3CC5B

H-2db complex with human gp100
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Design of agonistic altered peptides for the robust induction of CTL directed towards H-2Db in complex with the melanoma-associated epitope gp100.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 16
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cc5B00
1JPFA 4L3ED 4ZSOE 3PWLA 1MY5A 4Z8FH 4OTXL 1AGFB 5ALBH 1KIRA 4ZFZA 1AXSA 1FH5H 4PGDB 5GIRB 1GZQB 3HUJE 1K3ZA 4GW5B 3MV7A 1W72L 5H94A 2H3NA 2FO4B 2RJMA 3GMMA 3OKEA 4JQIH 2FR4B 4KMQA 5E8PB 1KN2L 2D7TH 4ZXBD 1UM6H 3WLWC 4QT5A 2VXTL 4OFKA 2FBOJ 1OAXH 1Y6KR 4XNXH 5TQ0H 1EFXA 1U6AL 3S3PA 1JZ5A 4D9LH 1IAII 3NACH 4JPKL 2JCCB 3MRJA 3C6SA 1ETZA 2DL2A 2E7BA 5DSCA 4KDTC 3TNNB 1MRCL 3NN8B 4CMHB 5D7IB 3STBA 2VZ1A 4UTAL 4PJIE 2DQUH 2EICA 4GRWE 5I15L 5F6IB 4N0CC 3LQZA 4TUJB 4NM4L 1ZT4B 4YHLL 3WO3B 3FQUB 2ILLA 3QIBD 4TQEH 2RCSH 1JGVH 1HXMA 2BVQB 4F33A 1X5YA 2WIMA 3D85D 1HE7A 1J7VR 3RDTD 1OGTB 3MROB 4CN1A 4XWOD 1YQ2A 3ALWA 4KDVA 5BMFL 2XN9D 2VE6A 1F13A 5MP6H 4YBLB 1VPOL 1IAIH 5GJTH 4NO0A 4O2FA 1T0MB 3H9HA 3IGAB 5IMKA 3QZWB 3L9RB 1TZIA 4ZQKA 4OJFH 4RSVA 3TO4D 2MHAB 2A74B 3IXTA 3W11C 5EU3A 3I6KA 1ZLSL 5IVXA 5LWYL 1ZLUH 3DVGB 3MV8B 4ODHL 2DJSA 1M4KA 3F7VB 4HLZG 3UYPA 3FZUC 2G60H 3EFDL 5I1EH 1IL1A 1ACYL 3AB0C 4KTEL 4NC0B 1QVOB 4C4KT 1KCUH 4Z0BH 4TSCL 5FDWB 4M6MH 4Q0XL 5A43C 3MRCB 4JEGB 5HDBE 1KCSL 4PGEA 3DRTB 1MWAH 4BH7A 4LEXL 2JB6A 1EEZB 1BOYA 4E5XB 1IM3B 1LEKB 5J9PB 1NFDE 4BSVA 2COQA 1RK1A 2BNRA 5KTEH 1QP1A 1VFUA 2ZCLH 3GIZH 5IVXF 3CVHB 1QSZA 2IPUG 4NKDB 4WU7B 4ZFOB 2BFVL 4BH8B 4KK6D 4XPAH 4OFIA 5GJSL 3T1FB 4H20L 4NNXA 1Q9WA 3QXDA 3FO1B 4D0CA 4AEEA 4AK1A 4V2BA 5C0CD 3CX5K 3RZCC 4Q9BA 3WL9A 5TDOB 3FKUS 5FUZL 1UB6B 3QPXH 1MOEA 3EOBA 3FQNA 4U31A 1NCNA 5B21A 4JREB 1F4YH 2IMMA 1J1XL 4K94C 1RZJL 1TPXB 1T4KB 1HQRB 2VIRB 2X9YA 2FBJL 5EA0L 1EO5A 1RZFH 4D0DA 4JKPL 4M4RA 3UO1L 1KYOJ 2VDML 2VO5A 4GW1A 3LRHA 1F3JA 4DTGL 2Z31B 3VGEA 3C5ZB 2I07A 4Y19D 2XKUA 2DN7A 3GJFH 3X13A 4QRUB 1U3JA 2Z4QB 1Z9SA 3RA7H 4NQUA 4UINL 4X7EC 3N9GH 1HZHH 4MNQD 1FO0H 3KXFB 4R4BB 1PY9A 3VFPA 5I74C 5HDQL 2Y6SC 3IAGC 2UWEB 5E2VL 3CPLB 5FO8A 4OLWH 4L8BB 5D1XD 4FQPA 1UCBH 1S7SA 1ZLVH 4XRCA 3EYOA 3ARUA 4WHDA 1SM3H 4X5WA 4ZUWB 3WJJC 1QSFB 2DTMH 1NGZB 3O0RH 2YN5A 4KKAD 4M5YH 1BF2A 2VITA 1RIVH 3E6HA 3F7QA 3ARSA 4RMUA 1YA5A 2R1XA 1IAKA 3FL7A 5AYUL 3KS0J 3LPFA 3GKZA 5KBNC 1BGXH 3C8DA 4M6NL 4JQVC 5CINH 1NL0H 3QIWD 1RIUH 3GI9H 5ISZE 3KWWB 1R24A 4L8CA 1NAMA 4YUEH 5CLWA 3SY0A 1JGUL 2F5BL 2H2PC 3CFDB 4H26A 4JM4H 1J8HB 3R06A 4JVUA 1RI8A 3SDAC 4P23D 2DWEB 3EZJB 3HZYB 3B2VH 3CAFA 4WI2A 1H3GA 4KQ4H 3GMLB 2LVCA 5GQBA 3ZHLA 1TVBA 4PJHA 2AXHA 3LHPL 5FGBA 3QNXB 2H2SC 2EYRB 4NQEE 2C4FU 3DLQR 1RHHB 1WIOA 4MXQC 4WO4A 1LO0L 3MLYH 3D87B 2YA0A 2OI9B 2EEAA 5MEQA 4HLJA 4YZFE 1F58H 2C3VB 1OAUL 1J05A 1A1OB 3BI9X 1YMMA 4LCCC 5D2LB 3DROB 4NQXA 5F8RC 3VD5A 1HOCA 1JPSL 4C54A 5FYJD 5JQ6H 4WI8A 3I50L 2FH6A 4Y8DC 4JDVB 2XV6B 4S10A 3C6LA 3CIQA 4Z76B 3TJHC 3B3IB 1RMFH 2YD4A 2IEPA 4ZO7A 2YA2A 1CI5A 2PKDA 3OAUH 2Y36L 3KPRD 1ZHKB 4FOMA 2NY4B 1AGBA 2ZPKL 5JUEL 1T21A 5HHQB 1WISA 1WBZB 1CCZA 5D1QB 1FV1A 5F9JA 2WWKT 3SQOH 3NABH 5FV1L 2NNAA 5DMKB 2ZUWA 1Q9LB 1EXUB 4J3XA 3RVTC 1L7TL 1PX4A 5F3HB 4PJAF 5IMMA 5HHXL 3QUZA 4HF5L 4Q74A 4JRYD 3MR9A 3PWNA 4JE4B 4ORGB 1FVEA 4MXVF 4EDXA 2CMRH 1JPFB 2EDDA 2FATL 3O6FA 5FUOL 4KI5E 3KYKL 1UFUA 3PWLB 2ATKA 4EUPA 2CRMA 2PO6C 5EBMA 3ZHDA 1KIRB 5E6IC 4HGWB 1J1OH 1AXSB 1CFSA 3WFDH 3MV7B 3PHQB 1B4JH 4H8WL 5H94B 3DXAE 1KPRA 4NWUH 2G2RB 2OL3H 3IDMA 3GMMB 3A6BL 1KB5H 1ZTXH 3F65A 4QT5B 1KIUA 3U0TB 4OD1L 4XMKL 1KEGL 4Z7UB 1FVDB 1EFXB 4FA8A 2CK0L 4NN5B 1YN6A 4Q9QL 3MRJB 1XIWA 4XP5L 3C6SB 1ETZB 4NBYB 5HHPB 1B0RB 1CD0A 4FZ8L 3WXVH 4IBLT 1UZ6E 3DV4B 1G6RL 2DQDH 5IMLA 5F9WC 3BP7B 4Y88A 3GSNB 3TVMA 4KROC 2XNAA 3WSQL 4JFDA 5CKAA 5DMJB 1AFVH 3GB7A 4JVPA 1P7QA 4FS0A 5GISL 1ZEAH 1FSKB 3S35X 4F33B 1OTSD 5EBGA 1T0NA 4HHAA 3RIAF 1T03H 4N5UA 4L3EA 1A3RH 4WNQB 5I8KL 5SWSB 4URTB 2PYEB 2QJDA 3EOYG 3ROOA 4GRMB 2VTFA 2UVEA 3RWFA 2VE6B 3IDJB 5IQ7L 1NBZB 4NHUA 1S9XA 4NO0B 3GMNA 3KPSD 4JPIA 1GH7A 5IMKB 5EH1A 1TZIB 4ZQKB 2IQ9H 4Y16B 4ZXBA 2GJJA 3IXTB 5IVXB 4GKOA 2IQAA 3ALPA 3G5ZB 1CL7L 1T1WA 5T1KD 3O2VL 1IL1B 5EZIL 1MREH 3VFOB 3S97C 4KQ3H 1KG0B 3NBNA 5EZJA 3ARDC 2NLJB 1KPVB 1VEOA 1C16B 2BVYA 5CAYB 1VADA 5T1LD 3D2UB 1RZ7L 2JB6B 1YECL 5LGHH 2NXZB 4BSVB 4CADB 4QWWC 4QKXB 1E28A 2BNRB 1RIHH 3QIBA 2GKIA 1FHGA 1K5NA 3D85A 3QA3A 3HG1E 2D4FA 5JPMA 3RDTA 2FL5A 3PWVB 2YMXL 3MNWA 4D0CB 2XN9A 4EOWL 3WL9B 4RWYL 3B9VA 5IR1B 1MCEA 3WFHB 5GS0D 1IAOA 4PG9B 1GYAA 4K8RC 3FQNB 1ZGLM 5IGXH 1V3KA 1S7XB 4UUJB 4CGTA 3TO4A 2ZUXA 4DVBA 4PTUA 4KKBC 4O9HL 1VGKA 4K7PH 2Q87A 1CN4A 3QQ3A 3NCYP 1INDL 4YK4B 4YHKL 1KB9K 1DSFH 1ZKAA 1C5CH 2X1OA 1F3JB 5FK9A 2BSRB 5TPWH 3P4OA 1TJGL 4G42B 4KRPB 3GRWL 4MDJA 4X80L 1S5IH 3P2TA 3C2AH 2J2ZA 3ARPA 4JANB 2CXGA 4EXKA 4RMRA 1EEUA 4EJ1C 3HPJA 3VFPB 3ZTJH 4U1SA 2OP4L 5DEGA 1E6OL 1WCBB 4PBXA 3R8BB 3TLRA 1OT1A 1LQSR 5C0CA 3G6DH 1LNUB 4G5ZL 1JFQH 4Y7MA 4HK3N 