2Y72A

Crystal structure of the pkd domain of collagenase g from clostridium histolyticum at 1.18 angstrom resolution.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
85
Chain Sequence
GGTIAKVTGPSTGAVGRNIEFSGKDSKDEDGKIVSYDWDFGDGATSRGKNSVHAYKKAGTYNVTLKVTDDKGATATESFTIEIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COLLAGENASE
publication title Structure of Collagenase G Reveals a Chew-and -Digest Mechanism of Bacterial Collagenolysis
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Hydrolase
total genus 17
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2y72A00
1QRNB 2R0LH 3S3SA 1SVZA 1DUYA 3MV01 1MHEB 4MD0A 5EA0L 3NFSH 5KSAC 1HDMB 5I1IL 3EZ8A 3SDAD 3AGVA 3JWOH 1IM9A 4OLVH 3DURB 3TN0A 1DANT 3OKLA 4ELMB 3GMOB 3ZE1F 4OLWL 5JHLH 1Q9LB 2DQGH 4PJ8B 1CXFA 5ACMA 2ORBL 3BWUC 1OTTD 2A6IB 1HKLH 4NC1E 4YUEH 2KBGA 3D2UD 3GI9L 2Y72A 3BDBA 2WINA 4YQXH 4I1NB 3SGEH 5HYJA 4AT6A 4JJ5A 3CFDA 1IAOB 4R96A 3TNNB 2X1OA 3CMGA 3QPQC 4ZXBD 5IQ9A 1YEFH 2W60A 5I71C 4BUGA 1J0HA 4XHJC 3VD7A 1RMFH 5ISZE 1A47A 2X41A 5J9PA 1MRFH 4P5TD 4AYFA 5I75C 1Q72H 5E8OA 4H88H 1AY1L 1SYSA 1F4XH 1B4JL 4OLUL 4BZ1L 1QYGL 2QQNH 3U0PB 4ZFZA 3DXAA 5FXCH 3TT3H 2EEBA 1HILB 1HXYB 4S10A 1ZHBB 2A2QT 2OP4H 1MCQA 3WS3A 2OXHA 2BSTA 2JTDA 1FYTA 2CDEA 1Q38A 2VUYA 2DTML 4KUZL 4IOFD 4AH2B 3QDJE 3PV7A 3D85A 4U31A 3S6CA 4OLXH 1PSKL 2P49B 4DQOH 1ND0B 2W91A 5CJ5A 4IOFC 4JPWH 1JRHH 3V95A 4OZ4A 4J3UA 5GGTH 5J06A 5JMOC 3D0LA 2AXJA 2IFGA 1NAML 4U1SB 1ZHLB 2J6EH 1NMCC 4S2SA 1WIPA 3EOTH 1FL3B 4P4KB 4ERSH 3DECA 3GJEA 4PJHA 4OF7A 1XMWA 3B9KB 3TVMB 4HQQL 4YFEA 3MLYH 4AG4L 1CFBA 5CEXB 4Z7QF 3RU8L 5C0AA 4CMHB 1BEYL 3MFFA 3MRGB 4GKNA 5JMRA 4KKBC 4JPVL 5ACLA 1AHWA 1ZE3C 2LTQC 4U0RB 5JW4N 1GRWA 2IFFH 4BH8B 5E9DD 3ZKXB 2D3VA 4N5ED 5BRZD 1MHPL 4JDTL 3S4SB 1YUHB 1A1OB 4P0DA 5KVEH 5IW1A 1ZA6B 5CJXA 2COQA 5CEZH 4M4RA 4YWGH 4PJ5D 3VCLB 1KJ2B 2Q86A 4PTTA 2IPUG 2DQFA 5DHVH 4KJYA 5TDNB 2AI0L 1WSST 3E1F1 4YGAB 3TBSB 1HHJA 3LN5A 3BKYL 4PJBA 1G6VK 3MBXL 3RGVC 3VW3H 4GXVL 3MRDB 1I3RA 4ZFOB 1H0DB 2VUOA 1XGTA 2X4QA 4FFYH 2O61A 3BPOC 3FQWB 3Q5OA 2V7HA 5FM4A 1UT9A 1HCFX 5F96H 4NN5B 5DC0A 1A0QH 1YNLL 1AFVL 4RMSA 4PB0L 3UJTH 3AB0C 1ZT4B 1A5FH 1A7RL 4FNLL 1Y6NR 3O9WA 4JFHD 1C1EL 5IWLC 4WFEE 1AD9A 2CXKA 1M71A 2AJYH 1FH5H 4IMLA 4UT9L 5IHBA 1FAIL 4UOW1 4G7VL 3L5WB 2EYRA 1NDMB 3VWKA 4PS4L 3UYPA 3BAEL 4QXUL 2ZCKL 2VITA 1HH9A 5HI4D 3DMMB 4X4YB 3T0EA 1LEKB 2YD5A 4IOIA 3F7YB 4NZUL 4OZFA 3KJ6H 2Y7QB 3OXRB 1AO7D 1UZ6F 4YXKH 1JFQL 4OZGB 5K9OA 2CH8A 1M6OA 2VB5A 5DD1L 1F4WL 1R24A 1RI8A 4L4TA 3PABB 5HHVH 1G0XA 4Q58C 4P48A 1HNGA 3ULUH 3BKCH 4V1DA 3AROA 5MEPA 3VGFA 4P9HL 5TPWL 3ESUF 5GPRA 3U7WH 4UINL 1RSFA 4KRPB 4Y8AA 2VOTA 3MXVH 1I9JL 3RUGA 5C0ND 5J4MA 1KULA 3MV11 1IARB 3GMNB 5C0NC 3O3EA 2IANE 5SX5K 2EO1A 1NCBH 4K2UL 2WUBL 1UA6L 1O7VA 5C6PB 