3CC5B

H-2db complex with human gp100
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Design of agonistic altered peptides for the robust induction of CTL directed towards H-2Db in complex with the melanoma-associated epitope gp100.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 16
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cc5B00
4X7EC 3DX7A 5IEKB 3C8HA 3F5WB 1CXKA 1F58L 3O9WB 4JFXA 4TSAL 3MOAL 3PWPB 5EUKA 8FABA 2NY3D 5IVOA 5MERA 5F7MC 5HVWA 1FVDA 1KB5L 1MLBB 3FO9B 3U2SA 3QUXB 1ND0A 4G8GB 1H15B 2PCPA 3MRRB 4S1DD 5EU6A 3KXFD 1AFVH 4YHLH 4PB0H 1NAML 4XRCB 4PJAA 1D6VL 3WIIH 2F74A 3GJFK 3TJEH 1BVKA 5E6ZA 3K8MA 4WV1C 1A3LH 1FGVL 3ARQA 4YFDB 2X4RB 3OKEB 3UC0H 3HMWL 4NJAL 5I1HH 5ESVB 1TVDA 4LSTL 5LCVL 3ARSA 3QJHA 5F89B 5D5ME 3DV6B 4G9FD 4X9GA 3EJZD 4Z0BL 4HS6B 3S36X 3T0VA 2DKMA 3NCEB 1KCRH 2W60A 4U7SA 3MCLL 1HILB 4KDWA 3WS6C 4F57H 2ZCHH 3SE9H 1IAIL 3KWWB 4QRUB 4LPCA 4K7PY 2EECA 5EU7C 4BSWB 3IJSA 4L3EA 3GBNL 1TZHA 4RZCB 3GSNH 2ICWJ 5EOCJ 4ZFOB 1N4XH 3S36L 5E2UH 2H26B 3S34L 1GCFA 2VDRL 3MBEA 2FYYA 2AAVA 4R96B 4GG8B 4KDTC 4TQEH 4OUOA 5SWSD 4KY1H 4M7LL 1S7TB 3HZMA 4JQIL 5F21B 1PDKA 3KPLA 4GW5B 5D71H 5F7LB 3TVMC 4HKXB 3W0WB 1AR2A 3GNML 4GRWF 5DRXB 4XP4H 2UWEA 4AT6B 3MACH 1ZT7B 1MCOL 5I1IL 4WIQA 4OGAD 1D5ZA 5C0BE 1CICA 4XCEA 4NRZA 3OZ9H 1QG3A 2EC8A 4KUZH 3S3PA 1U58A 1A6TA 2RR3A 5D2NC 4JFYB 4U7KA 3RWGB 4MJ2A 4PJHA 1BZ9A 3L5JA 4V2CB 5JORB 4Y19B 4D9QD 2R4SL 4LLAA 5E9DB 1FFNA 4OKVB 3BDXA 5D1QB 4NKOA 2XA8H 4U6VL 5DZOA 2GQHA 3BZ4B 4FHBD 5KSAA 4XP1H 4P2OC 2VLKE 1JF6A 5D1XA 1DLHB 2YRPA 1MCDA 3GUTB 5IJKC 3I9GH 3JWDC 3QDGE 1FYTB 1BQHG 4K7FA 3G6AB 3HI1B 1CR9L 1E4XI 1CDBA 4XPFH 1T5XB 3OAUL 5IB4A 1I3RA 2Q8BL 3OAZK 1OTSD 2CRYA 2DQFB 1W0VA 1XZ0A 4P5TC 1HQ4B 2PNDA 4NZTH 4PLKC 2YS4A 2A2QT 3MV8A 3ULUD 4M1DH 1Q8MA 1FVEB 5DK0B 4LSSH 3MRFA 4DN3H 5CEXA 1DVFD 5AZ2L 3D3VD 4KGJA 4P3CH 5DF0A 5GRYA 1QP1A 1AY1L 1YN7B 2KQNA 25C8L 4ZTPH 2YD6A 3QH3A 5HPMB 3RVTD 3NTCH 2NY2D 1CFNA 1L7TH 1HYSC 5DRZB 2IPKB 2JCCF 3UJTL 4EI6A 3ARXA 4U1NA 5FOBB 3K46A 1G7JB 2FJGB 3GI8H 1MLCA 4NQDD 3V6OA 2VLJB 4FMFA 1X6NA 4CVUA 2Z31D 4DUWA 2DMBA 2BRQA 4FFVD 3CC5B 5CJ8A 1J1OL 2XZQH 1JPSH 4Z78A 3MV7B 5C7XH 3U36A 2MKLC 5ISZE 4L8CA 3ARDB 2XFXB 4NYLA 4ODSL 5DD3L 2DQDL 2K7PA 3KYOB 4QHNA 2DF3A 1KCUL 3N1QC 1AC0A 3ARUA 4KI5D 1UJTA 4YX2H 2IG2H 1UXSB 3RL1A 1N8ZB 4XZUA 3EOTL 4MDJA 2ZOLB 4GXUN 1MCJA 3HMXA 4EI5B 1TENA 3STLA 3BJ91 4XMKH 4ZUUA 3QUZB 1FE8L 4LSUL 1JRHH 2XWJA 1HSAB 3GEWB 1CE1H 3NPZB 5DHXB 1NCTA 1NFIB 2X4UA 3PGFH 1QRNA 1I7TB 1U92B 4RQQA 1IZKA 2EKSA 1VACA 5LGKA 4G7VH 1RHHA 5D1ZA 4Y1AE 1DR9A 2VABB 5JHDD 4JRYA 5HHNB 3MRDA 4EIZC 4O51A 3B9KB 1CBVL 5CJXA 1CQYA 3LQMA 5DK3A 4ONHA 3VFMB 1A7RH 2GEEA 5HYSG 5HHOD 5A3IC 5JDSB 4X99B 1ZGLA 3HFML 4LIQL 1K4CA 4FFYL 1D5MB 2AJVH 2H2SD 1PW3A 1A7QH 1MCNA 2LAAA 4HXAL 2PO6D 5KSUA 3ETBF 1Q9WB 1ZK9A 1YY9C 3BPLB 5C0DB 4FFWD 5J3HD 2IADB 5TDNB 4HKZA 3L3GB 1IGIH 2Q7NA 5TQ0H 4XNMA 2J88L 4Y5YB 2O5YL 5IB5A 5K9OB 4JN2A 1PSKH 4FQHA 1AQDA 5DI8A 1C7TA 5D7IF 2EDXA 1PX4A 4JG0L 3MBEC 4G43B 4D8PA 4QWWC 4GG6A 4HLJA 3CVHA 4QHMA 3KYNA 1OAKL 5DD1L 1HXMB 2W59A 4KU1A 5L7XH 4UT9L 3EOAB 4S0TD 4DAGH 3ROOA 2CDGA 2EDTA 5BQ7B 4YUEH 2R1XA 4LQ1A 3I3EA 3HAEB 4PJBA 4M9OA 5F1SA 2I25N 4TPRH 4OZIA 2DD8L 2A6JA 3L3OA 4OFKA 4XGZA 5HVGB 1JZ7A 1A1OA 5JUEL 4E5XA 3QQ9D 1GC1H 2NY1C 3P2TA 2PTTA 2B0SL 1CICC 3EZJB 3PP3K 3DUHA 3HB3C 3GHEL 2E6JA 3JV5A 4FN0A 3SDCD 5HGBB 2DWDB 2C3XA 3S5LG 3P9MA 1KNOA 3CXHK 1MRDL 4PR5B 3SKNA 3CZFA 1YUHA 1GGCL 5DJYA 1W0YT 2CK0H 4CW1A 2Y36L 5CUSL 2RFXB 5EO0B 1XH3B 5FYJU 5KSAC 4TSBL 2ILLA 2X9WA 32C2A 5CD3A 4HC1H 5D1XC 3TJHD 4MX7B 3EJYC 1CGYA 5DQDL 5E8NA 5FEBA 5F1KC 3G6JF 1J5OH 1A7OL 2AXJA 4S1QH 2H3NA 3TPUA 4LSDA 3NFSL 1P69B 3QEGH 2HKHH 4APQC 1EGJH 3SJVB 2O93L 3BW9B 1AGFB 1HKFA 3GMQB 4U1MA 2VH5L 3HZYB 4OM1H 1R0AL 3U48A 5BZWA 3AC0A 5BS0E 2AABL 4IRSB 2MPAL 2NCMA 1F4WL 2FO4B 2A83B 2AK4D 5TF1H 1TLKA 4XAWL 3AU1B 3EJJX 1Z6JT 3NABH 1JK8A 1WFOA 2AEIT 5F96H 1QFWI 43C9A 3P0YL 5L8LB 2EE6A 4CVWA 3VI4F 1ONQB 2R0KL 1KCKA 3E6FA 1PLGL 1EEYB 4S0SD 3V6OC 5EZIL 1M71A 4BQCA 5LGJB 3VGDA 4JR9L 1QNZH 1G7HA 1E27B 4Y89A 3U4BL 3BE1H 4PV8B 3V7MA 1MHPL 4JKMA 3ZKXB 3L5HA 2V9RA 1MAML 4KK6D 2MCPH 1XF2B 4Y5XB 1NDGA 1A6ZB 2B1HH 3NFPA 5D96B 5DJ0B 4CU6A 2AGJH 2X6MA 3MA7B 3VFRB 3TBVA 2EDFA 2YK1L 1C5DB 1DZBA 1N0XH 3OKDB 3G04B 3WEXB 4UDTB 4GOSA 3IS1X 4F2MA 4KKCD 3PWPD 1A2YA 3HG1D 4LCIL 3MLZL 2XQYK 3C5SB 5JZ7C 3GRWH 4MZ3A 3BI9X 1N6QL 3QXWA 5T5FL 2E6QA 5KVFH 1UYWH 1Z3GL 4G8GD 3UBXG 3I2CH 3BXNB 1A7NH 3CJJA 4ODUB 4OUUA 2Z92A 2X70B 3QB7C 4HIHA 1KLUA 1NCDL 1NCAL 1J9CT 5D1ZC 4AENB 2VXVL 5L88L 1YMMD 4NN6B 4NC1E 3D39A 1NFDA 3RI5F 1CGXA 5CJXC 1DBMH 4LASL 4NQVA 3SDXB 3U0WH 3O6MH 1RUPH 3L3DA 1BEYH 5I19L 3QZWG 5CSBA 2R56L 3MNZA 4MD4B 5SWZA 15C8L 2V5TA 1BREA 1YQ2A 1IGCL 2E3VA 1BM3H 1N5AB 1RZKH 4DFHA 5J6GA 5GS2H 2XZCL 1TQBB 2WWMD 4GRWE 1TTUA 1JFQH 1IGTB 3QG6B 4RGNE 2BC4A 3EAKA 2A74A 1FBIH 2BY2A 3B8SA 2XICA 5HYJD 1T03L 1CD1A 4CMHB 4N0UA 5JMRA 4LSVH 1V05A 2VTFA 3H3KA 3BAEH 3VWKA 1E4WL 1MCWW 5E4EC 