2Y72A

Crystal structure of the pkd domain of collagenase g from clostridium histolyticum at 1.18 angstrom resolution.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
85
Chain Sequence
GGTIAKVTGPSTGAVGRNIEFSGKDSKDEDGKIVSYDWDFGDGATSRGKNSVHAYKKAGTYNVTLKVTDDKGATATESFTIEIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords COLLAGENASE
publication title Structure of Collagenase G Reveals a Chew-and -Digest Mechanism of Bacterial Collagenolysis
pubmed doi rcsb
source organism Clostridium histolyticum
total genus 17
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2y72A00
5FHBH 2W0PA 4QYOB 5GJSL 3T0ED 3D18A 3O9WA 1YEIL 1SMOA 1FL3A 3EFDH 4JKPH 1BX2B 1HZHL 3BDBA 4WU5A 4FQ2H 4Y16C 4Y5XB 5TE4L 5I1LA 4I77L 5E94A 1OAKH 3MZGB 4M00A 4QRRB 4Q9RL 4M7JH 4LRNL 2D7QA 5JA9A 1J8HD 5TDOB 1IGCL 1WBYB 1A6WH 3VGDA 1FDLH 2RGSA 4U6XB 4Z7WF 2IQAA 4HH9A 4KU1A 4PRIE 1TMCB 1LEKB 2JB5L 2P7TB 3W2DH 2ICCA 4LDLB 5L8LB 4BQBA 4EEEA 3V5KA 2YN3A 2HG5A 5J8OA 5T3XE 5KW9L 4PIRF 2DLHA 5HHQA 3SCMD 1AGBB 1LP9F 4XNZC 1DBBH 1C5CH 4WEMB 5D2LB 4JQXA 4JM2B 1KYOJ 1CGXA 4CMHB 4LSPH 3WLBB 2L4OA 3WEXB 3A6OA 3ZDZF 3ZHLA 4PJCF 1MJUH 3MRJA 1U58A 4MA7H 2DL9A 2ZUUA 5JXED 3KYNB 2BJML 3DVIA 1SM3L 2FD6H 3G6JF 4ENEC 3ULVL 1VCAA 2QTEA 2MHAB 3GDBA 2NXYB 2R9HC 5L8KB 2HFEB 5E8DL 5E8NA 1JGLH 5ALCH 3PG2A 1ZT1A 1FORH 4R2GD 3VXUD 2XG5A 3B8SA 4WTZG 1NLDL 1I1CA 1HK6A 4Y2DB 1AFVL 3QDJB 1FBIH 5IWLC 4BK4A 4CUCA 2NY4B 4F58H 4F7TB 5ISZB 4HUKB 1ZANH 1IM9A 1ZGLB 4X6EA 1QSFA 3QZWG 3MJ7B 1J8HE 3OF6D 1LO5A 4YUEH 2JJWA 1X5YA 3HUJF 4KY1H 2WQ8A 1CZ8H 1CWVA 1VEMA 2EE2A 3O3UN 3OAYH 4H20L 3O8XD 2Y07L 5L88L 3V5HB 1BFVH 1XGTB 3QULB 4ALAH 2J8UF 1BWWA 5F7DB 3NCCB 4PV9B 1XH3B 5C0BB 1IEBB 1Z0MA 1BF2A 1BPVA 1U3YA 2ORBL 1ZT7B 3MGOA 5BCAA 1UZ8B 5GGTL 4HPOL 2IBZX 4KROB 4GRLA 1S7XA 1DTUA 2CR3A 5FA3A 1F3DJ 1J7VR 5GS2D 3S8WA 1MPAH 4NKMB 3HB3D 3BUTA 4N8VB 5GJTL 1PYWB 2GTZA 3PP3K 4FP8L 3D69B 3K81A 3QQ9D 3ZDXE 4AMKL 2BOBB 3VU2A 1WV7T 4Y19B 2EYRA 1I9JL 2LTQB 5T3XL 1S7RA 2EH7H 3AAZA 1JYNA 2D0FA 1NCWH 4NO0B 1WAAF 1BQHG 4NZJA 4LDEB 3N9GL 3RZCC 3PWPB 1K8DA 3CFKA 4YNYA 4JO2L 1UZ6F 3LRSA 4NDMB 2W60A 2X6MA 1CICB 3FFCA 3IAGC 2IAND 5ESQA 4J3TA 4A6YL 3BPCB 3B3IB 2QL1A 1U3JA 5F3HA 15C8H 4IOSD 4Y1AB 4KRPB 4OF7A 4ONGL 4BYHA 1GGUA 3JWDL 4DZBA 4ZOEA 2MSPA 1N5AA 5JOPE 1EHLL 1RAMA 1A9BB 1N4XH 4MJIA 2O5YL 1A6VL 2O5XH 1HILA 4N90D 3FO9A 5CKGA 1WICA 3P9WB 1S9KC 1TVBB 3UZVB 4KWUA 3PQYD 5IK3A 2MCPL 4H25B 1DUYA 1KJ3H 4ORZC 3H42H 4M5YH 4OD1H 4WNQA 1U93A 3CXDH 4LCUA 3MACL 3QIUC 4JRXD 4IMLA 1NFIA 4GW4B 5IVZA 2CLRB 4X7TB 3QG6A 5EO1B 2PCPA 4JDTH 4KV5E 5EU7E 3GMMB 5F44A 5DZOA 2W9LA 3FQXA 4RMRA 4QRPA 3SE9L 4HUXB 5KN5B 1QQDA 2VXTH 1MHCB 2APWA 5F7WC 1DBAL 1YMHB 4RDQF 3LHPL 4MA8L 1WWBX 1RHFA 4UZGA 3RVTD 5T3ZE 3BGMB 5JOFB 3I02B 5FGBC 4HK0B 1S5HA 4QF1B 4P46C 3RGVD 4EKXA 1KB9J 3EOYG 4P49A 4C58B 3BIAX 1H3UA 2V9QA 3BPNB 3IU4H 3WNOA 4I3RH 2P1YA 4I2XE 4P57A 3MJ9L 1UG9A 2KPNA 2XY2A 3QEGH 2X9WA 2AQ1A 4G6KL 3LEVL 4DK3A 2F8XC 4X4XA 4NO2A 3MV8A 1JGEA 1OF2A 5C0DB 2EYSA 1YDPB 4F7MB 2A77H 4BZ2H 4ZXBA 4X4ZA 5BV7L 1KG0B 1HSAA 4LLVB 1F4HA 2BSSB 3BE1H 2Z9TA 3Q5TA 4I18A 2X9YA 4DCQB 2BC4B 1Z5LA 2EC8A 4PLJC 3WLWC 3QUMB 5EWIL 3VW3H 2W92A 4RIRB 4RMSA 3VE0B 3REWB 3X14A 3IFLH 1MWAA 1CE6A 5DJ2A 1A7QL 3Q2CA 1FFOB 5EO9B 4TPRH 5DK0A 1FVEA 4R8WH 1XFPA 4F8QA 1UYWH 5JQ6L 2F54A 4MNHA 4CVZB 5JW4M 2R8SL 2OTUA 3RDTA 3RU8L 1SQ2N 4H88L 4XHJC 5H37H 3I3EA 5GISH 3C08H 1JTTA 4Z6AT 5E6ZA 5FKPB 3TIEA 1TJIH 2EDTA 4MAYC 2V2WA 4POZD 4DGIH 2B4CC 2B1HL 3VXSB 1JGDA 4FQLH 3H9SA 1SYSB 1LNUA 3CSGA 4CU7A 3EAKA 1NAMH 4DUVA 3ESUF 1I8KB 1H3VA 2ADFL 3VWKA 1RZ8B 2JCCA 3HNTL 3NCEB 3VWJD 3GKZA 4M6MH 3P77B 4FRWA 3X12A 5JMRA 4BFIB 4ZD3H 4U1LB 3WIIL 5T3ZL 1WCQA 1KJVA 2I60H 1D5MA 4OKVA 5F8QC 5FDYA 5IFJB 4KJQC 1U92A 3FOMA 1T0PB 1J88A 2QQLH 5DJAA 1H8OA 2AJ3B 2CXGA 1NMAH 4PJXA 1ADQL 5K9OB 5DVOA 2AJYL 4IIQC 3U30B 4Z77B 4V2CB 4GRMB 2QHRL 4TTDC 4Y89A 1PG7L 3VXMB 2ESVB 1D3CA 1ZLVH 3DURB 4JJ5A 3M17A 4P5MB 3NFPB 4YHML 3NVQA 4ODWA 4EVNA 3Q1SH 5FCUH 1NGZA 1H3PH 3JTSA 3U46B 4W70A 4F9PC 2JLLA 3RWCA 1WCBA 1EMTH 5DD1L 3S4SA 1LVEA 1W0YT 3WFEL 4K9EL 3FHQA 1FV1A 4ZO7A 4I5BB 4F7EB 3S9DB 2YD9A 5E6YA 4Q74A 2R2BB 1KN2L 1EERB 1PSKH 4IJ3C 4PJAF 1VA9A 5JO5B 3TBTB 3ECBB 5I66A 2Z91B 3B2UD 1J05B 5I1EL 4J1UA 2ICWB 2YZ8A 3NCMA 3P9LB 3GMLA 5JW4N 4LSQH 1QLEH 2ENSA 5T1MB 3TBSA 5HYEA 5JIHA 3SO5A 3OJ2C 5TF1H 4S1QH 3QQ3A 4GBXB 4G6JH 4O2CA 4R4ND 3TV3H 3UDWC 5GS0H 3TZVA 5FIEA 4L4TD 5I2IA 1INDH 3HC3L 2BVEA 1XZ0B 3GB7A 3BP6A 1IZJA 3RAJL 2VZOA 4QTIL 5D7IA 2Q86B 1ETZA 4YHOL 3MUY1 1VERA 1DR9A 4P4KC 1R0AL 2W38A 2EYTB 1MCPL 2HT2D 3RWEA 1BFSA 3TVMD 5GGRA 4JHWL 1GSMA 4IRSA 2X4NB 1BEYH 3IDNB 2OXGA 4MSWB 4S1RH 4YHLL 1IAIM 2Z92B 5TE6H 1A0QL 4OCYL 4Y4KB 1CLOL 5EU6B 3SE4C 1N59A 1GCFA 3THML 1KCSH 4G9DB 2A6DA 1OP3H 4DAGL 3SY0A 3SJVA 2VLRA 2XZAH 4OZFA 1EJOL 4F33A 2VKWA 3IU3A 5DMYA 3D0LA 1EO8L 1IQDA 2P8PA 5FECA 4MJ5A 2VLKD 2YK1H 1INEL 1SEQL 4IRJC 3UPRA 2DI8A 4AIXA 3PHQA 5JXAH 4HJ0D 4EUPB 1FG2B 4P5KA 3SPVA 1EEZA 3TYGL 3MNZA 2FO4B 5T1LA 4JFFB 3EDFA 2OMNA 3HRZB 1HQRA 4R4FH 2X7LA 2ZCKH 