3CC5B

H-2db complex with human gp100
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Design of agonistic altered peptides for the robust induction of CTL directed towards H-2Db in complex with the melanoma-associated epitope gp100.
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cc5B00
3I6GA 1PQZB 4NKDB 4YK4B 5B3JE 4MCYB 4DVRL 1VGEH 3S35X 2A9NL 4XP6L 4LLDA 5C0IB 3SDAB 4BSVB 1TDQA 4X8JA 5IFHL 3FQXB 2HT2D 4Y5VC 4LF3A 3PGFL 2G60L 4M6OH 3ZDZE 2W65B 5DFVD 1KG0B 3FOMA 4WJ5B 4J3XA 1WFOA 5JXAL 5ESVB 4ALAH 2BSED 3JWOL 3PHSA 4IIQB 1QG3A 3UBXI 2UVEA 4G9FB 5KBNC 5HHMB 5C70A 1PKOA 2BC4B 4JQIH 2DMBA 2O5ZL 5DK3A 1H8NA 2IPUK 3NFNA 5KANI 4J4PD 3QDJA 3LKOA 4MMZC 1F3DH 2H3NB 3HPLB 1WWAX 3DI2B 4IRJA 3TFKC 4ZOAA 4XMKL 5GSRB 3IJSA 4CDHA 1T20B 3DVNA 4NKIL 5BOZG 2ZG2A 3QXDB 3TVMD 3J8F7 5IJVB 5JHDD 2QHRH 2JB5L 3D69A 3QXAA 3WKNA 1JHKL 2DDQH 4M61B 4N0UB 4LCIL 3X17A 2J4WL 5CINL 2N7AA 4JPVH 4WUUD 2BRRH 3T4YB 1C08A 1FGNH 1X3DA 3BOVA 4JG1L 5DRWB 1W0YT 3QR2A 3GB7A 1J5OL 3VFUB 2XQYG 5EZLA 2A38A 2VITA 3IFNL 2WK2A 1ZGLB 3O6LL 7CGTA 4RRPA 1J05A 1LK3L 4TNWF 5MENB 3VD9A 2PR4L 3MUZ1 4F7TB 2I9LA 3GMRB 3BP4B 1HIML 4L8BB 4LHJB 4U1GB 4KTDL 2P24B 5BVPL 3C6SB 4HX1B 4LVEA 1OAKH 3C5SA 2DIAA 5D2NE 1R3JB 4R90L 3RWDA 4Z0XA 3RJDA 3AS0A 5D1ZA 5CP7A 5GGVY 4N1HB 3VG9C 4BZ1H 4OZIE 2V7HB 3C60A 1ZOXA 3MFFB 1IM3B 3KJ6L 4IRSA 4MSWA 1C1EL 3T3ME 5EU6B 1QBBA 3VFRA 3L3IB 3I9GH 3O6ML 4UB0L 4H8WH 5CKGA 2P4AB 4JANA 4UAOC 1FVDA 3S5LB 4PB9L 5BZWB 2VLRB 3MLVL 3VI3E 3RWIB 1WZLA 3ZE1E 1JK8B 5C09B 3LSOB 1TFHA 1DANU 3IU3A 4NRXA 2G9HB 3G6DL 1HH6A 1RVFL 5ENWB 3TT3H 4FQXB 1GPOL 3T2QA 2GIYA 5EOTA 4P2QE 4QHMA 2ZOKA 2ENYA 4FG6C 2Y1VA 1VFMA 5E8EA 4OLZL 1HCFX 2UV3A 3DV4B 5DD0H 3V0VA 2C3HA 3GKZA 4V1DB 1NC4A 5ESAA 3NFSH 1VSCA 5SWQA 3CD4A 5DA4A 3SJVE 1WFNA 4GBXB 5GISH 2E9JA 3AM8A 3P9MA 3CFIC 1FE8L 2F5AH 3PGDB 2YKLL 2FX8H 1NJ9A 4FQJH 4FQQA 5I1AB 4XMLH 2VQUA 4WFGD 1RIHL 3HC0B 3SOBL 4W81A 4OT1H 1K4DA 5EN2B 3TN0D 2MHAB 3AREA 4YHNB 1M71B 3Q6GL 1GZPA 5I8CB 3CCHA 4K7PY 4A2MA 3IVKA 3ES6A 3WNNA 1WWCA 2X4NA 4PPTA 3T0XA 5TE7L 4GXVL 2X4QA 3VXMD 4JDZB 4M1CC 1YMME 2NZ9D 3QZWA 3VXUE 1CTNA 2YBRA 5I8OL 4WHYH 4QNPE 5E6ID 1X5JA 4CKVX 5T1KA 3MV9B 3RY6C 4JVUA 5I1HH 3CDYA 1OW0A 2NY7L 2CLZB 5T1DL 3BIAX 4M3KB 4EN3C 2W9EL 1BX2B 3WSQL 4AEIH 4EXPX 1QQDA 4D9QD 5FKPB 1D5IH 4YH6A 4AL8L 1VGKB 1W8NA 3JWDC 1UEMA 3BD3A 5D1ZD 3EYUL 2ID5A 5DS8B 2PXYB 1PD6A 3C60D 4IRSD 4LAJH 2KH2B 5F1NB 4PJGE 2WWMD 2EECA 5DYOA 4EJ1C 1KOAA 5I8EB 5F9DC 4JLRA 5I71B 3QIUD 2R56H 3MRFB 2NY6D 5GIRB 4OD2B 1GOFA 4NQEE 1RY7B 1UZ8A 1S9KC 1QYGL 1QD0A 2E7BA 3ARVA 1IKFH 3QUZA 3N1MC 3SKJH 3ILQC 5I73C 5J1AB 5IBUG 4PJFF 5CZVL 3RY4A 2CK0L 2B1HH 1BP3B 4KKCC 4FZEH 1PX4A 2A77L 1NMCC 4TNVK 1CDCA 4LLWA 4NYLB 4TSAH 3KLAA 1UC6A 5T3XE 1FCGA 1NSNH 3FT3B 2H9GA 1JFQL 4U0RC 4RIRB 4F80A 4TULH 3TA3C 4JKPL 3RWCB 5DFWH 1ULVA 3VCLA 4PRBA 1TNMA 2YUXA 1HCVA 1FYTE 1K3ZA 4WV1C 3SPVA 1DDHB 1WBXA 3BZDA 2E9IA 4GSDH 4WHTB 3DETD 3EOYG 5D7KE 4KKBD 5DFTA 3GSXB 3MJ9L 4OAWA 4MVBC 1BVLB 2CDGB 5ISZE 1A4JB 2JF1A 3FB7B 5DD1H 2WIIA 3RL2B 1F8TL 5CCKL 1RZ7H 2VWEE 2XICA 1ZTXH 4ODSH 1B6DA 1KTDB 5T1KD 2H1PL 4E42B 4AJ0A 2FGWH 5B38A 1M6OA 2C1OB 3C87A 2HT3D 3GUTB 3MLPA 4HZLA 1IT9L 4WU5B 1KN4H 1VDGA 3T08A 3ZT7A 2X4TB 5AWNH 1EDQA 1MQKH 4PJ7B 1RJZA 1YY9C 2J8UE 4XVTH 3I75A 1BVKB 4NO5B 1RURH 1A6ZA 4KQ3H 5CHNB 1EGJA 1ZE3C 3G9VA 4ZDHA 4KMQA 4YPGB 3IDXH 4BK4A 3T0BA 5DA0B 2ERJB 4Y19B 4QRPB 4XNXL 1KXQE 4FFWD 5BMFL 3BH8B 4FTVA 1BIIB 4YPJA 4HUXA 2X4RA 4QRUB 4Z6AT 4PGEB 5KSBF 1I3VA 1C5DA 4P46C 4XCFL 4XWOD 3LEYL 3U0WL 3PV6A 4YHIB 4Z78B 1RZGB 3O2WH 4XBGA 5DD5H 1YQVH 4I3RH 4NDMA 3L3DA 4OKDA 2DI7A 1JGLH 1P84J 1DEEB 5C0AA 2VXSL 3TJHC 3QCVH 3ARGB 3KAAA 5EPMB 3W82A 1FG9C 4MAYD 4N68A 4G8EA 3ORJA 5JO5A 3IFOA 2XA3A 1L0YA 2BVQB 2C3VB 5DZOA 3CLEH 4GW5A 3TO4A 4XCYA 3U6RA 2X4PA 5EC1B 4P4RB 3R8BB 1ZT1A 4DKFL 4CMMB 2VLLB 1L0QA 4NQDE 4M93B 3TYGL 2W0FA 4HHAB 4FN0A 2OL3H 1J11A 4JKKA 5HGAA 4Z7OF 1SBSH 1U8JB 4PJAE 4M1DH 1FFRA 2DB8A 3BW9A 5EUOA 3QA3A 4IHOA 4A6YH 5JOEA 4ZPTB 4RAUA 4ONGH 3G5YA 1NFDE 3BP5A 2AK4D 1VKXB 1S9XA 2NX5A 4P2OC 4ZUWB 3VFOA 5FCUL 4MCZB 2FECL 2XTJE 2BHYA 4RMWA 2Y5TA 4Y5YB 4PB0L 4U1LB 4JRYE 1RJLA 3QI9B 4MAUH 4O58H 2DQIH 4G6JH 5D7SH 4CBPA 5CGMA 1MAJA 4PJ9C 3DBXA 3RZCB 5DQJB 4ZSOA 3K81A 1MJUH 4L4TE 2HMID 5E8PB 4LSTL 2EXYD 2ESVA 3FO9A 1F11A 3BEWB 3P4MB 4BELD 2V7NB 4X4ME 2O93L 2G2RB 3U1SL 1ORSA 3WS3B 2AI0L 3PP4H 4OD3L 5ERWB 5CBAA 4R6UA 4L8SB 1FNHA 3BWAA 3RKDC 1VB9A 4W6YB 1X5AA 1RZ8B 4ZNCD 1IBGL 2PW1A 3B9VA 3OAZH 1V3JA 2DF3A 2N4IA 4XHQA 1HYRC 1M7XA 3P4NB 1DBJL 2K1MA 3VDBA 3MV7B 1MVUB 2ATPA 5GRVL 3WJLA 1AXTH 4WHDA 5CILL 1H3PH 2X4SA 5F8RC 1UCBL 6FABL 1BBDH 1U8IA 1NFKA 4PLJD 2GKIA 3A6BL 4G43B 3RDTA 3VMPA 3WBDA 3AU1B 1KJ2H 1AO7A 4OB5H 5FYKH 2A74A 1FFPB 4PTTA 1T83A 4CADA 5D71L 4PGBA 1MI5B 2AEQL 2ADJB 1G7HA 2FH6A 1MFCL 4Y2DA 4HIIA 3TO4D 4DTGL 1KLGA 1M7DB 1A6WL 4XC1H 3SBWA 3DO3A 1P53A 2NY2D 2P8MA 4MXWH 3H9HA 2VN4A 4W6WB 5CJQH 2OL3B 4HWZB 5F7KC 3O8XC 1UACL 3Q3GB 4JFXA 5FGBA 3N9GL 1EFXA 1KXTB 2RAMA 4A6YB 