1PAZA

Refinement of the structure of pseudoazurin from alcaligenes faecalis s-6 at 1.55 angstroms resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
120
structure length
120
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer(cuproprotein)
molecule keywords PSEUDOAZURIN PRECURSOR
publication title Refinement of the structure of pseudoazurin from Alcaligenes faecalis S-6 at 1.55 A resolution.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 32
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1988-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1pazA00
3SBPA 2HX8A 4BK5C 2YAFA 2ZOOA 3BQVA 3FU7B 1DYZA 2GSMB 3CZUB 4YSQA 1PCSA 3NJIA 1UATA 4YL4A 2HX9A 2GC4C 2OV0A 1FWXA 1PY0A 1A4CA 3WKPA 5TK2A 1ZDSA 4AZUA 3T71A 2OJ1A 3NSFA 3ZIYA 1OE1A 3C75A 5AZUA 4HHWA 1BEXA 2DV6A 5TK4A 1A8ZA 1JZJA 5ANHA 4NERA 4DP0X 1AZNA 1WA2X 3L45A 4YSOA 5I5IA 1CYXA 1RKRA 3KW7A 2GI0A 1OF0A 1N68A 3FPYA 2W88A 3EF4A 1MG3C 5I26A 2AZAA 2YAOA 5B7FA 4E9YA 2EIJB 2Q9OA 1TEFA 3WKQA 1SNRA 4A68A 3OD3A 4DPAX 2J56A 1CC3A 6PCYA 3NJHA 4K9JA 4JHVA 4DP6X 1V55B 3UAEA 3G5WA 1NWPA 1XB3A 3HB3B 4KO5A 3X1EA 1AR1B 1MZYA 1ET5A 1SJMA 1E65A 3AW5A 2PP7A 5I6PA 1E5YA 1GR7A 3FSWA 4KNTA 5B7EA 4UANA 2BW5A 3FYIB 1EHKB 4HCFA 1HFUA 2DWSA 3S3BB 2PCFA 2FT8A 2IWEA 1A4AA 1SDDA 1J9QA 1OV8A 4DP4X 1AS6A 3HEIB 2CJ3A 4GP5B 4TXVB 4HIPA 1V54B 3CVBA 1CURA 5B1AB 1ILUA 4UF7C 2GBAA 2QT6A 3CDZB 3QPKA 4NAJA 1WAEA 2XV0A 1PLCA 3PCYA 3NJMA 3ZDWA 1T5KA 2VM3A 1HAWA 2WO3B 1L9QA 1KDIA 1NZRA 3WG7B 1TEGA 2DYSB 2EIMB 2FQFA 2PPDA 2XLLA 2XV2A 3NSDA 2PPCA 3CVCA 3EH4B 2BZ7A 1NIBA 2BWIA 2XXGA 4N4YB 3TASA 2X87A 1J9RA 2BP8B 1PZBA 1A3ZA 3SBRA 4A67A 1AOZA 2BHFA 4YVNA 2ZWNA 2HZHA 2VW6A 1CYWA 3FU8A 3S3CB 2FNWA 1PNDA 2IWKA 3V9EA 1KBWA 5D4HA 1BXUA 1RCYA 2UXGA 1BQ5A 3CG8A 4RH4A 1TKWA 3ABKB 1SFHA 1SF3A 2MRYA 1AZCA 2P80D 4BWWA 1SFDA 1GY1A 1NINA 5AKRA 2E86A 2W8CA 3NJGA 1URIA 2BW4A 2VN3A 2XVBA 4KOCA 4M4RB 3V9CA 2CAKA 4HCIA 4M3HA 5I6OA 3QJUB 3UADA 2J55A 1L9PA 1EZLA 1PZAA 1GS6X 2I7SA 4GP4B 2AZUA 3NJLA 4AI7A 2FQGA 2YXVA 3D12B 2VSMB 3OMAB 1ZIAA 4N8UA 2PPEA 1M57B 2FQEA 1ILSA 4YVUA 1YLBB 1ASPA 3GYRA 2R7EA 1PLBA 2J5WA 2IDTA 2FJSA 4E9VA 1W6LA 2CALA 4BWTA 1A65A 2BWDA 3OQRA 3MBWB 3T6VA 3ZX1A 1IC0A 1ZDQA 2PP9A 3H4HA 5F7AA 2PLTA 3WI9A 3S3DB 1SF5A 1AG0A 1JZFA 1GS8A 2CCWA 4ZK8A 2YAEA 2XX1A 1KV7A 3X2QB 4E9SA 4PAZA 3FQYA 1R1CA 2XWZA 4KOBA 2XX0A 3AY2A 3EHBB 4G7RB 1IBZA 3UABA 5I6KA 2XXFA 4DP7X 3AZUA 2LLNA 1WA1X 1CUOA 2IDFA 2QDWA 2ZXWB 4KNSA 1AIZA 3NT0A 1JZEA 3GXUB 2B08A 3JTBA 3FPXA 5I28A 3SQRA 3QJQB 4AKPA 1SDDB 4HZ1A 4GXFA 5A7EA 4KO7A 3DKHA 1W8EA 2VM4A 3QJRB 4BDVA 1IKOP 3TBBA 2EILB 1A4BA 1ET7A 4A2HA 5I6MA 4MFHA 2XV3A 1DZ0A 4E9XA 3EH5B 7PCYA 3ASNB 4DP1X 1ASQA 2VSKB 1JZGA 4E9RA 1AZBA 4A2FA 2Q5BA 4GYBA 1JXFA 1X9RA 1MZZA 2QPDB 1BXAA 3PXLA 4JKNA 3ERXA 3NJKA 4BWUA 1E30A 4KNUA 1BYPA 1ETJA 1ASOA 3T6XA 4DPBX 2XYBA 5I6LA 3FQ1A 4P5RA 4HAKA 1F56A 3NP3A 1AZUA 5B3SB 1GW0A 1OE2A 1OE3A 1NPNA 3T6ZA 1TU2A 2CUAA 3IEAA 1JZHA 2A3TA 1MDAA 4YSDA 1RZPA 5I5JA 1QHQA 5LDUA 1J5CA 3JT2A 3N55A 2AANA 1L9OA 5B1JA 4HALA 3WIAA 7PAZA 2DWTA 4BXVA 4HCGA 2FQDA 1BXVA 4Q8BA 4FAAB 4A2GA 4G70B 3X1BA 5B7MA 4YSRA 2TSAA 2PCYA 1AZRA 2BP0A 2YQBA 1NIFA 4DP8X 3AG4B 4Q89A 4W9ZA 3S8GB 1J9TA 2IH8A 2NRDA 1E67A 2JFCA 1AS7A 1J5DA 1KBVA 3UGEA 1PMYA 1PLAA 1BYOA 3RYMA 5AFAA 1HAUA 2FT6A 2R7EB 3ABMB 1ZPUA 2HXAA 4G71B 4AX3A 4E9QA 3FU9A 4E9TA 3QQXA 5I5MA 1GSKA 3EH3B 1AG6A 2YAMA 3X1GA 3CVDA 1AACA 1KDJA 1QNIA 1ID2A 1L9TA 3TU6A 4YSUA 4F2FA 2GIMA 2WO2B 4CSPA 2YXWA 4W1TA 2HLEB 3AG2B 4YSTA 1NTDA 4EF3A 3NJNA 4KO6A 3NSYA 1B3IA 5B1BB 2QDVA 2H5UA 4AKOA 2J57A 1NIEA 1PZCA 1ADWA 1XB6A 1MG2C 1RZQA 3FSVA 1NICA 5PAZA 1OOWA 2UX7A 1SHXA 2PP8A 2IDUA 1NIAA 1ZV2A 2YAHA 3FQ2A 2XU9A 2XUWA 1XB8A 4A2EA 1NIDA 4G7SB 2FWLB 3PAUA 4QLWA 4BDVB 1OCZB 2OCCB 1ZIBA 2PPAA 3UACA 3IE9A 2IH9A 2I7OA 1E5ZA 1GY2A 3PLYA 4L0PB 1JXDA 3U25A 1OCCB 1WS8A 3BVDB 2FTAA 2HX7A 1JVLA 1JXGA 2ZONA 4FA7B 4X4KA 1JOIA 5E9NA 2PPFA 2JKWA 3SBQA 3FU7A 1NDTA 2N0MA 3QJSB 3ZBMA 3ASOB 3AG3B 3AG1B 4DP5X 1JVOA 2BZCA 2WSDA 2UXFA 3NJFA 1BQRA 1J9SA 1M9WA 1WA0X 4DP2X 4YSAA 1XMEB 2YAQA 2GHZA 4A66A 4E9WA 3UAAA 2I85A 2VW7A 3OM3B 1X9UA 2AVFA 3QJVB 4BXSV 1PAZA 4QKTA 3OMIB 3T6WA 3DTUB 1GS7A 2AFNA 2TSBA 1NPJA 1V10A 2CBPA 2EINB 5IY5B 3FT0A 2YARA 1IBYA 4DPCX 1L9RA 1KYAA 3DIVA 3PPSA 3ABLB 3FSZA 3TBCA 3WNJA 1JZIA 3IN2A 1PF3A 2X88A 2BP0B 4GP8B 4F7KA 1IUZA 2YAPA 5D4JA 3N2JA 2HRGA 2QPEB 1WS7A 2FT7A 2RACA 4P5SA 1SHWA 4GY4A 2DY2A 4CSZA 3S8FB 3H4FA 4PCYA 3IN0A 3T9WA 1AANA 3KW8A 1M56B 2IDSA 2VMJA 3FSAA 4UAHA 3H56A 2IAAC 4YSPA 2H47C 3TA4D 1W6WA 2BO0A 3X1NA 3MX0B 1OCOB 3NJJA 5EHFA 1PNCA 5B1JC 4ENZA 4WTQA 1NWOA 2HRHA 5F7BA 2B3IA 1QLEB 1AAJA 4A2DA 3NYKA 1GYCA 2IWFA 2VW4A 4DP9X 1VLXA 4WKXA 3WNIA 4YSCA 1KGYE 2P80A 2Y1AA 1BAWA 1OCRB 1N70A 5FC9A 3CDZA 5PCYA 1AQ8A 1BQKA 4G72B 3X1FA 2GC7C 2MTAA 1KCWA 3IBOA 5I6NA 2IDQA 3GDCA 4KO9A 5D4IA 1I53A 6PAZA 1FA4A 3NSCA 2DYRB 3PAZA 4AKQA 4NB7A 5B1KA 4YSEA 4YSSA 2UXVA 1L9SA 1JERA 1KCBA 2UX6A 3PAVA 3FYEB 4JHUA 1FFTB 4G7QB 1AS8A 2BP8A 4HHGA 1ET8A 3OMNB 3NP4A 2H3XC 8PAZA 4F2EA 2EIKB 2JXMA 2UXTA 9PCYA 3FS9A 2Y69B 3QJTB 3ABGA 2GB2A