3AMKA 1MCOL 4JQXC 1AD0A 5DFWH 2DQCL 1T7ZA 1K2DB 1KGCE 4PJAE 1NGZB 1YNTA 1HHHA 1M05B 4HKXB 3W5MA 1N6VA 4U7MA 4XTRD 4O51B 2D31B 4PV8B 4OKVA 3EO0B 5D2NC 2GYSA 4MA3A 5C08D 1U3HC 4NKOB 4Z7VA 5F70A 4R3SB 1D6VL 2NY2C 4X4ME 3UPRA 5HYSG 4RNRA 5T1KA 3OAZH 1INQB 2BRRL 1AXSB 1F3JA 1P84J 1IVLA 4MX7A 4Y4KC 3MR9B 1CDIA 3DV6B 1MFCL 5JR1H 5KSBA 1KG0B 3EOYG 1S8DB 1KJ2H 2ZSVB 5HHMD 1I8MA 1YEDA 4PJDE 3VXRA 3UO1H 1S5IL 2Z92B 1QTYT 3BYTA 3TH2T 12E8L 1NBVL 4ZAKB 3QDJB 1CE1L 4LEOB 4Y16A 3VD9A 3TCLB 1D5BB 3U2SB 3L3OB 4XZUB 1UWXK 5IBLD 2Q20A 2IMMA 4GRWE 4JM2B 2B5IB 1U91A 3VFTA 1YY9D 3LB6D 4M02A 3DUSA 1WIOA 1IAIH 5DMGC 2MCPH 1K5NA 3BGMA 4XC3H 1T3FB 1URLA 3IDXL 4NQEA 2ADIB 2F8XC 4P3CL 4LSRH 2X1QA 5MHSE 1T66D 3QXVA 3VWJB 4PJ9C 1JZ5A 4QHLA 1E27B 2AV1B 1T66C 2C1OB 1C16B 5B39A 1OARL 2IPUK 3BISA 1Q0XL 4ZFGL 3K2MC 4LSQL 1YJDC 3IJSB 4O9HH 4O2CA 3KYMA 2CUIA 3L7EA 1R3JB 1N5AB 1YMMD 3CXDH 2WIIA 5E8EA 5FYJH 5KVGH 5T1DH 2CDFA 1WWWX 4DZBA 4AL8H 3HHRB 5D7LB 4DK6A 5IFJB 3MRMA 4RDQG 1FFOA 1RZ7L 2K1MA 4HEPG 4Y88A 3X3FH 1JWSA 5TH2B 3CFKB 3IDJB 1PZUB 2YA1A 4KTYA 3SQOL 1YYML 4E42B 5E0QA 3SDDC 1F11B 2AAVA 1RZKL 1A9EA 5E24E 3PP4H 4XCFL 4N9OB 1UH4A 1J05A 3MV7D 5FUCE 3AU1B 3IU4H 2KKQA 2EIBA 1CGVA 4GRLC 25C8L 3P77B 4HMEA 4LVNC 4TUJA 5CSBA 3MLUH 1BOYA 1DVFA 2DLIA 2QV2A 5DRXA 15C8L 1WQVT 3UAJC 2DBJA 5DQDH 4OB5H 3FB5A 1UKQA 2DWDB 3U30C 5T3ZL 2HT2D 4UQ3A 2G60L 2EC8A 1L9NA 4V2BA 4PRID 2YKLL 4KUCD 4URTB 5GGRB 5HBBA 3RWDA 1OVZA 4RZCB 2FHBA 3LCYA 4NT6B 3WIFA 4KJWD 4E9LA 3HI1B 2DL2A 4KDVA 3I9GH 4UMGA 3GIZL 1UEMA 1YN7A 1Z6JT 4XMPL 2QADD 1CTNA 1BD2B 1TPXC 3G5ZB 5DR5H 5LXGH 3K2UH 3RUGF 1XIWA 3MREB 4UTBH 2Q6WA 4LF3B 3GEWB 2HJKA 1ZHKA 4R4ND 4B53A 3GBLA 3SJVE 4NO2B 2BNRA 4JN2B 5HYIA 2OZ4L 4KVCL 5D7JD 4QTIL 3IAGC 1VB9A 4G8GA 2X7LB 3GI8L 1WC7A 3D87B 2EC9T 2J3SA 2BFVH 4PJGA 1P7QA 4X6EA 4XNUH 5F1OB 4Y5XA 2WSKA 4HGWA 2YK1H 4NN6B 4P5MA 1WTGT 4K7PH 3TJEH 2W9EL 1CFQB 2VABB 4Q6IC 1CLYH 4QRQA 1UCBL 2ILLA 5AUMB 4HFUL 3MJ9A 1T7WA 3LKQA 3D48R 3UTSB 4QT5A 5M94B 4NKQB 3MV8D 4OTXH 5EZOL 2DICA 5BOZG 3OR6A 4IS6A 4Z7VF 5DO2D 5FM5M 2LAGB 3N1MC 2FWOB 3BPCB 3C09B 5C0RH 3SCMB 3EYUL 1DN0A 2NTFB 1F4YL 1OLZA 4XNMB 3S36L 3N9GH 3WEXB 5H94B 4WCYL 2X09A 4FQXD 4JN1L 1VFBA 43C9B 5DHYA 5GRWA 5EBMB 1DEEA 2X4UA 3BZFB 3QFJE 2IGFL 4Y5YA 5KG9A 3KPLB 4KKAD 4UT7L 1IILE 3EJZD 1RU9L 4KKAC 4S0TD 5D93C 1IKNC 1PX4A 4M6OH 4H0HB 5GIRA 2XIDA 4YHLH 4NUJA 4HKJA 2CGRH 5GRUH 1EIBA 4OCYH 4X0KA 4Y0GA 3NFPA 4XCCH 2A9MH 3KYAA 3WUZA 2V5TA 1X4YA 4BA8A 3NFNA 5EUKA 3RZCC 2R23B 2YD2A 3GHEL 5A3IC 3PV6A 5CZVH 3MLVL 5ID0A 2BVQA 4PJDB 4NQCB 5DUMH 4ORGB 4LLWA 2HJLB 3VRLF 4N8CL 2HT3C 2GJZA 2G5BA 5KTEH 2X4SA 2QQLH 3CLFL 2Q7YB 1MIMH 1JIBA 2B20A 3MRFA 1RUKH 3RWGA 1ZANL 3T3MF 1CZ8H 4K94C 2MPAH 3P4OB 2H2PD 2DRUA 4J3TA 2V5YA 3MBEA 2D7TL 4RFNB 3TH4T 3BP5A 1I75A 5BS0B 3TBTA 3C9NB 