1CIDA 1HNFA 2QSCH 2IFFL 4FQLL 4QXTB 4OM0H 2A6KA 4OTXL 1QFHA 2H2PD 1MJJA 3CFBB 4HXBL 1N6VA 4PJCB 4YBHA 1LILA 3Q6FA 5EBMB 4HUKB 3EFDL 4PJHE 5D8JL 2M2DA 4QYOA 1BJ8A 5HGDA 2AKRA 4X9FA 1X6LA 1ZLWH 4C83A 4KFZC 2Y9RT 3RWGA 4RWHA 5IK3B 4Q9RL 3DXAA 3IDNA 3NPSC 4X7DC 2ZKHH 4GG6F 2CIIA 5DMKA 2EIEA 1P7KB 3HNSL 3KXFB 4XX1G 2ESVD 2X2YA 1J9CT 1I1FA 3BPLB 3CUPB 4HGMA 3PXJA 5D2LE 4FFVC 3HI6L 3CLFL 5F71A 4YXKL 3F7YB 3UTPD 1U3HA 4JZJC 3SGKA 1S9VB 1NGZA 1FH5H 4ZUVB 4PJ7F 4JFOA 4HG4J 4KKAD 1AHWC 4CU6A 5HGBB 4X5WA 1JZ3A 4L29A 4LEOB 3K2UL 3PWNB 4NSKA 2E27H 1Y0LB 4XH2B 3I50H 1RZJL 2MPAL 1FL6B 3BGFB 4LKXA 4LEXH 3O9WB 3IJHB 4UT7L 5JOPE 2MQ3A 3I2CL 4NQCA 2IQAA 1EMTL 3RDTD 4K71C 5JPMB 3HC3H 1KJ2B 3G5XA 1HWGB 5DSCA 5F6HJ 4R2GD 3RUGA 4PJ5B 3M1BA 1CL7H 2P44B 3L5WB 1G7QB 5JIIA 1QNZH 3UTTB 4ESKA 1N26A 2WQ8A 4HK0B 4JHAH 4KJWC 4DQOL 4KI5F 4R8WL 1N7ML 3WD5L 3UXFA 1CBVH 4ORGB 1FZOB 3T0ED 4KTEL 4M7JH 1CDIA 2FATL 1X5IA 2BNRD 1QSEE 5C08A 2HKHL 5A3ID 2DQEL 1XMWA 2ICEA 2EEDA 4AM0B 3GMLB 3BHBA 1UCTA 1IKNA 5HI5C 3ARXA 3QO1A 5EO1A 3ECBA 2D03L 1CR9H 5CFHA 4Y7MA 5I1JL 1FORH 3WNMA 4WFHE 3SDYL 3ARSA 1SJXA 25C8H 5GS0L 1KCVL 3QWRA 4WVRA 5FAAA 2ZCLH 1NEZA 1QPXA 5IVOA 3MRJB 3TESA 1B2WL 2EDFA 4R97C 5INDA 1BZ7A 4PGCA 4QXGL 4UV7L 5F3HB 3F65A 4HWEL 4OLXL 1CFTB 5D72L 1W0VA 5I1GL 2Z93A 4Z18A 5IFAL 1FZJA 4X4XA 4OCYL 5FO9A 4HMDA 1HSAA 1RJYA 3VG9B 5DVNA 1AP2B 5EO9B 5I16B 1AY1H 1OSZB 3NOIA 2VL5A 3TZVD 4LCWE 4FHBD 1MFDL 5DC0A 3MR9B 2HAZA 3MRLA 2QKIB 1NFIB 3PWLB 4KJQC 4LHUA 2CGRH 5T1LB 2HLFC 3QNZB 4UAOB 5DJXB 1U3HD 3BN9C 2GI7A 4AEFA 1MELA 2VDRH 4HC1A 1BLNA 1QFWH 1MREL 4S2SA 3FFDB 3EYOB 3N85H 3THML 5E9DA 4NFBA 5HGGS 1ORQB 2VKXA 2HG5B 4LLMA 4JFYB 4MJIB 4HWBA 3QEUB 3W39A 1XCTA 5FECB 2IBBA 4F7CA 2A0LD 1CK0L 1OGTB 4OBRA 5JTWA 1BFVH 1A5FL 1T1WA 4ELMB 3S4SG 4LSPL 4L9LA 1DN0A 2P5EA 1C16A 4RZCB 3MRQB 3DUSB 2J6EL 3PGCA 4F7MA 4DGYH 4JCMA 1OTTD 2DQDL 4DGIL 4K3JH 4ZO6A 1T04B 2X09A 2DQGH 4X6FA 4GAGL 1CE1H 4G6FD 2ZOLA 3NMEA 1DUYB 3O3AA 1GGIH 1CL7I 3MMEB 5E2WH 1T1XB 1FAIH 5C08D 3V0WL 3H6JA 3T3PF 4U1MB 4I9WD 3DRTA 1DQML 1YYMH 2W9DL 4Q6IC 2RFXA 1F4YL 4PJBA 2AJYH 2GSGA 5GJTL 1OM3H 1UB6A 2I60H 4ZUTB 4WTXA 1N0LA 1Y18A 4G6MH 4DZ8B 1S7WB 4YGVA 1MHHB 3KPNA 3D48R 4YHKH 2W92A 1R5WB 4LPUA 4X6EB 5ALCL 4EI5A 4ZAKC 1UYWL 4QOKB 1TJIL 3FO2A 1MCKA 4O9HH 3D2UB 5HYSB 4L3EE 2FEDD 4WIQA 3GIVA 4NQSA 4OFYD 3T8XA 5IP4A 4H25A 3MLTA 2YUWA 5ANMA 3NACL 3V6ZB 5DO2D 4PJCF 4BQ6A 1F42A 3WFZA 2VZ1A 3D18A 4C56B 2XZCL 3FT2B 3SDXA 4NJAH 3BZ4A 4PRIE 1VFBA 5HBBA 3U4BL 4Z7WE 1PKQE 5DK2A 1WFTA 4JFHE 4Q2ZA 5KAQG 3Q1SH 2CRMA 5HDQL 1KIQA 2Y06L 4KVNH 4TTDC 1HI6B 2GEEA 3WKMH 4TPRL 1HYSD 2UWEE 4PRPA 3VA6A 3ZTJH 4OV5A 1FNGB 3STZB 4XNYL 1WBZB 4KDTA 1NAMB 3ZHLA 3KPSE 5JPNB 3DX7A 3ARQA 4LSVL 2ZSVA 1H3XA 5I73B 5IB5A 2JJSC 5DHYA 5GHWH 5K9JH 1QFWI 5BRZA 1MFEH 2IBZX 1A6AB 5C6WH 1UM4L 2C1PB 5JIPA 3MUGB 1NGQL 3MRGB 4JFFB 2EC8A 1LE5B 2DQTH 4ZFGH 2C7UA 4Z5RA 4FXKB 2FD6H 2DQFA 2ZCKL 1MFBH 2P5ED 5FYJL 2K7QA 1G7LA 4U0RB 1CYGA 3MLSH 2W38A 4MJ5A 1TTFA 5AYUH 1CICA 3TA3B 2C5DC 3NH7L 3ZMRA 1LK2B 2OR7A 4OZGE 4YBQC 4FXGB 1I7RB 4IBLT 4W68A 3O6FA 3B3IB 3EJJX 5EFIA 3C09B 4WV1B 5B4MD 4YAQA 1Q72L 5CMAB 1MWAH 4HF5H 1N6QH 1NGYA 4OF8A 4KZEH 4AENB 1QSFE 2CMRH 1V3MA 5T3ZL 3GJFA 5BCAA 3CMGA 3LIZH 5DVKA 1KGCD 4LSUL 5AZEH 1D3CA 3PE9A 3SDCA 2FHBA 3PJSA 5HHVL 4P57A 3S4SB 5HD8C 3MRRB 1QLFA 3AXLB 4X6CE 1T2XA 4YWGL 4FABL 3JWDL 3UJTH 4UT6H 5HGHA 1VFAA 1JGUL 1S3KL 4OLVL 2EH7L 3N1PC 3X3FH 4MA1C 4X4YA 3U7YL 5I1CH 1G7PB 3N1FC 5J1SC 1MHPH 4C54A 4Z7UA 2EDNA 4ZTOL 4R4BA 3S37H 3CK0H 2W0LA 3U7AA 3VJ6B 1MJ7L 1U95B 4JVWA 4PP2B 4QRQB 2AVGA 3T2OA 4H5SB 8FABA 2ZPKH 2R0LL 3TH3T 1YQ2A 1O7VA 5CBEB 1N3NA 1ONQB 3NABL 3TWCH 3EOAA 5LGKA 1JV5B 2ZNWA 4M6MH 3LRHA 3ALPA 3TM6A 2DLFL 4U1KA 5EUKB 1JTOA 2Y36H 4WW2C 2VSDA 3LN4A 1ZLSH 3I6LE 5L6YH 1HHKB 1GIGH 4PRPD 4P46B 1DANT 5AG9A 3VA2C 4WCYH 3LRSA 3MLYH 2ITCA 4LFHG 2EEAA 4L4JA 5IB1A 4UUJB 3OKLA 3JTTA 3MRNB 5D7IE 1I1AA 3DROA 4NQUA 3LQZB 5BRZD 4F58L 1JHTA 3EO0A 3DURA 3O3BB 3RTQA 1WIOA 5DJ0A 5KG9A 4MXQC 3QFJE 4CN4A 1AQKL 2ZSWA 3RNKB 4YXHL 5E4EC 4FZ8H 3OX8A 2D4FA 4FNLL 2Y07H 1AGEA 3QNYA 4KK6C 4ELKB 1EPFA 4S11A 1X5GA 2DIBA 3E3QE 4JRXE 5C3TA 3V9FA 1CICD 5EDXA 4KJPD 5TH2B 4MDJB 5TQ2H 4HD9A 4YE4H 1EIBA 4HS8H 1G0XA 2CLRA 3O6FD 5D2NC 5I30H 1XZ0A 1AFVH 1MWAB 2GSIB 3N06B 1FVCA 4P2OB 3QRFM 1QLRB 3IF1A 4OFKA 1J1OH 5GS1C 1U92A 3LH2H 2DWDB 5DJAB 2ILLA 5K9OB 5F1SA 1FJ1B 4K07A 1PEZA 2P43B 2Z4QA 1AXSB 4JJ5A 1VERA 2X7LB 4U1JB 3VDCA 4PJ9B 1XGUA 4Y4FB 3IFPB 1SM3L 3J7HA 3P4OA 3OJ2C 1YNKL 2BSRA 5FA3B 3S37X 1AKJB 4OIIH 1ZEAH 3STLB 3MJ8B 3DUUB 2E5EA 3NGBC 1P1ZB 5TE4H 2ARJA 1TCRA 4QRTB 2W60B 5DD6A 3QIWC 4HFUL 4L4VE 3OR7B 3FONB 3NZ8A 4YXLH 3HLAB 3MV8B 4XCEA 4Y4KA 4WEBL 4D0DB 3AGVA 5JA8B 1MHCA 3BZFA 3WN5A 3OL2A 1P5VA 5IF0B 2E6JA 3MLUL 3L5XL 1JNNH 3ARDC 3VXPA 1R6VA 3Q5TA 4JO2H 5EBLB 2AW2A 3EUUA 4U6VH 2F19L 1KYOJ 3G5ZB 5JOFA 3P4LA 4M7LL 1DQQA 4FA8A 3T09A 5KSAD 3FRPG 1SJHA 3RTQD 1DVFB 5EOCH 1FZKA 5SWSE 5DK0A 4Y89A 2XZAH 5IVZB 3OQ3B 5HHXH 1RQ5A 1WTGT 4N9GB 2OMBA 1OCWH 