chains in the Genus database with same CATH superfamily
5CFHA 2IF7A 4U7SA 2JF1A 5C0AA 3OKOA 1ZHBA 2N7BA 2R0LH 4F92B 4PI2A 4ZAKC 3C5ZC 4XB7A 5D7JB 2KDGA 1LM8V 2CLRB 3UTTB 1QBML 3VXRB 2CG9X 1WE5A 4O2EA 2J88L 3D4YA 5L4IA 2QQNH 3UTQA 4BM7A 1KLGB 5D72H 1P7HL 2Y6TE 5IOPA 3DDGA 5EIIG 2IQ9H 3VDBA 3D39D 3MNDA 4L9DA 1HINL 2WQXA 5K59F 1GPOH 3QE5A 4DP0X 2R1YA 3P9LB 3F2LA 2EDWA 1T66D 5DMGC 3U0WL 4UV7L 2GUYA 3LD8C 1KT2B 2L7JA 2BOBA 2Y1VA 3IE4A 2MCG1 3SCMB 4OD3L 4ADIA 2VN5A 3HR5B 1X5AA 4APXA 5IIEB 3PV7A 5BZDB 3U0TB 2LFGA 2NYZA 3HS0B 3LKRB 4LLDB 4NCC2 2EVFA 2AJSL 3AITA 1CK0H 1U8LB 4E9YA 2Q9OA 1FYTA 2YJLA 3RDTA 5I1GH 1EXUA 5AZ2H 2CCVA 3OAZH 4A68A 1PKQE 3L5HA 4R4FH 5FLVA 2A74C 2BS8A 2VDLH 1T7YA 2OMVA 1K8IB 3LXUX 4YGAB 3JTSA 4CC1A 2FIKA 1I8IB 1K4CA 2CJUL 1HH9B 2NY1D 4JY5H 4M8UA 1LK3H 5SX4I 3PUCA 2ADGB 3OTTA 4XH2B 4C83A 2PP7A 3E1F1 2UZPA 2B1HH 3ILEA 1QP1A 1JGVL 4XMUA 1IX2A 4K7FA 3V6OA 3WE6A 4JO2L 3P11H 1XGZA 4DFHA 1DBML 2LTQC 3B83A 3IDIB 4GAAA 4PRID 2X6MA 1RD6A 1AYOA 3HPJA 1TZIB 1NKRA 5KN5B 4GG6F 4CADA 4EZMA 1TXKA 3QIUA 1FZJA 1QLFA 1R19A 1OV8A 5IVXE 4DP4X 5F71A 2B77A 4LF3A 3VVWA 2LU3A 5HDOA 5HYSA 2OJEA 4GP5B 2NQ3A 4LEOB 1YJDC 3A24A 3CVBA 1J8SA 4APQB 2AEPH 4M6OH 1CLOH 3ALWA 2N3JA 5EOCL 2OW7A 5D2LE 1LE9B 2CK0H 4EVNB 4TULH 4G9FA 3TV3H 2GTQA 2ZD0A 2OQJB 4PR5A 2OMZA 5IVZB 1AXIB 1B4JH 5F3BA 5K5YA 4L1SA 5ICXA 3FAXA 2WCPA 1X5KA 1XGQA 2A6IA 4X6DF 2KPNA 4WI0B 1TIUA 2EIMB 3S88H 5HYQB 2NXYB 2XV2A 3SPHA 4GEJA 4F57L 2EEDA 1JGDB 4C59B 1IMHC 1EGJL 4YX2L 2ADYA 1HHIA 4NIYE 1ZLUH 2ESVA 4ZUUA 3AM8C 5FKAB 5FS5A 2UWEE 1UASA 3D39E 3VFTB 5AAMC 4HU8A 2HZHA 2L4OA 5HGGS 1RXLA 3VXPA 1PIFA 3D2TA 1KACB 5HHOD 3VTMA 3HN3A 5EDSA 3SY0B 3CG8A 1OTUC 1CICB 5E8DH 4ANUA 5I16B 3VRJA 2A0LD 3QRBA 4OIAA 4R4NC 1SF3A 3A6OA 3LTVA 3OHXB 4FXGB 4MA3B 5FK9B 4G2AA 1RU9L 1H5BB 1S7WB 3RJQB 5MENB 3CFUA 1XF4A 2M8XA 3ME0B 1D5RA 1MFVA 3QQDA 3B6SB 4PJ8C 2R4RH 5EU6B 2LAAA 1OTSD 4HCIA 4OCSL 2FVNA 1YN6A 3LHPL 4KMLB 4X80H 2DMCA 3T0BA 3NCXA 1O9ZA 4GKNA 4X0KA 1J12A 4P23A 4UQAA 2VLJD 3FU0A 1JD9A 4YK4B 1A6ZA 1WFJA 2EDBA 4GMSH 4GG6A 2WZPA 2AQTA 1M57B 1H3TA 3KCWA 3QUZD 5E5UB 4I9WD 3CXDH 2PMZA 5GGTA 4X4YA 2JJVA 1CDIA 3DARA 1H3XA 4UAOC 5KYNA 3M17B 4OLYL 3O6MH 1NC2D 3TTYA 3MJ9L 2JKIS 1SHSA 4J6IA 1WITA 1SF5A 4FFZL 2HFTA 4YFDB 1GS8A 1XEUA 1JJUA 2WGXA 3I9GL 3F8UB 3DETD 4WGVB 3KMDA 1BA9A 1ZPLA 4JHAL 1KB5L 3G6AB 4G7RB 2HJKB 4KKNA 4RMWA 1JN6B 4X6DA 1KIPA 1I1YB 2QADB 2W95A 3MMEB 1JCVA 1CUOA 3OAYK 4FHKA 3ZE0E 4ZNEE 4ZFFB 4XP4H 2J44A 4Y5VC 1R3IL 1DJXA 3EYSH 1IJNA 4FE9A 3OB0K 4HIXL 4ISVB 1XX9C 2D2OA 3QJQB 4W4OC 2OMNA 5BUAA 1QZNA 2JE8A 4G3YH 5KG9A 2BNQA 1EO8H 4DETA 4F7EA 5ABDE 2VL4A 3VH8B 2W0LA 4NQXA 1ZHNA 3HG2A 1BVKB 3KYNA 4RSVA 3CUPA 4L37B 2P45B 2MH4A 3QUHA 5CGYC 4YXHL 3U4EA 5EEVA 3R4DA 3I9PA 3KLDA 5FCUL 2XV3A 4J23A 5HHOE 4LHUG 1OQXA 2AQ3A 3FFDB 4NM8L 4GQQA 7PCYA 4N2MA 2Y7QB 4PGCA 4HSQA 2GUOB 2R1XB 1DDHB 3EFOB 3U6XA 3VXOA 1HINH 4M93C 2V8MA 5JQ6H 1A21A 4P04A 4PRHB 2HPTA 1OVZA 2XTJB 1NDMA 3BXNA 3K2KA 1QLEH 4K3EL 1F5WA 2BHYA 1JXFA 4P2QB 3U0WH 3FU6A 4P57A 5E2UH 1JUFB 3MRJA 3O0RL 2N7SA 1FAIL 4N87A 4QRTB 5GGTH 4ETQA 4PJEF 4BH8B 2P5PA 3PWPD 3N1QC 3ARGC 4P2RA 2NY0B 4L9LC 2VLJE 2NT1A 3L2NA 4LHJB 2VMEA 3A67H 1BQSA 3ARBA 4FD0A 1R3KB 4U6TA 1JZ2A 1JRHL 2VR9A 2JJWA 4MX7B 4I9WE 2CUAA 5A3ID 3BPOB 4GW1B 1BEYH 4YNYA 3NPSB 2A3TA 1MWAB 1KB9K 3TO2A 4AVKA 3GMNB 4JG1L 2CKNA 4KJQC 4A39A 4JUSA 2BXZA 4YDNA 1DBMH 1IM9A 4QOKA 4HCGA 4YBQC 4Z76B 1AJ7H 4XNZB 5I74C 3PL6B 4GFXA 3IDGB 1E9QB 3GXTA 4PGDB 2XKNB 1I31A 4TV3A 1DQTA 3BC9A 4WVRA 1WBYA 4WFED 3US0A 3TNNA 3LV3B 4JREC 1KYDA 4MJ4A 2NZ9D 3H2QA 2NRDA 1E67A 3MNZB 1PKOA 1HI6A 1JNJA 3M88A 4MQXC 1MFDL 3RYMA 4ZO9A 2EDDA 3QDGB 3T4AC 1T7VA 5EOCH 3DK0A 3FU9A 2GBVA 3GJFB 3BJ91 1ZTMA 5JXEA 4XNQA 1HL4A 1SEQL 1UOWA 3FUIA 3WFHB 3C6LB 3EO9H 3KPRD 4G83A 3RURA 1M3JA 2Z3FA 4FFZA 2AEQH 2YA0A 4KZDL 5C07D 4LMQI 1EMTH 4FJ6A 4YSTA 4EF3A 2WKOA 2HSIA 3FT9A 1T0OA 1KB5A 3DOHA 3H3PL 3F7VB 3TBYA 4NP4H 3UCRA 2UX7A 1UKQA 5F6IC 1LTXA 5E2VL 1KB3A 4BK5A 1TZ8A 3RWHB 4DERA 3FB7A 4U1HA 3S35L 4P9HH 3ZDZE 4BQ6A 1CFNA 5E6IA 2Z4TA 2XU9A 3E8VA 3A6BL 4JFHD 3FN3A 3OJDA 4JQIL 4Q2ZA 4NZTL 2JQZA 1LGVA 2UZIH 1XEDA 4WU5A 5B39A 1QD0A 2GTWA 2R1WB 3Q2WA 5GGRB 3IE9A 4UU9A 1AC0A 2OJZL 5HDBE 1R4XA 4U7MA 3MV7B 4LARH 4UM8A 1RU9H 3F3HA 2X1WL 3I6LD 4WWOA 5JHDE 4ZJ9A 3PWPE 1H9VA 4KHXL 1WS8A 3VWKD 5C0FB 4PJGB 3F84A 3UP6A 5BQ7A 3BGFC 3OG4B 4BH7A 5AVRB 3N43F 2HG5A 4D9RD 2BM3A 2VH5L 3KYKL 4OCSH 3LHPH 3HG1D 5FGCB 4CNIB 1NH6A 5J6HA 4NC0B 2DN7A 5IG7B 1PYWA 3V0DA 5JYMA 4LLQB 3ZDXE 1S9XB 4HIEB 5BV7C 4QT5A 4XCNB 3AQXA 1IC1A 4N86A 3ARFA 4BKTC 4MNGA 3N41F 1U0QA 2W94A 3N04A 1KIRB 3JT0A 3L3GB 1IC4L 1XGYL 4OF8A 3U46A 3VD9A 1SOKA 3SPVB 3ZT5A 5IQNA 1WZAA 4G8FB 4OJFH 4WFEE 4X8JA 1X9UA 2LT9A 3BYYA 2G4EA 1CL7L 3SEPA 3K5SA 3VMPA 2X4QA 3MJ7B 4FFZH 5KAQF 3N44B 2IJ0C 3CVIL 2WXIA 3I9GH 4PP2B 3F58L 2EINB 3ARVA 3BEWB 4RAHA 4JHAH 3HC4H 4AM0B 1NMAL 1KB5H 1NCWL 3IJHA 2WXGA 3GSNA 1RZKL 4S1DC 5FYLL 5CGMA 1R33A 3S97C 3WNJA 3PJSB 3KPRE 1T22B 4KQ3L 