4OT1H 1S7SB 4OIIL 4OF7A 2X4PA 4HEPG 3IKCA 4HS6B 4X5WB 3QHZH 2WBWB 2WLYA 4OFVA 1CBVH 4XPTL 1KIQA 4GXVL 2APBA 3ALXA 1FG9C 3BP5A 1KACB 4LU5L 5F88A 3HKFA 4D8PB 1Q94B 4O4YH 3VWKD 1OCWH 5D93B 4CU8A 3QDHA 5L9DL 1MF2H 1KTLA 1URLA 5D2NA 3ROLB 1CD9B 3KVQA 1YJDC 1R24B 3H9SE 1GC1H 1NUFA 5D9SA 1EJ6A 3MV01 4JFYB 5TDPB 3U79A 3BH9B 3B9EA 4Y19A 1P53A 5GGSB 1SBSL 5IHUL 5GS2D 4PLOB 3SY0B 2FJHA 3THML 3QEGH 3R06B 3N06B 4KKCD 3TT1L 1DR9A 3VWJD 4MNQA 5IT2L 4XXDA 2D3VA 1S9YB 4YFEA 2DBLH 3G6JB 4LRNL 4DUVA 5DYOB 5GXBB 4GAYA 5IROA 1FAIL 1VFAB 2CKBB 5D1XA 2WWMC 3FQXB 4GQPH 3BO8B 1JPGB 3BKJH 1U8MA 3JWDH 1ZMYA 3VXME 3EO1A 1WIUA 1HH6B 4D94A 5K9JH 2A9NH 2IANE 4NRYB 4WO4B 3MRHB 4W70A 4YBHA 5DRXB 4XAWH 3P0GB 4RQQA 5FHAL 5MEQB 2V2TB 4WEBL 5GSRA 1WT5A 1J05B 1F3RB 1YMMB 3R4DA 3ZO0A 1KIPB 3QIWA 1FLRH 1HOCB 3G04A 3C87A 4RX4D 1TENA 3E2HC 3E8UH 4PJAB 4XVTL 5D72L 1A1MA 3BAEL 1ZLUK 4OZFG 1TQBC 3SKNA 2C3XA 3RL1A 4NGHL 4O5LL 4PY8J 4KK5D 3BH8A 1AGBB 4P23A 4WFFE 3ZKXC 4WY7H 1EPFA 4JZOA 5I8CB 4R4NC 3WIIL 1FV1B 3A67L 4APQC 4GW4A 4HZLA 2P42B 1FL5B 3MO1A 4WTXA 3CMGA 2VQTA 3B5GA 2BNUB 3HZMA 5F7FA 1ZANL 5CJ8A 1JE6A 5I0ZA 1KT2B 5KS9A 4KPHL 1RUPL 4BZ2H 4C56E 2OCFD 2YPLE 1NGPH 2F74A 1WZ1L 5HYQA 3MR9B 4WWKB 3PWNB 4PP2B 4EDXB 3QUXD 3JV0A 3O6FB 3EO9L 1UT9A 1GCFA 2H8PB 3DHJA 1MQKL 1UACH 5EO9A 4XBPA 5EBMB 4EUPB 3B9AA 4O02L 4FQ1L 2P8LA 3IFOB 3LMJH 2QADC 4R3SA 1KFAH 3C60C 4FQHA 4TTDD 5KVDH 1I1AB 4OLUL 4JR9H 3OJDA 4QTIH 2WW8A 2DBJA 2ZUQB 4NZDA 5BW7C 4PRNA 3UPRA 3MNZA 5TE7L 2VAAB 1BZ9B 1W72B 2J5LB 1Z3GH 2ZKHH 2QSVA 3B5HA 4MS8C 2EIDA 3KPRA 1XIWB 1HH9B 2VLRE 4NKMA 3VH8B 4PB9L 4U1GB 2O61A 1UM4L 5DZNA 5F7EH 5C6TL 5IMLB 3ZHKA 3RNKB 2HFFB 3WUWA 3MRMA 3TVMB 3P0YH 2F53E 3GJFK 2XNAB 2BVTA 3GBNH 3GM0A 5EN2A 4UZGA 4JRYA 3AMLA 4KAQL 1M05A 1YEIL 1A47A 4OUUA 3SPVB 5HHMB 4ETQA 4HHAB 4L3EB 3GBML 2OS7A 3HMXA 3KJ4C 3ROOB 2VZOA 3LD8B 3W82A 4ZYKA 3RWFB 1WEJH 5ILTH 4YO0B 1S9XB 5HVHC 4JFXA 4F7TA 5I1JH 1ZLVK 4TOYH 1MVUA 5DD0H 4KZEH 2WSKA 4YR6B 1IQWL 3C2SA 5CHNA 2IQAB 1YNKH 1X5JA 4NN7C 1OB1A 4OIBA 4U1IB 3B83A 2W60A 2JKXA 3I6LE 4HIJA 4TSBH 2F8XC 3NPSC 2BZDA 4X9IA 4JREC 5EU7C 5IJKA 3WFBL 1TCMA 1VADB 2G9HB 4I0KA 4RFOH 5L8LB 5DLML 1EFQA 2GYSA 2NY0B 4JHAL 3BT2H 1LEGA 4LSQH 5ELIA 4N8VB 3QIBB 4HKXA 5L6YL 1CDIA 3GHBH 1K5NB 3CXHK 4ODSL 4UDTA 5LAXA 4LHQB 3T2QA 3QA3B 1AD9A 5ISZD 1I7RA 3MRQA 4FG6C 3MNVA 5JPMB 3RDTB 1YEFL 1JTOA 3QRGH 3C8HA 1F4AA 1YY8B 3UTSE 3MNWB 4DGYL 5GHWL 1QACA 3BX7C 1OOAA 3GKWH 2D9CA 1R3KA 4NUJB 4X9BA 2AJXH 4GMSL 1T22A 1EBPA 1U8OB 4CJ0A 3KPSA 1IAOB 1WWCA 1CU4H 5D5MA 1NBVH 1TLKA 3MRNB 1W0VA 2YSSA 3TO4B 1JF6A 5F96H 1AE6L 1NANI 4FP8H 1UJTA 3QT2A 3HC4L 1HHJA 3VG0H 3MJ7B 4KMLB 1T89A 1XR9A 3P77A 5T1KA 3QJFA 1IQDA 3UDWA 3LKSB 3R8QA 4DGVL 1T5WB 1TZHA 4NQED 4OCXH 3KYOA 2YKLH 4N0RA 4ODVL 5T1LA 2AV1A 4LK4A 5FK9B 2DLFH 5JOEA 2A1WH 1FH5L 2QTEA 3O4LB 2BY2A 3V6ZB 5J6HB 2VKXA 3P4OB 1GHFH 2NZ9C 5D5MF 1M71A 5I8OH 1IEBA 1GGCH 2VQ1B 3H0TA 4JQIL 3BQUD 4ONOA 4DFIA 2CDEA 1UM6L 3ZKND 4LBEB 3HPJB 4TVPH 5TQ0L 1KJ2A 1NANH 2GTWA 1IZJA 3EJYD 4D9RD 1JWMB 3NACL 2AKRB 2X7LB 5C0CB 3R0MA 3GM8A 1DVFC 4F57H 5KVGL 1F97A 4M7LT 2UZXB 2VDQL 5GS3A 2X9WA 4HG4K 1AY1H 1X5FA 2X4PB 3UBXI 3IKCB 1KIQB 5IESH 4ZNEE 4KI1A 3M17A 5JIIA 2L4OA 1NDGB 4LVNC 1JGVL 4D0BA 4KUCD 3AM8A 1M7DB 5D2NB 4M6OH 2OYPA 4JY6B 1ZVHA 4XP9H 5D9SB 3LEVH 2R0ZH 4NT6B 5MP6L 5D1ZD 5IBLC 3CSBA 4NQTA 3STLB 4Y19B 4KI5D 5GJTL 1MCWM 4XC1H 5JMRA 2FJHB 2VRAA 5FHBH 3GMQA 4QY8A 1JI1A 4I3SH 3DXAD 4XXDB 3SE4A 4MQTB 3IYLW 4ZUTA 1F90H 1A1NB 4GAYB 2G60L 5I1EL 3AGVA 4MYWB 1CFNA 4X6CE 1II4E 4HAFA 4XHJC 1GL4B 3MLUL 3BPNC 4IRJB 4FQCH 2R0WL 1I9EA 3BN9C 1DBBH 2ZSVB 5CGMA 1BHGA 3FO0L 4DJMA 2NY4C 1U8MB 1PG7L 2F5AH 2MPAH 3PXHA 4WFEE 1KXTB 3EO1B 3IU3A 4UT9H 4P5TC 4F9LA 4LQFH 5L2KE 2WP3O 4Z77A 1A7PH 1A9EA 4U0RB 4RQQB 5KTEL 4HWZB 1U8QA 4MQXC 3VWKA 2KZ1B 1A14H 2Q6WB 4UB0L 2VDOL 3DBXA 5BV7C 3KPQB 1I3GH 1KNOA 3QIWB 3G04B 2WINB 1GZPB 4H0GA 2CPCA 4RGMC 1U8JA 2N7BA 2ZUVA 2P45B 1JN6A 4PJFE 3D39E 1A1MB 2W9DH 4HWNA 3WNLA 1G0DA 3SKNB 3RL1B 4R7NA 4ZOEA 3T3MF 3HUJA 3VWJA 1ODAA 1KPUB 4PJBF 1EUUA 5EORL 2GSGA 4OCSH 3V7AE 4MQSB 2AJYH 1N3NB 3RVXC 3Q48A 3WMSA 1G84A 1A64A 2HVJA 2E6PA 3WN5A 1YUHA 2VWEC 2XWBB 3FT3A 2J6EA 5DWUL 2UY6A 3CZFA 1IKNC 5E6YA 2EDQA 4P0DA 4PJIA 4HT1L 5GGSY 2X5PA 4PY7A 2QQNH 2HA1A 2GEEA 2HTKD 2E7CA 1TFHA 1X5XA 3N9GL 1HZHL 2P8LB 4R3SB 3ARFD 2PR4L 4FQHB 1FSKC 1WTGT 3T4YA 3VW3H 2YHGA 5JPNA 5KVMC 1Z0MA 3QFJE 3QUMH 4OLWL 1BIIA 3HG1D 4RX4A 1I7UA 5CEXB 4PRNB 5E4EC 3MNZB 4G6KH 5DD5L 4PJDE 3L5IA 3V52H 5J13C 5I1DB 5HGGS 2NYYC 4HDIA 3L3DB 4PJIF 3VA2C 4XMPH 2G75A 4Z7QE 3C8KA 1MFBH 3MMEA 5HHVH 1F4XH 1CE6A 2FIRT 1YEHH 2EDNA 1V7NL 3DX7B 4NKMB 5D6CA 2O61B 4WU5B 3KPNA 3GHEH 1JJUA 4P57B 4AQ1B 2XICA 4U2YA 5IK3A 3TN0D 3WUWB 2ORBH 4HJGA 4YGVA 1PBYA 2IFFH 4I0PD 5CINL 2RIKA 5AWNH 1RIUL 3PJSB 3GI9L 1JZ8A 2VL4A 2B1AH 2EE6A 5EN2B 4JFEE 5D7JD 5EIIB 4UI2A 1ND0A 4MB4A 1WBXA 4JRYB 4IOIA 4JG1L 1X4XA 3NFPA 2VLJB 1D6EA 2J3SA 4OUUB 3QUXA 4TVPE 2P47B 4N9OB 5GZOC 2NXZC 1UJ3B 3T0WA 5DURD 1NFDA 3SDDD 1AP2A 2V5TA 1BD2E 