1PAZA

Refinement of the structure of pseudoazurin from alcaligenes faecalis s-6 at 1.55 angstroms resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
120
structure length
120
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN PRECURSOR
publication title Refinement of the structure of pseudoazurin from Alcaligenes faecalis S-6 at 1.55 A resolution.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Electron transfer(cuproprotein)
total genus 32
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 1988-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1pazA00
1M57B 5AFAA 1KBWA 4ENZA 4M4RB 2BP0B 2QT6A 8PAZA 3UACA 4A2FA 4K9JA 5I6NA 4PAZA 3PCYA 5I5MA 4YSQA 2BW5A 5ANHA 2Q9OA 3S8FB 1ETJA 1JZEA 1NPNA 1AACA 4AKQA 4DP8X 2IAAC 4HIPA 2YAHA 4YSSA 1GY1A 3CG8A 4GY4A 2YAEA 1WA0X 2UXTA 4L0PB 1DZ0A 1KYAA 5PCYA 2DYRB 2LLNA 2DYSB 3AG3B 1OCCB 4KNUA 1A4AA 4HCGA 3ERXA 1GS7A 1M56B 2XUWA 4PCYA 3IEAA 1FFTB 3EH5B 1ADWA 1BEXA 4DPAX 3ASOB 4E9QA 1ASPA 3GYRA 4UF7C 4BWUA 4DP1X 2WO3B 3NJKA 2IH8A 3WIAA 2IDSA 3QJTB 1PMYA 4CSPA 4G7QB 1A4CA 3V9CA 3L45A 3NT0A 4Q8BA 1VLXA 3QJSB 1R1CA 1GY2A 2TSBA 1TKWA 3PPSA 3PLYA 3ABGA 5PAZA 5TK4A 2BO0A 3PXLA 9PCYA 2XU9A 5D4IA 2N0MA 1HAWA 2QDWA 4F2FA 1ZDQA 2JFCA 3X1GA 4NB7A 1OF0A 3NSDA 1JOIA 2J57A 2VSKB 4MFHA 2I7OA 1NIEA 2W8CA 2PP7A 4BWTA 4A2GA 2PPAA 3IBOA 1XMEB 1EZLA 2XXFA 3DKHA 1OE3A 2HRHA 2PP9A 2IWKA 2H5UA 4YL4A 2Y1AA 1W6LA 3FU7A 5I28A 2HLEB 4G72B 1SFHA 3QJUB 1PZAA 3FYEB 2GC7C 2J5WA 3FSVA 4YVUA 4BWWA 3WKPA 4GXFA 3RYMA 2P80D 1CYWA 4BXVA 4KNSA 1GW0A 1AZUA 2IDQA 4GP8B 3FU7B 2PLTA 2AZAA 3CVBA 3IN2A 4QKTA 1BQRA 3EH3B 2XV2A 4DP0X 2MRYA 1IKOP 3NJLA 2B3IA 1KGYE 4F2EA 3NJGA 2XV0A 2XLLA 2FQEA 3X1EA 5B1JC 3FT0A 3NSCA 1NPJA 1T5KA 4GYBA 4HCIA 3CZUB 3HB3B 4E9YA 3C75A 1IBYA 2JKWA 1A4BA 2VSMB 4HAKA 4YSTA 4G70B 1J5DA 5B1JA 4DPCX 5D4HA 4A2HA 4A66A 3NJJA 5I5IA 1AS7A 2BP0A 4E9WA 4KNTA 3TA4D 4E9TA 3OMNB 1QLEB 1DYZA 4YSOA 4ZK8A 3UGEA 1WS8A 7PCYA 1URIA 3WNJA 2X88A 2PPFA 1X9RA 1B3IA 5IY5B 4N4YB 3FSZA 3OQRA 4DPBX 4YSPA 1GS6X 2YAMA 1WAEA 3PAZA 1PNCA 2OV0A 5F7BA 3GDCA 1NICA 2FQDA 4AKOA 4AX3A 2GB2A 4QLWA 2WO2B 1AANA 1JZIA 3BVDB 4P5RA 3X1NA 3BQVA 2E86A 1MDAA 1BXVA 3KW8A 1KV7A 3AG2B 3AG4B 3D12B 3ZX1A 1NIDA 2H47C 2ZWNA 6PCYA 1AG0A 2BP8A 1SF3A 1J9RA 2XXGA 4M3HA 4E9XA 4YSDA 3WG7B 3GXUB 2UX6A 3ABMB 1MZZA 2I7SA 4DP7X 3NJNA 1OCZB 1AS6A 1PLAA 4HZ1A 1SNRA 1W8EA 3UAAA 2EILB 2CCWA 2BP8B 5LDUA 1WS7A 3AG1B 3MX0B 3EHBB 4KO6A 4N8UA 2BZCA 1L9PA 4X4KA 4DP4X 1J5CA 1MZYA 2YQBA 5I6PA 1M9WA 1NWPA 3OD3A 1JZJA 1L9SA 1BXAA 3U25A 3SQRA 2PPEA 1RKRA 2PCFA 1KCWA 1CUOA 1PF3A 2FQFA 5TK2A 2YARA 3NJMA 2FWLB 3FQYA 3FSWA 3T6ZA 4DP5X 1IBZA 2H3XC 4YSUA 2JXMA 1OOWA 4YSEA 3H56A 4YSCA 1AZCA 1CYXA 1AIZA 2HZHA 1NTDA 2FTAA 5B1AB 4A67A 4DP2X 1BAWA 3JT2A 1AG6A 2IDUA 2AVFA 2EIKB 3NJFA 3T6WA 1V10A 1OCRB 4DP9X 2NRDA 4DP6X 2UXFA 3IN0A 1SHWA 2GC4C 1JERA 1JZFA 3DTUB 5I26A 3QJRB 1NIAA 1GSKA 2Q5BA 4KO9A 1TEFA 2VW7A 2CBPA 1E5ZA 5I6OA 1ZIBA 2XWZA 3PAUA 1PZCA 2CJ3A 2CAKA 3T6VA 1JXFA 1RCYA 2AANA 4BXSV 1KDIA 1V54B 3ZDWA 5A7EA 3QPKA 2MTAA 1JXGA 3H4FA 1AZNA 2PPDA 3JTBA 3SBPA 3KW7A 3S8GB 3FU8A 4HCFA 2ZOOA 3QJVB 2CALA 1AS8A 3AW5A 2YAPA 2BHFA 4FAAB 4WKXA 2GBAA 3CDZA 3TBCA 1N70A 2FNWA 1PLCA 1WA1X 2R7EB 3OMAB 3X1BA 1XB3A 1ZIAA 2DV6A 2HXAA 1XB6A 2P80A 1ASQA 3IE9A 2HX9A 1PAZA 2YXVA 3NJIA 3NYKA 1A3ZA 2OCCB 1L9RA 1OCOB 2EINB 2GI0A 3UABA 1BQ5A 3ABKB 2HRGA 1NINA 3CDZB 1ILUA 4Q89A 4FA7B 3FQ1A 1KDJA 2HX8A 3N55A 4TXVB 3S3BB 2VW4A 3T9WA 4G7SB 1E5YA 1W6WA 2W88A 3FU9A 1HAUA 1PNDA 2AFNA 3NSFA 3H4HA 4RH4A 3V9EA 2XYBA 2BWDA 1NIFA 2PP8A 2OJ1A 3N2JA 5B7FA 2A3TA 4G71B 3G5WA 1NDTA 1L9QA 1RZPA 3HEIB 3MBWB 1E30A 1SFDA 1ET8A 3NP4A 4HHWA 4HALA 3NP3A 2VN3A 1GYCA 4KOBA 4JKNA 1BYOA 1E65A 1TU2A 5AZUA 1IC0A 4JHUA 5F7AA 2XX0A 4A68A 4YSRA 2PPCA 1SHXA 1V55B 3OMIB 7PAZA 2IDFA 4HHGA 1ZV2A 1BYPA 1ASOA 1XB8A 2ZXWB 1E67A 1J9QA 2IDTA 2FT8A 4AKPA 1J9TA 1JXDA 2J55A 2BW4A 4UANA 3SBQA 1PY0A 1ILSA 4KOCA 5B1KA 1OE1A 2YAFA 2IH9A 2YXWA 2UX7A 2QPEB 2X87A 1UATA 4P5SA 1ID2A 4YVNA 1HFUA 1PLBA 3TU6A 2RACA 2XV3A 3WKQA 3S3CB 3DIVA 3PAVA 3CVCA 1AOZA 2VW6A 3ASNB 1J9SA 4G7RB 3UAEA 1SDDA 1KBVA 3QJQB 3NJHA 3X2QB 3WI9A 1MG2C 1SF5A 4BK5C 4AI7A 3AY2A 1ZDSA 5B3SB 3WNIA 1F56A 1I53A 2XVBA 3TASA 4F7KA 2GHZA 2QDVA 4W1TA 2Y69B 2UXVA 2GSMB 3QQXA 2EIMB 3T6XA 3ZIYA 1YLBB 4CSZA 1SDDB 4GP4B 1ZPUA 3SBRA 6PAZA 2IWFA 1QHQA 2FQGA 2UXGA 3TBBA 5I6LA 2GIMA 5D4JA 5B1BB 2BWIA 2WSDA 2ZONA 5AKRA 5EHFA 1A8ZA 2QPDB 1GR7A 4UAHA 1NIBA 1N68A 1FWXA 1TEGA 4WTQA 2TSAA 4E9VA 3EH4B 4E9SA 4A2DA 1OV8A 2EIJB 2FJSA 2R7EA 3NSYA 5B7EA 2J56A 1CC3A 4JHVA 3T71A 2VMJA 3FSAA 2IWEA 2DWTA 1PCSA 1OE2A 2YAQA 1JVLA 1AR1B 1AAJA 2VM3A 1JZHA 4NAJA 3FS9A 4YSAA 1FA4A 1X9UA 1A65A 1BXUA 2PCYA 2VM4A 3X1FA 3FPYA 4NERA 3FYIB 5I6KA 1EHKB 1NWOA 4W9ZA 2FT7A 1BQKA 1PZBA 3ZBMA 2FT6A 1NZRA 4GP5B 1L9OA 1AQ8A 4KO5A 1JVOA 5B7MA 2BZ7A 2DWSA 1QNIA 1AZBA 1AZRA 2YAOA 4A2EA 1WA2X 5I5JA 5FC9A 3ABLB 2DY2A 5E9NA 2AZUA 4BDVA 1RZQA 4AZUA 1GS8A 1IUZA 2CUAA 1L9TA 3FPXA 4E9RA 3FQ2A 1KCBA 2I85A 3S3DB 1JZGA 1ET7A 1ET5A 4BDVB 3EF4A 3AZUA 3OM3B 1MG3C 4EF3A 5I6MA 4KO7A 3UADA 2B08A 3CVDA 2XX1A 1SJMA 2HX7A 1CURA