3IRPX 4KFMA 4WNQB 3EGXB 1P6WA 3E3QC 4FRWA 5FO9A 1R3IH 2I07B 4HG4K 1KG0B 5DQJA 1PF3A 4YDIH 5C07E 1WCBA 4S2SA 1FZMB 3IDJB 3Q1SL 4J3OF 3WNOA 3N2JA 1QFUL 3OC5A 2KDYA 5IJKA 5E5MB 2Y2TA 3RGHA 1PY4A 2XZCL 3TBTB 1W80A 3HFML 1IIIA 3QJHB 2KS0A 2VDKH 2IDSA 2IAAC 3QI9B 5AVSB 1XXDC 3HE7D 4X8CA 2E6JA 3TA4D 1QR1B 4FKKA 4NM8H 5LGYA 3B9EA 2IADB 4LSPL 2PYFA 2OP4H 4HD9A 3GJFK 3FQNA 4HWUA 1WQVT 1RK0B 3IJSA 4TVPH 2VZSA 1EV2E 5EC2A 3VH8G 2J6WA 2HTKD 4K3EH 3WJLC 3BPNB 4V1DD 5HVGB 5GZOC 3I6LE 2YD9A 5J3HC 4BFIB 4J3VA 5AAWA 3HLAA 2ZOUA 4NLAA 4O02L 4RZKA 5CN1A 1CIUA 1BQKA 3AGVA 2VL5A 4FJZA 2YSSB 3FJTA 3EBAA 4D9RE 5BRPA 2GTZB 4I48B 4PB9L 3HG1E 2FO1A 1CDGA 1XIWD 3L6FA 1NM4A 3DLQR 4FC3E 2AXFA 5DURB 1KBPA 5A16A 1UD6A 4JPIA 1JRHH 4FERA 5TTRA 3LZLA 2Y5EA 3MRMA 4RGMB 4WU7A 3K0YA 4MCNA 3GSNH 4JG1H 4EBQH 4XRCB 2VDNL 3QDJB 5JO5B 4K8RL 4AEHH 8PAZA 5E1GA 3QPQD 1GOFA 1MDTA 2CDEA 4KK8C 3V10A 1D5BB 3H54A 1A7QL 4I3RL 1PQZB 4PB0L 1OHZA 4JCWA 1BJ1J 2CRZA 3BX7C 3P40A 1UATA 2Y7SA 2J25A 3QXVA 4GIPD 1NBVL 1UD5A 3FOMB 3WKNA 1LYQA 1ZDSA 1YQ2A 4TUJA 2Z93A 3U9PH 4ZXBA 5FW8A 5AW0B 2NQDA 5HHME 4UOJA 3M86A 5HJBA 1X7TA 4HHWA 2EICA 4L4TB 1QLRB 4PJCA 3TWCH 1UUNA 1Q0XH 2KPWA 5I5IA 1D9KC 4KZDH 5F7MC 3IU4H 2W9LA 3MRLB 2X2YA 3UX9B 3NCEB 1IV8A 5CILH 2NR6C 3FPYA 1KTDA 2Q7AA 5IHZA 1BP3B 3HC0A 3K2IA 3H3PH 4E0RA 3OKLA 2AZAA 3GI8L 1D6EA 3O6LH 1IM3D 5E2VH 3BH4A 2JB6A 4M29A 3F12A 4XHQA 4JRFA 5ES4B 4FKHA 3A6BH 3SDAD 3NJHA 1HKFA 4ZOAA 5ISZD 1TZAA 4LRIC 4NZTH 3L2MA 4V1DE 1KBKA 4JVWA 4MAYD 4YBHA 2R15A 1WZ1H 5EUOE 3GSOB 4IKKA 3X1EA 1E27B 1SUJA 3H8NA 4UUJA 1YEEH 1YPZA 3DPBA 2W60A 2OM5A 4ZYKB 5KANI 5D1XB 2Q7NA 2BDNH 1R24B 4KNTA 3NCYS 4OV6F 5I75B 4DGVL 1EHKB 4ANWA 3U1PA 1MI5D 4PS3A 1S3KH 4NJAL 2WQSA 4HIIA 1BPVA 4RAVB 3GSWA 5ABZA 3KYKH 1A4AA 4NJ9L 2I26N 4BSJA 5EFIB 3DUUA 4KAQL 1DSYA 1CXKA 4XCCL 5CSZB 3FQXB 4O02A 1IC4H 3L16A 4J3OH 2WVVB 4YH6A 4Y2LA 1E28A 4Q97A 4HMDA 2R29L 5KYYA 1XGYH 1HQ4A 5D7LB 2DTMH 2X38A 4LLUA 2O5ZH 2Y6SD 3SDCC 4NRXB 3NA9L 3UPCA 1PCXA 2P24A 4DOHE 3NZ8B 1AR1D 3T2NL 3MROA 3I9AA 1OIOA 1YEGL 4XMWA 5CEXA 3RZCA 4QXUL 3CZJA 3L1GA 1WYJA 1EZUA 3CVIH 4ZMTA 3V0IA 4H8UA 2G3MA 3RUGB 3J27A 1NCWH 3JV5A 5D9SB 2BHFA 1RZKH 2BLFA 5DMKB 4HBCH 1U8QB 5CUSL 1DZBA 3FU8A 3BGAA 4KQ3H 2GI7A 1CI3M 3GWJA 5HI3D 5TQ2L 4M6NL 3NIDF 2BSSA 4HS3B 5IGXL 3TBSA 1HEZB 5J12C 2G5BB 4ABQA 5ICZA 3Q1SH 3EOTL 1BZ8A 1QFUH 1YY8A 5I1CH 2EUZA 5DK0A 4U6HB 2I69A 3CHRA 3PGCA 1WF5A 4ZMVA 2YRLA 3HFMH 4I18C 2VXQL 5GRUL 4M7LT 5EC1A 5AEAA 3EUUA 1AGFA 1VENA 2H2SC 4PY7B 2EDYA 4NKIH 2XJLA 1CGTA 3VGBA 1I8LA 5BQDA 5ISZE 2NY6D 2X1QA 2PO6D 1IAIM 4TPRL 2X2JA 2V7NB 2CHDA 4LSPH 5FWQA 5F9JB 4W9JC 1RFDL 3W82A 4PJIB 4E41D 2UY7B 4TNFA 1CLZH 4Z7OF 3ML8A 2V7HA 3RI5K 1JHTA 4LVNB 2O5YL 1QFHA 2K3HA 3TONA 1MI5E 1AO7E 1FNGA 3RNKA 3MVSA 3C6SA 3WEMA 4E9VA 2Y7LA 4P3DB 2R2HB 5TD4A 3EO0A 5BUPA 2QLVB 3P9WB 4PB9H 3C5JA 5C0AD 3CU1A 3H4HA 2JCCE 3S3DB 2CGYA 2VR6A 5F93C 1IBFA 4QRRE 4UCFA 4K07A 5F8RC 4P5TD 3WTYA 1T6BX 4U6XB 4X0NA 4MMYB 5I6KA 2XWCA 4NQDA 1NEPA 2C3WA 1F4HA 3T0EA 1F2XK 3LZPA 4GXVL 3TZVD 1U41A 3HNSL 5EO0A 4WHYG 2AJ3B 3P0VL 4JJ5B 4AKPA 4OZIE 3BAYA 1BZ9A 1A7QH 3N50A 3H9SB 5ICYB 1IKOP 5F89B 3QEGL 3UPRB 3ZTJH 4DH2A 1JMZA 1U3HD 1CDJA 4XX5A 3D51A 1JTOA 2GSIA 1I1FB 3MOAL 4D8PB 1FYTD 3RDTD 3THML 1ZA3A 3CVHL 4JFDB 2WYIA 2EKSA 1MFAH 2BSDA 3KPMA 3LPOA 3MBEC 3P02A 5JNYA 4OFKA 5B8CA 2OFQA 2FEEI 4NHCH 3VFUA 1YECL 4KI5E 4PREB 1FH5H 4X6CF 4C4UA 1KZYA 5AB9A 4Y1SA 3V55A 2X4SB 3RY6A 3T4YA 5K1NA 4IGBA 1P5VA 3DROB 5T5FL 3QK0A 4JKNA 3SKMB 4AQ8A 1D5ZA 4NWTL 2P5EA 5DYFA 4LZKA 5G4NA 1QACA 1UCTA 4JGUA 1ASOA 1FUNA 4H26A 3ZE1E 4P5RA 3VG9C 3FB5A 5E95B 4LLYB 4HAKA 3MUGA 5TDNA 2OYLA 5DJXA 5FFLA 4E41E 1LE5A 1D5XB 1XAKA 2ZP9A 3TJPA 1TNNA 2XQYA 3F62A 4BSWA 1S7SB 4P8QA 5BXFB 2JELL 2Z31B 4L3CB 2OCJA 3GHEL 4PV8B 1BFSA 1E2WA 5L2KA 4HCRL 3IB4A 2VXQA 1C5BH 1X9QA 1MVYA 5JOFA 5C0AE 1HDMA 3U2IA 4DGVH 4UTAL 2VQUA 2F58L 3QZPA 4NJAH 3LNEA 4EN3B 3GMPA 1HHJB 3ZMNA 4HUMB 3AG4B 1J9TA 1OAJA 1JPGB 2IH8A 3S36X 2ESVD 4KQ0A 4TNEA 4NQEB 4PUBL 4FQPA 1BVLB 4KAQH 4QY8B 3G6DL 4N9GB 3S34L 4LDCA 5E2WL 5JIQA 4XCCH 4U1MB 5ACLA 4JZJC 2WNGA 1FNEB 1ZEAL 3AADB 2N0KA 4NX0A 1ZLEA 4N0YL 2ZYSA 5CU5A 1KDJA 1FL6B 1BQLH 3A0OA 4M8QA 3NA9H 1Q9KA 1LEKA 3MRBB 5BPPA 4MS8D 2WXNA 4W1TA 2AC0A 3ZL1A 3T2NH 4XP6H 2F9BT 1AKJB 1SGKA 2A73A 1UXMA 3MNWA 1FYTE 2FECL 1RZQA 3IS1X 2XWTB 2C9XA 3IETA 3CXHJ 3O9WB 4DESA 4GQZA 1GZHC 3W56A 2BMKB 3S3SA 5IQ9A 1MFCL 3DOIA 3WNMA 5DD3L 4P23D 2P5WA 5E1QA 2YD3A 4KBPA 1TOXA 3E0GA 4M6NH 3V8OA 2WZPD 5IGXH 1VKXB 2FWLB 4I7ZC 3EOYG 4X8XA 5FB8A 5HHNB 3T8VA 5E6YA 3V6OE 3EOTH 4A2LA 3IM1A 5EEZA 2CGZA 1U8PB 3TEUA 2HCZX 1O75A 4J3SA 1E5AA 3U25A 4CMHB 4OFQA 3V4PB 5GRUH 2FTAA 1I9IH 3QAQA 4RNRB 1L7TL 2XC8A 3W0WB 4HD5A 5KSBF 1A6AB 1GYAA 3QDHA 5DEFB 5E1AA 1HWHB 2OPCA 3OX8B 2JKWA 4Y8AA 4MHHI 3EJZC 4MCZA 1E50A 2WNKA 5C0EA 2D7TL 1RFDH 4X4MA 4BJLA 2JCWA 4G9FE 1HT6A 2FWOB 3ES6A 5T5FA 5A6IA 3IGUA 3NJFA 1WA0X 3O4OC 2BVPA 2O5YH 4P46B 3W81A 2WLHA 3DBXA 1GL4B 3DJTA 2BOCB 4GUCA 2ICEB 1F45A 4KKQA 2PWHA 3FL7A 3I6SA 2ZWKA 2BNQD 2NXZD 4Z7UA 3TA3C 6FABH 5SWSA 