3G08A 3ARFA 3WNLA 4YDIH 3K4ZA 2PKDA 3MJ7A 3LKSA 3GSVB 5IROC 2X1QA 5IHUH 5IVXE 5C07E 4DAGH 4NNPL 5M7QA 4FFZL 1T21B 1GAFL 4DW2H 4Z9KB 3EYSH 4LMQE 4LAQH 5FYLD 4ODHH 1N8ZB 4H88H 5LQBH 1NLDH 1L6ZA 2ICWB 4M8QB 2IJ0C 2D7TH 3ROOB 3VW3L 5DTFA 2XN9B 2EDLA 1ADQH 3R0NA 5D4QA 5LGJA 2A9MH 2YN5A 2PW2B 5DRZB 4OJFL 1RHFA 3PHOB 1S9WB 3V5HB 3BP6A 5LXGL 3QQ3A 4X0KA 4BQBA 3BH9B 4U7MA 1SBBA 3VH8G 2ICWI 3C6LA 4PJ8C 3WDIA 1BHGA 3FT4B 3QWOB 3ROLA 4LRNH 1TETL 3MACL 1FL5A 2DBLH 1UWEH 2XYCA 3QDJE 4G8IB 5E0QA 1M1SA 2EEBA 1OTUD 1XR9B 3VG0L 1CD1B 2GT9B 4RX4D 1QFWM 3SDDB 4MJ6B 4JZJB 1N0XL 4G6AD 4P3CL 5BS0B 3M8OL 3W9EA 2WANA 3SCMA 2WSKA 5GGQL 3FQUB 2X1XR 1QA9B 3GK8L 1ND0A 1KC5L 1V7NH 1D5ZB 1FNLA 4Z77A 1F13A 1FFNA 1EJOH 5D7LE 2RJMA 2Z31D 1JWUA 2ATKA 4MA7L 3D39D 1EHLL 1G9MC 3HFMH 1FNEB 4PJXB 5ITFB 5A2JH 1MIML 5EIIB 4LIQE 1D6VL 4K71B 3GI9L 4S1RL 2HFEA 1FFOB 1FIGL 3O6KL 4TRPH 3WFDL 3VFNB 4O2FB 4PGDB 3BKYL 5F7EL 5LWYL 3VE0B 5I9QC 4M7KH 1GGBL 1WICA 4JGMA 3F7VA 3HNVL 3RA7L 2OP4L 2VXUL 4RMSA 4E9LA 3C9NB 4HKBA 1BOGB 4TQEH 4PJDB 5IOPA 5MEOA 2VWEC 2QTEA 1UJTA 1U8LA 2YPLB 4TVPH 4GT7A 3X14B 1QBML 3ARFD 2HJLA 3AUVA 3D0LA 4DZBA 2BVYA 5CEYA 1I3GH 2GJZA 3HZMB 3U7WH 1HXYB 4YUEH 3PNWB 2B1AL 5F9JB 3REVA 1A0QH 2XA8H 4OD1L 1HWHB 4NZUH 1T0MA 1M7IB 5C2BH 1XIWD 3GSWA 5GZNC 5H35B 1K9TA 1V5JA 3UJIL 2PYEB 2FHFA 4GRWH 1ERNA 1LDPL 4LOUD 1BEYL 5F3BA 1IARB 4ODVH 3IKCB 3VRLF 2OZ4A 4M4RA 1FO0A 1K8IB 5HVHB 1U0QA 2VE6B 4XPTL 3HTLX 3KPOB 2V5SA 4XXCC 2D3VA 3TNNA 3FHQA 1DBAL 4R97B 3RGVD 2GY5A 5DD3L 3IJYA 3C6LD 4PLNC 3SE9H 5IFJA 1PQZA 3NZHL 4NKDA 4MCYA 2E9BA 2E7CA 5C0IA 4NQXB 3H2WA 4BSVA 3ULVD 3KR3L 1HZHL 3P0VL 4JFDD 1I85A 1L7TH 2HRPH 4PJFA 3FQXA 1IRAY 4OF6A 5JQHC 3Q2CA 2W65A 1KG0A 4YEEA 2NY4C 5HHPB 3UTZB 4WJ5A 1J0YA 5JW4Q 3PL6C 5L2JB 4O5LL 4DKEL 5F72S 2DJSA 3QG7H 4U7SA 3HZYB 3L3GA 3GNML 4XCCL 4IIQA 2OS7A 2XZQL 3X3GL 3OKYA 1X7QB 4G9FA 3K8LA 1BQLL 5GRUH 5L7XH 1CFVL 3RHWK 3QEHB 2G75B 1YEHH 2HJKB 3VH8B 1TZGL 2BC4A 1IGYB 1CDBA 4E41B 2NXZC 4FQIL 2H3NA 3HPLA 4N0FB 4CVXB 1NBVH 1O0VA 2EH8L 3BYTA 5GSRA 4HIJB 3MODH 4EUPG 3G6JB 4NPYB 2MCPH 2ZCHH 2WBJC 1T2QL 1IEBB 3QXDA 5M95B 5IJVA 5F1OB 4NKMA 1J7VR 3OF6A 5C0RH 4FQ1L 1ZVSB 2XTJC 3LN9A 5EOCJ 4F8QA 4M61A 4N0UA 4MJ4A 4XPGH 3CGTA 1IZJA 3T4YA 3HG1B 5D1QB 4MB5A 4HLZG 1WQVT 3HZKB 2VXVL 3MRIB 4UT9H 3TP4A 4NWUL 1AC6A 2BSSB 4QTIH 3PDDA 1D5BB 1F90L 1ZGLA 5MENA 2B8OT 3C08H 4P59H 4F7TA 3EDJA 3GMRA 2P8LA 3FAXA 2JJVA 3BP4A 3OXRA 5CLTA 4JGUA 2VLJB 3HR5B 4GRWB 2P24A 1K8DB 3BXNA 2BRQA 4EUPH 3C6SA 1OF2B 1BBJB 1V7MH 2P8PB 4HX1A 3VXSD 3G9AB 3KPRE 5IQ9B 3FO0H 3HB3D 1GOGA 4DKDC 5JIHA 5ACMA 4GOSA 4EDWL 3O3EA 2V7HA 5FO8A 4POYA 3F58H 3MFFA 2WUBL 1IM3A 2YPVL 3SHSA 5FOBB 5EU6A 3L3HB 3L3IA 4FP8H 3QBTB 2VDNH 4JO1H 3W0WE 5I75C 3SDAD 1KIPB 2GK0B 4HLZH 4FQ2L 4P2CG 3RU8H 2EDJA 2JELL 1WVZA 5BZWA 2VLRA 3RWIA 1JN6B 1JK8A 5C09A 2EO9A 3LSOA 1FPTL 4D0BB 4G7YL 3OSKA 2QEJA 4R7DA 3I3EA 2G9HA 1WT5A 4OZHB 4JB9H 2GHWB 1DLFH 3H9SE 5ENWA 3V4PH 4FQXA 3VRIB 4J2XA 1IC7L 2UY7A 3GBNL 2I24N 3WUWG 2P5WB 1EO8L 5I8KL 1AGDB 4G9FD 3DV4A 1JRHL 5HHMD 4V1DA 2CUMA 4YHMH 5CZXD 4N8VB 4RFNC 1A7PL 2CR6A 3RY5A 5BJTB 4GBXA 2J88L 4JKWA 4KI1A 5C0BB 1NDMB 1JHLH 4X83A 3PGDA 1YDPB 3IS0X 5DC4B 3RWEB 5I1AA 2AJSH 1JUFB 5DC9B 1FNSL 3TCLB 1RFDL 3HC0A 1A02N 1KBGH 3AS1A 5C2UB 5EN2A 4Y5XB 2MHAA 5IR1B 4OI7A 5FYKU 1WBYA 4YHNA 4PJXF 1N5AA 1M71A 4Y8DC 5I8CA 3GRWL 4KQ4L 3TVMB 4RGNE 3EHBD 3OF6D 4XP5H 2P42B 3MJ6A 1C5BH 2PTTB 4P4KC 3RWJB 1P6AB 4N9OB 3O11B 4LASL 4GG8B 3IDYC 4XNUH 3O2VL 3GBML 4XVJL 4YHLL 4Y1AB 1J0IA 2L7UA 2P45B 1PSKL 4FTVE 5BQ7B 5FB8A 1J0KA 4IEFB 2CLZA 5MEND 4PJDF 1FP5A 3WS6A 5I1KL 5LGHH 3TH2T 5CGTA 1NLBL 3QIBC 4IOSD 1BX2A 3U2SA 3HKFA 4OF7A 4EUPB 3MX0A 3BISA 2YA1A 4MD0B 5FKPA 4H26B 3GEWB 1VGKA 1A7QH 1YUHB 4DCQA 3NBNA 5DQ9B 5F7LB 1RZFH 5DS8A 4TOYH 5KTEH 4MA1B 1KPVB 3IFLH 2PXYA 3CFEB 5ICYA 1MAML 2EYTB 4D9RD 5C0AE 4TSCH 3NN8B 1KFAL 1KEML 5F1NA 2NZIA 3BQUB 2ADIB 2UUDK 2YS4A 2YD5A 2A83A 2W0KA 5AYQA 5D70L 5BW7A 2JK5B 1Y6NR 2VLRD 2AK1L 3D85B 1U9KA 5C09D 5GIRA 3EYFB 2HKFL 5J12C 1G6RH 2YPKB 4IDJH 5CD5C 1Z6JT 4IM8A 4KUZL 4PJIE 3P30L 2BK8A 1R3IL 4FQXD 5DMIL 1AD9B 1Z9LA 5IJKA 4WW2B 5J1AA 1CU4H 2O26U 1SMAA 2Q8AL 1JYVA 2B0SL 1ACZA 2FO4B 4PBWD 5IBTL 4I5BB 4MQSB 4NRZB 1JZ5A 4V1DD 3HE6B 5GJSL 4MS8D 2NX5E 2WV3A 4WI2A 2V5TA 3MGTB 4GBXD 4ACPA 2OSLB 3QPQC 4XVSH 4X9HA 3FT3A 2HP4A 3EJZD 4RIRA 3OB0K 5JW3L 1NCBL 3PDGA 2YRZA 1A3RH 4AZ8A 5SWZE 2Z35B 1E6JL 4R0LC 4MDIB 3IGAB 5JLZB 1AI1L 1NMAL 4I77H 3TN0B 1QRNE 2KQNA 5E4EB 3DUHA 4F9PA 2X1OA 1KENL 4QRRA 2M1KA 1DDHA 3WUWB 3M17B 3R1GL 4WHTA 2Y7QB 1TZIA 1JE6A 4PRDA 3D9AH 3GSXA 1T4KB 1U58B 2EZ0C 4X9BA 4GG6A 1BVLA 2CDGA 2F8VA 2HFTA 2GUOB 1A4JA 5TQ0H 3VXMB 3FB7A 3F7QA 4EOWL 3UTPE 3RL2A 2H41A 1EO7A 5D2NB 1GRWA 4JM4H 1KTDA 4ZPVB 3MV9D 5E6IB 3KJ4C 4E42A 5AAWA 2C1OA 5EIVA 3GUTA 5F96H 4OZIB 4KRPC 3DTXA 4WU5A 4WI9A 2HT4D 5CJOH 5GS1B 2X4TA 3I84A 1UB5B 3WCYA 4PJ7A 3GKWH 1CFSA 3TBTB 2HYMA 5C8JB 4A2LA 1BVKA 4NO5A 5CHNA 3MOQA 4KZDH 2KKQA 5HYEA 1T3FB 4YPGA 5EA0H 4OKVB 2PXYD 1AO7E 4KV5F 2VH5H 4GRWF 