2Y72A

Crystal structure of the pkd domain of collagenase g from clostridium histolyticum at 1.18 angstrom resolution.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
85
Chain Sequence
GGTIAKVTGPSTGAVGRNIEFSGKDSKDEDGKIVSYDWDFGDGATSRGKNSVHAYKKAGTYNVTLKVTDDKGATATESFTIEIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Collagenase G Reveals a Chew-and -Digest Mechanism of Bacterial Collagenolysis
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Hydrolase
molecule keywords COLLAGENASE
total genus 17
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2y72A00
1XF4A 1QO3B 1KG0A 4XC1L 1VCAA 1AFVL 4XP9L 3U7WL 1O7SA 3BPLC 3QIBB 4ZO9A 4PGBA 2Q20A 3D25A 4PD4J 4M7LH 4Y2OA 5LQBL 4L3AA 2EYRB 1JWMA 5M7QA 4JFDB 3CFJB 4OKVB 3VDAA 2WAHA 3FN0H 3E8UH 2DD8H 4GKSA 4U1GB 5KW9L 1WZ1H 2DMBA 4EDWL 2NY2D 4U1NA 1KEGL 1ES0A 1LEKA 1K4DA 2A9ML 4M4PA 5LGKA 3FB8B 2A9NH 5DWUH 2F53B 2YUXA 5CD5C 3BE1L 3DV4A 1MFEL 3BP5A 3V9FA 4KTDH 1AE6H 1NGXB 5EU6E 4XVSL 3UYPA 5JOFA 3BP4A 3HAEH 2IPUG 4UTBL 5I74B 3NPSC 2VQTA 5DMGD 3Q6FB 5EC2B 3I9GH 4S1DC 3RU8L 4R0LA 2C4FU 1YYLL 4TYUA 5CIPH 5JHDB 4POZD 4I0PC 3OAYK 3ZMRA 4G8FA 1IQDA 1J1PL 1ZHNB 1MCOH 5E2JA 1NAMB 3O2VL 1IGJB 3THML 4JO4H 2M1KA 3I6GA 4MJ5A 2JELL 3X11B 3RL2A 1CD1A 3LEXA 4KTYA 2CXKA 4PY8J 4DEPC 3RFZC 3IFNH 6FABH 4M3KB 4G5ZH 5C09E 3K0WA 4X8JA 3ZT5A 3K3QA 1DEEB 5JDJA 3LEXB 3V6BR 2FZ3B 1JIBA 4FQJL 4UILL 2LVCA 3IXAA 4IOIA 4HIEB 5IR1A 4HWZA 3HNVH 4LLUA 1ADQL 1VFAA 5D1XD 2BZDA 3UYRH 2ICWJ 3FO0H 3PHQA 4P5TC 5DRZA 3ZSTA 4C4KT 1F4XL 1R3JA 5CZXC 2QHRL 3BQUC 4JE4B 3SQBA 5HVGB 5IB5B 2ATPA 4XZUA 4DKEL 1F42A 4JQVA 3RY6C 4Y4FD 1BOGB 3A6BH 3SQOL 3O9WC 1IGIH 1RJYB 4YH6A 4EXPX 3X13B 5BS0A 2ZG1A 2NPLX 3GSRA 1SYVB 1T22B 2ZUUA 4NQXB 2V5MA 4CVZA 3W11D 2EIZA 1S7SA 5DEGB 4JO3L 5KVEH 1D5XA 4XVUC 3MGOB 3MJGX 4JFXB 4X6DB 1LO5A 3FB7A 3MOAL 4I1NB 4LCIH 5DWUL 1VFMA 2PYFB 3EW3B 1PJ9A 4M7ZB 5GZOC 1UKQA 4JM2F 3K81A 3CFCH 3SJVB 3G6JF 5T3ZL 2CO7B 2ZUYA 2DQCH 4MVBC 1Q0YL 3MUHL 1U41A 4PP2A 3GMLB 2XPGA 5IQ9A 3BP7A 1A6VH 2DQGH 3DJ9A 4Z7UA 1F13A 3HLAA 4POYA 4NC1C 1NGQH 4LVEA 4ZS6C 3V8OA 3BKCH 4RZCA 4MAYB 5H94B 2V17H 2IH1B 3BT2H 3WIHA 1DSFH 4LSPH 5IKCA 1AR1D 4G9FD 4JGJA 4Y5YB 4YXLL 3X3GH 1N7ML 3U0TB 4X6FB 2Y06H 2OX5A 4NNPL 3RZWA 2I5YL 5H37G 3EOBA 1K8DA 3KDMA 1T66D 4MNQD 3UJTL 1TVBB 4FA8A 1MCQA 4JR9H 3TO4B 2G75B 2B0SL 3D0LA 1DVFC 1UH3A 2FSEB 3WO4C 2CLVB 4F33B 1LE5B 3AREC 5KTEL 2V2XA 1LVEA 3WS3A 4AENA 4FQ1L 4QRSB 4S1SH 4JVWA 2E9IA 3WLWD 5DMGC 1F3JB 4LCWD 4L4VB 3K74B 3RI5K 1WZMA 2WINA 3RJQB 2C9AA 2DOCA 3GSWB 4U7KA 1QRNB 2EC9T 4EI6B 1N59A 2BCKB 3MV7A 4XNYL 2CDFA 4RMUA 1EXUA 4I9WD 1TETL 1JPFB 2NXYD 3ZDXF 3LN9A 1RUMH 1AXTH 4Z76A 3GSNL 3D5OF 4CVWA 1QOKA 2JB6B 2OI9C 1SYSB 4MA3B 4MVBD 2AEIT 2JB6A 4F57H 3GGWB 2W1NA 3BDBA 4R96A 1R0AH 4X7SL 1WBZA 1M6OA 3ETBF 1UB6B 1WISA 2A0LC 4YGAB 3WFHA 3W2DL 4YFDB 3CFDA 1QBLL 2H2SC 4UT6H 1F3DH 2JIXB 4LQ1A 4WUUB 1HK6A 3WBDA 3BPOB 4X7TA 2XA8L 1MRCH 4LP5A 4Q9RH 3KLSA 1YMMD 2J8UA 3JSSA 3VCLB 2WNGA 1MLCA 2ZOKB 1RZ7H 5D1QD 5KS9E 1PZUB 1MUJB 5H2BA 3P77A 4WDIA 4BZ1L 4MCYA 3OKNA 3ZSSA 1X7QB 3O6LH 1MFCL 3U46B 5SWSB 5D7LA 3BVNA 4HK0A 4MXVF 5EOCH 1AGCB 1TQCB 4XX1E 3QIUD 5KVDL 2JCCA 1ZGLA 3TNMB 3BX7C 3C9NA 2ICES 2EDJA 4HWEL 1Z0MA 3NVQA 3QUMA 4Z8FL 1FNGA 1IEAA 4DGYH 1HZHL 4N0UB 2BY2A 3UBXG 2Z8VC 1TJIL 4V1DD 4MNHB 4KAQL 1ORSA 4JVPA 4OUUA 3VXRB 2O5ZH 1J0HA 4H20H 4CU8A 2VZ3A 3C2AH 3MLUH 1WBYA 1CDYA 3QHZH 5DLMH 3LB6C 3LDBC 4XVSH 4WW2C 2OL3A 3HKFA 5E2UL 3EJYC 4HIEA 3T0BA 2ZCLL 1JNJA 2AXFA 1MWAH 5GS2H 5I1EH 2BOBB 1ZLWH 5E8DL 5DMKA 3VFOA 1BF2A 2NY3C 3VXUD 4OGXL 4JY4B 4B7IA 3ARFD 5BZWA 5GQBA 1FRGL 5HGDA 2FJGA 4JJ5B 1FC1A 2XWJA 5B4MC 5E1AB 1YPZE 4BELD 5ABDE 1X5FA 1IBGH 3EJZD 4JDVB 4J6RL 4KJWC 2CJUH 4LHJB 4GG8A 4FABL 3BKYL 2NXYC 3EOAA 3JTSA 4Y4KB 1HIMH 1H3PH 1MFDH 1MCSA 4HZLA 4JM2D 2ZG3A 4BA8A 1QZ1A 4ODHL 2NY4D 4M9OA 3V52L 4M6MH 1CFTA 1I3VA 4JFFD 3QJFB 4UOW1 1C5BH 4JFHD 4PRHA 3OKEA 4BFIA 4DGIH 1RZFL 4FXLA 1GGCL 4HS8L 3V4UH 4U2YA 3QP3A 2DKUA 2EYTB 1NLDL 3TN0C 5I76A 3MREA 4UV4H 5FA4A 1W0WB 2GKIA 5C92A 4N0YL 3GSQA 1CFQB 2VXVH 3FFDA 4PJGB 4KVCL 2VAJA 3S8WA 3K4ZA 3ILQD 1IGYA 2WUBH 5F21B 3GSOB 4IEFB 3RJDA 2ZSWB 2ZJSH 1F4YL 5J11B 5E8OB 2F5AL 4M48L 4Q2ZB 4PRPA 5DJYA 2X4SA 3VFMB 5F9WC 3LH2L 4JZOB 4GXUM 4X6BA 4R26H 2EYRA 1OAYH 5I75B 4Z0XB 4APQD 3W9DA 4F57L 4AIOA 1QFHA 4WI2A 4DKDC 3WIHL 1V7NH 2DQUL 3QO1B 5F7EL 1HH9B 1F3RB 3RAJL 5DD5H 5FHAL 5IV2B 2FL5B 5IVOA 3FQTB 3CX2A 5DRXA 1X5LA 1J8HA 1KEMH 4E5XB 1LEIA 3GSNH 4WWKD 5DQJA 4RMWA 2VZSA 1ZT1A 1JBJA 3NFNA 1G9NL 4KTEL 5HYJD 3ULUE 2AJVL 3S4SB 5D2NB 4KK5C 4HK3J 3DIFB 4QTHA 3QI9A 1S9KC 4KZDL 4HF5L 4KDWA 3IXTB 3TBWA 4LU5H 5A2JH 3U30C 5FFLA 3KPOA 4HIXH 2NXZC 4NQEB 5B38G 4KJPC 4NNXB 1NCBH 2R1YA 2EIZB 4KK6D 4EBQL 4OD2A 1CI5A 1R3HB 4ORGA 4MMZC 2JJSC 3MXVL 2CGRH 3WCYA 1KCSL 5EO1A 3TCLA 2DL2A 2AP2A 3GSUA 4O2CA 5CHNB 3MRNB 1CDUA 5I30L 4MJ2A 2FGWH 4G9DB 1MCBA 3SKNB 3VWJD 3DRTA 3LQZB 3KS0H 4ZYKA 3UPRB 2CR3A 3HC3H 4NYLB 3JBG7 3DVIA 3A6CH 1LK2B 4HUWB 4YXLH 1QO3A 1HE7A 3BHBB 3HZVB 4Y19E 5CCKH 3HTLX 2CLRA 5IR1B 3GUTA 5ETUA 4UMGA 5D4QA 5BQ7B 