4NO5A 1KCVH 2QSCL 5E94A 3ZDXE 4F15B 2LV4A 5CINH 2ARJA 2AXFB 4M7LH 5EIIA 3WFBH 3BEVA 5BRZE 3UTZB 3O2VL 3VXTB 2FB4L 3QO1A 4ZPTB 3DTXA 2ICWA 4LSUH 1HWHB 2I07B 2XKNA 2B4CH 4PJ5E 5B38B 3ARDA 4JR9L 4PG9B 3ZDZF 3F6IA 2UWEA 4Z77B 3KYOB 3C6SA 3CFBB 5GGQL 4QRPB 2V2WB 3INUL 5JW5B 2FYYA 2BOBA 4S11A 2DD8H 2PCPA 4APQB 2CK0H 3L7FB 3IXAA 4Z95H 5FK9B 4B0MM 2XRAH 3MLSL 4XPGH 1WIUA 4IIQA 2LU7A 4XMLH 1R5WA 3REVA 4PG2C 2YEZB 3W9EA 3FL7A 3IYLW 4CW1A 3C60B 4P2RE 3DJ9A 4U1GB 2I60H 4G6JH 3REWA 3UYOD 4JKMA 2ADJB 3MX0A 4OCRH 5IF0B 3MA9H 5C0JB 2Y07L 1KPVA 2VLJD 3BIAX 2ZOLB 5D4QA 3FQUA 3JV4B 3R8QA 5C1MB 4QY8A 4R26H 1G9NH 1QFWM 3HC3L 4PJGF 4MAUH 5ENWB 1HSBB 4Q9CA 2ESVB 5BV7C 1UADC 3U7YL 5F6IB 1HOCB 1NGPL 1FC2D 2VMFA 3QUXD 4O2FB 4KZDH 3DBXA 1JNHB 4B7LA 4XP6L 5D2LF 4PR5B 4YDLC 5A1AA 4M6NH 3QR2A 2VYRE 3EO1A 1OP5K 2APWA 4N8PA 1Y6MR 4TUKH 4B50A 1K3IA 4X6DE 1JUFB 4OCNC 3ARRA 3AREC 3U36B 3VFGH 4LBEA 3N50A 4R2GD 4ZDHA 2B1AH 2FHCA 2IAMD 3NACH 2CLRA 5JUEH 3HG1D 2OJEA 1HN1A 2X70B 2E7LA 4U1IB 1BIIB 1FZOA 3SDAB 5E5UB 3OJDB 5K9QI 4ZUTA 1DLFL 4HPOL 1BQLL 3DROB 3O2DH 3CFCH 4CN1A 4Z7UA 4NBXB 1T4KB 4PV9B 1TQCC 1P7KB 4HKBA 1AGDA 4MD4A 2AXGB 4YDVB 1WCBB 4JDVB 3N1QC 4J12A 4K3EL 5D7IA 4ZYKA 2RR3A 3WXWL 1PQZB 1BREA 1CIDA 1E0OB 2YS4A 1NLBL 2A9NH 3D2UB 4FTVA 1OTUD 4G3YL 2I9TB 1T83C 5TQ2H 5HD8C 4HUWA 3CXHK 4FQIL 3G6JB 1FNEA 1OTUC 5L8JB 1XGYL 1QRNA 3GSNA 4MS8C 4ZXBB 1A14H 1DBJL 1FVDA 5D2NE 4Y4FD 5K9JH 2J8HA 2GTZB 3UBXI 4WEBL 5F7NC 4MCZB 2AJXH 4XNYL 1S7VB 3LKPA 1T22B 1WF5A 3DURA 4M7ZC 3S37X 1X5HA 2FZ3A 3FN0L 5IB5A 1MLBA 4OM1L 5BVPH 3ARFD 3GMOA 4P5TB 4M7LT 2F19L 3GUTB 5EWIL 5F9DC 5DMYA 2XWBB 4D9RD 3VXSE 2IWGA 5CUSL 2A6IA 5GGUB 1H3VA 4JKPL 1YECH 1KBGL 1YEHH 5DJCB 2EDTA 3LV3A 1LEGB 2NY0C 2GK0A 2BVPB 1JGUL 4EDXB 4ODTH 1MHCA 3S34L 1MJ8H 3X3GH 4OFPA 3ZT7A 1CL7L 4HF5H 4K55A 1X4ZA 4P3WA 2FL5A 4P23C 2YMXH 3GZKA 3T2NL 1IZKA 2NXYD 5DJAA 4F7MB 4OCMC 3IFOA 1IE5A 4XPFH 4KKNA 2H45A 5SV4A 4AJ0A 3VRIB 1TJGH 3K81A 1MCKA 5JA8B 1SJHB 2XWTB 5SWZD 4U3CA 3TJHD 1YMHB 5AG9A 4HUUB 3AMLA 3ZHDA 3LZFH 1MPAL 4JFDE 4JG1L 3IDGA 1J1PH 4X8XA 2UWEF 2ITDA 5B8CB 1CIUA 1CK0H 5DQJB 3VU2A 1CLZH 4O00A 4YH6A 1KB9J 2LTQB 3QQ9D 4LRNL 2YRPA 3KLAA 2P5ED 1EAJA 5C2UB 4YHML 4NQVB 1YMME 1SMAA 2F53A 3W81A 5E9DB 1ZXQA 3O6LH 5DFVC 3BMWA 2PR4H 3PE9A 2EE3A 4QHMB 2FATL 2C3HA 4U1SA 4C4KT 5IP4A 4I3SL 3TV3L 4X7TB 4JY5H 3NABH 4QNPF 2W07A 1ZVSB 5GISL 3RPIB 3T2OA 4ZUSA 3WN5B 5ILTH 3BPLC 1RIHH 4HKZA 4O4YL 3LQAL 3RIAF 5EZIL 2X4NB 3FT4B 4R0LA 3P9LA 3VD3A 3N0PB 3MV7E 4HS3A 1G7HA 1RURL 2PUQT 1MWAA 4MNQD 5J1TC 1L6XA 4TVPD 3MRHA 1I7UA 1OAXL 3GK8H 2H2SC 4BH8A 3AB0B 3WKNA 2XY1A 3T0VA 2H3NA 4ZPVA 3SDCD 2GJ6E 2JB5L 1V3KA 5EZLB 3NCCB 3U0WL 4W4OA 4MZ3A 1ZA6A 3AXLA 5AYUH 4OLYL 4XI5D 2EE6A 3U9PH 3H7BB 1YEGH 5FGSA 4XI5C 2VDML 4ZOBA 4D9QD 1HQRA 1XH3A 3D25B 4DAGH 3TP4A 4P99A 