2X89D 4YHPA 1MCJA 1FZJA 4ZYKB 5DK3A 4CN4A 4W4OA 4NPYA 3H7BA 4LGPB 1N4XH 3FB7A 1DQLH 4JFXB 3WCYA 4PRPA 2FRGP 1FNLA 1OAKH 4LLYB 4TTGA 1OHQA 2E6QA 4P46C 1K2DA 3BVNA 5HGBB 1CT8B 3PL6D 4WUUE 4CW1B 4U2ZA 2GT9A 3QEUA 3HE6D 2B20A 3HNTH 1NFDF 4HIJB 2DQFB 1VGEH 2HAZA 3WIHL 5EG6C 5T3ZL 4CVWA 1ADQA 1OTTD 4I4WA 3T2OA 3MYJA 1DEEB 4KRMB 1SJHA 4E41E 4MD5A 3NA9L 4JY5L 1AKJD 2PETA 4F9PA 1TIUA 4YK4C 5I1HL 2IH3B 1G0XA 1MHHA 5LAXB 1AD9B 4XB7A 3H9SD 1DJSA 3BDYH 3MNVB 3SOBH 5GGVL 3IJYA 3QQ9C 1ITCA 3AAZA 5HI5C 3PDDA 1TTUA 5DXWA 5JW3H 1NFIA 1T22B 4RNRA 1CFVL 4X7SL 4IS6A 4RIRA 1CXKA 5DRWA 4W81A 2FX9L 2YD1A 5D5MB 3RKPA 5D6DA 1W0VB 1SJXA 2RHEA 3VXNB 3NIGF 5AZEH 4NZUL 1HHJB 2AJVH 5T3XL 4NZTL 1IBGH 4JJ5A 4K3EH 2AJZB 5BJTA 1IQDB 1FFPB 3HA0A 3VXMD 5SV4A 1RY7B 2OTWA 4LFHG 4C58B 2AV1B 1J1OL 2WNGA 1QZ1A 3LB6D 3WFDL 3ARTA 3MJ8B 4CVZA 2UYLA 3LEYL 3QB7C 1CXIA 5B4MC 2CH8A 5KOMC 3DETD 4NSKA 8FABA 1KB5L 4ZPVA 1YYMH 5ISZA 4IMLA 6CGTA 2EH7H 1AQDA 1N5AB 3JTTA 1D7FA 3LS5H 5J3HD 2WK2A 3BD3A 2VH5H 4WHYH 3QWRD 4Y5VC 4KTYA 4W4NA 2Z35A 3C5JB 2WBKA 3LPWA 3WXVL 1KLUA 3D0VB 4TNWK 2Q3ZA 1MNUH 2CDFA 4UT7H 5L7XL 4EEEA 4JDTL 1I1FB 1FC1A 1A6VL 3L6FA 1FFNA 2I60H 4OBRA 5A2KH 4QNPF 3W5NA 4C56D 2YPLD 4HH9B 1CGUA 2EZ0D 4NQEA 2A38A 4MWFA 4WO4C 4QLRA 2KQNA 1T1ZA 2XXCB 2Q3AA 2CD0A 4N5EC 3BE1L 2JELL 3QO1A 3WV0A 3VXTB 1TJIH 5E08H 3BQUA 3GMQB 1EGJL 3FB5A 2F9BT 5FECA 3MJ6A 4UV7H 4NQVA 1KXQE 2Q8AH 3EOTL 5KSAA 4ZUTB 5CBAA 1I8IA 3C6LC 1KCVH 1PSKH 1NMCC 1T83C 3T3PE 3BESR 1CFNB 4L4JA 4N90E 2PTUA 3HZVB 4ZG1A 3Q0HA 1YJDH 3G6AA 5E70A 4DUWA 5I17B 2O5YL 2O5ZH 1P1ZA 3WE6B 4YZFF 2VLRD 4XNYH 2ICWJ 2J8UF 3X11A 4Z77B 1A9EB 3MRDA 1MWAA 3CFIC 3GK8L 4IEFB 1A3LH 4PJBB 3VWKB 2FECL 4IJ3B 1X5LA 2JJTA 3ZE2E 2X4SA 2F53D 3QUZC 4X8JA 1C5DA 3VG9C 1ZT1B 3WNKA 2D7PA 3SEPA 2HFTA 5CFHA 1DANT 3P73B 2M26A 4HXAH 3O6FC 4NQCE 4ZSOB 3KAAA 3IDIA 5D1ZA 5IW6A 5EBWA 1FPTL 4FZEL 1JN6B 4XH2A 5D4QA 5I9QC 5E2WH 4K71B 1A7BA 4RDQF 4XCYA 1XGUB 3DMMA 3FFCE 3ES6A 4KFZC 4PS4H 4HIEA 3DXAA 2XA8L 4NRZA 2CLVA 4GOSA 2WM0A 1U8KA 1LK2A 4BSWA 1S7UA 4Q97A 3HI1A 4R2GC 5IBUG 2HVJB 4MHHG 3FQRA 4CKVX 1K8DA 2SEBA 4K9EL 3L3HA 4MDIA 1MJ7H 1HWHB 4Y1AE 1J87A 2J4WH 3CZFB 4FQLL 4KI5F 5KVEH 5D7SH 2B2XH 3I6LD 4GKNA 4XWGH 1FZMB 4U1GC 4P3CL 2CIKB 2XPGB 4XNZC 5EC1A 2D0GA 4PY7B 3U7AA 1EEQA 1F6FB 4GMTL 1S5IL 3C2AL 1EAPB 2P8PA 1CQKA 3TVMC 4A6YH 3GJFA 1JNJA 3V5HB 4YHIA 4XGZA 4BFIB 5L8KB 1A2YA 1JHTA 3CD4A 2J88H 2V5YA 1FO0A 5F6HI 1BIIB 1LP9B 1I7UB 3KGRA 2XKSA 4NQDB 1NGWA 2FSEB 1MUJA 3BP6A 3UTSD 1YEGL 5F7HA 5GS1B 3DYPA 4HDIB 4PP1C 1FE8H 1HINH 4OCYH 2G75B 4ZO9A 4PGJA 4RA0C 3P40A 3RTQD 1IC7L 4Y2OA 1NH6A 5D6CB 1FZOA 4ZXBC 4LHUB 4G7VL 1T1YB 5FM5M 3G5VA 2YA1A 3S5LG 4ELME 4IMKC 3T1WA 4JVWA 4HJGB 2EDYA 15C8H 1RUAL 3CC5B 3VFGH 1I8MB 2PXYB 1GC1L 3Q2CA 2CUMA 3FB8B 3GSWB 4IOIB 2A77H 4OI8A 1BZQK 1RVFL 3MA9H 3V4UH 1KJMB 1I9RH 4P4RA 5JW4R 2UY7A 3BDXA 3QUXB 1LK3L 1HHKB 3FO2A 2EH8L 4ZTOH 2HN7A 1NFDB 2KPNA 4RA3A 1AP2B 1PQZA 1HHIB 4YHPB 4ZPTA 3SDXE 4NQSA 5C0DB 5HJ3A 3RQ3A 3ARFA 2BC4B 4NPYB 3H7BB 1SY6A 3S88L 3HG1A 2EEDA 5TE4L 2D4DA 1S78D 1EHLH 5I66A 3BVNB 3JWDL 2P24A 3KPLA 5K9JL 3V9FA 3DGCR 2ADFH 4F80A 1XH3B 5B22A 2CGRH 3QH3A 4OSUL 3ZYIA 4BK4A 3MFFA 2JIXD 5LGJB 2QL1A 3FOLB 2M2DA 2FGWH 3TN0A 2FHCA 5ADPH 1BX2A 4I0PA 3IVKA 1YYLL 1SJHB 2R9HD 3KG5A 4LVHB 1D6VH 4MD5B 5D7JA 3VD4A 5BVJA 4EN3D 2V2XA 4NO3A 4NCC2 3S3JA 3E8UL 4LCWE 4JRWA 4OD3L 4ERSL 4PB0H 4Z7WA 1IGTA 2VUOA 5E2UL 1NAKH 1QR4A 4XNUL 3IJYB 1O5DT 3SDDA 5H35A 1DE4A 3RWJA 2X89A 4UQ2B 2P5WA 5I71B 2UZIH 2NR6D 2RFXA 4QRPB 1L7IH 3S35H 2X4NA 1XMWA 3QJHA 2CLRA 3RI5K 3MREB 1J18A 2HFGL 5HI4C 1T3FA 4JLRA 3FQWA 4L1DA 1LO4H 4ZDHA 1OLZA 1MFCH 1DQQA 3PL6A 1T7ZA 4I77H 2NY3D 3H3BC 3HE6A 3KPTA 1JF1A 1XF5A 5ESAA 2E27L 4WFED 4JN2A 3DGGA 1UVQA 2A83A 1UACL 4NN6C 5CD5D 2W0KA 5L2KD 5FA4A 3RL2B 3LQMA 1BBJA 3NVQA 4DKDC 4XZUB 2ZCKH 2UYLB 3DX6B 1B0GA 3O6ML 5F1KC 1FFOA 1A7RL 1KJ3H 5D2NC 1AKJA 1OARH 4NSKB 8FABB 4ZPVB 3HC0A 4NC1C 3Q5YA 4PG2A 5ISZB 2OX5A 2OL3A 4N0CD 4X7TA 3H9SA 5F3BB 4CNIA 5DVKA 5GGTH 3JTTB 2GQHA 5ALCH 4M61A 1FNEA 2V17H 4M3KB 1R0AL 4P2OD 1D5BA 3MODH 3DSFH 3TIDA 1NKRA 1KCKA 4HBCH 3NIDE 1KLUB 1YC8A 1C7TA 5GRZA 4JO4H 2HWZL 1GIGH 5IROC 2V2WA 3MRKA 2CDFB 4S2SB 4UIMB 2VDRH 4N0YH 5D1XC 1T04A 3QFDA 1TCRA 2XA3A 3L6FB 5DGRA 1FFNB 2YD9A 2ARJA 2VDNH 4DQOH 3QSKB 4KJYA 1X5HA 3MLSL 3IFLL 5CMAB 4G6AD 4X98A 3W11D 3VXMA 4NQEB 2VN7A 2XTJB 3QDMB 4U0RC 2BOBA 2E8ZA 4XT1C 4KKAC 1T1ZB 5ETUA 3FZUD 1QNZL 2B5IB 3EHBD 3SDYH 4AG4H 4YHOH 5FXCH 4TN9A 2J8UB 4QXUH 4QRSB 2ZP0T 5DJ6B 4WW2A 2HP4A 4LGRB 5DD0L 4U6TA 5C07B 1U42A 4QHLB 3KYNA 3CSYA 1ERNA 4M8QB 5FECB 4LPVA 1FGVL 1G9EA 5C0GA 4DW2H 3QFJD 1YNKL 1TJHL 3HNSL 1D5ZA 3VFSA 3MZTA 2MKLC 5AD0B 1QSEE 5ID1B 4X83A 4LSVH 3QWRA 1JPST 4NHCL 4HFUH 1A6TA 3UTTE 2VDPH 3FN3A 3G6AB 2NMSA 1P1ZB 4P23C 4JKKA 4LLQB 2HH0H 2HT4D 4RFOL 3QI9C 2F58L 3VXPA 5C9JA 1MJUL 4Y4KD 3BYYA 4IDJL 4LLVB 2XZCL 3MRDB 4Y4FD 5E8DH 1MWAB 1A6WH 3QBTB 2NY2D 2DQEH 4B41A 3V6OE 2X4SB 4C56A 2YPLA 4HLZH 4UQ3B 4KJWD 1SYSA 3T0EB 4H1LG 4XTRC 4UIKL 1EJOH 1GOGA 1T20A 