4S1RL 4CJ0A 2IJ0C 2HWZH 4RAVB 1QLFA 1WV7T 5BXFA 1BIIA 1UB5A 2X05A 3W81A 4RGNC 2MSPA 1RZGB 5I1GH 4MNQA 1KACB 4HKZA 2E5EA 5C9JB 3ARBD 5DF0A 1X9QA 3HPJB 4OZIE 1A6ZB 1BOGA 5KOVC 2H9GA 3T2NH 3HE7B 3Q0HA 5ECJE 1K9TA 5IB5A 5T3ZH 3ZL4L 5HDLA 1ZGLP 3P0YL 4S2SB 1Q9OA 2JE8A 3QBTB 4JPKL 5GS0L 3VRLF 3LKOA 3SE8L 5ANME 2BRQA 1F02I 5JPNB 3RKPA 1KN2H 3LIZL 2Y1VA 3PDOA 1WICA 2I07B 1FFNB 4KTEH 3FFCE 3DX8A 5BMFH 4FQQA 1NLBL 1JPSL 3MRQB 2OMNA 5KVMC 1TDQA 1T7VA 3PDGA 5TFSL 1MEXL 3NIFE 1EHLL 4XRCB 5FGSA 3EYFB 1H3XA 3ARFA 2I25N 3PNWB 3L5JA 5E2UH 3QIBC 4G9FA 2BJML 3TYGH 4WU7B 3KPRD 4JZJB 5CHNA 1A7BA 4K8RC 1GRWA 3EYFA 2Z4QA 1AR1C 4MXWL 1ZLWK 3C2AL 5HYQA 5SX5H 4NKOA 4WFFD 1DBBL 4PRPB 1U8HA 5HHVH 1G9MH 5CD5D 2Y36L 3VI3F 3QQ9C 2M26A 4CADA 5B39G 1IFHL 3DXAB 3T3ME 4QRRB 3S4SG 4Z7UB 4NO3A 1QRKA 3FB6A 5D7IA 4HWUA 4M93B 1XCQA 5C0GA 1QR1A 3J7HA 3MTRA 1FC2D 3HE6D 3DHMA 2OXGA 1O7VA 5C0EB 1I1AD 3G5XA 1EERB 3A6CL 4UI2A 5IJKA 3L5IA 1IM3B 4OCRH 2H3NA 4JFOB 4FQIL 4WNQB 1U8PB 2X4NB 4HJ0C 2RIKA 3L3DA 3G08B 1CICB 3QIUA 1IGTA 1MUJA 4P99A 3MRPB 3ZE2F 1BQHG 2EZ0C 1HIML 4LSRL 3DMMA 4PJGE 4P3CH 3W2DH 1CXHA 1LE5A 5H8DA 5IBLC 5C0AB 1RHFA 1CFNB 5SV3A 1Z3GL 3GSNB 4O00A 4OIBA 4KRPB 1OGAE 3WFZA 4A2LA 1VEOA 4D0BB 1MJ8H 5K9JH 4HG4J 3U4BL 4LU5L 1G9MC 1TNNA 5MENB 3MBXH 1H15A 3FMGH 2RGSA 5DYOB 3ZE0F 4ETQB 3K2MC 3O6MH 1OP5H 1SBSL 4F58H 4APQB 2R2EA 4IRJD 5JW5B 1YEGL 1TQCC 1EXUB 2VL5B 5HTSA 3OL2A 3LKRB 3FO1A 5BVJA 1ZS8A 3BN9D 4RAUA 4ZODA 1YPZB 2X1QA 1V7NL 2DQUH 1OLZA 1T0NA 2BNRB 4QOKA 5CGMA 5KSBF 1M7IB 2HRLA 3BMVA 3O9WB 4F7PA 1U58B 1RZ8B 2QBWA 3CFKB 4MAYD 1GC1H 4UOW0 2VITB 3OHXB 1TXKA 3UTTB 1DTUA 3RVXC 5I8EB 2YHGA 4U6HA 5F9DC 2Y25A 1KIUA 5I9QC 5E8PA 3BQUD 4WW2B 1EFXD 3OHXA 5CUSL 2H26A 2F5AH 5B8CB 4OBSA 3UTQB 2OS7A 2UWEA 1MLCB 3VFUA 3NPZB 2O26U 4H26B 3RPIB 5IF0B 2HJLB 1HHKB 2AQ1A 5C6TH 1VERA 1BLNA 4N8VA 1GSMA 2R23B 3UTPE 3CZFA 4HKBA 5CEYB 3TT1H 5JOPD 4OSUH 4K07A 2GIYA 3Q5TA 1YC8A 2F9BT 2BSED 1NCWL 4WU7A 4ODHH 2A0LD 1PFCA 1T5XB 1U42A 5KS9B 5GGSY 3OQ3B 2BOCB 4X7EC 5HHQA 5EPMB 1GGBH 4I2XB 5KN5A 5HDOA 3GI8L 3SDYH 3SOBL 2NW2A 3LQZA 4XXDB 5IGXL 5CEZE 2W9DL 4IRZH 1A9BA 2NLJB 4P9ML 3V6FA 1S7TA 4X9FA 2NNAB 2VLKA 4DUWA 1WUNT 2BP3A 1X5JA 3JTTB 3HUJF 4X0KA 4V1DB 3QNZA 3OX8B 4XPFH 4XTRD 3TIEA 2A74A 4OT1L 4OQTH 1NC4B 4PR5B 2HYMA 1MIMH 2VL4A 1U3HB 4HCRH 4RGMB 4O51A 4PB9H 4F33A 2NY0C 2EECA 4P4KA 4JFPB 3F5WA 5IM7B 4YAQB 3EAKA 2AK4A 3HNTL 4KUCF 3QIUB 3LHPL 4PJ9B 1JNHB 5IESL 5BS0B 1JZ5A 5CMAB 2RFXA 2WWMD 3G6DH 3VW3L 3GMMB 1A4KB 4ZS7H 1GOHA 5ICYA 1NBVL 5K9OA 5IBUB 4L29A 1VGEH 3X17A 2WANA 2HWZL 4WFED 1B9ZA 3U1SH 5JZ7C 4UDTB 4OCRL 3X12A 2YC1B 1F6AA 1CZ8H 1AJ7H 1U8JB 4MB5A 2VZ1A 3L5XH 2LVEA 4OGYH 1JHLH 1F00I 2AQ3A 2YEZB 2ZPKL 1INDH 2YPVH 4NO2A 2ZOLB 1HHHB 4LCWE 2FLRT 1J0ZA 2VLJA 4Y4HC 4TSAH 1VEPA 2EDFA 1EEUA 5F44A 3KHQA 3O4OB 3AXLB 2D3VA 1U8HB 1NAML 3SE3A 3V4PH 3AREA 4A6YH 4X8JB 4XAKD 1E27B 1NC2A 5CSZB 4NRXB 2F53D 1Q1JH 3HR5B 3S37X 1AD0B 4I9WE 3LD8B 4XPAH 4JFDA 4OKVA 1WGOA 4M5YL 5JPMA 1CLYH 3S98A 4NJ9H 3L7EA 1YEEL 4I5BB 1XIWC 2H1PL 3IFOA 3QWOB 2K7QA 1PQZB 4OAWA 4P2OC 3UBXB 1Q0XL 2A77H 3WKML 2E6QA 1ZTXL 3S37L 1MEXH 2MPAH 1WBZB 4OD1L 5L9DL 2QL1A 3C60D 3DXAA 3DNKA 3WXVL 1J8KA 5J89A 3MLZL 4PJFE 3CSYB 4XGZA 2P5ED 1BAFL 5C9JA 1OHQA 1GGBL 1XEDA 2QADC 4B53A 5IW1A 3QISA 3C2SA 2BSRB 4PJXF 3HE7D 3FMGL 3UTTD 1CLZH 5HVWA 1T7YA 1T7XA 3U4BH 2IADB 1QA9A 4NQDD 3IDJB 3MA9L 1J0JA 1W0YT 4DEPB 3D39B 3MRMA 5DXWA 3KPRA 4LLQA 2HG5B 1OTUD 4IBLT 2HKHL 3NTCH 4X9HA 4DFIA 3PWJB 4MA1C 1FFNA 1BFTA 1YEHH 2APVA 5ADOH 1GCFA 4FQ2L 3PGDB 1MREL 5D5MF 1KENL 3U0WH 3IGAB 2OK0L 4NQCD 4KHTH 5ESVA 3DUSB 4P46D 1X6NA 3BAEL 4ZUVA 5FCSH 1DDHB 4LEXL 4P23C 2ITCA 1A7PL 4WY7H 4ZFZB 1LO3L 3C87A 3ARWA 1K5NB 5EBWA 1P9MA 4A2MA 2R2BB 2IQAB 1S78D 1LEGB 3SKOA 5J13B 1KLGA 5DJ8A 3LQAH 4PJ5D 1HSBB 4TOYH 2ZWLT 1RZ7L 1J86A 5IB1A 3IDMA 1NANH 4HIJA 2GAZB 2W0KA 1TVHB 1I7TB 4RAVA 3EOAB 2YRZA 3RI5F 3E2HC 4QHLB 1OTTC 1MWAA 2DQGL 3LS5H 5EORL 3VGEA 1A6ZA 2C3XA 1UVQB 4HCRL 1DLHB 5F7LB 2QSTA 1P2CB 5E95B 1HWHB 4ZAKC 4K9EC 4JPVL 5DTFA 1T1YA 4IS6B 4OBRA 2AVGA 2Y07L 3DYOA 1HHKA 5GGVL 1S7UB 1K3ZA 1BEYL 3MJ8A 5IOPA 3Q5YA 5D6DA 5T33L 1HILA 2X4OA 3PWPD 1DQDH 4HMCA 4HXAH 2CR6A 4LAQL 4LLYB 3RWIA 5HD8D 5J11C 2C1OA 3MLSH 5JORA 2AJYH 4JY5H 1KC5L 4G8EA 1R3HA 4CN6A 1PW3A 2BERA 5E5MA 1MAJA 4Q2ZA 4FTVA 2NYYC 3TBTA 1MCPH 1LO5B 3HZYA 1CICC 4MJIA 3WDJA 1ZHNA 1IT9L 4QXGH 4FQHB 5IFJA 5JO5B 5IW6B 2EDYA 5C0JB 4L8DB 3U9UB 3VMPA 1JI2A 3QUXD 2GQHA 3BOVA 5FB8B 5KSAA 1DVFA 1EEYB 3QNXA 5JMRA 4Z5RB 2MHAA 2PN5A 1CFSB 1DUYA 3VI4F 4YPGB 3PWPA 1J05A 1P84J 3WFEH 1MY7A 3JV5A 1KBGH 2CDEA 3ARDA 5ACLA 4XPAL 4Y88A 4D0CA 3T0XA 4OV6F 3KYMA 5LBSL 4X98A 1NBQA 3BD5A 5J1TC 3O2WL 2XZQL 4QY8A 3FKUS 4YPGA 1CBVH 1F90L 3SDDC 1PG7W 4A6YL 4MDIB 1F11B 5E03A 1UB5B 5EO0B 3EYUH 3U30B 1G1CA 1GHFL 2GFBA 5IQ7H 1FNLA 1MHHB 2GTWA 3K80A 3T0EC 1DE4A 5HDBE 3KJ4C 1KLFA 2A6JB 1S7TB 4MWFB 4GBXC 2J7LA 1R3JB 3B3IB 2V7HA 3QEQB 4JHWH 1T3FB 3S3PA 1NSNH 1TJHL 4XPTL 3SCMA 1OGTA 3EBAA 3WHXB 3H7LA 5ITFA 3HNSL 4TRPL 4F7EA 2QADD 2HT2C 2P7TA 2HP4A 3HI6H 5HYEA 3KDMB 1LP9A 