4YK4C 1CLYH 1QFUH 4J3UA 3C5ZB 3X12B 2FX7H 2X09A 1ZLVH 2NX5B 3QFJD 3WFHA 4CN1A 3ULUF 2PR4L 4DCQB 4KQ4L 5C0GB 3SY0A 4G9DA 5FGBA 5INDB 4N8CL 5FCUL 4XTRD 2FL5B 3SDAB 2O5XH 3MJ9H 3TN0D 1I4FB 4JFQB 2BOBB 2YR3A 1S7VA 4KJQC 4RFNC 4UTBL 5AZEH 1IC5H 3LS5L 2IWGA 1A5FL 2CD0A 3T65B 4OTXL 1FIEA 3D6GA 3O3BB 1XIWD 3BRDA 1UC6A 1ES0B 2NQCA 4YDLB 2VXSL 3QIBA 4ONGH 4RIRB 3V95A 4F7MA 3V79C 3OXSB 5FO7A 1T1XA 5CWSB 2LVCA 5E2WH 3O41A 2OZ4A 2FB4L 3BT2H 5JOPE 1EEUA 3H3PL 1B0RA 1UJ3B 4HFWB 3WLWC 1NEZA 4KI5F 1JUFA 4FP8L 1G0YR 3UTSE 5FYKD 2HFEA 3BPNB 1DBBH 4FFZL 5E6IB 3QEUB 5E9DD 1KPUB 1J12A 1Q9OB 3PWLA 1PZUB 1WZKA 2JCCE 3R8QA 1MRFH 2P7TB 4NHCH 3WYRA 1CG9B 5IB2B 3WNPA 1CTOA 2ADGB 2OXGA 3FO2A 1FYTD 1QHOA 3GI9H 4BJLA 4MD5B 1S9YA 2YUWA 3IDYB 1FNEB 1OGAB 3UTPD 4HIIB 4P59H 4LLUA 4ZSOA 4NKMA 4IRJB 2BNQB 5MEOB 4PREB 4XNZB 4C56E 4CMMA 4NZJA 5GRVK 1K8DB 4UINL 1KIQA 4LSRL 5KJRL 2Z8SA 3FHAA 4RISH 4R9HA 5DJ6B 5CP7B 4HS8H 3QIUB 3T0BA 1EJOL 2ERJC 4K8RD 4Z7WF 5IQ9A 4JZOA 1RFDL 3IFNL 4MA8H 3BPOB 4JFEB 2JLLA 2OMNA 5JOFB 2D0FA 1S9KC 1NMBL 4NQXA 4UQ3A 5IUSA 1O7SA 4XNQB 2PKDA 4K23L 2VLJD 5C09B 4YBLC 1X44A 3EO1A 2DQEH 3UXFA 4LQFH 1DBJL 4ONFH 3U4AA 1KGCD 3MV7D 1JNHB 1RV6X 3MXVL 1VGKB 1ZT4A 4WWKA 4Z95H 2Y07H 3ARDD 4ACPA 2COQA 3QEQA 3GSRB 3IYLW 1IM9A 1FL6B 5J56B 3U30B 5BJTB 3CSBA 1RIVH 3QI9B 1CL7L 1D5IH 4XPAH 4R7NB 5TH2A 4WI2A 4EZMA 4WEBL 3MV9A 3MLYL 3DURB 4ERSH 3LN4A 4I18B 4X98B 2YEZA 5EB9A 3RAJL 3MR9A 2RAMA 4OGXH 2F54B 4R8WL 3QYCA 4HDIA 3BD3A 4DEPB 3N9GH 4MQXC 3WFCL 3FAWA 2BNRA 3D69A 3OJDA 2BY3A 5DHVH 3RRQA 4PG9B 3HZKB 3ZKMC 3B2VH 1F3JB 5DJXA 3H7BA 2HKFL 4OQTH 4QYOB 1CLOL 3H9SD 4C57C 4N0YL 2R69L 1MI5B 4B41A 2VISB 1D6EA 4YWGH 1U93A 3OKMA 2WINA 4N9GA 3IDJA 4JDZB 3MRBB 1Q72L 4KVCL 2YPVL 2ZPKH 3K0WA 4PJXF 4WFED 3TA3D 3F7RA 3P73B 1Q9LA 1BLNA 2XV6B 1XGQA 3BMVA 3RWJB 3VFOB 4MNGE 3EFFB 2V2TA 5ID1B 2VKWA 3OKNB 2Y06H 3VXRD 1U42A 3DROA 4X4MA 1IAOB 3IFLH 1F8TL 5CBEB 2DJ4A 3IDMB 4LCYA 1JF1A 2DQJL 3VWKC 3U79A 3X11A 4C59B 2BDNL 3AREA 4NNXB 3TP4A 1UWGH 4L4VB 3HS0B 1OP5H 3PGDB 3ISWA 1N2RB 3LD8B 2NY5H 5FGBC 4AEHH 4JY5L 2EO1A 2QLVB 4U1JA 2FEEI 3PV6A 3DYPA 1I8IB 5M7QA 4YAQB 4OAWA 4O58L 1RY7B 4QF1A 1RUAH 1SYVA 3TF7C 5ILTH 4OCLC 3RI5K 5FO9B 3TNNB 5DJCA 3E2HB 3SDDD 1OAYL 4XVJL 3DVNB 4NDMA 3MRLA 5HXMA 4FQXB 4H25A 5IG7B 3OB8A 4A6YB 2HFGL 3G6JE 5KSBF 3KXFE 5ANMA 4LDLB 1KTLA 2VDKH 4XC1L 2B5IC 2VDLH 3QIBC 3HR5A 4KHTL 1R3KB 2CDFB 4X9BA 2XQYG 1OP3H 5CINL 1K8IA 5ENWA 4OI9A 3ILQD 2VLRA 4YHKL 5C07B 4HK3N 1SVZA 4FXGA 3M8OL 5GRWA 1HCVA 3D25B 2HJLA 4MNHB 1JV5A 4MS8C 3BPCB 3L3IA 1Z5LB 1I1RA 4NUGH 5E5MA 2FZ3A 2QQQA 4NQEA 2ZG3A 1G7PA 3QRGL 4G9FE 4N1HB 1NGPL 5HHVL 1IGYA 3BHBB 4CN6A 1MQKH 4TVPD 1TNMA 4PJDA 3EOYG 3UO1L 1S7XA 3B2UC 2GT9A 5F70A 2ICWI 3T0EA 1GGIH 1WIUA 2Y1VA 3PL6B 3SJVD 3Q6FA 4PRDB 1NBZB 2A6KB 4YO0B 1MHHB 1MFCL 5LAXB 4PS4H 1A9EA 3DVFA 1G6VK 4LLDB 4HWBH 4JREB 3TO4A 2EDNA 5IVXA 3LV3B 4KXZH 2FSEA 3CFJA 4UIMA 1MCWM 2YD5A 2YWZA 5GSRA 1PG7X 2XWTA 3A6OA 1KENL 3QPXH 2J8UB 4IMKC 1AHWA 4U6YA 3QNZB 4P2YA 4X6EA 5SWSE 4UUJB 5DWUH 1OD7A 2VRAA 3FTGB 1ZA6A 4ODXB 1TJIL 3MYJA 1UB6B 4LSPH 3BKCL 4KK9C 3KPSD 4HIXL 3TV3H 4IOFC 1PG7L 4HF5H 2KPNA 3OTTA 1F6FB 4WWKC 1EAJA 1I1CA 5C08B 1NCBL 2EO9A 2WBJB 1A0QH 3NAAH 4OB5H 1AGBA 2J4WH 3CPLA 4FZEL 1CXFA 4HG4K 1F6LL 4EKXA 4D9QE 2OTPA 4UB0L 1NKRA 3IFPA 1DQQA 5FKPA 4H8WL 4PIRF 3BUYB 5EC1B 4KV5F 2F9BT 2PW1B 3WHXA 3K80A 4E42A 4AL8L 1DBKH 2Z91A 3CFBA 1HHKB 2P42B 4U6XB 3FQRA 1I7UA 3QULB 1JGDB 4PTTA 3CFKB 4XB7A 1FO0H 4GBXB 3IVKB 4NKDB 4PLNC 3H0TB 4JY6B 5M95B 5CP3H 2PTVA 1UB5B 1SBSH 3V4UL 5GZOC 3VRLF 1U8NA 5D7KD 3EBAA 2EXYC 4NQCA 4OZFH 3ULUE 3KR3L 2G2RB 3D3VE 4FQIH 5KG9A 4F8QA 4NC0B 4H1LA 4WV1B 1YNTB 3O2DL 4P4KD 5AUMB 4XCFL 5D7SH 1KTKE 1MJJA 2NY6C 5FKAB 4YDVB 3JXAA 1AD0A 2I07B 2C3WA 1F4YL 5CGYD 4GAYB 4KUCD 1KB5A 4NQDE 5DGQA 35C8H 4LCWB 4QRPA 1S9WB 5CGMA 3VXUA 4H0GA 2I27N 1DUZA 3EYOA 5B3JF 1HDMA 1NAMA 2PYEB 4J6RL 1VEMA 3ZLQC 5C6PB 4Z5RB 1VCAA 1S8DA 1P5VA 4BKLB 2PYFA 4I48B 4KI5E 3VG0L 2ZOKB 2ZCKL 4RWHA 5FUCC 3SDAD 3WIHH 2DAVA 4QRTB 1KJ3L 3Q1SH 2IALA 3V52L 2FHBA 1E4KA 5IKCA 3ARGD 3W11C 1WEJH 1BFOA 1GJIA 4BQ8A 4OCRH 4CU7A 1C1EH 3CFDA 4X6CB 1BAFL 4QOKB 1TNNA 3V6ZA 5ICZA 1FJ1B 1UEMA 3I6KB 1JE6A 3DSFL 5ALCH 3MRPA 1JWUB 1WBZA 1FVCA 3LB6D 3FB8B 4IMLA 3TVMB 3BVNB 4PRIB 2DWEB 5ADPL 2FJHA 5JHDE 5SX5K 3MRMB 3DHMA 5EUOF 3DX6A 1RUQL 4PJ8A 1T3FB 3W2DL 3PQYA 5E6ID 3SGJA 3KPRD 1EX0A 2C1OB 4Z7WE 3W9DB 3FKUS 4NQSA 5HHOE 1AQKL 4K71C 5D2NB 5MEPB 1YEGH 4WTXA 3UAJC 5E8OA 5EH1A 5KTEH 4MQ7A 5ITFA 1OGAD 5HDLA 1OWWA 1DQTA 4FQJH 1GIGH 4P2OB 4M5ZH 4IRJD 2JB5L 5F9WC 3TBYA 4XC3L 4FRWA 4ZXBB 1BX2B 3V5HB 1AHWC 3BYTA 4P5MA 2XPGA 2R1WB 3QIUD 2EKJA 4EN3A 1PQZB 1S9XB 5KVDH 1Q94B 1YYML 2HRPL 5BV7L 3D48R 3P77A 2FO1A 3IF1B 4LLYB 3FZUC 2G9HA 5C0CD 1JBJA 1QLRB 4Q0XL 1NJ9A 4LOUD 1B4RA 1T4KB 4XWOC 4LGRB 3WL9A 4KVNH 3JTTB 3RPIA 5K9KB 4NCDA 1FIGL 4JO1L 3V8CA 4OZGB 3QO1A 3QSKB 4X6FA 4AY0A 3ARFD 1J0HA 5D2LA 1VFBA 7FABH 3UPRA 2EH8L 3MTRA 4GKZB 3QI9D 1T6WA 1QBML 4PJXE 3NMEA 4J12A 1CDHA 1ZEAL 1HHJB 1U8PA 2BSRA 3UMTA 