2EIEA 2Y07H 3BWUC 3GKWL 4RGNB 4TVPD 3IDIB 4KK8D 5IW6B 1DTUA 3HR5A 2AABH 3QG7H 4M62H 4XH2B 1BD2D 1YEDB 1GAFH 3LV3A 4X5LA 1NBVL 3ES6B 4FP8L 4MAUH 3DXAB 4RRPG 1HDMA 4NRZB 4F58L 4ZAKB 3VG0L 1U8KB 4BSWB 1S7UB 3OXRB 5BV7H 5FGSA 5CP7B 4RWHA 1IC4H 1MFNA 3OJVC 3DUHA 2D03H 4FRWA 1S3KL 1XF2B 4JDZB 1K8DB 2SEBB 3L3HB 4WUUD 3P30H 5EO1A 4XP6H 2HYMA 2DLFL 2NW3B 2A1WL 4GKNB 3RVVD 2A6IB 1NC4D 4K7FA 1MI5D 3AU1A 3SGEI 3EBAA 1A4JB 2X44D 1GGCL 4PTTA 2OK0H 1RJLA 4K94L 3N1PC 3GJFB 2F53A 2YD2A 4OQTL 1CVRA 4YHIB 4AIXA 4XGZB 4E41D 5EU7E 4X9HA 1JHTB 1G7HA 4TVPL 3VFWA 4EZMA 3EYUH 4S1SH 2EDTA 5EOTA 4M43H 3WHE0 1BQSA 4LSTH 4OLXH 4WGVB 3BZFB 1N2RA 5LG1A 1V3JA 2IBZX 1JVKA 3UYRH 4H5SA 1QLEL 3TBSB 5ESVB 3ME0A 2VN4A 2ERJB 1ZE3C 1QKZL 5C7XL 4QHKJ 3ZYOA 3U6RA 5MHSE 3SGEH 4PGZA 1XCTB 3REWB 3G5VB 2HKFH 1JZ6A 3SDAD 1OSPH 3VXUB 4OGYL 2Q76B 3VCLA 3LEVL 4IRSC 4PRDA 4S0SD 4OB5L 5IJKC 4RMVA 4LARL 4M4PA 2BRRL 3BRGC 3QEQD 1A9BA 4PJCA 4ZPTB 4MA8L 4NQSB 2GJZA 3ARFB 4JO1L 5SX4I 3UC0L 4EIGB 1OTSC 3HG1B 3GIVA 2J8HA 4L29A 2XWTB 2F19H 1A0QL 3OL2A 2VABB 1MLBB 3UTSA 3PDOA 2FNBA 5DMYA 2ZJSH 5FOBA 3KPLB 1B90A 3RTQA 2M8XA 3SKOB 4RAVA 3EGSB 2YK1L 3T4AA 3QH3B 5DC9B 1A14L 1GGBH 3MFFB 5EOQL 2Q20A 1T89C 2VISB 2VZ3A 4JRXE 3BGMB 3IVKB 3KNBA 4I48B 3V0VB 4EI6A 5C2BH 1ITBB 2FH8A 2I26N 5BO1H 4I2XE 2ZNXA 5BVJB 4DN3H 2HJFB 4ODTL 5SX4H 5HGAA 4JAMB 4XCCL 5HHOE 1U93A 5D7LE 3RNQB 4FN0A 4EI5D 1DBKL 5DURB 5H35B 3SDDB 1DE4B 5IEHA 3RWJB 3FT2A 3AMKA 4RMQA 3SJVE 5DTFA 4HPOL 2XRAH 4JFFB 2AJYL 5EFIA 1ZHNA 3ILPA 2G5RA 3QDJB 3N1GC 3QJHB 4WHTA 2HRPL 3TZVD 1FN4A 1B9ZA 3PP4H 2PO6D 4M5ZL 4NBZB 5E6ID 4OV5B 3FQWB 4UILH 3LKPB 3JV4A 1NCDH 1P2CA 4N90D 3PL6B 5GS0C 3HE6B 1JF1B 5GZND 1XF5B 5ESAB 3VFVB 4JN2B 3SBWA 1UVQB 4MQ7B 3OZ9H 3ULUH 2JIXA 4WI9A 4ZNEA 3EFFA 1ZK9A 3BWAA 5FA4B 1QBLL 5ERWB 3KLDA 2FX7H 3HHRB 3QCVL 1EO8H 5KJRH 1B0GB 3SCMB 3AM8C 4EN3A 2IG2L 3QUML 1AKJB 3NH7H 2XKNA 5KAQG 2FIKA 5IVZA 3B6SA 5HYEA 1R3HB 1CFQB 2R1YA 4G6KL 4MSWB 4JGMA 5MERA 1E4XI 3TESA 3L3IA 4YXLL 3V52L 3H9SB 3CJJA 5DDHB 1KB5B 4NQCD 4TNWF 2BHYA 4JG0H 4M61B 3E6FA 1FNEB 1A02N 1IARB 5IJVB 1NMAH 1R6VA 5LQBL 1D5BB 1F4XL 1J8KA 4FQJH 3FFCD 1TQCC 1BQUA 4HFWB 5F9AC 3SE4C 2K1MA 4ZUUB 3WYRA 1BFVH 5J57B 2V2WB 3MRKB 4A2LA 1K9TA 1T04B 2O5XH 2AI0L 1TCRB 4X6CA 3B4NA 4K2UH 3U4BH 4MD4A 5JDJA 5DQDH 2R8SH 1NAMH 2IH1B 1V7ML 4Y1AD 3PGCA 4X98B 1HWGB 4WW1A 3VXMB 1E4XH 2EDHA 2BOBB 5L2KA 2IANB 2VWEE 3CFEA 2EC9T 3VI3E 3VFRA 1XGQA 2X70A 2V7NB 3CVIL 3VXSE 1N4XL 5ACZA 2FJFA 4B0MM 2BCKA 3ARDD 3LKRA 3LDBB 4LLWA 5E7FA 1M7IA 4KHTH 3NFSL 4G7YL 2CO7B 2LU3A 4PGCA 1CF8H 4PJFA 3RWHA 4P2OA 4YH6A 4BQ8A 1D5IL 1CDYA 1PGRB 4YDIL 1A6TB 4RZCB 1VGEL 4KKCC 3VWJC 1JHLH 5ICZB 3U82B 2W65A 3MRLA 3VXPB 3CNKA 3B9KC 3OWEA 5EU5A 1UXWA 2JF1A 3JSSA 1CD1B 3WN5C 2HT3D 1FNHA 4UBDC 4ZO8A 4HEME 2W92A 4C56B 2YPLB 5BS0E 1J11A 1MRFL 3QXVA 3MJ9L 1SYSB 3SOBL 1FZKB 2EYSB 4YPGA 1WFUA 5TH2B 2MWCA 1T20B 5TGBA 3V7MA 4NUGH 2BXYA 3L1OL 2RR3A 3U7YL 1PY4A 1R5WA 2MQCA 1NBYA 3SO5A 3RVUD 4Y89A 1OY3B 2V9TA 3QFJA 3WUZA 3S4SA 2VLLA 1QTYT 1FGNH 4PJDA 3EJJX 2AK4B 4M1GL 5CJXA 3U0PA 3BIBX 5DA4A 2UUDH 2VLRB 2B4CH 1RPQA 3EZ8A 4Y2DB 4Y4KA 3S96B 4OAWB 5MEOB 3AU1B 4Y4FA 2YD6A 4K8RL 4E0RA 1FRGL 5HBBA 2DI9A 4LVOB 4MA1C 3EOAA 4PJDF 1MAKA 1XGYH 4LCWD 3LS5L 4P5MA 3BSZL 4Z7QF 3PUCA 1BZ7B 2VH5L 1IEHA 2FB4L 2VXVH 1N2RB 3EO0B 4GAJH 4FQIH 2BK8A 3G9VA 4WUKH 3PQYB 1BD2A 5DVMA 1BBDL 4W4OC 4TTDC 5DUML 1PD6A 7FABH 2HMID 1NLDH 1ULVA 4MJ5A 5BRZD 3BPCA 4ODUA 5C6WH 2I9TB 5DVLA 4AENA 4U1LB 5DHVH 3GGWB 3ULUE 2I60L 1EIBA 1MJJA 2L0DA 1JZ3A 2A6KA 4WUUA 5LCVH 1OGAE 3VCLB 1FLTX 2AJUH 1NC4A 5HYSA 1Y6MR 1MI5A 5L2JA 5IFAL 4XMLH 3JWOL 5F7LB 5I30L 1A9BB 5E08L 2MQ0A 1XZ0A 1HKLL 4YC2B 5D8JL 3RUGE 4WTWA 3P11H 4E41A 1PFCA 4PUBL 4F9PC 1WBYB 3L5JA 1FP5A 5E8NA 2YD5A 2YR3A 4C83A 1S7VA 1PSKL 3UBXA 5FYJU 3GIVB 1WC7B 4G6JL 4L29B 3VDCA 3TBYA 7CGTA 4MXWH 5L8JB 5I0DA 3O4OC 1YJDL 3UTSB 5I71C 1LO3H 1T5XB 4HC1L 4XNYL 2H41A 3B8YA 2HKHL 2ESVD 2IWGA 3ZTNH 1DBAH 3AXLA 1Q9KB 3HMWH 3STZA 1IGFL 4UDUB 1CZ8L 2APVA 3SDAA 3T65B 4EI6B 1ZSDB 2N4IA 1MPAL 2R4SL 4GG6E 1U8PA 5HGAB 3W9DB 2BVEA 1U93B 4E42A 2AXFA 3H42H 1N6VA 3QEQA 3O3EB 1G9ML 3RI5F 3MRRA 1UM5H 1F4WH 3VXOA 3FT2B 4Z5RB 1TVHA 2FHFA 1VERA 4M93B 5DTFB 1GGIH 1JHKH 5C0RL 4MA7H 1ZHNB 3ILPB 4NKQB 4OCRH 3Q3GB 4XPGH 4WHTB 1LILA 1RFDH 5I75B 1CGSL 3BPLC 4F7CA 4Y0GA 1QSED 3JV4B 1UKTA 3C60D 1P2CB 5E7BA 2QSCH 3UTTD 2AGJL 5E56A 4JFQA 1GRWA 5CLTA 4OZFH 4KY1L 5KN5A 1HEZB 2B0SL 2ZCHH 3V6FA 5K59E 2JIXB 4NDMA 4MS8D 3EFFB 3BWAB 5DJZB 3BW9B 2AJSH 1OVZA 4KGJA 1CICD 3F7RA 3IB4A 4JZNA 2GK2A 4EN3B 2OTUB 4HX1A 5EWIL 1FL3A 3MJGX 5IVZB 2A9MH 3B6SB 2X4QA 5MERB 3L3IB 4NBXB 4POYA 1XF4A 3QUMA 2VYRE 4EI5A 1HINL 1J1PH 4OCYL 3MQIA 4NWTH 2E6JA 4X0KA 3MLTA 1OAQH 3BQUC 3F12A 4YXKH 4QXGL 1NCWH 1X5KA 4PJXB 3OBAA 1SYVA 3TZVA 4OV6F 4BQ6A 4HWEH 1DQDH 5KSAC 4XVJL 4G9FE 2PO6A 4K3DL 4UNUA 5DEZA 1SMOA 3HCVA 4PREA 3FN0H 4YIQA 5JORA 2APFA 1WICA 2BJMH 3Q5TA 3UTPE 2AXGA 3MRFB 2EO1A 4N8PA 4X6BB 4S1RH 4AEIL 3S7GA 2YEZA 1DQMH 1RULH 4OZIE 3KS0H 3GO1L 2Q7NA 2FO1A 5L2KB 