5T1MB

Cetuximab fab in complex with cqydlstrrlkc
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
219
Chain Sequence
b'EVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CETUXIMAB FAB LIGHT CHAIN
publication title Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 43
structure length 219
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1mB02
3DHJA 3MGOB 3VA6A 1B0GB 2GSIA 4MNHA 4F7CA 1OARH 4C59B 2A0LC 4J2XA 2FJGB 2XY2A 4XPFL 3UTSB 3RY5A 5F8RC 4P9MH 4K9EC 1UB6A 1NMCC 3UAJC 5I0DA 5L6YL 4WW2B 2FH6A 4OJFL 2RR3A 3MLUL 3FT4B 1INEL 4S1SH 4MA7H 4JGJA 1R5VB 2VAAB 1WK0A 3UO1L 1MH5B 5EC2B 1N2RA 4KU1A 4Y5YC 3SQOL 3O8XA 5KVGH 1FL3B 5MEPB 4CMHB 5AD0B 1II4E 1QSZA 3TZVC 1TQBB 4I5BB 2GK0A 3QUZA 5KW9H 1A1MA 1VB9A 4PGDB 4OLUL 1I7UB 4NC2B 2AEWA 3HR5A 4OZ4A 3L95B 4LKCB 1EEUA 4H8WL 4MD0B 4XT1C 4KRPD 1JPST 4XGZB 2PCPA 1IBGH 1UYWL 1JGDA 3G5VB 3WE6A 2FR4B 1JZ3A 1EEZB 4JFFD 5GJSL 1JMXA 3NIDE 3OZ9H 3BUTA 1FC2D 1N6UA 5J6GA 5T5FH 3IDXL 5CEZD 2XKUA 2XKSA 1KFAH 1EK3A 2ERJC 5F3HB 3DO7A 5I74B 3QIBB 1D9KB 3TWCH 2VDRL 2WINA 1A6ZA 4EVNB 4AEFA 3X13A 3REWA 4G7VH 3A6CL 3BPOB 4AH2A 3G6AB 3ZE0F 5IW6A 4PR5A 1KCVL 3WSQL 2DIJA 3RGVC 4YHNB 3R0NA 1KG0A 4JANB 2XTJE 1DBJH 3DX7A 4LLYA 1Q0XL 4LCCB 5GS1C 2ADJB 4DQOH 5CEZL 1CDGA 2I26N 1KCUL 3CZJA 1OQXA 1VFAB 1R5IB 3RUGE 1DBMH 2GCYA 4NO0B 4RGMB 3EOTL 2GQHA 2GUOA 4HPOL 3REVA 5I1EH 5DC0A 4YZFF 3CCHB 5HDQH 2KQNA 5SV4A 1A8JH 4TPRH 4JG1L 4NZRH 4WI9A 1W0WB 4MQXC 1AJ7L 2NYYC 3F6LA 1JZ7A 2VDLL 3BKJL 1J88A 4KV5E 3GSUA 5DZLA 5IF0A 1G7IB 1G0YR 3U79A 1U58B 1BIIA 1YEKH 3TA3B 4NHUA 4NKMA 3UTTD 4YEEA 1NUNB 1RULL 2R9HD 1HXMA 1DN0B 5T3XD 5E2VL 5T3ZL 1HDMA 4PV8B 3UTSE 2GY5A 3GMMA 3P30L 3QPQD 4WFEE 4G3YL 4RBPH 4N0UB 2A83B 1XGPA 5ELIA 3C60B 2AK1L 4PJ8B 3HE7D 3BP6B 4PJ7F 3X3GL 1BPVA 1MQKL 1HCFX 2J8UB 3T09A 1KCRL 5I76B 4NC1E 4O58H 1XEDA 4I18C 2VQUA 4YHPA 1Q9KB 1EO8L 3C87A 3WO4B 1BD2B 4XP1H 1AY1H 1UADC 12E8L 1OF2B 5T3XL 3BP4A 4UB0H 3H6JA 4XTRC 1KPUA 1QSEE 1IGYA 5CFHA 3QQ9D 4YX2H 1U3YA 1N26A 3F7VA 1FV1B 4XBGB 4HF5H 3OJDB 3L3JA 4P48A 2YMXL 3TBTB 2FBJH 1MRFL 4E0RB 3RL1B 1MCLA 4ISVB 3BIKA 5AUMA 1NUDA 2YPKB 3W39B 3LKNA 4XC3L 5IMKB 2VR5A 3IDNA 1YYML 1QRNB 1RHFA 1IAOB 3KPLA 5SWZB 4GAGH 2GTZA 4FMFA 4PJXF 1FL5B 4QYOA 4UZGA 1YN6B 1PZ5B 3OPZL 1Q1JH 4FQQA 2GITB 2XPGB 3WHE1 5CILH 3SHSA 3BN9D 2ICEA 4LP5A 1LK2A 4DEPC 5E00B 5FO8A 1A3RL 1IZJA 1XIWC 1TTUA 4GW1B 4KQ4H 1S7WA 2D7TL 2AJXL 2HJLA 3U0PB 5B3JE 4A2MA 1WIUA 2HVJB 2OSLB 5IFJA 3M8OL 2OYPA 4KQ3L 1A64A 4WI2A 4L9DA 4NGHH 3MLSL 3SDXB 4AY0A 2VERN 3G08A 1CFNA 2DQDH 4PJIB 4EKXA 4UU9B 2W60B 4LVOC 3WJJC 3RWCB 2X10A 1TZHB 4P23D 3RVUC 3U7WL 1UM6L 3KDMA 1JGLH 1OAQH 4L3EA 1U95B 5FM8A 3MRLA 1FVDB 4Q9RH 3PNWA 3CLFH 3PWNB 3HZYB 1MI5A 4JHWH 3GNML 3VFGH 4X5WA 1M05A 4O02H 1FLTX 5F71A 3C6LC 3ROOA 1FHGA 3WMSA 3FB5B 4LCUB 3OR6A 1KCSL 2OL3A 4BK4A 2OL3H 2W0KA 3DGCR 4M1GH 5FYKL 3IFNL 3LPWA 4AQOA 3MCKA 4XVTH 3RBSA 3T0EC 2XXCB 1MHHB 3RWFA 5K93A 3FHAA 5FUCC 1UM5H 1G9NL 1MUJA 2H1PH 2WLYA 4S2SA 1Z2KA 3RL2B 1H0DA 2DM4A 5EOCH 3R1GH 5T1MA 2Z0BA 2J6EL 3SDAC 1UXSA 1T21B 1QEWB 4HUUB 4JR9L 2Y5TA 1FIEA 1HI6A 5AZ2L 5TE6H 3V5HA 3MV11 2YZ8A 4H25A 1SYSB 3VI4E 4XMLH 4XZUA 4Y4FA 5EU6A 3M17B 4MAYD 4K7FA 2O61A 1QRNE 2HH0H 1BLNA 4MA3B 3VGEA 1NCDL 4WW1A 5HYSG 4JRYD 5GXBB 3BPNB 2EYSA 3IRPX 4FXKB 1BIHA 1C5DB 1G7HB 4NQDA 1PEZA 4UMGA 2YD7A 1AQDA 1X5GA 2J8HA 3CXHK 4X7CC 3VFRA 5JIPA 1JZ2A 3NCEB 4NJAL 5D1QA 3QUXA 3STLB 1WC7A 4XC1H 3TN0B 4POZC 1OB1B 4NHCL 4R96B 3RVVC 4TSAL 1UENA 4PRAB 5DUBA 2DWDA 1A7QL 5MERA 3EOYG 1H5BC 4DAGL 1FZOB 2XXMB 1OHQA 2HLFC 2PYED 2VRAA 4E41A 5ID0A 4CU6A 1I1CA 3ARDC 1CIDA 4RDQF 3RTQB 3D69A 3K2UL 3ARFC 3IS0X 2DLTA 2L4OA 1CXHA 3V52L 1XGQA 1KF9B 3BMVA 3P73B 3P4MB 1PGRB 4PJIE 3O2WH 5DA4A 3W5NA 3IJYA 2F5BH 1I8LC 1XH3B 2X70A 1FFPA 4KKCD 4KPHH 2GFBB 3MJ6A 1GC1H 3GIVB 3PWPA 2AP2A 5F96H 3IGAB 5JXEA 2N56A 1D5IL 1FIGH 5KVEL 3MUHL 4UBDC 3HC0B 1RUPL 4ZFFB 4HZLB 1L7TH 4HC1A 2QLVB 3P0VH 5D2NA 1ED3B 2ADFL 2B1HH 2F53B 4RQQA 3FB6A 3T8XB 4P4RB 1KJ2L 5SV3A 2DQGL 3GIZH 1HSBA 5ENWB 2CJUL 4Z77B 3SOBH 1AHWA 1X7QA 4JVPA 1CFQA 3C5ZC 4C58B 1A2YB 1MCPH 5EZJA 5LGJB 3U1SH 1XGUB 3OAYK 1AC0A 1JV5B 4AIOA 1A6UH 2C7UB 4K71C 4HPYL 3MUGB 4LL9A 4MDJB 2BSSA 2XTJD 3RU8H 2XA8L 4MCYA 4OCXH 2FO4A 4WWKA 3I9GH 5MENA 2XN9D 1I9EA 1CBVH 3V95A 1TVHA 2VABB 3GMPB 2WBJD 2EYTA 2X4TB 1RZGB 3LKRA 4OZIB 1LWRA 5SWQA 4OFPA 4ONFL 4LBEA 3EYSH 4UOW0 4H88L 4NN5C 4OLYH 1YECH 1XGTA 4U1SA 3DX8A 5TH2A 5L8JB 3TP4A 1Y0LA 4JPVH 4LIQL 3I75B 3MNWA 3MNZB 2I9LA 3NIGF 1RZFH 5ERWB 3TO4B 5MEOB 5C2UB 4XH2A 3L3IA 3Q6GL 4H1LB 3WIIL 1PKOA 3KR3H 2IQAB 3FQRB 4LKXB 3MRNB 5E56A 4PRDB 4X7DC 2P42B 3S6CA 3WS6C 5I73C 4DGIH 3U4EB 3ARBB 1A7OH 3KLAA 3UTSD 4WFED 1FC1A 4XHJC 4K3DL 2AV1A 1RPQA 2WAHA 2ZKHH 4PG2A 3V4UL 1VFBA 2NY0C 3BPLC 4ZUWB 1FLRL 1RZJC 3WJLC 2K1MA 5E95B 3FOMA 3JWOL 5JHDB 1TIUA 3MR9B 1JE6A 3LAFA 4G8IB 4NQEE 2N7BA 5D2LA 2F54B 3BDYL 1CYGA 4PJGF 3AREA 4HAFA 4U3XA 4PTTA 5CLTA 3EFDL 4QXTA 4WIQA 3IAGC 1DZBA 1UKQA 1ZE3C 4A6YA 5I19L 4HWZA 1I4FB 1S7VA 3N1GC 4V1DA 4UT7H 5FV2A 3WUWB 2DBLL 2H9GB 