1S7QA 3HNVL 3LRGA 5E8DL 4WU7B 2R0LL 2ICEB 3MJ7B 3MRDA 5EDXA 4ZFOA 1H0DA 2OL3A 4Z7OE 1DDHB 1I1YA 3NFSL 3GM0A 5CGYD 3B9AA 2CLZB 2J88H 4JPKH 3LDBC 4JANB 3JWOL 4OLVL 3U4EB 4MAYD 2VLKB 4F7PB 1AO7B 1SJEB 5D7IF 4JPIB 3QI9D 5JHLL 3V5KA 4QEGA 3QAZC 3STLB 2XTJD 2DQGL 1HKLL 2DQDH 5C07D 1R6VA 4YUEL 5IJVA 1JV5A 1OTSC 4QTHB 4YQXL 1WUNT 5HHOB 3L5WA 4M00A 1X44A 3GSVB 5DJ2B 2R39A 2GEEA 3FQTA 1X5JA 1YEFL 3MV8E 1NPUA 1TZGH 2ICES 4HK3N 4RMVA 1GC1C 4J23A 1RMFL 4F58H 5GZOD 1YDPA 1K4DA 5L88H 3D18B 1KV3A 3QRFM 1JWUB 4AIZA 1D9KC 4M5YH 1XAUA 2WAHA 1MRFL 1Q72L 2YUZA 1I9IH 4H88L 3KPNB 1F4XL 1EEYB 3QP3A 3PABA 2QQNL 2AJ3A 3OBAA 3R06B 5FO8B 3C6LD 3TT3L 4UDUA 3ARSA 1WITA 2OP4L 2DKUA 3KPSD 4XXDB 5FKPB 5B3JE 2PO6D 4G6MH 5C08B 4NP4H 2CRIA 3JUZA 1O0VA 2PO6C 2F74B 2DM4A 4OLXL 4DQOL 2FGWH 1U95B 4JPWL 1JRHL 5GGTL 1AGFB 4I18C 2DIAA 2HMIC 5ESAB 5GHWH 1F6AB 4TTDD 2J6EL 3JTTB 3EOTL 5HHMB 2F58H 1KT2B 1XF3B 4ERSL 5MEOA 2E9IA 3FHAA 3ULUF 3MLYL 1NGZA 4LLQB 5IB3B 5DWUH 1BM3H 2CD0A 3IFPB 5H8DA 4NIKB 5D1XA 3EO0A 1LGVA 2ICCA 2XKUA 3F7RA 5ISZA 2YPVH 4NQSA 1OT2A 1TCRB 1MVUA 1EJOH 3RNQA 4PJXB 3TO4A 1INQA 2SEBB 2IFFL 3F7VA 1XGUB 3OR7B 3GBMH 3MR9A 1U9KA 3DV6A 2NY5C 4U1LA 4HV8B 3HR5B 3MRBA 4FQHA 1CBVH 1KNOB 5KVEL 1BQHA 2IPKA 3OXSB 5DJDA 3OHXA 5CEZL 3HPJA 4YWGL 1TQBB 1DFBH 1EH9A 3V7MA 2MCG1 4RBPH 3QDJA 3BIKB 3V2AR 3TCLA 3U2SA 1YMMB 4KJQD 3WCYA 1FG9C 3FB6A 1BIHA 3KPTA 2DJ4A 4RAVA 5CSZA 3VW3L 4KJQC 1R3LB 5I1JH 4JO1H 4FFYL 1DANU 1BJMA 2HRLA 3WHXA 2V17H 5F72S 4FXLA 4TN9A 1WFUA 1ES0A 5F96L 4LVHC 1A0QL 3UJTL 4PRBB 2XPGB 3IDIB 1A5FL 1G9MH 1JGVH 2GITB 2C1OA 3SE9H 1C16A 2P1YA 5JXED 2WQ8A 2YD1A 2AK4E 1U8NB 1XCTB 1UXWA 1EHLH 1T2XA 2FJFB 3MV7B 2AJYL 5F7MC 1EBAA 5JIPA 4TSAH 1NFKA 3IJSA 1FH5L 4GG6B 1NGYA 1R3JA 4KMQA 4IRZH 1N5AA 4Q0XH 2BSRB 5ECJE 4A6YB 1QSVA 1MNUH 5F9OH 1T89A 4MNHA 2MTPA 3U30B 1G7MB 1U8MA 4LLAA 1RK0A 3W11C 3LN4A 4LGRB 2FSEA 1TZIA 2UUDK 4NNXA 4PRIB 5HHNB 3KJ6L 4RQQB 1WBZA 5TH2A 3F8UB 4HUMB 4YXKL 2X4TA 1JZ3A 3H8NA 4V2CB 3IJYB 5FUOH 1N8ZB 5DDHA 3BGFC 2B7DT 4N0FA 4N68A 4D0CB 4HJ0D 5HHVL 2RJMA 3OKKA 3PWLA 2IH3B 2QADB 2J2ZA 3BW9B 2FH8A 3ULUL 1FLRH 3BKCL 1KOAA 1I8LA 4B7IA 2JJTC 4KK5D 2KZ1B 5FB8A 1RJYB 1MI5E 3U7WL 3WO4C 2J1KA 4KK5C 1E4XH 4U6YA 4KPHH 3VXQB 3MXVL 3E0GA 4Y1AE 5D7JB 2DWDA 3DGGA 1MJJB 4C54A 5DC4B 4KVNH 3DX7B 1MJ7H 3E2HC 4LCWE 3HG1E 3MO1A 5BW7C 2IALB 5EUOB 2PTTA 1GGUA 3FB7A 3QWRA 4KU1A 1NCBL 1KXVC 3SKOB 4GW4A 4NM4H 4NRZA 4NHUA 3K4DA 2AQ1A 4I13B 5J1SC 4PJIE 4NQDE 2ZUQB 3EYFB 2YBRB 5C3LD 1N2RB 3MV8B 4HWBH 5IB4A 2RAMA 1P1ZA 1CS6A 5D70H 4CU8A 3TFKD 5DJXB 5F21B 1EFXA 2VSCA 3TFKC 4JN2A 1U8JB 1E28A 3ET9F 1J88A 4HCRA 3S7GA 4FQXB 2CLVA 2EIZA 5DVKA 3T8XA 4YNYB 4HDIA 5D1ZA 3BKJH 4WO4A 5JR1L 4EUPA 3C5JB 1KJ2L 5J11C 3FMGH 3UO1L 3BH9A 4U1KA 3GMRA 2CKBB 4O58H 5KVFH 1MQKH 4BK5A 1U8QA 1HYSC 4ZFOL 3DVNB 3VDCA 2IANA 