5T1MB

Cetuximab fab in complex with cqydlstrrlkc
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
219
Chain Sequence
EVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CETUXIMAB FAB LIGHT CHAIN
publication title Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 43
structure length 219
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1mB02
1AHWA 4KTDL 2FYYA 5C09B 1NLDH 5J06A 5J6GB 2ADGA 4J4PD 1QO3B 4P4KB 4JRXD 2X89D 5EOQH 5HXMA 4ZTPH 4EN3B 2C1OA 1WJ3A 4PJ5A 2GEEA 1U3HD 3SKUD 4BFEA 4GG6B 2UY6A 2OQJA 1J86A 1F4WH 3ZYZA 3NN8B 4U7MA 2F58L 4M1DH 5T33L 5GGRY 1UJ3C 4U1KA 3QUYB 5L6YL 3U36A 2WZPD 1MSPA 5HYSG 1KEML 3PDGA 4FFVD 4WFFD 4Y5VA 3MRRA 3Q5OA 5FOBB 1CXHA 1QHPA 1IC1A 3OTTA 1TDQA 1HHGA 3D69B 3FB6B 1MI5A 4U1MB 2DYPB 1IAKB 3CLEL 4XAKD 1KCRH 1MJJA 3QFDA 1TETL 1KCUH 4L4VB 3RVUD 5EZIH 3MROB 4OF7A 4TRPH 3SDDB 1K4DA 5CINL 4R2GD 4X4YA 1QYGL 4PGDB 1NFKA 2VABB 4G8EB 1JBJA 4MVBD 1KF9B 1DN0A 3BAEL 2ADIB 1C12A 1NEUA 4OGAC 1Q0XH 3L7EA 4OT1L 5EG6C 4N1EA 5ADOH 1IL1A 3UEZA 2GTWA 1Y0LA 5A16A 2B1HH 4QYOA 3CFBB 2OCFD 4DFIA 5HVWA 1X3DA 3QUXB 1A7NH 4YDJB 5INDB 4NQCD 3ZDXE 4ZTOL 3QHFL 4HKJB 5EB9A 1MFDH 2GW5A 1G7QB 2W0PA 2D3VA 5MEOB 4ZFZB 5C0RL 1TJGL 4MDJA 4X0KB 3D85D 3V0VB 5DRXB 4MA7H 3DSFH 4LP4A 4P3WA 2C26A 3DV4A 5C0CD 1RHFA 4ZUTB 5H35B 2A6KB 4FQ1H 3Q6GH 3IDXH 2FHFA 4RGOL 3S88H 4LRIC 1FRGH 5BVPH 4GG6F 4LPCA 4F15C 1JMZA 1U93B 4JM4L 3EFFA 1YNTB 4PY8I 4MXVE 5L88L 1CE6B 2VUYA 3HTLX 1G1YA 2FBJH 3CVHA 4XBGB 3BZFB 5D1XA 3ARFA 4Q0XL 3GSXB 5E6IB 2B2XL 4YQXL 3VDAA 4K9EH 3HNTL 4QT5A 4RAUA 1O5DT 4EI5B 2A6JA 3R0MA 4XT1C 4Q9BA 2DQFA 5I1IL 2NXYD 1XF2B 2QQLL 3ZKND 2A73A 2AJXL 2XKNB 4YBLC 1UA6H 3HHRB 1EJOH 3TJEL 1KCVH 3U9UB 4JFOA 3VI4E 3MRQB 2BRRL 4MCZB 2N56A 4PJXA 3CSGA 4RFEA 2HKHH 5E8EA 3TYGH 3NIFE 1U8MB 5ITBH 3GIVB 4M6OL 1KFAL 3D18B 2CIIA 4P2QE 3HC0A 3IFLH 2O5XH 3TNNB 3DX8B 2DQCL 4PS4H 1R3LA 3OV6A 4O4YH 3CLFL 4LVNC 2YPKB 1CS6A 3THMH 3PGCA 5CHNA 2PTTA 4XVTH 5K9JL 2V5MA 5GS1C 4LEXH 4PGBA 4JFQB 4DKEH 1KIRA 1CLYL 4YHIB 3SO5A 2R29L 5DURB 1WTGT 2LQRA 5GPRA 2FL5B 2I5YH 1HZHH 4U1LB 3P30L 3MOBH 4OLWL 4WI6A 3L3OA 1K8DB 2MCG1 2IAMB 1LO3H 1S78D 5C9KA 3SDAB 5K59E 1NLBL 4FABL 1H0DB 1AJ7L 4ZPVA 4FMFA 4JFYB 4QRRA 5KS9A 3PWPB 5FM8A 1PD6A 5D2NE 1T66D 5H2BA 5BJTB 5HD8D 3NCYP 1YEJL 2VUOA 3WS3A 3EW3B 4RSVA 4K3HA 3VFOB 5IVXA 4NT6B 2GSIB 2KH2B 4R0LB 1I7RA 3FQXA 3PE9A 4GKNB 2JF1A 4X6DB 5D5MF 2V2TA 1N6VA 3HFMH 2M8XA 4GAGH 4FQJL 5BRZD 1S7TA 3HPLA 1AO7B 4K8RH 1PZUB 4OUOA 3SDCD 2ZP0T 3AREB 5IB4A 4XB8A 3KPRD 2HLAA 4RMUA 5DZNA 2YBRA 4XX1G 4RWYL 2VZ1A 2R1YA 5TDNA 5E1AA 4QHNB 3MV01 4FQXD 5ABDE 4PRPB 3RPIB 4UAOB 3KLAB 4F8QA 3W2DH 1S7RB 2VXTH 5AZEL 4QO1A 5I74C 4UI2A 2BDNL 2OI9B 3D39E 3ZHLA 2CDEB 3WJJC 1FJ1A 1C5CH 4WUUE 2PCPA 3TVMB 1FV1A 4EN3C 4WENB 5GGSA 1WWCA 4ZD3H 4BK5A 1ZHLA 2WUBH 1A6TA 3O3DA 3RWIB 3EOYG 4HGMA 2I9LB 4OLZH 1A2YA 2UV3A 5GRWA 3HRZA 4IRJB 4HWBH 4WWKB 4Z7WA 1A1MA 4P4RA 5DGQA 1SYSB 4M5YL 3L3KA 3MR9A 4HQQH 1TCMA 1K8IB 2XWBB 4IOFD 2P42B 3T2NL 4O5LL 4NHCL 3UJJL 2B5IC 1KT2B 3P9MB 5AYUL 3DMMC 3ZL4H 1OT1A 3O9WD 4Y4KB 1X7QA 4JRYB 3NCEB 1AIFB 1RUKL 1FGNH 2C1PB 3SHSA 4RX4D 4X6DF 3R06B 5F9JB 1JWUA 2FGWH 4CMHC 7FABH 3W5NA 1ZANL 3SDDC 4U3CA 5T1KA 5D2LA 1IAIH 1TJIH 5GS0L 5JPNA 4PV8A 4N8CH 4LQFH 2HMIC 3WDIA 1A6VH 2XWJB 5JQ6L 4M1GH 2HG5A 5AYQA 1OP3K 5E00B 3TBWA 2LE9A 3BHBB 1R3IL 2R4RL 3B83A 1MCWM 4TTDC 1QBBA 3HE7D 2E27H 4QY8A 2Y6SD 4YGVB 3QAZB 4HJ0D 3KYNB 3KPSD 1NCBH 1X4ZA 3DX9A 1A3RH 5H37G 1G7PB 1IGFH 4OF5A 4BH7A 2FO4A 5FGSA 4HJJL 3U0PB 2AXGA 2MPAH 4M7JH 2P8MA 5JOFA 5D2NA 5HI3C 3V5DA 3HKFA 4Y8DC 1LEGA 4ODHL 4PRIE 5F7EL 3FCTA 1NAMA 1MQ8A 4MNHA 5LWYH 3BRFA 4KJYB 3T2PA 3PXJA 2XN9B 3BH9A 5ID1A 4EQ3A 4XC1L 1J1PH 4BSWA 4OLXL 1KN4H 5T1LA 4UILL 4JDVB 2ZUXA 1EVUA 3QWRD 3KYKL 5JPMB 3CIQA 1KLGB 2PTUA 1OPGH 1SVZA 4OGYL 1S7UB 4NRXB 3O6KH 2XTJE 4FXGB 5C0BA 1KYOK 1EFXD 5DUBA 2WWKO 5KJRL 3HMWL 4XP9H 1GAFL 5E6IC 2F8XC 4PJBB 5MHSD 1MCJA 4LSVH 2DTMH 2P7TA 4OFVA 4HLZH 4DUWA 2NW3A 4EI5C 1BECA 2B39A 4QRUB 1UXSB 4JHBA 2BSTA 2D7PA 4OCYL 4H20L 3MBEB 4P2RA 5FUOH 1UWGH 2D7TL 1JPFA 3O81A 4RAVA 4WU5A 4U6HB 2VL4A 1J1XH 3HUJE 2H2PC 2APVA 4UQ2B 3X13B 5CCKL 2E7LC 4BZ2L 4Z5RB 3ECBB 2D03L 2OXHA 4KTYA 3GRWH 1UCTA 3QNXB 2P5EA 4BUGA 4XHQA 3VA2C 5DD6A 3PIQB 3BP7B 5D70H 4AJ0A 4P9ML 5IK3B 2GJZB 4JN1L 5DJ0B 4B41A 2BNRE 1A9EA 3RKDC 1INDL 3IDYB 4PJ8A 1A9BA 4Y5XB 1BGXH 2ITCB 5IB1A 4U2ZA 3UO1H 5I19H 3IKCB 1NMCB 1F8TL 1RUQH 4JY5L 3AROA 2YA1A 3UYRL 4BFIB 4G9FA 4OZGE 4RRPG 5EOCL 2VZVA 4UT7L 1OVZA 4FFWD 1T1ZB 4MJ2A 1LK3L 1CGXA 2YPLA 5I1DB 1HIML 2VLRE 2JTDA 4WRLA 3P40A 3QG7H 3V4VL 4D0BA 5DMGD 4QXTB 3H7BA 2ARWA 1TTUA 1Z9OA 3UJTL 3RWGB 2IAMC 1FYHB 4JZJC 2VZOA 3SDAC 5DA4A 2JELH 3ES6A 2ICEA 5D4QA 1B90A 1BQHA 2E7CA 1FVEB 5GGTL 2CH8A 1EJ6A 3ARBA 5GHWH 1MJ7L 4PJBF 3FT3B 4DJMA 3BH8B 1RIUH 2PXYA 3LAFA 2YPVH 1CGVA 1FPTL 4KVCH 5KSAA 1ZKAA 3FB7B 1U3ZA 3QHZH 2E8ZA 4XCEB 5EU7C 5IB2B 4YFLF 1BIHA 3ARXA 1ZLWH 5HI5C 4RZCA 5HYJB 3HE6B 1JF6A 2VDLL 5HY9B 1J8KA 2FGZA 4FQIH 4UUJA 4X6CE 5KSVB 3AREC 1HSAB 4R3SA 1JHLL 2VLKE 2FIRT 1SJHA 