4HIIB 3FQUA 4MGXA 2C1PA 2YA1A 4PJCA 1D6EA 4UIMB 5HI5C 4M00A 1Z9MA 4U6HA 1FYTD 5GZND 4UNVA 3BDXA 1FJ1B 3QIBD 4X80H 1D9KD 1BQHB 4HKXB 4ELMA 3JXAA 4JDTL 1CLZL 2WZPD 3QRGH 5I9QC 2FX7H 4NRYA 3QA3A 4ELMF 2PTTB 3D0VB 3S5LB 2ZOLA 2VDML 4APQC 5IKCA 3CXDH 2H41A 3DBXA 5D6CA 1E6OH 2WBKA 2ESVB 3NCCB 2GIYA 3D39B 3MACH 4BQ8A 1HHGB 5H94A 3TV3H 1BFOB 3PHQB 4Y2DC 5ANMB 5L2KB 2Q76B 4ZQKA 5LG1A 3PDOA 4R3SA 5D1XB 2W0FB 2UUDK 4L1HA 4S1QH 1KTKE 3C5JB 1UZ8A 4GW5A 4NO0D 4OZIE 2Z31A 5F1IB 3RWEB 1T83A 4OIIL 2HJKA 4U1GC 1MHCA 1Q9OA 4MB5A 2WM0A 3TEUA 3U46B 3HI6H 1U6AH 1URLA 4PY8I 1EEYA 4QRQA 5ALCL 3BPCB 3TO2B 3X11B 3W2DL 5DEFA 3I3DA 2VL5A 3RWGB 1AGCA 3MRJB 3TA3D 3RY6C 3BXNA 2QQNH 4L9LB 2JJSA 4JQVC 3DUSA 5TE4H 4QRRB 3WLBA 3RVTD 2HFFA 3N85H 4C57C 3C60D 4PJ8D 3RHWF 1IEBB 3UPRA 3DYPA 4AIZB 5JHDE 4O2EA 4HDIA 3U7AA 4XPAL 1EGJL 3V4PL 1NANI 2F54E 5GS2H 5HPOA 2NNAB 3O45A 1WJ3A 3IT8D 1DCLA 1BD2D 3BZEB 2EIZA 1INDL 3MJGX 2VISB 1MFCH 2IANA 4N8CL 1G7MB 4I3GA 5F9OH 1WFOA 3PE9A 4OCYL 2XZCH 4LSSL 4LCYB 3QB7C 2IAMB 3IDUA 5L88L 5EOTB 3P2TA 4RMRA 2IGFH 4WU5A 3G5XB 4P2YA 1MFBH 5DD1L 3WFEH 1RJLA 1D5ZB 4L29B 1KIQA 5CMAB 3BQUC 5AWNL 4RX4D 1QRND 3QZWA 3CFJA 2F74A 2R1YA 5SWZD 1Q8MA 3ZKSD 2R4SL 2A73B 3BZDA 3QQ3A 1UC6A 1OSPH 4G6ML 2ESVE 5B38G 1QFUH 4MA1B 2Q8AL 5BRZE 3FONA 3U0TB 3BZFB 5DJDB 1N3NB 1JGEA 5IR1A 5IJVA 5J0BA 2FJFA 4LU5L 1ZSDA 2LFGA 3L3DA 4PJAE 2IBGA 3VCLA 1GGBH 5GRUL 2B5IC 3VGBA 3CVHB 5C92A 3TCLA 2MTPA 3KPOA 4BFIB 1LHZA 2FX8L 1AE6H 3PXHA 1K8IB 1LEKA 3LB6C 3QI9C 4RISL 5DDHB 5ISZA 1WCBA 3GMOB 4NT6A 2OR7A 5EO9B 3CFDB 4MZ2A 5HGBB 4L4JA 1NLBL 5DK2A 3VXUA 1SYVA 3B9KB 3H0TA 3OKEA 3EOBB 3IJHB 4PY7B 1NFIA 3O4LE 3QPXL 1DBAH 3T0WA 2D7PA 3TFKC 4WUUA 2RJMA 4YGVB 3DVIA 4Y4HC 3KLHC 2PR4L 4K3JL 3M1BB 1RIUL 3OG4B 4QRRE 2APXA 4RFNB 5E8EB 1CDUA 1L9MA 5F7KC 2BXYA 1S78D 2A77L 5E7BA 4HWBA 4HWBH 3T0AA 2UWEF 3OKNA 5HHOA 2A74A 3SCMC 2FIRT 3TN0C 1CTNA 1U2HA 2NW3B 1OY3B 3CDGB 3W0WE 3G6JB 3QIUC 4XXCC 4QWWD 2X1XR 2P8LA 3MODH 3FB8B 4P2OC 4Y5XA 4ZO7A 5E08H 3QFDB 4IBLT 1N7MH 3LIZL 4M1DH 1NMAL 5M94B 1HQ4B 5CP7A 2YD5A 3CMGA 3NCJL 5CJOH 5B3NA 5I18H 2MKWA 1EHXA 3PGDA 3ME0A 1DUZB 1KB9J 3CU1A 2Y9RT 2D4FA 3HMXA 1F00I 4LEOA 4QHMB 4ZUUA 3HMXH 1U8OB 1QQDA 4X6CA 2XWBB 1U8QB 2EDYA 1O7VA 1IM9B 1ZLSH 1DL7H 2AK4A 1MEXL 1TETH 1R0AL 3NA4A 4PJHA 2ARJB 2Q3AA 3UC0H 3D0LA 4NBYB 1S7UB 1R6VA 3WFHA 1ETZB 1DEDA 2VDPL 4L8BA 2Z92B 4OCRL 3GI9H 5DRWB 5HD8D 4ZTOL 1NC2A 5GGUB 1ZT1A 4FQ1L 4MWFB 3KLHD 1F90H 1UXWB 1FORH 3H8NA 3DECA 3O2DA 5A40E 3O2DH 3V0VA 2XWTB 4F57L 4YBHA 5F89B 1V7NH 5C07B 1JZ6A 1RURL 3H9SB 1BJ1H 3TN0D 1DDHB 2M8XA 4PJBA 1T22B 2ZWLT 4F33A 3C2AH 4DKDC 1JJUA 4HJ0D 4EBQL 4ODUA 1MAML 3O3AA 3S96A 2EDEA 3C8KB 5D6DA 5L0QC 3RJDA 3QWRD 3ZZ1A 1WTGT 4PD4K 4FABL 4AT6A 1NEZA 4BSWB 4OCSH 1RZ7H 2NTFB 3QJFB 3LV3B 3RTQD 5JHLL 1S7TA 5FDYA 5I1CL 1QFWH 4QXUH 4ODSH 5JOFA 1A7RH 1VHPA 4KVNL 1WSST 1EXUB 5DJAA 3X3FL 5D8JL 3WN5B 4BZYA 1T1XB 5KG9A 2VUYA 1UWGH 5AG9A 3LD8B 1Q0YL 1KLGA 3CVIL 4B0MM 4LSDA 3FQWB 2X4NA 2EE9A 4C83B 4YXKL 1A7PH 4YWGH 4RNRA 1T7XA 3MOAL 4NKIL 4JM4H 3B2VL 3B8SA 5JIHA 5HGDA 7CGTA 1GOGA 2E9WA 1U8HA 1RUQH 3W11C 4R0LB 1E28B 3IDGB 5DZOA 4D3CH 2A6JB 4EIZC 5EU4A 2F53D 3O6FA 4TSCL 2I5YL 3IXAA 4U7MA 3O2VH 5IUSA 4KMQA 3RPKA 5IB3A 4YHOL 4YUEL 5FYKU 4BH7B 5HGGS 1YA5A 4ETQB 3SDCA 2FD6L 2VR9A 1RK1A 4JFZL 4TOYL 3GBMH 2E7LA 5GS0D 4WHTA 4ZYKB 1VEOA 2O5XL 4XPFH 2D9CA 4RDQG 4MLIA 2ATPB 5L6YH 4OJFH 5D96C 1ITBB 4KGJA 1INEH 3AVEA 3IFOA 3UO1H 4PJDB 4WI3A 3T3ME 1DQML 2JKXA 4NZUL 3ULVF 4ODTL 4OLUH 3ROLB 3LQAL 3WLWD 3HRZA 5GS0L 1WZ1L 1ZA3A 4QRPE 4Z7WA 5KSBB 2X9YA 3QHZL 4H8WH 4JFDE 3SE4A 4IS6A 4U49A 4UI2A 4WENB 1UYWH 1CZ8L 2CMRL 1P7KB 3FFCE 5FDWA 5GJSH 2DTSA 1X6LA 1KBGL 3H9SE 1NL0L 5TQ0L 5DVLA 5D7JB 5C86A 3TO4D 5EC1A 4GLRH 2C3VA 1KXQE 4PRBA 2FJHA 5D5MB 1T0NB 3ARBD 2VDRH 3EGSB 3B9EA 1FVCB 2H2SD 3A6CH 3PJSA 4GMTH 5DFVC 4B7IA 3FTGB 4JFFA 4NCDA 1KCVH 3WSQH 1UGNA 5JHDD 4OB5L 2IADA 3SE3C 5D1XC 4JFXB 1HH9B 2FSEA 1Q0XH 3RDTB 2YPVL 5CEZH 3U6RB 1KCUH 2F54D 1CU4L 5FYJE 3NGBB 2DM2A 1BQLL 2Z91A 3EOTH 4HPOH 5FKPB 3I84A 4XPGL 3TT3L 4RMUA 1OPGL 1ZA6B 3KPSE 4JG1H 1IKNC 1T4KB 2EDBA 1AJ7H 1O7SA 2VDLH 3BKJH 2Q6WB 3MRMA 3QQNA 4KHTL 4KDVA 3ZKNC 1CG9A 3PWVA 3UBXB 1X44A 3BD5A 3OXRA 4W68A 1ACZA 4JZJC 2GK2A 3P30H 4R7NA 3S98A 4G3YH 1U8KA 2EO9A 2BC4B 1Q9WA 4Y7MA 2AK1H 4WHDA 3CIQA 3X3GH 4GT7A 1K4DA 4GFTB 4J3OC 1BP3B 2ESVD 3BMWA 1SVCP 2HFEA 3D39D 4PJDE 1SBBA 3DV4B 1KCRH 4CW1B 1Y18A 5I2IB 5L2KD 3HPLB 3LDBB 3PV6A 4NZJA 3UTTA 1I1YA 1C7TA 3MA9H 1EO8H 4OF6A 4UDTB 4WU7A 1KJMB 5T3XH 4PGCB 3TBSA 4N5EC 5KSBE 4LLUA 5DMYA 2RBLA 5EFIA 1P9MA 4PTUB 1C5BL 4Q9QL 1G7QA 2YBRB 3HE7A 2YUXA 3CGTA 4BQ9A 1MREL 3IDYB 2IAMC 3DGGB 1QYGL 4NOFA 4U1LA 5BZWB 3G5YB 3NZ8A 2YMXH 1EUTA 3V79C 5EBWA 1MRFH 1DQLL 1K5NA 5JDSA 4DK6A 5IG7B 5C0IA 4N0CD 1HHJA 4XC3H 1E4WL 3E6FB 5E8NB 1YYMH 4XVUD 5DJ0B 3O3EA 4RIRB 1C7SA 5GGTL 1IGIL 2VITB 3W81A 1KEML 5GGRB 1S8DA 2FRGP 4MA1C 3SKUD 5HHNA 3ARPA 1T3FA 4KI5D 4U7KA 2Y4SA 3KYAA 3OPZH 3Q2CA 1E0OB 4K2UL 2P5WB 5J11C 2C1OB 4KKAC 1QR4A 1L7IH 2NY2B 4UQ2A 4RFEB 