3G5XB 3CFEB 4J6RL 5KSBE 2ZUTA 4ZUSA 5GGVY 2X70B 4JY4A 2DICA 4P59H 1HQ4B 4JGJA 2JJTC 2FJFB 4NO5A 4XAKE 3MUGA 3OJ2C 4QXWA 2YUWA 5T1MA 4L9DA 1CYGA 3SQBA 1M7IB 3T3PF 1E27A 1F4HA 2W59A 5F9DC 2WWKO 5D1ZC 4NQCA 1FNGB 5F7DB 4HG4J 5FDYA 3D39B 1AR1D 5BCAA 5GRUH 4IOFC 5DJXA 1J0YA 5GRXG 1GOFA 5IB4A 2ADFL 1KC5L 3DMMC 5IMOB 3FFCA 4UAOC 4FG6D 3TJEH 1INEL 3MRLB 4Q6IC 2BSSB 1VACA 5CIPB 4F7PA 1U8IA 3ZE2F 5ADPL 1QFUL 4JKMA 5MHSD 4FTVE 1D6VL 2X4UA 4LHUG 4Y1AA 3GMRA 3VGFA 1NAKL 2I25N 4UOJA 4OI9A 3R0NA 2W91A 3K1KC 4YFDB 5ACLA 2C7UA 5JW4Q 3MBXH 4KXZI 4N0FA 3S35L 3AB0B 4LASH 1EV2E 3UZVB 5CJQL 4MA3B 3ARDA 3OPZL 4DKEH 2R2CA 4AL8H 3O6KL 5C8JB 1IFHH 1NBYB 1ORQB 2GITA 4LKCA 4OCMC 5EZLB 5BZDA 2VXSL 4U1MA 3QFJB 3FONB 4YHNA 3C5SA 3S4SB 3KLAB 2VLLB 4I77L 3NCFB 4PJDB 1X5IA 4UNVA 3L7FA 3OAYH 1QRNB 1V05A 3ZMRA 5F1NA 1IGCL 2EDBA 2HRLA 1WWAX 5DQ9B 2PTTA 1G7MA 4Y4KB 4QCIA 1DLHA 1PKQE 5IB3B 4K07A 2AV7B 3RZCB 4Y4HC 5H2BA 4E0RB 1KBGH 2W9EH 4AZ8A 5I1CH 4KXZH 5CILL 4ELMA 1NMBH 2VDLL 4JRXD 35C8H 1QBMH 1JGEA 1UQSA 2YPVL 3EOAB 4YQXH 5IF0B 4JFEB 4HSQA 2KZWA 3O2WH 4TSAH 4O58L 5HHOD 1J86A 1OD7A 3U9UB 4XNQA 4LSPH 5E5RB 5EUOE 2FCBA 2HTKC 3MLRL 4HBCL 3MZGB 4U6YA 3HI6H 1VA9A 2Q8BH 1CGVA 3SJVD 1RUQL 2H26B 3RKDD 3WKNA 2X4OA 3L3OA 2E9IA 1NGQH 3SDXA 3OHXA 4ELMF 4B5EA 3OG4B 4HUNB 4HUWA 2VSDA 4N0YL 2BSTA 3BPCB 4FFZL 5FM8A 4ODUB 1XR8A 2C1PB 5I18L 5FO7A 2VDNL 2DLHA 1Q0XL 1MJJB 3VGAC 5IB2B 3O6LL 3OXSA 3GEWB 4WUUB 2VLME 3NAAL 1JZ7A 5I74B 3W81A 1SJVA 2W0FB 4HJJH 4H88H 4KTDH 3CDCA 4HCRH 4XHJD 3SDXF 1U91A 2VXUL 2ZOKA 2FX8H 2ZOLA 1CLZH 3MRIA 2OR7A 3TN0C 4YXHH 4ODXA 4I0PC 4HUVA 5D7JC 5DO2C 4P5TD 8CGTA 3SO3C 5EC2A 1T2QL 4LCWA 4G8GB 1OD9A 4Z7VB 3UBXB 5I19H 1R3LB 5I1GH 3MGOA 3EW3B 3GSOA 1AGEA 4LSVL 3AS3A 1DCLA 4LCYA 2R0KL 4HIHA 4JO3H 3QCUH 4XX1G 3MXVL 4NC1E 1C08B 2IF7A 1NJ9B 3LS4H 1QPPA 2IAMD 5INDB 2DIBA 5BRZA 1A6WL 5A2FA 1YQVL 4AYFA 5J8OA 25C8H 3T8XA 4L5FH 5B39A 4MNQE 3QAZB 2JE8A 4OZGA 3SDAB 4U3CA 5BZWA 3HE6C 5KG9B 1RUKL 1U8PB 2Y07L 4WENB 3FN9A 4HXBL 3SGKA 3SGJA 4XXCA 1BJ8A 2NX5E 2AABL 3QG7L 4M62L 5CBEB 1X6NA 4OZ4A 4R6UA 1OTTC 4MCZB 2WBJC 3IF1B 5JIKA 1QUNA 3ZE1F 3V0AC 2NY6D 3VXSD 4MAUL 5E00B 1YPZA 2MSPA 1HXYA 5EIVA 4CAGA 4PJGE 1CE1L 4PG2C 4M48L 1IC4L 5EU6B 4RISH 1F11A 1F6AA 4N0UA 4L3CA 2AP2A 4F7CB 5SX5H 4JO2L 4LCCB 2ZSWA 4XBEH 1UH2A 4XP6L 1EDQA 2APWA 3PP3H 3BUYB 1U58A 4R4FH 5IB1B 3KYMA 3V4PH 5DR5L 5F7KC 3QHFH 1BM3H 2ESVA 5DJ0A 2BXZA 3L3JA 1S7RB 2DI7A 4U6XA 2DMCA 1K4CB 3ZL4L 2W1NA 3EYUL 4A6YA 4S1SL 4HK0A 1I1CA 4R90H 4JZNB 3QXWA 5BS0D 4M43L 4HX1B 4LSTL 3QCTL 3RP1A 3BIKA 5DUPH 3LSOA 2YRLA 1QO3A 1XF4B 3QUMB 4JN1L 5AEAA 5KS9E 2GY5A 3NIDF 3DYMA 4UU9A 4NRXB 3CFKA 5D96C 4HWBH 2FGZA 1CK0H 4YHMH 4LSSH 4WW2C 3LDBC 3DETC 1X5ZA 3F12B 1IGIH 4WIQA 2MFNA 4BSJA 3NCYS 1SYVB 3TZVB 3VRLE 4DK3A 1MH5B 2CIIB 2UUDK 3OKNB 2PO6B 1F5WA 5E6IB 4P2QB 3HCVB 1SBBA 4PREB 5DJ8B 1QSEA 3C60A 3M8OH 4JPVH 1HILA 3CFCL 3QNZA 2C4XA 2YOCA 3UTTA 3CVHH 1NEZA 4MD0A 4XPFL 1WQVT 2YEZB 1AI1H 1HCVA 3KR3L 1IC5L 3PGDA 2W38A 2F54B 4YE4L 1RZJC 2WV3A 4TRPL 5BXFA 4P46D 3LKOA 4KJQD 5KANG 1A7OH 1ES0A 3KPRE 4YDVB 3D25A 4ZUSB 3MGTA 2XZAH 4JY4B 1CICA 4V2CB 1CLOH 4WRLA 4ZO6A 5EOCL 3MOBL 5E95B 3V6OA 5T1MB 3LY6A 4HMEA 5IG7B 2EZ0C 1RZKH 4LCIH 4ODBD 3MCLH 5F9WB 1T2XA 2FEEI 4BFGA 4JCLA 3DX9B 2ZJSL 1JNNH 4KROB 4NQCB 3AY4A 4WGWB 2Y7QA 4PR5B 1ZVYA 3WD5H 3O3BB 1XF3A 4U7KA 3FFCB 3WXWH 1RU9H 5TF1L 2YN3A 1GGBL 3PABB 4ELKB 1S5HA 1VACB 3JXAA 4F7PB 4XC3H 3RWEB 2P5EB 4O2EA 3PHSA 5HI5D 1Q9OB 3ULUD 1H3TA 4N8CL 1T7XA 2A6DA 2X4UB 4DN3L 3S34H 3NTCH 4N68A 4PJ7E 1LE9A 5JXAL 3K81A 1OGAD 4GG8A 1BFOB 3FJTA 1MCDA 1ONQA 4L8DB 2I5YH 1MEXL 4YDJA 3HAEA 3RBSA 3ULVH 2C7UB 5JTWA 3QQNA 1RK0A 2XRAL 4N0FB 4QRRE 4EKXA 3ARDB 4YX2L 1XGTA 3E0GA 3PP4L 5E1AA 2GUOA 1JNHA 4G80A 4KC3B 5BZDB 1KN4L 4U1MB 4UILL 2OLDA 2BNQE 1XAUA 3C5SB 1HI6A 5B4MD 4WDIA 2I27N 4JFZH 4XPBH 3QIUD 4Y5YA 3L7FB 1FIEA 2P7TB 3E3QC 5F1NB 5CCKH 2Y23A 1L9NA 2C4FT 3FTGA 3OZ9L 3A6CL 3BMVA 1VFMA 1G7MB 2BVUA 3C08L 1Z0NA 1GJIA 3FQTA 5JNYA 4QCIB 4MNHA 3LKQA 3REVA 4JFPA 5H2BB 2DDQH 5ESQA 4ELMB 1KCRH 2DLGA 2IGFL 2IMNA 3VRJB 1JGEB 3KDMA 3N1FC 4OGXL 4S1QH 3V6BR 5J56B 3T0VA 3PV7A 1U8NA 4XNQB 4WI4A 3VE0A 4FQJL 5DS8A 5GGTA 2DYPD 4J2XA 3S9DB 4GS7B 1QR1A 1JWSA 5BVPL 3SDXB 1D9KC 3M07A 3OKKA 1OP9A 3O9WC 4X6DF 4HUWB 2BSTB 4FFYH 4N5ED 4YDKL 1KSRA 2MCPH 1ED3A 2A73A 5FO7B 2VXQH 5DQDL 2R8SL 1NAML 2CLZA 1I3VA 4DN4H 4M02A 1YEKL 1I8KA 4PBWD 3RTQC 2APXA 3LH2H 5C0JB 3GSXA 4PD4K 2DIJA 1OM3L 4S0TD 4O51A 2FHBA 1F3DJ 4XPHH 2ZOLB 3MRIB 1YNLL 5T33H 4QF1A 4ODXB 1Z9MA 1K8IA 1IGML 4JRXA 4LVEA 3PXJA 1R3JA 4I2XA 2VKWA 3LEXB 1DN0B 4KWUA 3QUKA 2OMNA 2H6PB 4LCWB 4P2RB 1MCCA 4P4KC 4PV8B 5HHOA 1CF8L 4NOBA 4QOKB 4PRAB 4LOUD 2CSPA 4OGAD 2ZWLT 2X4TA 4LCYB 3ARBC 4ZS7H 3HAEG 5H37G 3I6GA 3CZJA 3D18B 3SJVA 1ZAGA 1RD6A 3UMTA 1NSNH 4TUOB 5TF0A 4NP4L 3WFCH 2NQCA 2R2HA 2OR9H 4WJ5B 3WS6C 3F7YA 3SKJH 1NCBL 4KKLD 5I75C 4G9FD 1HIMH 4ORZC 5I76A 1EVTC 3VXRB 3T8XB 3RBGA 1W8OA 5AZ2L 1OAYL 2D31A 3TV3H 3UTPD 2AEWA 5BZWB 4BFEA 4R26H 2AEPL 4R2GD 3LIZH 3G08B 3SBWC 3UJIH 3K8MA 