4QHUB 1PG7W 1VFMA 3D5OF 2OJZH 4WRLA 2NXZD 3WXWH 1IKNA 2X4OB 1KULA 2AK4D 3RX8A 5E9DA 5IB4A 1KIQA 3WS6A 3MR9A 1KEGH 2XN9E 4OLZL 4WUKH 3KPRB 2PO6B 4P2OC 1S78C 2YA1A 2HTLD 2OL3L 2XY1A 1IGJB 3CDGB 4C56B 5FO9B 3QFJB 3KYMA 4M6NL 4XP6L 3MRGB 4NUGL 1FNSH 4IOFD 4LARL 3P11H 5J11C 1HHHA 4PJ9B 4Z7WA 3GSWA 4QO1A 3QPQC 4HGKC 1YEEH 3F12A 4YDJB 2XQBL 4KKNA 1NMCB 2UWEB 4JFHD 3MV7D 5TJWK 3UPAA 2VXUH 1S9YB 1G7JB 3G5ZA 4P5TC 3RWJA 1MFBL 2EEBA 3P4NB 4W6WB 4U1HA 4K2UL 1FCCA 3MFGB 5AEAA 1RUKL 2XTJE 3ULSA 5EZJB 2Y25A 3GSRA 4Z5RB 1UQSA 3DNKA 1T5XA 2JJSA 3G5XA 2VLKE 3QHZH 3BI9X 4GKNB 1MCWW 5F9WB 2X1OA 5J1SC 1BAFL 1BP3B 4U7SA 4H8WL 3ZDXF 3G6JA 4OI8A 5BRZD 4KI5D 3BKMH 1A14H 1BZ9A 1KLUA 1OM3H 3MRKA 3QAZB 3DO7A 5I17B 2VL5A 2IBGA 3FB6A 3PL6B 4YHIB 4H1LA 5K9QI 4G8IB 2DWDB 2Z31B 5C6WH 2YD1A 3MFFB 3S5LG 1O5DT 4NM8L 4ORGB 4XNXH 3HZMB 3H7BA 5KSVA 4FQQA 3MGTB 1IGFH 4KAQH 4XCCL 2OQJA 2OP4L 4AEIL 3MLXL 5HVWA 2VLME 3C5JB 4QY8A 5DRZB 4HH8A 3KHOA 3BIBX 5DSCB 3HC4H 5DFWH 5LCVL 1MQKH 3UXFA 3TGXA 5DLML 4DVBB 12E8L 3W0WE 4JFHE 3MV7E 1RSFA 4C4KO 5C9JA 4QRRD 1DBJL 5GS0D 2J8UA 1A3LL 4NRYB 5D93C 5I16B 1OGTB 1AQKH 1DQJB 1IEHA 3JV6B 3HAEA 4MAUH 2MWCA 2QR0B 3P9MB 3LY6A 4XXDB 3O9WC 4P0DA 2G5RA 3ZE1F 5A3ID 3EYVB 4JDVA 3A67H 3MA9L 3K8MA 1S7UB 5JZ7C 2D7PA 3QCVL 1N6VA 2H6PB 4JM2D 3L3HB 4PGDA 4PJDB 4LCCB 3SDAC 1RMFH 3TNNB 2NCMA 3IKCB 3MJGX 1A3RH 2HLAA 4PJ7E 4OI9A 1MAJA 1WAAA 1ORSB 4OFVA 4XMKH 3UAJD 1NGWB 1VFUA 2VH5H 4YHPA 4XVTL 1W72B 2NXYD 2BHUA 5D7LE 4F2MA 5HY9B 2ZPKL 3U4BL 1FPTL 4O4YL 2NX5B 4HIXH 4AG4H 5ICZA 3BESR 3WNKA 4Z0BL 3H3PL 4Y2DD 3QDJD 1B4JH 2NY4D 5EUKA 3CVHH 2C1OB 4X7SL 1IAKA 5ISZD 1OSZA 3QUMH 5FYLH 3HCVA 2P5EE 4EQ3A 3ZYZA 4X9FA 4GKSA 4WO4B 5I1CH 1QBML 1JGUL 1UGNA 1UJTA 3FAXA 3GJFK 4EBQH 4HIHB 3F6IA 1CT8A 4O51A 3WIFB 2L7UA 1FZJA 2YUWA 2V5SA 4QRSA 1FN4A 3E3QE 1A4KB 5D5MB 1NMBL 3MRRB 2FX8H 1RK1A 1IT9L 9CGTA 4TULL 4KK6D 1EHAA 1FGNL 2Z8RA 5C0BD 5C08E 5IHLB 3GI9H 4LCWB 3HZYB 1DBMH 1FO0L 2APBA 4X4ME 1K2DA 3MUGA 2FGZA 3FO0H 4KROD 4LSDA 1Q9LA 4GLRH 3AS1A 5DD0L 3U0PB 4XP1H 2JKXA 4IEFB 4TVSa 3TWCH 2VO5A 4FQCH 3W9EB 2E8ZA 3OAZK 1U95A 4ZFOB 4X99A 5EBMA 2FX7L 1CFQB 1J1XH 4U7MA 5DTFB 5ESVB 4YDIH 4NNPL 4Y19D 2Z0BA 1RUQL 5LGJA 3C5SB 1AHWA 1V5JA 1SJEB 1Q72L 1O7SA 4NO0D 4NZTL 4R3SA 4OAWA 1YMMA 1NBZA 5CINH 4MWFA 1KXQE 5DJXA 3UJIH 2XXCB 3PWPD 3SN6N 4B7LA 1OY3B 5KVDL 1BGXH 5ISZE 1KJMA 3TBYA 1CICD 3EHBD 4H0GA 2GJJA 4PY7B 4QGTA 5K93A 5HHPB 1RU9L 2BRRL 4Y1AD 1MRFL 4KRPD 2E6PA 1I9IL 4WIQA 1YY8B 3IDMA 2VLJB 1SYVB 5D72L 2AXGA 4HDIA 3DMMC 2RFXA 4K94C 1VEOA 3UJTL 2BX5A 4I9WD 3SHSA 3BPLB 3LPWA 4QHNA 4KZDL 4E41E 5TGBA 2RBLA 3ZMRA 5C0BE 5D1XA 1TVHA 4PRDA 3WIHA 3Q3GA 4KRLB 3MRMA 1NEZB 4ONFL 3RVWC 3K74B 2XZCH 3D2UA 5GRUL 2AEQL 5HYSB 1ZSDA 1HHKB 3PWUB 2FEEI 2PTVA 4TUJA 4KKLC 1Q9OB 5CEXA 3VRLE 1DQTA 5DT1H 3O6FA 4HGMA 5EOQH 1GOGA 2XNAB 4J4PA 5J12C 4G5ZL 1DQDH 1A6TA 1K5NA 5DGQA 3A6BH 4XNYL 3UYRH 3WE6A 1CK0H 1RI8A 3DGCR 3O6KH 1FQ9C 3DLQR 4HC1A 2FB4H 2J88H 1IC4L 1Z0NA 2NZ9D 4M61A 1VENA 1GRWA 3FQUB 5A2LH 1AGCA 1S7WB 2UZIL 1E28B 5EC2B 1WZLA 4KUCD 2VMFA 1QZ1A 3MV9B 1X5AA 1KPVA 4L8CB 1HEZB 4MCYA 2FIRT 4M62H 2IQ9H 4JPIA 1CG9B 5L6YL 1CD8A 5IKCA 3BQUC 3QUYA 1R3IH 3NH7H 5IBUG 1INQA 5ICXA 2NR6D 4EDWH 4S1SH 4AQ1B 3CFDA 3I9GL 4F7CA 4LFHD 1E6JL 1I3UA 1ZAGA 1VACB 5FYLD 3O4OC 1LMKA 5DEZA 5JMOC 3ZL4L 4FQ1L 4B53A 2XZQL 4N5ED 2ZG3A 5I1JL 2WBJC 4NC1C 4NRXA 1A7NH 4ZXBC 4M5ZH 5IVOA 1QHPA 4Y16B 2H1PL 1HE7A 4M48L 3F58L 3MBEA 3Q0HA 1BOYA 4I18C 5E70A 4PBXA 1U6AH 1P7QB 4DVRH 4D0BB 1CLZL 1CS6A 5GRVK 4NQCD 1SBSH 3DRTB 3VXSD 1FZOB 2DYPA 1HI6A 4JREC 1OGAB 4K3JH 1Y0LB 4I48B 3FN0L 4JLRA 3CZJA 2DLFL 1RVFL 3RDTC 3NFNB 4L8DA 3QUZA 4JDZB 2B39A 3HI6L 3TA3A 3NACL 3QDMB 4PJEE 5FM8A 2X5PA 3KS0H 1P5UA 4WI2A 4JHZA 3L5WA 2FIKA 3EYFA 5IMLA 4E0RA 3IFNH 4IDJL 3VFRB 1ZMYA 3STZB 2DLIA 1UXWA 3GSUB 3L95A 1ND0B 4LVHC 3KPPA 4DUXA 5AD0B 1LQSR 3MLTB 3QNYA 5A1AA 4N8PA 2VAJA 2ESVD 3IRPX 3VXMD 1OARH 2F53A 2VZVA 4AENA 3TT3H 1XGRB 1U8PB 3P73B 4KDVA 4LSSL 1BLNB 5GIRB 2HTKC 3FO1A 3G9VA 5ADOH 1M71B 3FQTB 4NQCE 5IMOA 4P2QB 3VXSE 4G8EB 3DROA 2ZSWB 1KB5B 3KAAA 3OHXA 1EFQA 1JNNL 1VB9A 4PRHE 1DBKH 5D1ZC 2K7PA 5E6IC 1VESA 2F58L 4N9GB 1UJ3C 4NN5B 3T0EA 2G2RA 1MHPL 3U0TB 6CGTA 5C2BH 3BWAB 2GJ6B 4WW2C 5JW5A 5AZEL 2W1NA 2JTDA 5JLZA 4NKOA 4D0CA 1T6VN 2VLLA 1RZKH 3VG9C 1WVZA 2WP3O 2A83B 2P44B 2ZG2A 4GBXD 4OLUH 1KCRH 4GXUN 1J8HA 3VI4F 4X5XB 2A6KB 3H9HA 4HWZB 3FB8A 3L3GB 4X9GA 4U1NB 4KTDH 1IGTA 1QO3A 1EHLH 4XPAH 1U8NA 1X5IA 2GQHA 1EX0A 4HBQA 1Q9WB 4OD2B 4OGXL 4WFFD 2CDFB 2GUOB 1QA9B 2ADGB 5J9PA 5C6TH 3SCMA 4OZIF 1SY6A 3GSNL 2GITA 1GIGL 3AY4C 3P0VL 4PLNC 1KACB 3AU1B 4PV8A 5E1AB 5J13C 3C6LB 4Y4KD 5EU6D 3QXTA 5IW6A 1XF2A 1MI5B 4ZDHA 3VD3A 4X0KA 4WTWA 1IL1B 1RJLA 5JXEA 2KUTA 4M7KH 3TM6A 3H9YA 4KI5F 4X6DB 3WCYA 3HE7B 3F7RA 3L9RA 2QHLA 1E4KA 3PWLB 4U1JA 5CHNB 3UJJL 3VXUA 4OZGE 5DS8B 4UAOC 1KJ2L 1BVKB 4R4BB 3O3AB 3BD4A 5A43C 3EDDA 2AJXL 1ZLUK 5IIEA 1ULVA 1GVIA 1UH3A 3QIUB 4JFFD 1MLBB 2YRLA 3OXSB 1N2RA 4OZHB 1G9ML 5HHME 4QWWC 1OAZL 3J7HA 3OF6A 3VGEA 1QVOB 5DUMH 3VXPB 3ET9F 4LNVA 5KS9E 2PO6D 2HT4D 4PB9L 