4IRJB 3HAEG 4JN2B 3VDBA 4M5YL 3STBA 3MV9A 2EDJA 4W6XB 1A3RH 3D18A 2QSTA 3STZB 2DTMH 2D7TH 2AJXH 2V9RA 1SMOA 2APBA 1MLCB 2ZCKL 5IROC 4YFLI 1VKXA 1OAKL 2CKBA 3M8OH 4FZEH 4XP5L 5IGXL 3SGDI 1ZLVH 2B1AL 3QUKA 2MJWA 3KYKL 2IAMD 2HMIC 2AW2A 2AERT 1OTUD 3X14A 4ENED 2V2TB 3T2PA 5C0GB 2VZOA 2BSTA 5GSVA 5J1AB 1HYRC 3BE1L 5JIIA 3U7WH 1HWGB 1JTPA 4ZPVB 1JNLL 4G9DA 5E2TL 1T20B 5KN5B 3RPIA 4WI6A 43CAA 1LEGB 1BMGA 1HN1A 3GNMH 4PBXA 5EA0L 4JKWA 4Z7NF 5DVKA 4CN4A 1KYOJ 2R23B 1NCAL 2AJ3B 3B9VA 5FCSH 2OTUB 5I1IL 2CDFB 1J12A 3PIQB 5DJ8B 4FFYL 1KCSH 2P1YA 3WL9B 4XMPL 2ITDB 1YPZA 1ZTXL 2IPKB 5CSBA 4IOFC 3E6HA 4P23A 5FYKH 3IFNH 2NTSP 1YPZF 4F58L 4HIXH 5FO9A 2JB6A 2R0WL 4JQXA 1T6VN 3VFVB 1PYWA 3RHWK 4HUWA 4N68A 2X44D 1FZMA 4M5ZL 2HT3D 1JYVA 2J6EA 4LVHB 2J6EH 5BVJA 4EI6B 3OKKB 4Q7DA 2ZZUT 4QRSB 4QHNB 4DVRL 1XR8A 3B9KD 5IVXA 4JR9H 1MCOL 1A6TA 3OG6B 5AZ2H 4RSVA 5CEYA 5LGKA 2XI9A 3LRSB 3VFTB 5IEHB 1S9KC 3EHBC 1AFVL 1IEAB 1JF6A 3MRQB 3QUMB 3U9UA 3T0VA 5GRJL 1RZ8A 1FZKB 3CVHL 1NCDH 3ZDXE 2R29L 4YIQA 1IAII 3GMLB 1RZKC 2FGZA 4FQIH 3E8UL 4YQXL 4AENB 4CMMA 2OI9C 4JEGB 3GBNL 4FNLL 1D5MB 1KPVB 2A6KA 2P5WE 1HSAB 3Q3GA 2CLZB 2FLRT 1CE6A 3DSNA 3LKSB 3GM8A 2HG5A 2WNGA 3V5DB 4NJAH 1ZHNA 2WV3A 2ZUXA 3TIDB 4KJWC 4M1CD 4NHCH 4DCQA 4LARH 4TSAH 1IAMA 3BYYA 3VXOA 2P24B 1A7QH 4OZHA 3U7YL 1GGUA 4MAYA 5C3TA 5I16A 1EA9C 1S7XB 4DAGH 2DKSA 4JRYA 1GZPA 1JYNA 3SEPA 1IAKA 2DQTL 1VESA 5IIEA 1N0LA 2P7TB 2WQ8A 3K2UH 1ZLUK 4XBPB 3KYOA 3W9EA 1U8PB 1NAML 4ZSOB 2R8SL 3V52H 4ORZC 2NXYB 2GJ6E 3RZCC 3CX2A 2EO1A 4K9EL 5ADOL 4KMLB 2EDTA 3I3BA 2CIIB 4JFPA 5IB2A 2G2RA 2PYEA 1QLFB 4HMEA 2WWMD 5E1HB 2B8OT 4HS6B 1D5IH 3P9MA 5KVEH 4M8VA 1ZT7B 3MJ7A 1MFAL 3L5IA 1RUPH 1H3VA 3SDDB 3GSWA 5C07D 1ZHLA 4X7TA 5EBMB 1Y6NR 3H9SD 4M7JL 4Y4KA 3UZVB 4L4TB 1JNJA 1KJ2A 2NY4B 1X5ZA 1KJ2H 3AUVA 3BP7B 4P57B 2DQGH 4UDUB 1T89C 3FO1A 4NOBA 2CJUH 2PNDA 4JY6B 3DLQR 3NAAL 3NA9L 5IHZB 1YEHL 4GRMA 1BM3L 3L9RA 4YDKL 4ERSL 4M3KB 5CGYD 5C0FA 1MHPL 4KDTC 1LP9E 4C55A 3HI1A 4HPYH 5EN2B 1KIRB 5BQ7A 2A1WL 1QLRA 2VMFA 5A3ID 4Q6IB 5DK0A 2IMNA 3NIDF 1M7DA 1IM3A 2XA8H 1MNUH 1WT5A 2FBOJ 5DI8B 1EZVY 1HH6B 4PRNA 4Y5VB 2HVKA 5FYJD 3T4AB 3VWJB 3VXRB 2NMSA 2AEQL 5ITBL 5FF6A 1V7ML 3HCVB 5F7YC 5BW7A 4H88H 4P3CL 1VENA 4ODWA 1L9NA 5CLWA 1AR2A 5E94A 1WISA 5H37G 1F3RB 1YMME 1GPOL 4OKVA 2PTVA 4LIQH 2P4AB 3FRPA 1L4IA 2IFFH 3TYGL 4K23L 3O9WB 3Q6GH 2DQEL 3WIIH 2ZUSA 2XN9A 2WBJA 4YPGA 3RVWC 2YEZA 5FECB 3GMRA 3HZVB 4MYWB 4HUMB 3QDGA 4AL8H 3FT3B 5H35B 4OZFB 3GSRA 3RUGF 2JCCB 3X12B 1G9EA 4RAVA 4LMQI 4W4OA 3QEQE 3RGHA 3V6FA 1BVKA 1FLRH 2NY6C 1NEZG 3KXFE 3PV7A 4I0PC 2BRQA 2Q20A 4ZSOE 3JWOH 1OLLA 3GJFA 3GSOA 3JSSA 1NDGA 1TDQA 3GJFH 1NSNL 2CR6A 4KV5F 1AGBA 4LHUB 5MEQA 2OS7A 4Z7UE 1XCQB 3BDYH 1R3LB 3K3QA 3MGOA 1B0GA 3EFDH 5HVHB 4ZUSA 4MJIB 5J13B 4OFKA 4Y16B 2BHUA 5I19H 1J1PL 4WW2A 1ZS8B 3FT4A 1R3IL 4LHQB 4NO3B 5EIVA 2Y07L 4R4NC 1R5VA 1MH5A 5EC2A 2DBLH 4L4TE 5D1ZB 1FL3A 1UT9A 5D7JD 5MEPA 3BW9B 1U3HB 4I5BA 3NACL 4O51B 3MXVL 3WNMA 4PGDA 1I7UA 4EI5B 5JMRA 1J11A 4DZBB 4AZ8A 4GJTB 2GYSA 5GGQL 4A2LA 4JDTH 1F4XL 1CLZH 3ZYZA 3VWKC 3D85B 4KMTL 4XGZA 2BOCB 3BI9X 3G5VA 1SM3L 2FR4A 2VDMH 5GGSY 4XI5D 3UJIL 4M6NL 7FABL 3VD9A 5FGRA 1KELL 4KK8D 3RDTD 2M1KA 1FYTA 2Z8WC 5F3HA 3QIBA 1D9KA 3VXRE 4OIIH 3PWLB 3KVQA 4GAJL 2CIKB 2P5EB 4WHCA 4EVNA 3G6AA 4E42B 4NP4H 4FP8L 4ZPTB 5ALCH 3LRGA 4JANA 3W2DH 3IAPA 4NM8L 5D7LB 1NFKA 3ARUA 4Q97A 2CUIA 4LCCA 1N4XL 4ZD3H 1A9BB 1NCCL 1I85C 2Q87A 1VFAA 1R5IA 2ILLA 4M61B 4NO0A 1YNLL 3CCHA 4R4BB 2JCCE 1JK8A 1F6AB 3VJ6B 3GUTB 3MLPA 1J7VR 1W0WA 2VXSL 2C5DC 1HYSC 1G7IA 2Q86A 1U58A 3TA3A 1B3JA 3HUJE 2PKDA 4XPAH 1EGJA 4YDLB 1EGJH 3V4PH 3TNNB 1TQCC 4U0QB 1INDH 3VXPA 1DN0A 2CO6B 4G8EB 2GI7A 3BKML 5F97E 4PV8A 1D5XB 4N0UA 5CINL 2A83A 1F97A 3QG6B 1P2CB 4MNHB 3C60A 4PJ8A 1TJHL 4LPYA 3LKOB 4FFVD 4OCYH 4LLVB 2LTQC 5FM5M 4LSSH 3QCVL 2J8UA 3FCTA 2HAZA 3BWAB 4Y19A 2R0KL 5I76A 5ICZA 5L88H 3RY4A 5F9WC 3CDFA 1Q9KA 5DD1H 5FYLE 1BD2A 1NFDA 3D25B 1OOAA 5AWNH 1OF2A 2DI9A 4TTDD 3B2UD 4POYA 3QXVA 1X5XA 3CSBA 4ONGL 1DUYB 3UTPE 5HI3C 3MXWL 4HQQL 1JZ4A 2HP4A 1XR9A 5GISH 2IQ9L 2R4SH 4NQXB 1CLCA 1FV1A 4G6MH 3TYFB 4M9PA 4OZ4B 4XBGA 3OJDA 2Q8AH 3C9NB 2P5WD 2VLLB 4NZDA 4LNRB 3TBTA 3CFKB 2NZIA 2ITCA 4E0RA 3CMOL 3ZE2E 3RL1A 1HEZA 2NY2D 3I50L 4OD1L 4IRJD 4ISVA 4LU5H 2YPKA 3W39A 4K8RD 3LY6A 5ESQB 3PGFL 3QH3B 3VI4F 1A1NB 4RX4A 1QRNA 2HFGL 3MA7B 3EYUL 5F9JB 3EBAA 5DLML 1IAOA 4GXVL 5SWZA 2ZUUA 2P5EE 1C16B 1CS6A 2K3TA 2E7HA 3DO7B 1QKZL 3IU4L 1FL5A 5GRVK 1YEJL 5JZ7D 1AGFB 1YN6A 4Z8FL 1PZ5A 4DFHA 1NLBH 5A2FA 2GITA 2XPGA 3VGDA 4DKFL 5IFAL 2BJML 3MC0A 4AH2B 1ZWIB 2VLKE 4DKEL 2BHYA 3QPXH 1AGDB 1YNKL 4K8RL 5E00A 3OJMB 4GBXB 2PR4H 4K3JH 5FM5O 4GW1A 4KAQL 4YHKL 1RIUH 4NQCB 3B43A 3R8QA 3QXWA 1UJ3B 2A77H 2HVJA 2GCYB 2OSLA 3WNPA 2UVFA 3GZKA 5AAWA 4GKOA 4XBEL 3R06B 5IBUG 4CRPA 1HWHB 3SDXA 2AJUL 4JFEE 4UU9A 2W60A 1K85A 3L5HA 3LIZH 3IETB 2BXZA 4PJIF 1NMAH 1RUML 3RWCA 1K4CB 1TZHA 4NHUB 1AGEB 3NCJH 5DYOB 1U95A 3DPBA 2DLFL 3U48A 2YZ1A 1FVDA 4PLNC 1ZVSB 4ZFGL 4M4PA 3PWNA 3HZYA 2VZ3A 3H9YA 