3SGEI 3OF6A 4ZPVA 1E6JH 1FN4A 2AI0L 3TFKC 2M26A 3DX7B 3HE6A 4XMPL 3TM6A 1XGYL 1E6OH 4KJWD 5DFVD 5EUKB 4NZRH 3WUWA 2W92A 1RULL 4LHQB 8FABB 3QQ4B 4Y2DA 1IT9H 1T6VN 3RVUC 3U2SB 1OTTD 1ACZA 1ND0B 5HI4C 2PCPB 4WUKL 3SN6N 1NBQA 4S1RL 5EU6B 3Q3GA 3EYVB 1H3PH 3EIFA 3L7FB 3FQUA 2AK4E 1ERNA 4XPTL 2QHRH 1ADQL 2VXQH 4W6XB 1BVKB 1BWMA 3EDJA 3MREA 2ARJB 3QWRD 3INUL 5KSBE 4NJ9H 3SE8L 2FD6L 4U31A 3QO0B 4XNYH 5JA8B 4C83A 2HJKA 2XKNA 4FXKA 2W60B 4PD4K 1KC5L 4GKOA 5EBLA 4MZ2A 1MEXL 1NGYB 3Q5OA 4QTIH 5JXED 1UH4A 5DMIL 3TYGH 1JPTH 3PHSA 1YA5A 2H8PA 1HKLH 1OW0C 2FEDD 3AM8A 5C86A 3IJSB 4L3EB 3WIFA 1VA9A 1T2JA 5H37G 1TZHB 4M93C 3TT3H 4FABL 2WIIB 4LARL 5FDYA 3ZDZF 3F7QA 1TJGL 3HG1E 3NIGF 2XRAH 5I1KL 5ACMA 2ICES 3UYOD 1IC4L 3BRFA 2HJFA 4JFPA 2G60L 2FYYB 3MBEB 1JZ6A 2VZVA 4D0DA 4M62H 2BRRH 4G80A 4HAGA 4CGTA 3F65A 4GS7C 1G7IA 1QSED 2CDEA 5ETUA 1YMME 4DWHA 4BK4A 3FONA 3LY6A 5C07D 3P0VL 2UWEB 3IB4A 2BVYA 2ATPA 3D0VA 5I15L 4XNXL 4PJ8C 3RU8H 4PP1C 3PHOA 3SGJC 2NY1B 3ZE0F 2MJWA 3SE4A 4NRZB 4PP2A 1KXTB 4OLUL 4X8XA 2DLFL 3VRIA 1U58B 2VWEC 1GPOL 4DVRH 4C58B 4NO5B 1G0XA 1ZMYA 3V6BR 3BH8A 3X17A 4TN9A 2UY6A 3NCJL 1BZ9B 3WE6B 4O5LL 2H32A 5C0AD 4AMKL 1W2KT 3TBWA 1CFBA 1FFNB 3FAXA 3O4OC 4NKOB 4CVZB 5HYJE 1F13A 5KSAB 5JDJA 4F7EA 5EO9A 4S11A 5I66A 5D1XB 4PJGB 2V9TA 4P2RA 1QR1B 3VFSA 3QFJE 2MCG1 4YE4H 2FR4A 4APQB 1VPOH 4EN3C 2CKBH 2ZNWA 3UPAA 2IFGA 2ORBL 3RY6A 1J88A 4HK3J 2NXZD 1CDJA 5CEXB 3MRFB 2EXWC 2HH0L 4UOJA 1RJLA 3R1GH 2R4RH 3OB0H 4WHDA 4W70A 5HYFA 3HN3A 4UILH 1WSST 4KPHL 4RNRA 4KUCF 5ELIA 4AEEA 2DBLL 3VGHA 1E4XL 2YPKA 3MXWH 4G8IA 4LDOB 1IGMH 1DFBL 1A9BA 2PUQT 4EI6B 3U1SH 4DGYL 3TC9A 3OKLA 4U1NB 5C08D 2R2CA 3LKPB 3VRLE 1MLCB 5BRZB 2WBJD 2R15A 1F00I 4QHLA 4D9LH 4XVTH 2Y6SD 1UKSA 5T3XH 4TRPL 1YN6B 3WS3B 2R0WL 2XA3A 3C2AL 5FYKE 4Z78B 2XTJC 3U36B 1D3CA 5LBSH 4L8CB 3RGVD 3BISA 4RMSA 4LAQL 5CIPA 2VXUL 3HE6C 4EBQL 1LO3H 3ECBA 5DSCB 1KELL 2ENYA 3AGVA 2C4XA 5HHQA 5D8JH 2Z0BA 3C6LB 4MDJB 2CXKA 2ZJSH 3SKJL 3I6GA 4WO4A 4Y2DC 1FZMA 3STLB 1YPZB 1OAXL 4GBXD 1M7DA 4I3GA 5TE4H 3UTPE 5I16A 1ZKAA 3HI5L 2AK1L 4ZUUB 5J11C 2AEQH 3NBNA 2YMXL 2O61A 3DOSA 4H5SA 1MCPH 1BJ8A 1I9IH 2X4UB 4LU5L 4ZOBA 3VXQA 1QRNB 4RQQB 1X7QA 2J2ZA 2EKSB 1KFAH 1RHHB 5D1ZB 4I0CC 4MNQB 1ORQA 1J0JA 4JRYB 5IJVA 4ODBD 5GGVH 4O51B 1YEEH 2MHAA 2B20A 5F6IC 4PJIF 1HHHB 4QXUL 5DRWA 3NACL 4ONHB 2VLJE 4GW1A 3MOAH 3GMLA 1WFTA 4PJ9C 4TTDD 3T4AA 3K2MC 1MWAH 5CHNB 2X1PA 1ZGLB 1K4CB 1KGCE 2ZUUA 4K3DL 5I2IA 3X14A 2P5ED 4KRMB 1J86A 4NO2A 5KSUB 5EUOE 3FOLA 3AM8C 5JIPA 1ACYH 2IPTL 4KTYA 3GBLA 1HWGB 5MEND 2D0GA 2F58H 2VOTA 3GM0A 2NY4D 3OKOB 3SOBH 5H35A 4XNMB 5IB5B 4FQHB 5E4EB 4YK4B 5IFHH 2J6EL 3DYOA 4HBCL 3MOQA 4N5ED 3U9PH 1IC7L 3A67H 4D8PB 4GG6B 4LNVA 2OJZH 3P40A 3QDMA 5KZCD 5C3TA 1UWXH 5LCVH 2Z8WC 4IOIB 4QOKD 1U3JA 2E9IA 1WCQA 1OCWL 2UYLA 3OXRB 1U8MA 2CDGB 3D9AL 2G5RA 2R1XB 4OCXH 4JM2D 4PJBB 4R90L 3H9SE 4LSQL 4K07A 1S7WA 4UOW1 2A6JB 2GK2A 4PRID 4RFNB 5GZND 1A1OB 4MQSB 4E5XB 2P8MA 1FPTL 4K3EH 3SE4C 4LEXL 4WFEE 1AXIB 4DKAA 3HE7A 2I5YH 3ARBA 3D85D 3IDNA 3QHZL 4WCYH 4ZAKA 4ZUTA 4U1SA 4OZIE 1KNOB 4MXQD 2X1OA 2DB8A 5JQ6L 3VXRE 3RJDA 2YUZA 5CBAA 1TDQA 5HI3C 2D0HA 3SKNB 3CZFB 1YUHB 5DJYB 3F12A 1BJMA 4CW1B 4V1DA 2DQTH 2YPLB 1YEIL 4UTAL 32C2B 3GK8H 4M7LH 5CD3B 4DVBB 4WHTB 3S8WA 5E8NB 5IHUL 4R4NC 2H3NB 3TPUB 2WUCL 4GAJL 5TE7L 2AJUL 4TTGA 4ZXBD 1K5NA 5I0ZA 2NY0C 1EDQA 3DPBA 4U1MB 1T80A 5DD6B 3RY6C 3TCXA 3T0DA 4R4FL 4DKEL 4QRSA 5GRUL 4HMEA 4L1HA 4GUPA 1JF5A 1JTTA 2CO7B 4RWYH 4G6JH 2P24A 4G42A 1A6WL 3CFIC 4F3FB 4P99A 3T4YA 4U49A 3TWCL 43C9B 3G08A 2ERJB 4ZYKA 4JPIB 5B38A 3E6FB 1HYSD 3RUGF 2WLYA 1KG0B 3JWOH 2BCKA 2ICEA 4JFHD 1P4IH 3C87A 3BMWA 2EEAA 1G7HB 2F19H 3MRJB 3OAUH 3PABA 2A1WH 4QNPF 1T1WA 4YBLB 5MEQB 3FFDA 4ONOA 1JJUA 4OGZA 2JB6A 1QFWL 1VEOA 3E0GA 1OY3B 3OAYH 4TVPE 2EZ0D 5IQ7H 4W4NA 5C9JA 3GKWH 4WO4C 3G6DL 1QSFA 2D4DA 4PRHD 4BSVA 4F2MB 3U7YL 5HVFB 1A2YB 5K9JL 5JR1L 4NWUL 1KTRL 1EAPA 3DI3B 4JAMB 1FO0B 2JJTA 2XN9E 3N50A 2Z92B 1ULVA 4JQVA 2Q3AA 1KLUB 3BIBX 4KZEL 3WO4C 3N85L 5J1AA 4GW4A 5DQ9A 3HZVA 4MJID 3OMZA 2NY7H 4E41A 1DP0A 4U6TA 2X5PA 3ZDZE 1OF2A 4QCIB 3LKSA 5KS9F 3NIGE 1NFDB 5ID0B 4ZDHB 5GS0H 2YBRB 2ARWA 1QLEH 4NQVB 3P9LA 2FWOA 3ULSA 5EIIA 5SWZB 5GS2D 4LKCA 2R23A 1RJZB 3KPSE 2VDQL 3LRSA 4EJ1C 5FIEA 3WSQL 3D39E 3KJ6H 1P9MA 2A38A 1I75A 4RMRA 3VD5A 4P9HL 1G9NL 4PRNA 3MCKA 3JZ7A 2A74B 5TFSL 3V4VL 4GAFB 3O6KL 4GLRI 5GRVL 1HH6A 2N1KA 3O8XA 1CD1B 4N0UB 4L3ED 3T2OA 3VWKB 2J8UF 4X6BA 1MHCB 2R2EB 3ZE0E 3R0NA 5IHZA 3X3FH 1GOFA 1QOKA 1EA9C 4PGDA 1IGFL 3WFHB 1I9JL 1FDLL 2BX5A 3QXTA 1R5WB 3SY0B 4G9DB 1ZE3C 2BY1A 3MBED 1U3ZA 3B3IB 3DX8B 4IOSD 3VW3H 2VNCA 4CVXA 5HI5C 3CH1A 1U2HA 1NCUA 4MWFA 4WGVB 4PRBA 5D7KE 2A0LC 2AXFA 3SHSA 5GJSH 1NGWA 3V0WH 3OHXA 3LRGA 2B5IB 3QCVH 3HE7C 3QIBB 3ARBC 4OD3L 5CFHA 3MLWH 3DETD 1T1XB 2J88H 4ZAKC 1J0ZA 3O41B 1NL0L 4OIBA 4ZUWA 1BQLL 3T77B 1KCVL 1JUFB 3SEPA 4POZD 3C8KB 5A2JH 3QXUA 1AKJA 4OZ4B 4ZODA 1J8HA 2X4NA 4UT9H 3PWLB 1CDUA 5KSAD 1FFPA 1EHLL 4U2YA 2DQHH 4G7YL 1Q0XL 4K2UH 5DEFB 1S9YB 3OWEA 3X3GL 