2E7MA 2NZ9C 1DVFC 3JTSA 3OG6B 5IB5B 2PN5A 1KTLB 2BVOB 3OKYA 5C0JA 2XRAL 5K93A 1YC8A 2VNCA 4ZUVB 3KLSA 4TVPH 3EDFA 3LS4H 5DJZA 3LOWA 4Y4FB 4LSTH 4UAOC 1OSPL 1EBPA 3T4YA 4OFIA 4WDIA 4P57B 4YXKH 3IDGA 3LN4B 5DSCA 3D0VB 1MF2H 1PZ5B 5AEAA 2YWYA 1NEZA 1HDMA 4D9RE 4DGIL 4WTXA 4P5KA 4PJ5D 4M9PA 3TVMC 1V7ML 4ODTH 1S7XB 5IKCA 4PP1C 2AJYL 4S1SH 2Y72A 5FXCH 3DXAB 1J18A 1H3GA 4KH2A 2OMBA 4GRWF 1UM4L 3RVXC 3FB5A 5JOEA 4BK4A 5JW5A 1WBXB 5DVMA 3RUGE 1MLBB 2VTFA 4PBXA 2OR9H 4WWKC 5AG8A 5GRZA 3I75B 3IXAA 1Q9OB 3OAUL 2R39A 4AM0B 4LKCA 3V0AC 5JIPA 3MJ9L 4LLWB 4NQDE 4U1HA 2DBLL 4HFWB 2E9BA 1QRNA 1MCEA 4XP1H 5F70A 2BNRA 3ZTNL 1DEEB 3O3EB 4F7PB 1EEZA 3LEXB 2VDNH 4J3WA 1UQSA 5KN5A 3EYSH 1A64A 5EZJB 2YUZA 2X42A 4OZGA 2BNQE 32C2A 4X6FA 3ORJA 3BP6B 1ZT7A 5LCVH 4B50A 3LY6A 4QKXB 3GSUA 3GSNL 4PP2A 1I7TB 5CD5C 5C07D 3RWCA 4NUJA 4MYWB 3PNWA 3QAZC 1A21A 3I50H 3DYPA 5EUOE 4KHTH 1SEQH 5JW4M 3EYFA 1IC7H 2KQMA 2XT1B 1MAMH 4NBZB 1WVZA 1DBAH 3UTTB 3H6JA 1W0WB 1HWGB 1HXYB 4FZEL 4WTWA 3VWJB 2X4UA 3SDXA 4S1QL 1JV5A 3G5YA 1UZ6F 2EEDA 2EEAA 1LNUA 4M6NH 3U48A 1A7OH 3H9HB 3U0WH 4LDLB 2VAAA 4FFYL 2G60H 5T5FH 3TESA 1K2DB 1N0XL 3AMKA 5DJ6A 2BNUB 1ZGLB 3FN0H 1TQCC 5IVOA 1G7LB 5D1XD 3F58L 4MB5A 1BVKB 3ARFD 1RHHA 1N59A 1BX2A 3VMNA 1LEIA 2QHRL 3SE8L 3D3VE 2PTVA 3KVQA 1XF3A 3DURA 5HGDB 1YC7A 2BOCA 3WIIL 5L8LB 3BDBA 1CL7H 1NCCL 4DTGH 2IFFH 3IU3A 4F9LA 5EO1B 3MLPA 5GS0C 2GY5A 1OT2A 2EH7H 1J5OH 5IW3A 1E28B 3IXTB 5IHUL 4XNZB 3VFTA 4LVEA 5TDPA 2AJSH 1T7VA 4NSKA 4XMLH 5HGGS 1A5FH 3QIWA 3FFCE 3B9KA 5B3NA 1V3LA 1NANH 1B0WA 1XIWA 3GSOA 4GO6B 4JRXB 1H3WM 5GJSL 3DRTA 5I8KL 1DQMH 1EMTL 2ARJB 1W72H 1Q0YH 5FUZH 4Z78B 1LDPH 3IDYC 4Y5XC 4CMMB 3JWOL 1U3HB 4L3AA 4HK0A 5DD0L 4KQ3H 1ROWA 2C4XA 3MLSH 3ESVF 4F7TA 1OTTD 4U6YB 3C2AH 2X4OB 3X17A 1FLTX 1BAFH 2ZUSA 3KPOB 1NMCC 1X4YA 5F3BB 1RVFL 4KI5F 4YXHH 2VC2H 4WTZG 3VXME 3FRPG 3ARYA 3VXSE 3DRQA 4DW2H 1I3UA 2WIIA 1SJXA 2R1WB 2WANA 3UBXI 2ED7A 4A2LA 5D72H 1BM3H 3LVEA 1ZVHA 3P73B 3F6IA 4YUEL 4MAYA 4S0SD 4QRPA 1D5XB 1PFCA 3ZTJG 4X4XB 5FHAL 2FJHA 4QHMA 4H25A 1NCWL 4QRRD 2OTPA 1I9RL 5ESQB 1U8LB 4HUMB 1C1EL 2D7MA 4NM8H 1ORSA 1IBGL 3AY4A 4WFHD 2DMKA 2YSSB 1NGYA 2C3VA 4LLYA 3V6FA 2CMRL 2FD6L 2NNAA 5CBAA 4Z7VE 3SDYL 3C5SB 2XWTB 4LHUG 4JY6A 2EIZB 3TIDB 1QOKA 1XF1A 4NO0B 3GUTA 1G7MA 5ESVA 5JZ7D 1ZLSL 3BPCB 1LO5A 1YEIL 4NQCB 5EC1A 1KPRA 1N26A 2A9NL 3HE6C 3VFRB 3L7FA 3SN6N 4M7ZB 3PABA 3L6FB 4CJ0A 4U6VL 1NDGA 2ZJSL 3D85B 4R97B 4KUCF 2GITB 2DTSA 2AQ2A 5ID0B 1AGCB 4KTDH 1CGYA 2X4PB 1AGFB 1Y6KR 3QRGL 5CIPH 5C0CB 1TVHA 1X5KA 1ES0B 4PIRF 3MV8D 4GRLD 4WGWB 1T89C 3UTQB 3STLB 5JOPD 3N0PB 1U8JB 3DIFB 1TITA 2LV4A 1UC6A 3NVQA 2CR6A 4JANB 1S9XA 3QDJE 4H0GA 2MSPA 1I8IA 4WVRA 1CXFA 1P4LB 3RVVD 5F72S 4HG4J 2F58H 5T33H 2YD6A 2VDOL 5LJYH 3QO1B 2VAJA 5IHLB 4B7LA 5KSUA 2X10A 1VKXA 4P3DB 3B9AA 5L6YH 1KLUA 1I1YB 3MA7B 4U05A 1KEMH 5I0ZA 3T0DA 2VDRL 2B8OT 4UNUA 1MH5A 4IHOB 2NXYB 1S5IL 4NRYB 1LK2A 2H32B 3CLEH 4H1LB 1NCUA 4HAGA 1NCDL 4HUKB 4J7RA 4LSPL 2CIKB 4WI9A 4XCNA 4MS8D 4NM4L 1TETH 4C58B 5T1MB 1KCKA 3B4NA 2D0GA 1AQDA 4QHKJ 4OZ4A 3FZUD 5CINH 1BD2A 1C08A 2R1XA 4PJGB 4PJ9A 3UTSE 5GRYA 1QYGH 4X9BA 2VQ1A 1QLRA 3BAEH 1I9JH 3LRHA 4CBPA 2FWOB 1JNHB 5T1KD 4OT1H 3BISA 4M4RA 2NX5B 3ULVD 1FO0L 4RIRA 1MEXL 4X9FA 5FGBC 1CL7I 4YAQB 4LKXB 1YY8B 4I18C 4G8GE 4M03A 3RIAK 4ZTOH 3T0EA 1NMAL 3QHFH 5IV2B 4UQ3B 2QR0B 5C0RH 1TJGH 5IMMB 1F3JA 4JY4B 3WFEL 1HSBA 4PY8J 5HHPB 1MFBL 1WGOA 3AS1A 4RGOH 4XNYH 1EEQA 2VLME 4LLVA 4X98B 3ULUL 4KI5C 1G7IB 2ZOKA 3VXRD 3MJ6A 1RZ8B 1KPVB 2X1OA 4JM4H 4L3ED 4Q6YA 3HZYA 5IM7A 5L88H 2K7PA 1D5ZB 2YXMA 5T1LD 3WUWA 3ZZ1A 1JGEA 3JTTB 1ZV5A 2BX5A 3BWAA 4Q0XH 2B2XH 4YQXH 1X5LA 1BF8A 3HNTH 2FH6A 5E99L 2AEQL 5C0BD 5BRZB 1OGAA 3A6CH 2F53A 5I1IH 2XTLA 1KPUB 2QQLH 4F7CB 2X4SB 2H3NB 1YN7A 3GSVB 1ITCA 1MCPL 2GQHA 3SDCB 4UOW0 3TJEH 4PJGF 5SX5K 1YPZA 3BW9A 3KPRB 2BRRH 1YMMA 4P2RD 2IAND 4RAHA 4KK9C 3BIKA 5EA0L 4M6OH 3ULSB 1AH1A 1KFAH 3IDMA 3BP4A 4FQXB 1LE9B 5JHDA 2IBGA 1N5AB 4TUJB 1YDPA 2AEIT 1EAPB 1NUNB 2DQCH 1YYML 4F33A 2PUQT 3V4PL 5FYJD 4J4PC 3CLFH 1DUZA 3GK8L 3MNWA 2FLRT 1WBYB 1SYVA 2JJUA 5K9JH 5I1CH 3H9ZA 4P49A 5I1JL 3WNOA 1CLYH 4Y1AE 1S8DA 2R29H 1XCQB 5J1AA 1OAYL 3X12A 1DDHB 4G9FD 1JPGA 3LKQA 2GFBA 2B0SL 5DVKA 1RJZB 3P30H 2Y9RT 1XCTA 5ICZB 4OLWH 2F15A 3DSNA 4ZUSA 4JAMB 3S96B 5E5MA 5FYLE 3WNLA 4FFVC 5HGBA 5HHQA 3NCMA 1NLBH 4AH2A 5JLZB 1CVSC 4PJHF 2AV1A 3UTSA 3ARGD 3VDCA 4FABH 4H5SA 1AJ7H 3FQTA 3O9WB 5CP7A 4GG8B 4ZDHA 5EU5B 4AEHL 4PY7A 4A6YB 4HV8B 3X3GL 1R24B 3EJZD 1I7UA 1ONQB 2HT4C 4PFEA 5IHZB 3RVUC 3IAQA 4KJQD 2CQVA 5DJ8A 4EUPA 8FABB 5IFJA 3LKNA 3ARBD 4GRMA 3T2OA 1KJMB 4FQJH 5H94A 1CFQA 3G9VA 3QB7C 5E08L 3PQYD 4CVZB 5C0FA 3PWJA 5KSAD 3CPLA 1BWMA 4XP5L 2Z9TA 3VW3L 3BSZL 1LP9B 2V2WB 1IGTB 2OX5A 1CD1B 1YECH 4NKMA 5CWSA 4M6ML 2CR3A 3IJHA 5E24E 3HE7B 2ZCHL 3CCHB 1IM9D 1W0VA 4DK6A 3ME0A 4ZNEE 4WO4D 3W9EB 2VE6B 4RWYH 1FFNB 1MCQA 2V9TA 3RRQA 1PKOA 3CXHK 3KPSB 4OI7A 1S7WB 3NPZB 3W81A 4QF1B 4KGJA 4M7ZC 1T1YB 3DUHA 4LRNL 1FL5B 4R97C 5AZEH 2X40A 3F6LA 4JPKL 3I3BA 2BDNH 1QNZL 5SX4H 