4Z7VF 3P11L 4H20H 2ADGB 1T2JA 3BIAX 1XGPB 3ZKXB 1YMHB 1GGYA 2IPTL 4XWOD 1M6OA 1MEXH 2D9QB 1R0AH 4LCUA 5GQBA 4NDMB 4LGPB 4JVWA 4HW6A 2JB5L 1I3UA 1AXTL 1DBBL 5F93C 2VDPH 4YHPB 1CE1L 4PG9B 4FQ1H 1MHHA 2BCKB 1OTSD 2VJXA 3BRGC 3KYNB 3GI8L 1CICA 3RL2A 5JXAL 1KPUB 2ZCHL 1PKQB 3EYOB 2ZG1A 2NY4C 1T21A 2VKWA 1RURH 1QEWA 4HUUA 3OGCB 1CIUA 4LLAA 4JY4B 5JR1H 3RWHB 1SYSA 4P9HC 2DQCH 3LCYA 4EBQH 3M17A 4X8XA 1MAMH 1HHHB 4HS3B 3BH9B 3RWJB 4LDOB 3L5WB 2D03L 4G6AC 4FXKA 5F7WC 4FABH 1C5DA 3VFWB 2HTKD 5JHLH 1AQKL 1FGNH 5I1CH 2J4WL 5E6YA 4UT9L 4XX1E 4KVNH 3STLA 2NXYD 3RI5F 5D8JH 1OB1A 4R96A 4J4PD 3ZMRA 3SJVB 4PRAA 4GSDL 3VWJC 3NCYP 3PL6C 3WS3A 1Q0YH 2M2DA 3CVIH 3R8BB 2A6DB 4IRSB 4NQCE 4YXKH 3TPUB 4N9GA 3V6BR 2OZ4L 3QWRA 3MOAH 4NKIH 1IAIL 5DTFA 3B2VH 3IU3B 1TLKA 2EC9U 3OJ2C 2AJZB 3FAXA 3ZTNL 1FAKT 3RTQA 3ZHKA 3SDDD 5HYQB 3O9WC 5B8CC 5IFJB 1FZJB 4L4TD 4TSCH 3P4MA 2NY4D 1CQYA 4UIKL 4YHOH 3IYLW 4PB9L 2I60L 5K59E 4BK5A 4KXZI 4LAQL 1XH3A 2HT2D 2RCSL 4JFZH 4TOYH 4MB3A 3U2SB 1CDBA 4DJMA 1WIOA 2GFBA 5DEGB 4RAUA 1F4YL 2O5XH 3GIVA 3IGAA 1GRWA 2DS4A 3WFCL 3HC0A 5HHVL 25C8L 3EUUA 4ZFFA 3KDMB 5F7EL 4HZLA 2X1OA 4K3EL 2VE6B 1ED3A 3S4SB 1RAMA 1WFTA 2F53A 2Q8BL 3BGMB 3T8XA 4P4RA 1EDQA 3PQYB 4XNUL 1DQMH 4NZUH 5HVHC 4ODTH 4HXBL 5ENWA 1RD6A 3ROOB 3VWJD 4XCFL 5GS0H 1WZ1H 2LU4A 3VXRD 4U6YB 1A2YA 4CAGA 1X4YA 4I9WE 5LGJA 5C71A 2KQMA 3Q5YA 1CZ8H 5GGVL 2CMRH 1XGUA 5JOPD 1PKQE 3MCKB 1JV5A 1KBGH 3D87B 1NL0H 2C7UA 5TQ0H 3MUGA 2BX5A 3K74B 5KSAC 1KN2L 3O3DB 3VFPB 5FB8B 3O9WD 4M7KL 5GPRA 3TVMB 1P4LB 4N8VG 5KTEL 2AQ1A 4V2CB 3GMPA 2VABA 1J10A 2X4TA 1RZGA 2W65B 3W5MA 4WO4B 3V5HB 4OZIA 1FPTL 4LF3B 4XZUB 2C3WA 3QEGL 5E6IB 5IFHL 4OZIF 1BLNB 3MV8B 5EO0B 5INDB 1MIEL 3C09B 3NFPB 4NQDB 3I75A 4OB5H 3TJHC 3MNZA 4WHYG 1NAKL 2XRAL 5ERWA 3TO4A 5MEOA 2EEAA 4LDEB 4LHUD 2YPVH 4H1LA 2IWGA 4H1LH 2IQAA 4LKXA 2PXYB 1FFQA 3MRNA 1CU4H 1WC7B 4PRDA 4UILL 4ZNEE 1BQLH 1EHAA 3U4EA 3ARBA 3N1PC 4XPGH 3TT3H 4MJID 1OPGH 3MFFA 4Y16D 3DHMA 1G84A 1FFRA 4S1DC 4GRWB 3K80A 3SGKA 5JHDA 3MUJA 3MR9A 2B7DT 4KHTH 5D1ZD 4NC0B 1CDIA 3D69B 1U3HD 4G8IA 3RWDB 5FYLD 5HVGB 5F9AC 4EI5D 2R0LH 3CD4A 5KOVC 5IOPB 2YS4A 4GG6B 2B20A 2NY3C 1HNFA 3UTPD 1YEEL 3CSYB 1I4FA 3D85D 3GKZA 1FFPB 4UTBL 3SDYL 4NKDB 5IW1B 1RQ5A 3K8KA 3FZUC 3EO1B 2H2PD 5MP6L 3WCYA 3WUWA 1RJZB 2V7HB 4CVWA 2H9GA 4LK4A 4HIIA 1MI5E 4YBLB 3GSQB 4UIMA 5CBEB 1D3CA 2QQLL 4HWEL 5D2NB 5EIIA 1BQSA 3TF7C 1YUHB 2PF6A 1FJ1A 2RAMA 4NO2B 1BQHA 1ZGLA 5EUKB 4HKXA 4KKNA 1C5BH 2PETA 3QWOB 5DS8B 2P5ED 4Q9QH 4JO1L 2BNQB 4DGYL 3D0VA 2QKIB 4AMKL 1JI2A 1MCRA 1QYGH 2ESVA 4KROC 4Y89A 3D39A 1MRCL 1QACA 4ZO8A 4BQCA 1HHGA 5D7LD 1BFOA 1DQLH 1PDKA 5ANMA 4NM4L 5IMOB 5L2KA 5DF0A 3O8XC 1OAZL 2DLIA 1F58L 3ECBB 1E4WH 1AKJB 1NCUA 3QUZC 5GGTA 3IF1B 4OBRA 5GGTH 1IGIH 4PJAF 5F1IA 4OAWB 3RWEA 5EU6E 5DD0L 2O5ZL 1UH2A 5CJ8A 2ENYA 3QNXA 5I75B 1KULA 2EYTB 3PDGA 3U46A 2FWOB 3LN5A 5GHWL 5EWIL 3BPCA 1V3LA 5AEAA 3B8YA 4K2UH 2PW1B 3TO2A 3X11A 4NQDE 4PJ9B 1NBYB 2VAJA 3RWGA 3MRJA 4LBEB 3QEUB 5TH2B 4C54A 2DKMA 2X89D 3OKMB 4D0DB 1Y0LB 4M5YH 4L9LA 2APFA 1B4JH 3DROB 2ZUYA 2XY1A 1UKTA 4J3WA 4BZ1L 3ZDZE 1A5FL 1CGSL 5KOMC 1OAKH 3LZFL 4XP5H 1A47A 4E41E 3ARVA 4HT1H 5IESL 5IGXH 4OKDA 4AIZA 3KLAB 2B1AH 4PP2A 1VFBB 3KYKH 3TH2T 1JNHB 4IIQB 3BZ4B 2C4FT 2D4DA 2NNAA 3PXJA 3BO8B 3BZEA 5FCUL 2W9LA 4ZOEA 5FIEA 5C08A 2VISA 3BGFB 4GG6E 3C08L 2MCG1 4OQ1A 3AS3A 1JNLH 1ZHKB 5D2LB 3ZSTA 5E2TH 1G7MA 4JCLA 1X5JA 3HZKB 4N0RA 5EA0H 1KN4L 4LCYA 4BUGA 5ILTH 1NCAH 4QHKI 2Y5EA 5EOTA 5I1IH 1C1EL 5D2NE 2ICWB 4URTB 4FFYH 2DOCA 4L29A 4XMPH 1KIPB 4PBVC 1ZTXH 3FQUB 1MCBA 1D6EB 4F58H 4XAWL 2R0WH 4U6HB 3QDHA 5E99L 2BNQE 2I24N 4GXUN 2A73A 1EX0A 3PUCA 4M5ZH 3KHOA 1FN4B 4I13B 4EQ3A 1JWMB 4L5FL 4KC3B 4DVRH 2HT4C 3BZFA 4QHLB 1N3NA 3SE9L 3U0TA 1SJHB 4HFUL 1MCOH 1X3DA 3FMGL 3DBXB 3CSGA 1DQJB 4X9BA 4YE4H 3WDIA 1AFVH 3UX9B 2HYMA 4GBXD 3CVHA 2YRPA 5GRJH 3CVHH 4U05A 2R29H 4BFIA 3FJTA 4NQCD 5TE7L 3PDOB 1K8IA 1QHOA 1YY9C 1BBDL 3GBNH 3H9HB 5DDHA 4GW5B 1RFDH 4FNLH 1KXTB 3GMOA 1YYLL 5CIPB 1T5WB 5EO9A 5ACMA 3CFDA 3HPJB 4MS8D 1MHCB 5H8DA 3ZKQD 1L6XA 3B9KA 2Q3ZA 1G9ML 3EOBA 3TBVB 3IJHA 3ARXA 4PY7A 4QRQB 2R2HB 5FOBB 2DQUL 2CDGB 3UXFA 4F80A 5FM4A 1X4ZA 4YGVA 2Z8VC 2D3VA 3RX5A 3U7YH 5LXGH 4OM1L 1A0QL 3MBEB 3M1BA 3UBXI 4OI7A 2DQTH 3Q6FB 2NR6C 3WXVL 1DP0A 1XZ0B 3ZT6A 4DOHE 3HE6B 2Q1EA 2WIIB 4XCEB 4OGZA 1HOCB 3S8WA 2R8SH 3CDGA 2NW3A 4NNPL 3G6JA 3C8DA 4OFVA 1GIGL 3UPRB 3FB8A 3UTOA 4K7PH 3QFDA 2B39A 4HDIB 4MQ7B 4WV1B 5ADOH 1I3VA 4M48L 1HQ4A 1OAYL 5D2LE 1I1AB 1H8OA 3O45B 1SJXA 4UTAL 2A38A 3FN3A 2X4SA 1DUZA 4D8PB 4QHMA 4TVSa 1MFAH 4RWYL 2Y6SC 1U8OA 1ZVYA 2X4UB 3MPCA 5C0JA 2XWBA 3QXDB 4YFEA 4M7JH 2VR4A 4ODHL 3OKLB 2ARJA 1FVEB 1S7UA 3F62A 2NY1B 5EOCJ 3T3MF 1ETZA 4I4WB 5DRWA 1ZVHA 2Z92A 3MLWL 1BVLB 5F9DC 5TQ2L 5GGUA 4MWFA 3T2NL 3NAAH 3NA9H 1OM3L 1UXWA 1KIQB 1BM3H 1YEHH 4M3JA 4YDKH 1JRHI 2XWTA 1W8OA 3IRZA 3EDDA 4NFDA 1MHPH 5F89A 5C07A 1Q38A 1SJEB 2X4OB 4P46B 4NJ9L 5DGRA 3H9SA 4NQSB 1YJDC 2IFGA 2F58L 3QQ3B 4FFWC 2P44B 4DN3H 5E2UL 1T22A 2H8PB 3SJVD 2KL6A 5CD3B 5C0CB 3FONB 