3O6FA 1R5IB 3IRZA 2ICEB 4MMXC 4P59H 1Y18A 1TZHB 5I18L 1G7QA 3ARFB 4ODTH 3UTZB 4KKAC 4NJAH 1OTSD 3UEZA 2HLAB 5ITBH 2DQCL 4BFBD 4L5FL 3S5LB 5CZVH 3L3OB 4OUUB 4KGLA 4JG1H 3PF2A 3OJMB 3WMSA 4C83B 1NEZB 4ZO8A 2ZCLH 3BO8A 2Q8BH 1ZGLM 5C0CB 5LG1A 3BISA 4Y2DB 3PL6C 1XAUA 2J88H 5DURD 3WKNA 4EOWL 1CS6A 3U7YH 4M6OH 4P23A 2OQJB 4K7PY 4H20L 1YEKH 4FNLL 4E41B 1A6WL 5K59E 3U82B 1IGCH 5BS0E 5DRXB 5IJVA 5CILH 1A22B 1AXSB 1RURH 3HAEG 3WIHH 2D4FA 1UM6H 4HAFA 3MLPA 1UM5H 3GHBL 2OZ4L 5DJDA 5JLZA 4MB4A 4MCYB 1QNZL 4PV9B 1T80A 5D96C 5I1AA 3TVMB 5F3HA 2P8PA 2AEPH 4PG2A 3KLHD 4FFWC 3H6JA 2AJ3B 5JUEL 1KTDB 4QWWC 1FBIL 4BJLA 3BPNB 4KHTL 3AY4C 4Q9RL 3QUYB 1YA5A 2FBOJ 1EO5A 2X1WL 4P57A 2CPCA 1NMCB 3MV9E 3JZ7A 5HHPB 1NPUA 2ITDB 3QEGL 4ORGB 3MRHA 3QXTA 2FHCA 4XNUL 3TNMA 2GJ6E 2VLKD 2HRPL 3F6LA 4I8DA 4NSKA 1N3NA 4JFEA 4XP1L 3SDCD 1RI8A 1GPOH 4MXQD 4QNPF 1U3YA 3CVIH 1FE8H 1PLGH 3CC5A 1JPTH 5E7BA 1IM9B 4ISVA 1WAAE 2RB8A 1VB9A 2VKXA 1W8OA 4Y16C 2X42A 5F7DA 1N8ZB 2NR6C 2O5XL 2CJUL 4HIXL 4KK9C 1BVKA 4EXKA 2EDKA 1INEL 4WFFE 4JCLA 1DQMH 5E6IA 3RL2B 5EB9A 4D8PB 1S9VB 3TO2A 1ZA6A 3BD4A 3M17A 4OFIA 5E2WH 3OR7A 1GOGA 3MYJA 3H9SA 3RTQD 3CDYA 5H37H 1YNKL 3IS1X 3DECA 5E8PB 1BEYH 3C6SB 4H25A 4PJFA 3NCJL 5F7KC 2GJZB 2PETA 3RAJH 1UENA 5EC1A 5D72H 4P46B 2EE2A 4HULB 1SJHA 2H32A 4MGXA 4JPVH 3PQYA 3GMRA 1TVBA 2FIRT 1IGFL 2J6EL 1DBML 4KHXL 2J6EA 2Z31B 1UWGL 2QSCL 5HHXH 4IM8A 1BPVA 2VLRD 3MZTA 2BNRE 3CSYA 4XGZB 4OF3A 1JF6A 2DBLL 3BGFB 1N6QH 5I1DB 4YXKL 3HI6L 1KB5A 1NL0H 5T5NF 3IDJA 3P30H 1I8KB 4J8RA 4CUCA 2UUDH 1FLTX 5IFAL 3ARDD 1FNHA 2VDRH 5GS2D 3RDTB 3ZE1F 3N85H 5F6HJ 4U6YA 5L2KE 5BVPL 4HG4K 5D2LA 1NBYA 5T1KB 4JLRB 3DRQA 5C1MB 3DX7B 5J1AB 3OF6A 5EIIB 3DUHA 2FX8H 5AYQA 1LO3H 3FOLA 1FO0B 2C4XA 4TVPD 1AI1H 2F58L 4YZFF 3HR5A 1DBAL 2BNQB 3OKOA 3TT3L 1UA6H 3B9KC 5FUOL 4K55A 1BX2B 3C60B 1ZT7A 1YYLH 5L8JB 1OD9A 3V0AC 3QHTC 1RUAL 1RU9L 4P9HL 4X6BB 1RK1B 1KIQA 4UTBH 1EV2E 1CFSA 1DUYB 4LCYB 5CKAA 1U91B 1FDLH 5IBTH 4Q6IB 3V79C 5DUPL 3FO2A 3MX0A 1WIUA 1LO2H 5D9SB 3L7FA 1PY4A 2VSCA 5FF6B 4DAGL 1PKQE 4C56A 5DT1L 3GRWL 4P2QE 1YMMB 4LHQB 2WM0A 1CVRA 2M8XA 5DHYA 3L1OL 1A7QL 1QFOA 2P5WB 4M1CD 3MBEA 4PY8I 5F96L 2DD8L 3EJYD 1PX3A 5C8JB 3QDGB 3BQUB 1MHEB 3WSQL 4ZTPH 1NGYB 5IVXE 2DI8A 5KBNC 3BZEA 2PNDA 2J8OA 1PKQB 5DD1L 3WFDH 1E6OL 2A6KB 2CQVA 3OKKA 1C5CL 3R8BB 4NQCA 4HH8A 2ZJSL 4EKXA 3RWCA 4XWGL 3C6LC 1HSAB 1N26A 5EIIA 2FB4H 3MLYL 3E6FB 3OKKB 4OZGE 5MP6L 2FH6A 3TEUA 4ZOAA 2VH5L 3NZ8A 1CK0H 3G9VA 1MCNA 3EYOA 4MNQE 5HVHC 5CBEB 1MNUH 3ZYIA 2DQHH 4U3HA 5HGHA 4WFGE 2BC4B 4OLVH 3B9KD 3RIAK 3F7YA 4X5WA 3O2VH 2XQBL 5IHUL 1T1ZA 4HS6B 5EA0H 4R7NA 4X83A 1JYNA 4UZGA 3L5HA 3SCMD 1PG7X 4FHBD 2MNUA 3FRPA 3TVMD 1AQKH 1P7KB 1AC6A 3E3QE 3O0RH 4DVBB 2EDWA 5F9JA 1MH5A 1RIUL 4L29B 1BZ7B 5DZLA 4PLNC 4NNYA 4MNQB 3ARYA 5IK3B 5JHLL 2MCPH 2AJ3A 2PW1B 5LCVH 5EUOB 4Q74A 3V5KB 2XNAB 2AK4B 4JZNB 3MRBB 4K9EL 4KI5C 2Q76B 5CP7B 2OM5A 5J0BA 2X44D 3EYQD 3I75B 4KMTH 3KYOA 3TBSA 3UP1A 4CN1A 2BVQB 3TH2T 3FQNB 4U6TA 3OGCB 5GS0C 5FOBB 1B4RA 4NZUL 2W65A 1FFPA 1T0MB 1FO0H 4LDOB 3FN0L 1INEH 2W9EL 1R3IL 2VSDA 3BXNA 2MQ3A 4QRRD 3VXOB 4HZAA 4HKJA 4EI5B 1HHGA 5C0NC 4PJCE 1J11A 4MCZB 3QCVL 1F2XK 3AUVA 3TH4T 4GOSA 2YMXH 1UCBL 3TYFA 4GW5B 2FEEI 2I9TB 3UBXA 1UJTA 1A2YB 3ARUA 3RKDC 3CCHB 1J05B 3KPTA 3IF1B 4BFGA 2EDHA 3FO0L 3G5XB 3RY4A 5F7UA 4PRNB 4DFHA 1AKJD 1JWSA 4JJ5A 3GBNL 3MUZ1 4J4PD 4LCYA 1BIHA 5JHDE 3JWDC 2QADB 5IKCB 4QRRA 2HVJB 1C7TA 3HMXA 3OKDB 2VH5H 3VD5A 3FQRB 1U8KA 3S3JA 4MD4A 1A21A 1DEDA 1HHIB 2F19L 1A5FL 1NCTA 1QD0A 4YFLF 5C6WH 1CK0L 3HE6B 5ANMB 3HZKA 1U8KB 2UWEB 2JLLA 5D71L 3NA9H 5C7XL 4LEOB 1QBMH 1M71B 5EU6B 4XHQA 3OZ9L 2OR8A 2CO6B 1HILB 2X4OB 4QHKI 5GS1A 3MRIA 1DBMH 2DBJA 3ZYZA 4R90H 5HGBB 5JQ6L 2X40A 1KSRA 3NFPB 1S7UA 2NX5E 3HI1A 4QO1A 1Q9KB 1QACA 3VW3H 2CLVA 4CMMA 4Z7WB 4IDJL 5E2VH 3TZVC 1RJCA 2VDMH 3K1KC 4M5ZH 4IRSD 5D2LB 2R4SH 1A9EA 4PJ8D 1CLZL 5TJWK 2UZIH 5HPMB 4M00A 3H0TA 3TA3D 2GCYA 4BKLA 3L1OH 4AH2A 4OCXL 1CT8A 4OQTL 1K2DB 5I66B 4P48A 2FH8A 5JW4N 2IQAA 1SHMA 4PRIE 3X14B 1OP3H 2NYYD 3MNZB 3KGRA 1EEYA 4RBPH 1D9KD 4NQCE 4H1LB 1QSFA 4W4NA 4KMTL 4ZUVB 2IH1A 1YNTA 5FUCE 3O8XA 2HVKA 2BK8A 2CDEB 2P8MA 4NFCA 3Q1SH 2BFVH 4KJPD 2NY4B 1JF1B 1RU9H 4P9HH 5EFIB 3O45B 4LCCA 1D6EB 5IVXA 3QDMD 2F54E 1IC4H 4KKNA 4GG6E 4ODUB 1BVLA 4PRBB 4OZGB 4Z8FH 2VLRA 2CK0H 3T8XB 4ZQKA 5F9JB 1MRFH 2OSLA 4O58L 4S1QH 3SGJC 3TBYB 4P0DA 4NQEE 4J1UB 2PW1A 4S2SA 4LLYA 3MUY1 1TTGA 1F4WL 3W5MA 5DTFB 2NY7H 4P4KD 3GKZA 1HXMA 3KYNA 1C16A 3MJ9L 4F9LC 3S35H 5FYLE 4HV8A 1ZEAH 5D1XA 4NM8L 2ZKHH 3DVGB 4MD0A 5CP3H 4GW4B 2NCMA 2OK0H 2WBWB 4CJ1A 4WWKB 3SDCA 1G7HA 2PCPA 3P30L 1INQB 3GIVA 1OW0C 3DVGA 3HC0B 5TE6L 4Z7VB 1EJ6A 2P24B 3QJHA 5FYJL 3LN4B 4XNQA 3VG9B 2QSCH 3EO1B 4X99A 3FT3A 2PCPB 5INDB 3SO3C 1XR9B 3SKUD 1FG9C 2Z35A 5DUBB 4K7FA 4M7ZC 2FJHB 1FSKB 1MJJB 4ONFH 3UMTA 3RWEB 3QFJE 1L7TL 2A6IB 4XX1G 3TFKC 3MODL 4G9DA 3VFOB 2QLVB 2R2BA 1XH3B 3JWOL 3W9DB 5JNYB 1HI6A 3RTQA 2GUOB 1NC2D 3MV8B 2QJDA 2BVYA 3I50L 1WBXA 5A2IH 4R4FH 4PJDB 1JMZA 4PJ8C 1UZ6F 3WXWH 3VWKC 3SCMB 2RHEA 2AJXH 3O6KL 2HFFA 