5ID1B 1IQWH 1UZ6F 4QRPA 1JF6A 3BT2H 3BH8A 4XPBL 3S34H 5IG7B 3O4OC 5DMGD 3I85A 4QRUA 4P2QB 4PGEA 3NGBB 4LDOB 2BVOB 3L7FB 3QIUB 1G6RB 1IC4L 1GCFA 4Z78A 3LV3B 3U9PL 1BJ1H 1RZGA 3CU1A 5FM8A 2WINB 3CDCA 2OK0L 4YHYB 3PWPD 1F6FB 3MLWH 3MOBH 4K2UH 3PDOA 1DEEA 4MNHB 1UQSB 3VRJB 4Z8FL 3ALXA 5T3XH 2J3SA 3ARDB 1U8PB 4OZHF 1G9MH 4PYHA 3TBSA 2OJZH 3TJEH 1MAKA 1B0RA 2C3VA 1EAJA 3MBED 1DBKL 2AABL 5EC1A 4P4RA 5ACZB 1TJGH 3A67L 3PIQB 4CMMA 4O51B 4S0SD 1YEFL 2VLLA 5B38G 1CDUA 4HHAA 5I18L 3DXAE 4EBQL 1QHPA 1U8JA 3VXUB 1YQVL 5F7DB 3V6OA 3CX5J 3AROA 1OVZA 4ZPTA 43C9B 3ETBF 4OUOA 2XKUA 1VKXA 7FABH 3HS0B 5HDBF 4ZUWA 4DFIA 1QBAA 1XF4B 4OGYL 1U8QB 4MCZA 2R0WL 1AD0A 3L7EB 4KJYB 5HXMA 5J0BA 3QEGH 2VAAB 4Y5YA 2E7LC 2C4XA 3LHPH 4U1LA 1E4KA 3STBA 4FQCH 4Q0XL 3KG5A 1GOHA 3RZCA 1MCFA 5DQJA 4ZTPH 1G9NL 5J3HC 2XZZA 2XFXB 2VN7A 2F54A 2NY1C 1CF8L 5E8PA 5SV4A 3BEWA 1S9YB 5F1IB 2V7NA 4BH8B 5ILTL 4U1SB 2G2RA 3WS3A 4HPOL 3ZLQC 1TJHL 2EKJA 3CFCL 4NQCE 1ZVHA 5ERWA 2LTQC 1OSPH 3DSFH 4L8SA 2D9CA 3KLSA 2FEEI 3ESUF 3RUGE 3VXNB 2QQKL 4Y19D 4QRPD 1RZ8A 2FLBT 2D0GA 4NP4L 2GW5A 2DKUA 1WCBB 1XFPA 5HY9B 3ZKXB 3FZUD 1I9RH 4PLKD 3T65B 3MV7A 1MVUA 5HDLA 4OFVA 3ZDZF 5HJ3B 4XI5C 3VXRE 3RIFK 3TNMB 3PP3H 4N8PA 1ED3B 1P9MC 1G1YA 1XGYL 1NMBL 5C08E 4G43A 4XMPH 2JCCF 4GMTL 4F15C 4HQQH 4HUMB 1YYLL 3AU1A 1UWGL 3GSOB 2A6JB 1J10A 1FFPA 3ARGD 2VR9A 4WUKH 1ES0B 5I0ZA 1MI5A 4GRLC 2ADJA 4WRLA 5A2IH 4NUGH 4X80H 1T5XB 2AXGB 2DS4A 3NCCB 4MAYB 1CFQB 2ZUQB 5BO1H 1MFAH 4R26L 5EU4B 4DEPC 5F21B 1M7DA 1FYTB 1R24B 4LP5A 3BUTA 1FSKB 5I9QB 3UMTA 4E5XB 1JCKA 4P5TC 3U30C 4HWZA 1UA6L 2Y72A 3Q3GA 1Q9OB 2NY5L 3P0YL 1T6WA 5ISZB 4A6YA 5IGXH 3FO1A 1DQDL 3VGFA 4QXTA 1QEWB 3ULUE 3MROB 2XKNB 3CFBA 4PJCA 3KPPB 1RUML 3O2DH 2AK4B 2X1PA 5EBMA 2F5BH 3BSZL 3EJYD 3UDWA 1IGFH 2I07B 4ZYKB 4HT1L 4HPYH 3QI9D 3W5NA 2J8UB 5IK3A 4WDIA 1IEAA 1KCRL 1B4JH 4NN6C 4KY1L 1H3UA 4XCNB 1BJMA 2ADGB 3P2TA 5E9DE 1P7KA 1I1YB 3KXFA 4MQXC 1KELL 4NN7C 2BNQD 4I3SH 4N0YH 4C4KT 3MZGB 2D7QA 3CUPA 1MLBB 2VR4A 1ZHNB 1CGXA 2IPKB 5C3LD 3F7YA 1SY6L 5TDNB 3T3MF 1F5WA 1S9VA 3WFBL 3HAEG 4ZUVA 15C8L 5SX5H 2WUCH 4LNVA 3K3QA 2ZUUA 4X99B 5HGBA 4K9EC 1BZ9A 2B4CH 1WIPA 3KYOB 4LEOA 1F4WH 3PL6B 4N8CH 5DI8A 4GW1B 3PWNA 3MV7D 2R9HC 3ILPB 1CD9B 2HFGH 1JTPA 1Y0LA 4XH2A 1FL6A 1P4IH 1KCUH 3O9WA 3IJHA 1BJ1J 5ADPH 5JPMA 3L1OL 1DFBH 1WZ1L 1KJ2A 3TBWB 1JPFB 4JM2C 1SEBA 4K8RL 1CLZL 3WHE1 4APQC 1QKZH 1T1YB 4PJ5A 4PJBE 2G5BB 3L5WA 3RIAK 1G7QA 1JWSB 1MFNA 1IGCL 3UTTA 2DQUL 3E3QC 1MI5D 4WW1B 4YQXH 4HK0A 5DGRA 1XGPB 1MUJB 4MLSA 3SN6N 3RPKA 2Z91A 4KTYA 3HAEH 2YD3A 1EHXA 1SJEA 4ORGA 2WBJB 2HLAB 3NCJL 1RULH 3BP7B 3BVNB 5ANME 4AM0A 4BZ2H 3GMLA 3PWUB 4GKSA 2XTJB 3MOAL 2YWYA 4NJ9L 4PS4H 5J89A 3ZHKA 4QGTA 4M43H 4X5XB 3L6FA 2OTUB 2BJML 1D9KC 1KCSH 4U1IB 1YEIH 1AE6H 5E1HB 3S36L 1Z0NA 2OLDA 3TPUB 4L4TB 1O5DT 5TE6L 1HINL 3QAZC 4H0GA 1SYVB 3LS5H 5DLMH 2BY0A 3MRJA 2XWJB 2Z8VC 4RA3A 5F3HA 2JJWA 1CFTA 4PRPE 2R1YB 4GKZB 3RVVD 1PY9A 4IRZL 1MJ8H 4XNQB 3TIEA 3KPQB 4X6DB 1LGVA 1X9QA 2EYRB 2Q86B 5TPWL 3KXFD 5IMOB 1AP2A 2FDBP 5EO9A 5B21A 1EAPB 1OSZA 2D9QB 4RGOH 4DK3A 1J18A 1Z3GH 4Q97A 3MR9A 5E2UH 5T5FL 4NFDA 5FK9B 2QKIA 1NFIA 5DJYB 5EU3A 5FV1L 5T1LA 5I75B 1CZ8L 5IBLD 1E6OL 3QNZA 1A3LL 1UG9A 1EUUA 1JGVL 3EOBB 4OV6F 1G9EA 3LKPB 4POZC 2AQ2A 3FFDA 4R7NB 3EYOA 2DLGA 1UM5L 1ORQA 5T33L 2CK2A 2HG5A 4LNRB 4JFYA 5A40E 5I1DB 1UH2A 2V2TB 3QEUA 4HCRH 3KLHC 5FECA 4JQXC 3QQ4A 3MLZL 1IJ9A 3AS3A 3MXWH 2DL2A 2X05A 1OGTA 4JPKL 4KXZH 5TDOB 2AXFB 3QISA 5FYKD 3QDGB 1YJDC 4EEEA 4PJ5D 4G6KL 2V5MA 2YMXH 3D3VB 4RFNB 1MCOH 2ARJQ 4RZCA 3UTTD 3MLRH 1CE6B 3DUSA 2D0HA 3MA9L 3OG6B 3UP1A 2FJGB 5DT1L 4ONFH 2AQ1A 4GH7B 4XP1L 3TFKD 5KVDL 4WENB 1T04A 2J8HA 3HAEB 1DUYA 2I26N 3MMEA 5JHLL 1T1XA 2VC2H 4YNYB 3V7AE 3WO4B 4CVZA 1HILB 3OJDB 1U3ZA 3UTSE 1LVEA 5FUZH 4MD5B 4PJHB 5L8KB 1ZSDA 3EOTH 5BV7H 4P23C 4P4KB 2KZ1B 4ZUTA 5DEFA 3MA7B 3NCEB 1S7WA 1QO3A 3WIIH 3BKJL 3ZTNH 1R5WA 1S78C 4X6EA 3C5JB 3B8SA 2X9XA 4YFLF 4EQ2A 2VDKH 3KDMB 3VGAC 4NHUB 3D2UA 5HYSA 3RY6A 5ITBH 1V8HA 35C8L 1FBIL 1DJSA 2D0FA 4Z7NF 5J6GB 3QIBB 3LMJH 3LS4H 4IRJC 1YEKH 4HXAH 1PAMA 2D7MA 4C56A 2X41A 3B9EA 2F58H 3FT2A 1EK3A 1CXKA 3VFPB 3CVIL 1HNGA 1MCCA 2ZJSH 5HHQB 3GBLA 3B5GA 1DE4B 4UNTA 5F89B 4HH8A 2J8UF 3V5DB 1OAXH 5T3ZE 4G42B 3TZVB 3C8DA 3MNWB 4YHPB 1IGIH 5FUOL 4ZXBA 5EZOH 5T1LD 1HI6A 2VDQL 5DR5L 4IMKA 3QDAA 1WAAF 3Q0HA 4EKXA 4KAQL 1DQLH 2FWOA 2IMMA 5IB4B 3VMNA 1FNGA 3STZA 2CQVA 1WBZA 3DMMC 4OCSH 1JNHB 2O61B 4RMQA 4MJID 1CGUA 1MHEB 2WBWB 1W72L 4MX7B 3V4UH 1PG7L 3BO8B 3K8KA 4XWGL 5FYLE 4DFHA 4FG6D 3JWOC 1A6AA 1NC2B 3B83A 3MUGA 4JFFA 1OP9A 1LE5A 4UDUB 4FXKA 1KB5L 5DXWA 1QSEB 4WI6A 4OLWL 5F6IC 3BDYL 1A9EB 4LK4A 5HHOE 3H0TB 3P40A 4HJJH 3LQAH 3E6FB 4S1QL 3S88H 1FZMB 3TA3A 3G6AB 1CVRA 3QDME 4I4WB 4K94H 3ESVF 1LK2A 3IDIB 4R0LB 4YDVA 3VXTB 3QO0B 1UWXK 3MNZB 4HJGB 5HYQB 4XBEH 5L88H 1I7RA 1BGXL 3RAJH 5GXBB 2DYPD 3B3IA 3W5MA 1LO4L 2FZ3B 4WV1A 1YEJH 4Y0GA 1INDH 1EXUB 1OGAA 1Z9OA 3U48A 5CEZH 3SKUD 5CMAA 4UI2A 3HC4L 3TIDB 4AENA 3CU7A 2QQNL 1I7UA 4M1CD 4AG4L 1G7MA 