1S9VB 4IRSD 3JV6B 5EUOB 2FJFB 2AEQH 3L3DB 5IV2A 5ITBH 3MROB 4KK9C 3TIEB 4BSWA 2FEDD 3JTSB 5KS9B 2NTFA 3LV3A 2Z8RA 4P3CH 4KK6D 3QR2A 5E1AB 3N1QC 1MCCA 4WFGD 5C7XH 1GPOH 4M02A 1A3QA 3WN5A 3TYGH 4K23H 4LLWA 1T1XA 2DQEH 1KENL 1TZIB 2FATL 5C70A 3NZHL 3P4LA 4Y4FC 4XCYA 3FQWA 1UWEL 4J8RB 4C83A 4OGAC 4PJEB 2BNUB 3LEVL 4GXUM 5IMMB 2V2WB 4S0SD 4FG6C 4R0LA 1E28A 3ISWA 4YDJB 3SPVB 3ARGB 1NSNH 3MOBL 4LSVH 5D1QC 2FB4L 3QUXC 2EDQA 4HS8L 3GEWB 4X6EB 4XHQA 4BH7A 5BOZG 3PQYD 1U8IB 1A4KB 1OGAB 3KJ4C 3K1DA 3QDMB 4ZYKA 3NOIA 4X6DA 1CGXA 1GYAA 4YBQC 1S9XB 2ATPA 1J1PH 3OJVC 3Q48A 4NQUA 1R3IH 4JFYB 4ODVL 1OTTC 2Y07H 1LO5A 3PGDB 4JPKL 3RI5K 4PJDA 4ZUUB 3NACH 3DX9B 3MXVH 4HH8A 5GRWA 4MVBC 3TVMD 4X98B 3ROLA 3VRJB 1EJOL 4FQHB 1Z3GL 3DSFH 5GGQH 4GAFB 4WO4D 5KSBA 1F4XH 3MLVH 5E6ID 4KMTH 3WFHB 3S36X 5KSBF 4U3HA 4JREB 5JXEC 3MV8D 3UJIH 5J3HD 5E4EC 4F3FA 3WKNA 4M6NH 7FABH 4NQDD 4FG6D 5D7JA 5LCVL 1QVOB 4ODXB 5D2NC 1H3GA 5BZDB 1KELH 2LAAA 5BV7L 4MB4A 1KNOB 5C0CE 5K9KB 5FO7B 4WNQB 2PXYD 5D5MA 5EUOE 5C2BH 1T0NA 2FZ3B 1M1SA 3EGSA 3H2WA 4GAJH 1AHWC 1UACH 3EJZD 5I1HL 1A3LL 1FVCA 2GSGA 4JN1L 3UCRA 2VSDA 2XQYG 3FTGA 4YHML 4FP8H 3CK0H 3E2HB 2A2QT 2DF3A 4JLRB 5ISZE 4NM8H 1CGYA 5BO1L 1OTTD 1BGXL 1S7TB 1HH9A 3RDTA 1N4XH 3VXUE 3SO3B 4WEMB 1NCCH 3U6RA 4BQBA 5JOFB 4QXWA 4OLVL 4WWKC 5IM7B 5EULV 1S3KL 2UZYB 4WUUE 5FKPA 3AXLB 4M6ML 4PJEE 1GGTA 1KB9K 3EYQC 1ZA6A 4GQPH 1QOKA 2A6IB 1BFTA 4L4VB 3L3KA 4JO3L 1KUMA 1T4KA 3S3PA 5CS7A 3RQ3A 2VXSH 2X1PA 2XQYK 1Z5LB 5F7FA 4JRXB 2IF7A 5HGDB 4FXGB 2KBGA 5HHOE 5F7HA 4WFHE 3OAUH 5ITFB 4YHZL 5DRXB 1OGTB 1I8MB 2R2CA 2EXWD 1GCFA 3QDME 3ULUD 2ICWJ 4HD9A 3CX5J 3BRDA 5F6IC 4F7PB 3SDCB 3B5GA 3EJYD 2E8ZA 2BC4A 1KJ3L 4PG2C 2BNQD 1TJHH 1ZV5A 1BZ9B 4I2XB 4P5MA 4L8SB 5AAMA 3DV4A 2R0KH 4JFHD 5I2IA 4QTHB 2HRLA 4K94H 4IOIB 3UEZA 3F58L 4KKBD 1MJJA 4NBZB 1AKJD 4PGCA 1P5VA 3AREC 3ULUL 2MNUA 4ONGH 3O41B 4PTUA 3K2MC 4HQQH 1Q9LB 2WK2A 4LVNC 5JUEH 2IQ9H 2YBRA 3HRZB 5E2WH 3OAZH 2P8MB 2R39A 3DGGA 3RIAK 3OTTA 3RBGA 5FGCE 5BZWA 3G5YA 2OJZH 4PJ9D 4KFZC 2Y25A 2YD6A 1OAUL 3EYFA 3E3QE 4HCRL 4F9LA 3CMOH 5HYSB 3I50H 4Z76A 4WEUD 5E8PB 4OD1H 1RZKL 3U82B 2LV4A 3LEXB 3HMWL 1ITCA 3E6FA 3QEHB 1TPXC 3PGFH 5E8NA 5DJ0A 3H7BB 2HFGH 2VITA 3EYUH 5DLMH 5GGRA 3NN8B 4GXVH 4UAOB 5IWLA 1MHEB 1XF1A 3LPFA 3IU4H 4YH6A 1YEJH 1WUNT 5I1LB 3BSZL 4Z8FH 3S5LG 1UWXK 2CQVA 2VWEC 5LJYH 3WKML 2L7JA 4G43B 4DKFH 4F15B 2BJMH 5IFAH 3RZWA 2C1OA 4DKEH 4M4RA 4RFEA 4IRJA 8CGTA 3ZYJA 2GT9A 4NNYB 2GEEA 3TC9A 1YNKH 4JN2A 4JKMA 4K8RH 4K3GA 1ZEAL 1SEBA 3ZHDA 4KAQH 3WNKA 4XNYL 3STZA 4R97B 5DJXB 4EUPG 1MFNA 1IARB 1MLCA 2DKUA 2Z31C 1GXEA 1T83C 3EOAB 1CL7L 4XRCB 2Z91B 4JM2B 4JRXE 3K0WA 4JY5L 4LNVA 5C0NC 4NPYB 2UVEA 3U0WL 2AJUH 2WP3O 5E8DL 2V2TA 3MFGB 4NFBA 1RUMH 4JB9L 4ZPVA 1T7YA 4ZXBB 2JJSC 1T20A 2DLFH 4NUGL 4XNMB 4AQ1B 4ZFGH 1LEGA 2CK0H 5C1MB 1ZT4B 4LPVA 1J0YA 3SGDH 3P11H 1JP5A 2R23A 1F3JB 3AU1A 3LOWA 4PRHA 4MJ5A 2AJ3A 5DK3A 2IPTH 2OTUA 1KC5L 4F7EB 1K4DB 3PIQA 5DJ8A 1CI5A 3WL9A 2ITDA 4LRNL 5DHVB 2IPKA 3IFLL 2JB5H 1IL1A 3IDMB 1AXTH 1DBBH 1Y18B 4X8JB 1NBZB 1CE1H 4FQJL 3VFVA 3W82A 5JORB 3GI8H 4KUCD 4Z7WE 4RWHA 5JXAH 1AXSA 4LLUB 5IHUL 2ZCHH 4EI6A 4TUOB 1YEFH 4QRSA 4QHNA 3EO9L 3UPCA 2NY1C 1LP9F 3GDBA 3LRSA 3VFTA 5IEHA 1IEAA 3P4OB 2P46B 3MRQA 5EBWB 3QUMA 5FGBA 4P2RB 2KDGA 1FZKA 3QUMH 1K5NB 3MBED 5C0IB 4OI9A 4CVZB 2D03H 1HHJB 4YNYB 1CD1B 2XFXA 4DK3A 1D5MA 3O3EB 1MY7A 5I6XC 1AQKH 5CCKL 3JV0A 1HSAA 2X1QA 2CLZA 3HE6D 3LKSA 2V5SA 4UT9H 2J8OA 4J23A 3V6OA 3BHBB 1WCQA 3TIDA 5CD5C 3VH8G 5D7IF 2MOVA 5FKAB 2P24A 3BT2L 5JA9A 2XQBL 2OZ4A 5CEZE 2OZ4H 3M07A 1I1AD 1EBAA 5TDNA 4HX1B 3MV9B 2P7TA 1QSVA 3ZTNH 5BMFL 2XIDA 1S9YB 4XBPA 1PQZB 3E1F1 1U8PA 1ZLWH 4ZSOA 1EH9A 1FDLH 1G1YA 4PLKC 5IP4A 3MLRH 2FIKB 4GRLB 1UVQB 5C0BB 2F9BT 4J4PA 4UIKH 5C8JA 4PB9H 1T1YB 3QUKB 1JVKA 5F1SA 4LAQH 5GRZA 1DEEB 2RCSH 2GKIA 2N1KA 3T0DA 4Z7UF 1S5HB 1D5BB 1F4YH 5F88B 1QLFA 4OZGB 4GH7B 2MQCA 5GSVB 5T3ZE 3LQZB 4HS6A 4PP1D 3WFCH 2C9AA 2VKXA 1ZT7A 2J5LB 5HHVH 25C8H 5T1LB 5F7EH 3SDDA 4K3EH 1FFNB 3D48R 1MFEL 4NN6B 5EBMA 4P46D 3S9DB 4L4TA 2Q8BH 1J0IA 2CLRA 4MHHI 4U6VL 3BP7A 4P57A 4ZFZB 4XNUH 4LLDB 4UDUA 5FA4B 1ES0A 3J8F7 3MZTA 4HXBH 2H32H 4Y5XC 5C0CD 5DVMA 3O4OC 4JY6A 3IDJB 3WFZA 4CDHA 2CLVB 4MXWL 4ZG1A 5T3XE 3B83A 4YLQT 1OW0A 1T1WB 3C6SB 3VXNB 4M62L 5GGVH 2DMKA 3ALXA 1OP3H 5E8OB 4YK4B 4LLMB 4LAJH 1I9RL 3KG5A 3L7EB 5EN2A 1KIRA 1CCZA 3B5TA 1KN2H 2YRLA 4Q6IA 4M7KH 5BVJB 5DI8A 3EYVB 4P2RE 4Y5VA 1Z6JT 3T4AA 3TESA 1A6TB 4Q9CA 1W0YT 3HTLX 3VXRA 1FPTH 1I7RB 5J7CC 4ZOAA 3QEGH 5IFHH 4FRWA 2WMPA 3HZMB 3HCVA 4YEFA 3KLDA 4YIQB 4WEBH 1MIEH 3GK8L 3MUY1 1CR9H 1BFSA 3ARGD 1JPFA 1A6VL 3DVNB 1NAKH 2XRAH 2BOBB 4YC2B 5DUML 3RAJH 1G6RB 2XTLA 3KNBB 1QO3B 3UP1A 1IC4L 4UILH 1OGAD 3RX8A 4DCQB 3HZVA 3WDHA 3QDMD 3TPKA 4OGYL 3PDDA 5HGHA 1DLHA 3FT3A 4I48A 5D6DC 4OZFA 5H35A 2PN5A 3MV9E 2JCCA 2PUQT 4MA8L 2P49B 4OZFH 3X12A 1AI1L 1U36A 5IQ7L 3ILQD 5LGHL 4P2CG 4PLJC 1KYOK 4K3HA 1QNZL 2OMNA 4FZ8L 1JBJA 5DT1L 2WW8A 4D0CB 2Z4QB 3HC3L 1F4WH 3DUUA 4N1CA 3UTQB 4LHUA 1S7SB 2EDXA 1XCQA 1R3LA 