2B7DT 1BWMA 5FF6A 1U8NA 3VXQB 4I4WA 5DRNA 4I18A 4HMEA 1S5IH 1WFUA 1F4HA 3I3BA 4WFHE 4AMKH 1RUAH 2EZ0D 1XFPA 2V2TB 4UINL 3QDME 5GRYA 1IKNA 2LU7A 4XTRC 3U7AA 3G9AB 4IOSD 1NSNL 1FG2A 1AGCA 1YN6B 4KROC 1P5VA 5D2NC 4M8VA 4QHNA 1C1EL 4S1RH 5E8NB 3MPCA 5HPMA 2I5YH 3GMNB 4N8VB 3KNBA 1NLDH 3QAZB 1P6AB 4J3SA 4NKMB 3FTGA 2W0FA 3C09B 1S5HB 1G7LB 3DWTA 1NGWA 1A7PH 3O2WH 4OGYL 4PG2C 4WHYH 4EQ3A 43CAA 3VFWA 2BDNH 2F5BL 3AAZB 1ZXQA 3EFDL 1U8OB 5F3BB 4X4XB 2AJZA 4KDVA 4RGOL 4CMHC 4PGEA 1VSCA 3BSZL 3MNVB 1JWMB 5IMOB 2B5IC 3QO1A 4OFDA 4FABH 3CVHL 5EPMA 4RDQF 4LCWA 4U1LA 1KFAL 4D9RD 5HI5C 1FL6A 3NPSB 5EO0A 5D7IF 4R7NB 4OZHE 1JHTB 3D6GA 3IJSA 4NZUH 5BJTB 5CWSB 1KJVA 1K4CB 2D0FA 1AIFA 1I8IA 2IFFL 3H9ZA 5BS0D 4X5WB 3GMRB 2OL3L 1YYML 1QFWH 3RWGB 3VD4A 2WWKO 4OZIA 3BE1H 1YC7A 3NZHH 5D8JH 4KKLC 4WJ5B 3JWOH 2DN7A 2C3VB 1L7TH 4HF5H 4CGTA 3QG7H 5CJOH 3DURA 4U6XA 2HH0L 3D39E 5BV7B 2VDPL 3H9HB 4D2NA 2QEJA 4HEPG 5FOJA 1MI5A 2EH8L 3BVNB 4IIQB 1TJIH 4YIQA 3VFGL 1AQKL 5DVNA 5E5MB 1IQWH 4BUGA 2JF1A 1JZ2A 1FL3B 4FQLH 2OR9L 4NO5B 4Q58C 5E99H 3BH9A 5ADPH 2APWA 2H41A 1J0KA 3HS0B 2BHUA 3Q6FA 4R26L 1B0GB 4JHWL 1EAPA 1CL7I 3FTGB 5JQHC 2VIRB 1DL7H 4ZXBB 2W59A 2VXSH 1BJ1H 3GZKA 3MJ9H 3FONB 1I3RA 4XPHL 3C6LA 4GS7C 4YR6A 1FVDA 4ZPTA 5DZNA 2XWBB 3EJZC 2DYPD 2WWKT 3BEWA 1DCLA 7FABH 4XBGB 2DLFL 5H94A 2R9HD 5IQ7L 1KENH 1OAZH 1NCNA 3U0WL 1QRND 1QQDB 4RFOL 1QP1A 4WENB 4K3GA 1OSZB 3GRWA 4MJ6B 5I1KL 4QHUA 2EDRA 5F7HA 5JOEA 4EI5C 4NWUH 3RNKA 5D7IB 2D0HA 2AJSH 2VE6B 4Z7WF 1XR8A 4ONGL 1A1MA 1UC6A 3V95A 3G6AB 3TN0B 1C8PA 3OKMA 5FYJD 3OJVC 2G9HA 3T4YB 4YHLH 4OCNC 5F3HB 1YN7B 1JWUB 3PQYB 5T1KD 4EBQH 3E1F1 1MAMH 2NY1D 4YBLB 1Y18B 5E1HB 1VPOL 3O9WD 4HXAL 2CKNA 3FT2B 2X6MA 2VLRE 3DOSA 1ZLSH 4LGRB 2BNRD 1S7RA 4YC2B 4WHDA 1U0QA 4NQXA 1T89C 4HPYL 2SEBA 1EVUA 1A9EB 4DWHA 4LHUA 4HFWB 3NCCB 3ZKMD 2C7UB 1VADB 3LV3A 1NFIA 5ELIA 1I3UA 4JDTL 1G7LA 3B2VL 3WV0A 1GAFL 1J8HD 5DVKA 2J2ZA 3L3GA 1OP9A 4QWWD 2VLJD 1ZOXA 4YGVA 3MACL 1N8ZA 1KYOK 4X6CF 3GM0A 2BSTB 2OR7A 3KWWB 4QHKJ 1HHJB 4NKOB 3F7YB 4NBZB 2HN7A 3SDXF 2ZKHL 2F58H 1AGBA 3D85B 2W0LA 4PGZA 2BVTA 4Y5YA 4BSVB 2VXTH 2XI9A 4NKDB 4YHKH 2OZ4A 1FL6B 1YMMA 2NY7L 4EIZC 1CD0A 1OLLA 2XG4A 4DUXA 1E28B 5AD0A 4E42B 2GUOA 4GQ9H 4I4WB 3CLEL 1DLFH 3HC3L 5HY9A 2VLRB 3IFPB 2V5YA 4P5TD 3EYUL 1IM9D 1OAXL 1XF3A 2EDBA 5JOPE 4JRXD 5KVFH 1NL0L 4GLRH 5CMAA 3IU4H 4QLRA 4JFDD 3BDYL 2XZQH 2YKLH 4ONHB 4H1LH 3V4VL 4NN7C 1LILA 1Q9WA 5C0CD 5I1HH 1QSFD 2NY6B 3HMWH 4UQ3A 1C08A 2VO5A 4JFYA 3VXNA 1XF5A 3GMNA 1A7RL 4RQQB 1P7QB 1EJOH 1FJ1A 4YNYB 5TH2A 5D1XB 2E7BA 2I24N 2CSPA 1ZMYA 5HVHB 3O2DL 2BMKA 3QJHB 3HG1E 2D03L 5F88B 2ADFH 5ETUB 4P23B 1INQA 3GIVB 5E5UB 2F74B 3SGEH 4XNYH 1N5YL 3VXUA 4ESKA 3WNPA 3FB6B 3UXFA 1WFOA 2CDFB 4J3XA 4HQQL 5ILTL 1MPAL 5EZIH 1WT5C 3MRJA 3Q6GL 5HBBA 1I1FA 1NCWH 3VU2A 1JFQL 4LVOB 4ODUA 4U31A 4AG4H 4UNVA 3Q3GB 1J8HE 4OCSH 4V1DE 4EJ1C 3OX8A 4UDUA 2IF7A 5T1MB 1WBXB 2NNAA 5A40E 5EC1B 2K1MA 5GGUB 4KRNA 3DETD 4HC1H 5GRVL 1KTKE 5A3ID 5IHBA 5KSUB 4ZMAT 4LLMB 2VDNH 4KI5E 2NMSA 1ZE3C 4TSAL 1KJ2L 1MRDH 3AFLA 3P73B 4K94C 4ZUTA 3MLWH 2ORBH 4WW2A 2XYCA 3DX8B 2YR3A 5GJSH 3UTSB 4HFUH 4G5ZL 3VFSA 2F53E 4PJ8B 2YA0A 1PY9A 4HLJA 3L3IB 4PJIB 5I17A 1FNSH 1LP9E 5F70A 3MREB 3UO1H 1K3IA 3BT2L 1VDGA 2JCCF 4XVUD 1IAII 4MD0B 3ZE0E 4ZSOA 1R5WA 2HLFD 4Y5XB 2XTLA 3V0WL 1ONQB 1DANU 1VGEL 2LQRA 4L8BB 1TVDA 1DP0A 1NBVH 2PTVA 5I66A 3IJYB 35C8H 4I77L 2ZZUT 3K4DA 4G6JL 3MACH 4OCLC 1I8MB 1JTOA 1JHKL 4YBHA 5IW3A 1MIML 4ELKB 1QSFE 1G7JB 1YEJL 5KSAB 1FO0L 3PWJA 4OCMC 4ETYA 5J6HB 3BIAX 4HUWA 3P4MB 5GISH 4ZOBA 4ZDHA 3HI5H 2AS5M 4QHMB 5DJ6A 1A6UH 2FO1A 5I75C 4LCIL 2E6PA 2HAZA 5JIIA 5EIQA 3HG1D 3MOAH 2R4RH 5K59F 1U58A 5LGJA 3RL1A 5ISZD 2YXMA 2R8SH 4LSUL 4U49A 3MOBL 2NTFA 3BESR 4PB0L 4XC3L 4XNZC 3HPLA 2A6JA 4DVBA 1JMXA 1FZJA 2A1WL 5AUMA 1QBAA 2ICWB 2VABB 5GPRA 1XIWD 1ZHBA 4U1GC 4WRLA 1KTLA 3IDXH 4O02L 5HYJB 3V6ZA 3K8LA 2I60L 2FD6H 2X4TA 3T09A 4U4BA 3BUYA 4IMLA 3D48R 5DD6A 5I0ZA 4X4YB 1CDHA 3HI1B 4OFPA 4IMLB 3RIAF 4BK5A 4EVNA 3LZFH 1GZPA 3T0EA 4QRQA 3AU1B 1WK0A 4KUZL 2F8OA 2YN3A 3WUWG 6CGTA 5F6IC 1HSAA 1S7RB 1KJ2H 5CUSH 5E4EB 3FAXA 1IAIM 2GITB 5EOTB 4WU5A 3ZKXC 1RULL 1QBLH 4TUOB 3I6LD 5FYLL 5KG9A 1FN4B 4G8GE 2XOTA 3TLRA 3P40A 5EOTA 2CRYA 4I48B 2MKLC 1QR4A 3VFPA 3O11A 1UT9A 1RD6A 5HHOA 3BW9A 2NY2C 5E99L 4PGBB 3GJEA 4JZOA 1IAKA 2NY0D 4X6CA 2EXYC 4I2XE 3C8KA 1QSEB 1Z0NA 4TQEH 3EHBD 1P4BL 1KCRH 4J12A 4PUBH 3P9WB 2J1KA 4NN5C 1EVTC 2NY3D 5FYKU 1RUML 3QIBD 2X4UA 1BQHA 1BZ7A 3TM6A 1V5JA 5D7KD 5JIPA 3VI4E 3KYKL 3L6FA 4DAGH 1U93B 5ERWA 4XCYA 5SV4A 4I0CC 1AKJB 3REWA 1R3LB 4Z7NE 3OAZK 1D5MB 4WDIB 4OTXH 3NN8A 1ZTXH 2VZVA 2W9DH 3PQYE 4N0FA 1MCWM 4JGMA 5M94B 2I9LB 4PY7A 5DVOA 1FL5B 2BVQA 1FAIL 3AMKA 4PJ8A 2UVEA 1OAUL 4YEFA 3HMWL 4W6XB 4R4BB 3QHZL 3HUJA 5F7MC 4AEEA 4MXVE 3MCLL 4G7YL 2ITDA 3SN6N 4PJ5B 4RIRB 3MRRA 4HLZH 1V7ML 4KROD 4XCFH 3E6FA 3NGBC 1VFBB 3RWIB 1FH5L 1SQ2N 2MKWA 3V0WH 2GK0B 1AI1L 2ICWI 5CGYC 3WE6B 4DGVH 5DVLA 1BJ8A 2WQRA 3HZVA 2EDOA 4TPRH 5HHMB 1AD0A 4ZUSA 4HGWA 3RKDD 3GSUB 4O2CB 5EZOH 4L3CA 5BRZA 4HUNB 3ZZ1A 1SVZA 