3S4SA 2OBGA 4CVUA 3MRRA 3AXLA 5BVJB 3IDJB 5KJRL 1P7HL 3CFKB 4QOKD 2Z8SA 1J1PL 3B2UC 1LO2L 2X4OB 1G7PA 3MNVB 4D9LH 1VPOH 3CAFA 3AM8C 4KRPB 4LCWB 4ZS7L 4XP4H 1BOYA 5GGTH 4NN5C 4HFWA 4LU5H 2CJUH 3VJ6A 3NTCL 4AIZB 1U95A 4PP2A 1OAUH 4C56D 4NHCL 1N64H 1QFUL 4QRQA 5EC2B 3GMQB 2OX5A 4H5SA 1AC0A 1DR9A 2F53D 3AREC 1ONQA 1CGSL 2APXA 4U3HA 2HFFB 2E8YA 1KB9J 3VGBA 1JV5A 3NAAH 2EDKA 2VLKE 4X6DF 3KYKL 5EUKA 3O4OB 5IW1A 3OXSB 4RCAA 1T03L 5C0JB 2MKWA 3QULA 3FN0L 4P46A 1T6VN 3WUZA 1CDHA 1DBMH 1S7RB 4H1LH 1OW0C 1QBLH 1CD8A 4XXDB 4UUJA 1ZANL 2FX7H 4NWTH 5IMMB 3MRNA 3ILQD 4QLRA 2WP3T 4WY7H 4F37F 1UXSB 1OD9A 3LQZA 3UYRL 1IGTB 4KKCD 4JFFD 4M6NH 3O3BA 1EEUA 2CR3A 1GSMA 2IAMC 1GZQB 4XPFL 4D3CL 1QOKA 4BSJA 1MIEL 3BGMA 4KROC 3RNKA 4AMKL 1RMFH 3SKNB 2VB5A 5F70A 1XF5B 4PIRF 1IGJB 4HGKC 4WWKA 5GRVK 4ELKA 4G8GE 4PR5A 4J6RL 1U8MB 2RCSH 2W07A 5I74C 3TA3D 4RAHA 4J23A 2HWZH 1RZKL 2VDOH 3IXAB 4GMSH 5I19L 2QLVB 3BMVA 4FQHB 2W91A 1RK1B 2XG5A 2UY6A 3B9KB 4XC3H 3C2SA 4KGLA 3I6KB 1U8NB 4NGHL 4HIXH 3CVHH 2RB8A 3CSYA 1MWAA 2NW2B 5JQ6L 1J8HB 1KEGL 2R69L 5E8DH 4N90E 1KJVB 2GSIA 3QUZC 4LLVB 5ALBL 3RPIA 4P2OA 3D25B 1QLRA 4MB4A 2RBLA 4MVBD 3SGDH 5E70A 4DN4L 2P7TA 4UILL 2DWDA 2QQQA 2COQA 1FJ1A 2XY2A 3MRCB 4YHOL 4HS3B 4DN3L 1H9VA 2VLMD 2X7LA 3L3OB 5CWSB 4PJ9A 4Y4FA 1YEGH 3IFPA 2NY1B 4WI4A 5HYIA 4O4YL 1MY7A 2R4RL 1WZKA 5FA3A 1AKJA 5MEPB 3STLA 2DMCA 3MJ8A 3DUUA 1EVTC 5I15H 4OM1H 1YY9D 5E99H 1P1ZA 1J0ZA 1M4KA 2LTQB 1CGTA 1DL7L 1FGVH 4QRTA 3OPZH 2W60A 3QCTH 3F6IA 4OZFG 5DUPH 1G0YR 4JR9L 3HLAA 4U49A 3MV8A 4K7PH 1JI2A 3KPSB 2ZG3A 4ODTL 4D0DA 3LZFH 1N5YH 2JIXA 2X89D 1AR1C 3LDBC 2EC9U 2OJEB 4Q9BA 4K9EH 5E2TH 4YX2H 5IF0A 4L3AA 4P46D 1B88A 4X7SH 4H1LB 4L1DA 5BXFB 5EBLA 1LO5B 1OP5K 3V4VH 3QEQD 1FC2D 4ZQKB 3BE1L 4RGNC 2X9WA 1MCPL 3TV3L 4JY6A 2GFBB 2YSSB 5DDHB 4Y2OA 4WTWA 3LOWA 1DVFA 2EDQA 3V6FB 3W2DL 1F58L 4OZGB 2W59A 1FNFA 4CW1B 4N0CC 4DEPB 5IVZA 5I6XC 2KDGA 3MLXL 4N9GA 4JKLA 3GSVA 3ULSB 3IRPX 2HVJA 5J56B 4Z0BH 1FG2B 1QSFB 3U30B 3IU4H 4J3VA 1T21A 3GHBH 5BOPA 1I9IL 3QCUL 5LCVH 1N8ZA 1KIUA 1QVOB 3CVHB 4PREB 2BCKB 2ICWA 4PJFE 2IG2L 3CJJA 3CFDB 3GSNH 3ROOA 2XN9A 2BP3A 3P11H 5C0NC 3FKUS 1N6UA 2FCBA 4LLUB 4P2OD 4UTBL 5CUSL 3SQOH 2G5RA 3UPRB 2SEBB 5DRZA 1NCAH 3PHOA 1S9WA 2ZUTA 1HN1A 4OGXL 1RV6X 3V5HA 1U6AH 2IANE 1JGEB 5CP3H 3BH9A 2YUVA 4OSUH 3QPXH 1MRCL 3JZ7A 2XXCB 3QUXC 3FT4A 3OJMB 4NN6B 4PJ9D 2DQHH 1OAQL 1HSBB 4PV9A 2O5YH 4B7LA 1VADB 4ZUSB 2OMNA 2IALB 1TLKA 1JTTA 1S7SA 1B0GB 4G8IA 1Q0XH 4ZOCA 1ZS8B 3CFJB 2DQCL 5FUCE 1N4XL 2BFVH 1A6VH 2R2BB 4NO2B 4LARH 4L8CA 4NM8L 4OQTH 3KGRA 1CD1A 2GT9A 3SDDA 1MCBA 4MJ6A 4JZJA 3RKDD 5FHAL 5BS0A 4OFPA 2HTKD 5GGSA 4K7PX 3FQUA 4MHHG 2Q1EA 1T7ZA 4O2CB 1OD7A 1OP3H 1LO3L 5D7IB 4N0UE 3CSBA 1S7XB 4M5ZH 5DUML 4CMHB 2ZG1A 5GSVB 1FNEA 4PJXA 2R1WB 2IBZY 5GGVL 5ITFA 5EIIA 2YD1A 5LVEA 5E4IA 2F15A 5DJ8B 3RHWF 3FFCD 1FFOA 5I2IB 1YEDB 4JM2B 3VFNA 3NIDF 4JPIB 4JKMA 4O2FA 2A1WH 4RISL 2Y6SC 4JFZL 4LGPB 4PGDA 4W4OA 4P2RE 5E94B 4APQB 1MPAH 5MENE 3VE0A 5ICXB 1FRGL 2X9YA 5JW4R 1I1CA 1R0AL 2R4SL 4OCWH 1BAFH 2R0KL 5KSAB 1PFCA 1KCKA 3C9NA 5LJYH 4KVCL 1BOGA 1NAKH 4PJDA 4B5EA 1A7RL 2YPLA 5KSBE 1UJ3C 3X14A 1A14H 4ZFOL 3BKCH 4J1UB 4J3UA 1IM9D 2MOVA 4I1NB 5EU6E 3LRGA 3HZMA 2AS5M 1HXYA 3O8XD 3PABB 3MRPB 2XT1B 3PNWA 5F9JA 3EKCA 4CN1A 1F2XK 3GSNB 1NEUA 1M7IA 3QWQB 1NBZB 5C09E 5H35A 1ADQA 1ZHKB 1D9KB 2XN9D 3IYLW 2PYEA 4HUVB 1DLHB 3GI8H 3IKCA 4KPHL 1K8IA 2QSQA 3FRPA 5KW9L 5MEQB 1MH5B 2VE6A 4UIMB 5JZ7C 3QAZB 2H45A 3WIHH 2R39A 3O3DA 3OKMB 3KPOA 5DJ6B 4DVBB 4GW4B 4Y2DC 5EOQH 4NZTL 4TUOB 4NQXA 4L4VB 4BZYA 5GZOC 2DI8A 4NZRL 4Q74A 3SBWC 4P9MH 5GS2H 1OPGH 1NPUA 2FHCA 4Z7OE 4O02L 3ULVH 2VDML 3HMXL 2A73B 5GRXG 1RUKH 2XA8L 4GKOA 5FGBC 3UTZA 5HHPA 5L2JA 3IS1X 3TYFB 4FFVD 1INEH 2H26B 3HZYA 3N1QC 4N1EA 5BS0D 4DVRH 4RFOL 2A9NH 4XP6H 1X7QA 1S5HB 1KN2L 3SDXF 4CNIB 5IFHH 1B6UA 3QEHA 5KS9B 2G75A 4Q9QL 2HJKA 3DIFB 1XCQA 3VH8A 3PGFH 2G60H 2B2XL 4BQCA 3MGOB 4E41A 4AY0A 5ACLA 2CLVB 3EFFB 4N0FA 1L7TL 5JXAH 4CVXA 3VD4A 3DI3B 5SWSB 3MRBB 3JWOH 5SX4I 1F00I 4YDLB 4NPYA 2J5LC 3GJFK 5FKAB 4BFIA 2CKBL 3VFTB 3KNBB 1IEBA 1CWVA 5IVXB 3TC9A 5C07B 1EHAA 3I6GB 2O5ZH 1ZVSA 2QADC 3BZEB 1GC1L 4KJWD 5C6TL 4GQ9L 2VDLL 4LLDB 2YOCA 3SGKC 3HG1A 5D1QA 4XRCB 2J1KA 4XMKH 2GITB 3ZKND 4MQ7B 3HZKA 3MRIA 1FLTX 1CIUA 5IW6B 4NKIH 4PFEA 1D5BA 3FOMB 5HI5D 2JB5H 2BY1A 2QBWA 4P23B 1F4AA 1FLRL 1JHKH 3HR5A 3H42L 1K8DA 4LCIH 2J4WH 5CINH 1OF2A 1BBJA 1NCWL 2P8PA 1I8LC 1XIWB 5E6YA 3M07A 3QXTA 4NKQB 4IOIB 5IQ9A 4KMTL 1A1OA 3FQRA 2VUYA 3VGAB 1NL0L 4JG1H 4Q58C 1J5OH 2GCYB 2ZUSA 2KQMA 3FRUB 3IFNH 4JFPB 3O6LH 5FOBA 4ODUB 4LQ1A 3QUML 1LK3H 3L3HA 2BNUB 1LEIB 2X6MA 5A1AA 2PR4H 2JE8A 1JZ7A 4CU8A 1CDJA 1HIMH 4PRNB 1KIPA 2GK0A 3U4AA 4KTDH 3DVNB 5BVPH 1KT2B 1JN6A 4JFDB 2WZPD 4LPTA 4R90H 4D0BA 1WITA 1YEEL 1BPVA 1DSFL 3QJHA 4OZHA 5D7LB 3VWKC 4BKLB 3VRIA 1A7OL 3KJ6H 4KJQD 1MNUL 1C1EH 2HLFD 5IKCB 2P5WA 3BN9D 3O6MH 4BH7B 4UB0H 2OI9B 3JBG7 2AEPL 1AGDA 1SJVA 4PB9H 4WFFD 2ADFL 1FC1A 3MLVH 2AV7B 4QRRE 3DMMB 1YJDL 4UQ2B 2DLTA 4JFEE 4N8VA 2IGFH 