chains in the Genus database with same CATH superfamily
1JV5B 2CCLA 4PSPA 4V11A 3SSGA 3OKMA 2UY6B 5D5ME 1DVSA 2V8MA 5IF0B 5CJOH 3BPNB 3FQNB 5T1JA 5KTEH 1H15A 3KYOA 1SQ2N 1IKNA 3SDCB 1UUNA 1X5MA 4HUNB 4NP9A 1GGCH 4BKLA 4KKCD 4IS6A 4U3SA 5DMIH 5MI0B 1NPNA 3VACA 2ODIA 4FFVC 4AG4L 4BH8B 3WTYA 3TBYB 5JQ6H 1EMTL 1MWAB 4NQDA 3VX1A 3WY4A 5AYTA 3RA7H 2MCPL 4TVUA 4HFUH 4KROB 1NAMB 1IX2A 5ADOL 1UYWL 4PRIE 5C07B 4CU8A 4F2MA 2B9BA 4IKLA 5FF6A 5I1IH 3P0VL 4YHPB 1I1AD 2DYSB 2G2RA 3IU4L 4M1CC 4OF0A 4BE6A 3RFZA 2APFA 2UVFA 1PDKB 3JYCA 4LSVL 4AZ8A 4U1MB 1A5FL 1A22B 1J8HB 2VO8A 4F24A 2B0SH 5D7LA 3V6ZB 1HZKA 3QAQA 1YYLH 2C9SA 4UIMB 4W6YB 4YDIL 2AXFB 3WIAA 5F7EL 1DUZB 4KHXL 1S7VA 3O3AB 2F68X 1U2HA 5A6MA 5ISZE 3EO9L 2R1YA 3QHFL 4ATWA 4JO3L 3B2VL 3V9CA 1KNOB 3L45A 3IMBA 4YEFA 1VFBA 3IBEA 3L5WA 3FCBA 5CKAA 4UB0H 3SGDI 4U6YA 3GEFA 4HBCL 1L7IL 4QLRA 4B5EA 2WPGA 4RMTA 5FYKE 1CGSH 3UG4A 4PIBA 4PUBH 4OLWH 5D6CA 3ESOA 3TBSA 3LN9A 4XPGH 3UMTA 1DLFH 1AHKA 4LPUA 4YHNA 3FO0H 2PPAA 3JQOB 1HWGB 5CWSA 3TH4T 4P2YA 2HRHA 3WS6A 4AJWA 5EDSA 4YL4A 1D3CA 4IOFD 1MI5E 4L1SA 1HHIB 4G3YH 1ETA1 1RZKC 1YVLA 4P2OA 4XWGH 5C0EA 2HPOA 3HHSB 4BWWA 4DEPC 4XPBL 4OFQA 1PS3A 5AZ2H 1GMIA 3OZLA 4TNWF 3VXOA 2WWOA 2P9RA 4I8DA 1EJ6A 1K72A 3VUAA 4E5XA 5KS9E 2IDQA 1T1WA 4XP6H 3D18A 1TJMA 4ZRGA 4K71C 2C4FT 2EYRB 2YD2A 3BT2H 3C5ZA 1UURA 4QKTA 4EVNA 4YE4L 5JHAA 2HH0H 1NCWL 1QZ1A 2ZF8A 3WSQL 2EVFA 5L2JA 2XYCA 3BW9A 3CIQA 1ZT7B 3NJGA 4PP1C 2XV0A 5CP3A 4HIEB 3SBWA 6FABL 4IMLA 2KMWA 4GRLC 1WHOA 3QEUB 2ZSWA 1TJGL 1JYVA 1RK0B 3HB3B 4XXDB 1RZJH 3AQXA 3G7TA 5C0JB 1TQSA 3EGSB 2VSMB 2ITDA 5L6YL 2WTOA 1UM5L 4YGAB 5CCHE 4ONGH 4JLRB 1AP2B 2QPSA 3KYMA 1ZLUH 3VD2A 3O0LA 4BFKA 3MRNA 5HHNB 5DZJA 5E5UB 4JX0A 1IQWL 3DHMA 3T6QC 3T1WA 3CXHK 4FLQA 3T0EB 1QLEB 1NFKA 2NY5H 1FJ1A 4OCWL 1WS8A 4PGEB 2VRQA 2X88A 1A7PH 1PFOA 4U4IA 3P4MB 2C34A 3ULVE 3TJEL 4ISVA 2GJZB 3FUNA 1WAEA 1JYXA 4L29B 1NBYA 3LSOB 4FFYH 2A73B 4U1GC 3DOSA 4QLWA 4DKEH 5C6WH 2DLHA 1U8LB 4B9JA 3BVDB 4MX7B 4UZUA 4MQ7A 3V0HA 5A7BA 3WFZA 1SRDA 2NY2D 4B9CA 2K3HA 3QQ9D 3RGHA 3N41B 1AG0A 3LDBB 3HLAB 5CN3A 4R4FH 4F3FA 1BD2E 1CZ8L 2W91A 2XJLA 1YUHB 1F4YL 3FO9A 3WG7B 3WN5C 2CGRL 3IDJA 3A6CH 4NZJA 4MAUH 4JRFA 3NABL 1A6WL 3OJVC 3UXFA 3VNZA 3MJ7A 1QHPA 4LLMB 3TCLB 2SODB 4O51B 4PP2B 2HP4A 4TF4A 2CCWA 1CE1H 4BSVB 3ZQXA 3P02A 4ZUTA 3SDXE 1HHKB 3FTVA 3LZFH 5K39A 4ZUUB 3AFLA 5EU6B 5BXFA 3ARZA 4K8RH 3EO0B 3VWJC 1MREL 4R5VA 3WIHL 4MRBA 2EE2A 2GEEA 3TT1H 2QHRL 3P0YH 2GJRA 5AENA 2EDNA 2FQFA 4JKLA 1JZ2A 43C9B 3S3JA 4HUXB 3ZY7A 4KJQC 1X6LA 3GMOA 5ECGA 1QBBA 2CIKA 2WXNA 4U7MA 2VJ8A 3TEYA 1D6VH 2MOGA 2H3XC 2WCGA 4Z77A 3G04B 4K3JL 1G9MH 1QG3A 1WEJL 4GKOA 3OJMB 4MAZA 3TNMB 1QPXA 2HJFB 2LU7A 4LP4A 4KHTL 5HD8D 3OC5A 1AZCA 4AQEB 1URLA 4HWNA 3GSQB 1CYXA 1FFRA 3IJHA 4RFNC 4WQOA 4X6BB 4AMWA 3BAKA 4OZFA 2IH3B 1VEOA 4PJCF 2VYRE 2CK0H 3DRQA 5GGQL 1G7JA 2MOQA 4X99A 5LUMA 2P24A 2VXVH 3HNTL 2M26A 4G8IA 2MH4A 4MMYA 2D0HA 2DTSA 4X6FB 1JZFA 2YKLH 5EO1A 5I66A 4ZAKD 3NFPA 4PI2A 3JT0A 5EORL 1DDHA 3U6RB 4LEXH 3FO1B 2VDRB 1ZRUA 2JIXD 3CIAA 2OSLA 3BCDA 4NKDB 3V0DA 1NGPL 4G6FD 1T66C 5AOIA 4Y5XB 5GZOA 1I8LA 4AM0B 5IESL 2H45A 2RGSA 4DVRH 4Y1TA 1OP5K 1WLHA 2QKIA 4NENB 3F58L 3JTBA 3OKDA 4P07A 1S7SA 4R7LA 4Y2OA 3OF6D 2LVEA 3K0YA 3O6ML 3S8GB 1IAKB 4NNXB 5EUOE 3STLA 1I9RL 5IVXF 3H1ZA 2YMTA 3HC4H 3QYCA 4N1HB 1OM3H 4JCLA 1CLYH 1LM8V 2FNWA 5DK0A 5EEUA 1EQWA 2R7EB 2DV6A 1Z6JT 5DWUL 1MAJA 4RGND 5IOPA 3K72B 4WUUD 3WTSA 1MWOA 4Q0XH 2NY3B 2ZX5A 4U1SA 3NCBB 2V3DA 3ABKB 4NRXB 1CDUA 5H94B 3VFGH 4XNZC 5FV1L 3FZUD 3L7FA 1OAUL 5BRQA 4CVUA 5ETUA 1O6SA 3FHAA 1WSST 1XF5B 2JSFA 1IKFH 1LK3L 4AGOA 2NW3B 4QO1A 3L3IB 2BOCB 1IAMA 4ZXBB 3FN0H 4HV8B 1SEBA 1JF1B 2A3TA 5FW7A 1XGYH 2NR6C 4LEOA 4R7VA 4WIQA 1TLKA 1EZVX 3S37H 1CF8L 3QUML 1NDTA 1NPUA 2CHDA 2KPWA 2OQJA 4OKDA 1JWMB 1KIPA 4PBVC 5AW8B 3V55A 2YGNA 4I77L 1ET8A 5BZZA 1TQUA 3D4CA 2EIBA 4HIJB 1BYOA 3DGGA 1YJDC 3VGAB 4XNXH 1BF2A 3S6CA 4DGUA 1E90A 1FDLL 1NA8A 5C08A 4AEHH 2Q3XA 5JHLA 2VZVA 2OTWB 2X6CA 4XB3A 3KE0A 4YSRA 4BGDA 5E5MB 5TH2A 4QGTA 2A6KB 4PLJC 2IDFA 4HHGA 3RTQB 5MEOB 3HG4A 1MY5A 1XB8A 4HAGA 3GHEH 3NESA 3B43A 5TE6H 5CCKL 4Q4EA 2ZCKH 4GSRA 5JPMA 4F7TB 3TFKD 5IVZB 2NNXA 3WO4C 5KSBB 1IBFA 1FZMB 3SBQA 3ZE2F 3GSWB 4OF6A 5IGXL 5F9OH 1T0PB 2YGQA 4FFZA 4NWUH 4PRHD 1VGKB 2J4WL 2ZCHL 3ABZA 5ENWA 1XR8B 3IWUA 3H3KA 3QO0B 4PGDB 2WXHA 5SV3A 1LYQA 4I18B 2HT3C 4OJEH 5TE7H 3CWGA 1JAEA 2MNJB 3HC0A 1BW8A 4FHJA 4UQ3A 1BJ1H 3QFJD 4D3CL 4WNQA 3I50L 4WGKA 4LPWA 4Y0GA 2PO6A 1GL4B 4NO0D 1SDDA 1RUQH 3ZDYE 4AITA 4Z18A 3ULUL 1NEZA 2BSTA 4Y4FA 3VXME 5BOZG 1FVDA 3FUKA 3BKMH 2GTWA 3O2VL 1SMDA 3PNWA 4AI7A 1S7XB 3ZMEA 2WQ8A 3T4AA 2QDVA 5EFIA 4I48A 2VRKA 4AQ8A 4EXPX 2UXVA 1NUGA 1EJFA 1L5GA 1WCBB 2TAAA 4JFPA 4KUCF 4LRIA 5T5FL 4OCMC 5D1ZB 5JIPA 1W8NA 1K3ZA 4POYA 2FL5A 3RWCA 3CSGA 1JMZA 3L1OH 3SIKA 5CJXA 1F13A 4X7EC 1E6OH 2H26A 3KXFD 1BLIA 3MRFB 3RP1A 1GKOA 1O7DC 4X8JB 1UWFA 4A6YA 4EN3D 1GR7A 3OKKB 1NIBA 5E8DL 3MV7B 3VFWB 1QUNB 4GAJL 1W16A 3K5SA 4UAOB 1KG0A 1P4LB 