1G4RA 1Y18B 4HH9B 2ESVE 3L5XH 2M26A 5DJ2B 1OK0A 1YMMB 3PIQB 3EOBA 5FHAH 2MMXA 1S5IL 3K4ZA 4DVRL 4ADJA 2OSLA 4HCRA 4K3GA 1CGWA 3DIVA 2HAZA 3DX8B 4OBSA 4ZI8A 4NOBA 3WUWB 3KYMB 2W07A 3O4LA 2MOVA 4UTAA 5DJCB 3I50H 2E7CA 4GXVH 4P2YA 1F0LA 3T0DA 3HBQA 2R0WL 3P0VH 4IOIB 4XNXL 5D4JA 3PHQB 2N59A 1RIUL 1P6FA 5H4YA 4FLHA 4M5ZL 1FF5A 3CWGA 2XVLA 1MFBL 4XWOD 3QEGH 2EDFA 5C8JB 3RGVB 1O6SB 1UT9A 4LCUA 4WFHD 1KEGL 2VDPL 3CFJA 2H1XA 3THMH 4P2RD 3I6GA 1M6OB 4XN4A 4Z77B 3WGUB 3II2A 4GG6E 2NY2B 3ARBD 2P3YA 4UQ2B 4G8GB 4NO0D 1C16A 3B4NA 1ETZA 3SDDC 4EI5A 1INEL 1NCGA 3OKDB 3EFFB 1R46A 5DWPA 4AYDC 1AD9A 2ADJB 5I1IH 1E2VA 5T5FH 4ZMZA 1A2YA 2AJXL 3K8LA 5CAYB 1OCRB 1M9SA 2ZSVB 2ZXEB 5D96C 5C0NC 2AK1L 5IMMA 1U58B 3WHXB 2ITDB 2P44B 3VE0B 1PZSA 3LSOB 2HKAA 4ELKB 3JWNH 1VGEL 1JI2A 1I53A 2ZUXA 4X6DE 4I2XB 2Z35B 4YPGA 2FUTA 5KBKA 3PAYA 5J06A 4NS0A 1GGBH 4YWGL 4X6FB 1JERA 1KCBA 3PAVA 4R4BB 2KYIA 4CUCA 5CM1A 1JHKL 3GHEH 4GW5B 4OZHB 3ULUF 4N3UA 2X6UA 1HJCA 1TQVA 2NUPA 3QWOB 2ZJSL 1IAII 3FH8A 4MJID 1SVCP 2BNQE 1UACL 4RISL 4TTDC 3HCVA 4UTAH 1NOFA 4L4JA 4DEUA 1FFRA 2I27N 1RY7B 2WMPB 1A1OA 4JCMA 4DVBB 3VX1A 3DRQB 3PHAA 2ZOLB 4TNVK 5BRZB 3PHSA 1E9OA 2B2XL 4WFFD 4Y5XA 4FN0A 3SB3A 4FQ1L 2A99A 4I3SL 2HVJA 4K2UH 3X13A 2ZXGA 4NUJB 5CEYB 3Q5YA 4UIKH 4D0DB 2XNAB 3G04B 3G6DH 2YN3A 5A6MA 4FEMA 2CRIA 3DBSA 3CPUA 4QRPA 5E6ID 4AJYV 2OMTA 1E40A 3QIWB 5BZWA 5SWQA 3RAJL 1H6UA 1ZEAH 5AZUA 4N0YH 3LZRA 4DO6A 3AWEA 3HS8A 2YSTA 1G7MB 4CMMA 4DKDC 3CFNA 4HIJB 4PP1D 2ERJB 1LO5B 2DMGA 1RKRA 5F3HB 5DO8A 4WFHE 1BF5A 4JY6B 1G6RL 4P2RE 5I18L 5DJDB 3BKJL 3VJ6A 3WDJA 4NQTA 2ATPB 3FAWA 4LSSL 5DD6B 4N22A 2FLBT 5G5DA 5KSAC 1U8KA 4JQVA 3UAJA 1H6FA 1G7IB 1MFCH 4R84A 5EU4A 1EVTC 1HESA 1JV2A 3ARWA 3FTSA 4H2CA 4J3XA 4QTIL 3LNDA 2IANB 1IT9L 1EXGA 3JQOB 4JFXA 3BDBA 2EO7A 2NDFA 2Q2EB 4R5VA 5A43C 4ZW3A 2WZAA 4MB3A 2OZNA 4QOKE 3H1ZA 4X4ZA 4XO8A 4OGQC 4KMQA 5D71L 3AU1B 1UWYA 3BMVA 2BW5A 4BQBA 4TLSA 2B16A 3L54A 4ABWA 2QZ5A 2VR7A 3QJFB 4BCXA 1L7TH 5C0CA 1E3ZA 4Y9CA 3BZFA 3AMKA 4LPXA 3ZKXB 3U7AA 4NUGH 1OF2B 5IB5B 4OFPA 3QIBA 1WT5C 4TNWF 2CM5A 1QWHA 1TQCB 1AIFB 4FL4B 4YC2C 1HCFX 2XZQL 1KYFA 3EYUL 1XT5A 2ZTBA 3HI5H 4KDTA 3N9GH 3QAZC 2WXKA 2XV0A 1W72L 3TO4A 2WWMD 1AFVL 3NRQA 5BVPL 2Z92B 5HPMB 1NGYB 1B4LA 1KXVC 2F19L 2XG4B 5E08L 4WFFE 2KC0A 2H3NB 1NGXB 1BV8A 5F9OH 5FA3A 2ZUQB 1XBDA 1DVQA 4ICXA 3TVMD 3BAEL 3K5RA 3KPQB 2AI0H 4Y89A 2X53A 1YN7B 4A67A 4FQXD 3WDHA 4DVRH 5D1QC 3JV0A 2NY3D 1O5PA 5AW7B 3ZYZA 1CYWA 4ZAKB 3C5ZB 2FNWA 1PNDA 1O9VA 3ARYA 4A7VA 4Y5YC 5D7KD 3H3KA 2DWYA 3ZSSA 4NQCD 4GG8B 1H19A 3D34A 4D0CA 3DGGB 4XNXH 1KF9B 3GB7B 1RIUH 4BUHA 4D8OA 4M5ZH 2JVUA 4ZQTA 1E0OB 2Q6WB 1N2RA 1TR7A 2Z8WC 2FIRT 1MXGA 1EX0A 1BXXA 1IKNC 1YUHA 3FN9A 2ISDA 3ZKMD 4XBPA 3NMEA 1WC7B 1HYRC 5EIIA 4KK6C 1KEGH 4CGUB 1FQ9C 2VDPH 1F00I 3TIEB 5ILTL 3J2PA 3LD8B 1L9PA 4MNGE 4FOMA 1H3WM 5D55A 1L3WA 1USQA 2ZAGA 4AV0A 4JHWL 3UEQA 1INEH 4MD5A 4ZS7L 5GGSA 1T5WB 2DL9A 3OKYA 5DK2B 5DUPL 3BEVB 4B7IA 3C6EA 2VLKB 1NMCC 2CU9A 1G6RA 1MJ8L 2A74B 1MCKA 2AJXH 4H40A 1TJGL 3RWGA 1JNHA 2CLZB 1N5YH 1FL3B 4XN5A 5A2LH 5IB4B 5TPWL 2A4CA 3OKEA 1MHHA 4U6YA 2AAAA 1IC0A 1GHFH 1ZDQA 3KVQA 1WH0A 4K94C 5JDSB 4ELMB 1N59A 3UYPB 4NC1C 1VGEH 4WO4B 5DSCA 5LN4A 3IFLL 4HF5L 4Y0GA 5JORB 2LTQB 2RHEA 1R1CA 5DHXB 4ZFOB 1INQB 1UQSA 3AT8A 4HWNA 1ZANL 5BVJA 4HWEL 3T2LA 2XTLA 2DIEA 1XD0A 2IGFL 2ZUWA 4CVXB 1M2VA 2ZJSH 2IWGA 5CCJA 2F2HA 4KV5F 2P8MB 3MJWA 2OL3L 3RE0A 1P4BH 1JPFA 3QZBA 1S7XA 5GZNC 4LQFH 4Q7DA 4NN7C 3AQZA 4UINH 1N4XL 5KSUB 1M6UA 5IROC 2BCKB 2F15A 4I3SH 4UB0L 5DO2C 1B2YA 5HGHA 5FYLD 4QWWD 1IBHA 4ZFGL 1EPFA 4XVSL 5ALCH 1K85A 2VJXA 3GIZL 1W72A 4DNLA 2FX9H 3ASNB 2Y07L 5D7KE 5ANMA 3RAJH 4Y1AA 2HH0L 4L0YA 2BX5A 4E9RA 4U1JB 1Z9SB 1HZHL 4WW2C 1ZXQA 1FV1A 1BIIA 3TBWA 3KL5A 3VMOA 4QXGH 1LO2H 3H9ZA 5K69A 3L3OA 2WPGA 2VAJA 4N2GA 3GGWB 2X4UA 1N5AA 2OXHA 1EZVX 5F7EL 3VXUB 4H8WL 4CN1A 2EYRA 3BWUC 3I2CL 3KPOA 3O81A 5I18H 2ICWA 1ZXKA 4JDEB 1K3IA 2ZT9C 4Q9RL 3D6GA 4AT6B 3WAJA 4P5KB 1XVSA 3WJMA 1M53A 2P47B 4M7ZC 1QA9A 1OE2A 1TKWB 4NO3B 4EDXB 1R3HB 1WFMA 3KBFA 4HS8H 4NZ8A 1IT9H 2R23A 1IAOB 1TMCB 4PJ8B 3DX9B 5AENA 2K0RA 2XIDA 1KTKE 3LNGA 2O6CA 5D71H 5E4OA 2WP3O 1E8XA 4PIBA 4O9HH 3DMMC 4Q8BA 1T5XA 4G70B 4BZ1L 3RQ3A 3SKOB 3EJUA 2NOYA 3LXAA 1TCRB 3IMRA 5DZAA 4HS6A 1K8DB 2GPZA 3VSTA 3RGBA 1XF5B 4KKPA 5E8EA 4JFQB 3UZVA 4UAOB 3P3RA 4BSVA 1HYSD 2XZQH 4PQXA 1JG9A 2EABA 3LN4B 4W9GC 3EYUH 3G6JA 3O11B 1DDTA 3EDJA 4K8RD 4PJCE 2YPLA 4G71B 3K6SB 3FHQA 3CN4A 4E9TA 1R3JB 2C8NA 3T65B 4H13C 2AERT 2ALWA 3DSNA 3RDJA 1AFVH 4OUOA 1VERA 4MDJB 2YD0A 5BVPH 5KZCD 3VB9A 4GBXA 2WXRA 4ZO8A 5F7WC 5E08H 3GDBA 4AIZA 3QQ4A 3O3UN 2KERA 1N67A 3K6DA 3BAEH 4YDZA 3DGCR 5IK3B 3BVNA 3BSGA 4GRMB 2Q8AL 2DM2A 5EIVA 1HCZA 1JZ7A 3CZEA 1I4FB 4MNHB 4ONOA 2QELA 2IDUA 4NUPA 3WXWH 1ZVSA 1J1OH 2YAHA 1RUAH 5T5NF 3WN5A 1UZ8B 4RA3A 1NIDA 1GMEA 2X70B 3CFEB 3QULA 1YPZE 5BJTA 2ZYHA 4L8BB 3EJPA 1QSVA 1MLBB 3ARRA 4PY8I 3HG4A 3EJCA 4FNPA 4GKZA 3V9FA 4OD1L 3V6ZB 3C5SA 3M6DA 4PG2C 4LB8A 1NCDH 1H0DB 2FK9A 2FEJA 4N25A 4M93B 4M3JA 4LKXB 4LHUA 5E4EC 1P69B 3ZUCA 2P46B 