4EXKA 3FQWB 3ABZA 4F33B 3G6DH 4E41D 5ECJE 5C0BA 5IV2B 1NDMA 1RVFH 1ODAA 2AXJA 2JJSA 4JQVC 4GG6E 1YDPA 4DWHA 4J4PA 1GPOH 1RZJC 1MOEA 1UXWA 1L0XA 1JUFA 3ZSSA 3C5SB 4Z0XB 3ULUC 3BIBX 4OLZH 4Y5XA 5IR1A 1YY8B 1NGPL 3LCYA 3TVMA 4HDIB 1QZ1A 3T4AB 4URTB 5AZ2L 1ZA3B 2YHGA 2PTTA 4I2XB 3ZDXE 1KXVC 4POUB 3RWJA 1FE8H 2YKLH 2FB4L 4YDKL 4TVPD 3HG1D 3O11A 4HBCL 4WUUA 5F9OL 2LABA 1RIHH 4GG8A 3SOBH 4Y1AA 1JNJA 4NC2B 3S5LG 2FJFB 4YZFE 1BFOB 3PG2A 4HUNB 3Q6GH 1A8JH 4H0IA 3T04D 3QDHA 4EUPA 3R8QA 5TE7H 2VLJD 4JG0L 2VTFA 1CFNB 3DWTA 4GXVH 4MD0A 4H26A 4CN6A 5ESAB 1YUHA 3VXSB 5IHZB 5DVMA 5I8OH 1T66C 4IS6B 3KHQA 5GS0C 5HI4C 3CFEA 2QQLL 2EYTA 4KI5E 4OI9A 3NN8A 3P9MB 3FOLB 4K3DL 2FL5B 2NY7H 1F4XL 3BQUA 4NN5B 4FQQB 5T1DH 4CJ0A 2ADIA 1K85A 3T1FB 4JFQB 2W9EH 2VXQL 1YPZE 2JCCA 4MWFB 4RSVA 3WSQH 2F9BT 5HYJD 2JK5A 4AL8H 3AREB 5KVFL 4LIQL 1MEXL 3EYFA 4RAVB 2YPKA 4ERSL 3EYUH 2EE3A 4K23L 4O2EB 2JTDA 4W70A 3VFSB 4AEHL 2X4NB 3DO7A 1AD9A 3RVWC 5GGSY 4U05A 4TTDD 4TNWK 4YLQT 2P5WD 2FO4A 2YBRB 5C0FA 5C92A 3F5WB 3V6OE 3BKML 4EI5C 4MNQD 4WFEE 4EDXB 4GKNA 4RWYL 2YRLA 4NRZA 2DM7A 3E1F1 3C8KB 1WEJL 3HE6A 2PNDA 3MGTA 2VDPL 5GRJL 3BX7C 5D1XC 3GJEB 2E3VA 5L9DL 5C0BD 2OSLA 5HPMB 1QYGH 1QQDB 2Q3ZA 4M9PA 5F7NC 5CEXB 5CZVH 5KS9F 2Z35A 2CK0H 3QQ9D 3IGAA 2IAMB 5JLZA 3TT1L 4KROB 4NNXB 2A77H 2F54E 3TN0A 3JV0A 1JPTL 3WUWA 4RBPK 4CDGC 1R3HB 3S9DB 2Y7QA 1UVQB 5I0DA 1Q0YL 5I74B 1JFQH 1U58A 1RK0A 1EEYB 3VXMA 4YBQD 5KSUB 3LVEA 3BUYB 4JKPH 2EIZB 5D2NA 4Y1AD 3KPRB 5DJZB 5E6IA 3QUZB 4OZIA 3UJJL 2CD0A 3U0TA 1EBAA 1VENA 2I27N 4KKNA 3FMGL 4X7FC 2PYFB 3OWEA 1UB5A 3GDBA 5HD8D 4IMLB 3RGHA 2B20A 3MJ9H 3W0WB 3TBTA 3O0RL 5C8JA 2J7LA 1PX3A 4QCIA 1F8TH 2A6IB 5CSZB 1T3FA 5CCKH 1PW3A 1Q9KB 1MCDA 4OKVA 3SE4A 2BXZA 2H1PH 5ID1A 4BJLA 3VFWB 4M7ZC 2FLRT 3BQUD 2M26A 4S1DD 5TF1L 1LO0L 3H9SB 4JZNB 4GLRH 1IT9H 4K3EL 3T3PE 5IG7A 3OR6B 1NCDL 4P2QA 1A6UL 3WFEL 1GGCL 4G9DA 2BVOA 3D85D 3V8CA 1X5ZA 3QIUA 1G6RA 3LV3A 2FEEL 2WINA 4ZD3L 1X5YA 3SO3C 3P3YA 5E95B 4JDTL 5ADOL 2V17L 3S98A 4XNXH 2DIJA 5J9PB 3ULVF 5BMFH 3LDBB 1UQSA 4MNHA 3VRJA 4DGVL 3SDCC 3FN9A 5H94B 4AQOA 4LSSL 5L0QC 1A4KB 1U8PA 3VFGL 4BYHA 3HE6D 4PJCE 3UYOD 1WTLA 4XCFH 2H6PB 4WHYG 4J7RA 3LEYH 3U0WH 1J86A 4QHUB 4AIXA 4M62L 4M1GL 4RGNB 5ACZA 5J06A 1IC5L 3PIQA 4NO3B 3KHOA 1NCCL 2VXSH 3MCG1 3W11C 3QHFL 3OV6A 3HUJE 1B90A 4MXQD 1ZK9A 3VXUA 5F7DA 3FQTB 2O5XL 3JV6B 3UAJC 1OL0A 43C9A 4CUCA 4I8DA 1YZZA 4FTVB 5EWIL 4KK6D 3HS0A 2EE9A 5IROA 5ESQB 1XF4A 4HW6A 3L7EA 1I1RA 4DKFH 4XNMB 4B41A 3LPGA 1TVDA 2VAAA 2N7BA 3TYGH 2FBJL 2BDNL 2ARWA 3BIKB 2XNAB 3OAYK 4NDMB 5FCSH 2XFXA 1I1AC 1MCIA 5JXEA 1S9YA 4MD4B 5FCUH 4BH8A 4J3SA 4U1SA 3UO1L 4S1SL 1ZLUK 3JVGC 2HA1A 3QHZL 4PB0H 3QUXB 4AEEA 4I3GA 4F57L 3VXNA 5C9KA 4NCDA 4PRAB 3KPMB 3AMKA 4JPWH 3MUY1 4PJIB 2H2SC 1CS6A 4LSTH 5DRXB 2XWTB 4P2QD 1WCBA 4J8RB 5HY9A 4JO3L 3U1SH 2YXFA 2AI0H 5F7UA 3TNMA 4LPYA 4OD3H 1ED3A 1X44A 2KL6A 4BFEA 1XT5A 2NX5B 3DX6B 4G5ZL 3VFOB 2Q8BL 3PWPB 4RA0C 2AP2A 3GSOA 2A6JA 3BGAA 1IBGH 3WHE0 3ZZ1A 5EORL 2Y5TB 1ES0A 1MRFL 4NNYA 4YC2C 3ARDD 3F8UB 1EFQA 1RUPL 1DBJH 4Z7VE 5SWZB 2BX5A 2GK2A 1EGJL 1T5XA 2AXGA 4MAYA 5CILH 6FABH 1CFQA 3DGGB 1U93B 1GVIA 1UCBH 5EU4A 4YHZL 1QRNB 1FYTA 2NY3B 1R24A 4ODBD 3MBEB 5CJXC 5J11C 1NBYA 5EO0B 1F3DJ 3RVTC 1ZHLB 1Q1JL 1CXHA 4P5MB 1Q9OA 1ZT4B 5ISZA 1YMMD 5D71H 3DGCR 3VXUD 2AEQH 4KWUA 3MCLL 2IQ9L 1QEWA 5C7XL 1MFCH 2VOTA 4JREB 2XKNA 2BVTA 4Y4KC 1UJ3B 3RKPA 3KPPA 4MXVF 4Z7QE 4DTGH 2AK4A 2E7HA 1A6WH 2PCPB 4FS0A 1U8HB 3C8HA 2ATPB 2I07A 1A7NL 4ZYKA 4PV8B 3HI5L 1UACH 3N9GH 2J8UA 4OZ4A 1VFOA 5HVFB 2IFFH 4FQLH 1H3TA 4OTXH 2ADGA 1AO7B 1I1YA 4HXBH 1S7TB 1I7TB 4PTTB 1TVBA 4PRHE 1WAAA 5JXED 1MLBA 3EFDH 4GAFB 3MBXL 1TZHB 4XXCA 4NKOB 1QFOA 1ZHNA 5D8JH 5CLWA 1MRDL 2NQCA 4C55A 2DN7A 2IPKA 4PJ8D 4XX1E 5TDNA 4Q9RH 5JDJA 1E0OB 2L4OA 4OLYL 1BIHA 4JRWA 1ITBB 3HNSH 2FECI 1OAYL 3MO1B 2AV1B 5DQDL 3VD3A 3KYOA 3OZ9L 3PL6A 4HMCA 4GW1A 1PGRB 2DLHA 3GMPB 4NM4L 3ILPA 4QO1A 2IH1A 1DQJB 1OARL 2H8PB 3MXVL 3HI6H 2X44D 1CG9A 3CLFH 4YXKH 5ICZB 4X6BB 4TUJA 3MREB 3KS0H 5KVEL 3TBWA 3WLWC 4ISVB 1JPFA 2EC9T 4F9LC 1LE9B 1T1YA 5T3XD 2G5BA 2EDXA 3N50A 5HGDB 12E8L 4LSQL 5AUMA 2I5YL 3HRPA 4UTAL 2XRAL 3K2UH 4S10A 1LEKB 1XGPA 3DXAB 1CDGA 2EIBA 1I8MB 4HIHB 2GJ6B 5E2VL 1RZJH 3FHAA 4NQVB 4UT7H 9CGTA 1FDLL 3I2CH 1CXLA 2J5LB 1EMTH 1FYTD 4KHXL 3E0GA 2NMSA 1N2RA 4OCXL 2B4CL 4MNGB 3EZ8A 2CXGA 2HLAA 3BPOC 3H3PL 3BP7A 3NFPB 3BVNA 3WFCL 4RNRB 3TO2B 1WIUA 4M3JA 1YMHB 1JI1A 3PWUA 4MZ3A 2QADB 4FFYL 5ISZD 3JV4A 4G80B 1NGWB 4X5XA 5IM7A 1S8DB 2OTUA 3OKKB 3SY0A 4DQOH 3O2DA 3SCMC 4R8WH 1N7MH 5FO7B 3WD5H 4KTEH 2FATH 3TPUA 3WO3B 2HKHH 3CMOL 1ZGLM 2DQEH 2XQYK 1SYVA 5EBWB 3ZL4L 5J13C 4WU7B 2XWJA 3HE7C 5EZIL 5CKAA 4YFDB 4TSBL 2R1YA 4GKZA 3UC0L 4NQCB 1U2CA 1QLEL 3EYVB 4XNQA 2D03H 3KPQA 1OOAA 4X6DA 1HHJB 1P84K 2EYRA 2QSTA 3MRDB 5I1JH 2Q86A 1P5UA 2LU4A 3M1BB 1XF2B 1IAIH 5IMOA 4RMRA 3SDYH 1KSRA 3F7PC 2BNQB 4NT6A 3RI5F 5F9AC 1FFQA 2KBGA 4XPAL 5DWUL 1KCVH 5GS0H 1QHOA 5FDYA 1EEQA 1JNLL 4LVNB 1RIUL 5DJYA 5FK9A 1B2WH 4UV7H 4QXGH 2WNGA 1H5BA 