4NUJA 4ZD3H 3QI9B 1JXKA 2X4UA 5JYLA 3UJIL 2G30A 1GMEA 4MXVE 4TS6A 5FO2A 1LO3L 3QJZA 2Q7YA 3GMMA 4NPYA 1OAZH 2WQVA 4M6OH 1JNJA 4JZJC 1BOGB 4N6RA 4FL4B 4DSYA 1XCTB 1H8LA 3BQUD 1MNUH 1MCBA 1E6JL 1E9OA 4X0KB 1DANT 3JWOC 4FNPA 1WT5C 4QTIL 3VI3F 2LVCA 3UTSD 4TQEL 3RY6C 2HFTA 3K6DA 1F42A 3LNFA 3VDCA 1AKJB 4QAWA 4OT1L 1ZHLA 2Q7AA 1DSYA 4GQZA 2YPLA 2DS4A 5JUEH 5D7EA 1CDYA 3ATEA 1IGJA 1YYML 3F7KA 1NWOA 2P46B 4HGWA 2YUWA 2LLLA 3BRGC 2EKSA 4KRLB 4DGIH 4CN4A 3ESPA 4N2NA 1A6PA 4GW4A 1BZEA 2ZTBA 3T09A 4CDGC 5I1JL 3TBTA 1DQKA 3C9NB 1F6FB 2J43A 4YDMA 1WICA 2QQLH 4XBEL 3BESR 2QPUA 1DQLL 5FYLD 2DQCH 4R83A 4AGLA 4BDVA 2JKLA 1SHMA 3D4YA 3E1ZA 4WI8A 5GGSY 5K9OB 2IH1B 5IHUH 4F33A 4ELME 4WI0B 1OARL 4NFCA 5E7FA 1XGQB 2X4NB 2Z3FA 2XNAA 4JO2L 3DXAE 4HIHB 3UTTD 1MJUH 4HS8H 2YUXA 4PJXA 3VYOA 1KCBA 2JJSC 4OZHF 2CR0A 2GITB 2LQRA 4J2QA 1CK0L 1FPTH 5E0FA 1ET7A 1KLUB 5HHQB 4KKRA 1INQB 2NR6D 2VDPB 4UUJA 1EVUA 3BIAX 4YX2H 5CD3A 5FGRA 5GS1B 3B2XA 1RZ7L 2WHVA 2OYPA 1CURA 1DQDH 5DD0L 4XO3A 1KBWA 2QGDA 3EUDA 1RJZB 1LILA 4KY2A 1FZOA 4AIXA 2JTYA 3IE4A 4KXDA 4Z5RB 3OR6A 2X70B 5FKAA 1YEKL 3FB8B 3QGVA 4XNUH 5BQ7A 1C5DB 4FCAA 4JFFA 4K7FB 3G5ZA 3OKMB 4EPSA 3U1PA 3QDGE 5B39G 5INDA 3B7RL 4P9HL 4J3OG 1T1ZA 4TNEA 3F04A 4L0ZA 3AXIA 4QTFA 4B9FA 3KYOB 2ZOLA 3BKCL 1FF5A 1KC5H 4N2DA 4BKLB 2OMWA 4I9XA 1Q9KA 4M7KH 4TTDC 2D4DA 4IS6B 4U3SB 4BZ2L 1VFUA 1KYAA 5JR1L 2CA4A 5C70A 3NIFB 5AL0A 4KNUA 1UB5A 4RRPA 5E5LA 3CZFA 5F7DA 4BQCA 2D7TL 2QV2A 4N86A 4NQDB 1GHFH 1T4KA 4M5YH 4OI8A 1ID5I 3E2HC 5GZND 3DX7A 4JHWL 2LFGA 5FYKU 2BM3A 4LGPB 5C3TA 3K0WA 5FF6B 2JE8A 4PR5A 2G2RB 2IDSA 4L18A 1K3IA 5JDSA 3RFZB 2ATAA 1EO5A 1J1XH 3CBKB 3KS0H 3SYCA 4AZ8B 3GXIA 4P5MA 4KZEH 4WWNA 2CHZA 5D7LB 2UWEE 2H1PH 3GI9H 4EKJA 2YRPA 1Y6KR 1S7VB 4KVPA 3OG6B 3BZDA 1BLNA 2R1YB 1CD9B 1HAWA 3V2AR 4JRWA 4ENEC 1MFAL 4TUUA 3RTLA 3RUGE 1DFXA 1VFBB 3LKNA 3WHXA 3L5WB 5F1NA 4ESKA 3CX5J 4HZLA 2I7OA 1LEGA 1IZKA 3OB0K 4U6YB 1JMXA 3KAAA 4UOZA 4F58L 1TZOA 1Z66A 5FM8A 1N5YL 5GS0D 4LLVA 4E41E 4OB5L 1YEHH 5EO0A 3OGOE 3GSNA 5I28A 3D4GA 2QVMA 2MHAB 5D6CB 3L5HA 5CSGA 3TBSB 5EWIH 5E1AB 5D1XD 3R7QA 4AEFA 1FNAA 1DVQA 1IC5H 1M2VA 2WZAA 3OF6A 5CWSB 3RYMA 1SN5A 4LK4A 1KYUA 1F90H 1TSHA 1YEJH 2IAND 4ZSOA 1KIRA 4TPRL 3EGXA 4N68A 3ZYZA 2W38A 3WFCH 5AWNH 5DS1A 2APTA 5T3XL 2VXQA 4P2OB 5C0EB 1KELL 4KI5F 5KVMC 5EA0H 3C5SA 5FA3A 5KOVC 3VXOB 1A7OL 1MJ8L 4QI3A 3N06B 2B3IA 5ANMA 3NIGF 2XLLA 4IBTA 4E5XB 3OHMB 2N3JA 3NSCA 3D18B 3Q1SL 4XPHL 2W5PA 3QIWD 2EDTA 4EVNB 3C5ZB 3HE7D 1B9KA 2N7BA 1JK8B 4GRLA 4JFUA 4DPCX 5KVGH 1KLGA 2HKAA 3BW9B 4MB3A 5L2JB 1JUFA 4GI8A 3WDJA 1E27B 3UJTH 4IMLB 4M3KB 1AS7A 3OTTA 5TDOA 1F4XL 4YDNA 3CDYA 2ZSWB 5DJ2A 1XMWA 2AAVA 1D7BA 5TGBA 3VD3A 2ITDB 3UGEA 4FTVE 1URIA 1OQOA 2ETWA 4ZX6A 1B3IA 4B60A 4KTEH 3KYMB 1ZJAA 4C8XA 3IS0X 4XVSH 3PAZA 3MRNB 4HXAH 1BJ8A 1CN4A 3LZLA 2BIOA 4AX3A 1G1OA 3IYLW 1X5XA 1FJ1B 1G6RL 4FS0A 3BKYL 4PJHE 3U4AA 4JFDD 3D2UD 4HGKC 5FYJD 4OF7A 4FNTA 4ISVB 4UM9D 1NBYB 1WG3A 1HKLH 3GXFA 3IJSA 3DOSB 4ZMOA 4X6EA 2XXGA 3RX8A 3VVVA 5F70A 4HWBA 1TTGA 3LH2L 1Q9WA 2WB7A 4P57A 5IW6A 1AE6L 3ABMB 3KPOA 2L0DA 4I13B 3II3A 4MQ7B 4UT9A 4HD5A 5KW9L 3IKCA 2JCCF 3U0WL 4O5LL 5FWQA 2BNQD 4L1HA 3WN5A 3TYFA 2OW6A 1JHLL 3TV3L 1WS7A 4F3FB 1E3ZA 4UINH 1ITBB 3FO9B 4AGPA 2D3NA 3IDJB 4FXKA 4PLNC 4PRHA 3PP4L 3SQRA 3WENA 3MJ7B 4FJ6A 5E1HB 3KDMA 4HCRA 4NBXB 3MUJA 4XPTH 3C6EA 4AV4A 4BFIA 1CUOA 1E8YA 1FHGA 2EDFA 5EIVA 4OLUL 4ZUTB 2G9HA 1HSBB 3VWJA 1AR2A 3S9DB 2ED7A 5D71H 5K39B 1TJIH 2DZEA 4XMKL 3UROR 3WEOA 5BXFB 3UG5A 1SYVA 3C6LC 1D5ZA 4CKVX 3OV6A 4DKFH 1LQBC 4Z7UA 3PPEA 3VA6A 1PZUB 1G84A 2E7HA 2VDOL 2CPUA 2OXHA 2CRYA 5LKNA 1TETH 2X42A 3GMOB 2CIKB 3RE0A 4KRPB 4FZ8L 2GW5A 2E9BA 4MS8D 3VQLA 4Z77B 4RFEA 3IN0A 2W80C 1YEFH 5FYKH 4N22A 1SY6H 5JIIA 4UQBA 3IJHB 1Z0MA 4OZFB 1GTNA 1K5NA 5I1GL 1RK1A 5E7BA 3RWJA 1LTXA 4HUCA 5I6OA 1G7JB 2OMBA 3DUSA 4X99B 2I24N 4J39A 2DLGA 2P24B 2CM6A 5BVPL 4OIIL 3T6VA 4G8IB 4MMYB 2KBGA 2ZXEB 1CTOA 5EO1B 5I66B 3NFPB 5C71A 1N7ML 1U41A 2ZCZA 1UT2A 3SOTA 3NA9L 2ZXQA 1X6NA 1DDHB 3EZJB 1J1OL 1VFAA 1QX1A 2JQMA 3NCCB 4KU1A 3U7YL 4PJ5D 4N0YL 1LO2H 3BH4A 1F4WH 1KCSL 4NXKA 4D9RD 4LIQL 3U1SL 2AMUA 3E8UL 3GTVA 1GOHA 1T4WA 3CHQA 3VH8G 5CLYA 3PL6D 1Q0YL 4WKXA 1KGUA 3IJ7A 1GIGH 2QKIB 3QDMA 3OKDB 4Y2OB 5KYWA 1S7SB 3JWNH 2VDQL 1XB3A 1XB6A 2ZUUA 3MLSL 5E23A 1ASQA 3STLB 3WUWA 1NGYA 1GYAA 1QBMH 1P4IH 3GBDA 2DM4A 3Q05A 2X53A 2DIEA 3HNSL 4S1QL 5DK0B 5E2WL 3V8OA 5BV7L 2WUBH 2BSRA 2AJ3A 4G6KL 4Y2DD 1QFUH 3DSFH 4G8FA 1OQXA 5GRZA 5KBMA 5IOPB 2B2XL 4G9FA 5F9JA 1R3KA 4OM0H 1VZGA 4HEPG 2D4FA 4U1SB 1NC2D 3WO3B 4KMLB 3LEVL 5CD5C 4PJ7E 4KK6C 1UXWB 2NY1C 4G71B 1WZKA 3UTTA 4HISA 4NZTH 3GTTA 1O6SB 1WJ3A 3ALXA 2K8QA 4J6RH 5ETUB 5ID1A 2PNDA 3H0TB 3A4EA 4B41A 4C4KO 3ULVH 3UBGA 4B9IA 4WHCA 2NR6A 4QO1B 1J7VR 5L9DL 1NAKL 3DLQR 4M7JL 1NBVH 1IFGA 4CKQA 1SEBB 2NSQA 4GNKB 4LEOB 3GHPA 1FO0H 2HA1A 3HI6H 3KBFA 1CIUA 2OQJB 1KIPB 5LQBL 4RMQA 4XTRD 5JMRA 1AC0A 1WPCA 1SXSA 5EZOL 4ZMVA 3DGGB 4U6VH 2QQKH 4I3RL 5C08B 3MXWL 4W9FC 3K1KC 4MKTA 1UXLA 1JNLH 1S3KL 3BVXA 2O61A 3ECBA 3DETC 5CFAA 5CEXA 3ARXA 