3F6JA 5TGBB 3WAKA 5ILTH 1TZGL 1W0VA 1FVEB 5GS0H 4PRIB 5JW3H 3SBQA 4KK9D 4N2LA 2WANA 4I0PC 5D7JA 4IU3B 2CLRA 1Z0MA 3UTTA 3VXRA 4NQDD 4ZS7H 5CKGA 1P7BA 2FHFA 3AG1B 4Y2NA 1I8AA 4DZ8B 1JHLH 1KLGA 1EXHA 3ARGB 4TKWA 1M9WA 4L9LB 4EDWL 5L6YL 1UJTA 1MJ8H 4RMTA 7FABH 1CBJA 1TJGH 2J4WL 2VXUL 4M7LH 4NN5C 2CR6A 1MCJA 2OSYA 2MQ0A 1F4YL 1A66A 2AVFA 1RULL 4N24A 5DVNA 3P9LA 4PJFF 4U7KA 2E7LC 5D7SL 1GAFL 3OMIB 3IFLH 4HKBB 1GS7A 1KT2A 2FGWH 4G6MH 5K39B 5F7DB 1V10A 4PU2A 3SCMA 5IIEA 3HR5A 5BZDA 2VUYA 2KT6A 5I74B 3U0TA 3HS0A 3LKRA 1ZANH 3B37A 4LLDA 4X6EB 4XTRC 5F8QC 3AT0A 1JZIA 1U8LA 3CIQA 5JZ7C 2BVQA 2IGFH 1C1EL 4NRYB 4JM2F 4FTVD 1LEIB 4PI0A 4JREB 5CHNB 5LB1A 1YEJH 3OMZA 4HT1H 2DJ4A 1K8IA 2A9AA 4GP8B 1I8IA 2MOGA 4F7KA 3VACA 1HH9A 4Z8FL 4P5SA 2HMIC 2ADGA 1JDCA 2DL2A 2Q76B 4XH2A 2OZ4L 5DHYB 4CSZA 2P5ED 3OXSB 1NJ9B 3MI6A 5BOPA 1RZIA 4I0KA 4PCYA 2C1PB 3IN0A 3T9WA 4BFRA 4DJMA 3PWVB 4XMZA 3FSAA 4N8PA 3IDIA 3LZQA 1TTBA 5KN5A 5EHFA 1CT8B 4PRBB 2Y07H 3VFRB 2NY4C 3WNPA 2HH0H 1PZ2A 2ZG2A 3EYOB 4V33A 3VFOB 1HZHH 4HJ0D 2YGPA 2AXGB 5F9DC 5F6IB 4LEOA 5L2KD 3K80A 3WNIA 4APQA 3B8SA 2P80A 3X3FH 1LE9A 1N70A 3AREC 5PCYA 2MFNA 3QUZB 4EVNA 4LBAA 3I2CH 2OQJA 3B7SA 5IVZA 3EF7A 2D03L 1JP5A 3AB0C 35C8H 4KO9A 2XN9D 3HBZA 5C9KA 2ETWA 1NUFA 1NC2B 4WI0A 4FFTA 5HYQA 4WJKB 4FXTA 4F3FB 4NQDE 1ML0A 4C55A 1F4WH 1JGDA 2XA8L 3T0EE 3ESVF 3T5WA 2WLJA 3MUUA 2V2XB 5FKAA 1TJMA 3NP4A 4J1UA 3LZOA 3VFTA 3DIFB 3HZMB 5KS9B 2HKFL 5BV7B 5CJXA 3STBA 3K7UA 4OFDA 3ABGA 1KFAH 3NIDE 3SY0A 1CICA 5I16A 4LAJH 2YAFA 4XZUB 4QIRA 2KUTA 4XGZB 3CH1B 2B8OT 4GFTB 3IGLA 1L3NA 4FXGA 2BHUA 3OHXA 4MA3A 5FK9A 1MF2H 1MWAL 1S7WA 1H5BA 5MENA 1FWXA 3GBDA 3HR6A 1ZVHA 3ME0A 3ZKND 2FBOJ 3T71A 3B6SA 1NSNL 3ZO9A 2P5WD 5EU6A 1OL0A 4UILH 3QUXC 4LBEB 1SM3H 4JFWA 1AZNA 4Z3GA 4Y9EA 4K5NA 5EZJB 3L9EA 2P5EE 3KPSD 3CFDB 2MCAA 1IGYB 3ULVL 5AW1B 1BJ1H 1N68A 4KTEL 5FYJL 4Z7OE 2Q8AH 2FD6H 4OCMC 3DHMA 4DUWA 3CX5K 3M17A 1WWCA 5B7FA 2MEJB 1J9CT 1D2PA 2EDJA 3FK3A 3D85B 1BD2B 5T3ZL 3BKCH 1HOCB 4CSTA 1B2WL 1FN4B 3BLPX 3BE1L 5L2KE 2WBKA 4ZNCD 4F33B 4C57C 5L0QC 1KJ2B 2ZCLL 3G6AA 2HJKA 4LCWB 2OZ4A 1JN6A 4OD1H 2NNCA 3DA0A 1I1YA 1QMUA 4KTDL 1DVSA 2YD4A 4ZODA 3MMEA 5I6XB 3VD7A 1MCHA 2X3AA 2YC1B 3C12A 3IFNL 4NPKA 3FYIB 4PV9B 4ZFFA 2DMBA 3LPFA 4X5PA 1F41A 4HUWB 5C6TH 3NSXA 4AQ1B 4ISVA 3MQIA 3IMWA 1TZGH 1M4KA 2X0WA 2QEJA 3QG6B 2H6UA 3VH8A 3DX7B 3VCLB 4AVJA 1II4E 1O6TA 3T3MF 1BVKA 5T8IA 1DTUA 3VD2A 3QR2A 2NNAB 1BVNP 3X12B 3MLWH 4L37A 4LESA 1OARH 3SOTA 2ED7A 3O4LD 5IUSA 3CDZB 2Z9TA 5D6DA 1ROCA 5L6YH 2EO9A 3PABB 2Z8RA 3FFDA 3PCYA 3WTVA 2J4WH 2Y7QA 1OAYH 3P3YA 3BP5B 2R1XA 2GUOA 1DDHA 2BCMA 2ORBL 3EFOA 3JVGC 4NZJA 1KGJA 1CJYA 3TEZA 3WY3A 4Q4EA 4P4RB 4PRHA 1XF2B 3HB3D 1E7VA 4N5EC 1RULH 3RWDB 3U1QA 2Y2YA 4F8TA 3WOVA 1M7IB 3LZNA 4P2QA 3IXAB 1GAFH 4K71C 4PHXA 1JUFA 3POHA 3TFKC 1G9NH 4QRTA 2P5WE 2EXYD 5D7HA 3O45B 4BH8A 4A38A 1KBGH 5CZXD 5AVTB 1C1EH 2DQJL 3CXFA 2PN5A 3ISYA 3KJ6H 5L88L 4FXKC 4QF1B 3V0VB 1R3KA 1NUNB 4MX7A 2X10A 1MREL 4BWWA 2VXVL 3CZNA 3GTTA 1JGEB 4XP1L 1F18A 1MWAA 1UH2A 2OZ4H 2W8CA 4UQBA 5J13C 2IPKB 4TQHA 1OT4A 3ZTNL 1D9KB 3TF4A 4Z76A 2GEEA 3PL6A 3IDGA 1E9QA 3MLRH 4PGDA 9CGTA 4X4ME 5GIRB 4TSAL 4BKSC 2XKNA 4F9PA 2F8IA 3RP1A 2GCYB 3LV3A 3MNZA 2EE0A 1ZIAA 3MFGB 4BZ2L 2DEXX 3NG5A 3P9MB 4Z7WF 5BRQA 2C4XA 2JKNA 3QDGA 5CLTA 2A9ML 3JWNE 4TUKL 3APMA 4Z7UE 2RTTA 4YZWA 1AGCB 3GJFA 5SWSE 5AOIA 1MJJB 3FO1B 3LEXB 3U7YL 1I82A 3QG7H 1OOAA 1OPGL 4PWEA 1Q1JL 3WFHA 3C6LA 3KXFD 4AUUA 1SBBA 1CVSC 3WFCL 4DW2L 5FO8B 5JYLA 5AB2A 1T2JA 2D8KA 1VFMA 2OR8A 3DTXB 4GRWF 5CXPA 2AJVL 2XA8H 2Q3XA 3BLBA 3O4LE 4Q4IA 3F7VA 2CUIA 1QSEB 1S7VB 4OF3A 1RH8A 3RY5A 1Z3GL 2R2BB 3RWHA 3D0VB 1WAAA 2ITCB 2HKFH 2YD8A 1S6NA 1JZEA 2VZ1A 2JNZA 3BVVA 3N1MC 1DBBL 2BRQA 4XI5D 2X41A 5BW7C 5J9PB 3LHAA 4NQVB 2R1WA 2EILB 1IQDB 5AAPA 3MV7A 1MWAH 2AJZB 4YEEA 2FBJL 3BKYL 3SDCB 3RX5A 4DGUA 5C0FA 4K3DH 2H1LM 4PJGA 3UAJD 1FFPB 3RB5A 1FNLA 5JW4Q 3AABA 1OAKL 5FYKL 4CNIA 5JHAA 3U6RB 4K3JL 4H25B 4RESB 2EXWD 3VWJC 5IG7A 4K7PX 2WLKA 1NEUA 3H7BB 4KQ4L 1S9XA 4LLQA 4HIEA 4FLRA 3EJYC 4XCNA 5I8EB 1E90A 5GGSY 1KIRA 4XO3A 2GY5A 5FYJH 3NJKA 1V8HA 2JI2A 3O2VL 4TL4A 4UQIM 3UMTA 1NGZB 3QCVL 3SPVA 4XVJL 3FQ1A 3HJ0A 2D0GA 3CMGA 4G8FA 3QIBD 5F1NB 3CHQA 1C5DB 1YY9C 3GD1C 1PD0A 4PBWD 1B2WH 5DJYB 3MJ7A 1IB5A 1MWOA 4I18B 2G5UA 3NAAH 4OFYD 2ARJB 4PP2A 2Y7MA 3BEWA 4P5MB 4AM0A 3DOSB 4JR9L 1AZVA 1IILE 3O6FC 2XZAL 2AANA 4KTDH 5B1JA 3MZTA 4C4KO 1TDQA 3IFNH 4W81A 4DEPC 3PJSA 3NABH 1T22A 3QWRA 1VCAA 2NYYC 4WNQA 2FQDA 3EGXA 1ZWIB 2KLTA 3BZDA 2I07A 3DI3B 1KG0A 2WSKA 5B7MA 5JPMB 3C2AL 4N2FA 4YSRA 3W37A 4HC1L 5CCHE 1FZMA 2MQ3A 3BW9B 3IDJA 1I1RA 2PTTB 4PVMA 3R0MA 4G8IB 5E5MA 1A7RH 3BPLC 4QRPE 4BZ2A 3TBTA 4AMXA 1SJVA 4JO4L 3FOLB 3SBWA 1JCKA 3QJHA 1XWVA 4GO9A 4KKBC 3WL9B 3O3DB 1EAPB 1BZOA 2WQUA 3QI9A 5IHLB 3MPCA 1QR1A 1MY5A 2IADA 2ORBH 3SGEH 2R4SL 3LRMA 1IBBA 1RK0A 4M48H 4NYLB 2NSXA 1JZ4A 3AG2B 3ARUA 3G9AB 4JO8A 4QI3A 4BFIA 3ARDD 2FLRT 1JRHI 1KLFB 1JFQL 1DUYA 2BVYA 4PV1C 4IMKA 1JF5A 4LNVA 2MOQA 1X5HA 5LCVL 2HJLB 2YSSA 1G1OA 2GTZA 4I48A 3INUL 1MHEB 3LS4H 