1UG9A 1CGWA 3D0LA 2FSEB 4P9HL 4OGXL 1S9YA 4MNGE 1DBBL 1B0RA 5E2VL 4P5TD 3H8NA 4IS6B 3O2DL 1Q9WB 1GPOH 4NQSB 4LIQL 4LK4A 3ILPA 1EFXB 2F54D 4M5YH 1KB5B 3T1WA 4G8FA 2Q7NA 3T2NH 3IFPB 2APBA 4O5LH 3F5WB 1GZQA 1R5IA 2D7QA 4NHCH 3UJJH 4R8WL 3PUCA 2IGFH 5AYUH 1AR2A 2NXYC 1MRDL 4YBQD 3QA3B 1BOYA 3ZKNC 1VADA 1FYTE 1RUKH 4NC1C 5CEYA 5ACLA 3V7MA 1XR9A 3U6RB 3O2VL 3WFZA 4F3FB 4X4MA 4FXKB 1VCAA 4WHYH 1ZANH 5D9SB 5J3HD 5CJOL 4PG2A 5GS0H 3PWNB 3STZB 1K3IA 3DYMA 4JKKA 1JHKL 2VLLB 2NY6D 4N8VG 3I6GA 2DRUA 2DLIA 3MLVL 5JQ6H 3N1PC 4Y1AA 4CADA 1MFEL 3TA3A 1R3IH 4I4WB 2B4CL 3QZWA 2R4RH 1BZQK 5BOZG 2VERN 4XVJL 3RWEA 1HHKA 3P4LA 3HG1D 1H15B 1NJ9B 4JFPB 4PRHE 1N7ML 1A4KA 3O6ML 7CGTA 3MFFB 1NL0L 5FEBA 3PHQA 2ADJB 5I1LA 4UTAL 2KBGA 3TWCL 4HJJH 1EZVX 4I3GA 4Q6IA 1IAOA 2GAZA 1X5JA 3PWUA 3U46A 4WFEE 3DX6B 5C6WH 2APXA 3OR7A 4ODHH 4ESKA 4GH7B 2WAHA 5F88A 4XC1H 4EIZC 4OLXH 3MGAA 4UILH 3V6ZA 5IROC 1U8HA 4CVXB 2CK0L 3KYKH 4GS7B 1UB6B 3HAEA 3SGKC 3FT2A 4OGYH 4GRWH 3QNZA 1ZHKB 3CUPA 5E8NB 1I8LA 3DHJA 5KJRH 3HMWH 5IIEB 1GAFH 3KPPB 3R1GL 5C3LD 2Y1VA 2FR4B 4YHPB 4JFDA 4GMTL 4HWEL 3NBNA 3HI1A 5IMOA 3S36X 5GGVY 3RIAF 5BS0E 1XZ0A 2GTZB 4UIKL 4H20H 5F8RC 1UB5B 3VG0L 2D7TH 1ORQB 4N9GB 1NBZB 1BMGA 1CN4A 1WWAX 5ICXA 3T65B 3F7YB 2Z35A 1WAAE 3VRIB 4BZ2H 2DKSA 3LQZB 4UIMA 3RGVA 2D03H 3PL6A 4DZ8B 2OL3L 3IT8D 3B9KD 4ZAKA 4NNYA 4HF5L 4P9MH 4JN1H 2FYYB 3RX8A 1T21A 2ADGB 1XIWD 1INDH 5B22A 3DVNB 1MJ8L 4P5MA 1II4E 5IFAL 4QRSA 5B3JF 3RWJB 2C1OB 1NFIA 1F8TH 4IM8A 4JY5H 1I9EA 2HLFD 3UYRH 4PJ5B 5EOCH 4UT7H 5FGCE 1OQXA 2OQJB 3RZCA 1LK3H 2GCYA 2YRPA 1T1XA 1HIMH 4U1KB 2D7NA 3LB6C 3NA9L 3O8XA 2NR6D 5I16A 3V4VH 5T3ZD 2EC8A 3TN0D 5C08A 4WGVB 3RI5F 4N90E 3U36B 3BP5A 3HNSL 2FECI 1OM3H 3UJTH 4FHBD 4MMZC 4MA3B 4PJDF 3CVHL 3PP3K 3SBWC 2Q76A 4MAYD 2X05A 3OJDA 2FEDD 3QPXL 5GGTH 4QOKE 3O9WC 1U8NA 4O00A 4PGJA 1K85A 1UFUA 1MJ7H 1OP3H 2I26N 5GSRA 4PJAE 1K4DB 3WBDA 2XQYK 4X4YB 2JB6B 4KQ4L 1IEHA 2HTKD 4KUZL 1FPTH 3OXSA 2CO6B 3GBML 4W4OC 4N0UB 1C12B 4G6AD 5TE6L 2VDLH 1IL1B 1PAMA 5CMAA 1Y0LB 3K3QA 5C0AA 1UZ8A 4L1HA 2ZUVA 4PBVC 4QYOB 3IVKB 3GSQA 1FFQA 3HE7C 3KJ4B 4KWUA 4LU5L 1JHLH 5C2UB 5C07B 3R8BB 2Y6SC 2I07A 4HJ0C 2ZKHL 3QUZA 3LMJL 2DQHL 2XRAH 1HK6A 4LARL 1LO2H 4OV5A 1FBIL 2BC4A 1OWWA 1MIML 1OSPH 1EGJA 4YFLI 4HXBL 3ISWA 2GY7B 4NO2A 4ERSL 2W65A 4GJTB 3AM8A 2DQDL 1A7BA 4KKAD 3C09B 3QCTL 1ZHBA 1T7WA 3TZVA 1DEDA 2ORBL 4DGIH 4EDXA 5I18L 3O6LL 1HHJA 2X09A 5EU6E 1V7MH 2GUOA 5DUML 2AJYH 5HDQL 3MCLL 4KHXL 3WFHA 2JCCE 4FP8L 2UWEA 3CVHB 5D1XB 1UM4H 1RUPL 1URLA 2JJVA 3ARFB 3MC0A 1W0YT 3AGVA 1HXMA 4TVPE 5ILTL 2VXUL 4QT5B 4WNQA 3KWWB 3OAUH 2A6JB 2VWEC 4DUVA 1KC5L 2DQFB 4JGMA 3LN5B 3MJ9H 2DBLH 4YFEA 3CSYA 3Q1SL 3QCVL 1NKOA 4LLUB 4MA8H 4JFOB 5F3HA 3RZWA 3ZTNH 4PJXB 4JFFE 4RFEB 4LLQB 5E8EB 1BD2D 2OM5A 2ZNXA 4PJ9D 4DVRH 5F1SA 2CIIB 5DYOA 4HC1L 2NTFA 1Z6JT 2E9JA 3S5LA 3CJJA 3MLWL 2XQYG 5TH2A 1PG7X 5E4EB 3PGCB 5CHNB 3GSNH 4LNRB 2PTTB 1KCLA 4PGBB 3T0ED 4JPVL 4JO3L 1KIRB 2Q3AA 4Z7NE 1T0NA 4P9HC 4K3JL 1AD0A 2CPCA 1IQDA 2V7NA 3QEQA 4MB3A 4QOKA 4FZEH 3X3FL 1T2JA 3L3OB 5KW9L 5I2IA 4S1QH 3EO0A 1XR8A 2W91A 4PJAA 5HI4C 1CFTA 1GVIA 4WHYG 4FFYH 2OZ4A 1N0XH 5F1NB 4QRRB 5KS9B 1F00I 4RWHA 4GXUN 5H2BB 4GS7C 3F58H 1EHXA 2QQNL 5JXAL 2M26A 1WIPA 3WS3B 5SWSD 2QHRH 3SE8H 4JPIB 4L4TE 5IVXB 1WFUA 1I7RB 3FQXB 4HHAB 4MHHG 4Y8AA 3HS0A 2G9HA 4IDJL 3WIIH 4NNXB 1S7TB 3HPLB 3QQ3A 4HWZA 1OGAD 1NCCH 1I1RA 4O2CA 2HTLD 1BJ1J 1CICD 4PJXF 3VXUA 2Y25A 1J0ZA 4M62L 5IHUH 4YZFF 3AU1A 3NIDF 1P5UA 1YMMD 1BVLA 2YBRB 1RQ5A 5FYKU 3UTPD 3AS3A 5EBGA 1G6RB 1DANT 3EOBA 4D9QD 5TDNB 5E1AB 3PWVA 1GZPA 5GJSH 5I8KH 3UPCA 1KG0A 1FNHA 1EMTH 3MV8B 4GRLB 3GMRA 1AHWC 4G80B 3JWOH 1FGVL 5DD0H 1F11A 1E6JL 3UBXA 1OF2A 2DIAA 5GGSB 5M94B 3WIFB 1JUFA 2DWEB 1RVFH 1ZHLB 3O3DB 1A6TB 5T3XL 3W11D 3VXTA 4TQEL 4LSRL 1A2YB 2EZ0D 2QADC 1Q72H 3HRZB 4K07A 4X6EA 4Z7WB 3VGHA 4C56A 5EU3B 1ZXQA 3JV4A 4P4RB 3B2UD 4KROD 5DZLA 4LSUH 1BFOA 1G9ML 1D7FA 3B2VL 3UDWA 4YUEH 5KS9F 5ISZA 4YDLB 4Y5VC 3SKOA 1X5XA 2V5RA 3HLAA 5FHAH 5ENWB 3S34L 5C09E 4R90L 1NCWH 3DWTA 2R23A 1I9RH 5IVXF 1C1EH 1IBGH 4LCWA 4RQQA 3T1FB 2CMRH 3QCUL 4FG6C 4ODWA 5T1KB 3SDYH 1JZ4A 5D2LB 3HZMA 4ZSOA 5DQ9A 2A83A 3UX9B 4PV8B 1A4JA 1X5IA 4GG6E 2I9TA 3VD7A 5KVGL 5JW4Q 1KJ2B 2WP3T 1S9KC 2HG5B 3TBWB 3ESUF 1YEIH 2A9NH 2P45B 2RR3A 4HZLA 2WLYA 4Z7UB 1HNFA 4QNPF 4U6VH 3KLDA 2ZJSH 3IS0X 4U0RB 1AD9A 3IDUA 3KJ4C 2VDPH 3DX9B 1P2CA 1QSVA 2RB8A 2W0FA 2Q7YA 4BH7B 4RNRA 4I9WD 2FO4B 1MCHA 2AI0L 1DZBA 2NY0D 2AXGB 3P4OA 2WQRA 4L4VE 2P8MB 1O7VA 5JOFB 3RDTA 3T2QA 2RIKA 3V5DB 4QHUB 1LEGB 2MQ0A 1NAMB 3WEXA 1NGQL 4MNHB 1CFSA 1A6UL 1A02N 4BSWB 1BZ7A 3C09C 1EX0A 5T1LB 1Z9MA 2VDOH 4Z7WF 3BKYL 2HFFA 1FZOA 4KDWA 4F2MA 1AP2A 1OARL 2ICES 2VDRH 4OZFA 5D1XC 1A6AA 3DVGA 1CK0L 4UT6L 1DUYB 5C0BB 5DUBB 3ARFC 1S5IH 3LHPL 3MODL 5LGKA 1CG9A 4QRQA 4KXZH 2R0LL 4YGAB 4Z8FL 2P7TB 5DD1L 1NCDH 1GHFL 3I3EA 4LSPH 3LD8B 3VFNA 3ARSA 2KL6A 3LEYL 1SBSL 4NM4H 2BSTB 5F71A 4P2RB 4WU5B 1JPFB 4RAVB 5D2LF 3W5MA 5HGHA 5E9DE 4A2MA 3ULVF 1QFWI 4ZPTA 2FBOJ 1JGVL 5C7XH 4XCCL 4OBSA 