4HWEH 4OLXH 3VXRB 5D72H 1MF2L 5I1GH 3OKEA 1IC1A 3EOBA 5IFAH 4U31A 4KH2A 3LKPA 4OCYH 1L7IL 4N1CA 2YD7A 2EXWC 2VISB 4NUJB 5KN5B 2NY4D 3VWKB 3S8WA 3PL6D 1P4LB 4LNRA 5I1DA 2V2TA 1MFDH 1YN6B 2VAJA 5I17B 4OBSA 1UM6L 2IWGA 3WXVL 2D7PA 5H37H 5FHBL 2WIMA 4KRNA 3KLDA 1NCNA 3QDGA 4LSRL 2XV6B 1OGAE 3SGJC 4U3XA 1MREH 1RUQL 3DHJA 3D3VA 1ZMYA 3JWNC 3THMH 4TUKL 1CE6A 4NQDD 2FJGA 2NXZD 1I3UA 4M5YL 1W0VB 4XAWL 4R4FL 1HH9B 1T7YA 3HAEA 4X4XB 5FO9B 3WV0A 4RFEB 4UU9B 5E1AB 3DPBA 2L0DA 1CK0H 4KK8C 4KU1A 3B9AA 3U46B 4YNYA 2WBJD 3T0EA 1HILA 3OJDA 2Q87A 2YK1L 2BNRA 1A5FH 4MD5A 4LSPH 3BN3B 3BI9X 2XTJD 3R06B 2J6EH 4P4KA 2YD6A 2DQDH 3MA7A 4JRYD 4DGIH 5JA9A 1M05B 1S5IL 2VABB 4GAGH 3C5JA 4NO0B 4KMLB 1JWMB 3KDMA 2FX9L 4NHUA 5TFSL 3V0WH 2QV2A 4L4TD 3EO9L 3QYCA 1GYAA 3GSRB 1DQMH 1ACYL 1F97A 1PBYA 2W9DH 2MQCA 5J6GA 4UV4L 3B2VL 1F4YH 1KULA 5IWLA 1VACB 2BMKB 3S96B 5FUCC 5GJTH 3GO1L 3IDGA 3VFPA 1EZVX 3PXHA 4U1HA 3V52L 5ALCH 3QRGL 2ORBL 1DE4A 5IQ7L 1UYWH 3JUZA 5F89A 1TJIH 3ELAT 3L9RB 3TPKA 2UZIL 4G3YL 4G42A 3TZVA 1OQXA 5D7JC 4YHPA 3AC0A 2EDRA 3NACH 3U4EB 1IAII 3OJVC 5B39G 1AJ7L 2XZCH 5IB4A 3T0VA 2OR8A 3ARZA 1X5HA 3U4BH 4QTHB 1RIVL 2PTUA 4Y5VB 1JNHA 2O61A 4RGMC 4HCRA 2UYLA 5HDQH 1MHEA 1CLOL 3VRLE 2Y06H 4U1GC 5A2FA 3BO8A 3AY4C 3KPNB 4JN1L 2GY7B 1IEHA 1NC2A 4EI5B 4HGWB 2JJTA 4TPRH 2AEIT 4XHJC 5C0GB 3QDGD 3ULUL 1RUAL 4UDUA 3D3VD 1QSEA 3INUL 1A9EA 4XNYH 4QHLB 1X5KA 3H0TA 5D1XB 3MLTB 5ANMB 5FF6B 4U2YA 5HYSG 4LSVH 1XGQB 1FZMA 3NA9H 4I4WA 3IDIA 3A6CL 1JYNA 1UM4H 4R0LA 3WMSA 4HC1L 3N0PB 4JHWL 1NGQH 3QO0A 4HJGA 5HYQA 1WT5C 2FZ3A 1IILE 4U4BA 1EXUA 4FQXC 3QXUA 1S7VB 2ZCKH 4NOFA 3TIDA 3K7UA 4HWBL 3IAPA 4P4KD 5FYJH 1DZBA 3BEVB 2DBJA 3WDHA 1BD2E 4HG4K 4OV5B 4ZNEE 3NH7H 3IDJA 5E08L 3CFKA 3MV8E 1G6VK 5IMLB 1JPSL 4Z95L 1LDSA 3MNVA 4QXUL 4LCWA 5DHYB 1Q72H 3QIBD 4OFYA 1C8PA 5FGCE 5T3ZH 5MHSE 4L5FL 4KRLB 3E6HA 4LSUH 3GMQA 3IRZA 5HHVH 4YWGH 3AB0C 4FABH 2HFFA 3JWDH 2DD8L 4ZOEA 1JGUH 1S3KH 4OLVH 2EH7H 5CD3B 2V6HA 1BM3L 4M7ZB 5IUSA 3U7YH 2DKMA 1E4XL 2HH0L 5E5RB 4GS7C 2GAZB 3X12B 3OXSA 3LKRB 3RJQB 4ZTOH 5T1MB 1MJ7H 3HPJB 2BOBB 5CGYC 5JOPD 4PG2A 3LEVL 2R0LH 4PBVC 5CD5D 3MFGB 3NABH 1OWWA 1NKRA 4XXDA 4HAFA 3GJFB 1NAMH 5IMMA 3T0DA 3E8UL 4I0PC 3DX9B 3CPLB 1UXSA 3SDCB 3EO1B 3PJSB 1RU9L 1NC2D 2HVKA 1IGTA 1WLHA 1GJIA 4JE4B 1UADC 2NTFB 1GZQA 1QSED 2H32H 3SKNA 3OKNB 1KUMA 4UIKL 3UTSB 1IGJA 3QPQD 4IOFC 1BWWA 1A64A 3GSQB 4U2ZA 3QUYC 1K6QL 3GGWA 5B39B 4AH2B 2YA2A 5I71C 5BW7C 1PLGL 4F58H 3IXAA 5M94B 3KYAA 4K3GA 4FQHA 3B9KA 1RK1A 3I6KA 1U8NA 4WFHD 5C0CE 1CLCA 4MGXA 1AQKH 4HKJB 4ZS6C 2NW2A 1OB1A 2DYPB 1J8HA 4YXHH 1KJVA 4LLVA 1TQBC 4FNLH 3DYMA 3D25A 1KJMB 3ZHDA 3HN3A 2EZ0D 1H3WM 3R4DA 4GXUN 1D5XB 2E7LA 5BS0E 4HS3A 2ICES 2ITCB 3L3OA 3KPTA 4R3SB 5CWSA 5IB1B 3ZTJG 1YECL 2IPUG 5GGTA 4KRPD 3RFZC 4LCWD 3VDAA 2R8SL 2OM5A 2NY0C 4EN3B 1I7ZB 1HKLL 5MEPA 3HZVA 5E24E 1FQ9C 3EO0B 3RVUC 1KV3A 4X98B 3TBVB 3D5OF 2YC1B 2GQHA 4M4PA 4OCRL 4D2NA 1DBBL 2MJWA 3UCRA 2V2WB 1WSST 2F53B 4F9PC 1OAZL 1AGEB 1FCCA 3KPSA 4GUPA 2CSPA 3EDFA 5DVOA 1YNLL 1SM3H 1ZT7B 3DARA 1L6XA 4LVHC 1YNKH 2OJEA 5AD0B 1MCRA 4YIQA 4U1NB 2AJVL 4H1LA 3HNTL 4DK6A 2YPLE 2AJZB 4LLQB 4HFUH 5BXFA 2PO6C 1IFHL 1IGMH 1LO5A 3C2AL 5HHOB 2VZ3A 4ZQKA 4WEBH 4Q6YA 2XPGA 4ZO9A 4U33A 4YC2B 1KTLB 2GFBA 2YSSA 3DX8A 5DDHA 4ZFZB 4G7VL 3QDMB 3MLUH 3V6FA 3L5XH 4Y16C 2PYEE 4RBPH 2H32B 5LBSL 2BSTA 1NMCB 3CXDL 1ZLWK 4CW1A 4OLUL 2ERJC 3WHXB 5J11B 2P47B 2F19H 3GHEL 3ULSA 1MY5A 4M7LH 4LBEB 1R3KB 3KYMB 1NGXB 2ARJB 4LPWA 3B9KD 1GH7A 2FR4B 3CVHA 1QVOA 4PREA 2BCKA 1X5FA 4F7EB 1QR4A 5CEZD 3T2NL 3CFDA 1J8HD 3DV6B 1Z5LB 4L3ED 3SE8L 1LQSR 4LLUA 4KI5C 5CSGA 2OCFD 3UPRA 2ED9A 2SEBA 3OHXB 1YN7B 3PHQB 2NW3B 1VESA 4NNPH 1JGEA 5CIPH 4FFZH 1A6TB 1GAFH 2XQBL 4PRID 1PEWA 3O45B 1KTRL 3PQYE 4YO0B 4JFHD 2BVEA 2R2HB 1IAIM 5J3HD 1HSBA 4U6YB 4C59B 2CUHA 3U83A 2NY1D 3VW3H 1VADA 3BJLA 4ZUSA 1SEQL 5CS7A 1PJ9A 2R29L 2IALA 2WM0A 2VLKB 3B5HA 2MNUA 1KJ3L 1B0GA 1F45A 4W6XB 1LP9E 1ZS8A 3CFJA 1FVEB 2Q6WB 2CDEB 4OJFH 4ODXB 4YGAB 3OKDA 4NO2A 5FYLL 1FZKB 5LXGH 4GJTB 3V6OC 3ZKMC 5KVGL 1B3JA 2ZWLT 3KPSD 2E6PA 1D5MB 2I9TA 4EI6B 1TETH 3MACH 1E4WL 4Y5YC 1S7XA 4U3CA 5EZJB 2VERN 5GSVA 4TVPE 3HG1E 3QJFB 5JUEL 2NCMA 2R1WA 1QSVA 4NC0B 3RZCC 3L3JB 4WTZG 5DJ8A 3VG0H 2LVCA 1BECA 1YEDA 1N0XH 4P3CH 3M8OH 4P49A 4NOBA 5E94A 5GGQH 4KHTL 3GK8H 1KC5H 3QEQB 2C26A 5ICXA 1YNTB 4G8GB 4KV5E 4GRLD 4MA7H 5IW3A 3MYJA 2MKLC 1IQDB 4OZFA 1UZ6E 2YRPA 5KSAA 1EHLH 2NXYC 3KPLA 4L8SC 5IT2L 2JKXA 2ZP0T 5I1EL 3CDGB 1MIMH 2VO5A 2ITDB 3KYNB 1D6VH 3GI9H 4S1RH 1FIGH 5K9KA 3BPOB 3O4LB 3O6KH 4J1UA 3WFDH 3K1KC 3BKYH 4PJEB 4P5TD 1T1ZB 1QSFD 5F7EH 3V8OA 2P49B 5LWYH 4AQ1B 4ELMF 4PLOB 1C5CL 3OAYH 2BZDA 2CKNA 1GGBH 3MRHB 5E2JA 2Z8RA 3GSNA 4HUWA 2DTSA 3HNVH 3RA7H 1BF2A 1NBZA 2OP4H 2VXUH 1ZHKA 1D9KA 1AGCB 3SCMB 2AJUL 2IPTL 1IAMA 3K80A 2VXTL 4HUVA 1DLHA 4M03A 5FA4B 3ARTA 2Q7YB 4OZHE 1QBMH 3IXTB 1JWUB 3SEPA 5MEQA 1MH5A 4HEPG 4UIMA 3FL7A 3SKMB 4BA8A 4PD4J 5CIPB 5CP3A 3OKMA 2P5WE 3L5IA 2I25N 3HE7B 4Y88A 5DJ6A 4DVBA 2B1AH 3G04B 1VHPA 4F7PB 4M48L 