5HGGS 3DRTB 4RGMC 3FFCD 4LEXH 4YC2C 4F7TB 5FV2A 4UQ2A 5CJQL 4PJ9D 5CSBA 3CVHB 3SGKC 5FK9A 2A6IA 4S1QL 2ZUWA 3ULUC 2YUWA 1A1NB 1T2XA 4MX7A 4NQSB 2R0KH 4HIHB 1AXSA 1MY5A 3O3EB 5E6ID 5ID0A 1AXIB 1DQTA 3VXUB 5JXED 1IC7H 3ARBA 4UTAH 3TA3B 1GVIA 4ZS7L 4LQFH 3MRCB 3VD9A 3SKMA 4GRWF 3P0GB 5I1CL 1RUQH 2VQ1A 1CFVL 2FCBA 4WI7A 3C5ZD 1IAOA 4ZUUB 1J0YA 5J8OA 1KJ2A 3S5LG 1TPXC 1WVZA 1SJEA 5H35A 1NJ9B 1Q94B 1GOFA 1OF2B 4LGSB 3WEXA 1C12A 4ONHA 4ALAL 4PBVC 2X4RA 4XAWL 3TO4A 2K7PA 2X1PA 5JMOC 5FM4A 1Q9KA 3R1GL 1KPRA 4WO4A 3UC0L 1UQSB 3QXAB 1AGFB 1N4XL 4LHUG 5FECA 1KC5H 1L6ZA 4OCXH 4XCCH 2BNUB 4ZUWB 3AREB 5C0ND 3RVVD 2PF6A 3UJJH 4YDLB 1TZHA 1JGVL 3FT4B 4CVXA 1M7DA 4W68A 4OGAD 3GMPB 4HUUA 3I02A 5ISZA 3T3PF 1ETZA 4X9GA 5KVGH 3WJJA 2KZ1B 5I18H 4O5LH 1A7NL 4JPKH 5HHOE 4B0MM 1NBZB 4O2FB 1RY7B 2AW2A 4WW2F 1AGDB 4HWNA 5LWYH 1KIRB 3V2AR 4Z76B 1LHZA 3N1PC 3I2CL 4DJMA 5BRZB 5EORH 1BFOB 1QBML 4GRWH 3QCTH 3OB0K 4BH7A 5E94A 3WNOA 1UXSB 4EN3D 1LEGA 2MJWA 3QDGE 4N9GA 1NCCH 1BZ9B 4KXZI 2KDGA 2I9TA 2P5WE 5GGRB 3PJSB 3QUZC 5ICXB 1Y6MR 3QFDA 5D7SH 5TE7H 4MZ2A 3W9EB 1YPZF 4JPIA 3OV6A 3RNQA 3JV6A 1CICA 4KRPC 4X4ME 2QR0A 2GJ6D 2CIKA 2VLKE 2YSSA 4JPIB 1C5BL 3THMH 2R69H 3RL1B 1MQKH 3O3BB 4R8WL 2YD8A 1KCSH 2IPTL 1C12B 2WIIA 3PUCA 3OG6B 3FFCB 4BZYA 1OSPH 5LVEA 2VXQL 5JZ7D 3V0VB 2KBGA 4FTVB 3EZ8A 3F58L 4OCYL 5DMIH 1S8DB 1CE1H 1RSFA 3GB7B 4PTTB 5D1QC 2C1OB 5LXGL 1JFQH 3RWDA 4PGCB 1Q0YH 1T21A 1QFPA 3ZDYE 2G2RB 7CGTA 2GHWB 1B6UA 3N9GL 4XT1C 1I8KA 4GKOA 4J8RB 5C0AE 3R4DA 4X5XB 2VLJB 3O6KH 5LAXB 4NCDA 4OFYD 3OJDB 1R5WB 4JN2B 5C6PB 1I7ZA 1G9NH 1NCAL 2VWEC 5HD8C 4PJEB 4IOFC 5F6HI 5E5RB 5TDNA 4PIRF 4OM0H 4H8WL 2XZCH 5GHWL 5EOCJ 1ORSB 3KYKH 2PW2B 1MHCA 3SBWC 1LWRA 4Z9KB 1JHKH 1VENA 3HLAB 4D9LL 4ZTOH 3GFUA 1ZA6B 5C0FB 3RUGE 2J4WH 1NAKH 4LASL 1P4BH 2HFTA 3CXHJ 4KI5F 1LK3H 1P6FA 2CDGB 4PJAA 5C0BE 2DQDH 5CJXA 1JK8A 1HKLH 4JQIL 3M17B 1K8DB 4LCCB 5IVXB 3FN9A 4UV7L 3RGVC 3BJ91 4GG6F 4PYGA 4HXBL 4XXCC 5C0DB 2WWMC 3RA7H 3P77B 2NY0B 3QDGD 4PJHB 1UZ8B 4K3JH 4N8VG 3ARSA 4KUZH 4OI7A 1HOCB 3X13A 5TDOA 3S35L 5BRZD 4OLUH 1O5DT 4KH2A 4MJIE 4C56B 1CBVL 2B1AL 2B1HL 4ZAKB 4XPGH 1DBKH 5DA4A 1RVFL 4M6AA 2FYYB 1JPGB 3QUKA 1FSKC 2VXSL 2V17L 5GGQH 4ZOEA 3OGOE 5E7FA 4YHNB 1FH5H 2I60H 4RFEB 1LE9A 3T04D 2F54B 4WCYH 1NFDB 4CAGA 2HN7B 2OR9H 2G5BA 4KKCC 1RPQA 2GJ6B 4CW1B 1PDKA 3O4LE 3I9GL 1RIHL 3F7PC 3VWKB 2IBZX 3IDXL 1ZVYA 4O02H 1VGKA 1FN4A 4JB9L 1ODAA 2UZXB 3WD5H 4ZS6D 2AJYL 4JY5L 1AHWB 2DIJA 3BGAA 1T0PB 3ARGC 5EO9B 5T1LB 5DHVH 5IEKB 1BX2A 1MELA 1UWEL 3C60A 3DXAD 1ZLVK 5BW7A 4JM4L 3STLB 4QRPE 3U36B 4Z6AT 4G8GB 3AGVA 4ONFL 2IQ9L 3MYJB 4LF3B 4J3WA 5MI0B 4F7PB 3FQXA 5DJZB 3C60C 3P0YH 3CSBA 2FEEL 3FL7A 4Y4HA 4ZFOA 1ZHBB 1IM3A 4WJ5A 1MAML 1BMGA 3UTTA 3WFBH 4L5FH 4N68A 3WIIL 1D5BB 4G6ML 4YHZL 4Y4HB 4ZFOB 2D0GA 4YHMH 1ZT4A 2JKXA 2NY2B 4KVNL 3ULSB 5I17B 2NY5H 4R4NC 3QI9B 3ARED 3LS4L 4AM0A 5KSVA 2QHRH 3OKEB 4QCIB 3TT1L 5I0DA 4NM8H 1C16B 4ZFOL 5TDPB 1R5IA 4EN3A 2Y06L 2GSIB 3DX9B 4P3DA 2V5RA 5CEXA 4MB3A 5DO2C 3SY0B 4RFOH 4OLVL 2YXFA 1I75A 3QULB 4FFVD 1CZ8L 3C5JB 1PGRB 3NMEA 3WNNA 4PS4H 1XF2A 3TPUB 3TCXA 4PRPD 2F54A 1S9YB 1F4AA 4QHMA 1IFHH 1MCWW 5DJ6B 5T3XE 4U3CA 5FM5O 3T0EE 1MVFA 1ZAGA 1BQLH 2ARJA 1UEYA 3MRDB 1G6RH 1KT2A 3KPPB 4M61A 1B6DA 2ZNWA 3TJEH 3UZVB 4K3DL 4JRYA 3QDJB 4NPYB 3TIDA 2A73B 5E6IB 4OIIL 1GYAA 2P8MB 3C6LD 3MCKA 3RRQA 2DQIH 4HH9B 2EDXA 2AV1B 1OAUH 1LK3L 3RVVC 3S36H 4Y2DC 1CDJA 3K4AA 4L8CA 1CLOL 1U92A 2J4WL 3P2TA 4LASH 1SEQH 2FO4B 3DGCR 3UDWC 5EZIL 4NQSA 3PG2A 4WNQA 32C2A 4N9GB 3R8QA 3LRSB 2KUTA 3CXDL 3FOMA 1WQVT 4WHCA 5CJOL 2DM3A 4Y19D 3KPOB 3JTSB 2B4CH 3O6ML 5HHPA 5FGBA 4KI5D 1EO7A 3O3UN 1ZLUH 1BFVL 2X7LA 3TP4A 3IETA 3U6RB 1KIPA 4YEEA 5IBTL 4F9LA 1T03H 5SWSA 5IMMA 2JB5L 2O61A 4WW1B 4NIKB 3MRRB 4YUEH 4G42A 4H0GA 4GKNA 1NDGA 2VLLA 3PHSA 3F58H 4OCYH 5DMIL 3GMQA 2B0SH 2LU3A 1PSKH 2VIRA 4ZXBA 4XMLL 4AK1A 4LSRH 2GK2A 4WHTB 3DO7A 5CLWA 2ZOLA 3H3BC 2P5EB 3BH9B 5DJXB 3EFDH 3ROLB 3TT3H 1C5DB 1MQKL 1BHGA 1JGLL 3X11A 3OAUH 2VR5A 4Z7WE 3PGFH 4R97B 1BF8A 2DQHL 1ADQA 1EBPA 3HZMA 4YHKL 4JM2B 5IB1B 4GQ9L 5FUZH 5ENWB 1DSFL 4Y4KD 2R2CA 3QA3A 1XGPB 5DD3H 3VH8A 5IB3B 4WY7L 1DL7L 4MQXD 4HJGA 25C8H 5FGRA 5FO8B 1BQHB 2IAND 4JKMA 5L0QB 4JO2H 2VXUL 5EWIH 3MNWA 2VDNL 2XA3A 3C5ZA 3O3EA 1MREH 3G6DL 3KPRE 4FQXC 4QTHB 3VXMB 1HSBA 1MHPH 3ZKND 2Z8RA 4NM4H 3ZT6A 1XF3B 4XCEA 1EEZA 3HG1B 4EZMA 3HPJA 2CLZA 5L6YL 2L7JA 1OM3L 1N2RA 3SKJL 3ULVE 5GRJL 3CU7A 2UUDK 3MFFA 4PJBB 3RNQB 4MAUH 3B6SA 4GRMB 4YK4B 2Z92A 4ZTPL 2XZCL 3EUUA 3WHE0 4U1HA 1MPAH 1I9IL 2ICEA 3CFBB 4M7KH 5BW7C 5EG6C 2X5PA 3C8HA 1S9XB 4LDEB 5KAQF 1A3RH 4U1HB 2W60B 5F7NC 3K1DA 1CFNA 1HQ4A 3QWRD 3EGSA 2YUVA 4PD4K 1KB9J 4OZ4A 5E24E 3U2SB 1S8DA 3SGKA 4K8RL 3VFRB 5IJKC 1CE1L 3PXJA 5IFHH 1MFAL 2O5ZL 4PJIE 3S88L 3GJFA 4FFWD 3U83A 4O9HL 4NCC1 1H0DB 3W0WB 5DUBA 2APTA 2P45B 4IDJH 5E2VL 4W4OC 1YEEH 3HB3D 4MQ7B 3U9UA 3EO1A 5JW4R 2BNQE 2VDLH 4G8GD 2XN9B 4OLWH 3BEWB 4CBPA 2RAMA 1DZBA 3G04A 1ED3B 2MHAB 3ROOB 2BX5A 3TN0D 3OPZL 2CXGA 3TIEB 5BV7L 4Z7OE 2DB8A 4DVRH 2W07A 3FN3A 1ZEAL 4M1DH 4KGJA 5ACZA 4UV4L 