5HHXH 1QPPA 2WV3A 4APQD 2N56A 5E8DL 3LH2L 5BO1H 3HAEG 4KKAC 1HXYA 1N3NA 4JFFD 4ZSOB 2Q6WB 5B22A 1AD9A 3HUJB 2R29L 4CMMB 5KANI 1A14L 1RK1A 1KIQB 1MRDH 3VFWA 4FG6C 1GGCH 4M48H 2R1YA 5JQHC 3FO1A 4H88H 1UCTA 1CI5A 1FZJB 4NM8L 1F45A 1V7NH 2A73A 5EOTA 5IF0B 3HNVL 1JNJA 5J13C 4NQXB 3TBSB 4UQ3B 5BRZD 4MA3A 2IGFH 3RWEA 4YHNA 3JBG7 3ARRA 3EO1B 4YEFA 3S37X 1ZT4B 4WWKB 1R0AH 4NUJB 5I73C 3KPRE 3QEQB 1V7MH 5HHMD 3VXTB 1TZGL 2CRMA 1BQHA 5CZXD 2EDEA 2CR6A 1KLGA 3QUYB 5TH2B 4OLYL 5CEZH 4XAWH 4PJIE 3C6LD 3MV9B 5T1DL 4TULL 3LN4B 3MODL 2ADJA 1MVFA 2I60L 4X80L 1OWRM 1AGCB 1OGAE 3LMJL 4K94L 2JJTC 4KZDL 2EDRA 1B3JA 4JM2F 5L6YH 5JHLH 1RZGA 3K3QA 4JQVC 5IW1A 3D69B 3KLDA 3U4BH 5IMKA 4LK4A 2Y25A 3H7BB 4OIIH 5EOQH 2AEPH 3DUUB 4PLOB 3ZZ1A 4MNQD 2UZIL 4CBPA 4DK6A 5K93A 3ULUL 1TIUA 1EFXA 1S7UA 4N9GB 4L9DA 4PLJD 1WGOA 5C0CE 2P5WA 2UV3A 4ZS7L 1BLNB 1X4ZA 1WTGT 3L3KA 4YGVA 5KW9H 4MB5A 4L29A 2V2TB 5I75C 4J3XA 3L6FB 2VZUA 4NO0A 1LK3H 3CMOH 1P9MC 3BN9C 1C08A 1BOGB 2H6PA 3DROB 2MMXA 3OX8A 2UUDH 2NY6B 4FQ1L 5T33H 5E99L 3O8XC 3BQUD 1PX3A 4LCYB 3H9ZA 1KTDB 1JF1B 1QPXA 4RGOH 1A7PL 3BP5A 5DVKA 3CX2A 1SJHA 3IDIB 4MD0A 5BXFB 4PRPB 4AQOA 1GGBL 1I9RL 4HLZG 4U1JB 4YDIL 3S96A 2XACC 3PV6B 3F7YA 2LU7A 5EFIB 4OAWB 1U0QA 4P57A 4KQ3L 4QF1B 2CIKB 15C8H 1SYVB 3QWQB 1JHTB 1CGSH 1KXQE 5DJCB 1SEBB 1XMWA 5C2UB 3PHQA 1C12B 4R3SA 5MP6H 3MRLB 1MRCL 1DQML 1T0NA 4H25B 3D18A 3LPFA 1MUJA 4N1EA 5ANMB 3JV0A 1H3XA 1OB1A 1KTLB 4BQ6A 1IAII 3O3EA 2A77H 3HR5B 4HJ0C 5HYSA 1C16A 2OL3L 3JSSA 2DI7A 2Q7YB 5GIRB 3IFOB 1K8IB 5ENWB 4R97C 5GGQH 2IANA 4HH9A 4FXGB 5DUPL 3IS0X 4JHAH 2PR4H 4KQ4H 1DDHA 1F3RB 2HJLB 3WLWD 1LMKA 1FL5A 3GBML 4WNQA 3WLBA 3L3IB 2YPLD 5E5MB 2AJXH 5T3ZH 3VWJA 4AIZA 1BZ7B 2AV7A 3CDYA 4G6KL 1IGYB 3PP4L 1G9EA 2RGSA 4PJDB 3RUGE 1RZJL 5C0JA 5CSZB 4KHXH 1S7XB 4HUXB 3VCLA 4EVNA 3GIVA 3Q6FB 1OAQH 5IV2A 1XR8A 4XPBL 1R3JA 1HHIA 4JPKH 5DFTA 5FYJH 1JPGA 3CAFA 4WY7L 1O0VA 1U8IA 2DTML 2H1PH 3QIWB 4BFIA 2ZUQC 5IVXB 1FLRL 3OJVC 4FTVA 5C0BA 3MMEB 4UIMB 2FSEB 1FNHA 2CKBB 5F9WB 3BKJL 5GSRB 1QKZL 1NSNH 4JVUA 3T0EE 2IAMB 3QCTH 3WXWH 4U6YB 4X6EB 5EOCL 1N5YH 3E3QE 5HBBA 1IEAA 1QSEE 3S5LA 5HDQL 2QSTA 3C5JA 4Z7UF 1ZTXL 3MYJB 5C07E 2ZCLL 1AIFA 2VLKA 1KBGH 3RZCD 3MO1A 3GJFA 1Y0LA 2FX8L 5FF6A 1XFPA 4RMUA 3QDGA 4P46C 1AR1C 4M5YH 4WENB 1JZ5A 1BBJA 5KS9E 2K1MA 5I18L 3ULVH 1KIRB 4WVRA 5F44A 1T2QL 4F33A 1JMXA 1H3GA 2SEBB 3WHE0 4LSRH 2AXHA 3CPLB 3S37H 5F1IA 1VKXA 3BEVB 5C0AE 3VD9A 2NTFA 1DQQB 4I0KA 1A6VL 4J8RA 3VU2A 4XNUL 3VGFA 2VQ1A 1S7RB 3VFUA 3SDYH 1AGDB 5A2IH 5EWIL 4HFUL 2VXTH 1S9VB 3WHXB 4MJ6A 2Z91B 1NQBA 4L9LA 4P2CG 4XCCH 4BQBA 3FQRB 4PTTB 4HGWA 3S35X 4OCSH 2IEPA 5I1GH 3BSZL 1OOAA 4AEFA 3S4SB 5D93C 2J8UE 5IT2L 2B4CH 4O9HL 4PJCF 4OF5A 3L3JA 3RJQB 1OTUC 4NQCB 5ISZA 1N64L 1BFSA 4YQXH 2GY7B 4ZOCA 5JA9A 4H1LB 2N4IA 12E8H 3O3AB 4U3HA 4EUPH 3VD4A 4PRAA 1S3KL 3LQAH 1OT2A 3PJSA 1QFPA 5I1JH 3SPVB 2QADC 3P0GB 2PW2A 1NC4A 3RL2A 1AD0B 5F9OH 3HR6A 3EYSL 4PJGF 4OCYL 2CLRA 4Z9KB 5IIEB 2F5BL 4R7DA 1L4IA 1UA6L 2R0ZL 3EYOB 4QRQB 4LCUA 2X89D 4RSVA 1WVZA 4M7ZB 5DJ2A 2GAZA 3UBXA 5GGTA 1S8DB 4Y1AA 4JZJA 5J1SC 3DUSB 2PYFB 3A6CH 4NQTA 3BOVA 4PBXA 1JWMA 4HXBH 3CLEH 3G5XA 3PV7A 4NRXA 2GJ6D 4M93B 2IALB 3RVVC 3BP4B 1A6AB 1XEDA 3MUY1 1QBAA 3VH8B 5ICZB 3QZWA 4QRRD 3HLAB 1G6RH 5FA3A 2CRIA 4YNYB 1P4BH 5FO8A 4N9OB 1CZ8L 3ZYJA 4GS7B 3THMH 1TCRA 2FJHB 1CF8L 3BO8A 1QFHA 4FA8A 1G7MA 1CD9B 5E2VH 3VA6A 1AE6H 2AXGA 2V17L 1M4KA 5ABDE 4HGKC 3VWJC 3PQYB 4BYHA 3O6LH 2W0LA 4EIGB 3LEYH 5L8JB 1YPZF 4NQSB 4LPWA 5EZOH 1NCWH 3HRZB 1UCBL 3DMMA 3BZDA 3BWUC 4XVSL 5E8OB 4QY8A 5E08H 3SCMA 2P5EE 5F7YC 1DUYA 1C5BL 1XGUA 4FXLA 1NMAH 3O4OB 3DGCR 3VI3F 1T1ZA 4TUKH 5MENE 1JZ4A 3QRFM 1L0QA 4J3SA 5FOJA 4KAQH 4DOHB 4ZOEA 2I24N 2YKLL 5JXAL 1J05A 3V4PH 1TETL 1MJUH 2EYTA 4MAUH 1MJ8L 3VXSB 3QQ3A 5D72L 3FN3A 2DQUL 4KK8C 1G7QA 4OSUH 5H2BB 3U6RA 3M17A 1ZT1B 4P5MB 2XPGB 3DBXB 3KPPA 2OS7A 2WMPA 2ICCA 3EZ8A 1J1PH 3GSQA 4QHUB 3VXMD 3CVIL 5IM7A 1CLCA 2VDNL 3UO1H 4X4YA 4WI7A 1NJ9B 3MROA 3NZ8A 1S5HB 1DSFH 4HWUA 4YZFF 3WL9B 3LEXA 3R06A 4XH2A 3RPIB 3H7LA 4F15C 4KK9D 4KJPD 3MRKA 4M7LT 3QO1B 3PF2A 1U8KA 1IKFH 1WC7B 2BFVH 4O00A 1BD2D 2X7LA 3BWAB 2EYRB 3UPRB 5GS3A 2FATL 2PXYA 5BV7C 5BS0A 4JO2H 4KTDL 3QUYD 5FYKL 1KENH 1U8PB 2XTJB 1WQVT 2BSRB 3WNMA 5TGBA 1KJVB 3UTZA 1IJ9A 4XPGL 3F58L 4ZPVB 1OT1A 2OBGA 3TYFA 1ZHLA 5B39G 1U6AL 3Q48A 2IH1B 3MJ6A 4L9LC 4XP9L 3HE6B 4KDVA 3I3BA 4K7PX 2HT3D 4JPWH 4G6AD 1KACB 5SX4I 3WUWB 3RX5A 1TXKA 3HNSH 4JG1L 4Y2DB 3EDKA 1G9ML 3KNBA 3C08L 1U3HD 3EHBC 2BSTA 3IKCA 2NYYC 4OFDA 5J11B 5DMKA 1HEZB 1UVQA 3AAZA 4G3YH 3RTQA 5FHBL 3N1MC 3Q3GB 4KRLB 1ZLVK 3DI2B 5AWNH 5I74C 5ADOL 3FQNA 1IAKA 3AXLB 1WF5A 4GFTB 3DXAD 3SGDH 4K8RL 2R0LL 2X4OA 1XR9B 3MREB 1RZ7H 2VZ3A 1FRGL 2FGWL 5EORH 1NUDA 4BZ1H 1RVFL 3RA7L 1CLZH 4ZG1A 3GO1L 2VSCA 2AJSH 5F6IB 4L8DA 3MFFA 1H0DA 1YJDL 2CO6B 4JDTH 2NR6C 4PY8J 3H9HB 4LLMA 4Z7VB 3MLVL 4C83B 2DQGL 1EBPA 4PJ9B 3QEHB 1H3TA 1OARH 4JKPL 4LHUD 1JN6B 4LLVA 4FXKB 4MMZC 4NHUB 3WXVH 1A4JA 3KPOA 1YC8A 2XKSA 3EO9L 1KCSH 4PJ5B 4WHYH 5EBLB 2YD9A 