4M7KL 1ZV2A 2VISB 3HNTL 2DQJH 4ODUB 1KGWA 3ROLB 2WP3T 4MXVF 1XZ0B 4AJWA 4M62L 5L88H 5LVEA 4J6RL 2K1MA 4ES8A 4NM4L 3TEYA 4KXAA 2XACC 1MCIA 1FLRH 1IGFH 2IFGA 1MREH 1BBJB 2VXVH 4XP1H 4XPBL 3D48R 4OTXL 4WEEA 5C0CE 3MBEB 1H8NA 4B9IA 2E7MA 4POZD 3Q6GH 4X6BB 5SWZB 3ATDA 4AGOA 4XRCA 3QDJA 5JO5A 2WTRB 1PG7X 3QUYD 2BH0A 4AUJA 5LN8A 1D5BA 3VFSB 2J1ZA 4LCYB 1NMBL 5KBPA 4NZRL 4TSAH 4UOW1 5DA4A 5F72S 4B9YA 4J7RA 3ZL4L 4Y16C 1F1DA 5EOTB 4KKAC 4BZ2H 4F91B 4C56D 2EZ0D 3FOMA 1DN0B 3UTPD 4N0CD 2A9MH 4XXCC 4JG9A 4NZFA 3MCG1 1IFGA 1U8MB 3LMJL 5DUMH 3FRUB 5F2FA 4L4TA 3TN0C 1E4XL 1QLRA 2AW2A 1IGTB 1AKPA 3WFBL 3WFCH 5EZIL 4DW2H 2SEBB 3MRLA 4Z7VB 1OXYA 4TOYL 5IY5B 2DEWX 1H6TA 5EBWB 2AJVH 2JTYA 3JYBA 2YQGA 5EOQL 1NBQA 3N5AA 5IBTH 5ITBH 4FG2A 4Z3TA 4OLEA 4AV4A 1FLTX 1Z3GH 1NLBL 1PPIA 1JL8A 4AG4L 4H88L 4FZEL 1RHFA 2K6WA 2MKWA 3FCBA 1HSBB 1D7CA 3BO8B 4HC1A 1RURH 4DKFL 1DBBH 2CKBB 4FF9A 3LQAC 4JZJB 5BMFL 5AOKA 3GSOA 3PWNB 1E27A 4RETB 5MHSD 4ZUVB 3AWFA 3V4VH 3H4FA 4ZYKA 1R0AH 1PSKL 2DKUA 5D1XA 1R24A 4MVBD 5I24A 4HJGB 2EDHA 3CZSA 3FRPB 2MIZA 3TL5A 5DRZB 4BQCA 4AV5A 4EIUA 2H47C 3WFDL 3MX0B 1BJ8A 4L3AA 1NGQL 4DO4A 4RAVA 4OLXL 3RKDC 4ENZA 2KH2B 5FM5O 2YXMA 2VJ0A 3L4TA 3PFUA 1IEAB 4PBDA 4U4IA 4O58H 5EFIA 3BRFA 4V11A 3H85A 4DP9X 2WCGA 4HKXB 4U1NB 1KTJA 5CSZA 3FQXA 4RWHA 1ITCA 3BT0A 2WVVA 1QHOA 4GNKB 3SE3C 5D7LA 4WV1C 1EERB 3IBOA 1XR8B 2B4CC 4XVJH 2IDQA 4NRXA 3QHZL 4ACTA 1TTAA 4PJ5D 3P30L 3AROA 3GKZA 1CVRA 1OALA 1GRWA 3M8OH 1VDGA 4DT2A 4XNYL 5FA4B 4G5AA 3S5ZA 2P8PB 3FUHA 3UTPE 1ZS8B 4P5TB 3RUGA 1FFTB 4G7QB 2G0LA 3RVTC 2N7AA 1EQWA 4JR9H 2CJSA 5D9SA 3NIFB 3I85A 5DMJB 3JVFC 5DMKA 1U8QA 3LNIA 5JQIB 1HCYA 2F5AH 2IFFL 1GGYA 4GBXD 3ZHKA 2A4ZA 3FQUB 2I24N 4XXWC 5EO9B 4LEEA 3TZVB 3GTVA 1M7UA 3C2AH 4HS3A 1HEZA 2G5BA 3FU7B 2XN0A 2WBJD 3O4OB 2GJJA 2WZ0A 4TQPA 2VLMD 1P2CB 4U6HA 2DF3A 5ANME 4FNRA 3BRGC 3L81A 5GRVL 1PU0A 1R6VA 4Y1AE 1U3HB 1WBXB 5IQOA 1FO0B 4WEBL 2HFFB 4PY7A 3UYRL 4BA8A 2ZXBA 1FPTL 1LDPL 4GKLA 1CTOA 4MMZC 3H9HB 2OMBA 3NEOA 3BUPA 2V7NA 4NERA 5F9JA 3G9VA 4NHUB 3MLUL 2Y25A 4P9MH 2WVTA 3H55A 2EDKA 3U79A 2R4SH 3ECWA 5IQLA 5MHSE 2UY7A 4RGOL 4P4KC 1KPVB 4GI8A 4WHCA 4Y4HD 4LHUD 2LU7A 1JFQH 2DOCA 3SDAC 2VYRE 4P3DA 2R2HA 4Z18A 3BH9B 4HFUL 3INUH 3VGEA 4M7KH 3OD3A 1U2CA 3HNTH 3N42B 5D7JD 1ZE3C 1NCBL 6PCYA 4M5TA 3UTTD 3VXRD 1V55B 4JW3A 1M42A 3UAEA 4M62H 3ZY7A 5FV2A 1EDHA 1AQMA 4NM4H 4IM8A 2GY7B 3I3EA 4U6XA 3GMLB 3PWUB 4U2ZA 1MZYA 3BIKB 3BQUC 4MMYA 2JJUA 1QTYT 2ODIA 2XSKA 1FGNL 2N1TE 4XPBH 1HJBC 4J5VA 4GPVA 5T33H 3LB6C 3A23A 2F53B 2XRAH 1LK2B 3VSUA 1G9HA 2HWZL 1QHPA 3PXHA 4TUOB 2BVEA 3SDDB 2ZXCA 1TPXC 1BLIA 4KV5E 3OLDA 2AJ3A 4JJ5A 3ZGHA 1ZJBA 3G6JE 3SCMD 4JZNB 2YPLE 3H9SA 5D96B 5ICYA 5F89A 4TXVB 3UPRA 2NUTB 3C60C 1MLCB 5KW9L 1L6XA 5JPNC 4W9DC 4KJYB 4JGMA 1I1FA 3AQYA 4D8PA 2XWJB 1A6UH 4JRXB 4M7JL 3UMNA 2DPKA 4JFDA 2D7QA 1B3JA 2ALAA 1E4XH 3DV6B 4PREA 1GKEA 1S7TB 3MN8A 4Q56A 2LE9A 3B2XA 5E6UB 3WFBH 2X4SA 2UVEA 4MZ2A 1DVFC 1HS6A 1NIBA 3DROA 3STLB 3SKMA 1FGVH 3EZ8A 3WS6C 2J8UF 3RFRA 3W9EB 3QXAB 5D70H 4WAFA 4YVNA 4JPKL 3QEQB 3WEBA 5INDB 4KI5C 1UXWB 4H7VA 3S36L 3F65A 2A6JB 4AG4H 2G2PA 2OK0L 4H88H 3ZLQC 4LLYA 1IKFH 1DE4B 1W0YT 5C86A 5TH2B 4TTGA 1PS3A 2HLAB 8FABB 2HT4C 1D5XA 5L7XH 4DKFH 3T8MA 1Y1DA 2XWXA 4APQD 2Y1ZA 1J0IA 2P80D 4FFVC 5BXFA 2XY1A 4L8SB 1BYNA 5AKRA 1IZJA 4PV8A 1URIA 2AQ2A 1XCTB 4RFNC 4KOCA 2Q1EA 4TN9A 3GIVB 1C9SA 4HJJL 1GW6A 2B1AH 3CSPA 5I6OA 3UADA 1QX1A 3UTTE 3VXRE 2NXYD 2WXQA 4EN3A 5ID0B 4HOWA 4O2FB 4XMXA 2D7NA 1GS6X 4OLXH 1ZA6B 3OF6D 4FI6A 4OCXL 5FAAA 5D1ZC 1YEIL 2YXVA 1NUDA 1WZLA 4D0BB 1JPGA 3MRRB 3CFTA 4YLCA 5E56A 4NQEA 3SO5A 4XWGH 3CLEL 1ILSA 3DYMA 4RMSA 1BVLA 2MHAB 4QY8A 1MW3A 2CPUA 4N9GA 5KSAB 3N91A 3GYRA 1SDAB 4U1MA 1NKOA 3V0EA 4B5EA 3ZE2F 2EH7L 1MAML 1FNEA 4QD2E 3FRPG 4JRWA 4OLZH 4BWTA 4JNXA 4KZEL 3EGDB 2BY0A 1CICD 1FL6A 4ZQKB 4K23L 5F7AA 3D3VB 1UM5L 4TM9A 3MRBA 4ZK8A 1AC6A 2AQPA 4U1KB 5FGBA 3P30H 4NQUA 4ALAL 4E9SA 5MEND 4LNRB 5CSGA 3LXBA 1AKJA 4RQQB 2R27A 5IB1B 4YHZL 1Q38A 3NEEA 2XWTA 5EU6D 5KJ7E 3O9WA 4M5SA 5IOKA 2XKUA 2X6BA 4V2CB 4FQJH 4WJG3 5HP5A 2BMKA 2VC2B 3ZW3A 3KWWB 4WENB 3KPPB 3BWSA 2IFFH 1BVOA 4YC2B 1RK7A 2B08A 3L4CA 4YIQB 3FPXA 4CGTA 3QORC 1VKXA 4DGYL 1GGCL 5HHNA 3WJJA 1VZHA 1RAMA 1G9MH 1SMDA 1U8PA 1Q8MA 3I74A 4FG6D 5JHBA 4NBYB 3V4PA 5JMOC 1DFXA 1DVXA 4PLOB 4RNRA 3W0WA 4L18A 4WEBH 1A6AA 3UYRH 3IWVA 3CNKA 2Q20A 1VA9A 3AAZB 5DEFA 1LDPH 5C2BL 2WC7A 1EUTA 1S2EA 3OX8A 1NCUA 4OIIL 4A2FA 1HK6A 2NY5C 5D1QB 4NO0B 4BUGA 2QADD 2W9DL 4RGOH 2X9YA 4IBVA 2FWOA 2YPKB 1YUKB 5ECJE 3PXLA 3QIUC 3EBHA 4MDRA 1Z2KA 4P46A 1FHGA 4MAUL 3IDXL 4Y5YB 4YPJA 2BOCA 2ICEA 4K9EH 4FFYL 4BQ9A 4QCIB 4HFUH 1ONQB 4XO9A 3NP3A 3CSYB 1Y18A 3HRZC 3P0GB 4HH9A 8CGTA 4QYOB 4KH9A 4N0UB 5DJ2A 1UFUA 3BH8B 1YMMA 1Q4NX 3PIQA 5EF0A 3VQLA 1DLFL 5E51A 5MI0C 1OB1B 2P8LB 4KKLC 3U9UB 2X6CA 2EDEA 2G4GA 1FGNH 5I1JL 4WO0A 1ZV5A 3DX8A 2NDGA 1WTGT 2APFA 3MXVH 2EKJA 5FXCH 3WUWA 3KYMA 3N06B 2HWZH 5DJCA 1PEWA 1WWWX 4PRHD 2F08A 2GAZB 2XTJD 4MJIB 3G5ZB 3QUMH 5C08E 5CGBA 4IOIA 2YQBA 1RI8A 4P2QD 1NMCB 5MENE 3PHQA 2FX8L 2BWQA 4Q89A 