3DBXA 3O2WL 4JFEE 3RY6A 1WIUA 1FO0H 1MEXH 5DD6B 3M1BA 4ZQKA 3VRLE 3O0RL 1IAIM 5KVEL 2QEJA 2H45A 1A9EB 3TA3D 1A9BB 2WWMD 5IB1B 5CZKA 3MRFA 4C55A 4XP6L 3MRJA 3J7HA 1HCVA 1T3FB 4OQTL 4AIZA 4G9FB 4OKDA 3GB7B 3WFEH 4IMKA 5D5ME 4WHDA 4MLSA 1MFBH 3SQOL 1KJ3L 5EZLB 5J1TC 5C09A 4L9LB 2YWZA 2Z0BA 4P4KA 2V5SA 3ULUH 2P44B 4HSQA 4D0BB 5IBLD 1OCWL 5J8OA 1DR9A 3ZKMC 3H7BB 3ARGB 4U7SA 3HCVB 4ZS7L 1RZ7L 3DGGB 4ZUUA 4GXUM 4ZODA 5FV1L 1L9NA 3BZ4B 3ES6B 3MRKA 2ICEB 4X8JA 2FJFA 2I27N 5I17A 5BV7L 1J0JA 3NN8A 3WHXA 1G84A 5D8JL 3ARBB 2YS4A 5E99H 2AEQH 4L3CB 3QUYA 5KAQF 2PXYB 5FCUL 3ETBF 3PQYB 3RPKA 5KSAB 2BVTA 1BQSA 1PQZB 4K7PH 4LSQL 4KKBD 1MCPH 4JFDD 4M00A 4YHKL 3BGMB 5KANG 5CP3A 1IQWL 1IAKA 3ZHDA 5ETUA 3B6SA 1IM9B 5LGHL 1AXSB 5JZ7C 4E41E 4NYLB 5FB8B 3IRZA 5E95B 4WO4B 2GJJA 1U42A 1X5GA 4UUJB 5CGTA 4K3DL 5EA0H 3VWKD 4L4VA 1YJDC 1RK1A 4R3SB 3RGVD 3HZVA 4G8EA 1DE4B 3PL6D 1YYMH 5C0JB 3V4PH 3PWPE 5DJZB 3BPNB 3GK8H 4J3VA 3T4YB 2QSQA 1VB9A 4WDIB 4XPGL 4RFOL 5DSCB 1DQLL 5I1JH 2VZ3A 1U8PB 4YDJA 4P5TB 4X6DE 5EU7E 3VH8G 3KHQA 1HDMB 2OYPA 3KXFA 1AO7E 3WNNA 4P5KB 1OAYH 3JVGA 3BESR 2B0SH 5TE4L 5IKCB 4ZFZA 3S7GA 2F54B 4X0KA 3RZCD 3FB5B 5JW5B 3O8XD 3CSBA 5C0GA 3GHEL 5SWZA 1SY6L 5H35A 4LPVA 3IXAB 2BFVL 3K4DA 1KB9J 4LKCB 4MCYA 2R56L 4AEHH 4PRPE 4U1HB 1YNTA 1M7XA 5EULV 1KB5H 3X3GH 4LPUA 4Y19A 5LAXA 4X5WB 1CE6A 4HFUL 3EKCA 3MJ7A 4HG4K 4XBGA 3V2AR 4Y4HA 4M9OA 5ICYA 3V95A 3MO1A 1EEZB 2NY6B 5E08H 3O3AA 1CDYA 5AD0A 1UQSB 5KN5B 3Q0HA 4XP5H 2ZUWA 1VSCA 4IRZL 3TH4T 3BSZH 5IB3A 1P7QA 4KXZI 1N2RA 4M8QB 4M6MH 3ULVC 32C2B 4X6FB 2ZCHH 2ZG1A 1ZT7B 4L29A 2WM0A 5HYSA 4FTVA 3REWA 1QSEA 3U9UA 4GMSL 3MRQA 3RWDA 3GSUB 4PP2B 4XPFL 4LRNH 4U0RC 3GIVA 4OF8A 3QUZD 3WFCL 4JPKH 4UV4L 2PW2A 1QNZH 4PRBA 3T4AA 4H8WL 1CXIA 3EYFB 4JRYE 4KPHL 3RTQC 1YYLL 5GRVK 3DX8A 4P9HH 1VEPA 2E8YA 5TF1L 1QHOA 2H41A 3BZEA 4RDQF 1P9MA 2YPKA 4OGXH 4CU7A 5D2NC 4OLUL 1DBBH 1MHEA 5E2VH 1JV5B 4X9IA 3SDXB 3G5YB 2EDOA 3VE0A 3TGXA 3O2DH 2ED8A 1G9MC 3FAXA 2VAAB 4YHIA 3SGEI 4Z77B 4LIQH 4GFTB 1MHPL 1YN6B 3CX5J 4YHML 1RZJC 2FL5A 4XGZA 3VH8B 4HAFA 1RHHB 1N59B 1BX2B 3RIFF 4EIGB 2RQ8A 5GZND 5HVFB 4R8WH 1CGSL 3VXOA 4JQIL 3DURB 4MJ6A 1L0YA 1RJLA 1MRDH 2BOCB 4QRTB 2Z31A 1YY9C 4PLOB 3IU3B 4P23A 3LD8C 3MLXL 3KHOA 4L8DA 3O2VH 2XZAL 5ANMA 5CKAA 5BJTA 2RGSA 3VFTB 5ADPH 3EOTL 5TDPB 4NSKB 5DFVC 5F6HI 1EFQA 1B3JA 3B9KB 2XN9E 2DMBA 1AXIB 1JHKH 3VFOA 4CGTA 4OZGF 4R0LA 4GKNA 1MFEH 5GGUA 1XIWB 2B4CH 1QFUL 2EIBA 3DRTB 3IGAA 4XVJH 5LQBL 1RK0A 3C5JA 2VDQL 3CXDL 4PJ8C 3LCYA 4XI5D 5DK0A 1N7MH 2OS7A 3I3DA 3O6MH 4HK0B 1RI8A 4PJBE 2R2BA 1NL0H 4F7TB 1FSKC 2V6HA 4OD2B 3C87A 4UTAH 1INEL 4GQ9L 5DJXA 3WIHA 3TWCH 4LOUD 5TGBB 4QHNA 5MENA 3GO1L 5AWNL 2HYMA 3TN0B 2YK1L 1JRHH 2Y7QA 3DRQB 2ZUQB 4YPJA 3SDXF 2Q1EA 3QEQD 5EOTB 1FLRL 4MAYB 2CK0H 2N7BA 3FO0L 5DR5L 4QHMB 1PG7W 1R6VA 3RGHA 1MCOL 4XRCB 1UWXH 5I6XB 4BSVA 4IRJA 3RX7A 5GISL 1ORSB 1OD9A 2BOBA 3R1GH 3ARBC 4KZEL 4GMTH 4LLYB 4HWEH 5CBAB 4L8CB 3U79A 1KUMA 2PXYC 2J4WL 4UT9L 4UIKH 3VG0H 3IF1A 5KSAC 1HINL 2CXGA 5DI8B 4P2QD 1G7MB 2J1KA 1ZLUH 4TSCL 4PYGA 1WIOA 1LO5B 4Y4KA 1KPRB 3VXUD 2ZZUT 3L7FB 4M5ZL 3PABB 3R06A 1NDGB 1B4RA 2OL3H 3BN9C 1JPTL 5JR1L 4HF5H 3N1FC 5DS8A 3MCKB 5CS7A 2XWJA 2LVEA 3IB4A 1MJ8H 1MCNA 2EYRA 1VPOL 3MUHL 1HI6A 5IFAH 1CIUA 4M93C 1MCDA 3BPNC 1WEJL 4JQXA 5DUPL 5K9QI 1UVQB 5FFLA 3P4NB 4NCDA 4AEIL 1MPAL 4PJIA 4S2SB 1I8IB 4YGVA 2QSCL 2XTJC 3CZFB 4B7IA 2P46B 1JNLL 5BO1L 4LBEB 3EYOA 2BVQA 3MRNA 5BCAA 3MTRA 5C0DA 3NA9H 3GNML 4TNWK 1YEDA 1C5DB 4L1DA 1KLUB 4KAQL 4UTBL 3U0PA 3HNSH 4C56D 1M7DA 1MH5B 5IMKB 3U1SL 3L3IA 5A3ID 2K7QA 3CVHH 2I24N 3DGCR 2OR8A 4KJYA 3IFOA 1T83A 3G9AB 4B53A 3GMMB 4YBQC 3QPXH 2F8OA 2NY2C 3W9DB 4KDTA 2CRIA 3SCMA 2CRZA 1KLGA 1BD2B 1C08B 4KQ4H 2QKIB 4PJ9B 4KUZH 3GBMH 1ZT1A 2GHWB 1UADC 1QLRB 1T7ZA 1ZTXL 5HHNA 2NY6C 5TE6H 4H26A 1UZ6E 3DXAE 5AAWA 1UXSA 3TO2B 3D25B 2MMXA 2XXCB 4WV1B 3MBEA 2Z93A 3EJYD 5SV3A 5CSBA 4LU5H 3T0EB 2N7AA 5A40E 2BY0A 4WUUD 4EEEA 4B5EA 3X13A 3LMJH 4LARH 3ECBA 1F3JB 1FBIH 4Y5YA 1MIMH 2G2RB 1HSBB 4HXBH 5KVDL 4JKPL 3BP7A 4ERSH 5IK3A 1JP5A 2DQDH 15C8L 3RDTD 3QCTH 5I18H 2ORBH 3O6LH 3KNBA 4OKVA 1J88A 5DUMH 5IM7B 5HDQH 3VI3E 4XH2A 3MCLH 2A77L 4KHXH 1C5BL 4BFIA 1I1FA 4FP8H 4U7KA 2EDTA 3EHBD 1DSFL 1RUPH 3WUWB 1JGEB 1RIHL 3K4AA 1F4WL 5SWSB 1JF1B 5I1DA 4CN4A 5ILTH 2VXUH 3QDHA 4LQ1A 3T0AA 1JRHI 4NBXB 1OGAB 3E1F1 1KC5H 3ZMRA 5E2UL 1CICB 3RWGA 1IMHC 2IH3A 2V9QA 4J2XA 3UYOD 3QCVH 1YPZB 3BW9B 4XPHL 2D9QB 1YMMB 4KI5E 4WEBL 3UTTE 4F9LC 1EV2E 2DIJA 3OKEA 4X7SH 4MD4A 3I84A 4LVOB 3BH8A 1JJUA 3IDMB 4OSUL 2OSLB 4HUUB 4HC1H 1HE7A 5JHDB 1FC2D 3QIWC 3B9KC 2HVJB 2HFEA 4CKVX 1YDPB 5F44A 1XIWC 1DUZB 2L4OA 5HYJA 3PF2A 2FX8L 1I85A 5HY9A 3MNWB 3AXLA 4D0CA 4PRID 5KSVA 4PRAB 4JPVH 1R5VA 4JO3H 3OX8A 1S8DB 1MCRA 2V2XA 1L7TL 4K3JH 4AEEA 4Z6AT 1J05B 3X12B 2GFBB 4XP4L 3BPLB 1ZA6A 4HK3J 4KROB 1EEYB 1XCTB 1FN4A 3X3FH 3I2CL 4Y4FA 4DUXA 4ZUSB 5KW9H 2OXGA 4P57A 2ZUQC 5E5MB 3LN4A 4I0PA 5HGBB 2EKSA 2BSED 3D0VA 5F6IB 2AV1B 3HC3L 1IAMA 3G6AA 1FRGL 2X1XR 3FQTB 3NIGF 5BXFA 5CP7B 4ZDHB 4JRXE 2NCMA 