1KT2B 4JZJC 4PJ7F 4PRPD 5DMGC 5HGHA 2H8PB 3KR3H 3DRTA 1A4KA 4HK0A 3P4NA 4KRNA 3KPQA 3WIFB 4ENEC 4PRHE 1TZIB 1OPGL 5B4MD 4MDIB 4YXKL 3MFGB 1F4HA 1BHGA 2A6IA 3VDBA 2ZKHL 3O2DH 5HDBF 1NGQH 3VXPA 5BMFH 2C7UB 4LGSB 3LKNB 2EDQA 2HJFB 1EO5A 5HYEA 1K2DA 1JGUL 4D0DB 1EO8L 3FO0H 4EEEA 1FNSH 4U1KA 2C3HA 1MFAL 2ITCA 1CFVL 2CLVB 1RIUL 2YA0A 4MJIE 3T04D 1S78D 4HKBA 3O2WH 4N0CD 3FONB 1LO4H 3RDTA 1NEUA 1II4E 2ATPB 4HT1H 4XXCA 3D0VB 4YIQA 4OBSA 4ZQKA 1FFRA 4Z7OE 3PHOB 4JJ5B 4BUGA 3HA0A 2J6EA 3NIDE 4LLQA 3IT8D 2M1KA 1OGTB 3VRIB 2FHFA 5FM4A 3DMMC 4HWEH 3BH8B 4YHZH 2CIIA 4Z76A 3TT1H 5IGXH 5E70A 2H32B 2KBGA 1P7QA 2XG5A 2OQJA 4OV5A 4Z7UE 3TBWB 3UZVB 1MREL 3UAJD 4EDWL 2BJML 4I5BA 4IDJL 4OT1L 1WZ1H 2M8XA 3TIDA 5F7UA 4F7EB 2R2HA 4WEUD 2ZG1A 2UY7A 3EYUL 5I66B 4GQ9H 2AP2A 3T09A 2HTKC 4UT6L 2QL1A 3QIWD 4JLRB 3K4AA 4P2RB 3BRGC 4J4PD 1XF5A 3P30H 4IIQC 5F8RC 4P23A 2FR4B 4KRPC 5DRNA 3LIZL 2IAMD 1VFAA 1CT8B 5JO5A 1YNKH 4WTZG 3TCLA 3UTSA 5C1MB 3HC0B 3BZFA 2XWBA 4M4RA 1MIMH 1INEL 1CXHA 4HIJA 2QV2A 5H94A 1RJLB 3LKOA 3QP3A 3AY4A 4Q9CA 5JW4M 5HJ3A 4N0FA 4RNRB 2JCCA 4N8VA 3FT4B 2YPKB 4L8BA 5IMOB 1UM4L 5DJ8A 1JYXA 3CK0H 1A9BB 3OKLB 4PJCE 4I3RH 5T3XD 5A2KH 1OHQA 4OLZL 2WQRA 2PXYC 4QHLB 1QHPA 4OZHF 1K6QH 3PWJB 4NO3B 4YLQT 4C56A 1RUML 1VFUA 4KXZI 2GKIA 2HRLA 1BQUA 1P7KB 3IJYB 2GITA 4FZ8L 2HRPH 1X6LA 1T21A 5CIPB 4TVPL 3MOBH 5KOVC 1LO0L 3V5DA 4P2QD 5C0FA 3UTTB 2VDML 4LNRA 1R5VA 2GSGB 4PJGE 3MC0A 4WO4B 1FZMB 2BERA 5F72S 1FG2A 2ZUVA 3CFEA 5I9QC 1WAAF 3CSYA 5HYQA 1M7DB 2HFFA 5I16B 1FL3A 2OSLA 1FIGH 3KPMA 3SKMA 2AJYH 2QQKL 4JFDB 4YBQD 2QHLA 4M43H 3NN8B 2O61B 3RTQC 3UYPA 3BIKA 4K55A 2Y7QA 4JFFE 3VFPA 1WZMA 3BGAA 3VXQB 4UT7H 3H42L 5LXGL 5KVEL 1CL7I 1X7QB 1OP5K 4HCRH 4X6DF 3WO4B 4JO3L 3E6HB 4X7FC 5F9AC 2CK2A 4RRPG 3S98A 1ORQB 3TLRA 1I7RA 2Z35A 1UWEL 3FOMA 3MRHB 4GKSA 5EU3A 3H9YA 4HUMB 2MHAB 3O6FA 1A6PA 5CJQH 4OD1L 2X10A 5DRWB 3DX9A 4QHKI 3LQZA 4GW1B 2VAAB 4I0PA 1W72A 4C4KO 5F3BA 5FGCB 1RURL 1LO5A 5E1AA 1WITA 2GTZA 4J3OC 4S2SB 4Y16A 1ZANH 1OP3K 1D5BA 1HNFA 3KG5A 4ZS6C 1JYNA 4NO2B 5HHME 1NKOA 3HUJF 4NC1C 4LF3B 3I84A 4HUUA 5L9DH 4P3DA 5GPRA 5AG8A 1F11B 4YHIA 5D7IA 5H35B 1ADQH 5DUML 1KEGH 3PGCA 4XWGL 4DN4H 1YPZE 3REWA 4MXVF 2IFFH 4I9WE 3CU7A 3GSWB 4HH8A 4MNGA 3WFEL 2C1PA 2JKXA 2ZUSA 2HFTA 3QDMB 5HD8C 3LRHA 2QQLL 4U0RC 3HC3H 5IMLA 3OPZL 3MLRL 2UYLB 2D7QA 1T04B 3QXDA 4RGNC 2I9TA 3ALPA 3WBDA 1U8MB 3VI3E 3R8BB 1IILE 1A3QA 1EZVY 1CVRA 1RMFL 2B39A 1B2WL 1S7WB 4XXCC 3CMGA 1LEIA 3UPCA 2XTLA 5KVMC 5F7DA 1F42A 2VDOL 2P8MB 4U6HA 3BD5A 4ODTH 4ALAH 2ESVD 2GFBB 1RIHH 5LGHL 4PP1D 3HE7B 4ZD3H 3ARBB 1YMHA 3O2VL 4ZAKB 5I1CL 1NUGA 4U1SB 2OTUA 3QUML 1FV1B 3DO7B 2OP4H 3RWCB 1M7IA 3FRUB 4X5WA 3FQXB 2BVPA 4V1DB 4FS0A 3P4MA 1NCCH 4YZFE 1BWWA 4NSKA 3G6JA 3KXFA 4PJFB 2ID5A 3O3DA 4M61A 4UI2A 1RQ5A 1U8QA 4E9LA 4JRXD 5EU4B 1J0KA 4P23C 4UV7L 3JUZA 1A7BA 3LKRA 3VXSD 1T66D 1K5NB 1EMTH 1ZVSB 5BW7C 5L2KD 4LMQI 1LO2L 2DLFH 4HMDA 2A9NH 4U3CA 4M6ML 3K2UL 5ITBL 1MAJA 4GUPB 5IESL 4MXWL 2EXWD 4G42B 4G9FA 3ZKNC 3VFNA 2HT2C 1F90L 5CEYA 4RBPH 1YEKL 5BZDA 3RVXD 2EYSA 4IBLT 4S1SL 1BPVA 3MGOA 3I75B 1ED3A 3G08B 3JTSA 1CU4L 5EPMA 4QT5A 4NT6A 2JK5A 4GMTH 4JPVL 4P5KA 3QNYA 1DE4A 1LP9F 2BCKB 1T1YA 2ICEB 5JW4R 1XF4B 4X4ZA 1YY8A 4JANB 1TVHA 1YEDA 4XP6H 2DDQH 3PABB 3BEWA 2AQ2A 1J1XH 1T1WB 4FNLH 4GAGL 2YZ8A 3F6LA 3L5IA 1LE9B 2YPLE 5J6HA 2QR0B 3FFDB 1CD0A 2GYSA 2JB6B 2DQCH 5I73B 5T1KB 5IP4A 5DTFB 5AG9A 4ODWB 5SWSA 5F71A 3ZHKA 4KPHH 2EDHA 3QR2A 5F97E 1YQVH 3O45B 3CDFA 2Q76A 4BSVB 3C09C 3H8NA 2DBLH 3SQOH 1GSMA 1EAPB 1NANI 1SY6H 4NNYA 4DQOL 1W0WB 4HW6A 3FRPG 3B6SA 4PJ7E 1D9KD 1NC2B 2DMCA 2X40A 2VO5A 1QSVA 5HY9A 1OAUH 4J3VA 4R2GC 5FECA 1A1NB 2D03L 2R0WH 4GW4B 5J1AB 5DQ9B 1G7LA 2Y72A 2DIBA 5GS0D 2E6PA 3UYRL 1MH5A 3ZL4L 4ORGA 3FB6B 3GSVA 5HDBE 4EUPB 3O6FC 4ZPTB 2DQIL 3P9LB 3IETB 5EIIB 4I3SL 1FZOB 4I0PC 3DGGA 4HS3A 2YOCA 5J89A 5IBLD 1AP2A 2R23B 5F3HA 4YHML 4E41E 4PJEF 1AXSA 3LRSB 5AAMA 1CFSA 4PJ9D 5I75B 3MLUL 1INDL 1WBXB 1TFHA 4Y16C 2Q8AL 5IFAH 1QBLH 4P49A 4LP5A 3AROA 4PJ5D 4PRNB 3TZVD 3MCKB 3ES6A 2E9WA 4D3CL 1HH6B 3O8XB 4L5FL 3BZEA 3DO3A 3NH7H 2D7NA 2HLFC 1DVFA 3D3VA 3UROR 4PGDB 2PTUA 5DUBB 5IR1A 1UZ8B 1PY4A 4OLXH 1T0PB 4YHOH 5ESAA 3EO0B 2JIXD 1NGZA 1VENA 4OJFH 2IH3A 3NFNA 1UQSB 4P9HC 1OSPH 1G9NC 4G6FD 4NQDA 1AFVL 1G6RB 4CVXB 2Z31A 4YHLL 4WW1B 1VEPA 4PB0L 3CH1B 5T1MA 5CLWA 3QUKA 3LSOA 3WIIL 4PRBB 5F88B 2HLAB 5E00B 2C3VB 2VMFA 3CDCA 3TJEL 5DYOA 2KKQA 3RVWD 1MCHA 1NGWB 3G5ZA 1MHEA 4M1GH 4PYHA 1JNLH 1A3LL 3FB7B 5BVJB 5HHPB 4G6MH 2ZUXA 1UM5H 3UC0L 4R97B 4ZUWB 4DTGH 5I1HL 1TQCC 4IS6A 2DJUA 2VJXA 8CGTA 1IC7H 2NY3C 4YPJA 2ZSWB 1ETZB 1AKJB 1DQLH 4OD2B 1J8HB 3CX5J 4LRNH 1OVZA 4S1DC 1KCRL 3QNXA 1X9QA 5IK3A 1FFPB 4F57L 2ZCHL 2X1QA 2FGZA 2V7NA 4L4TD 3SE9L 5FUOH 4BH8A 4HHAA 2OL3A 4I2XE 3BKMH 4WUUD 4DW2H 5MI0C 4XCNA 2X4PA 4ZFZB 4OZHE 2ZUYA 1QO3A 1SJEA 3GSNL 5TDOA 4LEXH 5JHDA 1X5KA 5E2UL 1QEWA 1N3NB 2GJ6E 4BM7A 4BZ2H 1GZQA 1DBAH 2ZUQB 3ZTNH 4U05A 5JPNA 4TQEL 3VFWB 4F7TA 4Z7WA 1JGEA 2R1YB 4LKXA 4OLVH 4YFLF 5HHOA 4QRRE 5D71L 1CGWA 3LDBB 