1NFDE 5FDWA 3O8XA 3MCG1 2X4QA 1YN6B 1ITCA 4P46B 1J87A 3QFJD 4NRZA 3IJSB 2EE3A 3CSYA 3WFZA 2VDRH 4PJ9D 1AD9B 1JCKA 1YEJH 3OR7B 4V1DB 4G3YH 1IKNC 4M6OH 2J3SA 4YE4L 3ZKND 3WS6C 4N68A 5EU6E 3MRBA 1A7QH 4M1GH 3BAEL 3CCHB 3VCLA 2VERN 1AO7D 5D2LF 4JM2F 5L8JB 5GHWL 5DK3A 4LIQH 4JB9H 3PHSA 3S36X 1HINH 5DVNA 1NAKL 4DTGL 5BVJA 4OQTH 3RTQB 4KVCL 3LB6C 5ITBL 3M1BB 2H2SD 2UUDK 4BQ9A 1A7PH 2DD8L 2BY2A 1CFVL 4HXBH 3BEWA 4JFFE 4XNUL 4UNVA 5GS3A 3H7LA 2VZTA 2IANA 3BD5A 5EFIA 1OAXH 4XPFL 4AYFA 3PL6D 3V5DA 4QHKJ 3MO1A 3IYLW 1MCOL 2Z31D 2XKSA 3FB7A 4PR5B 5L2JA 1C5BL 3OKKA 5KVFL 1CIDA 3V0VB 1QFWI 3GSXA 3NIFE 4MAYB 5DWUL 4PJIB 1JPGA 4KKBC 1H3TA 3PQYA 5CUSH 1R5WA 1KTLA 5F7MC 4DKFH 5LWYL 4K7PH 5IEKB 1XGUA 5EORL 3ETBF 4GQPH 4HS6B 3FT4B 3N85L 4YGVB 4JRXA 4XMPH 2YMXH 5IM7B 1T1YB 3B2VH 3MLPA 1X9QA 1YA5A 5GZOD 2W0KA 1A5FL 1H0DB 3OKOA 1AO7E 3BJ91 5DR5L 3V6OA 5C0JB 3UMTA 3VFNB 1YQVL 4GQ9L 2VR5A 5HGHB 4DUWA 2FNBA 1WQVT 2I07B 3O11B 5E2UH 5IVXA 1CCZA 3BJLA 1V7NH 1IM3A 1G7MA 4JY5H 5F1IA 3RGVA 1L7TL 3IB4A 5GGSY 3OB0K 2ED8A 3GKWL 2MTPA 1XCQA 1BZ7A 3VRLF 2UYLB 5MENB 4Q9QL 4IIQB 1XEDA 3DV6A 1JMXA 5HVHC 3VMPA 4LU5L 1CU4H 4PRPE 1LEGA 2OCFD 2FX9H 3ARVA 3MX0A 5E00A 3VJ6B 4F80A 4K3EH 3LN5B 3T4YA 2XXMB 1U8MA 2QQKH 2AGJH 5INCA 3OV6A 2FJHB 4KUZL 3LS4L 3HPJA 4UT9L 5KBNC 2NX5D 5BS0E 3SQBA 3NFSH 4NGHH 2ERJB 1T20B 1KCLA 4WUUB 3GGWB 4KMTH 1PKQE 4JQVC 1MRCH 3HC3H 5I1HL 3B8YA 1S9WA 5C0GB 4NQDB 4NKDA 5FHAH 4IJ3B 4WO4D 4LSRL 4QHMA 4OLYL 3RY4A 1QRNA 4S0SD 1I7ZA 5F71A 4ZO9A 2RCSH 4W4OA 3V0WL 2HMID 3SKMA 3ARWA 1KENL 1MRDH 2DQIL 3MRDB 2W9DH 4UILH 4CDGC 1KV3A 4WDIB 3GI8L 4HUWB 5EU5A 5CMAA 3O2VL 4OLVH 1QPXA 3WNMA 4NUJA 4M4PA 4LCWD 3QG7H 4DAGH 1L9NA 2NY7H 3BDYL 3CFJB 3PJSA 4HF5H 4TN9A 3AM8A 2CIKA 2BHZA 3TH2T 4P3DA 4M3JA 1D6EB 2DQEL 3S37L 4ETYA 5DI8B 5IB5B 2CKBB 2GSIB 3QUKB 4WHTA 4FXKB 4P4KB 3MRQB 3KPSB 2VN7A 3HFML 3CD4A 4P9ML 5JORA 1EGJL 1JPSH 2N4IA 1JP5A 3DXAE 2WUBL 4P59H 4HUVA 1FGVH 3VWJA 4M3KB 1M7DA 4ZYKA 3EOBB 5F7YC 3SDXE 4PYHA 1TETL 4GW1A 4YWGL 3GMNA 2B5IC 3R06A 1ZVHA 1BHGA 3BRFA 1R3HB 1RUML 4KUCF 5D96B 1BJ8A 1EAPB 3FCTB 3LEXA 4DOHE 1N3NA 4G43B 1JRHL 1JVKA 1IAIL 1FNEB 5IHUL 3LMJH 3V9FA 1B9ZA 5EIIB 1TQBC 3LKOB 3LPGA 4M6NH 1G9NC 3L3JB 2VLJD 2GT9A 1AHWC 3LH2L 4L4VB 2CIIB 1CFTB 5JW3L 4RFOH 2OJEA 5DK2B 5CJQL 2OI9C 5F9JA 1JUFB 3LD8B 1NQBA 3D0VA 1F8TH 3CUPB 3GIVB 3H9ZA 3Q48A 1HHGB 1RZGA 4DWHA 3MLSL 3O2WL 5HHVL 4MNGE 4OJFH 2BSRB 3O41B 1P7KA 4G7VL 1O0VA 1A6ZB 1KB5H 3WMSA 5E08H 4JKLA 3MXWL 4TTGA 1IZKA 4OCNC 4LLWB 4RAUA 3PP4H 1UCBH 3QDHA 1ZS8A 5CKAA 5GGUA 2R1YB 4R0LB 3TEUA 4KK8D 5E8OA 3HMXL 5CP3H 5LVEA 2JJUA 5D1XC 1NDGA 1LDPL 3HE6A 2CO7B 5CD5D 2X70A 4PD4K 4ISVB 3RWFA 5HYJE 4HBCL 2PW1A 1OOAA 1X44A 4G6MH 3CVIL 4L4TA 2WINA 4ERSH 1NFKA 2HRLA 5E8EA 4EJ1C 2M1KA 2OP4H 2WK2A 4XWGL 2ZCLL 3MA7B 1T5WA 2P8MB 5DJ6B 5KTEL 2V6HA 1W72L 2VLJE 3O6FC 4MA3B 4U6HA 1H5BA 2APXA 3GMOB 4WFGD 3MV9D 5HDOA 4OSUL 3MNVB 3DYMA 5INDA 3TVMA 2LVEA 1YNKL 4LLQB 4XGZB 3RWIB 3S4SG 4HUUA 3WKML 1DFBH 1CYGA 5F7EL 3WUZA 4LP4A 1ZHLB 2DLTA 5FUCE 4G9FB 2AERT 4U49A 5BMFL 5DJ0A 4YDVA 1G6RL 5D2NB 5I30L 2KH2B 4ACPA 1OCWL 1FYTE 2VE6B 1I1AA 5F93C 1PQZB 1D5XA 3U7WL 3KPMB 4HUNB 2FZ3B 1ACYH 3QUYC 3QDGE 3ZT5A 3WHXB 3V52H 4Y16D 4NBZB 5H94B 4UTAL 4LEXH 3LKRA 4M02A 5J1AA 4K8RH 2YSSB 4HIJB 3BMVA 1W0WA 3QEUB 4BA8A 1P7QD 2V9RA 2IPTL 5DYOA 5E5UB 5DEGB 1JL8A 3FO2A 3SQOH 1I8LA 5D93B 4PRAB 4OZGF 3RKDC 5DJCA 3ZLQC 3FB5A 4MX7B 4ELMB 2AK4A 3BH8A 3N1MC 1E4WH 3QQ4A 4Q97A 2DQTH 5LG1A 1OGAD 2QSTA 2G75B 4KXZH 2DM2A 3D3VB 3ZKMC 3WS3B 4HKZA 1LE5A 1NAMA 1FPTH 5FKAA 1T0MA 4FXLA 3MV9E 2OXHA 3SDAB 4K7FA 1B3JA 5KS9F 4ZPVA 3QDMD 1DQLL 5HI3D 3DJ9A 4LHUD 1OW0C 1TCRB 5IG7B 2VABA 3O6ML 2B2XL 1NUNB 1EPFA 4OZFG 2WWKT 1NGPL 4P23C 4ENED 3BN9C 2W9EL 1A4JA 3V5KB 2HG5B 1KC5H 5JNYA 2R0LH 3S3JA 3MREA 5J6HB 4OZIA 3C5ZA 1AGDA 4PBVC 5KG9B 5BO1H 3NA9H 4XNQB 3QUZC 1CL7L 1REIA 2QSQA 2OYPA 3TA3C 1UH4A 1WZMA 5EUOA 1JI2A 1F2XK 1FGNH 3P4LA 3SGEI 4RFEA 5EOCH 2CKNA 4Y5YA 3OQ3B 5BRZA 5AZ2H 1AQDB 1T04A 3D9AL 4BSVA 2GCYA 1N0XL 2OK0L 3RPIB 2DWEB 4WVRA 3C09B 4U1SA 4WTXA 3V4PL 1K8IB 4CU8A 4P2QD 2AV7B 1U8QB 3DVGA 1JYWA 2F5AL 4KGJA 2ADJB 5DD3H 1G7PB 4OV5A 5TPWH 1Q72H 4KQ3L 4M8QA 4XAKE 3BRGC 4OF6A 2X1QA 4NWTL 4X80L 2VQ1B 1YY9C 2FLBT 2V2XB 4XAWL 1ZHKB 3L7EB 1LO5B 4G7YL 4LCIL 2GJ6D 4YR6A 2DICA 4ZQKB 1KN4L 1HH9A 1I1YA 2VZ3A 1F4WL 4Y5XA 2ARJQ 4PD4J 1WUNT 3L7FB 3R1GL 3R0MA 5E99L 4QRRA 4MHHI 1MQ8A 4X9HA 5TDOA 4HZLB 1WBYA 4J12A 4D94A 4U6XA 4NQEB 1IMHC 2VDPL 1LEKA 2QBWA 1JNHB 5BOPA 4GSDL 2ZOLB 5ABDE 2UWEF 5SWZE 4HXAL 1T7VA 4FFZL 5K9QG 1I7UA 3NMEA 1GC1C 4X6BB 3U7YL 3OKNA 4ZS6D 5MERB 1AGBA 3DUHA 5D2LA 1F42A 1MCSA 1UA6L 4JM2A 1P1ZB 4H1LG 4ZMAT 5DJYA 3WLBA 5E7BA 3WEXA 2BZDA 3C6LD 3DETC 1MI5D 2HN7B 1EXUB 1Q1JH 2HFGL 3NABH 4RMTA 4JO4L 3DMMB 3KYNA 2HT3C 5DMIH 2MHAA 5E2VH 2EXYC 2HFEA 4F7PB 5IT2H 3HE7D 2VR4A 4ZNCD 3GBNH 3OG4B 1QYGL 4CW1B 2J8HA 3I75B 4PLOB 2E6QA 2H32H 4Y2DA 3QDJA 3QEQB 4ODUB 3MLVH 4J6RH 3QIUD 2HA1A 3RWGB 1ERNA 4F7TA 4ZFFA 3VXTA 4RAHA 4URTB 2XV6B 4TSBL 1T89A 3HAEG 1VGKA 5DZNA 1ZGLA 1MVUB 4KQ4L 3MJ7A 3MRFB 2UZIH 4YXHL 5FGCE 