3T0AA 3MYZA 3UGEA 5GGRY 5EU6E 2MNJB 3MLZL 5C8JA 3RGVA 5KW9H 1OM9A 1X44A 3Q2LA 1H8SA 1O6SA 3ABZA 1HWGB 3V4PH 4M7JH 4D2NA 2NY0D 4KKZA 4MDIB 2GIXA 1M6OA 4Z77A 3U1SL 4IS6B 1TQWA 2GK2A 3JV6B 1DJYA 2IH3B 2E75C 2K7PA 1AHKA 4G8GA 2J3SA 4PY8J 4UQ2A 4KJWC 4NNYA 5EPMB 3RG1C 4JO5A 2P26A 5JIDA 2K70A 2X0VA 4YHMH 4I1NB 4B9CA 3OKDA 2D0HA 1KV3A 1Z5LB 1YSOA 1UVQB 3EFFA 3NSYA 4H20H 3AXHA 2H5UA 2ADJA 1GC1L 1G0YR 1J11A 1JZ6A 2ZSVA 3M1OA 5DWUH 2WN2A 3JWOC 2DQHH 3PL6D 1U58A 3WHXA 2ITDA 4UDTB 5ALBL 1HIML 4NN7B 4ZW8A 3VE0A 5EIQA 2ZOTA 3LSOA 4ELKA 1K4DB 4XNUL 4C4KT 2OK0H 4I2XA 2Z35A 4IEFB 5JW5B 5CJBA 3EFDL 3ULVD 4DWHA 5T1MB 4X6FA 2ZOKB 4R4BA 3OAUL 5MP6H 4OZHA 4GW5A 2C9UA 3PLYA 4ZTEA 2DLTA 2ILLA 4HPYL 3QWOA 4WW2B 1N6UA 3BZ4B 5T3ZD 5AG9A 4XNMB 3WY4A 4HJJH 2CIIB 3HHSB 4Y4KD 2WMPA 4DVBA 2I60L 3C8KB 2ZOLA 3DRQA 1OZTG 4P2OC 4PJ9C 5BRZA 4F7TB 1TQSA 5CBEB 4OCXH 3QJSB 4IKJA 1Z3RA 1YEIH 2OA9A 4AIEA 1Q72H 4NUJA 4AYID 2BVTA 5CEYA 1Y7VA 4X98B 1UTDA 3MRCB 5DJ6B 3CLEH 3B2UC 4HLZG 4D0DA 1JWUB 2XNAA 3G04A 4Z0BL 1T1WB 1J9SA 4GSQA 3DVNB 4MGXA 4X5RA 2FECI 4PRHE 2EH7H 1MAMH 2XTJE 3QIWA 3HUJB 4N2OA 3KLSA 5TE6L 1U95B 4F1ZA 2QPUA 4KZEH 1I9RH 4P2QE 4Y4FA 5DFVC 3VI4B 1FSKC 1HL5A 4K23H 4A55A 3FSOA 1UM5H 1JYXA 1UB5B 4IBSA 3FFCD 1G7MA 3HRPA 2BRRH 4HIJA 1LO5A 4U05A 5IEKB 4Q52A 3MV7D 5F3HA 3SDXB 4ALAH 4ZD3L 1BBDL 1KJMB 2HTLD 5L4FA 2X6VA 3DMMB 1T89C 4JY6A 4YHZH 4UNTA 5DJDA 5DQ9B 1T20B 5AZEH 4A7UA 2ATPA 5DD6A 2OTWB 4LSUL 4XB8A 2YO3A 1G7IA 2NY3B 3D0LB 3U4AA 4EE2A 3VFWB 4ZMLA 1FI8C 1E6JL 2X88A 3GI9L 2CZNA 4YHIB 1KELL 2IANA 3DJSA 5EF3A 4P9HC 1QAWA 2H2PD 1UYWL 4NQCB 4PLKC 2V6HA 4XP5L 3B7TA 4B5ZA 4ZFOL 2F68X 1UM6L 3AU1A 2ZKHL 3KZ8A 3WKML 3UZEC 2A9NL 5AL8A 3FCGA 2GYSA 3QJFA 3KM2A 4J3UA 1TG8A 3CC5B 3K2MC 1XGUB 2Y24A 1YJDL 3SGKC 1OF2A 5IB5A 2VSCA 5H37G 4TLTA 5FYJE 1P4LB 3OLGA 3QDGE 3QJOA 4ORZC 5I1HH 2QTVA 1AIFA 1S9KC 3CIAA 4WZ9A 2HYMA 3IDMB 2XCMC 4YSCA 1KGYE 1QRNB 3II1A 4NBXB 5CJ8A 5CEZL 2IMMA 1N64H 4OGAD 4MAUH 3IDXH 1UEYA 4XE0A 5TDOB 2Z92A 4A2MA 2YGOA 5HPMA 1AHMA 1NGYA 1IE5A 2XG4A 1ZSDB 12E8L 2H3NA 1NGXA 2O5XH 3VX0A 5EORH 3GNMH 5JXEC 3NSCA 2EIEA 3BP7B 4HOMA 1Q90A 1WP6A 1DQVA 1CDCA 1U9KA 5E4EB 3KPQA 4YSEA 4YAQB 4DN3L 4YS4A 5J7CC 1E43A 4XHJC 1WAAE 1YN7A 3QI9D 3ZN6A 4FFWD 5LAPA 4Q6YA 1A1NB 4HETA 1BMGA 5I1JH 5EB9A 4U1LB 4ZTPL 1J87A 2APBA 4ZAKA 3C5ZA 4I0PB 3A3YB 1Y6MR 1A7PH 3VFNB 1R75A 5JW4M 1VFBB 4BK5C 3MV7E 2WGNB 4GG8A 5KYUB 3DGGA 4JCLA 4F15C 3GB7A 4MB5A 5AVWB 1M7DB 1FNSL 2WXFA 3CZUB 3RWEB 3ZTEA 2ENPA 4PJGE 5AB1A 4GKSB 2Q6WA 4NN5B 4JJOA 3MLZH 4HUXB 4OZ4B 1U2YA 3ZXAC 5FGCE 4E42B 3HG5A 1WC7A 2OJ1A 3APNA 1G7HB 4NUMA 4OSUH 2CBOA 4Z3FA 5DURD 3TIEA 1H6EA 4OLVL 1N7ML 2BIHA 3WTWA 1NGWB 3BDXA 3CTTA 1JDDA 4KXBA 4QTHB 1JWMB 3PREA 1A47A 3IJEB 2HRPH 1T5WA 1EHLH 5DK2A 5IHUL 1DANT 2VLKA 3D1MC 2A74A 1DO5A 2JSFA 1NUGA 2YD7A 2E9IA 2CLZA 5I1DB 2ODHA 1FL3A 3ARFC 5IB4A 5INCB 4D3CL 3KGSA 4JFOB 4GIAA 5FYKD 4NXSA 3CDGB 3MUJA 5CJOL 3AY4C 1MEXL 5ALBH 3TCLB 4Y2DC 1KXHA 2V5YA 5JDSA 3SYCA 3UYPA 4ELMA 3EYQD 4XNUH 4WO4A 4IOSD 2OMYB 1F6AB 4NOFA 1UG9A 5JORA 4DSYA 4ODSL 3K6NA 4ZFOA 1INQA 4F7PB 1G6VK 3OAUH 1MW0A 2IDCA 2NY4B 1DEDA 2V5RA 2WQWA 1HTYA 1MCLA 5F9AC 4L4TD 4HPYH 4CVXA 2WKLA 2ZCHH 1LDSA 4JY4A 3O3AB 3U0PB 2P8MA 15C8L 4TQ8A 3OC8A 5C0BB 2IWEA 3WLWC 3MNMA 1AS6A 3VD0A 4HJSA 5KSUA 3FT2B 2BCKA 4MSWB 3ILDA 1CURA 1D3CA 4RWYL 5HGAB 4LDEB 1T83A 2WXOA 4Z3HA 3AB0B 1I7TB 1O7SA 1RJCA 2LABA 2UWEF 4I0CC 4Z0BH 1T6WA 3U4BH 4F37K 4XN2A 3BIBX 1T7XA 1U30A 2VCOA 4IK6A 2Y1YA 4L05A 1CU4L 3IXTB 4U1JA 1Z9SA 4POUB 5IW6B 2VQTA 1KCSL 3A4FA 4RSYA 4F80A 3N0PB 5D1XD 2WZ6A 5AAMA 4EXKA 2XXGA 3ZT7A 1KGCD 3GGWA 5E99L 1IARB 1BBDH 5EOCJ 3VXUA 5KUMA 3SBRA 3G5XB 3IKCB 1WFIA 5CIPB 1MVFA 1S9YB 1I8KB 3NFPB 4JDEA 4AE0A 4LSUH 4XMPH 1TQTA 4WNSA 4GMTL 3V9EA 4AT6A 2YMOA 2F1EA 1RCYA 4P5KA 3ZKQD 4AVIA 4KVNH 1HQRB 1TKWA 4EDXA 1E6JH 3GI9H 4U0QB 1R3HA 1IAOA 4ODHL 3QDJE 4PJ8A 1V27A 4LVOB 3OJMB 4XP5H 1S78C 5FDYA 1KMGA 4HK3J 1CD8A 4ANXA 1UM6H 2OKMA 2E3VA 1RMFH 4XBGB 5D7LD 1U8CB 5FYKE 3QT2A 4BK4A 3WKMH 3V9CA 4M5YH 2A9NH 1DUZB 2G3XA 1JVKA 2VMCA 1NBCA 4FYQA 3SKOA 3CDCA 3TYGL 2XBDA 2EYTB 1TCRA 3MZGB 1K8DA 4N2DA 4LDLB 3V5HB 1XF5A 3L48A 3QYNA 4JFQA 1G9EA 1R5IB 1L9NA 2D3VA 3FO0L 2BVOB 3LN4A 3ECBB 1ASPA 1OAXH 3O11A 3PV6B 4L4TE 1OHQA 4U3SB 5IFAL 5CEZH 3K6SA 4FQ2H 3U2JA 5C6PB 2H0EA 3V6FB 1R3JA 1N0LB 2DQIL 2F7RA 3T65A 1FYHB 2WNXA 4A7TA 2ICWI 4PIRF 4J3OC 1QI4A 2BVUA 2VITB 3LNHA 4MDJA 5FUCE 5L0QB 2LQRA 3UJJL 1HSAB 2CCWA 4ZXBC 4L8DB 3STZB 2YAEA 2JB5L 1TYEB 4QRBA 1M71B 3KAAA 5FECB 2H8PB 4PAZA 5E9DD 3UDWA 1MH5B 5IK3A 4GRMA 4DN3H 4LFHG 4KROC 5IBLD 1CQKA 3AZUA 4G1MB 4W4OA 4QYAA 1CN4A 2C3GA 4CKQA 1I4FA 4MNHA 2DI7A 1Y0LB 1XL4A 2RALA 4PMFA 4M9OA 1T1XB 1UZ8A 2WJ7A 2X70A 4FTVB 3CFEA 4MXVE 5IQMA 4L8BA 1PZDA 4U1SB 2OTPA 5D1XE 3GO1L 1MXDA 4RZCB 1KGCE 1MLBA 1QBBA 1CE6B 4HULB 1FNSH 3UIZA 1RSFA 3V6ZA 3C9NB 3ESMA 1LO4L 1H0DA 2XZZA 1BWWA 3KLKA 2CH8A 2AVGA 4LKXA 1A6PA 4MFHA 4ZT1A 3L4XA 4WSGA 5BV7L 3EG9B 5TGBA 3WFEH 3RFZC 3B9KD 4HWBL 1PFOA 3KD4A 4OLVH 1FVEA 1V3KA 4PRIA 1YEFL 4F8OA 2VSKB 1FIEA 3ZYOA 4NQSB 2ITFA 3RTQC 