1Z9SA 1WAAE 2A73B 3RBSA 2PO6A 5E1HB 1ZV5A 3D2UD 4XBEL 4LMQE 3MACL 3E8UH 4F7PA 3VA2C 3K81A 3VXNB 3MGTA 4XHJD 3GFUA 5DLMH 1RZIB 3WKNA 4YHNB 3VFGH 2HMID 2X4SA 3OZ9L 4KUZL 1LE5A 2W9LA 4X6DE 4P46B 4DZBA 4LBEA 5JW5A 5CEZD 4LRIA 5GRUH 3PDOB 4K3GA 1HZHH 2V2WA 1SQ2N 2ICWA 2LE9A 2V2XA 1B6DA 3UTTD 4BH7A 2XA8L 1A6WH 1M1SA 3IDGB 1WIPA 1B0WA 4XP1L 4KMLB 2ADJB 1GRWA 4Z7NF 5BCAA 4PGBA 4ODVH 3I9GL 3S88H 2YD3A 5DURB 4ZUVA 4XPFL 4PY7A 4JFDD 3X13A 3JV6A 1Z9OA 1KN2H 4OGAC 2OM5A 1LNUA 2DJSA 2IC2A 3HUJE 4NZTL 5I6XB 3SDCA 3EOBB 3CXDH 2W65B 5I1AA 1QA9A 2P45B 3VFVA 1BF2A 4M1DL 4BFBD 4LSSL 4DN3L 3QDJD 1CE6A 6CGTA 3P4OA 2OXHA 4PJXA 4P3CL 1KEMH 2B1AH 3VXME 4MXVE 2EIDA 4ZTPL 1S7UB 3U0TA 7CGTA 5CKAA 4O2CB 2B2XH 1X5XA 4K94C 1T20A 1L7TL 3TNMB 2C26A 4M7KH 4WGWB 5GGRA 2P44B 3U7YH 4L29B 5K9JH 5JR1H 4NO0B 3GI8L 4MAYC 4MVBD 4NPYB 3MLTB 4F7CA 5BVPH 4KFZC 5DJDA 1OTSC 4CJ1A 2H6PB 3OX8B 2X2YA 5C3LD 2X9YA 3NCBB 2XZQL 5D7JB 1BD2E 2P5WE 1JPSL 5C7XL 2J8HA 3N0PB 1XCTA 2E7HA 5CJOH 3BYYA 3ULUC 3UBXI 1DVFC 2D7TH 5TE6H 3EGSA 5CJ5A 1INQA 1SJHB 4NP4H 3FFCE 5DQJB 4YX2L 2IG2L 5T1LD 4UU9B 2AK4A 4XHQA 1YEJH 4MD0B 5DGRA 3RVTC 2NY2C 3DV4A 4ZTOH 4OGYH 4PGCB 3S96B 4XMKL 4OZFG 1ZLSH 1JYVA 4P57B 1JRHL 3QG7L 5CILH 1KJ2A 4KMTH 1CE1L 5KSBA 4J23A 2YSSB 3PHQB 4R3SB 3PGFL 5D5MB 4FFVC 2DLTA 1T0NB 3D18B 5ICYA 2D31B 1MUJB 3UTOA 1OB1B 4G7VL 4BZYA 3V4VH 2KL6A 3O3EB 3TH3T 5HYSB 1C16B 3D0LA 3OR7A 4KI5C 1JIBA 2VITB 3HE7D 2J7LA 3C60B 5I8OH 4O02H 3DXAE 1QVOB 4HH9B 1QD0A 1IGFH 5TQ2H 1I9JH 5J0BA 5B3NA 5BOPA 1A7RL 2ED8A 2E5EA 3PWPA 5T3ZD 3HG1A 4IRZH 1FL5B 2WAHA 2ZSVA 3T3MF 1I85A 4WNQB 4OFYD 1IQDB 3OB0K 3VWJB 4AIZB 2AJVL 4G8GA 2AV7B 4UDUB 1A7QL 2IANE 2NPLX 1FGNL 5C0JB 4XRCA 2V6HA 1LP9E 4OV6F 3DWTA 3ZYZA 1IGIL 3STBA 1T22A 4OI8A 5FYJD 4PRPE 5TQ0L 1YMMA 4CU8A 3GIVB 4EVNB 4I77H 4YDKH 2XNAB 5IV2B 5F6HJ 1PSKL 1XR8B 2DYPB 4LFHD 2X4RA 1JPGB 3OKEA 2X9XA 4BFIB 4KKAD 2BNUB 5ESVA 5C0BB 5J1TC 1SJXA 4UNUA 4A6YH 3OKKA 1MFEH 1L7IH 3T1WA 5L7XL 3DV6A 3ZHDA 4DAGL 1N26A 1RZJC 3ZHLA 4YUEL 3KLSA 4OCMC 1FSKC 4WFGD 3QHFH 2PO6C 1ODAA 2OR9H 1AJ7H 1C7SA 1HILA 1OL0A 4Z7VF 2BVOA 2D4FA 4FFWC 1BFVH 4G7YH 4FTVE 5J3HC 3KWWA 5HYJA 1GC1L 3C5JB 4QRUA 3KPNB 4U33A 4YC2C 3VXOA 4BSWA 2VLKB 9CGTA 1Q0XH 2BP3A 3ROLA 3X3GH 1Y0LB 5FF6B 3IU3A 1KLFA 2QKIB 5JMOC 3QDGB 1CFTA 1KYOJ 1BGXH 3QFJA 4F15B 5E8DH 3LH2H 5FB8A 1FC1A 1KN4H 4HWZB 3ULVD 3OKYA 4LRIC 1BBJB 2CK0L 5T1KD 4R96A 1WV7T 2WBWB 3TN0A 1CIUA 2MQCA 5BV7B 5F1IB 4HC1L 1VKXB 1EHAA 1N7MH 3Q5TA 4GW5A 2Y5EA 2FRGP 1AO7D 2GUOA 2VQ1B 4PV9B 4PJEE 1J5OL 4S1QL 3QQ9C 3RKPA 3QEGL 4M7JH 1EGJL 1XIWA 2UVFA 4L9LB 1DANU 1I1FA 1ZT7A 3SDCC 4X8JB 4QLRA 1NC2D 4HGWB 4M9PA 5IHLB 2JELH 2BVTA 5E94A 3L3JB 1LHZA 4U1GC 2P46B 5TF1L 4MA1C 5JORA 5ISZB 1TZGH 5E9DA 3NABL 5K9QG 2I26N 5F96L 4HGMA 2XKUA 5LWYH 5I74B 5T1DH 3D5OF 4PRAB 4KROD 1ZHNB 4X4XB 1DLHA 4I8DA 1UWXK 3B4NA 3IU4H 4LPUA 3V8OA 2P48B 2XQBH 1FYTA 2DLGA 2PW2B 1QNZL 1NC4B 1IFHH 5F93C 5T3XE 3BE1L 3RL2B 4ETQA 2DQFA 4NRYA 4R7DB 2BVEA 4B0MM 2MCPL 4KI1A 4Y4KD 4LCUB 2B1HL 3W9EA 2AGJL 4A2MA 2GAZB 3WN5A 3WFBH 1YN7A 3ULUH 1N0XL 2DM7A 4JZJB 1REIA 3W81A 4P2QE 4POYA 1T7XA 3WD5L 1MF2H 1JWMB 4TNVF 2EDOA 3GRWL 2CSPA 3KLHD 2IPKA 2DM4A 3NCYS 3G5XB 3PNWA 3REVA 5KVFL 1UYWL 4EQ2A 3F6IA 3I2CL 1G7JA 1A7NL 2FJGA 5FCSH 1LK2B 4Q9BA 2VLJA 5FFLA 1UACH 2FX9H 4JGJA 1FLTX 5HPOA 1ZWIB 2FBOJ 3CC5A 5B8CB 1AXTH 3MV7A 5FA3B 4KK6C 3AS1A 3ARDA 4Y4HB 2XFXA 2Z9TA 5FO8B 1EVUA 5C0IA 3KYOA 3I3DA 5EUOA 1OAZH 3JV4B 3FT2B 1DBML 1UXSA 5E4IA 3O6ML 3U0WL 1RUPL 3BO8B 1B88A 4KKCC 1J7VR 1G7MB 1MNUH 2AXGB 1CFQA 3ARTA 1BM3L 4LHUG 4WFHD 4Q9QH 1FYHB 1RZKL 1A22B 3GSXA 3VRJA 4I4WB 3L5WA 5EIQA 3O0RH 4XX1G 1RAMA 1HSAA 1B9ZA 4OM0H 1NFIA 3UJIH 3LEVH 4CDHA 3DMMB 1UM6H 5GRXG 5A40E 1I7TA 3GMMA 4QY8B 4ELMB 3MLSH 3I50H 3AS3A 4LSVL 3BAEL 2LU3A 4Q9RH 1XGUB 3H9SA 2VABA 1CLYL 1QFUL 4ZMAT 3KAAA 3WJJA 2OL3H 1T1ZB 2AQ1A 2FX7L 4Y4FD 2APVA 3TA3A 3MBXH 1KSRA 4F9PA 3QCUH 1J05B 1A3RL 4KJYB 2EYTB 3AMLA 3VFMA 3P11H 2O5XL 3MJ9L 3U6RB 1NBVH 4IIQB 3VFTA 3NPSC 3KPPB 3OAYK 5F7KC 4XMLH 5JDSA 4X99A 3VXRA 3W82A 2WWMC 2HWZH 1D5MA 4MHHG 2F53B 5AZEL 1IC5L 5IM7B 4Z7NE 4X4YB 1Q9WA 1V3MA 5C0DA 3QHTC 4ONGL 1E0OB 4XH2B 3OGOE 1NCNA 4LVOC 5E2WL 2DRUA 5F9DC 4YXLL 3WDJA 3QWOA 1T2XA 4XPBH 2ESVE 1G0DA 1JGVH 1TVBA 4M1CD 4P46D 1U8KB 2DTMH 4G43A 4ODHH 5F7NC 4XTRC 4NFDA 3VGGA 1DBBL 5CJBA 3TN0C 5CD5D 3BKJH 2PXYB 5BS0B 5E2TH 3EOAA 1FAIL 3SDDA 1CCZA 1MRFL 5I1DA 5IMMA 1ZS8B 2XXMB 3HAEA 2UZXB 5TGBB 1JHLH 3KS0H 3TYFB 3OL2A 1XIWC 3GI9L 1ZHLB 5HDQH 5DURD 3OJMB 3JWDH 4JRXE 2L4OA 4WU7B 4X5XA 3LS4H 4NBYB 4X0KB 1GGYA 4P59L 1WJ3A 3VXSE 1X5IA 3BN3B 2ADIA 5I9QB 3KNBB 6FABH 3VMNA 3IKCB 5L2KE 3FMGL 5DMKB 1UVQB 1H3VA 3AAZB 3BP6B 4PR5A 3RTQB 4RISL 2X1WL 4AEIH 5I18H 2PN5A 3G9AB 4HS8L 2XZAH 2RFXA 1XH3A 4P3WA 3FQNB 1I3GH 1IAKB 3CIQA 2FIRT 3FQWA 2Z4QB 4MA8L 3ZTJH 1B4JH 2JJUA 4R26H 5DDHA 4YHYB 1QQDA 4PJFF 1G9MC 2D7MA 2NW2B 4FQQB 1JPFA 4NN5B 3SJVA 2DQEL 3BW9A 5D7JD 4L8DB 1AGFA 4ONFL 1H0DB 3GMQA 5ICXB 2E27H 2XN9A 3AS2A 4Z95L 5EG6C 4LLMB 3HZYA 2J3SA 3TGXA 4CADB 1ZVYA 4LLVB 2IMMA 