1QTYT 1AJ7L 1EO5A 1ZLWK 4O5LH 5MHSE 4HFUH 4P46D 3V5HA 4FNLL 5EO0B 3QULA 1ROWA 3OKEB 1XH3A 1IEBA 5C0AB 1ZT7A 4OM1L 1UZ8A 4J23A 4V1DD 1LGVA 5C0EB 1CD9B 1JFQH 4Q6YA 4OTXL 1T83A 2CKBH 5GPRA 4NKMA 2BNQB 1KEML 1MEXH 3O8XC 1PYWA 5I1GL 2B8OT 3D69A 4PJDF 4L5FH 2V2TB 2BOBA 2H1PH 3BQUB 4Y19A 1CLYH 4JFPB 1YJDC 4XCFH 1P4BL 2AEPH 3WHE1 1IKFL 3RTQD 3AVEA 5IQ9B 2IEPA 4NO0A 3UTZB 2J2ZA 3WLWD 4R90L 4M1CD 3CMOL 3PWPA 1BQSA 1IC5H 4NDMA 3GUTB 1BM3L 1KTRL 1CICA 2I5YL 1QSEE 3VMOA 2WBJB 4BUHA 1MFCL 3BPCA 4CVXB 5JHLH 3B3IA 4NO5A 5EU3B 2AK1L 4Y1AA 3GHBL 4YGAB 2NTFB 4JO3H 3HMWL 1M7XA 4OGAD 2A73B 3DO3A 3UTPD 5HGGS 4I18B 4XHJD 4D2NA 1LO3H 2QSCL 4QRUA 1QLFB 1UM6H 5LBSH 5ICYB 4MAYD 4DKEL 1TVBA 4FQJH 4NNXA 1MWAB 3TIDA 4RDQG 4H25A 4JREB 8FABB 4TSAL 4MNHB 4WFHE 3BT2L 5D5MF 5E0QA 1L0XA 2PXYA 3MLZH 3HR6A 3LS5H 3K4ZA 4GW4A 3RDTB 2CLRA 5HDBF 4X7TA 5EO1A 3W11C 2DQHH 3GMMA 5T1DH 3DSFL 4JQIL 3V95A 4GAJH 4WI6A 1OAUL 1IC7H 4HUXA 5KN5A 1MHCA 3H9SB 4KJQD 3BGMA 5JOFA 3I02A 4HK0A 4QF1A 1NL0L 1UWXH 2I26N 4LSTL 4LKCB 4JG0L 2E7LA 4M93C 4LVHB 5DFTA 3FRPA 4LLMB 4F15B 5MEND 4RX4D 5KVGL 3WDJA 2DB8A 4TTDD 4MNQB 3TN0C 1U92B 2JF1A 2APTA 1AC0A 3UTPE 5F96L 1T7WA 5C0DA 3FFDB 4JG1H 1YDPA 3RGVC 4F7MA 4L9LB 2EDLA 5C70A 1KG0A 4LLVA 3PGCB 1GGYA 2BSSA 4PJIE 4ZUWB 4WUUD 2G5BB 1AXTH 4XB7A 4Z7QE 4DCQA 2BC4A 3CVHA 1RZJL 2FSEB 3QUMA 3BXNB 3BGFC 5B21A 5D1QB 5D1ZB 5E6IB 4NQDD 1L6ZA 4RIRA 2XWTB 3REWA 3UROR 3VE0A 3W5MA 1TPXB 4UI2A 1NLBL 4LMQE 1DVFC 1UJ3B 5IJVB 2Y06H 1FFOA 5EO9A 1A1MA 2YWZA 3KYAA 4OGYL 1QSVA 4WW2B 2D31B 4CVZA 1WT5A 3V2AR 1XR8B 5C07B 2PNDA 1OT2A 4JFQA 1I85A 2ZOKB 4N1HB 2HJKB 2CK0L 2EO1A 1GGIH 3BZ4A 4G8GA 4F8TA 1CDIA 4TYUA 1V05A 4XMLH 5FKPA 3ZHKA 5I15L 3MODH 1WWCA 5HTSA 5EOTB 3VXSA 2B1AH 1SYSA 4J1UB 1CGTA 1S3KL 4OCRH 1WFTA 4P4KD 3KPSD 3TBSB 1TTFA 3KYKH 4GLRI 1DP0A 1I8KA 4R6UA 2IFFL 2DQJH 2OR9L 1RZ8A 4MS8C 5DF0A 3W82A 1KPRB 3P77A 1RZ7H 4BFIA 2DI7A 3C2AH 1N7MH 2YKLH 4U1LA 1RJYB 4ZSOE 3D1MC 3LQZB 3C6SB 5IFJA 4L8BB 4OCSH 1KXVC 1K6QH 1FP5A 4JVWA 3NZHL 1F90H 5FYJU 3RWEB 4NQDE 3BKJL 1EUUA 1HNGA 2Q8AH 3BKCH 5K9OA 4UAOB 5CD3B 2B7DT 3WFBL 4GRMA 3V7AG 4G6AC 2HH0H 5I1DB 3D6GA 4Y4FB 4RMWA 5I8KH 1U8JB 4L4VD 3W81A 3EO9H 2OBGA 2ESVA 3VXMA 5I6XC 2DTMH 3DURA 3GRWH 4YHKH 1YYMH 3CFCH 4JCMA 5ACLA 4P5MA 3CMGA 3NFPA 2F19H 4ODVH 2B4CL 3X13B 3G6AB 2OR7A 3IU3B 3U46A 1PAMA 3G04B 2D4FA 1D9KB 3ZTJH 3UZQA 1X4ZA 2F5BL 3B9EA 1S78D 1LEIB 4J2XA 4I5BA 4J7RA 3BP7B 4F7EA 4NJAL 2MPAH 2ZUTA 2R2BA 3MJ8B 5AAMA 4UUJB 4XC1L 2X7LB 4DKAA 5JO5A 3ECBA 2Z91A 1J05A 3QPQD 2DD8H 2V5RA 2ICWA 2A1WL 3LKNA 3P9LA 4OF8A 5ANME 1QBBA 5E2TL 4IM8A 1WC7B 5T1MA 1SBBA 3BISA 4XPHH 4UB0L 4NOBA 2ICWI 1WEJH 2DQUL 3P0YH 1MFDL 4GBXA 3QBTB 3T1FB 2WIIB 3SBWC 2R56H 3L3DB 5I8OH 1XZ0A 3VFUB 1TZHB 4HKBB 3GSWB 1U8HB 5KVFH 3B2UC 1G7HB 3ME0A 4NYLB 1T21B 2Q86A 4PJ5E 4L29B 5JR1H 3F7QA 4L4VE 2EYTA 1RPQA 4GUPB 3HE6C 4JFOB 3G5ZB 1JBJA 2X4NA 4OM0L 3BKYH 5A40E 3OBAA 1T7ZA 3KLAB 4MSWA 2Z92A 1C16A 4Y4KA 5EU6A 4EI6B 2IAMC 4JN2B 4P99A 4G9DA 4D8PB 1FRGH 3ARRA 4G9FD 5HDQH 2R0WL 3DYOA 4XC3H 1ZHNB 2YD3A 4CVUA 2D9CA 1OAYH 1TJHL 1ZV5A 2J5LB 2BHYA 2H9GB 1BZ9B 25C8L 3TVMC 1I1RA 1LE9A 5GRYA 4D3CL 4HJJH 4X7CC 3LOWA 3X3GL 1TNMA 3N1PC 2DQFB 3SKJL 3GKWH 1FG2A 3OX8B 4EUPA 4Z78B 4JY6B 1QLRB 4JFFA 5IR1A 4Q9QH 4C57C 4YFLF 3DUSB 1I3GL 5JHDE 1EUTA 4QHUA 5AYUL 2X4OA 1AH1A 1I1AC 5BOZG 3WFDH 3FRUA 3GBLA 3KPRA 4BSJA 1N64H 3D3VD 3CNKA 2AI0L 1IGJA 4C56A 4OUUA 5JZ7D 4X6CE 5FO9A 1P4IH 3QFJA 1DL7H 3O45B 2FHFA 3SGDH 1ZLVK 5C9JB 3DX9A 3SDAD 1A21A 5F6HI 4PJ9A 2O93L 1I8LC 1XGYH 3I6GB 1MVFA 3KPTA 5HVHB 2CDGB 4YDJA 1UFUA 3QHFL 1R5IB 2UWEA 4LSVH 2NY2C 1HYSC 3T2NL 5IF0A 2HKHH 2C4FT 2PW2B 3WL9B 1S9YA 1WLHA 4AEFA 1G7JA 3QA3A 4U2YA 3S88L 1WBXB 2PYFB 3P4NA 1F11B 4E9LA 4PUBL 2VZ1A 1JZ7A 5EZJA 1Y6NR 4Z5RA 3D39A 4FZ8H 3QIWC 4ELKB 4NZUH 4P48A 3AB0B 4GKNA 4QRQB 1PLGL 1YPZB 5DA4A 5C92A 4WWID 5CGMA 1CDJA 3H3BC 5I74C 4X6DF 4TSCH 3OAUH 5I17A 3V4UL 3C5ZC 3PL6A 4YHIA 1N5YL 3WBDA 3FQWB 4JFXA 3BSZL 4G8IA 2DWDA 2QV2A 2Z31A 4JZNB 5AWNH 3MFFA 5ERWB 3CDFA 1MNUL 1UENA 1H15B 4ORGA 3HZMA 4XCEB 3T2PA 4OZHF 2DF3A 3C5JA 3ULUH 5DRZA 2VDQL 1MCFA 5DSCA 4W81A 3GNMH 1MHHB 3WUWG 4NM4L 3KDMB 2D0GA 3CLEL 4DVBA 3N0PB 1A3QA 2GIYA 1FN4B 2H3NB 4NKIH 4LLYB 5DC9B 3T1WA 4MVBC 1OP3K 3LZFH 4N0UB 3O4LB 4NRYA 3L5HA 5GRJL 1OGTA 5I16A 4NQED 1C12B 3JV6A 3CFIC 1JGVL 2QR0A 2DMKA 3P9MA 5DVMA 4C55A 4PS4H 4LAJH 1K2DB 2B5IB 1XF1A 2O61B 4NO3B 1CXKA 1RUPL 4WI4A 5CWSB 1CGSH 4RBPH 4XWOC 5DQDH 2EKSB 2GY7B 4KZEH 2PETA 2H6PA 2ATKB 3L3HA 4PJDA 4LCCA 5EBMB 3OWEA 5HI4C 1I7RB 5GS0C 1J0JA 3TNNA 3LKPA 3IKCA 5JUEH 4KTEH 2CGRH 4MD5A 2VIRB 4JRWA 5DO2C 1D5ZA 4U6YB 1ORSA 3DMMD 1NGWA 1X5HA 5A3IC 4RGOH 3F62A 4QT5B 4RISL 4YPGB 1KJMB 1MREH 2YBRB 1EO7A 4UIKL 5T1KB 4JM2C 2NX5A 1QSFE 3CU7A 4FMKA 1EA9C 3QEQD 3TP4A 1ONQB 2NY1B 3RVWD 2C1OA 1CN4A 1NCDL 1J5OL 1PX3A 3UAJC 4NWUL 2RFXB 5FYKH 2BVOA 4WO4A 4XWGH 3GSQB 4MXQC 3CSPA 4QHNB 4YC2B 4PJIF 4BQCA 4EOWH 3BMWA 5TGBB 4HIHA 4Z7QF 4XCYB 3WIFA 3U1SH 2VAAB 3Q5YA 3A6CL 1U42A 1TVHB 1A4KA 5D5MA 1E6OL 1Z9SA 1OWRM 4GKZB 4Y2DC 2CRYA 5HGDA 3M8OL 3MRRA 5IMMA 2V5YA 