3GMNB 5C6TL 3HUJF 2MPAL 4YHIA 4YHYC 1NBVL 4NBXB 4MJIA 4Y16A 4FHBD 1RZIB 1YEEH 3K7UA 1GHFL 3SDYH 4JFPB 4RFOL 1IKFL 1ZS8A 5MP6H 5CEXB 4GKNB 5D1ZA 4IM8A 4KHXL 4P59L 3RVXD 4KZDL 4X5XB 1U3HA 3U30C 4O51A 3SKOB 3O6FC 2QQLH 4HWEH 1ZHLB 5D9SB 4PJ7B 4EI5A 4Y4KB 2H3NA 1KJVB 4DZBA 1KJ2B 2AJYL 3SDCC 5B38B 2YUVA 2E7LC 1EUUA 4JCMA 3PGCB 2W9EL 4HJGB 3D85A 4OBSA 4UINH 5FYKE 1OT1A 4DGYH 4AMKH 2OXHA 4KKLD 1ZHBB 3JBG7 1MRCH 3K46A 2NXZB 3B6SA 5KVFH 3FRUA 1IQWL 3D3VB 2LABA 1WAAA 4NM4H 5DQ9B 5I71B 1F58H 4MNGA 3ZE2F 2FECI 4PGJA 2HKFL 5IVXE 3OR7B 3PP3K 3AY4A 4PJFF 3UJTH 3NPSB 3PWLA 4IMLB 5DD0H 4M7LL 2CIKA 2P5EA 4H8WC 4L4VD 4JKPL 4E42A 5GZOD 3SE4C 1X4XA 5GHWH 5EWIH 4NN7C 2YK1L 4ZPTA 5DC9B 2G5BB 1NCBL 1LD9B 4JRXD 1OWRM 3GJEB 4FQXB 5D7LA 1CFVL 1TZGL 4JG0L 2VDNL 4PJXB 5JO5A 1MCJA 1CGWA 1A9BA 1K8DB 1UQSB 1LO3L 2BNRA 3LKPB 3QUYB 5DRNA 1WGOA 1IGTB 4M61A 4EOWH 2ZSWB 3QDJB 4KY1L 1QR1B 2CRYA 4BZ1H 4OZHE 2QADB 4R4BA 1HKFA 3EKCA 2QSCL 1I8KB 1JPGA 1A5FH 2EE2A 2FYYB 2KZ1B 1CGSH 3VJ6A 5C6WH 3GUTA 2YD3A 1KB5L 4KRPC 1MCQA 2QV2A 2YEZB 3LZFH 4JRYE 3AB0B 3QDGB 2YD8A 3CH8A 2DQHL 5FUOL 3ZT5A 4U33A 3QULB 1MCSA 2X89A 3TNNA 1NGWB 5EORH 3WHXB 4MX7B 5FCUH 2V5RA 4G8EA 2C4XA 2VZUA 3SQBA 3OQ3B 1AGBB 3OGOE 4I8DA 3C08H 1D5XA 3GKWL 4EDWL 1LE9B 3QG6A 1P2CA 3VU2A 2XWJB 4FS0A 2PYEE 3BKYL 4QKXB 3LKOA 5HHPB 4LLVA 4CADB 4ZUSB 2IALB 3QRFM 1B9ZA 2IJ0C 4JJ5A 2YHGA 3BWAA 1NJ9B 2PO6B 1E27B 4ZOBA 1HE7A 3UBXG 1C1EH 2IG2L 3VI3F 4PJ7E 3RKDC 5BVPL 3D25A 5CBAB 2BVEA 4XAWH 3QP3A 1DUYA 3BGAA 1E4JA 2ZUVA 2VXTL 1OP5H 5E99H 4TSBH 4U0RB 1OP9A 2QQKL 4NQXA 3T08A 4GMSL 3TYFA 3C9NA 2VLLA 3HFMH 4L5FH 4LNRA 4DUXA 3CFKA 1PY9A 5F70A 3VXTB 3D3VE 3SE9H 4G8GB 5T1KB 4HFUH 3HNVL 3FMGH 3UPAA 4OFYD 4BFBD 1VGEL 4QF1B 1DN2A 5ESQA 2YWYA 4P4KB 2CRIA 3QH3A 4QTIL 1A1NA 2R9HC 3THML 3MA7A 5F9JA 5TE7H 4HLZH 2R4RL 1C16A 1FYTB 3QPQC 3BEVB 1P9MC 2F15A 1BBDH 1AGFA 1UH4A 1YYLH 1L0YA 2HRPL 2YXFA 3HE7C 4JM2D 2BSRB 3RJQB 3VGAC 3T0XA 1G9MH 1ZWIA 4OIAA 4L3AA 1AGDA 2DQUH 1MQ8A 4LIQE 1IEHA 1MOEA 1WEJL 2E27L 4GBXA 1P84K 4TUKL 3QDJE 4OM1H 1A0QH 5SWSD 4BELD 3RKDD 4NQCA 1WWBX 2XN9E 2A9NL 4WTWA 4ZXBD 1GGCL 1UJ3A 3WXVH 1M7XA 4GUPB 3BJLA 5T3ZD 3KWWA 3QQ9C 2JELL 3QDGE 3FKUS 4RZCB 1I1FB 2XYCA 1JK8B 1Q94B 3R06A 5DO2D 1FSKC 1XF5B 4K07A 1GIGH 5CJBA 4AG4L 2AABH 4P3DB 2Q86B 1J18A 3IETA 1CT8B 3VFUB 4M48H 1K4CA 1OAYH 1AGEA 2CK2A 4U3CA 2RGSA 2QJDA 5DWUL 2BMKB 5DYOA 4UTAH 3H3PL 4XCCL 1CFBA 1MFDL 1ZVSA 3VXPB 3MRHA 4RWYH 4UV4L 2ZNWA 1FCGA 5EU3B 5ICXB 2ADGA 3K4DA 1DANU 5J89A 4ODHH 1YMHA 2BVQA 4PRPB 3KPRB 3V7MA 1CD0A 4NDMA 3FCTB 3BN9C 4Y19B 5ICZB 4HG4K 4P2RD 3WHE0 3QHFL 5T1DL 3T4YB 1OAXH 1ORSB 1KLFA 3MLWH 2P43B 3B3IB 4PG9A 5TQ2H 2Q7YB 2BCKA 3EIFA 1NFDB 3T2NH 1OM3H 3KYNA 1ZAGA 3L5XL 3IVKB 1PKQA 3QXAB 3EYOA 3MCG1 4YAQA 1XR9B 4NJ9H 3WEXB 3OGCA 4QHUB 1C8PA 4G8GE 4KGLA 2F58H 4JY4A 4JFOB 5IQ9A 2JJTA 5E2UH 2AQ3A 3RWHA 3CJJA 1QBML 4ORGB 1TMCB 4BSVB 4CVXB 1MLBB 1HHHA 4HS3A 4RMWA 3TM6A 2ITCB 4P2QB 3BH9A 4S0TD 3VXQB 1HEZB 3RWJA 1FYTE 3L5WA 3S35L 3H3KA 5B4MD 4P23C 3SE3A 1A7BA 3VFWA 3MV9D 1JIBA 4JQXC 5KJRL 1F42A 4FQCL 1NKOA 3JWDL 3OB0K 4LGSB 1UCTA 3ZTJG 4W6YB 5HYFA 4GRLD 4J3VA 1MCNA 2GW5A 5C0BD 5C0DA 3SJVA 1KENH 2FATH 5DUPL 1M7IB 2A6DA 3NZHH 4IRSA 1LGVA 2UY6A 1X5YA 3OWEA 1NQBA 4ZNEA 3TPUA 4EXKA 1T7ZA 3GHBH 1BBJB 1S7QB 3IU3A 2R1WB 1DTUA 2AJZA 3LEVH 1TNMA 5DMKB 1CXFA 3UMTA 2VLRB 2VDKL 2EH8L 5T1LD 1U0QA 4YC2C 5HYQA 4UNUA 3MOBH 1FZJA 2E7MA 1Q72H 5JPNB 2FB4H 1H3UA 5DJ2B 3BOVA 5DQJB 3IJSA 5ACZB 3NVQA 5JNYB 2G60L 1E4XH 1NDMB 3BH8B 3U2SA 4IJ3B 4MAYC 5DEGA 2OTWB 1IC1A 2MHAB 4UT6L 1FRGL 2D0GA 4GKZB 5FYKD 1WZMA 4TQEL 4OCMC 4N0UE 4RRPG 4ODVH 4JFQB 2VE6A 4JPKH 1V5JA 3S4SA 4PRPE 3KPRE 3BGMA 2D31B 1LQSR 5DR5L 3MRRB 2J8UE 3PQYA 5DA0B 1MJUL 4Y19E 2MQ0A 4I0KA 4GG8B 1EJOH 1Z3GH 2VLJA 1UJTA 1M6OB 1KEGL 3EJJX 1BD2E 1NFDE 4U6YA 2DMBA 1B6UA 2PW2B 5EPMA 1REIA 2ZUQC 3GHEL 3QO0B 1RUAL 5IBLD 2D7NA 1BQUA 4PGBB 2D7MA 3L3GA 5LCVH 3O3DA 1CICB 3VFPA 5FB8A 5BV7H 3TVMA 1P4LA 4WFFE 4M93C 3NCYS 4AK1A 3MV01 3INUL 2W65A 4WO4A 5F6HJ 4KKCC 4X7FC 4LF3A 5I1HH 2NY5L 5E6IA 1A3LH 2Z35A 3CNKA 2NZ9D 4M8QB 1YNTB 3CLEH 3EDKA 3MV8A 5SWZE 2CXGA 5EO0A 1NC4D 5CZVL 1LEIB 5INDA 4YFDB 5D93B 4EEEA 3NFPA 1G6VK 5BO1H 4KJQD 2Z8SA 1BGXH 1G6RL 4XB8A 2KH2B 2PXYA 3MV7B 1WT5C 4OLVH 2Y7QB 1S3KH 2AEPL 4M6MH 3WS3B 4MXQD 4ACPA 5HYJB 4JO3H 1JF5A 2VLRE 4B7LA 3ZDZF 1MF2L 4N9GB 4GRWH 5BW7C 1HILB 5DTFB 2ZSVB 2X4RB 1DBML 5EG6C 3RWDA 2XTJC 1PG7X 2ZOKB 5F1NB 5I8EB 1QBLL 1AR1D 2E9IA 3SDXE 4Y4KD 2WIMA 4PD4J 3MRKB 5IOPA 4BFGA 2WBJC 1MWAB 4GG6A 3CSYA 1UM4H 4R8WL 4GG6F 1P4BL 4NKDA 5IW1A 1KJ3H 4LSPL 3BJ91 3EO1A 4W4OC 2X1WL 4RAUB 2H26B 5E2JA 3WXWL 2J7LA 1RJZA 1T66D 2V7HA 3V7AE 5LKNA 2NXZD 1CGUA 3JWOC 4HWNA 3D3VD 1VFMA 3GSQA 2CGRL 5CBEA 3B5HA 2GTWB 1ND0B 5M95B 1SJVA 2G9HB 3MQIA 1S5IL 1YUHA 4D9LH 1IRAY 3ULUH 4NO2A 5EUKA 1Z0MA 5DS8A 1I9IL 3QWOA 1X5LA 2BNQA 3FN0L 3JVGA 2QKIA 3DURB 4P0DA 2RFXB 4WW2C 5ADPL 1LNUA 3BEWB 1EZVX 2CD0A 4FQXD 4P5TB 1OAUH 4HCRH 4ZFOL 5IMOA 5HGAA 4NWTH 1RZKH 4CMHC 3ECBA 1TQBC 3AAZB 1A1OB 3S37H 4NC1C 2VIRB 3QUYD 