3KPOB 3WN5C 1RIVL 4MMXC 4YHPB 3O9WD 1D5IL 2IQ9H 4XPAL 2A83A 5INCB 3I02A 4K8RC 5HGHB 2E9BA 4Q6IA 3DRTB 1A4KB 4HK0B 5A43C 2N7AA 4ERSL 3P4NB 3SO5A 1C8PA 3QUXD 3KPQB 2G75B 3T3ME 1X4XA 3S4SG 4OGXL 4NQUA 1ONQA 2BHZA 3GGWB 5LGJA 3N9GL 4UNVA 4BELD 5IOPA 3KPSA 1CN4A 1K2DB 3B2VL 1E28B 4OQTL 4LPYA 1QTYT 2EDBA 3ARDC 4U0RB 2V7HB 4UAOC 4GRWB 1UA6H 2ITCB 2VR5A 4RGNB 3IAQA 1XF2A 3ULVF 4HKBB 1DQJB 3C60D 5IVZA 1IARB 4WW2F 3MA7A 4HZAA 3FCTA 2ZPKL 3VDAA 4WTWA 5J4MA 3WEXA 3OKDA 4ZQKB 3HPLB 2NLJA 5DZNA 4LLQB 1SEQH 2L0DA 2Y06L 5I0DA 4O2FA 1GHFH 1QRKA 1W8OA 4ODUA 4Z7VE 5E56A 1S7SA 2CIIB 3IFLL 4Z76B 2X70A 4TNVK 3GMRA 1P7QB 4U1IB 4PJ5E 3T1FA 1IVLA 2BK8A 4I5BB 4HPOH 1MPAH 2W91A 3N1FC 3WUZA 1UWGL 2R2HB 4RFEB 1XGPA 1I8LA 2XIDA 2DYPD 2QSVA 1IAIM 3TA3C 2NY5L 3QQNA 2MTPA 2YA1A 1T89A 1CF8H 3VH8G 2WP3O 5TPWH 1XF5B 4P23B 3NCFB 5DRNB 1RUAL 4JVWA 4NIKB 5ILTL 3W0WD 3GM8A 3QUMA 4HUWA 4P4KA 4N90D 4XCYA 1GGUA 4OFIA 3TCLB 1LDPH 2XWBB 3RP1A 2CJUL 3V2AR 1IGTA 5H94B 1KIPB 3LKOB 2VDKL 2OK0H 2VDLL 3C8DA 4N0FB 1PY9A 2JCCB 4N8VB 3BH9A 2WUBH 4M3KB 4L8BB 5DJ8B 5GHWL 5C0RL 3K8LA 5LJYH 2YC1B 2DL2A 2EE2A 2KUTA 4Y19D 1JHKH 4DCQA 4UNTA 5D1QD 3CLFH 2FHCA 1TETH 3SDAA 3MRQA 4NUGL 3SDDC 4C56B 3FB5B 4JFQA 1WBYA 2D9QB 1MQKL 3ARGA 3T2NH 2GITB 3SE3A 2ITDA 4FQLH 3V5DB 1GGIL 5C0FB 4L4TE 3O3BA 1BVLA 1ES0A 4WUUE 1R5VB 5JIIA 3IDXL 3LN5B 3ILQC 4RIRA 2L7UA 1FG2B 4PS4L 1ZHKA 5EO1A 4NWTH 1KULA 2UUDK 2HFFB 1FL3B 4HWBL 3KPMB 3SKMB 5E7BA 3BIKB 2Y7QB 1J87A 3EHBD 4JM4H 3QPXL 5D70H 2DN7A 3KPRA 3QEUA 1KPUA 4R2GB 4B5EA 2GK0A 3QFDA 5DWUL 4OBRA 1I1AB 2P7TA 1ZOXA 3U7WH 1CG9A 3CUPA 5IB2A 4PJIA 2Z35B 2UZYB 1VGEH 1U6AH 4JB9H 4LSPL 2ENSA 3TV3L 4HF5L 1C5CL 1OGAA 5EU5A 4HV8A 3LQZB 4HIIA 1QUNA 3ARVA 4IRJA 5F3BB 3GMOB 2DMKA 5MEOA 1LO5B 5I17A 1A0QL 2VLLB 5E1AB 1WFNA 4PB9H 2GTZB 2Z93A 1FH5H 4OB5L 2J4WL 4Y16B 4EI5D 5FHBH 4Q6IC 4J7RA 5CEZE 3SGEH 5IBTH 2MFNA 4HJJL 3QIUA 5I30H 3HMXH 3QUZD 4MJ4A 4CNIA 4YHIB 1NGXB 5H8DA 1H8NA 3PGCB 4JDVA 5C0CA 4LHJB 2MQ0A 2R0LH 5JOFA 5DFWH 4RFOH 1QLFA 3REWB 4QO1A 2FGWH 5DHYB 4XBPA 4UBDD 4MNGB 4AZ8A 1FO0L 1R3LB 5CCKH 2ADFH 5IMLB 5D7IE 5FUZL 1MCEA 1VGKA 3B5HA 1HK6A 3QXDB 1SBSL 1A6UH 3NA9H 4Y4HD 2I9TB 3ARFA 4HSQA 4J3WA 3B9KD 1S5IL 5C71A 3QDJE 4HKJA 3QI9A 3CX5K 3V6FB 1A1MA 3BFOA 1LEIB 4R7NA 5F7DB 1FFQA 3MNVB 3A6BH 4HPYH 4U6HB 1IQWH 4X7CC 4EDXA 1P4LA 5HSFA 5D7SL 1HINH 1J10A 3ZDYF 3KDMA 35C8L 1TQCB 5JW4N 3L7EA 2NY3B 4X5WB 1VERA 3MRCA 1OQOA 3P4MB 4QYOA 4NSKB 1I8LC 3G6JB 4YFEA 2VISA 4M61B 5JLZA 4M6OH 1T89C 1OLZA 4H20H 3K74B 4NM4H 1I8MA 1SMOA 4X7SH 3RKDD 2VUOA 3CVHH 1DLFH 1I3VA 3W39A 5I8KH 5MI0B 3LKRB 3AVEA 3WIHL 5AYUH 3G5YB 1MVUA 3Q1SL 4P4KC 3RNQB 2EH7H 3EFFA 4GRLB 5ID1A 1TQBC 1WEJL 3QWRA 4LAJH 5DJAA 4OCRL 4NGHH 1C1EL 2F53D 2FBJH 1IAOA 5CBEA 5EA0H 3SBWA 4CMHC 4G9FB 5DS8A 4N68A 4MCZA 5ALCL 3VFNB 4K9EC 2GJZA 5CEYB 5BZDB 4EDWH 4IEFB 2BJMH 3RUGA 2EYSB 4H26B 3MGOB 1ED3B 3JTSB 5EPMB 4QT5B 5JXEA 4NT6B 2JK5B 4P5KB 4JFOA 1N2RA 3BX7C 4O4YH 4XVUC 4UT6H 1OM3H 3GSNA 1B90A 2CMRH 1LQSR 3SDAC 1YY8B 1BZQK 1I8IA 4YAQA 2F15A 3VI4E 3BEWB 1SVCP 4ZFGH 5T3ZE 3LIZH 3ARGC 1MCCA 1IEHA 3SE3C 4W68A 1TJHH 3ZKSD 5J6HB 3DVNA 5D7LB 3U0PA 5F9JA 1YEGL 4KKLD 5IG7A 5CGTA 4PJFE 5KTEL 5D5MF 5SWSB 2HA1A 4YDLC 4FQCH 3N06B 2DIAA 3DRQB 1QSEA 4FQJL 4IRSD 5FYJE 1GIGL 2W9DH 4M5ZL 3EDEA 5C07A 1Z2KA 3VDCA 3GHBH 1ZA3B 1J0IA 3B6SB 3GJEB 4OF7A 1K4DB 4TUOB 3BPCA 5HY9B 1YEHH 1A21A 5EN2A 5FECB 1WWAX 1G7LB 3GSUA 5JPMA 5KS9A 5KVDL 1GH7A 1RK0A 3BHBA 1YDPA 1NH6A 2W0FB 3GSVB 3MJGX 4UQ2A 4WFGE 1FHGA 4Y2OA 5C0AA 3HNTL 4MA7H 3KYKH 4KVNL 3U7AA 1I1YA 2NNAB 5KVGH 3DGGB 4HS3B 3F7VA 4U7MA 4YO0A 5LAXA 4IRJC 1AP2B 2FDBP 5F3HB 4LPXA 4XNZC 3PXHA 3TH2T 7FABL 4NKIH 3AFLA 2QQKH 4JVPA 4MAYB 3ULVE 5B39A 2EIEA 1JI1A 1VESA 2J8UA 3MA9H 1ORSA 2RQ8A 2P1YA 3BZEB 5IROA 4XI5D 4UUJA 2P4AB 1E6JL 1DVFB 1RJYA 1XGRB 3D3VB 2Y5TA 3FTGA 5DD5L 1IBGH 1AO7E 1UWEH 1PYWB 5IR1B 1E6OL 3SGDI 1UB6A 4XXDA 3EFDH 2NY2B 4NZRL 1NGZB 1IT9L 1WWWX 4NCC2 1A64A 4LDEB 3ARFC 5C08A 3I85A 4POUB 3U30C 4NQDB 1RURH 2H2PD 3QI9C 2W0PA 1HYRC 1GXEA 3QUKB 1M7XA 4GXVL 4TVSa 4KK5D 1CK0L 1P84J 2K9UA 2QHRL 3O4LB 5DYOB 2VXQL 3Q6GL 3RGVA 1MHEB 1AI1H 5GRZA 3GMNA 4FQ2H 3KYMB 3B9EA 3HC4H 4KJWC 4LLWB 5DFVC 3AREC 4IS6B 5IVNA 1WIOA 4U6XA 4NN7C 4NJ9L 3U9UA 3QULA 3H3BC 4NBZB 4GBXA 4UV4H 5DD0H 3C5ZD 4XNYL 1OTTC 4NKDA 2NX5D 3OBAA 4JO4H 1JNNL 1UB5A 1OSZA 1RD6A 3QNXB 5IK3B 3L3HA 3T8XB 4QTIL 3TYGL 2V7NB 1HKLL 1HSBA 2G2RA 1B2WH 2OL3B 3OJ2C 4HHAB 4Q7DA 1WCBA 3U82B 1JZ3A 5ALBL 3NZHH 5C6TH 3TT3L 3VD7A 1QO3B 5TDOB 4GT7A 2A9MH 5JHDB 2XRAL 1YNTA 1QEWB 4M6NH 5AUMA 5KBNC 3TIEA 1GZQB 1WICA 1YEFH 3MUZ1 5FKAA 1NAKH 1RHFA 2Z8VC 4EOWL 2O5ZH 4M62L 4QXGH 3SBWC 1KYOK 4TSCH 4F7TB 5FA4A 4Z7WB 5HHOB 1L9NA 5JXEC 1MFBH 1U36A 2OZ4H 3HI6H 1FSKB 2P5EA 4Z5RA 1BMGA 2PO6B 2FEDC 4GO6B 1BF8A 4K9EH 4BKLA 5CZVH 3RU8L 3IJHB 1Q1JH 5MENA 4WDIB 3G9VA 3UTQA 2ZG2A 4J2XA 4HUVB 2EDYA 5JW3H 3R0MA 3TBTB 4QRTA 3E2HC 4DVRL 2YD4A 2B8OT 4HJGB 3T0EC 1ZVHA 4WFFD 4DZBB 2Y4SA 4LBEB 2GTWA 1R3IH 2R8SH 5LG1A 4QOKA 3E3QC 3KLAB 2ICWB 1FJ1A 3I6KA 1R24A 4BH7B 4M02A 