3D2UB 2NY5H 1UKTA 2AS5M 4LCWA 5C0AD 3HZYA 1CTOA 5LKNA 4HSQA 3MLUL 1FL6B 1I8MB 3T3PE 1HXMB 1EFXB 5FM5M 3U0PA 2W65B 3E1F1 3KPLB 1A7RH 2A9ML 2BNQD 2E27H 3NOIA 3W9EA 4X83A 4ZFOA 1SVZA 4Q7DA 3OJVC 1CFQA 5DTFA 5ESVA 1KTKE 1QFUH 3EYSL 3BQUD 5J6GB 1WZ1L 3I85A 4KK6C 1BBJB 4OQTA 4CAGA 3FFCE 1SJEA 1YEKH 3TT1H 5E2WH 4HWBL 1OLLA 4Z95L 2VWEE 1NANH 1MF2H 5IGXL 1U2HA 1IGML 2DQCH 4GFTB 1KPVB 4PY7A 1F02I 5HHPA 2WBJD 4JPIB 3Q6GH 4MJIE 1F6FB 2ICEB 2Q3ZA 5DUPH 1INQB 1YY8A 4O9HH 2VLJA 1VFOA 1SYVA 4HG4J 3GJEB 2Q6WB 1Z9LA 1FIGL 1YYLH 4CADB 3ARZA 3ULUD 2W0FB 4UDTB 2IG2H 1GAFH 3U9PL 2DLGA 4NRXB 1H3WM 5CCKH 5I19L 4N8CL 1AY1L 1NEZA 5LAXB 1K4CB 1J11A 4QRPE 4U6TA 3UZEA 1QD0A 1AGFB 3RDTD 2BNQE 1S8DB 5HYSA 2ZKHL 2I9LB 1HHKA 2G9HB 3PWUA 1A8JH 4MMZC 1BJ1H 3MLRH 2VC2H 1E27B 2VXVL 2X41A 1Q9OA 2F8OA 2X4UB 3H9SD 2XNAA 2DIAA 1HI6B 2Y6SD 3L6FB 1CDYA 4P23B 2WIMA 3WJLA 2PXYC 4KDTA 1NH6A 5IQ7H 5ILTH 3CX5K 5C0FA 3FQRB 4L8DB 3MV8E 5BQ7B 3HHRB 4NC1E 2A9NL 1K9TA 4MNQD 5DA0B 4K94L 1S7WA 5F1SA 1E28A 5EC2A 4XAWH 5I18L 4OT1H 4YHYB 1KCVH 1HEZA 3NCYP 5CILL 1CG9A 2HTKD 1UWEL 2E7LC 2P47B 5F1NB 4Z18A 4HPYH 2PYEB 3MCLH 1BVZA 3MOBH 4AL8H 1VACA 2F54E 2E9JA 1X7QB 2YEZB 2F53B 5D1QD 2P45B 5D1ZD 5E6ID 1FAIL 1AIFB 4GSDH 4AIOA 3UO1L 1AXSB 5GQBA 2D9QB 3LEYH 2FLRT 5FUOH 2VXSH 1F4XL 3WN5C 2BY3A 3IDUA 1X4YA 3MOAL 3UYOD 3B5HA 4I3SL 1GZQB 5C07D 3GHEH 2CDEB 2XA8H 3K3QA 1V8HA 4Y16A 5A2KH 1XCTB 4K7PX 1ORQB 2ED7A 1IJ9A 2MCG1 1IE5A 3H9SE 3Q6FB 3QXAB 5GSVA 1P7QA 1RURL 1CD0A 4D0BA 4JFEB 4YK4C 4JO4H 3RJDA 4W4NA 3WDHA 3DRTA 2JCCE 1FZOA 1QKZH 2JELL 1P4LB 1OGAA 1R6VA 4ZS7L 2WQRA 1Y0LA 4I48A 1AR1C 5JLZB 1IGYB 1I85C 2VLLB 3NFNA 3S35L 2BNRB 4JDZA 3VFWB 2YA0A 3INUH 4K3DH 3QDMA 1GGBH 1QO3B 4PJXE 2J4WL 3RIAF 5MP6L 1BWMA 1BBDL 1U8NB 1FC1A 4XBEH 4ZTOL 4Z7VB 3STZA 2P5WB 5KJRH 1FFRA 2QQQA 3WO3B 3ZSSA 1BFTA 1NBYB 4WI8A 4O58H 5I1AB 4MGXA 1C7SA 2Q87A 3MLTA 1J1OL 4MDIB 5IWLA 4N0YH 1QFWM 1R24A 2IGFL 1XGRA 1U8PA 1BQUA 1MWAL 3P73A 1TQCC 4QWWD 4N0RA 4EQ2A 4JFDA 1EBAA 1BLNA 4AT6B 3FONB 4F9LC 1RJZB 1FL5A 4Z7NE 1M71A 1D9KD 3VFTB 3L5XL 3FQTA 4KHTH 3OPZH 2AABH 4XXCA 4P2QA 4G8EA 2ZSWA 4JANB 1KB5A 1CE1L 4Y4HC 4PG2A 2CK2A 4PGCA 5C0RH 3EUUA 3HS0B 2AJSL 3MV11 5EULV 4EI5A 5HVFB 1FE8L 4N9GA 4ELMF 2EIDA 1S5IL 4YFLI 4HQQH 4PTTB 4O00A 4YX2H 2GJ6A 4XPTH 1FFQA 1Q94B 5C3TA 5CP3A 1JN6B 4MQXC 1HKFA 1ZHBA 1W8OA 2A83A 5D7IE 1P2CB 4WW1A 1G0XA 4X5XA 2A6KA 5DRWB 3ARGC 1MFEL 2BXZA 4J8RB 2COQA 4P9HH 4HWZA 1T4KB 2BERA 3L3GA 2L0DA 4FFYL 1MCWM 2R4SL 3LB6D 1X5GA 4N0CC 5ALBL 1Q9WA 2VDKL 4OD2A 5IHZB 5GRVL 2CDFA 2GUOA 1QA9A 2ADGA 1GJIA 2KZ1B 4XP5H 2DBLH 5B3NA 1DANT 5DHYB 4ZFGL 1TJGH 3EYUL 3SJVE 2VLRE 2HVKB 3AU1A 5E1AA 3W39B 3C6LA 2MQ0A 1AKJB 1MI5A 4MD0B 3BN3B 2IBZY 1IL1A 3FMGL 4P3CL 1QG3A 1AP2B 3GO1H 2JIXB 3ARBC 1NCAL 4X6DA 2Y72A 3HE7A 2VXQL 4MHHG 4KKBD 3PWLA 3VXNB 5CHNA 4YXKL 1BVKA 2K1MA 1U9KA 4R4BA 1CXEA 2FCBA 3MO1B 3AREB 5F21B 3JWOL 3MRNB 5E9DE 3QIUA 5TDPB 2FBJH 1G7IB 3OXSA 4PB0L 4OZHA 5CBEB 2IPUK 2YPLB 1J18A 3V6FB 5IFAL 3IJHB 4BQ6A 5EG6C 1QVOA 3MRIA 3VXPA 4PJBB 3K2UL 1GXEA 4Z7WE 4QXUL 4ODSL 4QXGL 3IDXH 3DHJA 2HFTA 1G0DA 4P46A 4IS6A 3IJSA 4UNUA 3KR3L 3ARDA 3CZFB 4M93B 5AUMB 1AD9A 1FHGA 5ADPH 1P84K 3OR7A 4KFZC 4V1DA 4XBPB 3HNSH 5EZOL 3TJEH 3ULVC 3TN0B 2HWZL 3CCHA 4YAQB 2RR3A 5C9KA 1JHLL 3RX7A 3AGVA 3FT2B 5IJKA 1HNFA 4RGNE 3EFFB 1TITA 4JFYA 3I2CH 3PF2A 3G6JE 1C1EH 3T3PF 3SEPA 5T33L 4M1DH 2CJUH 3RTQA 3QI9C 3M1BA 3NBNA 1LEGB 1T03L 1DLHB 2WBWB 3BGFB 2NW3B 1G7QA 1OTUD 2Z8SA 3T4YB 5DHVB 4WV1C 1DVFB 1H3GA 1IAOA 1U8MB 1U36A 3U2SB 3G5VA 4AEHH 2FGWH 5EBWB 5CIPB 1N6QH 3L3IB 5A2IH 2H2SC 5ESAB 4YH6A 1DCLA 4NFBA 3V0VA 5EBLB 1T7YA 4JN1H 4D9LL 4MAYA 4S2SB 3P30L 2LABA 1ZK9A 5FF6B 5CEZD 1YECH 3GMRB 4FABH 4DW2L 5IEKA 4N8VG 4HS6A 4UTBL 3E6FA 4YGVA 5AG9A 1I1FB 1T1YA 4JPVL 5C6PB 5IM7A 3S96B 2V5MA 3WFBH 5TQ2L 3SDYH 3O4LD 5C0JA 3RA7L 1TZGL 3VFNA 1KFAH 2X4RB 4IRZL 5HGHA 4XNMB 2IPKB 2CIKB 3O11A 3QXWA 3N1QC 2DM4A 5F7FA 3RL1B 1MJ8H 1WAAE 3JTTA 3P2TA 5JIIA 2J6EH 2DLEA 4DQOH 2XWBA 2UYLA 5MENA 4RX4A 4IIQA 4LVNC 1FNHA 4CN1A 3ZTNH 4QNPF 4NJ9H 3VJ6A 1JV5B 4QTHB 4YHZH 3LN5A 3MLYH 1KF9B 1VGEH 5HXMA 2FJHA 3LEXB 4KHXL 4NQXB 5T1KD 3D85B 2WBKA 4F9PA 3GJFB 1NCNA 4JZJB 4Y88A 4LAQH 1MFDH 2K9UA 3F7PC 1T20A 3KS0J 4WUUA 5CEZE 3IDYC 2NY1D 4YQXH 1BOGB 3QDAA 5C0GA 1TIUA 3T0DA 3ULUF 5IEHB 1ZGLP 4N0UE 1JWSB 3MBXL 43C9B 35C8H 2HRPH 2RIKA 3L1OL 1OPGH 4QKXB 5D1XD 3MRDA 1LD9B 4N1EA 1J1PL 1IC1A 4MMXC 3D2UD 4KVNH 1BVLB 4HUWA 3UDWA 4ZPTB 1Q0YH 3QCTH 4PP1C 5HHXL 4WO4C 4IMKA 1F58H 1IGIH 1D6EA 1EFXD 4X9IA 3ARQA 5DI8A 5IB5A 2CKBA 2Y36L 2AJZB 3RNQA 4DGVH 3QUKA 4YDLC 4FXKA 3N1FC 4MLSA 3H2WA 3MRQA 3KPSA 1FNGB 1GC1H 4D3CH 3HE6B 4HCRH 5L9DH 1YMME 4M43L 3S3SA 1VADB 3S98A 1CFBA 2YXMA 3C60C 1E4XL 3EOBA 4LFHG 2VISB 1YEDB 5E8EB 2IAMB 4B0MM 4XP9L 1V3KA 5IOPB 1F4YL 1EAPA 3FCTA 4JVPA 1JNLL 5INDB 4G43A 5JW4Q 1FNEA 1BD2B 3PUCA 3I6KB 5EIIA 1KYOK 5K9JL 2FH8A 3LKOA 4XVUC 3L3JA 4RWYH 5KSUB 4U6VL 4L4VA 1CLCA 1F6LL 2CIIA 2X4TB 2ZNXA 4YDVB 3CSBA 3RKDD 3CUPA 3GIVA 5JDSA 5CEZL 3I84A 3QO1B 1TCMA 4MQSB 1HHGA 1PZ5B 4Q0XL 1I1AB 3QR2A 5F7NC 1I9EA 4WW2F 2Y5EA 