4XP4H 3BPCA 2F54D 2E5EA 4E41E 3CDGA 2NTFA 1A7PH 1IAIL 4JQVC 3KWWB 2MCPL 1JGLH 4XC3L 4XNMA 2OQJB 5F6HI 3BN9C 4LSRL 3JUYA 4PJAA 4ONFH 4KK9C 5JTWA 1IC4H 2H32A 3CVHA 4D8PA 4YZFE 2L4OA 2DLEA 1LE9A 4O9HL 4X4MA 3QISA 4A6YH 3VXMD 3CXDL 3TC9A 1MHHB 3DPBA 5FYJL 4KFZC 5KVGL 5T1DL 1NFDB 1L0QA 4AL8L 5IEHB 1RUQH 2NY1C 4XP1H 3R0MA 5SWSB 3VFNB 1AP2B 5F3BA 2DOCA 3EJJX 4PJDA 3X3FL 4XVSH 5A16B 5IR1B 3Q48A 4J2XA 2HJLA 2P45B 3T2QA 3KJ4B 9CGTA 2XA3A 4M03A 4FZ8H 1H8SA 2HTKD 3H9YA 3PP4L 2Q7YA 5KOVC 1AGEB 1MH5B 3FN3A 3IU4L 4HFWB 4JQIH 4GLRH 1P6AB 2G75A 1SEBA 3BP7A 2X89D 2N56A 2GSGA 3MLUL 5J7CC 3FT2B 4I48B 5DQDL 4XMKH 4OB5L 5JZ7D 1RVFH 4P2QE 2F8VA 5B4MD 3O3BA 4WTXA 2R2CA 3V5HA 3GM8A 4HBQA 2X44D 1FVCB 4TVPE 4MD5A 4MJ5A 3I9GL 1CR9H 2CDGB 2YPKB 4M61A 2O5ZH 4X80H 1EZVX 2FJHB 3GJFB 2WWMC 5ALBH 2CKNA 4ZPTA 4WW1A 3F6LA 1UACH 1CFVH 4L8CB 1AKJA 1EJ6A 3L3DA 5DR5L 5LXGL 4LAJH 4MXQD 3K2UL 2VLJB 4UTBL 5F9AC 4MXQC 3LPFA 3RA7H 5FO9A 5I1CH 3CFBA 1N59B 3OX8B 4WUKH 2BVYA 4QOKD 3X13B 1N6UA 2P8MB 1HI6B 4M9PA 5EC1B 3QUXB 2BFVL 3FO9B 5GS1C 3L7FA 4LDLB 4XNUL 4IMKC 1FSKB 2YK1L 3EYSH 2Z31C 4WI2A 5DA4A 2Q3ZA 1JN6A 2VQ1A 2XI9A 4K7PL 5DJ6A 3TJEL 4BKLA 3BQUA 5KVMC 1CLYL 2YEZA 4C56E 1FCCA 2CKBH 4LNVA 3HUJB 3MQIA 4OTXL 1PW3A 4U49A 4P57A 3P11H 5C0JA 4R2GB 4ZTOH 2ZOLA 4KWUA 2IAMB 5IEKB 1QA9B 5TDOB 2WV3A 6CGTA 3ZLQC 3IJHB 5C0RL 2DQEH 2VDKH 3N9GL 2AGJH 3KDMA 5ADOH 1GZQB 1JNHA 2J8UE 1IT9H 2XNAA 1JZ2A 3TCXA 1TQCB 3AM8A 4PR5A 4OUUB 1IEBA 3X12B 2JK5B 5D6DC 3UDWC 4I9WD 1GGCH 3UJJH 4X98B 5C92A 1V8HA 3OB0H 1BAFH 4M6OL 4K94H 2YA0A 3SJVA 1CQYA 4YHLL 1NGWA 4NKMB 3VRJA 1MLCA 2CGRL 5GRUL 3U36A 4OCYL 4XCCL 2A9ML 3QO0A 4OJFH 5CEYB 3RJDA 1WJ3A 3P2TA 5KSAA 1N3NA 1BZ9A 4Y4FB 1NC2D 5ICXA 3QUKA 4PJAF 4YPJA 4QRUB 5CZVL 1OF2B 2HFGH 1M7IB 3CDCA 1LO4H 2C3XA 3OKMB 3DROA 3KNBA 3ARFB 5DUML 3QUYC 1FORH 3RDTD 1T4KA 5AZ2H 3RDTC 3FQRB 2EXWC 3RWHB 4J8RA 1CFNA 5KTEL 2QQLL 2WP3O 3K4AA 3KYNB 1PQZA 1MCWM 2YSSB 3D2UA 5C8JA 1MIML 1TJHH 1A3QA 2H26B 3GSQB 3O3AB 5D5MB 4CJ0A 1NGXB 1YPZE 1RUKL 3W0WE 1FNGA 3IDYC 4P9HC 1CZ8L 1RFDH 2MPAL 4UDTA 1CXKA 3T65B 2Z8WC 1NUGA 4WNQB 4M8VA 4PJDF 3QFJA 2GTZA 1YEEH 4JY6B 4UBDD 5E5MB 1OB1B 2NXYB 4H8WC 1YA5A 3BH8A 3ECBB 3HMXH 1S7VA 1VESA 5E00B 3D9AH 4M93C 3QIUD 4DKFH 2OS7A 1KCVL 1U8HB 5C0BE 1WWAX 4YE4H 5CINL 3DV4A 5DJ0A 3GJFH 4U1NA 4M7LL 3WFBL 4YAQA 3BN3B 5SWZB 5I1LA 5DZNA 1GIGL 4L9LC 1G7QB 4LSUL 1ZSDB 3C5SB 2OI9B 4Z5RB 2F15A 1RUAH 2B4CL 5KANG 4F2MB 1IEHA 2EC9U 1WGOA 3DX8B 2P5EB 2ZNWA 1NCDH 2BDNH 3FFCD 4F7MA 5L6YH 4P2YA 3GSUB 2DD8L 3QUZD 4KKCD 3GSRA 5TE4H 3MNVA 2CK0L 4Z95L 1VSCA 2XRAL 4LOUD 5ESQB 3VRIA 2EDBA 4KKCC 1TVBB 1IJ9A 4XPGL 1CL7I 4LOUC 5EOTA 1XR8A 4XMLL 2ENSA 1MSPA 5I76B 5ESVA 1BMGA 2EECA 1S7RB 2CO7B 2HP4A 3T2PA 2I60L 2V7NA 4G6JL 3V6OC 2VAAB 1UQSA 3W5NA 4JDZB 4OCRL 4JFFE 2IQAA 2P5WD 3MA9L 2AEIT 2GK2A 