3DO7A 1BAFH 5ITFB 3I9GL 4J3VA 2CR6A 5DD1L 3DI2B 4C59B 4ACPA 4NUGL 4M03A 5I1AA 3T2NL 5ADOH 2EIZA 3OGOE 2G5BA 1ZHLA 3CFJA 4HUUA 1E4WL 4EN3C 4XAKD 4IIQA 4P5TA 4MHHI 5KW9H 1ZVSB 1YEEH 2R69H 5I73C 2EDWA 1OWWA 4M1DL 3LQAL 2VC2H 1FGNL 2OJZH 3IDGB 2NXYD 1F11B 1Z6JT 1G7IB 1F6AB 3GSRA 3CLEL 5CGYC 1OW0A 1UH3A 4O2CA 2NR6C 2ZSWB 4TULH 5I1KH 1Q0YL 1U58B 2IAMA 4GKSB 1DLFH 3E2HB 2BVPB 2ZUUA 5DJ0B 4Z7NE 5CJBA 3TYFB 2UWEE 4PP1D 1TQBB 3QDAA 4M00A 3X3GL 4U6XB 1G7LA 3ULVE 1P6AB 4FTVD 1A21A 4WV1A 1MHPH 4XVSH 2NY3C 5DT1H 4GRLD 4HK0B 3ZKXB 4A6YB 1U95A 5IP4A 4QXTA 4APQB 4FABH 3VXQA 3VFMA 4MGXA 2IPKA 5DQJA 2EDOA 3P4NA 1ORSB 4UV4H 1NEUA 2VXVL 5CD5C 2MJWA 4EBQH 4GAJL 4FQIL 4WUKL 4HKZB 2W0LA 4GQ9L 4UU9B 3MLZL 3ARQA 3MACL 3CFKB 3VXSA 4HBQA 4DGIL 1IKNA 1NLDL 3OAYK 1FORL 4MNGB 2HG5A 4AM0A 4JFHE 3Q6GL 2LAGB 5CEYA 3X3FL 1JWUA 1QHOA 1LO2H 5FF6B 3EYVA 1OT2A 3HS0A 4P2OC 2QADB 5I1LB 1ZGLA 3C60B 3MOAH 4KHXH 5J6GA 4JCMA 2YD3A 3UTTB 3VI3F 1NEZB 1J8HE 1IAMA 5CEZH 4DAGL 3ARGD 3SE8L 1H0DA 5SWZB 4XMLL 2QHRH 1NUGA 12E8H 4G6ML 5AAWA 2JJVA 4ONHA 3D0LA 5BXFB 3LKOB 1FFQA 1ES0B 1YEJH 4L4VD 1QHPA 3TFKD 3D25B 4K23H 3MGTB 5C0IA 4QHNB 2R4RH 1WITA 2R23A 3DVNA 2DMKA 3QG6A 4G6AC 3OR6A 2DQJL 1HHGA 5T5NG 5BS0A 4OI7A 1Q38A 1UZ8B 1X5GA 3OB8A 4OGZA 5GRVK 5DMIL 5ENWA 3EHBC 1ZWIB 3K8KA 1ZT7A 4MAYD 3A6OA 4X7DC 3RU8H 2Y7QB 3BD4A 3IS1X 3MCKB 3ZTNL 5D2LE 1DBAL 4OBSA 1TETL 3HMWL 4R7DB 3GZKA 1S5HB 2GJ6B 3U0WH 3KJ4B 1AXTH 1ZV5A 2YWYA 4O2EB 4P48A 3HRZA 3ARED 5IHZA 2WUBL 5HVHB 5CJXC 4PRPE 1AQKL 4F2MA 4OCWL 2HT4C 2VLMD 5HI4D 4LPWA 1LE9B 3H42L 1JRHL 3M45A 3QUYD 4Q58C 1NGYB 4Y4KC 3S37X 4P46A 1UM5L 5FKAA 4Y4FC 4U1NB 4LHJB 4NN7B 2QR0B 5GRYA 2AQ2A 2NY2C 3C9NB 1GGIL 1PG7X 5AG9A 4RAUA 4MA7L 3KPMB 5KSUA 1FCCA 1N6QH 3NPSB 4KJWC 1KLGA 1XGTB 1CR9L 1RFDL 1UWXH 4ZTPH 5E1AB 3AUVA 2GUOB 1K4DA 4I3RH 5FYKU 43C9A 1JNHB 2OSLA 3NZ8B 4G80B 5B3NA 3CXDL 4OZHA 4KK8C 3B2UD 5I8EA 3MFGB 4WDIB 3UROR 4Y5YB 1CDUA 4LSRH 3OAZH 1FJ1B 3BJLA 3UJJL 1ZS8A 1DBML 3FTGB 2EDLA 1P4BL 4WVRA 4HIIA 1LDPL 4NFDA 3TNMB 3FQTB 1UYWL 2WLZA 1J5OH 2YUXA 2AJSL 2PCPA 3LKQB 4JFPB 1Y18B 4X6DB 3EUUA 3BKYL 4Z7UE 4XP4L 5C08D 2A9ML 2F15A 3KDMB 4POZD 5JHLL 2BOCA 4TVSa 1OGAA 4Z0XA 2KKQA 3U1SH 3MLXL 3RVVC 5DMGD 3LN5B 5T1DL 1MIML 2NX5D 2CKBH 3EYFA 3VE0B 3RGVD 3F58H 4YXKL 1U3HC 5KZCD 1NCWL 3G5YB 4NJ9H 1QR1B 4PLJD 1JWSB 5SX5K 2BMKA 3RUGA 1MRDH 2C1OB 3BZ4B 4JHZA 3PP3K 4RMSA 3ULUF 4F7MB 2C5DC 4Z95L 2ICES 3OKLB 1P4IL 4JJHA 3RWIA 2DKMA 4ZFFA 2BJML 2QQLL 5SWSE 2PYEE 3QIUA 32C2A 1RULL 4KVNH 4L8SA 2ARWA 2R2BA 1MJ8L 4LF3A 1I8KB 3FCTB 4W6YB 3BD5A 3CLFL 4QYOB 4HS8H 1GGYA 1I4FA 1RZGB 1KEML 2EE2A 4ZFGH 4E9LA 1UADC 3RUGF 2HTLD 3VFNA 4NOFA 1JZ4A 2MNUA 4LP5A 3GSUB 1CVSC 1DVFB 4Y5VA 5AUMB 3WFZA 3QAZC 3WLBA 4QF1B 1XCQA 1SY6H 3MTRA 3NOIA 3MXWL 4OQ1A 1LE5A 3QI9D 4LSUH 4NKIL 3OGCA 1AHWA 4I2XB 4MCYB 1RJZB 4GG6A 1TZGL 3W0WA 1P84J 3UCRA 5HHOB 5C0FB 3S98A 3GJEB 5D7LB 2ICEA 1ZA6B 3RWCB 1UEYA 2DQIH 4LVNB 4HS3A 2X4TB 2DYPA 4R9HA 1UWEH 3CFBA 3TJEL 1NCCH 2IALA 4HV8B 1FVCB 4XTRD 5CEZE 2VZTA 1R5VA 1A7QH 2R2HB 2MQ3A 4LIQL 5DFWH 3F7YB 2H9GB 1R3IH 1J10A 1FFRA 1H15B 4PJHF 2E8YA 3KHQA 4J8RB 4OLVH 2D31B 1S9WB 5JA9A 1U8HA 2ADIA 4D9RE 3OX8B 4J1UA 4DZ8A 3MBXL 3P9MA 1T83A 1FQ9C 1W72H 4N1HB 3BPNB 5DVOA 3Q1SH 3QDGE 1FYTB 2MMXA 1IFHL 2G5BB 3T77B 5HPMB 4XBGA 3CFJB 2VXTH 4HUUB 4DEPB 3IS0X 1DFBL 4P5TB 1UCTA 2XQYK 1F45A 3D3VB 1U6AH 3K4AA 1A8JH 4EI5C 1MRCH 4H1LH 5BV7B 4UTAH 3PWJA 1O0VA 5GGRA 4AEFA 3HR6A 2V7HA 1OQXA 4M8VA 5K59F 5FCUL 3MLVL 2DQCL 3IDNB 3MRBB 1QLFA 4RGMB 3TZVC 1EHAA 4NM4H 1FL6A 4YHLH 4ZUVA 5HDLA 4QTHA 4G9FA 4ZFZB 5FYJL 3VD9A 1WIPA 35C8L 1G7LB 4O00A 4X99A 1OTUD 4YQXL 5B8CC 2H3NB 5CGTA 3O2WL 3OKEB 3X14A 5GZNC 1U95B 5E5MA 5BMFH 5C6PB 4QXTB 3VFTA 5F7UA 4Q9RL 2IPKB 5DQJB 3SDCD 4OZIA 3P4NB 3JTSA 1FNSH 3T2PA 4NM8H 1W0YT 3K74B 1AD0A 3WFEH 1I8LA 1E4JA 1WSST 5KSBA 3HC3H 5HI3D 4R96A 2BDNL 5DSCB 2P44B 4QRRD 4IRSD 5LWYH 1JYVA 3OF6D 4JHWL 5GRVL 4ODHH 4AM0B 4I18A 3EFDH 1ACYH 1H8SA 4KTEH 1JWUB 2A0LC 3EYVB 3LQZB 4JKLA 4TSCH 4LAQL 2BNQD 5DHVA 4PBVC 1A5FL 3QXTA 1KCSH 4OZIF 1ZGLB 3HMXL 4LEXH 1YDPA 2YPKA 1HXMB 4H88L 4BZ1L 1HN1A 4JPWL 5KSBF 3JWNC 5HGHA 1H0DB 2IPTL 5E4EB 5F89A 2DTSA 4ISVA 3G6JE 1BWWA 5J13B 4S11A 3AS1A 4P99A 3L95A 2ICWI 5EBLA 4FTVA 5FYKH 2BFVH 4O2FB 5GJSH 3T09A 3H9HB 4H20H 2R23B 4UTBL 1CGWA 5E1HB 3RPIA 4GRLA 5LBSH 2ZG2A 3OR6B 5BS0B 5EU3B 3I6KB 1I9IH 4X6EA 5FUZH 2IBBA 3EJZD 2N1KA 1RZ8A 4IMKA 1VKXA 2Z91A 2X10A 5ENWB 1BOGA 5DEFA 5DD3L 1RZJH 2CK2A 1OL0A 4PGEB 4BH7B 3U36A 1JGDA 2FBJH 4DKAA 4ONFL 4U7MA 5EA0H 3FT4A 4JKPH 4L5FL 1RK1B 3GMOA 2RAMA 2W07A 4PJAE 2EEBA 4OCLC 2VDMH 3IDXH 1G9NC 2VR4A 3HRZB 5IHZB 4BYHA 4IM8A 4CN6A 2R2EA 3ARGA 1XEDA 5FKPA 2Y5TA 4PV9A 4NNXB 1B6UA 1VCAA 1Q9WB 3QXDB 1U8LA 4OM0H 2EDKA 1JV5A 4P46B 1Q8MA 1PKQA 5C9KA 3MLWH 4UINH 4L4VA 1J88A 2LVEA 1ACZA 2HT3C 3MV8D 5HDQH 3IU4L 5E2VH 2VJXA 3EOBB 2OJEA 2NTSP 1PLGH 2GSIA 4NJAL 3K1DA 3H9YA 5HXMA 2OSLB 2FJGA 1T66D 5EUOA 4D0DB 4GS7C 4MAYA 1CTNA 3RHWK 4NFCA 2HJKA 4Z7WE 4GW1B 1ZS8B 3RVUC 1I7ZA 5F72S 4OZFA 2I07B 4KZDH 4HIIB 2P5WE 