3U36A 1KBGH 1JI1A 2BSRA 3ZKMD 1WFUA 5DEFB 1A6ZA 2PR4H 1NCBH 1CVRA 3UX9B 4BZYA 4BUGA 1MCBA 4LLWA 4I0KA 2OZ4H 1PKOA 5EZIH 4Z7NF 5D9SB 3RBSA 3FO2B 4BZ1L 2XICA 1ZA6B 4HT1H 3BPLC 2R1YA 1CD1B 3FB5B 5C09B 4R0LA 5B39G 2NY2B 2R1WB 4P23D 3BN9D 3RPKA 1LE5B 4ISVA 3PXHA 2D7TH 2EDHA 1RULH 5B3JF 4R7DB 1MNUH 2I25N 1G9NL 2X89A 1YJDH 3QIWB 1A7OH 5DJ6A 2P8MA 2Y1VA 2P24A 3MA7A 2J1KA 5ETUB 1KELL 3UTTA 3S34H 2Z8WC 2ZCHH 4MA3A 3V4VH 2Q1EA 3GMOA 5I74B 3MNVA 5CD5C 2K7QA 7CGTA 3WJLC 1SJXA 2EH8L 3OGCB 2LU4A 2WANA 4AIZB 4LLQA 4XGZA 3RWIA 1MIEH 3C5ZB 1AGDB 3MRHB 1NC4A 2FATH 3ZSTA 1ZHLA 2PYED 4AM0B 5DRXB 1F3JB 4G9FA 3HPLB 1GPOH 2F53D 5D2NA 3VA6A 3SKNB 3PGDB 2FJFA 1RUPH 2DJUA 2YPKB 1YY9D 4BSVB 4LSUH 4HFWB 3KPMA 3ARPA 5IMKB 3MYJB 2WLYA 3TPUA 1DN0B 1RIHH 3WIHL 3RUGA 3IDGB 3WHXA 4NFCA 4U1SB 1RZFL 4DFHA 2FEEL 5H94A 4HIEB 2RAMA 4JY4B 2YSSA 3DOSA 4HIJA 3QEUA 2OS7A 5C0CB 3VD7A 5DEGA 1DUZB 1IQWL 4JFED 5LGHH 4MX7A 4ELMA 1HKLL 2WUCL 4KJYB 4M7LH 3IXAB 2G75A 3CK0H 4YR6B 4EN3B 2ICES 2PN5A 5D71H 3D3VA 3QFDB 3WS3A 1HH9B 1I1YB 1FLRL 2XPGB 1MHEB 1CBVH 2CMRH 2E9IA 3RL2B 4Z8FL 3X3FL 3SDAA 2VUOA 4HC1L 4JPKL 2R0ZH 1PDKA 4PBWD 3DETD 3TYFB 4TVPD 1TCRA 1KUMA 5IG7A 5CJ5A 1UM5L 1QNZH 4A2MA 3QH3B 2HT3D 43CAA 1I7UB 2ZUQB 2P5WD 5J6HA 2EXYD 2F53E 5E5MB 3HNVH 3OKNB 4OB5L 1HSBB 1UACL 4YBLC 5KG9A 3VGHA 3O0RL 1E6OH 3E2HC 4PJHB 4XNQA 4EUPG 1KB9K 2CLVB 5DJYB 2DQGL 1FFNB 3FAWA 5B38G 1RV6X 5HI3C 4TQEH 2IMNA 3GRWA 4FZEL 4Z7UB 4FQXB 4D9QE 4HWBA 4HX1B 1AQDA 3QCUH 2BFVL 5DHVH 4GAGL 3HN3A 3RPIA 2CQVA 2DWEA 2ZUVA 1D6VL 1DQML 1D5IL 3OL2A 2DMBA 1CR9H 1K8IA 2AV7A 3T0EE 1QBLH 4GG6B 1U8QA 5DJZA 5CIPH 4RNRB 4LKXB 2ADJA 3B9KB 1G7PA 4HLZH 4ZFFB 4JO1H 3VXTB 1FZMB 1VGKB 2VQ1A 4MB4A 2V2XA 3VGAC 1ZHKA 3L7EA 4ZQKA 2IPUG 3FN3A 2EXWC 2FBOJ 4MJ6A 4ZTPL 4WY7L 2LE9A 4TVPE 4XXCC 1EJ6A 2VDML 3L7FA 4JHAL 4U31A 4X8XA 3VFGL 4WCYH 5C7XH 2G60H 4PG2C 4HZLA 1K4DA 2I27N 4NCDA 4NQEA 4EI5C 1FIGH 2AJUH 4NN5C 1JNHA 2N7BA 1DN2A 2ZOLA 5T5FL 2VQUA 4L3EA 3CLFH 4OCXL 4X6BA 4LPTA 3GSVB 1LO4L 4FFWD 2AJVH 1GHFH 4UV7H 5MERA 5GZNC 5LXGL 1EBPA 1VPOH 1P1ZA 2F15A 2XACC 3L3OB 3KGRA 2FEDC 1AKJD 2HN7A 1EXUA 1KTDB 3WSQH 1JYVA 1YPZF 3VXUE 1DSFL 3ES6B 3DMMA 3NAAH 4LQFL 2JJVA 4OD3H 1TXKA 2JIXD 1D7FA 1L0QA 5D8JH 3C87A 1HXYB 4ZS6C 1WITA 4F7PA 2V17L 5C1MB 2HJLB 4OIAA 1UKSA 3GJFH 3MLWL 4CW1A 3I75A 1LP9B 5HHNB 4NO5B 3ARED 3C6LC 2NY3C 4MQ7B 2ZSVB 3QEQA 4ODUA 4MXWH 1UM4H 5IB3B 3GK8L 3RWGA 5J3HC 1RY7B 1QP1A 4NN7C 4OLWL 3QRFM 3P4OB 3W11D 3T65A 4FA8A 1MVUA 4BELD 2YPLD 4QRUB 1X4XA 1NSNL 3TJHD 3MRFA 3FT3B 3HE7C 4NNXB 3TIDB 4TUOA 4R97B 4RGMC 4U1KB 1NCCH 5IB1B 3VXRB 1NKRA 4CN6A 2LAGB 4GAYB 5CILH 1RHHB 2EE9A 4G42A 3MXVL 1UEMA 2XOTA 2PXYB 1ZEAH 4K8RC 4TRPL 5J7CC 1NBVL 4LPXA 3ZE1E 3OAZH 3QIBC 5EO0A 1PEWA 3OKEA 2DQDL 3PIQA 4TVPL 3TPKA 5C0AA 4PPTA 1S7VA 3SGDI 2KQNA 5C0EA 4YBQC 2QQNH 1YNLL 3TN0D 5D7SH 4OIIL 1F4XH 2BNQA 3PGFH 2HKFH 3HUJB 3RP1A 6FABH 5IW1B 1SY6L 3U0WL 3EZJB 2X4PB 3S36L 3RVXC 4NPYB 5I1IH 2V2TA 2C7UB 4JR9L 4U2ZA 4WTZA 3BQUA 4JFPA 3V7MA 3ARDC 1NEUA 4XRCB 4LBEB 4HULB 4XVSL 2IANE 5IQ9A 2WNGA 3UTZA 4XPGL 2VDLH 4U0RC 3O6LH 3I50L 1JHKL 3GUTA 3TFKD 1P5VA 1DVFD 4Y7MA 3EO1B 4UT6H 3KLDA 3RGHA 5DD5H 2WBJA 3WN5B 5IJKC 4CVXA 2YPLE 4N90E 2YC1B 5EU3A 5GXBB 1X5XA 2NTFA 1FSKB 2FHCA 1MAML 4JM4L 1YN7B 1KIPB 1U3HC 4JRYB 5BVPH 1T2QH 2CLZB 2A73A 3PQYE 3WD5H 3RTQC 1F13A 5EZLB 1Y6KR 5CZVH 3CVHB 4MLIA 3EDJA 5KVEH 4M1CC 3LN4B 4WENB 3ROOB 1QLFA 3LQMA 1T2XA 4JRXE 4YK4B 5ICYA 3JV4B 4C4KT 5FB8B 1A1MB 1QRND 4CL7A 1R5VA 1LWRA 3V6OE 8FABA 2ARJB 1JZ3A 4JFQB 3KJ6H 4OGAC 4P2RB 3U9UB 5IVXE 4MS8D 1I75A 3BDXA 4UQ2B 1FCGA 3BZ4B 4G8GB 4C54A 2O5ZL 5FYKU 1HIMH 4OLXH 4DN4L 1JZ6A 5IB2B 5DC4B 5MEQB 3DX6B 4YXLL 3GIZL 3MYZA 2B20A 5TFSL 4ODHH 2Y4SA 3NCJL 3UTSB 3EJZC 1U8KB 2AEIT 3BZDA 2D0HA 4LKCA 4F3FB 1NGYB 1OAQL 4NZRL 2IBBA 3REVB 2R69H 4LLMA 3MGAA 4FQIH 4R26H 4U4BA 2C1PB 5GGQL 4G6AD 3S35X 4MNQA 2B0SH 4LASH 2ATPB 1EZVX 3QXUA 3HA0A 2XRAL 1TQCB 5D7JA 5GGVL 3FFDA 3BZEB 1YEGH 3F7YB 2BRQA 4UNTA 3D85D 2DTSA 1FNFA 4L9LA 4YHNB 3PGCA 4K23H 3MCKB 5L0QB 1GGCL 3ZHDA 3GBMH 4O2FB 4OCMC 5KSAB 1MIML 4UT7L 4ZUWA 2G5BA 3QXDA 3BYYA 2C3VB 1QFWL 1QRNE 3LV3B 3SKUD 5TQ0L 2MNUA 5F9OH 5HYSG 4Y4HB 2FSEA 1F97A 3BXNA 1MLCB 3E3QC 5D1QA 5D1ZA 5E6IA 3RVUD 2XWTA 5FHBL 5F97E 1UJ3A 4R96B 4RA0C 5IJVA 2YR3A 3EOTL 3GEWB 5E24E 2YPVH 1D5BB 3EFDL 3RJQB 1BQLH 4JKPL 2DL2A 4NN6B 4WW2A 4FQ2L 2D31A 4LRIC 1XR8A 5C07A 3BRDA 1OAKL 2ZOKA 2ERJC 2HJKA 3EO0B 1UWGH 4KRMB 4M7JL 1LO0H 3VRJB 5EOCJ 1A6WL 1FDLL 3ARGB 3FMGH 3NCBB 3NCYS 4ETQB 3W2DL 5EOTA 1KGCD 3JWNC 3LKNB 4HHAB 1NCAH 3FOLB 4ONOA 2BSED 5HHOB 4XZUB 3KLHC 2WLZA 3HE6D 1KCKA 3BO8B 1DBBL 1C5CL 1II4E 4LSPL 5CGYC 3AY4A 1KPRA 4U1GC 3RHWF 1MJUL 3MRPA 1RJYA 4MA7L 4JJHA 4H0HB 2IAMD 1LO2H 3C6SA 3LQZA 4IMKC 4MB3A 4BH8B 4L8BA 4QHKI 4UINH 2FD6L 3K46A 4F57H 5BJTB 4PJGB 5F72S 3ARBB 5F7KC 1JGLL 5ALCL 3OR6B 1FORL 2KL6A 4KJPD 4XVJH 1WIPA 2WWMC 5CD3A 2IC2A 3EJJX 5I1DA 1FBIL 4F58L 4Y4FA 1C16B 1U8JA 4FQHB 5LQBH 1RD6A 1ZANL 3OXRB 2D03H 4X98B 2QADC 4FMFA 4U1MB 5D96C 4XP4H 3OZ9H 3X13A 1NCTA 3G6AA 4GRWB 4KJWC 1UWXK 1B0RB 1M1SA 1I1AD 