4OD1H 3K4DA 3VXQA 4DOHE 4TVSa 1PYWA 4L4VA 1J8KA 1SQ2N 1G9NC 3VGGA 1ZHBA 3VGHA 3UJIH 4MQXD 4K7FB 4B50A 1LDPH 1AR2A 1BEYH 3P77B 4UBDC 4H20L 1SVCP 4U7KA 4N5EC 1URLA 2A73A 5F93C 1OTSC 1KF9B 1G7IB 2NR6D 4XPTH 4OQTA 3I6LD 3TYFA 2H26A 1DBAH 3F12B 2VIRB 1CLYL 4U6XB 5DD3H 3PWVB 3NZHH 2CIKB 2DLIA 4LQFL 1BFTA 4RX4A 1AQDB 1S5HA 3WXWL 2X42A 3KR3H 1HZHH 3P0VH 3QFDA 3IETB 1ZV5A 5JHDE 4CNIA 1RHHB 5KS9A 3CIQA 3DIFA 3H3KA 4YBLC 1A9BB 1FYHB 1HHIB 3FQNB 1ITCA 2Z31A 3MGOA 2R9HD 3HHRB 2BXYA 3D39A 2YXMA 2CLVA 4WUUE 4O5LH 4WI8A 3HCVB 3RQ3A 3WLBB 3QFJD 3RNQB 4DKEH 4PD4K 1I9JL 5SWSA 3MRBA 1JYWA 4Y1AE 1O7SA 3GNMH 4XCCH 1REIA 4JM2D 2XZQH 3FFCB 5FKAA 3X3GH 4APQD 5GGRB 5E8OB 3VFTA 3KNBA 3BPLC 1T5WB 3CH1B 1BQLH 4ONHB 1CFVH 1G84A 4JRXD 5C07A 5IB2B 1TZGH 5JORB 2LFGA 3BZEA 2OR9L 5IBLC 4FQIH 5BZDB 1K4CB 1TNNA 2VQTA 2FJHB 4U6HB 4XRCA 4PJFB 2EH8H 1INQA 2GITA 3UBXB 2MMXA 2YEZB 4MQ7A 4U6TA 5IW6A 3H9ZA 5F88B 1T2QH 1IM9B 4OCLC 5DURD 4UINL 2JCCE 2NY5C 3O8XB 4P23A 5IESL 4KUCF 2IANB 4FQ1H 3BGFC 3L3GB 3O9WC 1E27B 4OF0A 3QHTC 4GAJL 1D9KD 4J3WA 1XIWA 4GFTB 1WC7B 2AJXL 4IOIA 3BAEL 5EULV 2DI9A 5DJ2B 2VXVH 3WIHA 2PF6A 3MRMB 2Y5EA 5L2KB 1K3IA 4NWUH 2GCYA 5MP6L 1VEPA 2R2EB 4WO4C 3FRUA 1F90H 1OHQA 4JFPA 4ODUA 4MZ2A 3JV5A 1AIFB 4HIEB 2BNUA 1LEIA 3RGVA 1BFSA 1LNUB 3OB8A 1KYOK 4LCCC 4PRNA 4L4VD 3NPSB 1KT2A 4UOW0 3TLRA 4JFDA 4FMKA 4NKMB 2QR0B 2GYSA 2WWKT 2AGJL 5D7LA 1P4BL 4BKLA 4EDWH 5D7JB 1Z0MA 2WUBH 2FSEB 2YPVH 5I1LA 2DTML 5IKCA 3HI1B 4WFGE 3RWFB 4BH7A 1RAMA 1HQ4A 2HTLC 1R3LB 5HHNB 4POZD 2VR5A 4FQ2H 2JELH 2OZ4L 4HK3J 2AV7A 1TVHB 3DMMA 1FO0L 4UQ2A 1HQRB 3DNKA 1FPTH 4P2RB 1AHWB 5LAXB 4G7YH 3FQWA 1G7JB 4RMVA 4RGMB 3DLQR 4F33A 2APFA 1YC8A 2RGSA 1LMKA 2P8LB 4I18A 5IV2A 3OXRB 3KLHD 2X4UB 3GIZL 3WNKA 3VXME 3S35L 1IC7H 3GBNH 3BXNB 1QACA 3B6SB 5SWSD 4HKZB 1EO8H 4P3DB 5I8KH 4K8RC 1U41A 1A47A 5KSBB 1YY8A 1JRHH 1WF5A 3O3EB 5FO8B 4HDIA 5C07D 1A7PH 3T4AA 3ZDYF 2J88H 1ZA3A 4I2XA 4D9QE 4PYGA 3U36B 3UX9B 3BPCB 5C0EB 2XOTA 4LPCA 1FNSH 1RFDH 2IGFL 4XPHL 4GO6B 2NTSP 4R7DB 2FJFA 2DM2A 2X40A 1BFOA 3V5KB 4EVNB 3MQIA 32C2A 3GRWH 4KQ4H 4P23D 2DQJL 1CQKA 2YWZA 3RP1A 1BZQK 1CFNA 4WEMB 1S78D 4PJEF 2XXMB 2ICWJ 4LASH 3VXSA 5IHZA 2MFNA 4P9HL 4IS6A 3O2VH 3GBMH 4XVJH 4WNQB 4YHLH 3FTGB 3DVGB 1PSKH 2V5YA 3QDJD 5HI3C 3FOLA 2FL5A 1IE5A 3UTOA 2DOCA 3L5JA 4IRJD 3ZE0E 4N8VG 3T1FA 4JFQA 5I1KH 1NLBH 4WHCA 4MWFA 5GS2D 1JGDB 1GGUA 2UVFA 3SDAA 4KRMB 3ZE2F 1WBYB 3AB0B 1N5AB 4LGRB 4RAVA 4LCUB 4O2EA 3VFSA 5D7LD 1MAMH 4GS7B 1KFAH 1KEMH 4UMGA 1R5IB 1KACB 2VMFA 5ESVA 3F5WA 4OF3A 3ARBC 4MA8L 5I76B 4EDXA 4PUBL 1AXIB 4LRIA 5D70H 4B0MM 3C8KA 4FRWA 1MCJA 2AK1H 3DMMD 1KNOB 5FB8B 4XP9L 3VWJC 2BOCB 2HKFH 1V3LA 4JY5L 3GJEA 2ED7A 4KUZH 3QXVA 5HPMA 3P30H 3U2SB 1R3IH 4I0PB 5DMIH 1VGEL 4BQ9A 4JO4H 5CEXA 2Q8AH 3REWB 2B0SH 1B9ZA 5CZKA 4DCQB 1R5VB 2IAMA 4EZMA 5IBTH 4M6OL 1T20A 5ICYB 4NNXA 5GJSH 4LPVA 5J8OA 5L8LB 4FXLA 1S7UB 4OUUB 1KPUB 1R3HA 4Z76B 4ZXBC 4OIAA 3QUYB 4ALAL 1UVQA 3BESR 4KK5C 4OGZA 2OQJB 5FIEA 2NYYC 4IMKC 2A83B 1U36A 5JW3H 1H8OA 1EEYA 1NCBH 1JRHI 1ETZB 5KSUA 4OFIA 3BUYA 2YN3A 1E6JH 3T77B 3DYOA 2EIZA 5CSBA 5DRWA 3KPRA 4S0TD 5DJZA 4JQIL 1AI1H 1NMAH 1NH6A 1EA9C 3VFUA 4KKLC 1PY4A 2Z0BA 4Q6IB 1TQBB 1KENH 5F9WC 1TENA 3R1GH 5IEKB 2PYFA 1HDMB 4L8BA 2X70B 4IMLA 5IIEB 3W0WA 1NC4D 4AT6B 3QNXB 1NKOA 4EOWH 4ZAKB 3S97C 3B2UD 1R3JA 5C6PB 2A6IA 2QHRL 5CSZA 1Q9KA 3LB6C 3VFWA 4QWWC 2NY0B 2GTZB 2DDQL 5GQBA 3H9SA 4JZNA 4JPVL 2BRRL 3OR6A 1FGNL 5F1KC 5GRZA 3S5LA 3ARED 5HYJB 4NC1E 1N59B 3C09C 1JMZA 4QRRB 3WIFB 5KOMC 3P0GB 4JFEB 4ODWB 4Y4HC 1TZIB 2J8OA 4PRDB 5J9PA 4LVHB 4XPBH 4GG6B 5H94A 1OAKL 1X4YA 1A4KA 4IDLA 4Z7NE 1XF3B 3P9WB 4BZ1L 3DHMA 3N1GC 4MNQB 4J12A 3CC5B 4XT1C 2H6PA 1IC4H 2AK4E 4B7IA 3U9PH 2PO6B 3DTXB 4QHUA 1RZIB 1P2CB 3GZKA 5E7FA 3UPAA 2OK0H 2WMPA 4PGJA 3I9GL 5D5MB 4H8WL 1ZA6B 1OLZA 4HUUB 1D6EB 1F3RB 4NO3A 1CFSB 4Z8FH 1JIBA 1B0WA 4TNVF 4Y16B 2IAMD 4R4NC 2VSCA 3WFHB 3FQTA 1X4XA 4KROD 3JV6A 1XH3B 3TT3L 3UZVB 4PY8I 1WAAE 1DBKH 1UKQA 2AABH 5ESQA 4AIOA 3A67H 4XNMA 1YEFH 3WE6B 5DD0L 4L9DA 4M02A 4JDZA 3NFSL 5I18H 4EBQH 3EAKA 3KPRD 3BIKA 1KLUB 2XNAA 2UZXB 5GISL 3GFUA 3MV9A 1H3VA 3QUZD 3U9UB 2F5AL 1H15B 2Q3AA 3PDOB 2FX8L 4FQJL 2EDTA 4XMLL 3P73B 3CXHJ 3MJ9A 4MD4A 3VI4F 4OGYH 2DJ4A 2OTWB 2R0WH 3W0WD 1YPZB 4OT1L 4XVUC 3TBSB 1LEGB 1B0RB 3QUXA 1BQHG 3PV7A 4Q0XH 4PRAA 2FIKB 4WWKC 3KPMA 1CGWA 1G9NH 4HEME 4PJIA 3H9SD 3BRFA 1CF8H 2EKSB 3NIGF 5DRXA 2XWTA 2GTWB 4J8RA 5C1MB 3KVQA 4P3WA 5I8EA 5ILTH 4HPOH 2B39A 1TJHH 3ZKQD 4LDEB 3CFCH 3O81A 5I1HL 4L1HA 3WL9B 3MRFA 4F2MB 5IBUB 4OD2A 4ENEC 3DX6A 4ZUUB 2QQKH 3PWPA 2KPNA 1AD0B 4AEIL 4HWNA 1AR1D 1D5IL 4NP4H 4XNZC 3K46A 3CZFB 5TF0A 5EUOE 5SWZA 3DOSA 3DGGA 1U93A 4Y4FC 2NNAB 4JPWL 3CXHK 1XGYH 2F54B 4NYLA 1NMBH 2YZ1A 1QRNA 3LN5B 3QQNA 3MBEA 4RGND 2EE2A 4GMTH 1H8SA 4PY8J 1YYLH 1UWGH 5EO0A 1UENA 1ZHLA 4P5MA 2R56L 2YUZA 2NXYB 1ZT4A 4X6DE 3RWHB 3RWCA 4C58B 1Q38A 4N0CD 4ZSOE 5GGUB 2HTKC 1UJ3A 4C4KO 1IKFL 3FJTA 4R26H 4FTVD 3SKJL 2ESVE 5IEHB 2AJ3B 2PCPA 2W9LA 1U8HA 2B1HL 3K8MA 3G6JF 4PG9B 1NDGB 4FZEL