3U4EA 3MRPA 2QQKL 3X13B 1VENA 3AREA 4R90L 5EIQA 5LGKA 1KJ2L 4XCFL 1MIEL 1S7TA 3LZFL 5EUOF 4BM7A 3V4VL 4LKXA 1UH4A 3QUYA 1UEMA 5GS0L 1F2QA 5FO8B 2XOTA 2GK0A 2J8OA 4HWBL 1CK0L 1IGIL 4XRCB 3EYOB 1CDHA 3PIQA 1HYSD 4V1DE 4W6WB 3N85H 1A7NL 3LHPH 4PJ8C 2VITB 1E6JL 4RCAA 3E6HB 4JPVL 3RWIB 3BYTA 2XFXA 2R1XB 2Z31D 1IAKB 3C5ZD 3CU1A 4UOW1 1AH1A 32C2B 3RWDA 1P7KA 1AI1L 1LO0H 4Y5XC 2OXGA 4L8SB 3VFUA 4MZ3A 5CJ5A 1HHHA 2R2BB 3TPKA 2HMIC 4L8CB 1NAMB 1A7OL 1G7PA 1I4FB 3WEXA 2EE9A 3BDBA 3VFNB 1CLOL 4Y5VB 1JPSH 3P9WB 4H26B 2WUCH 1X7QA 3ULVD 4U4BA 3I50H 3WLBB 4EDWL 1XGRA 5C08A 2JLLA 1Z5LA 1LE5B 1AGDA 3OGCB 1AHWB 3HI5L 3SGKC 3B9KD 3SGJC 1TVBB 4XXCC 4PJHB 2Y36H 1UA6H 4JFOA 2NX5A 5K9QG 2ZPKH 5JUEH 3RGVA 4UBDD 4KH2A 3WD5L 3BGFC 5IM7A 3WXWL 3CFBB 4HH8A 5TDNA 4XC3L 4JFHD 1R5VB 4PJGA 3P4MA 2P4AB 2LTQC 4MB5A 3O11A 3DARA 5HVWA 1M6OA 3NTCL 5FYKE 5GGQL 4NQXB 3H6JA 2FATH 2PYFA 3H3PL 5FUOH 2R29L 1A6UL 1J8HD 2Y06L 2Z8VC 2VQUA 4RMWA 2ADIB 1OP3H 3KPOA 4DZ8B 3C6LB 3P9MB 3P0VH 1NMCB 4H8WH 2NY1D 4NNPL 4N1CA 5GPRA 3RWGA 1Y0LA 3M1BA 3A6BH 5DHXB 4LFHD 1MCIA 1MAML 1T21B 4N9GA 3QI9A 5F9JB 1NLBL 1K6QL 1SQ2N 3MBEA 4OD1H 1KEGH 1DQJA 2J6EL 5HTSA 5GRJL 2CK0H 2FLRT 2NNAB 2XZQL 3TT3H 1B3JA 4Q9QH 4XPBL 2X42A 4HUXA 3TBTA 3U2SA 1NCAH 3O4LE 5IMMB 4FZ8H 3QUZB 3VG9B 2V7HB 1G6RH 3PHOA 1I75A 2CO6B 5F21B 1FVEB 1CL7I 3NGBC 1CXFA 4AT6A 4KUZL 3WSQH 4ZUVB 2ATKB 3ZDXF 4U33A 5SV3A 4G9FB 1FNFA 5I9QB 5GISH 1CLYL 1J0KA 1F8TH 1CFSB 1KLFA 4X99B 1QEWA 1KPRB 2BRQA 5DJDA 4PRPD 5I8KH 3IDMB 5E24E 5KS9F 3V5DA 4R2GB 3VFTB 3TGXA 4KV5E 4MX7A 4OZIB 1UWXK 1H5BA 1AD0B 5DUBA 3MV9E 1JGLL 5KSBB 4TUKL 3JV6A 3BIAX 4EXPX 1YN6B 3CMOH 4R96B 4DCQA 1CICC 3VRLF 1ZHBA 3V6OC 3OAZK 3K2UH 4XNZB 5GGUA 4UT6H 4JZJA 1T1XA 1CL7H 5BOPA 3O2VH 2MCPL 1VDGA 3RX8A 5IFHL 2NXYB 1WFOA 5EPMA 3AY4C 4AH2A 5DHVB 3HFMH 4JFDB 4X8XA 3GB7B 4NKOA 1P7QB 3ZDYE 1HCFX 3U7WL 1YDPB 3RAJH 1T0NB 1PZUB 2GTZA 3C09C 3EYSL 1JPTL 2DM2A 4F3FA 2LFGA 5E99H 3GI8H 3TO2A 2ITCA 1MCKA 1ZA3A 4KRLB 3E3QE 4HCRA 5EBLB 2VZVA 4FTVB 5IOPA 4NC2B 4NHUB 1NCUA 4DVRL 2VMFA 4K3GA 3WBDA 3GMNB 3VD3A 4JPIB 2YMXH 2ATPA 3RPIB 3ESUF 5ANMA 1UKSA 1JBJA 1RUMH 4PJ7A 4ZXBB 4EOWH 1HSBA 2ED7A 3SDCA 1KELL 4X6EB 3LRSA 1RZ8B 1VKXB 1AGCA 1T1WB 2Z91B 1MCLA 1G7JA 4UOW0 2R0LH 1IGJA 3VJ6A 1ADQL 5EZJB 3WFCL 4QRRA 4IRSA 2VUYA 3CK0L 3OF6A 3QR2A 2ITDA 3SKJL 4O9HH 1AO7E 1BQHG 3U36B 4CJ1A 5IB5A 3JVGA 3FT4B 4KVCH 4PJCE 4LGSB 1BVZA 1E28B 2BNQA 3OSKA 4PJ7F 4Y5YC 1AR1C 5SWSD 2PYED 4YHKH 1CXEA 1AGFA 5MI0C 4R26L 1A3QA 2V5RA 3B8SA 3D85B 3UJIL 1GZQA 1BAFL 2R2EB 1TJGH 3PWPE 4GW5A 5FKPB 2ED9A 2FL5B 4XVUD 2Y5TB 3GRWH 4LPXA 4DKFL 2XN9B 1JV5B 3PNWA 1D3CA 2BHUA 5ADOL 1PKQB 2KH2B 1JYNA 1JYWA 4Y16D 5B38G 1IC1A 1UWGH 4PJEE 4EIZC 5I2IA 3TCLA 4C55A 2F8VA 2OP4H 1E6OH 2VC2L 2OJEB 2JCCA 4LDLB 3TNNA 3SKUD 4G5ZH 1N59A 3NN8A 3KJ6L 4DVBB 1DP0A 4PTUB 1WWWX 1MFAH 3I2CL 5KVFL 4U1JA 1VGKB 3OQ3B 3ISWA 4F7EA 3D2UD 5EUOB 5I1KL 3BUTA 5INCA 2Z8SA 3QQ3B 4GXVH 4P49A 1DLFL 1IRAY 4TUJA 3UTQA 1ZT4A 4X4XA 3WIFA 4HQQH 4LU5H 3FQUA 4OFYD 4Z8FL 5ALBL 5CEZD 2BVQA 5L9DH 3U4EB 4MDJB 1OGTA 2BP3A 4QHKI 3MROA 1MHPL 3QPQD 4G8EA 4LRIA 2D7TL 3DURA 3GMPA 1EUTA 1MSPA 3K8LA 5D70H 5EOCJ 5J1AA 1OAXL 4XNXL 5IHUH 5KSAD 3U30C 1T0MA 4LKXB 3IGAA 4U1SB 5DEGB 4D9LL 3THMH 3ZT6A 2DJUA 3L9RA 1U9KA 1WUNT 1U41A 2MHAA 1PDKA 4YPJA 3TT1H 5IT2H 4S1DD 3RJQB 5FUCC 2DQUL 3TWCH 4LRNH 3MV8A 3QDGD 3F7VA 1YMHA 1FAIH 4HWBA 3JBG7 4J7RA 5JW4N 5C1MB 1LO2L 2E7HA 4NN6B 2EDRA 5FDWA 5B3JE 2VLJE 3BP5B 3MRCA 5F88B 2VLKE 3OG6B 4TQEL 3CH8A 2RCSL 3MOAL 1EEZA 4E5XA 4HULB 1KTLB 4YHYC 3RKDC 3VFUB 5FHAH 12E8L 3CVHA 4ZFOA 1G7PB 3WEXB 1IAIL 4BH8A 3WNPA 3T1FA 1KOAA 2Y5EA 1AC6A 4IOFD 5CSZA 1X7QB 1DQTA 2B8OT 3DMMD 5J1TC 4OJFL 3CU7A 1L0QA 1XGRB 4MNQB 4XVTH 3RZWA 3BAEH 3I3DA 4P5KA 2JJSC 2DQHH 5D1XB 4NGHH 1KCUL 4JFOB 4Z0BL 4LLDA 4M6ML 3RGVB 1T6VN 3T0XA 5KZCB 3WIIH 1T4KA 3A67H 5IM7B 1MWAL 4DEPC 1H9VA 3MV11 4IIQC 3AROA 1Q1JH 1QFOA 1Z9OA 3P4MB 2ZCLL 4KPHH 1RUPH 3GIZL 5GSRB 5FYLH 3QULA 4DOHB 1WZ1H 5DJYA 2XZZA 2Z31A 2HT2D 1OW0C 3C5ZA 3O11B 3EDFA 1M7XA 4XPAL 4TNVK 5J0BA 4QRUA 2BVOA 2WIIA 4BUGA 2IAMC 2OZ4H 2Z4QA 3HTLX 3DECA 2AVGA 4RGOH 4O02H 1NFKA 4FQ1H 4AY0A 5JHDE 4R4BA 5GSVA 2IC2A 2UWEA 3QPXL 4OLUH 4F15C 3CPLA 1RJYA 3S6CA 3RWGB 3BH8B 4WV1C 1J9CT 2YUZA 1F4YL 4P23B 3UYOD 5HVGB 5TE7H 5EU4A 3EKCA 4JZOB 4J3TA 4N9GB 3QI9B 4GW4B 4HZLB 5E4IA 3BKCH 3MO1B 1DQJB 3B9KA 4U49A 4Y4HD 3HZMB 1FAKT 3ZKQD 1RZFL 1MCBA 3QZWG 2ZG1A 3TBTB 4EQ3A 3U2SB 5KS9B 3LOWA 4WEMB 2W9LA 2NY6C 4PB9H 1UM4H 2F74B 5ICYA 5HYQB 4Z7NF 2XT1B 5C6TH 4LSDA 5T5FH 1W0WA 3HUJF 4AT6B 4OF6A 3KWWA 3RA7L 5EO9B 4XBPB 2PW1A 1KJVA 1L0YA 4KAQH 1FO0L 1YEIH 4GH7B 5E2JA 5CS7A 1QEWB 5C0BE 1KUMA 3OJDB 3GBMH 5DJDB 3U1SL 1Z2KA 3CFDA 1UKQA 4PFEA 1J8HA 4FNLH 1WFTA 3V5DB 3UPRB 3LCYA 4MX7B 1UCBL 2DWEA 4NJ9L 5DUBB 3GMLA 4GRWF 1SM3L 3KPRB 3JV6B 1MRDL 2VDKH 4WFHE 5JDSA 2DTML 3O0RL 4G6FD 1IQWH 4M5YL 5JW4M 5J06A 4M7ZC 1RIVL 3LKNA 5GGUB 4JZJB 5C2UB 1T1XB 4IOSD 2EYRA 1EX0A 2DKUA 1CGYA 1BGXL 1RHHA 3MRMB 3ARVA 1NL0L 4LPCA 2HLFD 4XI5D 4AH2B 2GHWB 3PG2A 4I3GA 5DO2D 