1MELA 4MAYC 3HA0A 1B88A 1PX3A 5HDOA 2EDJA 1O7SA 2QQNH 1I7UB 1T7XA 5JXAH 2DQJL 3C60A 3DXAA 2HT2D 3U4AA 5DJ8B 4EUPB 5IFJB 3LKNB 1JFQL 1WBXA 5I9QB 4IOSD 5I6XC 3QSKB 3OBAA 1MLBA 4IDJH 5H94B 1CFQB 4RRPA 1MWAB 3AY4C 4MJIA 4KC3B 1PGRB 1KIQA 5C0FB 1YPZF 3PWJB 3CPLB 4ZO6A 3ARDD 4KK5D 4NKMB 2DAVA 4M62H 4LLWA 4HEME 4WFFE 1F5WA 1KCVL 2ESVE 4HIHA 2LTQB 1TTFA 4M48L 4XAKE 2L7JA 3VFPA 1TQBB 1FHGA 4NZUL 4MWFB 2NY0B 5ERWB 5HHMB 1N8ZA 2XKSA 3D0LB 1FGVH 5FYLL 1E6JH 4G6KL 2XKUA 1S9YB 5E8OA 1B0RB 5T3XH 4KK6D 4PJCB 4TQEH 4LSRH 4LEXL 3KXFD 4JG1L 3RVWD 5FA3A 3B43A 4P99A 4I3SH 4HK3N 3ILPB 1KYOJ 4NQCE 5HVHB 1G9MH 1NSNL 4G8FB 1T4KA 3B2VH 4JKWA 4ODUA 3O45B 1B0GA 1GZQB 5SWZD 5EUKA 3VWJA 4OFYD 3QQ9C 3S34H 3HR5A 2ZCLL 2BY3A 4R90H 3V5KA 3H9HA 3V6OE 4HBCL 3ILQD 4Y19D 1K2DA 4DEPC 1XR9B 1DN2A 3QCUH 1S7SA 1KXTB 5E2JA 4Y4HD 2YUWA 4XMKL 1BVKA 4W81A 2EE6A 4PJ9C 5KZCD 5KVGH 2FATL 4Q7DA 3I6GB 1QLEL 4CADB 3DETD 4TPRL 1CD8A 5HGDA 4ZFOA 3TA3B 3NCYS 4OI8A 1MCBA 3QZWB 1P7QD 5DTFB 1QA9A 3RWEB 3MSPA 3B8SA 5E5UB 1IILE 1Q1JL 3IXTA 4RA0C 4FTVD 1QSED 4E5XB 4LSSL 1A4KB 1WZ1L 3T0EC 2DM7A 5I1LB 2GJ6D 3ALPA 2IF7A 1PEZA 2AI0H 3EGSA 4Q6IB 2GAZB 4JRXA 4ZO7A 1K9TA 1F58L 3PWUB 3U46B 1F4HA 1D9KD 1RJYB 3RY4A 4PJGE 4XC3L 5D96B 1NBVL 2ARJA 5F88B 4PYHA 1A6UH 2FZ3A 1QZ1A 3RU8L 5C2BL 4U6YA 1D5MA 2NX5E 3KPOA 2WLZA 2YUXA 1OARH 3FT2B 3GSRB 3QNZB 3D87B 2ILLA 3CUPB 4J12A 4UT6H 4MXWH 1CK0H 1XAUA 3FT4B 1RZFL 3MUJA 1HOCA 3LHPH 1PKQB 4U6XB 2R0LH 3HZKA 3TP4A 4Q74A 3VGAB 4LGPB 1FFOA 1HYRC 1F4AA 4JFDB 1NGPL 3OMZA 1GHFH 5IMOB 4Y16A 1XZ0B 5DHYB 2R2HA 5HDLA 3CZJA 2ZPKL 1SBSH 3LEYH 3NCBB 3P73A 4ELKA 4OD3L 4G6JL 2RFXB 3LS5L 2Z31D 4N0RA 1HWHB 1D5XA 2NY4D 3NFSL 1UCBL 3VWKB 4PLJC 4M3JA 5ICXB 4P23D 3E6HA 1L4IA 4HZAA 3LKSB 5F8QC 4U1GB 1FG2A 2Z35B 5ESQA 1JGVH 1U8LA 4XCCH 3QBTB 4UIMB 3RGVB 1SBBA 3B5HA 3O2WH 3PL6B 3WLWD 2YSSA 4LVOC 4NNYB 4JB9H 1BJ8A 3O0RH 3VXQA 1CT8B 5KVEH 1T21B 3MOAL 2EIZA 3H0TB 1R3HA 4PJ7A 4QRSB 4XNMA 4BQCA 3IFNL 4XP6H 3QXVA 1NFIB 3BDYL 3MV9E 3SE9L 3QFJA 3VFRA 2OLDA 3L6FA 2WUCL 1JGUL 3N1QC 1MVFA 4GOSA 1P7HL 4APQD 1EGJL 3QNYA 3W11C 1L6ZA 2GITA 3RZCB 3VGDA 1I9IL 2GCYB 1T1XB 3SQOH 1AGCA 1KJ3H 3K74B 3NTCL 4JQVA 3S36L 2BHUA 3KPRE 1EVTC 3O8XB 5MEND 1AGFA 5C0CA 5I16B 1DBKL 1OCWH 1E4KC 3BP5B 4ZS7H 3STLA 4N0CC 1RD6A 2EO1A 1BLNB 12E8L 5JA9A 1J11A 5F6IC 2VSCA 1P4LA 3D9AL 5I15L 4ONFL 5BV7H 5HYQA 2LU3A 1U8NB 5D8JH 5GRXG 4W70A 3GBNL 4X4ZA 3QO1A 4Z76B 5GSRB 1KSRA 4P3DA 5FCUH 3MA7A 3CFIC 3O6KL 1J9CT 2J6EL 3OXSB 4LSQH 5I9QC 2KQNA 4YHKH 4IHOA 4E0RA 5TE7L 3ZE0F 4N9OB 4HXAL 1IQWH 2B20A 3VCLA 2H32A 1Q8MA 4WTZA 5LGHH 2YD8A 2PO6D 3FRPA 5CMAB 2CIKA 5C0AB 1CI5A 1UZ8B 3T0WA 3GSQB 4K3DH 3MLYL 2Q87A 2AEWA 3RJQB 1QLFA 5EFIB 1CQYA 2JIXA 2FDBP 2I07B 2NY7L 3P0YL 4XCFL 2IFGA 4DGVL 3QUZB 3JWDL 3PP4L 2CLRA 3OAYH 4OV5B 2FWOA 5IWLA 1QVOA 2BC4B 4K94L 2NY0C 3MZGB 4XPGH 4RFOH 3VXMD 2FNBA 1A6PA 1QRKA 1DQLH 2W65B 4KRPD 1QFPA 4OIIL 5HYEA 3AC0A 1AR1D 1YY8A 2VDML 1ZHBB 5GZOC 4EDXB 5F7NC 4PJEA 1TTGA 4LHUA 2AJVL 4UQ3A 5EH1A 2GUOB 4FQQB 5TE4H 3W39B 4KTEH 5IMMA 4AIOA 3WFHB 1LP9E 1MCFA 5F9DC 1OAXL 2UWEB 4MLIA 1AE6L 4C54A 2DF3A 1FZKB 3C5ZC 4JGUA 4Y2DD 1SY6H 4OZHA 2DQUL 1ADQL 1U8OB 4LCUA 5HVHC 2BFVH 1LVEA 1G7IA 2Y06L 4PPTA 5HJ3A 1YMHA 2R56H 3ARWA 2YHGA 2X4QA 4HGWA 3CSYB 1T2XA 4YHNB 5DK3A 4HFUH 3HMXA 5F3HB 2QTEA 2CDFB 3SCMD 3JTTA 4HT1L 2VIRA 3B3IA 4LL9A 5FO9A 4HKZA 2Y5EA 2QBWA 3EZJB 4JR9L 5J6HB 2DN7A 5BRZA 3U83A 5DFWH 2MOVA 4PG2C 4IRZH 5DYOB 2X9YA 4F7CA 2H3NA 3QPQC 5DO2D 3SDCA 2VR9A 3TA3C 5DHVB 4G43A 3DROA 2XI9A 4GMSH 2WWMC 2W92A 2VWEE 5GRJL 5TH2B 5I71C 4RISL 4XPFH 4Z9KB 2O61A 1CWVA 4UV4H 4FQXA 3BVNB 1LE9A 5K9KB 4KPHH 1YYLH 1SQ2N 1EAPA 5TF1H 5CEZD 4YXLL 3QEQB 4GW1A 5K33A 4Q6IC 1A14L 5IBLC 4OLUH 4NJ9L 5I2IB 3EO0B 2YA2A 2WW8A 1WBYA 4GW5A 4WFGD 1JL8A 1CFTB 2UWEF 2XOTA 4LHJB 2CK2A 4GKOA 1MHPH 3E2HB 4XPTL 1S7QA 3CFJA 4YHMH 4ODTL 4Z18A 5DRWA 3VD5A 5D6CA 1OAKL 1UM6H 1WFOA 4R7NB 1NUFA 4HCRA 1CGSH 5IT2L 4JQIH 1I8LC 3S96A 1HHHA 1QG3A 5B3JE 5JXED 2G9HB 5F6HJ 4UV7L 4HWZB 4EBQL 3QQ3B 5JLZA 5E70A 4P2QB 4KKBC 4Q9CA 3QWOA 4O2CB 5JW4R 5L2KA 1TZIA 4P48A 3MLXH 1ERNA 3FOMA 3O11A 3VXUB 3T08A 2XZAH 4A6YA 5GS2H 3AU1B 4RX4A 1R24A 3EOTH 2EYTA 5I1HL 3EYVB 2DMCA 4OI9A 3TO4A 1KJMA 3EOBB 3RGVC 4ZMAT 4XPAL 1QFUH 3PWVB 3PL6C 1GZPB 4PJDE 4CVZA 4ZAKC 3HRPA 3WJLA 5LQBH 3GMRB 4W6WB 1LP9A 4TNVK 4GAYB 1CD1A 1G9NC 1EHLL 2VDQH 3CXDH 1G0YR 3AMLA 1F11B 3H3BC 1JZ2A 2J8OA 3V52L 4GQ9H 4C4KT 3KPSA 2YD5A 1JUFB 5F89A 2DIBA 3VXTB 3GO1H 5AWNH 4D0DA 2UVFA 2YK1H 3KS0J 4R4NC 3EIFA 4X6EB 3RZCC 4C56B 4MZ2A 3JV4B 4M43L 3JBG7 4PJAF 3MV7D 3BXNA 1J12A 3TT3L 3O8XC 5F7YC 4JM2D 4K2UL 1DBAL 5EORL 2YEZA 3EO9L 3OR6A 1FLRH 3QO0A 4I0PD 5ISZB 3FO0H 3SKOB 5IBUG 3B5TA 2V9RA 3QWRA 3TBSB 1I3VA 5DR5H 3Q5YA 4IS6A 2R9HD 1YNLL 1A1NB 2CKBA 1MCOH 3LN9A 2R23B 1T03H 4HIXL 5GISH 3GMPB 2A74A 4RQQB 1EFXA 3C60D 4KZEH 4QWWD 4ZO9A 4ODWB 4PJ5E 3GMLB 5F9OH 2J4WH 4UT9H 5DQ9B 3F5WA 1GGIL 1A4JB 1X5AA 3Q2CA 4XAWL 1HINH 5CD3A 3BUTA 3K8LA 4MJID 5CAYB 1P84J 5DJDA 3CSPA 4TSCH 3QA3A 5E03A 4JZOB 1NCAL 1ZT4A 2VZTA 4HZLB 3STBA 