5TH2B 3HC3L 1DJGA 2DAVA 2OP4L 4ATTA 1BEYH 5D70H 4KOCA 3LXUX 3PYCA 3LIZL 5DT1H 5B1KA 5KVDL 4HLEA 4EI0A 3E80A 1BGXL 3L4WA 4L9LC 5JPMB 4FQQA 1PZ5A 1UATA 4P5SA 2P8LA 4RGNE 3ULVF 4WUUE 3RWFA 3VXQA 4E68A 2Q2EB 2APVA 3V0AC 1G7PB 3ECWA 4OFYD 1DHKA 3W3BA 1U3NA 5CBEA 3BVNB 1UA6H 5ENWB 5L88H 2NYZA 2ZKYA 3QJQB 4Q9RH 2F1EA 1QSFE 5F88A 1UGNA 1EEQA 3HC0B 3V4PA 2GHZA 1LP9A 4UQ3B 2A77L 5DLML 3C09C 4WNQB 4XN5A 4XCCL 3GLDA 2EDLA 3VMOA 1IE4A 4JO1L 2PO6B 3ZIYA 1Q0XL 1SDDB 5F3FA 1RIHL 1T22A 5DVNA 4MWFA 4PHXA 3EDFA 1NEZB 2BSTB 2OJZL 4Y4FB 5LGYA 1FVDB 4AUYA 3HFML 2GTWB 1QRNA 4FQ2L 3PNWB 3FC8A 4NHUB 1DQVA 2QPDB 1AR1C 2XZAL 3T4AB 5EFIB 4I48B 3SDXF 1F18A 1L5GB 3OVUB 4JFPB 2M2DA 4E9SA 2F54A 1VJSA 1A6UL 1SLUA 4MAYC 2EIJB 2FZ3B 2FL5B 2HWZL 3RWCB 1ZSHA 4GRWH 2H26B 4A6YB 3B9AA 1FGVL 1UG9A 3MCLH 3K2UL 2JMRA 4S1DD 3D39A 4Z7VA 3ULUC 2LFEA 1KG0B 4NUJB 5IJKC 3FFCA 4YDLB 2YWZA 2X4UB 1KB9K 2VM3A 4JZJA 1TYJA 4UNIA 2E59A 3WFEL 2IANA 1DBMH 4AW4A 4EIZC 1N64H 2Q7YB 3A6OA 3GMMB 4NPYB 4FJYA 1HOEA 3DX8A 1NMCC 4N6RB 1OB1A 1WGVA 3EF7A 4OGYH 3VSQA 1E9OB 3RY6A 1BQKA 4GAGL 5IVNA 2X4TA 3GBML 5E03A 4EKXA 4FHBD 4ZMQA 4I9WD 5B7MA 3GO1H 4OZGE 4DTGH 4PWJA 3OLEA 5AVVB 1JRHH 5FOJA 4UV4L 1ZHLB 2VN7A 3QFJE 2YPLB 2YLKA 5CN1A 1IGJB 3QIWA 3VQ2C 1BM3L 4HGWB 1UD8A 3FFDA 3QNXB 3NCWA 4BRJA 1KWGA 1IRAY 2EKSB 3D8MA 3FF7A 2BIHA 2NXYC 4GRWF 2XZQL 1C1EH 3O0RL 2FHFA 4GQPH 4PS7A 4YPGA 1QFOA 2IBZY 3GMPA 1XGPA 4ZNEA 5IW3A 1KGCD 3FQ2A 3G9VA 2X10A 2E4TA 4KK8C 3X13A 4BDVB 4L3FA 5EUOF 2P5EB 1E4KA 1UUSA 3OM3B 2H9GA 4F33B 4LU5L 5G5DA 2JJSA 1MH5A 4LVHC 4MVBC 1JJUA 3X3FL 5A2LH 2XNAB 3KXFE 4M7ZC 4PJXB 3V7AE 1HYSC 3QWQB 3EHBD 4TSAL 4UOW0 4U0QB 3K74B 2V7NA 4I2XE 2PABA 4WSKA 2IV8A 4UUJB 4XVJH 5LVEA 5DMKA 4OCXH 4CGTA 1QR4A 4I0CC 4JG1L 4WFGD 2R27A 4XNMA 1KYDA 4OD2A 3ZHDA 4HWZB 2EUVA 4V1DD 1YDPA 2XTLA 4I0PC 3WELA 1TZHA 1FZOB 3PABA 1ECZA 2X3CA 3OR6B 5DD3H 3VSTA 5FKAB 5E2UH 3SGJC 5BQ7B 2D7MA 5IBTH 2VDNB 3AVEA 4JFFB 4HDIA 4K5NA 5CZXC 1CFVL 3DETD 2MCAA 4GH7B 3F00A 4ZOCA 5BS0D 3G5ZB 2EXSA 2B1HH 5INDB 2GUYA 4MCZA 3EOAA 1T1ZB 1MCOH 3MRIA 2JI1A 4ZMZA 3MNWA 2KQMA 2ZOLB 3JWDH 3UAJC 2HMID 5EN3A 2X6MA 1Q9KB 1MIEL 3OJDA 3S7GA 2BY1A 3D06A 5D7IA 4X2UA 2HUHA 2IH8A 2UZXA 1UB5B 3AM8C 3KLAA 1MLCA 3CZFB 3QJTB 3PDGA 5F7DB 5FYLE 3MOBL 1M7IA 1KSRA 1MIMH 1T4KB 4G7QB 1H3PH 1MFDL 3J27A 5SV4A 2Q8BL 2DH2A 5IQ7H 4K3GA 3DX7B 5E99H 1R1CA 5A40E 2OJEA 5HDBB 1AXSA 4PR5B 4N85A 3I3DA 3CN4A 3LNGA 4UQ9A 1ZPLA 1DR9A 4GI9A 5JDSB 3O6KL 1PBYA 4E0RB 2EDXA 2H4EA 2HN7A 3ARTA 4P5MB 2X2HA 3WFBL 3QYMA 2CR6A 3EFOA 4HAFA 3FU3A 2C8NA 2DMBA 2Z4TA 3GMLA 3NZUA 4OQTH 1E50A 4BWTA 1O7SA 1CD1A 4A2GA 5A3IC 1E43A 1BLNB 4FYSA 1W0VA 1ADQH 1I9IH 3F7LA 5FGCB 4DCQA 2EEDA 3JUZA 3LHPL 3WHXB 1WFIA 3LKNB 1L0PA 1ZXQA 3CVHH 3LQMA 5F1NB 3IGLA 4HZLB 4JY5L 1LEGB 1ZLVH 1WUZA 1JHTB 3SQOH 4WU5A 4Z7NE 1NANH 4U2YA 4RDQF 2R2CA 1Z9SB 4LLVB 4PJ5A 4ODWA 3ZDYF 5EO0B 1TVDA 4DZ8A 3GSNB 4GP8B 2C3HA 2PLTA 4Y16C 4B97A 3FOMA 1P7HL 1CS6A 2AQ3A 3EH3B 1M2VB 2YD4A 4XH2A 4GQ9L 2WIIB 4ZSOB 1KIRB 1QNZH 3EGXB 4Z3GA 1TEYA 3W38A 4DEPB 2EEXA 2UZYA 1AH1A 2X3AA 3BAJA 4P4RA 2BSED 1T20A 4XP4L 1QLFA 5FA3B 3C5SB 4TNVF 1ZVHA 5ANMB 4ZMPA 1E9PA 4HH9A 4K71B 2H6OA 2K7PA 4PJGA 4CDHA 3K80A 3GI8L 2G5RA 1W8OA 4CL7A 3GKWL 4X9BA 1HU8A 2FO4A 2WLZA 4E9TA 4N0CC 1DYZA 4YSOA 2O6CA 4TSBL 1RVFH 1ZGLP 4GRLB 3RY5A 4KVCL 4A7GA 3EYSL 1KLGB 3IDNA 4LESA 2VZOA 3V5KB 5TDOB 4XC1L 1PNCA 5JW4Q 5DJ2B 5I1EH 4G43A 5IJDC 5TGBB 1JCKA 4TQPA 1GJUA 1ZA6A 2CHXA 2XQBL 3MJ9H 3DRTA 3N1QC 2LW3A 4BSJA 4KKLC 4XN2A 1SXBA 3ZX1A 6PCYA 5JPNC 2BVQB 1DZBA 2JK5A 2WVUA 4TVPD 3WEBA 5CJ5A 2VDLL 2CRZA 1A7RH 4U1GB 4M6MH 1NQBA 3HUJF 4I1PA 2FEJA 3VD7A 2NOYA 3IJSB 4XBMA 5D55A 2EECA 4ELMF 3FT4A 3FRUA 4MDRA 1IILE 5E8NA 2YQBA 4FC3E 3SKJH 4P57B 1Q9WB 5IW6B 3KPOB 3IJ8A 1BQLH 5GJSL 3NSJA 2F53D 4HJJH 3SD2A 2UY7A 3IKCB 5TPWH 3HR5A 3WN5B 3WKYA 4W9EC 3TYFB 2X9XA 4JO5A 1JFQL 1F58L 4I85A 4R0LA 2YARA 3IT8D 3NJMA 5B8CC 4DQOL 3T6ZA 4OFYA 4HKZA 1IBZA 1QEWA 4PRHB 4AENA 1OOWA 3KDMB 3OKLA 4BFIB 3AXHA 1DTUA 2G9HB 5AW2B 3VWJB 1MLBA 3C6LA 3ZKMC 1KIQA 2DBJA 5HI5D 5CGYD 5C7XH 5E6ZA 1JPGA 4YDVB 2KZKA 4BZ1A 1SYVB 3D09A 1D5ZB 1IAOA 1XH0A 1QSZA 1JNHA 2JKJA 3F7VA 2JKTM 3DTUB 4EJ1C 1NIAA 2OXHB 1GSKA 2YIHA 3VDBA 5EU6E 1KEGH 2P49B 3LS5H 1F1GA 5M95B 4RFNB 4JFDE 1EAJA 5FYJE 3N85L 1IIKA 5GGRY 1MCLA 5T1MA 3WIHA 4LP8A 3W39A 4A7SA 4R26L 1K5NB 2WN2A 2JWYA 1RK1B 1H6UA 1WFTA 4B6ZA 1M4KA 3DUSB 4ZX5A 4WV1C 1I3UA 3EJUA 3OLDA 1EJOL 2BVTA 1MELA 2BNQE 4LSPH 4YBHA 3MACL 1ND0A 2LHAA 2BHFA 2LU4A 4FKEA 4LAJH 4R7XA 4FAAB 5LG1A 3DMMC 4DWHA 1MVYA 1VFAB 5MEND 3W0WD 4G5ZL 2FGZA 2V37A 1ZE3C 4QXTB 1BQ5A 3BVWA 1FLRL 3RUGF 3QDMB 4GUPA 4XI5C 3AB0C 3N55A 1CBVL 4KK5C 1L7TL 2A74C 4NOBA 1FN4A 3WDHA 4GRMA 3WUWB 4BINA 1NGYB 1A7QL 1EEUA 1RHHA 3WY3A 3UBXA 3UYRH 3FUMA 1SXZA 3L16A 3CMOL 3G9AB 4ODHH 3BGMA 1G6VK 1HQRA 3G5XA 3QWOA 5DO2C 2BSRB 2AJ3B 2Y2TA 3DVFA 1N6QH 1AI1H 2ZX8A 4G8FB 4NJ9L 5HHPA 2Z1KA 1J5OH 4G9FB 5F9JB 1KYOJ 1R3KB 3DPDA 1RFDL 1PGRB 4OZ4B 5HYEA 1FNHA 4ORGA 4A6YH 4J4PC 2BDNL 1E65A 2F1AA 2ZX7A 3QAZC 2B1OA 2JVUA 2EKJA 4NUGL 4NKMA 5FHBH 1HX0A 5ID1B 