4KY1L 3G04A 3RNKA 1D9KA 1JTPA 4NFDA 1LE9B 1CZ8L 1LEIA 3VG0H 3BP7A 4DN3H 3EOAB 1BFVL 5C2UB 4LF3B 4CN4A 4ALAL 4ZUTB 5T33H 4UBDC 3RIAK 5IR1B 1NBQA 3MJ8A 2DDQH 1XR9B 3GMPA 4UUJA 4LHUG 1UT9A 5B8CC 3LD8C 1Q0XH 3QT2A 1OB1A 1ZTXH 5C09D 1A6PA 3TBVB 5F9AC 3IS1X 2NY2D 3HI5H 4L4TE 1HYSD 5KVMC 3FRUB 1MPAL 1WC7A 2R4RH 1BREA 4YIQB 3NIDE 3WXVH 4OCWH 1T80A 4OUUB 4TUKH 5E8PB 3T1FA 2PTUA 2WIIA 3DX9B 3L3DA 2E3VA 2EH7L 3ALXA 3KHQA 4FFVC 3VFUA 3QIWD 1TZHA 4HKBA 1U8HA 4FTVB 1NCWL 1G7HA 4PJAB 2A6JB 3N06B 4NYLA 1T21A 3QI9B 4R0LC 4L29A 3DSNA 5IF0B 1KLGB 3WFHA 1IFHH 4GUPA 4W6YB 4JFOA 4Z7VF 1DDHB 3QA3B 4LHQB 5TE7H 4WV1B 2VDOH 2EDYA 4MCZB 3PV6B 3C5ZD 15C8L 3KPQB 3KLAA 3QNZA 3D39B 5D4QA 4EI6A 5TQ2H 2EIZB 4R7NA 4JN2A 5HBBA 4D8PA 1ZLUH 2ITCB 4NHCH 1N4XL 1ZHNA 3K7UA 4LL9A 1DQQA 5CSGA 2ZJSH 2O5XL 2H9GA 4DZ8B 1A1OB 3D87B 3LSOA 1KJ3L 3G6DH 3H42L 4M5YL 4OD1L 4EXKA 2QSVA 5DDHA 4PRIB 4JFXB 3CXDL 1IBGH 2DQFA 4CJ1A 3OX8A 4Z78A 4B50A 2AK4E 4JY6A 2DMCA 4RMVA 1QLRA 2DIBA 3DUSA 5C0CD 4JDTL 4MVBD 5D2NC 4X5LA 4ZNEA 5I75B 2Z35B 1HDMB 2HJFB 3IFPB 2VXTL 3VI4E 1EEYA 1I9RH 1K85A 4EN3D 1JWMB 4I0PB 4O2EB 4XWOD 3NCFB 4H1LH 4A6YB 5BW7A 3O45A 1MFAH 3IU4L 3VFVB 4JFZH 4I3RL 2WM0A 3CU1A 5HI4D 3QEGL 3ARUA 1SMAA 4YJZL 2CD0A 4LVNB 3I6GA 1XGQB 4OZIE 2CDGA 4BK5A 1R5IA 5JIKA 5DO2D 2Q8BH 2PW2A 4GH7B 3WL9A 5I73C 2AQ3A 5EUOE 1WBXA 2PYFA 1F11A 4OQ1A 3H6JA 1PY4A 2VITB 2A77L 4BZ2L 3LIZH 4Y8AA 4GO6B 3BE1L 4KI5E 5BRZE 4LQ1A 4ELKA 3VH8B 1YEHH 3LKPB 3IDYB 3ESVF 4QRQA 3F5WB 1G9MC 1YPZA 3FTGB 4JQVA 4MD5B 3VW3L 4FQXD 1D5ZB 4HAGA 2VDNH 4A2LA 4Z7OF 3IFLL 1E4XI 4WEBH 4TPRL 4MXQD 2Y36H 4GXVH 4R8WL 1UYWL 2CH8A 2HVJB 2VYRE 3FQWA 4RFNB 1KCUH 3T3MF 3VMNA 1Q9KB 4PREB 4JZNA 5ERWA 4K71C 1H15A 1WK0A 2R15A 3NIGF 4XCEA 5CJXA 1CDHA 5GISL 3C08L 4Z76B 3B9KD 3T0WA 2OR8A 3NTCH 1TJIL 2BY0A 2BVOB 1OP5K 4DGIL 3QJHB 2WP3T 4GS7C 4QRRE 5GRZA 4FQLL 1MHHA 3C9NB 4KPHH 3CGTA 4PJBF 4U3XA 4Y5VB 5GGVY 1TDQA 3KDMA 5IFHH 3WFCH 3C09C 5F9DC 4OCLC 4YDLB 1NAML 4RWHA 2H3NA 3DX7B 4X7DC 5E4IA 4LLYA 5BV7B 5HGDB 5IESH 4M6ML 5IMMB 4N0UA 3O4LA 4ZD3L 3C60B 5GS1C 2C9AA 1C12A 1JPTH 2I60L 4L3CB 5D2LE 1L7IH 1BJMA 2ED9A 2HAZA 2R29H 4WWKC 2O61A 2D3VA 4NO3A 1OTTC 1MJ7H 5IVXF 5CWSA 3PV7A 1DEEB 4HIIB 4Q0XH 5E4EB 2EKSA 4HKXB 2QQLL 1G1YA 1J0KA 2ATKA 2F74A 1NMAL 4ZODA 4HS8H 1I7RA 2P48B 4HKJB 3FZUD 5FUZH 1E4JA 5A2FA 5HD8C 2VIRA 4U6YA 3LVEA 4J3SA 7FABH 2Q3AA 2ZUXA 1BIIB 3QDJE 3Q1SL 5FCUL 4QT5A 2NYYC 4DGYH 3WUWB 1H3PL 4YPGA 2YBRA 5T1KA 3PHOB 4XPBH 5DXWA 3DVNB 3UC0H 3EDEA 3DTXB 2Y7QB 1ONQA 1CIUA 1RUAH 3IDJB 2R0KH 3QRGH 3VGBA 2PKDA 3KVQA 1YNTA 1JMZA 4HWEH 1P9MC 5FK9A 2IF7A 1PSKL 2OTWB 3GSQA 4ODTH 4LOUC 5MI0C 2DAVA 1ZE3C 3HG1B 5KAQF 4QOKA 4LSQL 1QLEL 4XCYA 4I2XB 4NHUB 3VXRD 2YN5A 2VAAA 5TF1L 4O02H 4S1QL 3QEHB 4GKZA 1QFHA 2PXYD 4G6JL 3TV3L 1E0OB 5GS0L 5T5NF 3SGJA 1INDL 1WGOA 3RWDB 2BK8A 3O81A 2DJSA 1AE6H 1FL6A 1I8MA 3ARYA 1HXMA 4RCAA 1EFXA 4LNRB 4Y19E 2W65A 1A2YB 3KPLA 2V7HB 3G08B 4UV4H 5FYJH 4XI5C 1OSPH 5F6IC 5L7XH 1BEYL 5JPMA 2JB6B 1NGXB 1OWWA 3PWPE 1OQXA 5J6GA 5C0FB 2BSTB 4S1RL 5TE6L 1LK3H 5FFLA 3WO4C 1YEFH 1BBJA 3O2DH 4BJLA 1KCSL 1CF8H 2AKRB 3I3BA 4Y1AE 5EA0H 3C8KB 1AGEB 2XZAL 4MD4B 5GJSH 1YEIH 2MMXA 1IARB 1HZHH 1SEBB 2YK1L 4CU6A 2ICEA 4I9WE 5JXAL 5TE4H 4I77H 3FKUS 4JRYD 4Q9RH 3X3FH 4LRNH 4Z0XB 5IV2B 3GJEA 2Q6WA 1IGCH 2ZCKL 4CADA 2BXYA 2JB5H 2OJZL 4WI5A 2W0FA 3WXWL 4UDTA 2DRUA 4GRWH 1YC8A 4L8SA 4WI7A 1KEGL 1UB5B 4TNVF 4WUKL 5KW9H 3QUXC 4ODBD 1IRAY 4X5WB 2HFFB 5LAXA 1K4CA 1AR1D 1AGFA 4HMEA 4P2RD 1FNSL 1MCKA 4CMMB 1S8DA 5GSVB 2EZ0C 3P11L 2I9LA 3FJTA 4G8GD 2G9HA 5DD6B 3O3DB 3SE3A 3QWOB 3PWNB 2HLFD 1YEEL 1E27A 1M4KA 3ULUC 1B88A 4GXUM 4KRNA 1OW0A 2BJMH 2XG4A 2VXUL 5J06A 1SM3H 2E9WA 2X4UA 3ULVH 3L6FA 3DPBA 1W8NA 4XB8A 4HLJA 3KNBB 4P23A 5E8DH 3UTSD 2J6EA 4FG6D 4LGSB 2PUQT 4YBLB 1NLDH 3FQRA 3E2HB 1WTGT 2JK5B 1AFVH 3KXFA 1QEWB 3QHZL 5BQ7A 1A02N 1EEQA 1BIHA 3NIDF 1XF5B 1B0GB 4YLQT 5ID1B 3BKML 1A14L 4UDUB 2Y6SC 3T04D 1OM3L 1LDSA 4D9RD 3I6LD 5FYLE 1IEAA 3SKOB 5DQJB 4H20H 4LDOB 4PJ8C 2Y07H 5F1NA 4F15C 5L88H 5KSAD 4XNXL 2PYEA 3KYOB 4KAQL 1IGFL 4Y4HD 5H8DA 2W07A 1X7QA 2YEZA 1WFNA 1AIFA 1R24B 2ORBH 2ITDB 1AXSA 4LEOB 5GGTH 4HPOH 3HC4L 3X11B 2GY5A 5HYQB 5D7JC 3H0TA 3BPOC 4JFDB 5IROC 4G8GE 3BUYB 3T0BA 3VGAB 5E95B 1HYRC 2YD8A 3U6RB 1FL5B 4L9LC 1GZQA 4MQXD 2CDEA 5GJTH 5ID0B 1RZIB 1XCTA 4FP8H 1ORQA 3LQAL 4AMKH 3JZ7A 3EIFA 3Q6FA 3QXAA 1I9JH 3KWWB 3OTTA 5T3XH 4PGCB 5D1QC 1AQKL 5CJOL 3ARGD 4JFEA 3VXOA 4POYA 4MAUL 4WFED 1TPXC 4EI5B 4NT6B 2VOTA 3N9GH 1P4LA 2EDKA 5BXFB 4N0CD 1JNJA 4JO2H 3A67L 3S6CA 5HHOD 1IGYA 4HCRA 1ZHBB 1IVLA 4A6YH 2VZUA 3PDOA 1XIWC 2BNRA 1RMFL 3VFWA 4ONGH 4WW1B 4D9RE 2NY5C 3I6LE 4S11A 3JWDH 3ZT7A 1HHJB 3MROB 3A0OA 4LCYB 4XMKL 3T8XB 1XGPB 2O5YH 1A6VH 2VH5L 5CP7B 3VXQB 4C59B 3ARBD 4Z7VA 2P5WA 3VXME 2ESVE 3ZE0E 2MCPH 1NKOA 4HIXL 4AG4L 4OGZA 1NBYA 2MKWA 4Q9BA 5HDLA 1QACA 4TRPH 5I1AA 3TO2B 3MACH 4ZFZB 5F3BB 5I1KL 2NY3B 1B4JL 3CVHL 4MDIA 5EUOF 3QUML 2XN9B 5FYLL 2N1KA 3G9AB 4NN7B 5I1CL 3JVGA 3E8UL 3SE9H 3HLAB 4AT6A 3FONA 4EBQL 1RJZA 1DBAH 3LHPH 4MA8H 4RGMB 3VFTA 1UVQB 4QCIB 4ZUSB 3PABA 