2YMXL 2ZX9A 4EKJA 1DSFL 3VYNA 3ASWA 4IU3A 4JS7A 5FUZH 3KHQA 1RLBA 4BZYA 4XVTH 2YD6A 3KYOB 4YFEA 2QPDB 3O3EB 5D7LE 5I0WA 1OCWL 4DZ8A 5IHUH 3ARGA 3U7WH 4L9LA 4Q14A 3S5LB 4F9LA 4OCYH 5KOVC 2QKIC 4FXKB 3D33A 4D3CH 3T6XA 2I9TB 2XYBA 2VN6A 2HJFB 5EEWA 3VQ2C 4MBRA 3H9SD 3RUGE 1QFWH 3GM8A 2HA1A 4ZMPA 4HKBA 1RL1A 1J0HA 1UOKA 3T6ZA 5K39A 3D69B 5EU7E 5F7DA 5KS9F 1UH4A 5F7NC 4NN6C 1GGIL 4ODSH 1KCRL 5LDUA 3HKZA 4DGIL 4JFDD 1KUMA 3K1DA 4UWQB 1L9OA 2IQAB 4X6EA 3WFZA 1P84J 2BERA 3RZCC 5GRJL 1LEIA 4NRYA 4B3VA 1T21B 3I9IA 1A3LH 1V05A 5DD0H 4YO0B 2FAUA 15C8H 3SO3C 3GRWL 3W3BA 2OMUB 4RGNC 1F97A 3EAKA 1KJ2L 1U2HA 5DHYA 3AXIA 3OXSA 1AXSB 1NJ9A 3IJYB 2C1PA 1HAUA 1QEWB 4TSBL 5JMRA 4EN2A 3PWVA 3FT3B 4U0RC 3RIAF 3LIUA 5I5MA 5E9AA 5D5MB 3Q9QA 3T0WA 4P3WA 4PJIE 3ZDZF 1IIKA 1S46A 1CT8A 2YGQA 3N6YA 3QH3B 3DHPA 4IDLA 4MJ2A 4PRBA 4HGWB 4YDJB 3VFRA 5LNGA 3L9BA 1CU4H 3EYOA 3VFOA 2Q2LA 1JTPA 2RMNA 4FQLH 2Z31D 3K91A 1I8LC 2AXGA 3FU3A 5B1BB 3BESR 2G60L 4LLVB 1MSPA 3SE8H 5E99H 1OW0A 3CFQA 4WSKA 3KPSB 5BNXD 1GXEA 1KCUL 2JJTC 5PAZA 4PJBB 1I9JL 3QUZA 3TNMB 4WLCA 3L4WA 4JMNA 3J8F7 1HU8A 3CVHB 4MYPA 4XOAA 4F2MB 1PY9A 4OZGB 4RDQF 1XB8A 2K8MA 1NC2A 5GGQL 3ZDXF 4G7SB 1HHGB 4NQED 4F3FA 1T04B 3BKMH 1P5UC 3MLYL 2Q7YB 4BDVB 1RIHL 5D4QA 1U3YA 1GIGL 5IM7B 4ODHH 4RFEB 1GY2A 4PLJC 1N6VA 2V2XA 3BFWA 3QW9A 1FFQA 3DIFA 3VWJB 3HZMA 3OLEA 5FM8A 5KS9A 4HW6A 2CNZA 2KQMA 3LH8A 3H9SE 4HWBA 3CBKB 4F1SA 1XSOA 3HW7A 2PCFB 3K6IA 3T0EC 4XZUA 5AVVB 3TYGH 4CVWA 1NDTA 1AKJD 4XGZA 4RMUA 3CH1A 4HGMA 4IW4C 4JFDE 4DP5X 4OCWH 2I9LB 3O9WD 1JVOA 2GEQA 2KZ1B 5IFAH 1XMEB 3MV9D 1UWEL 1JXKA 2AMGA 5F9WC 4LBEA 4AJVA 1ANUA 1MCDA 1J8HB 3LVEA 4R7DB 3RVUC 5EZJA 3O6FB 1Q9OB 3QO0B 2JB5H 2VAAA 3DTUB 1TYRA 4OT1H 3CFDA 1IGYA 1YYMH 4HUCA 4YXLL 2EC9U 5E0FA 3W0WD 3RU8L 2CLVB 4IIQC 4CBPA 1RVFL 2C9RA 3JUYA 3B9DA 3DO4A 1HEHC 5DD1L 4IGBC 5LXVA 1ZK5A 3IN2A 4IOFC 1D7BA 3OGCB 3D85A 1A4KB 1BD2A 3W57A 1HOCA 4P2CG 4U4BA 4AYMC 1FN4A 3GRWA 1IUZA 1EO7A 2HRGA 3NTCH 4F33A 1H3UA 4OLUH 1WBZB 3KPNB 2R8SL 1KJ2A 4LCWA 5A2IH 1L9MA 1DP0A 1AANA 2YC1A 4ZG1A 4IYKA 4PV9A 1SLXA 5JW4R 3BI9X 2CIKB 1JF6A 4HUWA 3SE4C 4FYSA 5IUCA 4AQ1A 1DQJB 4HWBH 4NQEE 1CFQB 1OAZH 1YEFH 2JKSA 1YMMD 1KCKA 5B3JF 5H35A 2GK0B 3DX7A 3VCLA 2YMXH 1DSFH 2NW2B 1GYCA 1AQKL 3O8XD 5GSVB 2NNAA 3X12A 2CWRA 1UM4H 1WFUA 3BVWA 3LIZL 2IV9A 2EH8L 4NFDA 4WUKH 4PJDB 4UZUA 4CJ0A 2B9AA 5L4JA 3CDZA 3INOA 3PABA 3HS9A 2VLLB 3ZR6A 5KEZA 3WTXA 3BP5A 1F8TH 2VABB 3U30B 1QBLL 3WO4C 1PAMA 3CE1A 1W0WB 3OV6A 4P4RA 3RWDA 1XF2A 3OAWA 4JFPB 1M7IA 3IXAA 1EJOH 1OLZA 2J12B 3K74B 2CO1A 2RH0A 2ZX7A 4WK2B 3FYEB 1XH0A 2XIBA 1P53A 3O45A 3K4DA 3S5LG 2Q10A 1CGUA 2NY2D 3V0GA 4KUZL 2VWEC 2CDFB 4G8GD 2J72A 4Y16B 3BWAB 3F01A 2GB2A 4QF1A 3V0VA 3BVUA 2JKTM 1OP3K 1A7BA 4RRPG 4FZ8L 4QRUB 1JGEA 5I71B 4KUCF 2AJYL 2HX9A 3W0WE 1S9WB 2OV0A 4OM0L 2EDOA 3TN0B 2N4IA 1SEBB 2IPKA 5TK2A 2K9FB 4GXUM 2ATAA 1OE1A 4XP9L 1D9KA 3Q9PA 1XO8A 5GIRA 3P3TA 2NR6A 3E1ZA 4OQTL 4G6AD 3S9DB 2GCYA 4QDGA 3NACH 1FFOB 5EUOF 4CL7A 1FNHA 4QKXB 3P9MA 4A7GF 1KLUB 1PVHA 2G60H 4H8QA 5I0ZA 1BGXH 1KCUH 1AGCA 2VZ3A 5CU9A 2FEDC 1MJJA 2R59A 2IBZY 3FO1A 2O6EA 3LEXA 3O0LA 3D08A 2GKIA 3PGFL 1SXNA 2VSDA 3LRSB 4X5LA 5BRZD 1YMME 1XCXA 2H0PA 4LL4A 4MQ7B 2DQGL 2X2IA 4XCEB 4WSJA 1ADQL 5FO8A 4ZMXA 1BOGB 3DTXA 1NKGA 2C9SA 3G5WA 3OR7B 1TVBA 3MLYH 3JWNC 5IB2B 3KEDA 4PJ7B 4AXWB 4MCMA 1QSEA 1S7VA 4EI6B 3QIWD 2R2BA 2X4RB 5DRXB 3VI3B 2DJSA 3D0VA 2BIQA 1FL5B 2ITCA 3M46A 1ZK9A 4HCFA 1HFUA 5AVZB 4ODWB 1PX4A 4OM1L 1A6VH 3VGFA 2FT8A 4B9PA 1GGTA 4WWID 4GS7C 5J9PA 4NQVA 4JB9H 4HIPA 3FW6A 1IQDA 5I8KH 32C2B 3HVNA 2AJZA 2WLIB 1AMYA 3K1KC 1BAGA 4U6VL 3QCUL 4WV1B 3SDCA 1BW8A 1Z66A 1E2ZA 5K9JL 4OF7A 4G8GE 4JHBA 5GISL 4CBZA 1FFPA 1SPDA 3DIDA 3VTAA 4DIXA 1ZLVH 1U6AL 5B4MD 5C09B 4QPEA 3MUZ1 2IAND 3U6RA 1DQKA 4H25A 3WG7B 3H7BA 3FC8A 3BDYL 5CLZA 5TQ0H 4AQZA 4WEUD 4QRSB 4AQAB 3WMSA 3NCJL 5I8EA 1F6FB 1CGVA 4N0FB 4YJZL 4DKAA 4K73A 3ZKSD 2H26B 3P0YL 4UQDA 2BP8B 2IOIA 2HT2C 4EI5C 2WHVA 3ARDB 1A7OH 1AOZA 3WNKA 1W8OA 4YZFF 1NGZA 3O6KH 4GI6A 4I2XE 3RU8H 1OWRM 2Y7NA 4DKTA 5DD1H 5F1NA 4HKZB 1MQKH 1C5DA 3ET9F 1SVZA 2IV8A 4RH4A 4M00A 5DJYA 4OZHE 4X7EC 4I18A 4G43B 2ARJA 3MCKB 1GJUA 3PS6A 4AL8C 1SFDA 1S8DB 4TL5A 5ESVB 5C3LD 2R8SH 4PD4K 4F58L 4P5MA 3MRQB 3DOSA 4PYGA 1L5GB 5D8JH 3ZDYB 5I73B 4MMZB 3ISRA 2HVKB 4LCIH 4ZW5A 5BRZE 1GCYA 2Z7UA 2QHRL 1ZWIA 2X09A 4UQEA 5C0IB 5EN3A 4FP8H 3F7LA 3QHFL 2JCCF 5CO1A 5JPMA 4P4KB 1VGKB 5DT1H 3GBEA 3QUYB 3BW9A 2A4EA 3TIDB 3SGEI 2PWFA 2CKBL 5CFAA 2PTTA 1CXHA 5H2BB 4G8IA 2DBLH 4BCYA 1NBZB 1WD9A 2FQEA 2YBGA 2GT9B 3CHOA 3FOLA 2QBWA 2G9HB 3B43A 1NAKH 1N6QH 1K2DB 1F4XH 4ZAKD 3C5ZD 3O3DA 1EAPA 4Y5XC 3WL9A 4C56B 5CBAB 3BMWA 2WUCL 3HIZA 4UIMB 1WPCA 2NQCA 3JXAA 4J8QA 4X9FA 3DI2B 3GS0A 3BQUB 4OUUB 3SSGA 3T0VA 1ADQA 2WBXA 3PDGA 3UO1L 4NYLA 5C0JB 1KV7A 3VAEA 3MBXH 3GKWL 3VXQB 1J5HA 1PG7L 1KLFA 5IFHH 1IBZA 1TPXB 4DP7X 2FO8A 2AABL 2X9ZA 4ENEC 2HJLA 2VXTH 3GK8L 2V33A 1YZZA 1MHEA 2IANE 3Q48A 2VISA 3EKCA 3NN8B 4KUZH 5ENWB 4ODUA 3ROLA 5CKAA 5JPNB 3PRZA 5C9JB 1XZ0A 3ZQWA 5LNDA 3QJRB 4FNLL 2WQRA 4FZ8H 1BBJA