5E8PA 4M5ZH 4X99A 5EBLA 2DKMA 4K7FB 5CJXA 1YZZA 2EH7L 1MFAL 3L3GA 3V5HA 3U6RA 4P2CG 5JQHC 1AD9B 4FXKA 5KOMC 1JPTH 2FIKA 5JR1H 3PWNA 3STZA 1P2CB 2W0FB 3QUZC 2AW2A 1CZ8L 1VPOH 3P4OB 3K46A 4YDVB 2WP3O 3RDTB 5D1QA 5DUPH 5EZOL 4BFBD 1KJVA 2R4SL 4HLJA 4AEIH 1MPAH 3KPQA 5IF0A 2QSCH 3AM8C 2UYLB 5FA4A 3HB3C 1JNLH 3CFCL 4AK1A 5BO1H 1BZ7B 1FH5L 4MA1B 1OLZA 3TZVC 5DT1L 4YEFA 4LASL 2HJFB 1FZOB 3GNMH 3SKMA 4F2MB 1PDKA 1AP2B 4KAQH 4NWUL 4UTBH 1MOEA 5J0BA 1AQKL 4OZFB 4WHCA 1A6AB 3K2UH 1AGBA 4OBRA 1FNEA 2V7HA 1BIIB 5CUSH 4BQ9A 3LZFL 1QTYT 3MLTA 3VFNB 5FGRA 2NMSA 2XA8L 1RZKC 1S7VA 5D7KD 1L7IL 1XFPA 4CVXA 4LAQL 1QBMH 1LD9A 5F9WC 1ZHKA 2PYFB 3JV5A 5KVFL 2DBJA 5HGHB 3FO9B 4ZPTB 5IMLB 3BPOB 1ZTXH 3KPPA 1FP5A 3DBXB 4YHPA 4JHAL 1G7HB 3BZDA 1BJMA 2EDBA 2ZOLB 5DXWA 4PGCA 3IAGC 5E2TH 1MFCL 4K8RD 3DECA 4YWGL 2OJZL 3IETA 3MRFB 1OP9A 3TIEA 4K94C 3MRJB 3FTGA 2IPUG 5DEGB 3VRIA 4AIZB 5E5RB 2J5LC 1S9WB 1ITBB 4OLEA 1NDMB 3QIUA 5KVDH 1U8QA 2HT3C 2W1NA 4JKPH 1E4WL 4ZUWA 3I6KA 15C8H 4PJXE 4ZS6C 5CIPA 2DLEA 3DVNA 2SEBB 1XMWA 4OD1L 4YZFE 3MXVL 3NIDE 2ZCKH 3RWJA 5DEFA 3GM0A 4N8VA 3PJSA 4ZUUB 1UM5L 2A77H 5J9PA 3FO1B 1C5BH 4KVNH 3ZE1F 3MRKB 1DSFH 4X8JB 2FJFB 5I17B 1RIHH 3WHXB 4YC2B 1XGYH 3HUJB 2DLTA 3E2HC 5FYKL 4FQHA 3KLHD 2N1KA 2PR4L 5F7KC 1HH9A 5JW3L 5E2UH 3V6BR 5IESL 4HS8L 3ARDB 4MA3A 3QXAA 4Y16D 5DQJA 4FOMA 3MRGB 3QQNA 5ETUB 4NQVB 3B6SB 4XPHH 5IVZB 4RMRA 3F62A 4WEBH 2EDFA 5D7IA 3CXHJ 3QXTA 4HIIB 1RK1B 2NXZD 4C57C 2FX9L 1UJTA 4OSUH 3SQBA 2JB6A 3HZVB 4MQTB 4S0TD 3JWNC 3MRLA 2LVCA 4N0UA 4QRRE 1I9JL 5KS9E 4NO5B 2FLBT 4QHKI 4M7LL 3CGTA 2FX8H 1KIUA 2AABL 4OB5L 5DFTA 4WFHE 3QJHA 5MI0B 2E7HA 3IVKA 3LEVL 3G5ZB 5IVXE 2AAVA 3ARUA 5ELIA 2NY3C 3TBYA 5C07A 4MGXA 3QFJD 1L7TH 3KXFB 1E27B 4XP4H 4KKNA 4JRWA 3I2CH 3MLUL 5DRNA 3LPFA 2F9BT 5SWZB 5C0GB 1L9MA 3TFKD 2EDEA 5HHOA 3HC3H 4XNYL 1CLOL 2IADA 4QNPE 3GSWA 3UDWC 4MCYB 5D93C 5DJ2A 5BS0D 2ATKB 5FYJU 4BQBA 1P69B 3MV8E 1H3VA 4Y19B 5LAXB 2DQJH 5T5NG 5JOPE 1UH2A 3MJ7B 2DLGA 4H88L 4BUHA 4IIQA 1F2QA 4Y4HB 1JFQH 5ICYB 1J0KA 5KZCB 4TNVF 3MO1B 2UUDK 3O3AB 4O58L 5FM4A 4QCIB 4OGZA 1CU4L 5AD0B 3KWWA 3A6CL 4Y88A 5IB3B 1P7QB 3LN5A 1N2RB 2FB4L 4WCYL 1FVCB 3UYPA 4LF3B 4Z7WE 1UEMA 2FHBA 2Z92B 4L29B 3QULA 5HYSB 4JDTL 4HMCA 4GBXD 4FTVB 4LLUA 1QSEB 3REWB 3RA7H 4M48H 3RWDB 2G75B 4LLQA 2GJ6B 4O02L 2JIXD 3EAKA 4NZUH 5F96L 4NKOA 5B38G 2PW2B 4G5ZL 4PRBB 3T4AB 3C08L 4JN2B 1D9KB 4N5ED 4MXQD 5HHXL 1N6QL 1T0MA 2W0LA 4ALAL 5C9JB 3OJMB 5FYLH 3GZKA 4G6KH 3BZEB 4P3CL 3FQNA 3RDTC 3VFWA 4M1CC 3WFBL 1MHEB 3WIHL 5D2LE 1BPVA 3VE0B 3ULVE 1X5FA 4LNRA 5I1CL 5C71A 4JKLA 4LHUD 4JG1H 1VHPA 3UZEA 3GJFK 5E1HB 1T22A 2JJWA 1XGRA 1NSNH 5B21A 4XGZB 3QRFM 2L0DA 4YK4B 2RHEA 4Z7UE 5D7LA 4LCYB 5GSVA 3HAEH 3VXOB 4MJ6B 1RJLB 1U95A 2YD3A 2ZCLH 4OZIA 2Z31B 4QXGH 2NY4B 3VRLF 4ELMA 1JZ7A 4HBCH 1KGCD 4P23B 1RURL 5T3XE 3QQ4B 4BQ8A 4L8DB 5F1NA 1WTLA 5ANMB 4YDKL 4AT6A 2VH5L 4XMKH 5E7BA 5ALBH 4JPIA 2FATH 3CDYA 4L9DA 1QLEH 4HHAA 4TPRH 5EUOB 4Q9RL 5GGUB 1NCNA 4NNXA 2NPLX 4EVNB 3RVTC 3RY6C 5I76A 2DWDA 5KSBA 3IGAB 1SJEA 4PGEA 5C0BE 1RK0B 1Q1JH 1YECL 3C5JB 4GAFB 1I7ZA 2VDKH 3PDOB 4LSSH 5DK0B 1G0DA 1WZ1H 3QUKB 2R2BB 4APQB 3QWQB 1KTRL 3ABZA 1G6RA 1IGCL 5DJXB 5EU6D 3T0BA 4OM0L 4P2RE 5MENB 4IMKC 1F58H 2EXWC 4CNIA 2Y7QB 3MV8A 4GRLA 4XC3H 1WCBA 1NBVH 2FECL 1H3PL 5IEKA 4TVPD 3RU8H 4G80A 4P4KC 5C2BH 3WKNA 3CK0L 2P5EE 3A6OA 3GBLA 1WISA 5FYJE 3WIFA 2C3GA 2DWEA 4XXCA 3P4MA 1CF8L 4GW4B 1RZFH 3OPZL 4BSVB 3A0OA 3BYTA 4LCIL 1GPOL 3P0VL 5EU3A 2BOBB 4YC2C 2A38A 1DQQA 1NGPH 3QUYC 1J1OL 1FAIL 2ZPKH 4G9FE 4U1JA 3O6FA 3WN5A 2GIYA 2PO6B 4OD3H 2XQBH 3IF1B 3LQMA 4G6JH 3LS5H 2W9EL 1XGUA 4NCC1 3QUMB 3NFSH 1UCBH 2IGFL 2YPLE 5L2KD 5ENWA 3OB8A 3WS6A 5IBTL 3ZDYE 3T1FA 3W0WA 1AGDA 1GC1L 1V5JA 3QR2A 3TO4D 5DS8B 4BA8A 4GSDL 3MOAH 4XBEL 4JFZL 1MRFL 3VXMB 5L9DL 1KJ2A 1ZMYA 3QISA 4KRPB 2EYRB 4NC2B 4HKBA 4ONGL 4QLRA 1HI6B 3IFNH 3BDYH 4R4BB 3SE9H 5GGRA 3RBSA 3PQYE 5J11B 2ZSWB 5MI0C 3ARPA 4Z7UA 2WUCH 1JGUH 4PJIB 3PXHA 4V2CB 1EGJH 3QUXC 4DK3A 1I9IH 1DBML 3NTCH 4HUVA 3EYOB 3S36H 2BVQB 3MRNB 5C0DB 3JVGC 1JHTB 1YEDB 4Y2DB 1DBKH 4HULB 2NZIA 5F1IA 1M7DB 3VXRA 5I1GL 3L3IB 3GJEA 4L3EA 3S3JA 4QHUA 2WBJA 4NFDA 12E8H 3IFOB 3D9AH 5I15H 4ONFH 3ZT6A 5DQDL 1RUAL 3G04A 3SCMB 2C9AA 3GBNH 1U3JA 3ILQC 5TFSL 3P9WB 5KVMC 5L8JB 1JWSB 4EOWL 3H7LA 3L5HA 3TH3T 2J6EH 1DUYA 4Y4HC 1ZT1B 4G42A 5TE7H 4UB0L 4DCQA 4HXAH 5HHNB 4CUCA 1CFVL 4GT7A 4H26B 2ERJB 4PJFA 4D9LL 4CW1B 3KG5A 3MLYH 2Z93B 2IANA 1WC7A 3ZT5A 1KIPB 2R0WL 2NY7H 1ZVSA 3P0YH 4XCFH 5E7FA 3RKPA 1OTSC 4DGVH 5J4MA 4G7YL 3JWDH 3GJFB 5CJ5A 2FH8A 3PP4H 1VESA 2VZSA 5IW6A 4Y5YB 5IJVB 1QRNE 4K94H 2A0LD 2ENYA 1PX4A 5AAMA 2MCPL 2OK0L 4IRSA 5FECA 4OIIH 3FB8A 4PJIF 2VDMH 5D1QD 5JMOC 2EH8L 2VN7A 2AJVH 3KNBB 1P9MC 4OKVB 5EC2A 4OFDA 4PD4J 4WW2B 4QTHA 4XH2B 1T3FA 3G6JA 2P1YA 2C3HA 1I1FB 1OAXH 3IDNA 3GB7A 1AE6H 1BVZA 1RAMA 3BE1L 3ARTA 1CQKA 3LQAC 4GXVH 2DQUH 1ADQH 5EZLA 1LMKA 3BKJH 4L9LA 1BOGA 3U7WL 2Y06H 4YK4C 4MB4A 3ARGA 5A2KH 4ETQB 1FIGL 3HCVA 1OM3L 5FHBL 1UKQA 2IH3B 3DGGA 5F7DA 1VEOA 2HVKA 5FO7B 