1UKTA 3TO4C 1KV3A 4LFHG 4XP5L 4BUHA 1PJ9A 2BNQD 1VADA 1YEKH 3CFCH 4JM2A 1JWUA 5E8PA 1EXUB 5FGRA 4WTZA 2YA2A 5TDPA 3BVNA 1CU4H 2DWEA 4PGBB 4PRIA 4AQ1B 4JKWA 4ZUVB 1JL8A 2WZPD 3MRGB 3X13B 4PY7B 1SM3H 3GIZH 4P5TB 4YE4L 1PKQE 2RCSH 2EDKA 1VPOL 5IFJA 3D85A 1I7ZB 2CKBL 1QA9B 4KKBD 4JFED 4ESKA 5DMYA 1U3YA 1TITA 2PETA 3W9DA 1RU9H 4AYFA 4P9MH 3R1GL 1I1AD 2R4RL 4PJXB 4RAVA 4NNPH 5C09D 4HC1A 4UILL 4XBGA 4U1GB 3U0TB 1EBAA 2P8LA 5GXBB 4DKFL 4MA1B 3WFDH 5FK9A 5IEHA 1MCBA 1HE7A 3MXWL 1EEZA 3EDDA 1IGML 3L95B 4G8EA 4ELMF 3U1SL 1EGJA 3L1OH 3RWIA 4JHZA 1F4XH 4D9LL 5T3XL 5J9PB 4ZXBA 1BX2A 1MFNA 3V5HA 2EEDA 5LBSL 1XCTB 5IROC 2NXZC 2XY2A 2F54D 43CAA 1INQB 3KHQA 4JFXB 3ZL4H 1BIHA 1LO3L 1QLRA 3ZKQD 5D8JL 5DR5H 5MERB 3ZDYE 3LZFH 1FVDB 1T4KA 2ZJSL 3JTTA 5K9KA 1O5DT 5FXCH 5FYLH 5TE4L 3RBGA 1MI5D 1MFDL 3L5XH 2AEQL 5HDOA 1A8JH 3PUCA 4PJAB 1U8HA 5FHAH 1MCPL 5KSBB 2Y6SC 1I9IL 4EUPG 4IM8A 2F74B 1NLDL 5GGTL 5IB3A 1GAFH 4GKZA 3V5KA 1CDGA 5ICYB 1KFAL 2C4FT 3RGVC 3J8F7 4MGXA 1HHJA 3B83A 3D0LB 3OR7B 4UIKH 4LPVA 5GGVL 3T08A 1X5FA 2O26U 3QJHB 5A16A 1YEEL 3H2WA 5GSVA 1PKOA 3GRWA 4PUBH 5L8KB 4PRHA 4GBXC 3WKML 3HG1B 2W9EL 3QQ4A 2ZSVB 4HEPG 1MWAL 1MSPA 3HRPA 4L4VD 5IB1A 2HTLD 2QSCH 4HG4J 4GLRH 3V0VA 2GHWB 4WHCA 3EYVA 1ACYL 3L7FA 1YZZA 4CKVX 1E4KC 2F58L 3PWPE 1T22B 2UVEA 4MJIA 3MUGA 3SOBL 1YMMB 1ZHBA 5IFHL 3L9RA 4FQXD 4KMQA 4G8GE 4GRLD 2ARJA 3U9PL 3A67L 3TPKA 4D0BA 2OJZL 4HZLA 1LEGA 4JFZH 3HZMB 4NZUH 3OKKB 3KPLB 4HQQH 4TTDC 1BVZA 3ALWA 1FAKT 1JZ8A 4QXTA 3QO0A 1DL7L 4KTEH 3KJ4C 3NPSB 1BQSA 4OCXL 1JGLH 3BGFC 2AV1A 4JRWA 4Z7UA 1NGYA 1RUKH 4W6YB 2HAZA 2BVOB 1N59A 1D5ZB 5GJTH 1CICB 4XCEB 5HYJB 2NY4C 3K7UA 4K3EL 3VXOB 3MJ7A 1A6TB 4C4KT 2I5YL 4NFBA 3ROLB 2J5LC 3IU3B 3IDUA 4GSDH 2CUIA 4PJHB 2WIIA 1CFTB 4WCYL 4N5EC 4LVOB 3QFJB 4XPHH 3DECA 5FB8B 3KS0J 3WFZA 3MJ9A 5D7LD 5DK2A 1FORH 3CD4A 3PL6D 2AKRA 4JN1H 2DQTL 2X4QA 3TN0B 1YYLH 5LQBH 3WHE1 5HGDA 3GK8L 4JM2C 5C2BL 4HMCA 1GC1C 4K7FB 4KH2A 4A2LA 2RHEA 2GUOB 1U8LA 5GZNC 5IB4B 1I3RB 3BDYH 1IM3A 3SDXF 3MCG1 1W0VB 1XZ0B 2EDWA 3S97C 2VC2L 1XIWB 4RA0C 1ZXQA 4XBEH 1I1FB 2GCYA 1LWRA 1DQDH 3MV8B 4PJCA 5T5NF 2X44D 4KV5E 3ZMRA 5C70A 2G5BA 4MXQC 4MJ5A 4NO5A 1YNLH 3W0WE 5E94B 4P4RA 4N90E 3FN0L 3QH3B 1CXEA 4RWYL 3WE6A 4G6JL 1CFNB 5FGSA 3MLXH 3VE0A 5F7EH 4CVZA 4R4BA 1FC2D 2VZOA 3JWOL 4DGVL 1P4IL 3MGAA 4P0DA 4PJGA 1QR1A 4ZXBC 4MAYD 2F19L 4Y19E 2LV4A 4NYLB 3ZT5A 5E9DE 4ETQB 1MIEL 2A1WL 4APQA 1X5HA 3PWVA 4NRYB 4QHNB 4YXHH 2V5YA 5I1EH 4JFFA 2AS5M 2ZZUT 4PGEA 1Y6NR 3RL1B 2MNUA 4XZUB 3BESR 3W9EB 4M8QA 1FYTE 5IQ7L 3WN5B 2YXMA 3FRPA 3GKWL 2BZDA 3LHPL 2YD2A 5B3JE 5GISH 2XWJB 1H9VA 3PIQA 4X7DC 2FH8A 3PNWB 3REVB 4Z8FH 5DT1H 4EXPX 3LKPA 3UX9B 1VDGA 5BRZA 1VACB 2HN7A 4BSJA 1YN6A 3WS3A 3WCYA 2DKUA 3MRDB 3O4LD 2NY7L 4H1LH 4UAOB 5C0IB 4X7TA 3EYQC 1U8OA 2EZ0C 1CD8A 5EUOB 5GS0L 1F58H 4TSAH 1QLEL 4LCWD 5DSCA 2APBA 1DTUA 3C6LA 4X5LA 4U2ZA 3QXAA 4Z77A 1KB5H 4WHYG 1CFQB 3MV7E 4BK5A 1YPZA 2PYED 1ZLWH 4Q2ZA 2LQRA 3GSXB 3VRJB 5DHVA 4J3TA 3L5WB 3DNKA 2BVQA 3KJ6L 1NAMH 3O81A 3QG7H 4RBPK 4OQTA 2A6DA 1D6VH 4RX4D 3ZSSA 1IGJA 4HKZB 3LN9A 5F1OB 3WNLA 1FNGA 5DEZA 1CGUA 3GMMB 3Q2CA 4JN2B 5DI8B 1AQDB 2VZTA 2BXZA 1FGVH 3H9SB 4MNQA 3RWFA 3T0WA 5AEAA 4W81A 1CS6A 3X3FL 3HMWH 4NJAH 3CVHB 5L2JA 4QHMB 4LSTH 5GS1A 5DVNA 3KYNB 1LGVA 1NUNB 1D5XA 3TA3B 1RZKC 1HHHA 4LVNC 2HG5A 3ROOB 2GW5A 2CGRL 4Z0BH 3K4DA 4OZIB 3VFTB 1BBDL 3BJLA 5CHNA 3MCLH 3VW3L 3TVMD 3L3OB 3VXRB 3F62A 4XGZB 1U41A 1IAIH 2PTTB 1FGNH 3CCHA 3BQUA 3GBNH 5GJSL 3V0WL 1NLBL 5TJWK 3QCVL 1MCRA 5EIVA 4AM0A 3OKOA 3P9MB 3S36H 4W4OA 3MLWL 3S34H 3QWOB 2VDRH 5FM5O 1TVBB 5D4QA 4PG2A 1T7ZA 4PD4J 4JQIH 1E4JA 4IOIA 4FOMA 5DEGA 3SGKA 3GNMH 3OXRA 4P2OD 3SKOA 4ELME 3SDDB 2DQHL 5I1DB 5IMMB 3CDGA 4YR6A 1MCOH 5I1IH 2LVEA 3UP1A 1FFOA 4RGMC 4K2UL 5HHXL 4D0CA 2X4TA 5BZWB 4P5TD 4X5XB 3DETC 2F5AL 4PLKD 4X9HA 5BO1L 2W1NA 2ADIB 4POZC 4ETYA 2R4SH 3LAFA 5AD0A 1JK8B 4FMKA 4M48L 1L6XA 4U6VH 2F53E 1F6AA 2YPLA 3J7HA 4H88L 4HD9A 2VR9A 5FM5M 4JEGB 1M71B 1V7NL 4DVBA 3FQWB 4WHTA 1UG9A 1CR9H 4J1UA 3MUJA 2Q8BH 5DDHB 1QQDB 3Q5YA 2IGFL 1JPFB 4OCWL 3OG6B 4HWBA 2JTDA 1NDGB 2XN9B 4YEEA 5DD6A 1L0XA 1Z9LA 3NFPB 1M05A 5AZ2H 4PJ7A 5J57B 3TBVB 1BIIA 1V7ML 4AH2A 5CLTA 1AY1H 25C8H 3T3PF 5KN5A 2P8PA 1MCLA 5CEZL 3I02B 3SJVE 4F3FA 4Q6IB 3UJTH 2HVKA 1W72L 3PDGA 4JPIA 4OUUB 5EU6D 1QFOA 3DTXA 4RMWA 4Z7QF 4RMTA 5JHLL 4HIHB 5CMAA 5L6YL 1KG0A 4LL9A 1J1OH 5IOPB 3RZCA 5C9KA 1QBBA 1T7WA 3KPSB 3MRJA 5EOQL 4ODSH 4OIIL 2BHYA 5DD3H 1NDMA 2DQDH 2AEPL 1JWSA 3D39B 3O11A 4CUCA 1KCUH 2OYPA 4D94A 5MEQA 4QKXB 3V9FA 1SMAA 5CZXC 3L3DB 2ZUTA 3EOTH 3MNZB 5IVZB 3C6LC 4MQTB 3FCTB 4Q58C 3ARZA 3U46A 1UADC 4U0QB 1RJCA 4OF0A 5KW9L 5J6GB 2GSIA 1FE8H 2NLJB 4LSUH 3WD5H 5A3ID 1LK3L 4B50A 3CMOL 4O2FB 4JAMA 1FO0A 2BC4B 1DN2A 2WLZA 1T83A 2DIJA 1J11A 1S7SB 5T33L 1YY9D 5CP3A 3QPQC 3GMRB 4GMSL 3T1FB 4RGOL 4OZFA 1UZ6F 3MSPA 1CBVH 1XGPB 4NKQB 5GS1C 2CUMA 4QCIA 4Q6YA 3BD4A 1ZLUH 4PLJC 5ID0A 1G1CA 4QWWD 4ZDHA 4LCCA 2YBRA 1EJ6A 2E7CA 5ECJE 3GMPA 1FZKA 2HT4C 1IEBA 1S7VB 3HFMH 2RIKA 4LIQH 4FFYH 1PZ5A