2DM7A 5I1LA 3JUYA 1JNLL 3D3VA 4GMSL 1OF2A 3MLWL 3CX5J 2EEAA 5GGSB 4OV5B 2Q7YA 1PG7H 2OJZH 1FZJB 1KXVC 4XI5D 2X4PA 1MRCL 4MNGB 1ZHLA 4ZPVB 1JK8B 1QFUH 4D3CH 1X5YA 3F8UB 1K85A 4HBQA 1KCLA 5J9PB 3RP1A 3U1SL 2IANE 4M6ML 3VGGA 3O41B 3QI9D 1MCEA 3F6IA 3RZCC 3GHEH 4IIQC 4Z78B 4NO0D 2EH7L 3QPXL 2KZWA 3JWOC 4QGTA 3PP3K 3TBVB 2CGRL 2PYED 4XRCA 4P23D 3LEYH 1Q8MA 1UCBH 3ULVD 2RCSH 4B5EA 4ZUWA 5I76B 3L95A 1IZJA 4QNPE 1DANT 4J3TA 1WLHA 4BUHA 1RZKL 4PJGA 1QLEL 2X4QB 1BREA 2YA1A 4GS7B 4X7DC 5I71C 1NFIB 1DN0B 1G7HB 4I3RL 5L88H 4OI9A 4XMPL 3VXRD 1H3GA 1X3DA 4BZ2H 4RRPA 3GSXB 1T1ZB 3KPNB 3LSOA 4NRZA 1R24B 5HHNB 2DJSA 2DTMH 4HH9A 4D9QD 3CH1A 2V9RA 5EO9A 4G6JH 5J13C 4JG0H 2YZ1A 2C4FT 4QXUL 3RDTD 4K9EH 5FDWB 4P2QA 4S10A 5HHNA 4OLYL 5DJ0B 4P4KC 4XP9H 1MHPL 3QZWG 1KXTB 4PTUB 1M7IA 3P4OA 4P2QB 5EUOA 3NCYS 3G08A 4NZRL 3ARRA 5C2UB 1U3HD 1NGPL 3NCEB 5E9DA 2DQJL 4X9BA 5T5NG 5I8EA 3U0PA 5GS1B 2FR4B 1MFBL 1ADQH 3REWB 4LEOA 1JI1A 4K3HA 4LRIA 5D7JC 5HI3C 1TJGH 1X6LA 5IK3A 1EAJA 3SE3C 3VD7A 1MIEL 1NMAL 3PGCA 5DDHA 5B4MD 1QBBA 4U0RB 1JNLH 1YNLH 3I02B 4LRIC 5D7JA 4Y5XA 3RPIA 5IVZB 1GGCH 1U8JA 1GGTA 2O5YL 1S3KH 4GW1A 1PSKL 5HYQB 3QG6A 1XGRB 1G7IA 1OP5K 3QH3B 3WFEL 4PJ7F 1CD1B 1H15B 4HJ0D 4HT1L 3DPBA 5KS9F 1HQRA 4HQQH 1MJJA 1S5IL 1P53A 3OR7B 2F15A 3SKOB 3QAZC 2AK1L 2YWZA 1I8LA 4XPBL 1KNOA 3EO0A 1RFDL 3NCYP 3MLSL 1KN2L 3CPLA 4RWYL 4IJ3B 1OGAA 4TVPE 5B38B 5AG9A 1S7VB 4JAMB 4OM1H 2A9NL 3RDTC 1OB1A 3VRJB 1KOAA 2R4SL 1U8QB 1U8MA 3QEUA 2YS4A 3DVNA 3HI5L 2V5TA 3HE7A 3IFPA 5HVFB 3CFDB 3BUYB 1A14L 1K4CA 4D9QE 1PEWA 4LKXA 2ZCKH 4DKEH 3N1QC 4RCAA 2BXYA 4OUOA 3ZHKA 1FV1B 2GTZB 3V8CA 4XNUH 1GZQA 5SWZE 2AERT 3GEWB 1A02N 4OFVA 1BQLL 3EDFA 2EH7H 5FYLH 2X70B 5CJ5A 3ARGA 3IDNA 5A2KH 1FQ9C 1JVKA 4HLZG 3CMGA 2CRZA 1A7OL 3SGDH 1OTTD 1FBIH 4LSQH 1NC4D 1MJ7L 2YPLD 1QFUL 2J5LC 1ULVA 4Z0BL 1ROWA 4FQIH 4WI4A 3WE6A 3TPUA 5DUML 5E08L 5DD0L 4Z7VA 1EBAA 2NW3B 1KCVL 3T0VA 5J4MA 4I2XA 4KJYB 4PJHE 1TCMA 3DX7A 2QQNL 2AKRB 1D6EA 4FXGA 3V6OC 4LAJH 1UM6L 3VGDA 5TQ2H 1KJ3L 2R0WH 1U2HA 4PRAA 2OMBA 2P1YA 1SYSA 1WC7A 2E8YA 4CDHA 3KPSD 3N1MC 4YWGH 1HXYB 2EH8H 5F1NB 3TIDB 2ZUTA 4JG0L 4I3SL 1FAIH 4I3GA 2ZSVB 1RZGA 5DQ9A 1CICD 5D1ZD 3RTQC 2R39A 4HIJB 2QKIA 2HFEA 2Q6WA 1QQDA 3RX5A 4LLUB 4AQOA 1BFSA 4L8SA 4OZFG 4S0TD 4XZUB 4ELMF 5HPOA 5K93A 1DFBL 3KR3H 1JTPA 3Q2CA 1JYVA 1F58H 1L0YA 1A3RL 5ID1B 1BLNB 4PJHA 3MYZA 1KPUB 4J1UA 4LPWA 4P3DB 4L9DA 1UACH 2O61B 1I4FA 1I9JL 4H26A 1FDLL 5C0RH 2FX7H 5EUKB 3AB0B 4MSWB 1VFBA 2DICA 3GMQB 3QPXH 5C2BH 1TTUA 4GAYA 5ITFB 3D0LB 3SY0A 1B3JA 4EUPG 4WW1A 3SKJH 1D5ZA 3ZKMC 4RX4D 4G3YH 4NC2B 3KPRB 4R0LB 1NANI 2YD4A 4ZYKB 3O6FC 5GRUH 3I6GB 4MJ5B 4JFXA 1G7MB 4R7DA 4X6DA 5GS3A 5I1KH 2EIEA 5JTWA 1ITCA 5DSCA 1S5HA 2XKSA 5TPWL 1A1OB 3VFNA 5KOMC 5SWQB 3O3DA 1W72H 4L4JA 1BQSA 1S78C 1NMBH 2XZZA 4GW5A 3KPNA 4YHPB 2E7HA 4KQ4L 4WTWA 2VLKB 3B2UC 3ZKQD 3ZT7A 4EEEA 4HIHA 4YDJA 3PWPE 4EDXA 1BZ9A 3CDGB 4RAUB 1CGXA 4LRNH 5JUEH 3ZHLA 5KN5B 5EBWB 1FYTD 4NC1E 1KJVB 4OJFH 3N85L 4BK4A 4EUPH 2UY6A 4A6YB 1QNZH 1AP2B 5FYKL 5JW4M 4HGMA 2DLGA 2VTFA 1KYOJ 1PZ5B 2FNBA 2EE6A 2FBJL 4PJDE 4ZFGH 1NGPH 4R2GC 2DBLH 2FEDD 2YD2A 4LARH 2ED8A 1WEJL 4MD5A 3TF7C 4HUVB 1IGCL 5AD0B 3LVEA 4O2EB 4WV1C 12E8H 3DI2B 2X9WA 1NFDF 3VXMD 1HDMB 3FQWA 4NDMB 4UBDD 1D5XB 3NCJH 2IADA 4NKMA 4QCIA 5FGBC 1CGYA 2XV6B 3H42H 4XPFL 3UAJD 3IDUA 3QG6B 5TF1L 3QUKB 3KPMA 3WJJC 5L88L 5DJ2A 5D6DC 3VFTB 5DFTA 2V7NA 4YO0A 2EDEA 4BQBA 4DN3L 1CR9H 3IJYA 2H32H 3RZCA 5E56A 2MCPL 4M43L 3L3GB 1URLA 3WD5L 4X7CC 5C0IA 2MTPA 3BH8A 2W0FB 4NPYA 2EYSB 2Y4SA 2DLIA 2JJWA 2YWYA 1ZLVH 5DSCB 3HZMB 2PR4L 4Y2DA 1FGNH 5DRWB 1KJ3H 4YJZL 1EUTA 1JPTL 1PQZA 4OAWB 4NO3B 2EYSA 4C83A 2VB5A 1EEQA 4W6YB 2JJSA 1RHHB 2NZIA 2ZCHH 15C8H 3MRGB 2B4CC 3B2UD 4PJAB 5DD0H 2FJGB 1T4KA 1UJ3A 2EC9U 3U36A 4JO1L 4Y4FA 5SWZB 1GGIL 5MEOA 5TE7L 1ACZA 1P5UA 3OXRA 2YSSB 4GRLC 2G9HB 4N1EA 1HCVA 4HMDA 2KL6A 3UBXI 1MIEH 4X7TB 1A7OH 1XR8B 5GGSA 3U6RA 4OV5A 3MOQA 3VJ6B 4MWFA 4UB0L 3OKDA 5EZJA 1T04A 1T83A 4DZ8B 4E9LA 4ZD3H 3CFIC 1JZ3A 2Q8AL 2P8PB 4JQXC 5A16B 5I19L 5DD1H 2HKHH 3ABZA 3D69B 4Q0XH 4X7SH 3QDGA 5EU7E 4GRLD 3WN5B 1E6OH 5JPNA 4EQ2A 3HMXL 4Z7QF 3LAFA 1WT5A 3MLTB 2AAVA 4QYOA 3OXSA 5D6CA 5E2TL 4WWKA 1GZQB 3HNTH 3LKSB 3OWEA 1N5AB 5C2BL 3I6KB 5CJBA 1EA9C 1JGVH 3PXHA 5SWSD 4ZFFA 5HJ3A 4LDLB 2FX9L 2JCCB 1H0DA 5IIEB 5D6CB 1L6XA 5GS0D 5GZOD 5F96H 3H3PL 2D7QA 4XPBH 4LP4A 4PJIF 2OYPA 1B0GA 4IDLA 1LNUA 4RAHA 4BKLB 4TTDD 1NCUA 4FXGB 4LLDB 2X41A 2MFNA 5FB8A 2VAAB 3H42L 5F89A 4UIMB 5DT1H 3NZ8B 3AS2A 1T6VN 5ESVB 4ODXA 3I85A 3CSPA 4F2MB 5EU4A 3FJTA 3GI8H 5GGVH 3SDYL 3SOBH 1A9BB 4YHLL 2W9LA 4P2CG 4RGNB 3GUTB 2ESVA 5J3HD 2EXYD 4BH7B 1E28A 1UH2A 3WFHB 3D2UD 1S7WB 1UKSA 3MSPA 1Q1JL 1OSZA 1UJ3B 3Q3GA 5JXAL 1TZGL 5CP3A 1RZIA 1CGVA 1LGVA 1FGVH 5DS8B 1Q9LA 2E9JA 3KPLB 1JPST 1FVEA 1XGTA 4NN6B 4X6FA 5GGQL 5I8KH 1BM3L 2IPTH 2JIXA 1X5GA 2QSVA 2P7TB 2KQMA 1A0QH 3ZKSD 3VRJA 2QTEA 4U1MA 2EDDA 1INDL 1M7XA 5DQDL 4Z0BH 4FQCH 1EK3A 4JFYB 1MJ7H 1JV5A 1SJHB 2H32B 1FPTL 4PJIA 5I1DA 2PXYA 5C09D 4PFEA 1ZGLB 1YECH 1QVOB 3DV6B 1AGFA 4ZNEE 3PWUA 4YDLC 