4OFPA 5DRZA 3BZ4A 2Z31C 5D7JA 3FHQA 3QEUA 4HT1H 4P23C 5D71L 2ZSVA 3OKEB 2EDQA 4MD4B 5C6TL 5FDWB 4JR9H 1BJ1H 1WFNA 4HS3A 1P4BL 4L3CA 3SDXE 3WDJA 3CU1A 3RBGA 3EO1B 3PQYA 3DMMD 4PLKD 1PQZA 1HQ4A 2HFEB 4ISVB 3MJGX 4KKLC 4R0LC 3BGMA 2VISB 3T3ME 5MERB 1IM9A 4R26L 5GRJH 1AXSA 4NYLA 4YEEA 2LABA 5FB8A 4RISH 4WO4A 3AXLB 3PDDA 4D0CB 3FL7A 1R5VB 1OP5H 4MDIA 3OX8B 5K9OA 4MD5A 2VZUA 1YEEL 2V2XB 1HNGA 4UOJA 3GI9L 1DE4A 5DC0A 1GXEA 3BUYA 1ZA6B 5IEHB 4YXLH 3MV7B 1LO2L 3QIUD 2JJTA 1FN4B 1A14H 4TOYL 4JM2B 4NJ9H 2IWGA 3DX7B 4I0PB 4RGND 2EKSB 1NC4A 4O51B 2VXSL 3HR6A 2OI9C 2X6MA 3G6AB 1U8PA 4P5TA 3Q6FA 5BXFB 1DLFL 1Z5LA 2E6PA 4XPTH 3OAZH 5HI3D 3OQ3B 3WV0A 5FDYA 3C60B 2F54A 1OAKH 2R0ZL 5GGQL 5IT2H 3Q3GB 1M4KA 5E9DD 4N1HB 4IRJC 4UV7H 4EBQH 1XH3B 5HBBA 3VXPA 4MJIB 1PG7H 1KIQB 5CEXB 4DOHE 5JO5B 4JFED 4ZYKA 2MHAA 3MJ9A 1F90L 5T3ZE 4GUPA 4X5WA 2IC2A 4YHLL 2VLJA 1DJSA 3ELAT 1RU9L 5I1HH 4MA8L 4HIHB 4X83A 4Y4KC 5CLWA 1BFVL 4ZFOL 2F5BH 1XT5A 4HGKC 1DFBL 4XPAH 3VFPB 1HYSD 1KXQE 4QRPE 3IDJB 2Q20A 4DVRL 1CLZL 5ACZA 1U91A 1FNFA 2WBWB 3OKKA 1EHLH 1F3DJ 1N8ZB 4M8QA 2H2PD 3LIZL 4AQOA 1E4JA 3HG1A 4HH9A 3V52H 2EDWA 1AR1C 1UGNA 4JQXC 4OCWL 4K7PY 5E8OB 1REIA 3LDBB 5J11C 1U58A 1IKNA 2AKRB 3BMVA 2HN7B 1CR9L 2YC1A 3WKML 5FA3B 1M6OA 1EUTA 1UACL 4M43H 4NO3A 2DM4A 4IBLT 3TT3H 1T4KB 4LCCA 4K2UH 4ODUB 1G6VK 3FO2A 5EORH 1B0GB 2X1PA 3EO9H 1Z2KA 4YHYB 2H6PB 2BCKA 5EUKB 4K23L 5HHOD 3U0TA 2BVPA 3VD3A 3HR5B 4PB0L 4OZFH 3V5KB 1YNLH 1T83C 4WHTA 3H42L 4HIXH 4Z77A 4TUOB 4E41D 1YN6A 4KDTC 4NCC2 2DJ4A 3SCMC 1S7SB 1QFWL 1NFDA 3VH8A 4R96A 4NC0B 3SKNB 5F21B 1F6LL 4CU6A 3NFNB 1GGIH 4XAWH 2YXFA 1ZLVK 3WO4B 4ZFOB 1EDQA 4QRTA 2ATPB 3EZ8A 5DO2C 3PWPD 3S37X 1NCAH 1GC1C 1QA9B 3SJVA 4CN1A 1J10A 2EDRA 1MFAH 3MBEC 1LDSA 4R4FL 4MNGB 2EKJA 2WMPA 4RCAA 2ICWA 3VI3F 5AZ2L 1X5ZA 4WI5A 5KG9A 1BF2A 2FHCA 1CZ8H 1K4CA 5CJQL 5C70A 3EGSB 1A7PL 1CE1H 1I3RB 4Y5YC 4AYFA 5EZOH 1BD2E 2R4SH 2IBZY 1AC0A 2JLLA 3ZDZF 1DVFD 2FZ3B 5ACMA 4XVSL 3CFCH 3QHTC 4XWOC 1FH5H 5DT1H 2AXFA 4LASH 1D5MB 4OD2A 3B9EA 3KDMA 3QI9A 4NWUH 4XZUB 5TGBA 1AQKH 2DLFL 3O3BB 4XNXL 5I1AB 2IBBA 3TN0A 4HLZG 4PREA 3L1OL 1Q72L 1HOCB 3T0EE 1EAJA 2QHLA 1BBDL 3HZKB 1FFOB 4KMLB 1JGDA 3LZFH 3O4LA 4OCXL 4LSUL 5D7LD 5EOTA 5JORB 4Y16B 2R2HB 1QR1B 4ELKB 4ZG1A 2XA8H 4J8RA 1L7IH 4GKSA 4LAQH 4F80A 1R0AL 3V4UL 1WZKA 2EE2A 3MNVA 4U1SA 2Z91B 5I66A 5KVFH 3E6HB 2NXZB 2KZWA 1IM3A 4XRCA 1FG2B 4R2GB 3TM6A 5CP3H 4ZFGH 3MREA 3VGBA 1LWRA 3VG9B 4JHAH 1CFBA 1OTUC 1DBJL 4BFGA 4L8CA 4QGYA 1I1AA 4XWGL 3VGGA 4AENA 2MKLC 3VXQB 5CILH 2BJML 2HJLA 3QDGA 4OCMC 2OTWB 1R3HB 3NIGE 1MFCH 2K1MA 5DI8A 4PJ7B 4JRYD 2WBKA 1IT9L 4YWGH 3MRBB 5C1MB 2OJZH 4EXKA 1KULA 4ZOAA 4XNMB 1GIGL 1OW0A 3JXAA 2C3XA 2P4AB 3OGCA 1I85C 3QFJB 1OGAE 2F53E 3AAZA 3HNVH 3JUYA 1ZSDA 4UBDC 3QNYB 9CGTA 5IHBA 1RV6X 2VDPL 5JA8B 1E4WH 1YPZE 1B6UA 3MCKA 5GIRA 1YMME 2AJ3B 1SHMA 4J23A 3DO7A 4YFDB 2IALB 4OD1H 3MXVH 5CD5D 1R3JA 4D9QE 4KK8D 3L95A 3TBVB 4Y4FC 1IGML 2EEBA 3QEGL 4OF6A 1UM5H 2B7DT 5BS0B 1UVQA 3P4NA 4I0PC 5JHDE 3F8UB 43CAB 4S2SA 1CCZA 1ETZB 3CZFA 1EHNA 5HYQB 3P9LA 1QSZA 3B5GA 4LBEA 4L8SA 5FYKH 2DM3A 3QH3B 2PR4H 1C5DA 3VGEA 3C60C 3UP1A 4QWWC 5JW3H 1PJ9A 3WHE0 5IESH 3BFOA 4FQPA 4HS8H 5IMKA 2AK4D 2XN9D 3RWHA 1M71B 4E0RB 3HMXL 4YO0A 2Q8AL 4WWID 3VCLB 3CFEA 2D4DA 3O6FD 1YEHL 2DJSA 3GMMA 4ORGA 4K71B 4GBXB 1XGTA 1MQKL 3OKOB 3W9DA 4HMDA 3K8KA 2AV7A 1QLFB 2FX9H 2JIXB 1B6DA 2GK2A 3QJFA 2QKIA 1MAKA 5C0IA 3W0WD 4BKLA 2CLRB 4PJ7F 3SEPA 5C7XL 1QVOB 4LHQB 5GS0D 4M7LH 1FO0A 2AABH 4OB5H 1ZS8A 5EDXA 1MRCL 3TO2A 3D25A 3MGOA 1P84K 3LEVH 3DUSA 4OTXL 4WV1A 1WT5C 3U30B 1JI1A 4JZNA 4PJEB 4LHUB 1R5WB 5BQ7A 1EUUA 3LDBC 1PEWA 4AEFA 5E56A 4U49A 3MLUH 2G2RA 2CO7B 1BQLL 2HWZL 4HIJA 4OZHB 3D6GA 4LCUB 4MD0B 3LQAH 1AKJD 1CLOH 5HJ3B 1EO7A 1IC5L 1YMHB 4E42A 5T1DL 2EO9A 2WBJD 4XBPB 2X4QB 4HGWB 2V5YA 3VWJC 1ZWIA 3MRIB 5HHME 4M6AA 2IH1A 4H88H 4HCRL 2DQEL 4RMWA 3ROOA 3CDGA 2VIRB 5SWSA 3B3IB 1JF1A 3ZYIA 5FO9B 3QP3A 3NAAL 4HKZB 4O58H 1ZOXA 1JYNA 1CU4H 5I8OL 1TENA 2VRAA 5FM5M 1JZ6A 4A6YL 2FB4H 4WCYH 1CICA 4K7PL 3WO4C 4LGSB 2EDNA 2EC9T 4JDTH 5D6DA 2FJGA 4G43B 2O5ZL 2LFGA 3DROB 1CD9B 2P5WA 3NPSB 4KV5F 3DPBA 4M7KL 2ZUYA 4OCLC 4O02H 5DWUL 4I3RL 5DK2B 5F96H 3WYRA 4XNZC 2O61B 2CD0A 3X11B 2OSLA 4G5ZH 2D0FA 4HUUA 3C08H 4UDTB 5HHXH 2HVJA 2EE3A 1N6QH 4ALAH 1INQA 1I1CA 3GMQA 5B39G 1OWRM 4GW1B 4P3CH 4X4ME 4PJEF 1TNMA 4IRSD 3WFBH 3WIHH 2IJ0C 3MPCA 1CDUA 1FAKT 1T04A 2PW1A 1FNAA 4GW5B 5B8CA 2XICA 4PRAA 1U3HC 1CBVL 2CXKA 5DZOA 2ICCA 1VFBB 4OZHF 1J05A 1S7QB 3CFJB 1U92A 1OGTA 5DRWB 5D6CB 2EE9A 1EEYA 3C8DA 4FQCL 3KLHC 5DVLA 4IDLA 4UOW1 1HHHB 4I2XA 3OG4B 4HWUA 2EDHA 3QWOB 2CKBL 2YN5A 3MYJA 5L2KB 1TZIB 1RURH 3FOMB 3O11B 2X2YA 5J7CC 5D7JD 1KB5L 4YDKH 5DHXB 2VH5H 1IKFL 1XGQA 4V1DA 2EYTB 2PYEA 3U2SA 2XG4A 1T2QL 4KJPD 3TO4B 3PV7A 4R2GC 4Q9RH 2PKDA 1TFHA 1MWAA 4MVBC 1NKRA 3VG9C 1YEKL 4DFHA 1AGEB 5BZWB 3TCLB 4HJGB 5M7QA 2D9CA 4AG4L 3GMNA 1N64L 2JJSA 4JFDE 3GKZA 1IGCH 1N6UA 1HQRA 5F89B 2P8PB 4OM0H 4D0DB 1QSFA 2HKFL 3BRGC 1ZHNA 3ZE0E 4MWFA 3LRSA 2GK0A 4OCRL 2ADFH 5ERWA 