1OLLA 4PLKD 4R26L 1G9NL 4MAUL 4MNQB 1HQ4B 3ZKNC 2VAJA 4PLKC 2NX5E 3HS0B 3QNXB 4K3DH 3GMQB 4UV7H 4KZDL 5BRZA 3SDCB 3IF1B 4UAOB 1FV1B 4M6NL 5A2KH 2QQKH 1ZVSA 4PJ5A 4DZ8B 4TUKL 1MCDA 5FYJU 1C5CH 3DRQB 1HE7A 5JIHA 5IOPA 4WFFD 4O02H 1KCSH 3RGVA 3O3UN 3SE8H 4WW2C 3VFGL 4MJ2A 1A3RH 2B1AL 4PFEA 4YDIH 3NACL 5JUEL 1FO0B 1FNFA 4NFBA 5DMKB 1HIMH 5HVGB 1ZAGA 3B2UC 4PRHD 4UV4H 1EHXA 1UM5H 3CSYA 4MAYB 5E4EC 4RA3A 5ITFB 4JGUA 3NZ8A 3O2DL 3CFCL 4P2RA 2R15A 2ARJQ 5IWLA 2NR6D 1LILA 5BZDB 3QI9B 5EZLA 3HE7C 3NCJH 1RZKC 2BNQE 2XTJB 3PL6D 2XOTA 3H7BA 5C07B 3CK0H 3HZMA 5B3NA 3QH3A 4AIOA 2A9NL 3CC5A 5TQ2L 1DSFH 1DQJB 4BSWB 1NC4D 1M1SA 3FO2B 3P4NA 4WU7A 2ICEA 3RL1A 3RQ3A 1A14L 5K9JL 2QTEA 4C59B 2WBJC 5DD5H 3RX7A 2AJXL 1KFAH 4GBXD 1S7TA 2ITCA 4Y19E 3W9DA 1HYRC 4X6DA 1N26A 3EYOA 5BVPL 1SJEA 2VZOA 3L3JA 3WIIH 1RJCA 1AI1H 1L0YA 3T1FA 4YHIA 4IEFB 5I19H 1F02I 5TJWK 3RVVC 5JOFB 1BGXH 1OGAD 5EC2A 1OWWA 5GSVA 1YECL 3C6LB 3HZYA 3FZUD 4QXWA 1E4KA 4ODTL 2JE8A 4RIRB 4WI8A 3KPSB 3MYJA 1MJ8L 3X3GL 2PO6B 4D2NA 4HF5L 2ATPA 4LIQE 3GMMB 1SY6A 3CFEA 2YMXL 2FCBA 2ICWI 3RX8A 5HDLA 3PXHA 5DZOA 1UXSA 4XAKD 4BQBA 4XPFL 4L8SB 4DUXA 1G7JB 3S96B 4N0UE 3SGEI 1CLCA 4JQXA 1TJGL 4LLYB 1QBLH 4BYHA 4RMTA 5EFIA 2DJSA 3R06A 5C9JA 2GUOB 1LVEA 3PGCA 4JHAH 5D2NA 3BDYH 3LZFL 5EBWA 5DI8B 4GG8A 2BSSA 1J1PL 3CXHJ 3V79C 1CK0L 1U3HA 3DIFB 1CLZL 4NUGH 3S88H 1E6JH 1XT5A 4TVPH 4XPHH 1MAJA 4Y4KA 2R2EB 4M3KB 3KXFE 1TZHB 4M9OA 3UCRA 4KTDH 4ZSOB 3VXSA 3O6LL 1AGFA 4L8DA 4QWWC 5DEGA 5DVOA 1KEGH 2PR4L 3D39E 2NNAA 2R1XB 3QT2A 5DD6A 1Z0MA 3JTTA 4JY5L 4PJEE 3NABL 2OK0H 5F7YC 1MFAH 4FFWC 3W39A 3OG6B 1S9YB 4KMTH 5IB3A 1JRHI 5ILTL 1FGNH 1RIHL 4JB9H 1CXLA 3X14B 2XA8H 1P4LB 1FZKA 1RHHB 1FO0H 3GSWA 5E1HB 4P59H 4QYOA 5F89A 5F97E 1RIVH 1JTOA 2B0SH 5GGVH 3TWCH 4NSKB 5B21A 1IM3A 3D3VD 1YC8A 2GJJA 3O41A 4DVRH 1NLDH 2SEBA 3GK8L 1CE6B 3V6BR 1QVOA 4PJ9A 5DRZA 4HV8A 1XGRA 1QFOA 4JFDA 5AYUL 1EVTC 5JORB 3U9PL 1FN4A 1NEZG 1YEGL 3VXNB 3PWNB 2RFXA 3L6FB 3RPKA 2BXYA 1YEJH 5GZND 5EZJA 3BIKA 3LPGA 4DAGL 4NNYB 1I7RB 4ODUB 1YMMA 1TJIH 3QCTH 3G5XB 3OF6D 1Y18A 3GKWH 3MYZA 3SE4C 5C0FA 2V2TB 3MRJA 2AV7B 5E1AB 4P5KA 4WRLA 4FN0A 2J88L 2FX9H 4JPKL 3LAFA 5IROC 1J8KA 5TGBB 2H8PB 1B90A 4ZS7H 4XNZC 3SDDA 4QOKE 4GAYB 3U0TB 2C5DC 3UYRH 2W65B 3ZDYE 2C3GA 3TF7C 1B6DA 1UZ8A 4N90D 4CJ1A 2PYED 3NN8A 1L0XA 2XXMB 1U8NA 2JLLA 2G2RB 4S1RH 4XNQA 5JO5B 3MV7A 2DQDL 4GRLA 2MWCA 3IT8D 3SPVA 4CMMA 3VDBA 1O7SA 1OM3H 2PW2A 3ROOB 4QRRD 5HI5C 1H3XA 1T1ZB 4OF3A 4RGND 1TZGL 4X6DF 2GJ6A 4LLDB 4F58L 5L88L 4ZODA 5EU5B 5HHNA 3GRWH 4XGZA 2GSIB 4QHUA 4XCYB 4M5YL 3QQ4A 1I9IL 4QCIB 4HK0B 3UJIH 5I6XC 4GO6B 3BW9A 4GUPA 1ZS8A 3BPNB 3MUY1 1LK3H 5FKAA 3TBWB 4F33A 2FO1A 3RNKB 1QSFD 4I9WE 3T4YB 1JPGB 5HYSA 1Q94A 3VXPB 4E0RA 5FA4B 4G6ML 4NP4L 4NBYB 3P4MA 3DETC 1FJ1B 1KLUB 2FGWL 1LQSR 3ES6A 3QA3B 4Q6IA 