1AKJA 3WUZA 3QDJD 1AO7B 3IF1A 4OAWA 3MLZL 4B5EA 1XFPA 2QADD 5JW4N 2FWOA 2J1KA 3BSZH 5IMLB 1MCHA 3DI3B 3QDGD 4G7YL 1AIFB 4L8DB 2PW1A 2BVUA 3WKMH 4PJ9A 4XWGL 1NBYA 3VD3A 3I6GB 3QEUA 5FK9B 1RI8A 4M9OA 5E03A 3OKMA 2BY1A 5HJ3A 4GAGL 4D0DA 3MV7E 2AJSL 1C12B 1ZEAH 3DIFA 2XACC 5GZNC 5HHMB 3DROA 1FYHB 3QCUL 2XG4A 5I74C 3QIBC 1WFNA 5MI0B 1D9KC 1JPTL 2DLEA 3S97C 3S35X 1CL7H 3N0PB 1YC8A 3BPOC 4JY5H 4XP4L 2ZPKL 3ZT7A 4JGUA 4LPCA 3MFFB 1JNHA 4IIQA 4MDIA 1F6LL 3U0WH 3BZ4A 4NKQB 2PO6D 4KQ4L 4TULL 4EN3B 3BO8A 4LCCC 2UWEB 1WBYB 5F1OB 1XF4B 4H5SB 4KI1A 4XMKL 2I07B 4JB9H 4LFHG 3VG9B 1ZHKA 1ZOXA 1I9JL 5IBTL 4RGMC 5JIKA 4BKLB 4XNXL 2AAVA 3CFIC 4NUGH 5AZEL 5D2LF 3HZKA 5FA3B 4G9FB 3RWIB 3ZLQC 1U8NB 4KRMB 5KBNC 4G8GD 5DFTA 5T1KD 1KC5H 3TA3C 1OAQL 2ICWA 3T3PE 3MRDB 1KIPA 2F53E 2VZTA 4QXGL 3MGAA 3HN3A 3IFLH 4P4KD 4Q9RL 3OXSB 3CLFL 2UYLB 2DM3A 2IH3B 3T65B 1CGVA 1SMAA 3L3HB 1Y6MR 4FQJH 1YJDL 4PJCF 5EIIB 4OSUL 2EXYD 4RGNB 3RVTC 1LO2L 3HLAB 1U9KA 1FN4A 1ZGLB 5IHUH 4P5KB 3C60C 4PJ8C 4X4XB 1N64L 2Z9TA 1JWMA 4LPXA 3G04B 4QHLA 2FHBA 1SJHA 4HUXB 5EU7E 1DQJA 4HKZA 2XZQL 5AG8A 3WO4C 1AO7E 5CKGA 2P8PB 3PHSA 4QY8B 1DFBL 1AP2B 4PB0L 1R24A 2AKRA 1IGML 3H9HA 2VH5L 5CIPA 5CIPH 1JGUL 1T5WA 5CCKH 4MHHG 1U91B 3HPJA 3CH1B 4XMLL 2OR8A 3QNXB 3P4NB 3LN5B 3TBVA 3ARZA 4C4KT 3L6FB 1CVRA 2R2HA 5FOBA 2CDGA 3I6KB 3BT2H 4DWHA 4OFIA 1P4IL 5HHME 2XQBH 3MBEA 4HLJA 3HKFA 4BFEA 5J1TC 4HUVB 3DXAA 3Q6FA 1SHMA 4ZS7H 3FQXB 1RK0B 5BMFH 1XZ0A 2B4CL 3HE6A 2WIIA 4XCEA 1HOCA 1BHGA 4XX1G 2G75B 4PRPD 4LPUA 1J0KA 1NGZB 3DX6B 3KPRD 4MQ7A 4WV1A 4PP2B 1J9CT 3MBXH 4Y19D 1JYWA 4FQLL 1I1AA 4NIKB 1NGXB 3RNKB 1N8ZB 1TENA 3ELAT 5JW4M 3QO1B 1J0JA 3LS4H 4D8PA 5C08B 3T2QA 4G9FE 1LO4H 2X4UA 3KS0J 3IXTB 1MFEH 3QXDA 2F5BL 3OKLA 3AM8A 4KPHL 5CHNB 1WV7T 4U6VH 4UV7L 1FVEA 3FOLB 1I1RA 2ATKB 3R0MA 2V7NB 2CPCA 3HRPA 3QIWB 4WFFD 4P2QD 4I4WA 3AS1A 1BVLA 1Z9OA 4MXWH 2V2XA 3ZSSA 4HC1L 4GKSB 4M62H 5DQDL 1S78C 4X9GA 4GLRI 1I9RH 3GIZL 1SJEA 2X4OA 4P46A 4NQSA 4GS7B 1P6AB 4X4ME 3L5JA 2DAVA 2H8PA 4QWWC 3D39E 3D9AL 5F8QC 5CD3A 4KK5D 5C0CA 4R4FL 4K7PY 1S9VA 5L2KE 2Q7NA 5ANME 3JV6A 5EUOA 1G7LB 1RY7B 2K7PA 4ZS6D 3KPMB 3WFDL 3MROA 4NQTA 3TIEA 3JTSA 5KS9A 2XV6B 4X99B 2VLRD 3MNVB 3O0RL 1CICC 4I1NB 5E1AA 2IEPA 4RBPK 3GK8H 2J2ZA 4KJYB 1A6VH 5DUMH 4R2GB 2YWZA 1FGVL 1TZIA 1IC4H 5JTWA 3T1FB 2C3XA 4J8RA 1YECL 2RB8A 4OGYH 4XCNA 2E6JA 3BD4A 4PJEA 3LH2L 4MA8H 5HD8C 1AI1H 5IQ7H 4X9FA 2BNUA 3BPNC 5IMMA 2V2WA 5LGHH 4PJEF 1QNZH 4FZ8H 2ENSA 4YDJA 2DDQL 5DT1H 3HC3H 4KI5E 3SPVA 3ARGA 2F5AL 1DVFA 4X6EA 1NAMB 3A6OA 5C6TH 1U8IA 1A4KA 1HXYB 4HJ0C 1OGAA 1MAKA 2MPAH 1INQB 4G6FB 3HNTL 3QDMA 1NMCB 3I02B 1NBVH 4PFEA 1S9XA 5C08E 1GHFH 5HDBF 1UG9A 4RFOH 1IKFH 5EU5B 4Y5YB 4JFYA 3RTQC 3TZVB 2X4SB 1E4KA 4KHXH 4P59H 4KZDH 4PV9B 1CICD 3DX9A 1TVBB 5FHBL 5C0JB 4G6JH 4K55A 4X98A 4A6YL 3VRJA 4FQHA 4X6CF 5ICYB 3OF6D 4XP9L 2BY0A 2W9EH 5L9DL 4PJHF 4G42B 1QHPA 4WWID 1QBAA 1FFOB 1VFUA 1NPUA 2AI0H 2YSSB 3F5WB 3BFOA 1KPRB 1IQWH 1U92B 3S4SG 1QVOA 4ODXA 5BZDA 1BWWA 2ERJB 1KNOA 4POUB 5K9KA 4DKAA 5FO7A 5I8CB 4WNQA 3MV7D 2HKFH 3SKMB 3VFMB 2FZ3A 5GS0C 4M7LH 4PJBF 5HYJD 4HIHB 3ZL4L 3TV3L 4JKPH 2E7BA 2BRRL 1NCBH 5IJKA 5IV2B 4IMKA 4JLRA 1QFOA 5GS1B 1U8JA 5EU7C 1CFVH 1TZGH 4JG0H 1FH5L 2VDNH 1AD9B 4E5XA 1LO3H 1JUFB 2NLJB 4HWUA 1AXIB 5IM7A 4KY1H 4LLWB 3WLWC 3HB3D 2R2BB 3AXLA 2QSCH 2A6IA 4L4VA 1KB5A 1KB5H 2BFVL 4XCYB 1Z5LA 3IKKA 3KYMB 4JRXA 1B4RA 5FUOH 4FXGA 1J86A 1JPSL 3F6IA 3VFSA 3OHXB 3TO4C 4Q9BA 5ITFA 5DRXA 1OGTA 3G6JE 4MXVE 1N6QL 1I8MA 3DETD 4WJ5B 5DJZA 5MHSD 2HTLD 2XZAL 3KHQA 1MWAL 2O5YL 1H3WM 2DQIL 4HK0B 4QGYA 3VFOB 3GKWH 4F7PA 2VXUL 4EDWH 5LWYL 2C26A 3ARBC 3U83A 2EDLA 4KTDL 3ETBF 4HHAB 3BKYH 2H2SC 1BZ9A 4I2XA 4X6DB 4L8SA 3CU7A 3NH7L 4IHOA 4CUCA 5KANI 4I18B 3SGKC 4P5TD 4IRZL 3LSOB 2R1XB 3MLUH 4QTHA 43C9A 5JW3L 4C56B 2IG2H 4IOIA 1LO5B 5EH1A 3SQOH 5F9OL 5TPWL 1VFOA 3SGJA 1AO7D 5JW5B 3O41A 1Q9LA 3UYRL 2QQKH 2P8MA 4PGZA 4GMSH 4ZO9A 4Z7WF 3WIFB 4HV8B 5HYSA 3HNVH 5E8PA 5C07E 5ESAB 4F3FB 3LEXA 4TVPE 5SX4I 1VGEH 4BJLA 3QEHA 1I3RB 4QTIH 5HHMD 3H7BA 3THMH 3O3BA 3IDXH 3NN8A 1QFUL 4U7SA 2R4RH 1QFPA 1MHEA 5I1LA 1IT9L 1QTYT 2HRPH 3MOQA 1JZ8A 5ETUA 2EICA 2GSGB 4G43A 3JUYA 4OFYA 4DEPB 4EN3D 4NNYA 1XIWB 2DQJL 3HS0B 1WEJH 4PY8J 3G9VA 4TUKH 1HNGA 5DJXA 2A9NH 4IEFB 3EOAA 5DJYB 4XRCA 2JELH 3V2AR 4JM2A 4G9FD 2APVA 1T2QL 2B2XL 1IVLA 3L3KB 3NCBB 2V17L 4NPYA 2OTPA 3AFLA 4LVOB 1BEYL 15C8L 4AG4H 1CDJA 4X83A 1BX2B 4N0CC 1QUNA 2EYRB 5C0AB 5SWSA 4L9LC 4L1DA 3OAYH 3AMLA 4XVUC 5C0RL 1V8HA 3SO5A 4ZXBA 5DWUH 2AEIT 1RULH 3H3PH 4XCCH 3HNSL 1MFDH 4XNMA 4RGND 5GGRY 5E2VH 3D1MC 5T3ZH 4X6DE 1ZT4A 4UV4H 3DYOA 4KI5C 3C6LB 4XP6L 3VRIB 5E08L 1P53A 2GAZB 1F3JA 1U3JA 1QPPA 3WIHL 3TT1L 1JHLL 4NYLB 1MQKH 1WVZA 4F7EA 4P5MB 2JTDA 1DLFL 4KH2A 5DHVA 5DHVH 3IDMA 4X8JA 3T0EB 3QHFH 5T1DH 1NBZA 3HMXL 1N5AB 1YEIL 3S88L 1MJJB 1A6PA 12E8H 4OD2B 5JORA 3SDAB 1DL7L 3L5XH 2C3HA 4TUOA 4N8VB 3TNMB 1XMWA 2RQ8A 2CUHA 1UA6L 4TUJB 2DI7A 3GI9L 1QBMH 1OTUC 5EDXA 4H26B 4ENEC 2KKQA 3VA2C 3P4OA 1B0WA 1N59B 3GFUA 3EYFB 4JAMB 4P2RA 5KSVA 