1CN4A 4K3JL 4UU9B 1I9RL 1TZIA 1FYTA 3LS4H 3VFTA 1P7QA 5EOQL 4RISL 4BFIB 1AQDA 3RU8H 4LVHB 1S7XA 1QYGL 3TC9A 1QG3A 4G6MH 4AH2B 2RR3A 4CNIB 4URTB 5DHVB 2AJZB 5D7KE 2WQ8A 2WLZA 4Z7OF 4XCNB 1K6QH 3IS0X 4HKXB 2PXYD 4JFQB 5C09A 3V5HA 2X4SB 3VFMA 1HQRB 4AZ8A 3F12A 4NKDA 1MCIA 2NW3A 1I9JH 2GITA 5E8OA 4UNUA 4FMFA 2Z31D 1D6VH 4MX7B 1BFVH 1UWXK 4ENED 1SJVA 3PHOB 3H3PH 4BQ8A 1F58L 3P4NB 3GIZL 1OAQH 4R4FL 3D85D 3BEVB 4XP6H 5BJTA 2QKIB 5C0EA 1FZMB 1TLKA 4OB5H 3HAEB 2DM2A 4L4VD 3EO9H 3P4NA 3C08H 2VE6A 5AZEH 2G60L 3KPLA 3O4OC 2GJZA 1CF8H 3QRGL 4GBXD 1U8MB 3QEUB 3M8OH 2X4UB 5ICYB 4LARL 5F7YC 4D94A 2X4TB 2BSRA 2V6HA 3T1WA 1T1YB 4IS6A 5A16A 3SJVD 1L9NA 4Q0XL 4YWGL 5L6YH 5DRNB 3QB7C 3VA2C 2E27L 5ALCH 1N0XL 1XT5A 1I8LC 4Z78A 1RJZB 5I1GL 2WUBL 3MRLB 4MDJA 3WYRA 1VESA 4U6VL 2UZYB 1Z9LA 4O4YL 3B5GA 2VN4A 2AGJL 5HGAA 5DK0B 3IRPX 1TZIB 1S9YA 3GBNH 1C1EH 4MSWA 3QXAA 6FABL 3KYOB 3QYCA 4HKJB 2R0ZL 4KKBD 2D7TH 1LE9B 5A43C 5KJRH 5DQDH 3U4EA 4OLWL 4TNWK 2GT9A 1E6JL 1NFKA 1MCOL 3DETC 1B4JL 5TDNB 3KLHC 2D9QB 1T5XA 3V52H 1RV6X 5C0CA 4TSCH 4NC0B 2P49B 4HJGB 1YMME 3AM8A 2XN9A 1AGBB 3OG4B 2FX7L 3QXDA 4F9PC 4QXGL 2CD0A 4NBXB 5HHOB 3BD3A 2P4AB 1RJLB 2BHYA 4PB0H 4XC3H 1CIUA 2CK2A 3DVFA 4JREB 1UXWB 4DOHB 4PJDA 1CXIA 2J88L 4EOWH 5IT2H 2QQKL 2H2SD 4FG6D 3ZYOA 3VFSB 5D8JL 5DJDB 1U3HA 1AO7D 4L8SC 1RQ5A 4RA0C 3IETB 1E4KC 4HUMB 2WIIB 4G43B 3MBED 4JCMA 4LOUD 1BBJB 3UTQA 3UYOD 3NIGE 3WHXA 3C9NB 4KZDH 1QRNE 2N56A 2NTSP 5EBMA 5HDQH 1SY6A 4YAQA 2E7MA 4ZNCD 5KW9H 5FKAA 1B90A 1KPVB 5I73C 1J1OL 4PJHF 5AAMA 4OGAC 5F9OH 4FN0A 3PV7A 3PDOB 5IF0A 3CU1A 5T5FH 4NKQB 1VA9A 4PY7B 3H9HA 1KPVA 3BPNC 4OKDA 2YPKB 2BY0A 1KB5L 3FO9B 5FOBA 5GIRA 3T1FB 3K8KA 4ELMA 3E2HB 5CEXB 4RA3A 4NHCH 2WZPD 1UH4A 4S11A 3VXUE 3BMWA 2D7NA 4JFEE 4C59B 1NUGA 3P11H 5IEHB 3FRUB 1BP3B 3CFEB 1IQDB 3QEGH 5HJ3B 4ZD3L 3JWDH 1U8LB 4MS8D 1OPGH 4GLRI 1T5WB 4NO0B 1JGLH 4L3CB 4G6FB 4UUJB 5DR5L 3KYMB 4O2FA 5SX4H 4RWHA 1A0QL 2AXGB 1U8QA 2HFGL 1BM3H 4FZEH 4Q6IA 1L4IA 4LVNB 5DRZB 4LOUC 4G8GA 4LKXB 4TPRL 4JFZH 4Y4FB 15C8L 3SBWA 4W81A 4M8QA 1TCRA 3REVA 3MFFB 4HPOL 4PJBA 3OB0H 5DC0A 5L7XL 2DDQL 3L7FB 1OB1B 4YHOL 3M8OL 4BQ6A 1RURL 3OXRB 2MOVA 1EGJL 3LEVH 4PJ9A 5ID1A 5CD3A 1VACA 1EHLH 4NCC2 4O2EA 5FEBA 3SGEI 4OD2B 1UQSA 4U2ZA 2FJFA 1M05A 3HE6C 3MCG1 2DWDB 1N4XH 3ZKXB 5J1AA 3JV4A 1CFQA 3FFDB 3O81A 1SY6H 2G5RA 3SDDB 3PDDA 1QPXA 2DWEA 2PO6B 4F58L 2NY6C 3LIZH 5I1IH 3SDCB 4OZFB 1BD2B 5DMJB 3EDJA 4N5ED 5E8NA 4JN1L 5EC2A 2BNQA 3OKOB 1B0WA 1YQ2A 2ADGB 3PIQA 4QT5A 1QVOA 3DV6A 3W0WA 3ZL4H 5E2TH 2IFFH 4DK3A 4GG6A 4I0KA 4DN4L 3V6OE 4UQ2B 3PWPB 3TYFB 4P2OA 1YDPB 5C0CE 4NZTH 4OLXL 2R2EB 5JW5A 1OL0A 2NX5D 3ZDYF 3ROLA 3WN5C 5IV2A 1A1NA 5J12B 3RVWC 5CFHA 3BRFA 4W6WB 4Q9QH 2ERJB 3QIWA 2VLME 1D5IL 4PP2B 3EIFA 1PKOA 4GO6B 1UWXH 4FXKB 5C07A 1SMOA 4LK4A 3BP7B 4DQOL 4UDUB 1FZMA 4UT9L 3TWCH 4JFED 1JZ4A 4K7FB 4GRLA 5MHSD 4GKSB 1J1XL 5EU3A 5EBLA 3FB5B 1KIQB 1MJUL 4HUVA 1T3FA 4O51B 1GXEA 2CIKB 1MFCH 5D1ZA 3DROA 1E4XL 5L2JB 1IAOB 4ZUUA 5HYSB 4XCEB 2H3NB 4JDZA 5FHBL 3MC0A 4U6VH 4AEIL 1CWVA 5C86A 4NZRH 3MLYH 5IW1B 3B9EA 1JGDB 5F9AC 5AYUL 3S96A 2YD3A 3U9PH 4AENB 4Y19A 3BKMH 4M7JL 1NKOA 4HD9A 1N0XH 4U1JA 3QT2A 3S9DB 1GL4B 4CVZB 1FFOB 2A6DA 3EYQC 4Y19B 1UM4L 4FZ8H 1ZKAA 4ZFFB 3ZE1E 3CFCL 1FLRH 1Z6JT 3CX5K 4XP4H 2H2PC 1NBZA 5IFHL 3EO9L 2DI9A 3NFSH 1RUPL 5LKNA 4R7DB 1VADA 3LV3B 4JZJA 2ZG2A 4PREA 3MBEC 1A7QH 1Z2KA 4R97C 3DBXB 4OGXH 4ZDHB 1NCAH 3C6LB 5IMKA 4N8PA 4NYLA 3B8SA 2HMID 3GMOB 3ILPA 3RVUD 1W0VB 5DI8B 1LD9A 1SEBB 5LCVL 3VG0H 1XF2B 4Z0XA 4U3XA 3KG5A 4WCYL 4HAGA 1CLYL 1JTTA 4PGEB 2H6PA 1NCDH 4LVHC 3QFDB 4KJQC 3WEXB 4HS6A 5DGQA 2NQCA 4QF1A 5T3XL 3VXTA 4F3FB 1OSPL 5E9DE 4Y1AB 1OAZL 3PGCB 5DDHB 3HCVA 1I9EA 1VEMA 3QCUH 3DURB 4TVPH 1KCKA 4HJJH 2Y7QA 4DZBA 2ZPKH 4XMKH 4X4YA 3T0ED 5DUMH 5E08H 3DHJA 4PRHE 1FG2B 3AMLA 3D87B 3ELAT 5BOPA 5BVPH 5AWNH 2FWOB 43C9B 3OKNB 2BVEA 4PLOB 1BGXH 5FKPB 4L3EA 2YBRA 4MCZA 2AEWA 3VXNB 3UTZA 4P4RA 1NCCL 2VZTA 3RWJA 1OP3K 2IAMA 2VISA 1FCCA 4LLWB 3LHPH 1IQWL 1BQUA 3VFRA 3MV9D 1NGZB 1WWWX 2GK0A 3SKNA 4AL8H 3L3OA 3WFBL 2FATH 1QPPA 2ENSA 1YY8B 5BO1H 5IESH 3DYPA 4OCSL 2P42B 4WTZG 5HI4C 1SJXA 2WBJB 4NRXA 4UIMA 1XIWA 3BPOC 3WIIH 1JWSB 1UADC 5A3IC 4PB9L 43CAB 4JDTH 5FM8A 1D9KB 2JJUA 3IXAB 4XNXH 2AXGA 1CG9B 2CKBH 3QQ9D 4M6NH 4IMKC 3D85A 2Z8WC 1ZLUK 4MD4B 1VFOA 2JJTA 1T20B 4GT7A 4XWOC 4G8IB 1JYXA 5DC4B 3QQNA 4TULL 4X7FC 4JB9H 2IGFH 4Z95H 3A67H 4KY1H 1EEZB 4Q9CA 2AK1H 1YY9C 5L9DH 1JL8A 5D1QB 4I3SH 4IRSB 5TDOB 1EJOL 5F6IB 3LS5L 1A7RH 5F1OB 1I7TA 1A4KA 2VDML 4M5ZL 5EU7C 1I7RB 4FQXA 4L3EE 5KTEH 3P0VH 3SDXE 3U4AA 4ONOA 3DMMC 4HWEH 3B43A 1MI5B 4KKLD 5HGBA 3U46A 3WJLA 4POZC 5JOFB 2E6JA 1AQDB 2YKLL 1CFTB 2O5YH 5E9DD 2J8UE 3KPMB 2HLAA 1WZLA 3T1FA 2JK5A 3LRGA 3T08A 4Q6IC 3RVTD 2Z91B 3UJIH 4TNVF 3ALXA 4O4YH 1OTSC 5EUOF 1MQ8A 5MP6H 3QCUL 2X4QA 1NFDA 4PJXB 2VRAA 1CLCA 3AS3A 1J1XH 3LQAC 4HS8H 3V4UL 4JKLA 1U2CA 5I73B 4UT9H 3VWKA 2ZUQC 5DRWA 4JQIH 1T5WA 1IC1A 4HXBH 1T83C 4OCWL 2LU4A 2ZSWA 4AIZA 2ZSVA 4LCWB 1HKFA 5IB3A 4LSDA 3F7VB 4MYWB 5C0RL 4K94H 2X89A 4JY6A 4LCUB 4UUJA 1RIVH 3FO2B 