2PPCA 1MFBL 3CD4A 4JS7A 5DJ8A 1RH8A 1ZD6A 2WBJD 3G08A 3QISA 2IPUK 5BV7C 4OTXH 4KKLD 5LAPA 5KSUA 4Q9QH 3CPUA 4MD0A 3MC0A 4V1DA 4JE0A 5KSAD 4TMPA 4PS4L 3W1ZA 1T5WA 2C9VA 2QFRA 3G6DL 4ONFL 4TYUA 5DJXA 5BOJA 5E2TL 5HDLA 2A9CA 3N43B 1MFVA 4U7KA 2J55A 2A7BA 3NIDB 4LSSL 2VN5A 4Q56A 2KQNA 1C8QA 3CSYA 1DBJL 1IM3D 5CIPA 1CICD 1Y07A 2DLEA 2QPEB 4H44C 2O61B 2XG4A 4ZW6A 3ECBB 3H9SD 5CEXB 3MJWA 5E6UB 1AGCA 5C0DA 3RI5K 4L9LA 1L9NA 1DBKH 1SOXA 5KTEL 2DN7A 1F45A 3OXRA 4ANWA 1GGCL 3WO4B 1BXXA 3R1GH 1F3DH 3ASNB 4FQQB 2VZ3A 5DMIL 1PZ5B 2X5PA 3TFBA 1JV2A 3MTRA 3VFSA 4QF1A 3VGFA 3RWFB 3VXQB 3ZRSA 1KB5H 4HOMA 5JQ6L 1S9KC 3RVTD 3WEXA 1K6QH 3TT3L 4FLSA 3RA7L 3D25A 4HFUL 2B4CL 5CBEB 3PJNA 4RMBA 5C86A 2Z8WC 2NXZC 4LSQH 5I1IL 4LSTH 1ZLSL 5EZIH 2GJ6A 3D05A 5F88B 2Q8AH 1G94A 3E9UA 5KSBE 4BUHA 4XX1E 5B1BB 2WSDA 2XQYA 3V4PB 1LP9B 4PLKD 3MYJA 3JTTA 1DSFL 4NS0A 1TEGA 5EO9A 4JM2D 2MQGA 4MWFB 2R56L 3TH3T 1M7XA 1IARB 2ADFH 1QRNB 3DNKA 3ZGHA 3PHQA 4W9KC 4XNBA 4XCFL 3U2SA 1T1YA 2J5LC 3L08A 4MAYA 5CJBA 1N59A 2WWMD 3IDXH 4UB0L 5AVQB 2F54B 3KPSD 1JVLA 3L13A 4KRMB 1U8MA 1BJ1J 1CGSL 3LRMA 2X05A 1OEZW 1X5HA 2Y7QB 3WNNA 1G1KA 4GT7A 5IJKA 3MKGA 3D39B 4Z7VB 2I25N 1T1XA 1RULH 4XPGL 1DLFL 3FFCB 4JFXA 5GGRA 2IEPA 3FO0L 2O6FA 4JZJB 2VQ1A 5T5FA 2IANB 3HE6C 3MRBA 1II4E 1XX9C 3DX8B 3TA3D 3VFVA 1OB1B 1PW3A 1MFNA 1NLDH 4G3YL 4XWGL 1GAFH 1P1VA 3OSKA 4N8CH 3QPQD 2X4TB 3DHJA 5AZ2L 2GYSA 3H8NA 2BIIA 3KD4A 1IUZA 4Q52A 2J44A 3H9YA 4XP6L 2VMEA 1KTDB 4PVBA 4E5XG 1ET5A 3FFDB 5KVEE 2XG5A 1JBJA 2HH0L 5A43C 3L4VA 3TYGH 2H2PD 1ERNA 1PZ2A 1I7ZA 3M88A 3FQUB 2B08A 4ODBD 4YPGB 3S35X 4WGWB 3KJ4C 3TXAA 2HLFC 1BVKA 1XGPB 1A14H 3OWEA 4L2LA 4UIKL 5J3HD 4OZIA 4H8HA 5F97E 2Q3ZA 1RZJL 3KHOA 3X13B 3ZHLA 2OCJA 1IAIH 2H9GB 3QEQB 2D03H 2PYED 4ONGL 5G5DB 5D1QC 1MH5B 3GSNH 2VDKB 2Z8VC 4X4MA 2BW5A 1IBGH 3QA3A 4G8GA 2VKXA 3FRPA 3MTXA 2RQ8A 4YHMH 2PW2A 2V9UA 2FGWH 2V7NB 4ZO6A 2NY5L 3VI4A 3V10A 4OCRH 3HS0C 1A7PL 4KFMA 3M17A 4I0PA 5I0DA 2DQFA 1XCWA 3RY4A 4XNMB 2J1WA 3K6FA 4OD2B 5E6SB 5D93C 3GXMA 2E74C 3VXSD 1YDPB 4FFYL 1KACB 4PJ7F 3RVXC 3SGJA 1TZHB 5FO7A 1K4DA 3PABB 1NBZA 1BFVH 1XEDA 3LNHA 3V4VH 1ESOA 3ZQWA 2F53A 3SN6N 4HDIB 1UZGA 4YFLI 5L4IA 4I9WE 1ADWA 3PNRB 4P48A 4BFJA 3L81A 3LEYH 2BVPA 2ENYA 3UH8A 4WZ9A 1FIEA 3EOAB 4R4FL 3UAJA 2P4AB 3MNWB 2QVTA 2F08A 3A6CL 2WJ5A 4MAUL 3AM8A 2HT4D 3DX0A 4BFBD 3OJDB 3CZKA 1HINL 2XIIA 1CDIA 1ZSDA 5D7IB 3UEQA 1BJMA 1CE1L 1KGCE 2BO0A 2UZXB 3IGUA 3KLAB 1MLCB 3E2HB 3ATDA 4EE2A 1M7IB 3LZFL 3OQ3B 5DDHA 3MJ8A 4IGBC 1OAYL 5AVWB 2OJEB 3TT1L 3P0YL 3B3BA 3S3SA 5DYOA 4LE8A 2X1QA 4YGVA 3MGTA 2DLFL 4KJPC 1EFXA 2HN7B 1S7QA 1LQSR 3PWPD 4PJBE 3TX4A 1D6VL 4ELDA 4OCNC 1CT8A 3W2DL 4YHYC 1JS4A 2AQ2A 2E75C 4KTYA 3EFOB 1YY8A 3QORC 4P99A 1T7YA 4WFGE 3GMLB 1OTUC 5FEBA 2DKSA 5F7NC 1KBKA 4JJ5A 1XTMA 1CD1B 1TIUA 3L17A 3PWUA 3HBGA 4OQ1A 2WIMA 4UI2A 2CK0L 3D3VA 4FQLL 4OZFG 4ADGA 4AEEA 2H0PA 3TCTA 4DCQB 2LAAA 4KI1A 4XMPH 1OSEA 4HUMB 1RUAH 2YKLL 4Y9GA 4AUUA 2VM9A 3QDJD 4WU5B 1SEQH 3LRHA 4QJ5B 1J12A 4YC2C 3TN0C 1LGVA 1OPGH 4Y16A 4URTB 3D9AH 3O41A 4ODWB 4MQXD 2HYMA 1B90A 3CDGA 4X9YA 3W0WA 4IRZH 4DZ8B 2G60H 4YDJA 3NPSC 1TJXA 1B2WH 4E9YA 4PQXA 4YSTA 5J12C 2CHNA 4G70B 5CS7A 4LVNC 5DFVD 4XH2B 5AW5B 3NJJA 3R4RA 1CTNA 4TLTA 2LGNA 2D7PA 1E4XH 2UZYB 4P4RB 1T20B 1UT9A 1SLVA 3HC4L 1A3LH 1QLFB 1OM3L 4Y88A 1JPTL 3X12A 4AQZA 1CLYL 4PJAA 1X9RA 1E9PB 4HH9B 4ZFGL 4PJGB 4NIYE 3UPCA 1K4CA 2X6UA 4QXUH 3TL5A 4OF3A 1FNSH 2FO4B 2WO2B 3DV6A 4Q0XL 4Z8FH 2CXKA 1IQDA 3GD1C 3VFGL 2GJJA 1MEXH 1DVFC 2R1XB 3AMLA 1SJHA 3IDNB 4K7PH 1EUTA 3AG2B 5GRVL 2K4WA 4EDWH 1OOAA 2VWEC 2ZUVA 1Z7JA 2W0KA 3V0WH 4NM8L 4OZGF 2DWYA 4G43B 1UWYA 2IAMC 1J9RA 3PQYE 3QIBC 2R69H 5JOPD 3LMJL 3ZO0A 5DURB 3FN0L 4FQXC 1ZA6B 5C0NC 3DRTB 2C4FU 2W9EL 5JPNA 1XGYL 1UADC 3S37L 2FYVA 4JRXD 4KC3B 2X0VA 5DHVA 2JK5B 1UTDA 1J5CA 3LXCA 3EDEA 2V9RA 4TTGA 5DS2A 5IW1A 2W9LA 4QYAA 1WIPA 2PETA 3B4NA 1IGIL 1IM3A 1D2OA 3I9IA 2MMXA 4Q9CA 4AEHL 4KKAC 4YHKH 1OSYA 1TITA 2HT2D 3ECUA 4HUWA 5BW7C 3FT4B 1K9TA 4ANKA 5C8JA 3AITA 1W72A 5BRZA 3UAFA 5E8NB 4LARL 2XACC 2WXLA 1DBBH 2ITFA 1H9DA 2AABH 1G6RA 4OKVA 4ZS7H 2VXSH 2UY7B 1U95A 1BP3B 2O6DA 3MV8D 5FYLH 2BVYA 3HR5B 5TE6L 1ZOXA 2WP3T 4LCWD 2XN0A 5B8CA 4PV9A 1N0XH 4DGYL 2HZHA 5FHAL 5IUSA 5FYJU 5T1KA 4F9PC 3SDYH 1J8SA 4HKZB 1QEWB 5J6HA 2F8OA 4L23A 1MFEL 4AENB 3GFUA 1QI4A 4PWEA 3OKLB 4TUOA 2EDJA 4QRSA 3LRSA 1MLBB 4NUPA 4PPTA 4BHUA 1YEEL 3C6LB 4L5FE 1KIQB 4HU2A 4J12A 5TE7L 3GPEA 4DFIA 2EC9T 2Y7SA 3CFEA 4N0UA 3V0FA 1JPGB 4M62H 4C4UA 2F7PA 1IAOB 3F7VB 3SE9H 2Y5EA 1RUQL 1DLHA 1KDIA 1V54B 2Z31C 3ZDWA 4KPHH 3BKML 4P9ML 4TVPE 3H4FA 1NEZG 4BCZA 5JHBA 2AK4D 1VF5C 4N2EA 5K9JH 2QELA 2ZOOA 1L0QA 4IIZA 4F7MB 5T1MB 1AS8A 3W39B 2YAPA 3ARFD 2WVSA 4WV1A 3L1OL 5E56A 1NOAA 3V6OE 1E6OL 5J06A 2CUHA 2XY2A 3L48A 3TURA 1G87A 3UC0H 4ICXA 3UYPA 4GXVH 3O9WD 4L4VA 5BUPA 3Q2VA 2RFXA 3DMMA 5DC2A 4C55A 1A6ZA 4UQEA 1HWHB 2XN2A 1MWAL 1ND0B 5DS8A 5DVMA 3WTVA 3FU6A 4Q89A 2V5SA 4X6DA 3SYQA 2J25A 4FQ1H 3T9WA 1OAZL 2WNWA 4M6OL 2FIRT 3L4XA 5JA8B 3FBKA 2QBWA 3HG1A 3MQIA 1MNUL 1GOFA 4GMTL 4PB0L 1D5XA 2PP8A 4GUPB 