4Z76B 3MCLL 4CVZA 5JDJA 4YNYA 1CD1A 1IC7L 5D5ME 3O6LL 2CDEB 4Z18A 2X4QA 5KJRH 1H8NA 4FQCH 3C2AL 3JWDH 4W4NA 3BHBA 1FAIL 2WP3T 5FXCH 2Z93B 5FKAA 5DUPH 3G5ZB 4OCSL 3GGWB 1P1ZA 3TBYB 1P7HL 1YDPB 2GT9B 2K9UA 4HX1A 5F7LB 1SEBB 3ARFB 5C08D 1S9YA 1PQZA 2EH8H 2EE6A 3ZKMD 1OCWL 2HT3C 4Y8DC 1WBXB 3MZGB 4GRLA 2FIKA 3AGVA 2DLHA 1UVQA 5C0BA 1P6FA 1EAPB 2E6QA 3B9KC 4KQ3H 1Y6KR 1T1YA 4JJHA 3JTTB 3QIWD 1DEEA 5C0AE 3MLSH 4KDWA 4LP4A 2DYPB 3QFJB 1S5HA 1D5BA 5F88A 3U4AA 4OZGA 4RFNC 3LQZA 4UT6H 1FRGH 4JO2L 1H3PL 4TQEH 3ULVD 3A67L 1UM6H 1UEYA 4I77L 4LOUD 5T1LA 3UTZA 1FFNA 2VN7A 2Y06L 2UUDH 1GZQB 3FN9A 3GBML 5DR5H 1EV2E 2DM7A 4NWUL 4ZFZA 4DFIA 4LLDA 4M1CC 5FA4A 1MJUH 3AU1B 3VRLF 4PRHB 4MJ5B 3T0EE 1A9EA 2IBZY 3IDJA 3MLYL 3C5ZB 1KEGH 5FUCE 2OJEB 5F7DB 2CLVA 3O6ML 4LSQL 4MNQB 1T1WA 1IL1B 3C6SA 3GHEH 3VXNA 1RUAH 4ZAKD 3FFDB 4K71B 3ULVL 5E8OA 3BYTA 4LLMA 4WRLA 3L7EA 1FBIL 1G9NH 5IK3B 1NMBL 1DQQA 1AXSB 4R2GD 1X5HA 2FDBP 3EYVA 2XZZA 1QSEB 3INUH 3ARTA 4OD3L 4RCAA 5B39B 3H3BC 5IVXF 1I7RA 2YC1B 2NY5H 4NN5B 2WWMC 1A4JB 3HZMA 2V5MA 5A43C 4P49A 1U8LB 1ULVA 5CZVH 3QZWG 4DZ8B 1JN6B 2XFXB 3OSKA 1KT2B 3DVNA 3I2CL 2BOBA 1G6RA 1J1OL 3KNBA 1G6RH 32C2A 3L7FB 1QO3A 1KSRA 1VEMA 2V9QA 5I73B 2A0LD 4GMTL 2XA3A 5J56B 4G6FD 2EKSA 2AVGA 5C09B 2AEPH 2NY0B 3UAJD 1H3TA 4X9HA 3BPLB 1X9QA 4LRIA 5T33L 4X6FB 5A2LH 3ZO0A 4OZHF 3ET9F 1MF2H 1NC4A 5TDNB 5GGVY 5CGYC 4D0CA 2Z4QA 3TZVD 3IFPB 3N1MC 2HJFB 3VGFA 4L8CA 5TF0A 4FFZL 5E5MA 3UTQA 5A3IC 1S7SA 1IQDB 2DJSA 4JE4B 2NW2B 3WN5C 1J8HB 1DR9A 1JHKL 1QBLH 3GMNA 5H2BA 2MSPA 3LD8C 2JJUA 3ALWA 4NRXB 3QFJE 5C8JB 3LRHA 1XAUA 4OV5B 1I8IB 1RZIA 3K8MA 4R8WH 4U1KB 1CLOL 1IGJB 1P4BH 4LSPH 1TTFA 4KJPC 5CEXA 3WXWH 4GKNA 4HZAA 4GO6B 4R0LC 1NGYB 1GOFA 4X5XA 5ACLA 3SKOA 2MFNA 2CGRH 1ADQL 4FMKA 4PRHE 5D9SA 4TVPD 4PJ7A 1S5IH 2ADFH 5GRVL 1KJVA 4Z95L 2CLRB 1CQKA 5B38A 2GJZB 5I9QB 4OCNC 1YQVL 2B0SL 1ES0B 1I9IH 2H32B 3PGCA 5B21A 2VLMD 2CO7B 4HJGA 4MNQE 5DHXB 4APQB 1NUGA 3FN0H 1FNHA 3RGVD 5ADPH 1UZ6E 3MA9L 2OQJB 1ZHBA 2COQA 5I17A 2VZ1A 4Y2DB 4YJZL 1NH6A 4ZFOA 4J7RA 3D3VA 4LCIL 1CDCA 5DQ9A 4MMXC 5I8OL 1VGKA 3B9DA 5GSRB 4TVPL 1HIML 3OR7A 4U1GB 4P99A 3MLZH 1J1XL 4IMLA 4MQXD 2NYYD 3VMPA 4F8TA 1CTOA 2QHRL 1UB5B 2G5BA 4G7YH 1LD9A 3PF2A 3ES6B 3GJEA 3GSNB 4FQXA 4XWGH 4ONFH 2JK5B 4KJPD 2BERA 2I27N 4PJXA 5D7JC 1K8DA 1UQSA 1XCTB 2AJSH 3V6OE 3CC5B 3LKPA 3QUYA 4G8FA 1JPFB 1WWAX 1IGTA 4OUUB 5C09E 2DL9A 2ZSWA 3QCUH 3QDJA 3VXMA 1QR1A 5J06A 2K7QA 1I8KA 1JPTH 2FYYA 1EHNA 3QYCA 4XNQB 1L7IL 3ZDYE 1A6WL 5HGHB 4XP4H 1DLHB 3NABL 2ZPKH 4I48B 4K3DH 4XI5C 1JCKA 4IDJL 3V4UH 4HEME 1G7PB 5E0QA 1MVUB 3OB8A 1KCLA 1MJ8L 3QULA 1IGFL 4OQTL 4HH9A 4TULH 2DTML 1NGWA 4C56D 1J8HE 4Z6AT 3TGXA 1A21A 4KK8C 3RDTC 5EZLB 3WHXA 4MX7A 4F7TB 2X5PA 3AC0A 5DJ6B 2Y72A 4XTRD 5DURB 4FZEL 3DUUB 4JDVB 2CKBL 4XMKH 3NGBC 1I9JH 5IBTH 2XKNB 1LE9A 3DYMA 4XNXH 5AZEH 1T5XB 2XWJA 3GSXB 4U1JB 4ZUTB 4YHIB 4U6XA 5HHPA 3H7LA 4CADA 2IALA 1F11B 3IKCB 3IDIA 5D70L 1NJ9A 2R15A 1HK6A 2PO6A 1E27A 3QXUA 4WW2F 3BQUB 1W72B 1MCIA 5JA8B 1B6DA 3QXTA 4QXGH 3AS2A 5CBAA 4Z7VB 2D7QA 3D5OF 3DRTB 1YJDH 1B0RB 4OSUH 2H3NB 3DMMA 1LO2H 4AEHL 1N64H 3ULSB 3MRFB 3FB7B 3SE8L 3VXTA 3BUYB 4G8GA 5T1KA 1JF1B 2B5IB 4HIXL 4XXDB 1ERNA 1XIWD 3DV6B 1PG7W 2XZQH 3LDBC 4K94C 4QF1A 3B6SB 4P4KA 3FRUB 5CWSB 4OF0A 3QI9B 1N0XL 1DFBH 3VMNA 4MNGB 5J6HA 4PB0H 3BEVA 1KLUB 2VQ1B 3MJ9L 1IGMH 3DOSA 2VH5H 3VE0B 2ORBL 3SGEI 1JGUH 3P0YL 2JJVA 3QJHB 2BSRA 5IEKB 3HA0A 4OV6F 3IDYC 4FFVC 2EECA 3MRBB 3V0WL 4HIEB 4PS4L 5JOPE 3P77B 3MJ8B 4DTGL 4Y4HB 4F9LC 3BAEL 4FQIL 2IPUG 3OKOB 1P4IH 3RVUD 1AH1A 5C0AD 5D71L 2EC9T 5JO5B 1FNLA 4TTDC 3B2UC 1EFQA 4F9PA 2BNRB 5HYEA 4YO0B 2AXGA 1LO0L 4GUPA 2NX5B 5DRNB 3DRQB 5IWLC 3SCMB 2EIBA 5EBLB 4RZCA 5IVZB 1I1FA 4LARL 2B4CH 3QIUB 3C6LD 1JPGB 5TFSL 1Q94A 3MREB 5CUSL 3MX0A 4P2OB 1XF5A 5ID1A 5A16B 5ABDE 5B3JF 1BF2A 2NY2C 1SY6L 4P3DA 4IRJC 4O2FB 1CT8A 5HTSA 2IPUK 4K8RC 3VFUA 5I1GL 3T0ED 1ZK9A 2D0HA 4FQLH 2ID5A 3F65A 2BMKA 3EFFB 4HBCL 3SDAD 1J05A 4MJIE 5JZ7C 1LILA 4N8CH 5EU3A 5ICXA 4NQEB 3EDEA 4LMQE 1ACYL 1G0DA 4B41A 4PRPA 3KPRA 5A2KH 4UV7H 5C6PB 1VACB 4JJ5B 5EIQA 4Z7VE 1F3DH 3CFBB 2E7CA 2HFTA 2J8UF 3T4YA 1ORSA 4WDIB 1UH3A 3B3IA 2Q7YA 1TTGA 4X4ZA 4MQTB 4HC1H 1QSFA 4HIJB 2DD8L 4JPIB 5K9JL 1NFDF 5DQDH 1QP1A 3MRPB 4LSUL 5CJXA 3IVKA 1CDYA 3QXAA 1RIHL 1YY8B 3Q0HA 3WEXA 2X2YA 3KAAA 4QRUB 4POZD 3RVVD 4QHUA 5FHAL 4OT1L 4L3CA 5TJWK 4JFOA 2DMCA 4ORGA 2DQFB 3D9AH 4BSVA 3KJ6L 4CVXA 4R4FH 1MLBA 2VB5A 5L0QB 1WAAE 4X6BB 2HLFD 3VXQA 4P2QA 4YXLL 5I8KL 2FNBA 1HHKB 4MNGE 3ARDD 3OV6A 3WFDH 3UZEA 5GRUH 3ARFD 3QHTC 4E9LA 1JWUB 1MNUL 2FX8H 3O0RH 3ARRA 2VDQL 1WBZB 1WIPA 4LVHC 4RISH 4HKBB 1EPFA 1U3ZA 2X6MA 1FGVH 5DSCB 4XWOC 1FQ9C 5D7LE 1M7IA 5DRZB 4H0HB 1DSFL 5FGBC 2ZNXA 2DYPD 3QFJD 2BNRE 1BBJA 4F37F 1S7QA 2R1WA 3N1FC 3FL7A 3LH2H 4UBDD 2NX5E 5C3LD 1OTSC 2W91A 3A6BL 5LQBL 1P7QD 3OBAA 1T04B 5DMKA 2VLRA 2IFFL 3H9ZA 1FNGA 2DDQH 4Z78A 4OLEA 3KWWB 2F5AH 5JPNA 2KPNA 4RMSA 3V6OC 3CFEA 4AL8L 5DJ2A 5DQJA 5ACZA 1QFWM 2UZXB 4PRHD 1KACB 5JNYA 1NDMA 3BH8A 4J3UA 3HNTH 3QT2A 3C5ZD