3WFBH 1MY7A 3MOQA 3MUY1 1M05B 4HS8L 5DLMH 4YUEL 1A1OA 4JHAH 4ETQB 4PRIE 5D2LA 4YFLI 1IVLA 4F3FB 1ZOXA 4OKVA 5F1IA 4JM4L 3QYCA 3TO2B 2ITCB 5L6YH 1SY6L 2P5WD 4ODSH 5IOPB 3B2VL 4F7TB 1YEFH 4KQ4L 1MVUB 4DGYH 4PJ7B 1LMKA 5CHNB 5I6XC 3TH3T 4KJQC 1WBZA 5HDBF 1C12A 1OB1B 1G7JB 5D2LF 3O8XC 5DMKA 1T80A 3BKMH 1EXUA 2W60B 3MLYL 1AE6H 4QRRB 3HC4H 4IRSB 3WO4C 4V1DD 3QQ4A 5HY9A 5F3HA 1MI5E 1F58L 1JP5A 2IJ0C 5E2TH 1SJEA 4P2CG 2DJ4A 1NC2D 1KTRL 2JB5H 2WBJD 1A6ZA 4ORGA 1LEGB 4LCUA 4OLVL 2BNQB 3HNVH 3T0BA 4DGVH 5E8OA 5JQ6L 4HKXB 4Z18A 1MLCA 3RIFK 5F9OH 4ODVH 4HGWA 1U3ZA 4UDTB 1I7RB 1RMFL 1WGOA 2K7QA 3MRQB 1EEYA 3PHQA 1N0LA 4L3AA 3Q1SL 2V9RA 2G2RA 2PTVA 3OAUL 3PNWB 3ULUC 1R3KB 2FZ3A 5K93A 3U0TA 3KPSB 5CZXC 5I2IB 3SQOL 3NABL 4Z7UA 3TCLB 1FVDA 5C0AE 2YS4A 3QISA 2YSSB 5HHPA 2GFBA 1N59B 5KVGH 1G9NH 1B0RA 4X4ME 3RHWF 2VDQH 1XR9B 3P77B 4U1JB 5FYLE 2XQBH 5T1KB 3DV4A 4F7EB 5F7NC 4OKDA 3QJFB 3BP7A 2NY0D 5INCB 3DYOA 3GSNA 3N50A 1AIFA 2CMRL 2X09A 1TZHB 3UTQB 2ENYA 4X4XB 5E03A 3WIFB 3KYOB 1HK6A 5T1LB 3QEQE 4HGKC 4KU1A 1X4YA 5DRZA 2X05A 1OP3K 4Z7UF 3TBWA 4FHBD 3IAPA 1B4JL 1LP9E 1M71B 4NQDE 3O2DA 4NWUL 1PG7W 1IEBB 2OL3L 4OFPA 4WNQA 5SWSA 3QIUC 2PYEA 3H0TB 3H8NA 2EC8A 4GRMA 4L8SC 5FYKD 2DKSA 4G8EB 4FQ2H 1ZTXL 2CDEB 3DURB 3GMPB 5J1AB 3IDJA 3LAFA 3QEHA 1NBZA 1FNSL 4NM8L 2B7DT 1KJ2B 3WFEL 2GTWB 3HC3L 1NKOA 4Y16A 2DOCA 3IT8D 4ZOAA 3G5ZA 3ZSSA 3I75A 4U1HA 4FQQA 1YMHB 2DQDL 5F7MC 3K80A 3F6IA 5JMOC 1AHWC 3H2WA 4PRHE 3VFOA 3S37H 1RZIA 3MLUH 1KG0A 3BHBA 2R0WH 2NLJA 1KPVA 2K3TA 1AFVL 1C16A 3FO0H 4I8DA 3VD7A 3M17B 4DUXA 1PG7H 1ZEAL 3D2UA 1YY9D 4D0BB 1L9MA 3O4LD 5KANI 1T03L 2NY5C 4CADA 4D2NA 1A3RL 4OFYA 1X4ZA 5A2JH 4UB0H 2VDOH 4PLNC 3NCEB 5FYKL 1P6FA 3PWVA 3X12A 4YHZH 1I9JH 5CSZB 5LBSL 4QY8B 3VGGA 2IQ9L 1KULA 1TQCB 1I9IL 5IR1A 3WFHA 2APTA 5JLZA 3S5LA 4X4YA 3O3AA 2VL5A 4P5KB 4PG9A 1MREL 4KMTH 4XB8A 1S7XA 4KQ3L 4UUJA 4X9FA 2XY2A 4LLDB 4LAJH 3BRFA 4LLAA 5IWLC 3MV9D 5EORH 2HJLA 3QDGA 1U92A 5CKGA 5C09E 3IU3B 2FD6H 5DGQA 5LGHL 5FEBA 4ZD3H 3NIGE 4AMKH 2EDJA 3NCMA 1RIHL 3IDXL 1U8QB 4LOUC 5DWUH 4OGAC 3QULB 5FA3A 5DJYB 3DBXB 2BSRA 2J7LA 4HT1H 1CD8A 4G42A 2J1KA 4PD4J 1KNOB 2BVOB 2WIIB 4QRPE 1TVDA 4PJ5E 4OM0L 3RJDA 2Q86A 3S36X 2QHLA 4JANA 1U8JB 2E9BA 1RSFA 2WQ8A 3MLWL 2B4CC 4KKLC 3UXFA 4X9GA 2PR4H 3D69A 5GSVB 3LN9A 1WCBA 3T0AA 4B7IA 5IGXL 1RJYB 4R7NB 1PLGL 3HUJB 3VWJB 1LNUA 4IRJD 1U2CA 2GSGB 5DD5H 4Q6IA 5EU4B 2ADJA 2D7QA 3Q5OA 4KUCF 1BJMA 3B9KB 4K7PL 3TBVA 4HS6A 3FMGH 3WN5B 1YUHB 1I8LC 3FT3B 1V7NH 2P46B 1JI2A 4D8PA 3IDUA 1Q94A 1DSFL 1C5CL 3MPCA 5ICYB 5TPWL 4OLZH 2DM7A 1CGTA 4PJIB 4KZDL 1CDBA 4I18C 1TDQA 4GRWB 5IKCA 4XX1E 1W0WB 3ROLA 3WDHA 1AO7D 1KTDA 2NXYC 3DSNA 1HKFA 5A3ID 1VEMA 5L0QC 2PW1B 1KJVB 4JFYA 4QNPE 1LGVA 5TDPA 4JG1H 3BH9A 5GGSA 1D9KD 3T4YB 3O9WD 3TM6A 1V3LA 5JPNB 5DJAA 1IEAA 3G6DL 2XIDA 3PWPD 1KENH 5ITBH 1JFQL 4NFBA 3IFPA 1S9YA 4OT1L 2XI9A 3G6JA 3DUSA 2NY1B 5DYOA 4F37K 1UZ6F 1VFAA 2CKBA 3C8KB 3QHZL 3MMEB 5JDSB 1CBVL 4M9PA 1BVKA 3N85L 1CE6B 3FQXA 4GRLC 3HRPA 1JF5A 3BO8A 1JPGA 2K7PA 3KPNB 4HUKB 4O4YL 1OCWL 3LKNB 3MCG1 4Y4HA 1HH6A 1MF2L 2XTJE 3QDME 5IK3B 4P3WA 2AQ1A 4NRYA 3MRHA 4YGVB 1WWBX 3VA6A 5DRXA 1CXLA 4MA1B 4GBXC 2V2TA 3VDBA 1ND0B 3WIHH 1WBXB 3G6JF 2J8UE 2BSED 3NFPB 5T3ZH 5KSVA 1D6EB 2D2OA 5C07E 4P4KD 3L3GA 4JM2C 1KIPA 1REIA 2XG5A 2WUCL 2ZZUT 3QEGL 3ARBD 4OKVB 5F1IB 3NA9H 4JY5H 3WKMH 1FZJB 5I1HH 4PJAA 1S9KC 2DBLL 3QP3A 5JZ7D 3FB7B 3T0DA 5GGVH 3BEVA 4PRPB 3ARGC 5J4MA 1UA6L 1GVIA 3WDJA 1H3UA 3BKJL 5I8CA 1K2DB 1CFVH 3RX7A 4X7SH 2IADA 1FL5A 3TFKC 1C12B 2O26U 2FX9H 2D0HA 2BNUA 2GT9B 2A9NL 3QEUB 1P9MA 3CH1A 3D9AH 4XAWL 1KT2A 4NZUH 3JUYA 3I02A 3QQ4B 5HY9B 1IILE 1DDHA 5T3XH 1SJEB 3T0EE 4NZTH 4WWKA 4D9QE 4I4WB 2VLJD 4PP2A 1A6ZB 1WZLA 2VLKD 1OWRM 3MYJB 2Z92A 4LCUB 1FLRL 4RGNE 2R1WA 2H8PA 5E8OB 4MAYC 1MLCB 1C7SA 3PDGA 3CSPA 1MHHB 3IFOA 2LE9A 3HAEH 5H37H 3EYQD 1V5JA 3P0VL 1BJ1J 1EEYB 1I1AA 3BPOC 3KPPA 3LEYH 4Y8AA 5CGYD 3O4OB 3AAZB 4FFVD 2V6HA 1AC0A 2VAAA 3L5WA 3NIFE 1BZ9A 1B0WA 1NFIB 1W72A 3AREC 4WY7L 2FZ3B 3V79C 5CUSH 4RNRB 4IS6B 1BP3B 2QSQA 4RIRB 5BRZE 5DRWB 2VSCA 3TT3L 4ZODA 4LDOB 1HH9A 3QUYC 2GFBB 5EZOH 1NCAL 3AVEA 3VH8A 4BZ2L 1NGPL 4OZGE 3GFUA 4Z7WF 3BRDA 5TJWK 5HPOA 1E4KA 4H1LA 4JJ5B 3RNKA 2HFFA 4YNYA 5BJTB 4LPUA 5CSBA 1AIFB 5L7XH 4V1DA 4JDTH 2RGSA 1A6VH 2OTWB 5HGDA 2CUIA 1NC2A 4ENED 2WBJA 5DRZB 3LMJL 1F8TL 2R39A 3MGAA 3SPVA 3TBWB 1KFAL 5KVDL 4CVZB 2ZUYA 4YAQA 4JR9L 3B2UC 4QTIL 4RRPA 1YPZE 3V2AR 1N7MH 2ARJQ 4PJ9D 1Z3GL 4IMLB 3FHQA 2ZKHL 3CX5J 3BE1H 2JELH 3QEHB 3QXUA 1VESA 2FECI 4YO0A 5IBUB 1AQDB 4N0UE 2GAZA 3BPLB 3CMOL 4OD2A 5JHDD 1EGJH 4YR6A 4ZS6D 5IV2A 3ARZA 3F8UB 2Z35B 3K2UL 4GFTB 4I9WE 3EOTH 4UT6L 4WEUD 3I75B 2ESVE 4U1HB 4FQQB 5F7EL 4U1IA 4POZC 3VXUE 1RZIB 3D5OF 3BHBB 5DMGC 3P0YL 5JIPA 3K2MC 3GBNL 3HFML 3K0WA 2O5YH 2OXHA 1R5IA 3RGVC 2G9HA 2UZYB 3RAJL 4PLJC 3CDGA 4R97C 4MWFB 4UNTA 4N8VA 5E99L 3GI8L 3GK8H 3TIEA 1DEDA 3H9ZA 3FRPA 1WEJL 5TQ2H 1WTLA 3IDYB 3QO1B 2BERA 5ILTL 4P9HC 5ID0A 5I1JL 4TOYL 1U0QA 3QNYA 3X12B 4KZEL 1YY8A 4KKNA 3BQUB 3FB5B 1RUML