3IDUA 2WQRA 2R4RH 4KQ3H 2EDBA 3O2DH 1FN4B 1VIWA 5KZCD 4GRMB 3T3PE 2G9KA 4Z7NF 1RHHB 5E08H 3NACL 3FN3A 3WDIA 1I8UA 4DQAA 4H1LA 3VMNA 3LPPA 4BA8A 4DGIL 1TQTA 3ESUF 3BGMB 1HQRB 3G5XB 3T2NH 3QWOB 1IC0A 2DM3A 4JHUA 3R4DA 4K94H 5HHPB 1MRFL 2FIKA 1XD1A 4J4PA 4IBYA 1XFPA 3KEDA 4TL4A 5GISH 5LGJA 2NY1B 3KL3A 3IRPX 2IMMA 3KPPB 5LNDA 4M7LH 4QHUA 1SMAA 4ORGB 4X9GA 5GS0H 2NZ9D 5J6GA 5IHUL 5DO8A 3NH7L 1BYPA 5HHOD 1V27A 3EBAA 3KCWA 5C97A 4NKMB 5E5RB 1MJUL 1TCRA 3ZE0F 3SYOA 1FPTL 2BNRA 4TSCH 5DJ8B 3G08B 3V52H 3IXTB 4W9DC 4WI9A 5KSUB 1SXNA 1RP9A 1KXTA 2Z0UA 4MD0B 3T08A 1IU1A 1LDPH 4HD9A 4V1DB 1T5WB 5DJXB 1IC4H 4BYHA 1EGJA 4YVNA 5C3LD 4DETA 5IFAH 4WEMB 1FL3A 1T2QH 4RQQA 2D3JA 4XNUL 3CSYB 1S9XA 4L4TD 2AV1A 5CIPB 4Y4KC 3WLBA 2VW6A 2PWGA 2XG4B 3II1A 5I1LA 4U1JA 1U8IA 3T0WA 2G4EA 3X2QB 3HPLA 1AGCB 4YHLH 4PRPA 3LKSB 4ETQA 2FLBT 4L9LB 3ZTNH 5I23A 2R29H 4NJAL 4QWWC 2ZUSA 1IB5A 5KYUA 2BSSA 4M4PA 4LF3A 1KC5L 3OXRB 2NX5D 4ALAC 3MFGB 4X5WA 4M7KL 3T6XA 1P7BA 5FM4A 3VFSB 1JV2B 3U4BL 5J1TC 4QF1B 4J5VA 6PAZA 1R0AH 2FQGA 3WEXB 2VLRD 1WHPA 1NL0H 2Z34A 3D25B 2VH5L 4GKNA 2VUYA 1EHLH 2EXYD 3WFDH 4E9VA 3LIZA 1QLEL 5T3ZD 3GRGA 2GJ6B 2NZIA 3LZOA 1A64A 1WWCA 3C09B 4WVRA 5FYJH 5BO1H 4WJKB 4IU3A 4RWYL 5JXAH 2B16A 2DQEL 4YDKH 5DVLA 4KZEL 3MYJB 3JTTB 4NQEA 2H1PL 3EDKA 3GI9L 5EO9B 3ARRA 4MYWB 1PCSA 5CLXA 5ILTL 5BUGA 2WMPA 1A6TA 3V8CA 1AR1B 1NC4A 5DQ9A 4IU2A 1AAJA 2J7LA 3N42B 1J5IA 2I27N 1RLWA 3PHQB 3DYMA 4OLVH 3U2SB 4JQIH 1T1YB 5J0BA 1V3KA 4MAYB 4X5XB 1N59B 4EOWH 3GXPA 4GKSA 3QDJA 3T0DA 1U8MB 1CFTA 3NTCH 1UVQA 4K3DH 2F19H 3NCYP 1YEHL 4CADA 3HKZA 1YNKH 4EI5C 4CGUB 1SJEA 1SUHA 3VM7A 1T1XB 3JVFC 5EWIL 3HE6A 3MRRA 2AZUA 4JFXB 5GGRB 3SGEH 3V0EA 4Q2ZA 4QKXB 1MXDA 2VMFA 1BX2A 2VQ1B 1NMCB 4FA6A 1WZMA 1F90L 3MRBB 1YEJL 1XR9A 2VLJD 4M6NL 3NN8B 3WFCL 2JKNA 3VFVB 2FSEA 1S7RA 5ABDE 3HKFA 2DD8H 5SWSD 4RNRA 3V5HA 3AZUA 5B22A 3WNLA 2OYMA 4ICWA 4OFPA 5IHBA 5LN4A 2XX1A 5I18L 2I9TA 3FAXA 4LKCA 4NDMA 3AADB 5DA4A 2NXYB 3S5LA 1QFWI 5DMGD 5I17A 4P3CH 2XG5B 4YS4A 1ZXKA 1NBCA 1Q94A 5KVGL 3SD5A 1I7ZB 1KBGH 1Z0NA 1XQ4A 3TWCL 4AQ1C 4YSQA 4F8NA 1DANU 1VEMA 2P52A 2YPLE 3H2WA 4OZIB 1BZOA 1HQ4A 5D1QA 4LVHB 2ALAA 2Q7NA 3FT2A 4K2UH 2V5YA 5B4MC 2VDRL 3KPSE 4C58B 4M7ZB 4NSKA 3KLHD 3QXUA 4JKPL 2YXMA 4OCLC 2AGJH 2X2JA 4KTEL 3IDMA 3QXVA 4XVSL 4HXAL 3QA3B 1YNLL 5IG7A 4G8GB 2BFVL 4MMXC 3FRPB 5IK3A 4FYRA 2DYRB 2P5EE 2PW2B 5TFSL 4X98A 2V0AA 1QSED 5I76A 1R3IH 3VI4B 3HPJA 5TF1L 3VTAA 4IBVA 3IEAA 3U4EA 4I0PB 1SVZA 2DQFB 3S35L 4F8QA 1RZJC 5C6TL 2C1PA 1CGTA 1HKLL 3BZ5A 4BWUA 5ABZA 3NJKA 1EO8H 2XFGB 1K4DB 5I16A 4I0KA 4YHZH 3GJEB 1UM4H 1UH3A 3L9RA 5CGTA 3CN2A 4RMVA 4Y4KD 1OTSC 1L4IA 2AF2A 2BJML 3KVPA 2F53B 4OM1H 4PWHA 3U46A 4M43L 2BCKA 4G59C 4JZNA 4NZFA 5DJZA 1B4RA 5L4FA 5FUCE 5DUPH 4M48H 1XCXA 2TSBA 2BVPB 2NY5C 2C9AA 3CNKA 4QMEA 3RX7A 2ZYSA 2V3EA 3IMWA 4UINL 4ZMTA 2BZDA 1R24A 2X3BA 2JJTA 2N0MA 4PJEA 5DEJA 4IKJA 5IFHH 3QRBA 5EC1A 2ZUTA 4B53A 4H88H 1AQDA 1GPOL 4NB7A 3TLRA 1JWUA 5FGSA 1NM4A 2CZNA 1ZSDB 3K8KA 2W07A 4N5ED 4XPTL 4Y4HC 4IGBA 2LLGA 1CG9B 1QBAA 4Z3FA 5I0ZA 3RBSA 4P3WA 4ADJA 1VB9A 5D71L 1OE3A 1TJIL 5DDHB 3MJ8B 1X5FA 1B3JA 2CCVA 2YD5A 3CSPA 5K69A 2JKIS 3BDXA 1JVKA 3BI9X 2YSSA 2BY3A 3QJUB 4PJDE 1AO7D 1RXLA 2B5IC 4YGVB 5DYOB 3MGTB 1EO7A 1TETL 3QORA 2FX8L 1EFXB 3MUY1 1S7QB 2AK4A 1CT8B 2X2IA 1YY8B 2B8OT 2X1XR 1YEFL 5HDBE 4P5TD 5ICUA 4IRSC 1SY6L 1CMOA 3VXSE 1GVIA 2BIQA 2CBMA 4JJ5B 3PWUB 4N2MA 4PFEA 2JLPA 3LB6C 4K8RC 4PY7A 3S96A 2YA1A 4JFVA 2WXQA 3UC2A 1UC6A 3D3VB 4QDGA 3US9A 4G8EA 4ERSL 4CC0A 3FT0A 1KN2L 3FMGH 3TN0A 2QGEA 2WN3A 3Q8CA 5AYUH 3PV7A 2WY3B 2J21A 3Q7JA 1HL9A 4MA8H 4AYFA 1VADA 4HEMA 3GZQA 1UWEL 2C9RA 2ALWA 3ARBC 5TDPA 1JPSL 3L2MA 4KFZC 4Y16B 1G9MC 5HSFA 5FGCE 5FX3A 3CDGB 4JRYA 4XODA 5IB4A 1LO2L 1F4WL 4YDJB 4ZQKA 5KBPA 1HS6A 3GK8H 2F9BT 1G4RA 4XAKD 4QOKD 3MV9A 5DLLA 4ZK8A 5JA9A 2E27H 2L4OA 2ZUYA 3B1UA 5CEZL 4W9GC 1GIGL 2VC2H 3OKOA 2R4SH 1IV8A 3QUYC 2PR4H 5IY5B 4N4YB 4BZ1H 1PJ9A 3GUTA 5KVEH 3GINA 3TPUA 1QBML 1AD0A 1P4IL 4M5ZH 4LQFH 1DO6A 2X1PA 3WUWG 1MW3A 2Z91A 1BMGA 4WWKC 3F3HA 1YNTA 1PJWA 1A6AA 4PJAB 2IGTA 3BJ91 2WUBL 2J6EH 3PWPE 1KZQA 2E9JA 1K4CB 3CFQA 1LDSA 3DSFL 3UTQA 3O45A 1DVFA 4OM0L 3DV6B 2HKFL 1OAKH 3U30C 1IQDB 3MSPA 1LE9A 1OP5H 5FFGA 1AKPA 1SJHB 2L8AA 1GA2A 3D85A 2IAMA 4ZMXA 3CZGA 3EYQD 3QIBA 4XNQB 1EJ8A 2IG2L 1IGTA 2WZ0A 4FQXA 3ULVL 3VWKD 3NJVA 2BZCA 5ADPL 5DC9B 1PY9A 4FMVA 1NBVL 5G4OA 5JPNB 3K8MA 3UDWC 3K71A 2CNYA 3HI6L 2FYYB 4F57L 2R8SL 5DHVB 5C6PB 3M1CA 4N2AA 4NT6A 4Z23A 3J7HA 4H0IA 5IW1B 1TOXA 3KL5A 3L3HA 4MB1A 4ZMLA 1EANA 5BW7A 4U6VL 2H2SD 4L4TA 3I9PA 1FH2A 2JXMA 4Z7OB 4TVSa 2JJVA 2DIBA 1JNLL 3NOIA 1MXGA 3OX8A 4HUWB 4R4BA 5C8JB 1D5MA 3D6GA 3F85A 4MHHG 2Y06L 4DP2X 1W72B 5BRZB 1BAWA 1CE6A 4Q6YA 1BEYL 1XHHA 2ADJA 5D70L 2RHEA 5FOBA 2XTSA 5JOEA 4WK0B 4CILA 1G6RB 5DT1L 4OKVB 4BQ9A 4GG6A 1DO5A 3ES6A 4F9LC 1U95B 2UXFA 3AJ7A 2XWTA 3L2NA 4F9PA 1A9BA 1JERA 4PV9B 4UTBL 1PAMA 5I26A 5B8CB 5I0YA 2WNKA 3CC5A 4FG0A 5T1KB 1F8TH 2R1WA 2YD7A 5IT2H 1T6BX 1FRGH 2WKOF 4FFTA 1GGTA 3DI2B 2LTQC 2VABA 3PAUA 5FR3A 5J6HB 2OLDA 4NO5B 