1CDGA 1H3PH 3DHMA 2HAZA 2J7LA 3BXNB 4JQVC 2HRPL 2G5RA 4FNLL 5FO8A 3C2SA 4FMKA 2F74A 3V6OC 3TFKC 1U6AL 1SEBA 2YEZB 3OR6B 3CK0H 3QO0B 1JTTA 1NC4D 2DL9A 2UUDH 4EJ1C 1YQ2A 2R2CA 4PJCA 4C4KO 1CF8H 3O2DA 2CKBB 3OPZH 3OKNB 4LCIH 1DQJB 2GSGA 3P0VH 4KI5D 2A74B 2AEPL 4MAUL 1J1OH 1FAIH 4Y0GA 4CDHA 3O45A 3F7VA 4X7FC 1VFAA 3P77B 3FRUA 2W9EH 5CD3B 1VGEL 5DJDB 1B2WL 4HD9A 4NDMB 1ZT4B 5GGSY 5C08E 5E8PB 4XB7A 3AFLA 4X99B 1GGCL 5EBLB 1RMFL 2DI7A 3UPAA 5IBTH 1NGZA 2VLJD 3L3GB 3V5HB 3F7RA 1GC1H 4Z0BL 5ADPL 1E4XL 2FIKB 3VDBA 4BQ6A 1QBAA 1NGXA 3TJHD 4GSDH 1LP9F 1XGPB 4I13B 4JFZH 4XBEH 1MRFH 4AMKL 5L9DH 1OAUL 2EIDA 5CJ8A 4N5EC 3BOVA 4KK9D 4MXQC 1HCFX 4ONGH 2OJEA 1CFNB 5D1QB 1AC6A 5DTFA 1KJVB 2CLZA 3T8XA 4JEGB 3KPQB 3V8OA 5IF0B 2VB5A 4JFHD 1GH7A 5DMIL 5FA4B 4ORZC 4E5XA 1N4XL 1DBMH 3U30C 2FO1A 3SKMB 2UY7A 4KUCD 5C0AE 2GI7A 1AGBB 2Z4QB 1JRHL 1XF4A 1RJYA 5I1GH 2XY2A 4RMTA 1FNEB 3UROR 1Q9LA 2V7HB 1DTUA 3FOLA 4U33A 2QQKL 1S78C 1BBJB 3MLTB 5DQDH 3SY0B 1RUAH 3U7AA 1NC2D 3VMPA 3UAJD 1S7VB 3LKRB 1EPFA 2E3VA 5TFSH 3DARA 5TJWK 1LD9B 4EOWH 3GSRA 4MJ5A 1KENL 1T66C 5H37H 5HD8C 2B5IB 3FT4A 3H9SD 2ESVD 1OOAA 1LILA 4UB0H 3DMMB 1PKQA 2J8UA 5GRUH 4U6XA 3MRDA 1YEGL 5DA0B 1K5NB 2H8PB 4K55A 5DJCB 1F2XK 1CFVH 3E6FA 3IS1X 1JTPA 4D9LH 5DHYA 4CL7A 3K8MA 2UWEE 2HT4D 3SGJA 4CMHB 4PGCB 2RFXA 4NWTL 2P47B 2HRLA 5A43C 5IJKA 3VWKA 1GOGA 3SDCC 2R0WH 4TULL 1UT9A 3SJVD 1DL7L 3IETB 1F6AA 1AY1L 4G7YH 3MOQA 3LKSA 3NPSC 3TIEB 2DQIH 3FTGB 1JPST 1N5YL 3JV0A 1U8IA 2CUHA 5JUEL 3OHXA 8CGTA 3ZSSA 2OL3A 3Q5TA 5JHLL 6CGTA 3QIUB 1U8QB 2MCPH 4NO0D 4FQXC 2OK0H 2NLJB 3QEHB 1CT8A 4ZUWB 3I6KB 3H0TA 1P1ZA 5CIPB 4RGNB 1MLCA 2EH8H 4W6XB 4LFHG 5DEFB 5HHVL 4N8VB 3PJSB 3I85A 4GAJL 5J9PB 3RNQB 2BSSA 4YIQA 1TNNA 1OSZA 3BE1H 2HJKA 4NFBA 4HX1B 43C9A 3QI9D 4C59B 3QXUA 5E9DB 3U7WH 4FQHB 3U4EB 3UTZA 5EBMB 5CFHA 1FIGH 1G7JB 1HH9B 5C86A 2H9GA 4JFEB 5FHBH 2AGJL 4IOFC 3O4LD 3QXAB 1BLNA 5DQJB 2X4RB 4KRNA 1ZEAH 1BFSA 5D71H 3C8KA 1OAZL 3QEQE 3G5VA 5D7IB 4CU8A 1HH6A 5C6TH 4Z76A 1P4BH 5IQ9A 1FQ9C 1A6WL 2OBGA 1NUGA 1EO8L 4UMGA 5D5MB 2N4IA 3JV6B 3MRLB 4MNQA 3TO4C 4G8IA 2DQTL 3BD5A 2VITB 4I77L 1I1AD 1KNOA 4R26H 3QDGD 1MHHA 3WJLC 4P46A 3QJHB 4WEUD 4JFXB 1A7RL 3TBYB 3MACL 1YEEH 4ONOA 5EFIA 3G5XA 4LEOB 2EYSA 4F7MB 3GI9H 4ODXA 1P4IL 3RAJL 1M05B 2NX5D 3VXUE 4TOYH 4YE4L 4Z7QF 4HWNA 5DRNB 1Z0NA 3BI9X 5FK9B 2VXSH 5HHOB 1ULVA 1F02I 3BD4A 2MTPA 4HS6A 1UXWB 2IADB 3GSWB 1DLFH 5DJ2B 4WI4A 3S35X 3QDMD 4FQQA 3RL2A 1P53A 5DDHB 3W39A 2LAGB 3HI5L 4E41B 1VFUA 1OB1A 1OAQL 1RUML 4IIQB 4Z0XA 1V8HA 2R0ZH 5GGQH 2E6QA 4JZJB 5I30L 1FZKA 5BW7C 3EDEA 1J7VR 1U8OA 5EN2B 1T1WB 4X7TA 3TV3L 1X5YA 5B4MD 4I48A 3TPUA 4NQXA 5E94B 1F90H 5D7IF 1F4XL 1U41A 4C56E 4YHNA 4YHLH 3QULB 1RU9H 3CH1B 3REVB 2CDFA 1BFVH 3MV9D 4X7SL 1DFBH 2HP4A 5CJXC 5ISZE 1PLGL 4NZDA 4O9HL 1QR4A 4NKOB 1NCTA 5J6HA 1CLZH 4O2EA 1MJUL 1U0QA 1D6VL 4ZNCD 4HC1A 1YJDL 2A0LC 3S4SG 3LIZH 5CBEA 1T0MB 4LCWE 4C83A 1DVFB 4NQUA 5DHVA 3FQNB 1AI1L 3VFWB 1JN6A 5D1QC 1G6RL 4OCWH 3QIBA 4BM7A 4WUKL 4ZSOE 3DI3B 4HDIA 1CR9H 3WKMH 2A6IB 1J8HD 1UACH 3BVNA 3VFSA 4FFZL 4FFWC 1T22B 5K9KA 1XGRB 2AXHA 3U7YL 5D7LB 1KCSL 5GSVB 1MVUA 4K23H 5DMGC 4JO1L 3FFDA 2Y23A 1U95B 3ULUD 4OZIB 4PB0H 4ELMB 3LPWA 1V7NL 3LB6D 3H42H 4PD4K 3ZE2F 1QFWH 2P43B 4AT6B 4R7NA 4YPGB 2X5PA 3GM8A 5E6ZA 4PLKC 1BZ9A 4P2QA 5I76B 2DWDB 5KSBB 3ZE1E 1IVLA 1SJEB 4PGEB 2A9ML 3B9VA 3OGOE 1RY7B 1T20A 1JK8B 1I7ZB 4R4FH 2P5WD 3LSOB 5AZ2H 3FQWA 3ULVL 4KZDL 4NNPL 3EYVA 1KJ2L 5EIIA 5CJQH 1YNKL 3V7AE 1A7PH 4WW1B 2DJUA 1JGLL 1A1OA 4BZ1L 4CNIB 3JSSA 3LH2L 3QIUC 1WCBB 3CC5A 1JVKA 1X44A 1MCLA 4GAYA 5IEKB 4XVSH 3EJJX 4RGNC 2H2SD 1TVBB 2YRZA 1YEFL 5CLTA 3RTQA 3S4SB 1NUDA 3DUUA 3QXDA 4NQED 1IJ9A 3P4MB 4QHLB 4XXDB 3EYUL 2DLFH 4XNXH 1PYWA 5JW4N 5C8JB 3L1OH 4MX7B 1G1CA 3EDJA 4I3SL 1NAML 1BBDH 2VYRE 3H3KA 3N9GL 4HPYL 2AK4B 1DQQB 4OZIF 4OCXH 4ELMF 5KTEL 1V3JA 3P11L 4U1JB 3WN5B 3O6FB 2XZQL 3MV11 1ACZA 1TQCB 1RZJL 1RIVL 1XGUB 1R0AH 1T7YA 5FKAA 3TBSA 3V4UH 5KBNC 5ECJE 3QT2A 1A1NA 3MFGB 1VDGA 3FONA 5CZXD 3GMPA 2H32H 4H1LH 4V1DD 1MAJA 4NZRL 3W0WB 1DANU 1AGDB 2PYED 1DBJH 1K3ZA 3GMLA 4XWGH 5KSBF 1HYSC 1U36A 2BJMH 5SWQB 1P7KA 4JO4L 3FN3A 3SE4A 1IT9H 4BELD 4NOBA 4LPTA 2F5AL 4HKBB 1FZMA 2DQGL 1GIGH 1MCWW 1X6NA 1VGKB 4DN4L 4JZOA 3D39A 3ZTJH 5GGRB 4WUUA 4K7FA 25C8L 2X7LA 5FYJL 1MY5A 4HUVB 4F58H 3KYMA 4X8XA 1KEGL 2EIEA 3BQUA 1QSFD 5I8EA 1T0PB 2XA3A 4YDVA 5F1IB 1AKJB 2OTUB 3VXRB 1IGMH 3QEGH 3GJEB 4L3EB 2WBJB 3BEVA 1JPSL 4HUWB 5E2WL 4J3UA 5EU4A 2UYLA 5L7XL 2CRMA 1ZLVH 3G04B 1Z9LA 2ITDA 5IW1A 2X9XA 2HJFA 4RBPK 3I02B 1Q94A 2Y36L 2IQ9L 1IGJA 4GRWB 5EPMA 5HI4D 3IDIB 4MXWL 4IIQC 4G42B 3K2MC 4RA3A 3C6LA 3HMXH 1IARB 3KXFE 4KRLB 2Q8AH 1BIIA 4DCQB 4OUUA 4LLDB 1YEHH 5JDJA 2UZXB 4FQ2L 4PJFB 1I8KB 1MQKH 3NH7L 5J12B 3N1GC 4DVBB 2IANB 1WC7B 1YUHA 2FCBA 3M8OL 5MEPA 4IMLA 5SWZE 2YD9A 2D2OA 2YMXL 1ZVSB 2PYFA 5FYKE 3FO9A 3LV3A 4I0CC 5IMLA 1A6ZA 4YJZL 5IW6B 1RZIA 2M1KA 4Y19E 4OIBA 1MIEL 3OZ9L 1G7HA 4NPYA 4S1RL 4JB9L 3BJLA 1MRCH 4IRSB 2ZOLA 5FECB 4OTXH 4L5FL 4Z7UF 3FB8B 3V0WL 4J3OC 3NACL 4PRIA