1WTGT 1AP2A 3QCVH 3CD4A 1KF9B 4Y0GA 4PTUA 2H26B 5D5ME 1RJLA 4ODSL 2C26A 1N5YH 5AEAA 3F5WB 3LRSA 4OFKA 4X8XA 2X4PB 1TQBB 4BM7A 1NCBL 5HYSA 4BFEA 2HLFC 4M03A 4M6OL 3KYNB 5IVNA 1DFBH 3VGAC 1FRGH 3MRFA 1LMKA 4NQEA 3UTPD 3VG9C 5HSFA 3WXVH 4FTVD 3TVMA 4F37K 1RZJC 2A2QT 2XWTB 1CTNA 2A9MH 2V2XB 1ZHLB 4P2QD 3OAZH 4YXHH 4YBQC 5DEGA 1YN6A 1MLBA 2CMRL 3C5JA 5FHAH 1B0RB 3IJHA 4JKKA 4JFFA 3I6KA 1G6RL 3MJ7A 1XR9A 3F65A 3UX9B 3AXLA 5IMLB 2QQNH 1Y6NR 4K71C 2J8HA 2NY1C 4LHUD 4JJHA 3VXSB 5F71A 2D31B 4OZ4B 4YDJB 3AS0A 3PIQB 4QT5B 5FCUL 2XICA 3PWVB 3B5HA 2WBJA 4D3CL 1TPXB 3PGFL 1C5DA 3FONA 4R2GB 3MV01 1CIDA 2EO1A 4RMQA 3BAEH 1IL1B 1QRNA 4N0YH 3OMZA 2AXHA 1KGCE 1IGML 3OF6D 2OJEB 4HJJL 3MO1B 1TVHA 3TGXA 3IFNL 1F90H 3GMOA 1W72L 2AV7A 4MJ4A 1W72A 5ACZB 3KJ6H 1I85C 3EOYG 1TITA 3WL9B 5IB2B 1CD9B 4NUJB 5I16A 1Q94A 2V2WB 4OLXH 5T3XH 5KSUA 1AD9A 4JANA 4KZEH 4S1DD 2EE3A 1DQLH 4BQ9A 3MV9A 1A47A 2VQ1B 2GY5A 1OGTB 3MUJA 4Y4KA 4KI1A 4NFDA 2P5WD 4OTXL 3MV9B 3FT2A 4XMPH 1NLBH 3SE9L 3X3FH 3BPCA 4NZDA 1KB5B 4DW2L 4JG1L 3VXPB 2R4RL 4NN7B 4XCCL 4ZSOB 2G2RA 1AE6L 2HG5A 5T33H 3QI9C 2XIDA 4TUJB 4YHIB 4M6NL 2DYPB 3RPKA 3JVGA 1W2KT 4XNXL 5K9JL 3QNYA 1S7QA 1TENA 5DJAB 5DFWH 4EI6A 4PJXE 3QDJA 1HHHA 4EDWH 5IMLA 4OZFH 3E8UL 1M7DB 1OAYL 4HHAB 4PV8A 1FVDB 4ZPTB 3F12B 4I77H 3PWVA 4QRPA 5LQBH 1HHGB 4UTAL 5D5MA 2N7AA 4MAYA 1L0XA 4MQSB 4XBGA 4YPJA 4X4ZA 3BW9B 3RTQB 2VC2L 2C3WA 2X10A 3BIKB 5I71B 1ND0B 5B38A 2VXUH 2WV3A 4PS4L 3UTTE 4V1DA 1A6TA 1II4E 5GGTL 1EFXA 3C5ZB 1WCQA 4G43A 4NNPH 4F8QA 5FDWA 3HE6A 3OKMB 3L3DB 5DEZA 5E6IC 5GGRA 3BZDA 4MNGA 5FCUH 3EOBB 3VMNA 3TZVD 4FQCL 3L6FB 32C2B 2V2WA 1GGUA 3QFJB 4LPYA 3BGMA 2VDLL 4UT7L 4LSPL 1QUNA 3S34L 2ARJQ 4XBEL 1JWUA 5CJXC 1NJ9A 1KTRL 2DQFB 3NCFB 1N6QL 4J2XA 1FGVL 3HHRB 4U0QB 1S7SB 1V7MH 1G0XA 3H0TB 1FZKB 1NUNB 4K8RD 3D69A 3DO7B 5IIEA 2B8OT 4R0LC 3WJLC 3CZFB 3RX7A 1BBDH 4OQTA 5IHLB 3KXFD 4WGWB 2VDPH 5I9QB 4RQQA 5D7JB 4XVTH 2HT4C 1H3VA 3OXSB 3VRIB 3QEQE 4PJXA 4N0UA 1J88A 5JIKA 4OM1L 4KMQA 1K5NA 2AJXL 3C8DA 1O0VA 3PNWA 3FQUB 4P9MH 1YEIL 4L4TD 1R6VA 4MZ3A 3QUMB 4K7PH 1DBJH 5BRZE 5EZLA 2ICCA 3VRIA 1OAQL 4JFHE 4N0CD 4QTIH 1LK2A 1U9KA 3R0MA 3QDAA 1I3RB 2FECI 4XBPB 4Y4FC 1YY8A 2R9HC 1VPOH 5SWZD 5JR1H 5ESAB 3KPQB 4HIIA 5GRJH 2XN9E 2IH3A 4LLVA 5I1LB 2GTWB 3HUJE 3LPGA 3SEPA 2C1PB 3LKQB 3AROA 3A6BL 4WWKC 3GHEL 3SQOH 1WCBB 3TJHC 1EZVX 2FO4A 1X4XA 4WHYG 3PWNA 1IMHC 1DQLL 3O4LD 1AO7A 2YPLE 5D2NA 1F4XH 4JEGB 1DE4B 1F8TH 1IC5L 1U93A 2HRPH 3STBA 2VDKL 1NUDA 2ICWA 3V4VH 1P4IL 3WLBB 1QKZH 2VITA 1D5MA 4YFLI 4PJDF 4FQPA 1LEIB 3S36X 3GSVB 3O6LL 4FQXB 4U05A 2AGJH 4OZFA 1DUZA 1YECL 3QUYA 2DMCA 3QJFA 7FABL 3X3GL 4YHYB 1Q9WB 3ZDZF 1JHLL 1DVFD 1OAKH 3NFPA 3ULVF 2JCCE 5CEYA 1AHWC 3OR6B 4PGDB 5EN2A 5SX4I 3H9YA 3OGCA 4U1KA 3QULA 1CDIA 5DJ2B 4MHHI 5C0AA 3PWLA 5JORB 5FYLD 4DCQB 4PRDA 4Z7NF 5A2FA 3RWCB 3GMPA 4HUUB 2WUCH 5ISZB 1R0AL 2UVFA 1CL7L 5FYJU 3FRPG 3WSQH 2Z91A 1LD9B 1SEBA 3P4MA 2OCFD 5ILTH 5DMYA 4TUOA 3P3YA 5IMKB 5EZLB 1I8MA 3GMLA 1YDPA 4QXUH 4H8WH 2E7LC 3UJJL 1I1FB 1DJSA 2CUIA 4P2OD 3KXFE 4Y2DD 5DURB 4E0RA 2EICA 1RHHA 2NX5A 4KJWD 1HN1A 2HT2D 3GNML 2HMIC 3CCHA 4J3VA 4IRJA 4XNMA 4FRWA 2JJVA 1CE6A 4HPYH 2XZAL 4L4TE 3ALPA 3O6FD 4IRZL 2HT3C 1F11A 1PEZA 5DA0B 3EOTH 4KK9D 3C8KB 2Z9TA 3TESA 1HCFX 1KTLB 2FGZA 4XP5L 3P9LB 4JFOA 4HCRA 4U1JB 1FVEB 1XGTB 3HPLB 1ZV5A 3TA3A 2HJFA 2DLHA 4Q6YA 5H2BB 5HYJA 4ONGH 4PJCB 1M4KA 4P57B 3O0RL 2IG2H 2B5IB 4MQXC 3HFMH 3UTSD 1LO0L 1G6VK 4M1GL 2ILLA 5D7LB 5IMMB 1I4FB 2J8UF 1CVSC 3MJ8B 1EHAA 1G9NC 1S9XA 1CDGA 3BSZH 3QIWC 2V9QA 3EYVB 1NQBA 1G7IB 4M7LT 4FFZH 4NO5A 1TNMA 4QXTA 1QHOA 4OJFL 3DBXA 2GSGB 3IDYB 3G6JE 4BZ1H 5EOCL 3HUJB 2Y5EA 1EPFA 5LGHH 1NGZA 5CJ8A 2VMFA 3VXSA 3VWKD 2Z0BA 2VC2H 4PV8B 5K9KB 2R1WA 3B9AA 4ZNEA 4TUJA 3WO3B 1G7JA 5F7DB 1GIGH 3GGWA 1T2QL 5HHXL 5BZDB 5FM5M 3W39B 3H7BA 1S7QB 4NZTL 5DJ8B 1KN4H 2HVKB 3ARZA 5FK9B 4D0CB 2CMRH 2BC4A 3B83A 2YPLA 5D2NE 4K7PX 3M1BB 3W39A 4K2UL 1AIFB 3LMJH 4ZAKD 2E9WA 1NDMB 1BIIB 2ADIB 5LGJB 4QRTA 1RK1A 1CF8L 1EHXA 1IBGL 4LVOC 4GG8B 3GJFH 1P9MC 5EBGA 1J0IA 2OTUA 3VJ6A 1KTDA 4QF1B 3CXDH 4WUUA 5CLTA 4HK0B 4OM0L 2ADFL 3VWJB 3BP4B 4BQCA 4HKZB 3LN5A 4NUJA 2NY6D 1IKFH 5E8EB 2YA2A 1RUKL 2ZOKA 4IIQA 1Q0XH 2A77L 3ARTA 3QR2A 2QQKH 4R4BA 3NAAH 3MA7A 4FFYL 1L9MA 3JVGC 5T1KA 2Q87A 1Z9MA 4KKAD 3MLUL 1BJ1J 3MRQA 3FCTB 3DX9A 2WP3O 3OZ9H 5TGBA 4J7RA 5L0QC 2P8LA 1RULH 1QTYT 3OJDA 2D31A 4ZFGL 1ETZB 2R29H 2P24A 4Q7DA 2HTKC 4G7VL 5F88A 4IJ3C 1TMCB 2R1XB 4KWUA 4PJ7E 1B4JH 1JRHI 1NEUA 4LLAA 1T21B 1CDCA 1QSFB 5FHBH 1KCVH 3BRGC 3CPLB 1HYRC 3H3KA 4LRNL 4Y16D 5FUZL 4X98B 1X4YA 3ZYJA 2VXTL 1YQVL 2NX5B 3CLFH 1S9WA 3PP4H 4F7CA 1ITBB 3SCMC 5GJSL 1P4IH 2A73A 5I30H 3IDGA 3FQTA 5MEQA 3OJ2C 2XG5A 3PJSA 2OSLB 2IH3B 1T0NB 1D5IH 5SWSE 2CKBA 3MLRH 4RFNC 1BD2D 4JQXA 5C0BB 4JANB 5KANG 2PO6D 5F9OL 4M43H 1BVLB 4PRBA 1DQJB 1H8NA 2X2YA 5EU6A 2R8SL 1E4JA 2P47B 2V2TA 4EVNB 1EX0A 4PJFF 2IQ9H 5EUKA 5C70A 1FIGH 3I75A 1CYGA 4FP8H 5ANMA 2XZAH 1OY3B 4NHUB 5GRWA 4L3ED 2Q76A 4K7PL 5J3HC 4H0IA 2BHZA 4U1SB 4KK8D 5JDSA 2KQNA 4R9HA 4YZFE 5I1IL 3FT4A 4JFFB 3GSNA 2DI7A