1UA6L 3O4OC 4TUOB 3CX5K 3KNBA 1FFOA 4QRSB 5B3JE 2Y36L 3Q2CA 4O9HH 2AANA 3LRSB 2QLYA 2VDPL 5J11C 1S6NA 4LFHD 4X7TA 4GT0A 5JOPE 4KDTC 3CFEB 4N0UB 3GZKA 1HVXA 2Z31A 4NP4H 4G42A 3RPIA 1A9VA 1SM3H 5FM5O 1DLHB 4JRXE 5HDWA 2XC8A 5INCA 2XRAH 2NLJA 3QW9A 1AGBA 2GIXA 5HXMA 1N70A 1UZ6E 2O6PA 3VG0H 2YD0A 3FOLA 5IR1A 3WNOA 4UV7H 4YBQD 2ESVD 3KDPB 4N2OA 1HSAA 3S0PA 1L9RA 3F7QA 1F2XK 4GO9A 3PU7A 2GI0A 3LH9A 4WV1B 2ENJA 3ZTJG 3SO5A 4XHJC 1UCBH 2R83A 2VDOB 3KYKL 4U6XA 2NYKA 3DUUA 5MEPA 1CTMA 1MCQA 1NCCH 5BZWA 3RWHA 4L4VB 3UYPB 2VLKB 2RFXB 1WD8A 3DMMB 3ARBD 3MV8E 1A6ZB 1PNDA 4PJBF 3WFHA 3WMPA 4LCWE 1OLZA 3QR0A 5DQDH 4XNAA 5HYFA 4X6DB 2BXYA 3N2JA 5F8QC 3KVQA 1DBML 4PJ8C 1N64L 2IPTH 1KCRL 3TZVC 3AB0B 3HG1B 3TTSA 3NP4A 2PYFA 4DN3H 2K70A 1KTLA 1MQKH 5IQ9A 3BD4A 4YXHH 3GMRA 3RFRA 3QXDA 4JKNA 3WGUB 3QUXD 4DTGL 4F7PA 4JDVB 1JRHL 3FQTA 5IMLA 2J1ZA 2ZOUA 4WWID 1RIUH 3TNNA 4HJEA 4KZ0A 2WYZA 5DTFA 4UWQB 1HZHL 5AVRB 1V55B 1R47A 4H1LB 3P73A 4HS6A 4KROC 3HC2A 1ED3A 5DFAA 4WO4D 1ZLWK 5I0XA 1C1EL 3RZCD 3RWGA 2YQ2A 4FF9A 2IDTA 2FIKB 5FO9A 2VDQB 2XFXA 1TO5A 1U8QA 3U6XS 2JB5H 5LGJB 3SJVD 2FNBA 4OV5B 3QAZB 4QHUB 1BFSA 1H3VA 2BW4A 4QRPA 3RWDA 3VFTA 4PJ9D 4BQ6A 1QA9A 3PWJA 3PUUA 1FL5A 1Z9OA 4G9FE 4XNYL 5BV7B 1TCRB 4NXSA 1ID2A 3SODB 1DP0A 2BNRB 3ELAT 3E8VA 1TZGL 3U0PA 1WBXA 4DO5A 4XVJL 3ZOAA 1KXTB 4OCXL 3K2MC 3JV5A 3B7TA 3WKQA 3ZK0A 1V3JA 1D9KC 3LZQA 1JGLH 1AOZA 3EIFA 5JHDA 1J9SA 5EC2A 1KBVA 2IGFL 1P84J 4ZX3A 2BC4B 3DO4A 3GSRA 2V2XB 1JDDA 1ROCA 1KB3A 3GB7B 4Y4KA 1FL3B 1G7HA 1URZA 5E2UL 5IBTL 1G5GA 1S9XB 3SE8L 4XWOC 1RSYA 2AV1B 3WLBB 2R0LH 5I1LB 1JYNA 4U1JB 1U8IB 2YGPA 1JN6A 3HPLB 4PRPB 1MCOL 5ID0B 4XOAA 4ORZC 4G1MA 5KYUB 2BSSB 4LF3B 4JG0H 2X6AA 4X5PA 8FABA 4X5WB 4LBAA 1I4FA 1WIUA 2RH0A 5HI3D 3ZRCC 2YPVH 2FJSA 2ZNXA 2ZKMX 3EJZD 4WSGA 2EYSA 3X17A 1MIML 2NXZB 1H3PL 5HYJD 2ENSA 4R90H 4N0FA 5IQ7L 4YNYA 4GKNB 4P23D 5HHOE 1G0DA 4TVPH 3M8OL 5EOQL 5AVXB 1C7TA 3OLGA 1OTTD 1ZCRA 2BNUA 4IU3B 5DZ9A 1JZHA 1NMAH 4X7DC 1M3JA 3FQWA 3NZ8A 1F3DJ 4NQEB 5CP7A 5SX4I 3MMEA 4YL9A 5SX5K 5I9QC 4W9IC 2DOCA 5AKTA 2WMPB 4W9ZA 1A6TB 4KWUA 1NC4B 2NZ1A 3Q01A 1PEZA 4IU2B 5DQ9B 2J5LB 25C8H 2EDYA 3NBNA 3TO4C 2K78A 4MD4A 4FP8H 4GKSB 5IVOA 1G7QA 3GMQA 4NPKA 4X7FC 1BQUA 3U9WA 1HILA 1WBZA 1CFTB 3F8UB 3TIDA 4EI5A 1UVQB 5CCJA 2YFOA 4XAWH 4P2RD 1V3LA 4CADB 1J05A 3GJFK 1SJEB 3WMQA 2NX5E 3NUKA 4ODUA 4XZ4A 3NZHH 4KI5C 4IBLT 3HE6B 3MRRB 5F89A 3ZZ1A 4Q2ZB 3ILQD 5A2AA 1FLTX 3VB9A 2B7DT 4EF3A 5I6MA 3TZVD 1FIGL 3ALWA 4YDZA 3SQBA 2VLRE 1XR9B 1QNZL 1SJMA 2BHZA 1FYTA 3OAWA 5JLZA 2FSEB 1S7RB 3WUZA 4KITB 4N26A 3FFCE 1P7QD 4CJ1A 5FS5A 2QT6A 4RNRB 3S4SA 3LKRA 3V5HB 4EO5A 3MLYH 3OB0H 5LO7A 2EVIA 5I71C 2D2OA 4HLZH 2NSMA 1ZANH 4PSRA 4F1ZA 2I9TB 4B7IA 2C9XA 2NYYC 4LKCB 5C0AB 4NDMB 3S5LB 3QO1A 2QZQA 3N1PC 3KYNA 5I17B 3MBXH 3TV8A 4AQ1A 3KJ4B 1RVFL 2P5WD 3ROOA 1Q94B 2WYTA 3STZA 5EOCH 3VXRA 3RB5A 2QEJA 4OJAA 1OGAD 5AW9B 4FXTA 1GGYA 3B9EA 3O3DA 4QRBA 3UOAB 2D7OA 1HQ4B 5D1QB 5I1EL 2LLNA 3KH4A 3T3PF 1MCNA 1Z2KA 1B88A 3CQQA 3MUGA 2H3NA 3FUJA 4NSKB 4PCYA 4X7CC 3MJ9L 4MMXA 4ZTOH 4ADIA 4MNQD 4UOQA 3HRPA 4BFNA 1P4BL 4NKQB 4DKEL 4L1TA 2E6PA 2FJHB 4AMXA 3ETTA 3HS0B 3PIQA 1J48A 3SGKC 5IK3B 1LXMA 5CJ8A 1K2DB 4X98B 1FAIH 4WEEA 3QEQE 1U3HD 1HHGB 1PMYA 5D93B 3HPJB 2ATKA 4JY4A 3U4EB 3T2QA 1A7RL 3ARGD 4M6ML 4M5SA 4GI6A 1KXVC 2VIRA 3D30A 5DMYA 2VLJE 4WHYG 2C1PB 4L3EA 3ABGA 1MCPL 3CDFA 3KCPA 3VFOA 5I16B 3BWZA 3O6FD 2PW1A 3SKJL 3V0IA 1BQLL 3HVNA 3U46B 1DJSA 4Z95H 1OHQA 5F96H 3FJTA 4R4ND 2FD6H 2BCKB 2JFCA 4HJJL 1SUJA 4JZNB 5DJZB 5GSVA 5TPWL 2DQIH 4HU8A 1TENA 4L3AA 2VSKB 4XMLL 4FNLH 3BRFA 4FFYA 1R24B 1PX4A 4PJEB 1UQSA 5EC1B 3PV6A 1TJHH 1I8MA 1AQDB 4Y4HA 2EICA 3FU7A 1JWUB 1PKQB 3WLWD 2J2ZA 4AQAA 2GC7C 2W07B 2E7CA 4IGBB 3FSVA 3ESMA 2G0LA 1B0RA 1RV6X 3BN9C 2F61A 1N12A 4Z7QE 1AD9A 4IQHA 2YSSB 4PJCA 3TEUA 1A3RH 1QATA 2E7LA 3P2BA 2NDGA 4U7SA 3OAZK 3DVNA 1RERA 4YHYB 4LLDA 2I9LA 1T5XA 3CHSA 3QORB 3DX2A 4CVZA 1QSEE 5CR1A 1EDHA 3FTZA 1KEGL 2AK4B 3LQAH 3LS5L 4IRSA 3H42L 4F2EA 5JO5A 1QR1A 1IFHH 3WY1A 5T1DH 1Y7VA 3HJEA 3TVMC 2E4FA 4FG6D 4GSDH 3QCTL 2JKWA 1P5VA 4LMQI 3S96B 2YBGA 3KLKA 1GH7A 2ZAGA 1IT9L 1IAIM 3GRWH 4Y19D 3CLEH 5CINH 3UL4A 4F8TA 3U9PH 4NGHH 2KKQA 3QJFB 4G8EB 2FATH 4MNHA 2R0KL 3T2OA 4YC2B 2BP0A 3TN0B 4E9WA 3ARBA 1E2ZA 3QCUL 3TA4D 1E5BA 4WFFE 5EZJA 2CK2A 4LSPL 2Z0BA 3FB5A 1TZ8A 1VADB 4AYFB 5IVXA 3RVUC 5TDPB 3NPSB 4TUJA 3RLSA 1MNNA 3I6SA 4FFZL 5HDOA 4HUVA 4JRYB 5IB4B 5EIIA 5J12B 4ZQKB 4LVNB 3LRLA 5H37H 3QUYA 4JO4H 3MV9B 2JELH 3PE9A 5EBMA 3HN5A 2H0EA 3S97C 5K1VA 1KJ2H 3MLXH 3AS0A 1CF1A 2X38A 4KTDH 2CPCA 3TPUB 1XT5A 2MNWA 1AD0B 2YOCA 1WCQA 2VE6A 4ZW3A 3UYRL 3EJPA 3QPXH 1SF3A 2X7LA 2Z91B 4QRRD 2FSDA 1BMWA 1YNTB 3HW7A 4M3HA 3O4LD 1AO7E 1A6AB 4PN6A 4F7CA 4ODHL 3ULSB 1BOYA 4NHCH 2B20A 2YXFA 1AI1L 3UTQB 2GJPA 1EEYA 3O45B 3UAAA 1DVFB 3W11D 1CXKA 1QACA 4N8UA 5E9DA 3TBWA 4C83A 1LE9B 3JWNC 4NC2B 4A6YL 1M05A 4PJGE 2Q20A 3NSXA 1RSFA 3ZIMA 3D85B 5CAYB 2IAMB 1HNGA 1KJ3H 2LU3A 2FBOJ 3QIBB 5FHBL 2V8LA 3BYTA 1IGTB 3Q44A 1ML0A 1V5JA 4FQXB 2OSYA 1GRWA 1U3ZA 3UDWA 1BZ7A 1DJXA 4NQCA 