4NQVA 4JANA 4XBGB 3BWUC 4Y4FC 2FX8L 5HHOE 2EO9A 3MJ9H 3QIBB 3HS0A 2OZ4A 3GI9L 4YO0B 1DBML 4PRBB 4G6KH 3BVNB 3LEVH 1MY7A 4L1HA 2EDFA 3FO0L 2XTJB 4PTTA 1S7SB 2UZYB 4XP1L 1Q94A 3MRIB 3JSSA 3ULVD 1OTSC 1JN6A 3TWCL 1D9KC 2AVGA 2YWYA 3KPRD 4FQCL 2VLKB 1XT5A 4K3HA 4C56D 1J1XL 5BV7H 1P2CA 1H8NA 4YDIL 4WHYH 4PGEB 1PGRB 4IS6B 1DE4B 2BNUB 3HC0B 3IRZA 4WFFE 5DRWA 4J8RA 3ARDB 1T4KA 4FTVD 5EWIH 2A2QT 5CINL 3QI9D 2DM7A 4Q6IB 3UJIL 4U0RB 2I9TB 5IHZA 1BGXL 1X6NA 2CPCA 1L9MA 4N5UA 5DVKA 1HCFX 1KLFA 5DHYA 5JQ6H 3ZTJG 4PJHF 2HVKA 3IVKB 2PF6A 3W39A 4JFYB 1M6OB 2R8SH 3D39D 3RU8H 1AKJA 3IAQA 1U3HB 4H88H 4MD0A 2FECI 3SDDC 4IHOB 4Z7UF 1T0NB 3S7GA 3PWJB 1AP2A 3CC5B 2JIXA 1FO0B 3W0WB 3MV7B 1G7QB 1GZPB 2B1HH 4J3WA 4BM7A 2FR4B 1IAOB 3VXNA 5JA8B 5KSBB 3W5NA 3N1GC 4PRID 3AREA 4B5EA 1I3RA 1CXFA 4GG6F 2ADFH 3G5VB 2XZCL 3MRNA 4JCLA 5TDPA 3HNTH 1N8ZB 1G7IA 1ZLWH 4KK9C 4I4WA 3KPRE 1PY9A 1BFOB 5T3XD 2APVA 3UEZA 5AYQA 3WIIH 1H8SA 2NW2B 5T3ZH 3IJYB 5CBEA 2J5LC 4C56E 3IDIA 2YPLA 1TNNA 2IH1B 3V6FA 3ZO0A 3BIKB 3QFJE 3IJHA 5DT1L 1QR1B 5EOQL 4PJBA 4FTVE 1DQDL 4I0PD 4M9PA 4PJ7B 4QRTB 3A6BL 2UWEE 3E6FB 3UYRL 1ADQH 1YQ2A 2C5DC 2AJYH 2VQTA 4ODXB 3O6KL 1QFWH 3CZFA 1CVSC 2QHRH 3ZKXB 5AUMA 2FB4L 5D7LB 1PG7H 4ZOBA 4NQTA 4XBPA 5E7FA 3TN0A 3D39E 4YHMH 3EOTH 2IJ0C 4U7KA 1UEYA 4YAQA 5HPMB 4M62L 2IQ9L 1CXLA 3FT2A 3IAPA 5BW7C 3JTTB 3IETB 3EFFA 1R3IL 3NH7L 5DD1H 2P5EB 3WFEH 4K9EH 4PG9A 4EDWL 1BJ1J 2XWBB 4S1SL 1QFOA 1KN2H 4BFGA 1DLHA 2NW3A 4F37F 1MH5B 4HGWB 1QPPA 5K33A 1RIUL 5I1EH 3BHBB 3VDCA 5DHVA 1DVFA 1MY5A 3U2SA 1A7NL 3ROLB 4M5ZL 5C08B 3KJ4C 3U7AA 3VFOA 4PRNA 3JV5A 5EBWA 3AB0C 2ENYA 2H32B 3B83A 5CIPA 3PXJA 1U6AL 3L3IA 1KSRA 2PTTB 3HZVA 4DVRL 5ESAA 1QOKA 2C3WA 5J1TC 3ARFC 5EBLA 1OTUC 4PP1D 1SBSL 3RAJH 2UY6A 4S2SA 4QTIH 1TZIB 3VFMB 1UB6B 4K3JL 4YHOH 5FF6A 1R0AH 4APQB 3GMRA 1MCPH 2NQCA 4K3GA 5EPMB 3TCLB 4JHWH 3OKMB 1ZVSB 1I1FA 4WHDA 2N56A 5ELIA 5CJXC 3S96A 3IXTB 4YHLH 4U1GB 3ILPA 5B4MC 1A0QH 4OCYH 1CLOH 3C60D 3THMH 2X4RA 4XNMA 4PJDE 3RI5F 2EECA 2IPKA 4KKCD 3JUYA 3IFNL 1P53A 4CJ0A 1EJOH 3RNQB 1FZKB 1EO8H 3RL1A 3T09A 3B6SB 3NGBC 1INEH 1SEQH 5JOPD 1A6AB 5GGSB 3UBXB 2YRPA 2YZ1A 3TYGH 5E1HB 5DUBB 4E41B 4P9HC 3MNWB 4XVUD 4FN0A 1OARL 2NX5E 3TT3L 1CDUA 2YD7A 3KPOB 1JV5A 4QTHA 2QADB 3PNWB 3FQNB 1BMGA 3TO4B 5HGBB 5C0NC 4OLZH 5ADOL 4NQXA 3D85A 2OL3H 3GJFA 4JZJA 2NMSA 4XP6H 4NUGH 4LARH 1BOGA 1DBKL 3QP3A 5T3ZD 5D5ME 2XQBH 5B8CB 1KPUA 2FL5B 1SJHA 5IEHA 1JWSA 5HDBE 5C2BL 5JDSB 3HG1D 1A64A 3TNMB 43C9A 4LCWE 1MFBH 5DQ9A 1RZKL 3U36B 1LD9A 4K2UH 1RUKH 1XAUA 4OLUL 4XTRC 1KCRL 2NY1C 1BVLA 4ZPTA 1FVDB 3SBWA 4KTDL 4XPAL 2NY6B 1BAFH 4YC2C 4LLUA 4LIQE 4H8WH 3JBG7 2AJZA 2CRMA 5C6TL 4MB5A 1FNGA 2H8PA 4M4RA 1VADA 3EYQC 5F7HA 1G6VK 3SGJC 5JPNB 1LK2B 3NPZB 4U3CA 4PGJA 4NM8H 1RZJC 2VISA 1YEDA 2IAMA 4XCCH 1R3LB 2EEDA 4AEIH 3MLXH 5KANI 4M7KL 2P24B 3UTTB 5IOPA 5LCVH 4LGRB 4OZ4B 5DLMH 1BD2A 1TVDA 2AXHA 1KT2B 12E8H 3I6KA 1NC4B 3QJFB 1CGYA 1WFOA 4NC2B 3V79C 2Y5TB 3HG1E 5KSUA 5IUSA 4POUB 1DBJH 4WU7B 2EE6A 3VFPB 3CFEB 1A3LH 5GRXG 2X4TA 2D7MA 3ZE0F 1KNOB 1KXTB 4OUOA 3U48A 3QO1A 3KPNB 5IBTL 2FJFB 1PZ5A 5DUML 3O3EB 4I0CC 3TPUB 3RHWK 4RMUA 3MA9H 1J12A 4NBXB 3AMLA 4PJEB 1Z9OA 3QCVH 4P2CG 3NA4A 5DEFA 3RUGB 3BFOA 3GSNB 4WI3A 1CFSB 2VDRL 5D9SA 1YEJL 1ZA6A 3ISWA 4G3YL 4M6OL 1CD1A 2DOCA 5C09A 4L8SC 3HZKB 4XVTH 5TDNB 4ZAKA 4M1GL 2R1WA 5I73B 1CXHA 4JKKA 3CH1A 2DJ4A 1XF4B 1S7TB 4ZFOL 2ZPKH 3U4BH 4O4YH 1KJ2B 4DJMA 3ALPA 4LIQL 4JB9L 4R7DA 4WFGE 1HINL 4Z0BH 1CGUA 3H3PH 4NSKB 4OQTL 3SE3C 3QIWA 4KMQA 4X7SH 4HV8B 4L3AA 1A7PL 5I8EB 5ETUA 3SDCC 4NQCB 3MMEB 5FM5O 4PJFA 2A74A 4HXBL 3VRIB 1QBMH 4HEME 4PJGF 5L2KB 3P0GB 1JGUH 3HI1B 43CAB 1CDBA 4PRHB 1OAXL 3OGCA 1FFPB 4AIZA 3VGFA 3MRHA 3F7VB 1CGVA 1C7TA 4GMTL 1NMBH 3R8QA 4K71B 1VFAB 4AM0A 5DRXA 1IT9H 1F3JA 1W0VB 4TULH 3HPLA 5CEYB 3M45A 1L0YA 1U8OA 1FO0H 5GSRB 3IGAB 3SKNA 3MRLB 3PGDA 4GAFB 4YHYC 4NQSB 1JPST 2YPKA 4GRWF 4GS7B 4JFDD 5CUSL 5B39B 4HFWA 5DD0H 5IMKA 3MYJA 4DKFL 2AV1A 4K7PL 1DN0A 2EXWD 3IDGA 4MXVE 4MJ2A 3WNNA 3LAFA 2NY0B 2ZUWA 4KH2A 3IF1A 1FH5L 2FYYB 4XMPL 5A16B 2FX7H 4HIEA 2YMXL 2W91A 4JY4A 3SGEH 3B2VL 4NNPH 1OGAE 5DJZB 5C0CA 1RUQH 1ZLSL 1QSZA 1DUZA 4NQUA 3AS3A 2P8LB 5GS1B 4XX1E 4EI5D 4NZTH 2X10A 5E2UL 4KJYA 2JJTC 3O3BB 4WWKB 1V7NL 3IXAA 4YZFF 3ULVF 5KVDH 4EN3A 2BVPB 3QDME 3QFDA 4JY5L 3ILQC 4MJ6B 2XPGA 1MHEA 3PWVB 2LU7A 1RU9H 2BRRH 3RL2A 5GZND 1MRFH 1I9IH 4KKAC 1K4DB 1A9EB 4WGVB 3QWRD 5D72H 3TYFA 1CU4L 3WJJC 2FEDD 5BZDB 1I7TB 2FX9L 1G7LB 5H35B 4OZGB 3UJTH 4K3EL 4KZDH 3QH3A 4UOW1 2QQKL 1NUGA 2AGJL 4L3EB 2BCKB 2GFBB 4RAVB 5E5MA 1T1XB 1HSBA 5CFHA 1CTNA 3RY6C 4PJHA 5HHMB 2CLVA 3NFSL 4ONFH 1FFNA 4GJTB 4NGHL 1DANU 4JFDE 2H26B 2NY3D 4KMTL 5GRUH 2AEQH 1MRCL 3VDBA 5KS9B 2XN9D 4Z7UA 4IBLT 4FQXA 5J3HD 1NFDB 3BH9B 4P2QE 5FHAL 4HX1A 5SWSA 3UPCA 4I1NB 3ARSA 1MJJA 5MI0B 5KZCB 1R3JB 2RCSL 4G5ZH 1T22B 3F65A 1MRDL 2FHBA 2W9DL 1XMWA 4GG6A 1T3FB 4XNYH 4UILL 1S9VB 1HQ4B 4RNRA 2GJ6E 4LKXA 3SO3C 4K8RD 2EDBA 3B9KA 4OLVL 3QIBD 1AD0B 2UY7A 4ZO6A 2Q20A 1FZMA 1IC4H 4X8JB 4XH2B 3QG7L 3T65B 2NY7L 4HF5L 3JVGC 2XTJD 4OF3A 5D7KD 1P7H<