4Z0XB 1DE4A 4UQ2A 1T1WA 5GHWL 4ODXB 5HPOA 2Q76A 3PQYE 5IIEA 2F58L 1PVHA 5JPMB 2ZCHH 3PJSA 4U33A 1FIGH 4PTUA 4ZUUB 3EHBC 3EYFA 3TA3D 3CVIH 4Z76B 2M26A 5DWUL 1BM3L 4IRSC 5C7XH 4H25B 2L7JA 1KXTB 4NRYA 3Q1SH 4JO2H 1XF5B 2R29H 5SWQB 3MXWH 4WUUD 5IW3A 4Z7WB 1OD7A 3VFPA 5I8CB 2YPVL 3WLBA 3UTTE 2F54B 1QSEE 4Z7QE 3K8MA 5F9JA 4RSVA 1EJOL 5FCUH 1F58H 4G6FD 5ANMB 1WAAE 3QJHA 3GBML 4FQXA 1OAYH 2GI7A 2PXYC 3O8XD 3HLAA 1CBVL 4YFDB 2W9LA 4MQXC 1IKNA 4G9DB 5EH1A 1ZWIB 3RAJH 5CD3A 1DFBL 4I3RH 1AXTH 1HINH 3THMH 3QWOB 3UPCA 1U41A 3VXMB 3RZCA 2NY4D 2MSPA 3STZB 4PJXF 1NBYA 1ZLUH 1FNSH 5I1JL 2YD8A 2H41A 4JO1L 1H9VA 3PWVA 3X11B 2QSVA 4PBVC 2V17L 5TQ0H 5DK0A 4G6KH 4GFTB 1J8HD 1JNLH 2H6PA 4H1LA 3CSGA 4EXKA 1G9ML 3EJYD 1JGVL 3FFCE 3SE9L 1ZA3B 3BMVA 5DVMA 3KS0J 1RHFA 1U93A 1IAII 1EHLL 2XY2A 1HHIB 4PGEA 4LKXB 5T1MB 4A2LA 3EBAA 4TSAL 2FJGA 3E6HA 4IRZL 4Q0XL 3O4LE 3V6OE 3Q6FA 1MNUL 5F9OL 5J12C 4GSDH 2MOVA 1UB6B 5I18H 1RUPH 1G84A 1JTPA 4JFQB 2P5WE 1ZOXA 4EN3C 2V2XB 5E6ZA 4M48H 4OZIB 2O5XH 4UOJA 5LBSH 5E7BA 5FUOL 1PKOA 4JRXE 1GH7A 3ZHLA 1BQUA 3I50H 4ODHH 3T1WA 3GMPA 4BFGA 4ZNEE 1FLRL 3NGBB 4EQ3A 3HC4H 2BJMH 1KEMH 1RULH 2VZUA 3L3KB 4HIJB 3QG6A 3RVXD 3N1PC 1DQMH 4KUCF 1E4XL 4MMZC 4KPHL 3RVXC 3EYVB 4QOKB 1Y0LA 4KVNL 1EX0A 2R0KH 4JGMA 1MJ7L 3BP4A 2AK4A 4NDMB 4AEIH 3EFDH 4PG2A 4FA8A 8FABB 4NM4L 1ZHNA 3CUPB 1WZKA 3H2WA 3LQZB 3PIQB 3FQXA 5DSCA 5IG7B 1U3JA 4K9EH 4HWBL 3LQAC 4XX1E 3V5DB 5D70L 2ZUWA 3DRTB 3B5GA 3RVWD 2QR0A 5EUOF 3X13A 2A83B 2OSLA 5E7FA 1P4IH 3SY0B 3FO9A 1ZLVK 5DK2A 1PBYA 2ERJB 5HGHA 2ZOKB 5CIPB 5T3ZE 2NY6B 3K1DA 5INDA 3RTQD 1YY8A 1ZVYA 3BKJL 1CDUA 4L4VD 2UYLB 3B2VH 1CGXA 4G8FB 1TITA 3FMGL 1A6AB 3AREA 1MI5A 5DMIH 4O58L 5KVFL 1MQKL 4NOBA 4R97B 3Q2CA 4Y1AA 2IH1A 5CP3A 1B6UA 3S5LG 4X5XB 4DEPC 4LCWA 3HG1A 4XP4L 1IEAA 4GKOA 32C2A 1NC2B 1T20A 3IJHA 4XVJH 1PYWB 4U6XB 1A7PL 4WHTB 5I74B 1JGLL 4HC1A 3JWOC 5C09D 4PJIA 4NQDA 5CD5D 4HUKB 1FZMB 4Z78B 3RDTB 2E6QA 4OKDA 5CD5C 4ONFL 3KPRE 1JE6A 4HW6A 4Y2DB 4OUUA 1IC4L 3CLEH 1AQDA 4XAKE 3WNNA 4CNIA 1FZJB 1U2CA 1EGJH 4X98A 4LCCC 3QEQE 1T83A 5HYQB 5MI0B 4RDQF 4G8IA 2EYSA 3MLTA 3D1MC 4K7FB 3T0WA 4A6YL 4LEXH 4IHOB 5FDWB 1CD0A 4OV5B 4WJ5A 2YZ1A 3LIZH 2M1KA 1Q9OB 1RUQL 1TTFA 2HN7B 4NWUH 4XP1L 4ETYA 4BFIA 1H5BB 1M7IA 3QIUB 5IMOB 1JTTA 5TDPA 2O5YH 4XVSL 2X05A 1EMTH 4LDOB 2D0GA 4ZTPH 1A4KA 5I9QC 2EXYD 3HPLB 3IAPA 1IGMH 4MNGE 4FZ8L 4FG6D 4DK3A 3RWHA 1MCSA 5HVWA 1C5DB 1CGTA 3VXOB 4BH7B 3GSQA 5C0EB 4JQIL 4E41A 1OWRM 5E2UH 1NGXA 5CILH 5I17A 1NFDF 2E9JA 2AEPH 3ARBD 1XCQB 4PYHA 1MY7A 4P23A 3IKCB 4KJPD 3O6FD 5IKCA 1Z9OA 2PF6A 3CPLA 1Q0YH 3BD3A 4W70A 4XMKL 3U46B 4JY6A 4C83B 3QDGE 4TOYH 3ECBA 4HXAH 1WK0A 1RVFL 3SE3A 5E2JA 5E00A 3J7HA 3QUZB 4XWOD 2FLBT 3OKNA 4PRPE 3KGRA 4UIMB 4XWOC 1CR9L 2O5ZL 4X80L 3WE6B 2LABA 2V5MA 5ALBL 2IBGA 4OD2A 3H9HA 5LWYH 1UACL 