1CB4A 2AEPH 4QAMB 4CU7A 3GRBA 3AROA 4OTXL 3ZYOA 4Q9QL 3CGTA 1RAMA 1BYNA 4JM2F 3K71B 2XI9A 1RUPH 1XAUA 3T77A 1OIOA 2YRLA 3X3GH 4TM9A 2G0KA 4JPQA 4NT6B 1NTDA 4A67A 3P11H 1NBQA 3L4CA 4XAKE 4KXBA 4QOKE 4HF5L 3K6OA 3L3HB 4AH2A 2GG1A 2KDGA 3AS3A 3MV01 3WXVH 2JXMB 1Q8MA 4DGVH 4Y1AA 2FAUA 3ULVC 1BPLB 4MRCA 3IMRA 2CNZA 4R4BB 3CSBA 3CLFH 1P9MC 1D5MB 2YA2A 1AFVH 4WEUD 3JV6A 1CE6B 5FOBB 3BAWA 2ADJB 4PGCA 3WN6A 2ENQA 1DBKL 3G6AB 1Z32X 1PZCA 4ZMYA 3ES6B 4GG6B 5L0QC 3RKDC 5JDJA 4U1LB 2XWTB 2Q0ZX 1CLZL 1XGTB 1A9BB 5I74C 5MERA 1I3GH 5IROD 1RJLA 1QYGL 3CC5B 5A7EA 3X14A 1KB5L 2R1WB 1AZNA 2YRBA 1K6QL 3SEPA 3A22A 2NNRA 1DQIA 4XR8C 3VRIA 1MFCH 2VABB 5E4AA 4WRLA 2GFBA 4FI8A 1KZYA 1FFOB 4LSQL 3KM1A 1A47A 5IJBC 5EZIL 4YUEH 1S4IA 1QASA 2WLMA 3DWTA 4WU7A 4X7TB 2Q8AL 5IB2A 4QNPE 4P46D 4KJWD 2YZ8A 2HXAA 1DBAH 2CBOA 1IGCL 4UTAA 2XQYG 2Z31B 4PRID 2W65A 3NDYE 5GJTH 1EGJH 4G42B 3RPIB 4PWGA 3KPRD 5INCB 1IEBA 3UABA 3IETB 3HLKA 4G80A 5KOMC 2ADFL 3GBLA 1AGBB 4JFZL 5C0CD 3FQ1A 4IBQA 2XIBA 2CIIA 1TO4A 1KYFA 2DYPD 3FOLB 4HPOH 5IR1B 3VB8A 1E5YA 1JF6A 1HSAB 3MI6A 3IDXL 3LD8C 1BVLA 4PREA 2XYBA 4EUPH 5ISZD 5DD1H 5SWQA 3U48A 1S7WA 3WTXA 1E40A 4PJDF 4U6XB 2Z9TA 2Y6SC 3DUUB 4HKXA 2FH8A 5MEPB 3VI3A 5BZWB 1OALA 5FCSH 3RWHB 2WBWB 3RU8H 1ZTMA 3WFHB 2EE3A 2G4GA 1FUNA 4PJ8A 2VN3A 4PBDA 2VITA 3TZVA 3BAIA 3U6XA 5L8JB 1PSKL 1IGYA 5F7AA 2ZYHA 3NA4A 3MX0A 1HDMA 2PYFB 3D50A 2QADC 1KTLB 2DQUL 5IQ9B 4HJ0C 4N8CL 1USZA 3GMRB 1WVZA 3QXDB 3TESA 5KBKA 1ZV2A 3L54A 4JCMA 3RWEA 4F7PB 1ASOA 3C12A 3FQTB 4KDVA 5IHZA 5IMLB 3TNNB 4NN5C 4JVWA 3MRKA 2R0ZL 5CZKA 1ZT4A 2CBTA 4A39A 3WJLC 4IW4C 4LRNH 3Q3GA 3P73B 4HS6B 3PJLA 4OZHA 4YR6A 2WLIA 1ED3B 1WISA 1YEIH 4Z1PA 3QHTC 3N1GC 3RWGB 1OGAA 5FO9B 4A2LA 2XFXB 2X87A 1U8QB 2XQ0A 3UBFA 2ESVE 4JM0A 3MLVH 3TJHD 1OP4A 3DUHA 2C3WA 1RUMH 1RZ8A 4QRPB 3RNQA 3RWDB 2EEBA 3GSNL 1QA9B 3W81A 3PWJB 3WS3A 1F00I 1A9EB 1FL5B 1IBGL 3ARED 3LXAA 4QGYA 3HS9A 4EZMA 4LP5A 3UZVA 3FB6A 2RJMA 4YHML 1SLWA 2CKBH 3BSHA 2NCEA 5I1HH 2OXGA 1D9KA 3FRPG 4AT6B 2G3ZA 4FKHA 4OCRL 3U0PB 1WBXB 2WYIA 4GBXD 4LAQH 5ALCH 1RZKL 2EVGA 3TA3A 1X4ZA 4N2KA 2ORBL 2WANA 2VXQL 3LN5A 1MW0A 3NK4A 5JHDB 4JJOA 4C54A 5EC2B 5DD5H 3QG7H 2A2QT 2IWFA 1BFVL 3GSRB 3O6FA 4Y4KB 2IGLA 4ZPTA 1G7HB 4ZMWA 4MDJB 2EXWC 4K23L 4JPVH 4NWTH 2WLKA 3EFDH 2X12A 2J12B 4B9ZA 2VXTL 4EIBA 1CL7I 3QDAA 1JN6B 3WS6C 1ROWA 3L5JA 4G1MB 4HOWA 5LXGH 4CC4C 2AQTA 3LY6A 5BJTA 5FW6A 2P8PA 2VXUH 3T8XA 2O30A 4N5EC 5ACZB 1I4FB 2M83A 5KYNA 2A6DA 2ZOWA 5AW0B 1BD2D 3D5OF 4JKMA 4X4XA 3V0GA 2EYSB 5JW4N 5LG6A 4NAJA 3BE1H 1FA4A 3QZBA 4N0FB 4YNYB 3MBED 2ZXDA 1NDGA 1VPOH 1FH5H 4DZBA 2QKSA 1UD6A 3C60C 2BNUB 1Z3GL 4XP1H 3JWDC 3DX1A 3QFDA 1R46A 2QQQA 1JVOA 3I75B 1KCKA 3FQWB 3NZ8B 2NY6D 3OWRA 4IJTA 1KOAA 3GGWA 3UTZA 3MMEB 4B27A 5C7ZA 5LNGA 5CKGA 2AJUH 2GJ6E 3TO4A 3EJJX 2DTMH 4LHJB 5JIDA 3FCSA 3NK3A 5AW7B 2K8MA 2IBGA 5CUSH 2MQ3A 4Y19A 4JFED 1GS8A 5C09E 3Q2LA 3THML 5B3JF 2HFGH 5D7JD 3K6IA 2DWEA 4MD4B 4DO6A 2XTJC 1A2YA 1XTLA 4XMPL 1G7QB 3GMQB 3OC8A 1UCTA 3OR7A 1MW1A 1FBIH 2XDHA 1F1DA 2V3FA 1HILB 1WBZB 3ATBA 3TIDB 1HEHC 1MCKA 1ACXA 2JV6A 3B9KD 3L4ZA 3N9GH 4EI5B 3QWRA 2CO7A 2O5YH 3CVDA 2G60L 1J05B 1KYOK 1UZ6F 4ODUB 2YS4A 1INDL 3JBG7 4B95C 5F89B 3T0XA 2R9HD 3ULUE 4K9JA 4PVMA 2V7HA 3SQBB 2JQAA 3K4ZA 5HYJE 3QQNA 1FYTB 5ANHA 5JLZB 1NCGA 2XWRA 3I84A 1JZEA 3Q6FA 1MJ7H 3KWWB 2QLVB 3S4SB 3LKRB 1X9LA 1YQ2A 1A3LL 2NY7H 4DP8X 1LL1A 2NY0D 3OL2A 4ZG1A 4U33A 1JZ7A 3O2WH 1JHKH 1JK9A 3EDDA 3KBEA 1CPUA 3MR9B 4OFIA 3MLRL 3S2CA 1DZ0A 1FNSL 5FUZH 3S36H 3KYNB 1OCCB 2V9TA 4AQ1B 1Q1JL 5GRVK 4C56B 3ERXA 3ROOB 3LS4L 4B0MM 3STZB 4LXFA 5A6LA 3VXRB 5EU5A 4J6IA 1BEXA 2MKWA 3NEXA 3ASOB 4EDWL 3O3DB 4G7VH 2DLTA 4M1DH 4UF7C 2I60L 1QRKA 3UEZA 1W9XA 3V0WL 4ZFFA 5IREA 5DK3A 2MPAL 4ODXA 1ZEAL 2WSPA 3MUGB 5CNHA 2H3NB 2DKMA 4MMXB 2P7TA 4ZJ9A 5J6SA 1QP1A 4P06A 3WOVA 5CBAA 3W57A 1I1RA 3PIQB 4P2RE 4RX4A 4BK4A 3WEMA 3UTPE 2JCCA 4MBOA 5GGTH 4XP9H 1KXVA 2ATKB 1CQYA 4JY4B 1RZFH 4F8OA 5KWYC 3A6BH 2FWOA 2R2BA 2ICWJ 3NSDA 1GGIH 1DQJA 4MFHA 4POUB 2ROYA 4X8GA 1AOHA 4L3EB 3KCPB 3VFOB 2GT9A 4H40A 1E4JA 2XT1B 2W60A 2ZKXA 4LHUA 2B77A 2FK9A 2F0CA 1W15A 3VQMA 1DBBL 2PP9A 5GZOC 2AABL 1ZHNA 4GINA 3JUYA 4KX9A 2AEWA 5GSVB 2IQ9H 2VXSL 1J0HA 5FYLL 2HLEB 4G72B 2XA3A 4LPCA 5BNXD 1S78C 1N0XL 1V3MA 2K3TA 2D0FA 4OV6F 2OZ4H 4IRJD 1NOLA 1DQMH 4CBPA 3PV6B 3BXNA 1I8MB 1BAFH 1SPDA 4Y4HB 1GW0A 1J1PL 3WAJA 3FU7B 1I8IA 2AZAA 1PD6A 5E6ID 2J2ZB 4AQAB 4ANXA 1GXEA 3IN2A 1CR9L 1GGUA 4R2GD 4PWIA 1ACYL 4J3UA 1B0RB 1CU4H 1IVLA 5DRWA 4D9LH 2A99A 4PRIA 2B5IB 1AD9B 1PG7X 4MNQE 4XMWA 3QJOA 4PJCB 1NPJA 1T5KA 4HCIA 3SE9L 3MOAH 1M1XA 3RIFK 3FL7A 1P6WA 5AW3B 2P3YA 3I85A 4JM4L 3DVNB 1V05A 4LLDB 3PF2A 2I9LB 1T5XB 4P2QA 3HI5H 4CVZB 3TVMA 5IFJA 4TKWA 2AEQH 2DYPA 4IRSB 2JKXA 5JO5B 1QR1B 4KK9D 4NCC2 5ID0A 2X4SA 1CLOH 3ZKNC 3FUIA 3V4UH 5CGBA 1NLBH 2ZJSH 3OMNB 1P5VB 4X0NA 4N2GA 5ISZA 1OSPH 2TRYA 2WV3A 4JN1L 4MNHB 2BPBA 5I1CL 4N8PA 3UC0L 3F6JA 4AKOA 4UMGA 3ARBB 1AXTH 1IM9A 4KMTL 5EZJB 2DQHH 5IVXB 1FL6A 1E4WH 1YHPA 1SY6A 3MN8A 4M03A 4TUJB 5K9KA 5E1GA 4BFGA 4HUVB 4FQ1L 2MJWA 4QT5A