5MENB 1CFVL 3MRNA 1TDQA 2P5WB 2XKSA 2J5LC 4F2MA 4P3DA 2E7LC 5IW6B 3RA7L 3LEYH 2X1WL 4MA1B 1G6RB 3MRQA 5I1CL 3MROB 1RV6X 4WUKL 4UUJB 4ZO6A 3JV0A 2NY3C 3MRKA 5DZLA 3NZHH 3GSUA 5CIPH 3FONB 1ADQH 5F93C 4LQ1A 1MCFA 1YQVH 3EYSL 5E8PB 3S4SG 1I8IA 1R3HB 2YD9A 3VMOA 5HI3D 1BFSA 3T4AA 1JGEB 2CKBL 2EEAA 3HE6C 5C71A 1I1AB 1PG7H 3WUWG 5GGSB 2VAAA 4LVOB 4LPCA 4N90E 2PYEE 2VL5A 3P11L 4ZTOL 1S7WB 3O3DB 4KRLB 4P2QA 4DOHE 4L1HA 2DQEL 1KJ3H 1S5HA 4PRHB 3ARZA 2VDKL 5E4EB 3HS0A 4HLJA 2AGJL 4FMFA 5ADOL 2CIIA 1IT9L 1S7SA 4MDIA 3IF1A 1W8OA 1T0NA 4XBGB 4PJ8C 1E4WH 1B0GA 1M7DB 1MCLA 3PL6B 4DZ8A 2JKXA 1GGCL 3LEXB 3UJJL 3K74B 3L9RB 1BAFL 3LRSA 4K94L 2B1HH 5IESH 1HHKA 4YC2B 3R1GH 5CMAB 1NC4B 1IRAY 1I1CA 3FOLB 4LSSH 3NIDF 4OJFL 5JW4M 5IVXE 4H8WH 2EDQA 1NCCH 1D5ZB 2F5BH 4YGVB 4P46D 5F1NB 2BOCB 4EI5D 1I9EA 4Y4HD 2N7BA 3O4OB 5DUBB 3VJ6A 4GBXB 2BNUB 2HFGL 2R1WA 1QO3A 1LO4L 4LARH 4C56A 2PW1A 2VWEC 2Z93B 1FORL 5AZ2L 3V6ZA 2GW5A 3PWUA 1DP0A 4ZUWA 3VI3E 5HVHB 1PY9A 1OGAB 3L3IB 2GAZA 3OAYH 4XCEB 1A1NA 2D9CA 3VRLE 1DBKH 1TJHL 4M7KH 5IHZA 3ULUC 1DQJA 4MJID 1XF4A 1G7IB 3F58H 1RFDL 2JCCB 1SBSH 3ILQD 3DYMA 2P24B 2J8UA 5D9SA 1T0PB 3RY5A 1YEEL 4HWNA 3T3ME 5HGAB 3LKOB 4BZ2H 1D9KA 3HMXL 5I1AB 1VACB 3D9AL 4DKFL 1AJ7H 3ZKMD 1T1YB 5DRNB 4P4KC 4YE4L 3FCTB 4PRAB 1BX2B 3B9KC 3TVMC 4YIQB 4M8QB 4XBPB 5HJ3B 3QEHB 3S97C 3LSOB 5E99H 4CMHC 1VEPA 4JO4H 2OTUA 4KDWA 3EKCA 5DF0A 1RUAL 2PO6A 4PGZA 1G6RH 1JI2A 3GMMA 4U0RC 4ZQKB 4YZFF 1KF9B 2RGSA 1NCDL 3ZKXC 4I18A 2BDNL 4LGSB 5ICYA 5KZCD 5L6YL 3OZ9H 3S96A 5TE4L 3NIFE 2G5RA 4YPGB 2EZ0D 1YPZA 4MGXA 3W0WA 1T5XB 3B9VA 2EZ0C 4QHKJ 3I75A 2B8OT 4D0DB 1J8HE 3HRPA 3UEZA 1B0RB 2KL6A 4LPXA 4O2EA 4BJLA 1F8TH 3WDJA 1DBAH 5C0CD 1K8DA 1U8PB 1OW0C 3I6GB 2FO4A 4HX1B 1ZT7A 4NN7C 3ARXA 5HY9B 5C0BA 3QIBD 4U3HA 1XEDA 5I8KH 3B6SB 2R2EA 3C2AH 3D3VB 3T0BA 3QIBC 4NN5C 1IGJB 3QIWD 4K3DL 3OAZK 4UV7L 1LO0H 5F7DA 4X7DC 1U8LA 3MJ8A 3MNWA 3V4VH 1X6LA 3S3PA 1KENH 4LU5H 2F5AH 1XF1A 3TYGH 1VKXA 2QQKL 1XGQB 2QHRH 2FLRT 4DVBB 1K4CA 4LPTA 4PRDA 1C5CL 1OQOA 5D2LE 3EFFA 3UP1A 3L5HA 1FFNA 4O02L 5EU6D 1KCSL 1CICD 3CDYA 3LD8B 3LKSB 3SE8L 2R1YB 3DMMD 1CICC 5DYOA 2P43B 1A3RL 4YDIL 4XH2B 3DMMC 4LGPB 5A2LH 2KDGA 1HIML 4ENED 5IB1B 1IMHC 4OFYA 5LQBH 4UV4L 3RWCA 1U58B 2BERA 3QNZA 5LGJA 3H9SD 3QEGH 1RK1B 5CKAA 4L5FH 4S1DD 2BY0A 4LLVB 4NO3A 2I25N 3NCJL 4NPYB 5JXEA 4JFFA 1N5YH 2PYEB 2FBOJ 2UZIH 3CK0L 1FL5A 1W72B 2P8PA 3L6FA 1HEZA 2YC1B 1DSFL 1OAQL 3N1FC 3NCYP 4BFEA 2OZ4H 3EYQC 2NX5A 5J13B 1GJIA 4KRPC 1GOHA 4QRRB 4UTAH 4WU5B 4HSQA 3BT2H 4HIHB 4RGNB 2WP3T 2W0FB 5DD5L 1KFAL 2NY7H 4LQFH 3FT3A 2BC4A 5ABDE 3A67H 2BVOB 4YHPA 3MJ6A 3WIIL 4IRJD 1AI1L 3QZWA 5CAYB 4YHNB 1BLNB 4HHAB 4U6HB 3TM6A 5I19L 3OJVC 5FYKD 1BGXL 2XQYG 5EPMA 5JLZB 4Q9BA 5I66A 1QSFB 2JJTA 1UWEH 1Z5LB 2VXQH 1LD9A 3V8CA 4GQPH 2AERT 1H3TA 3DOSA 1S9WB 4F8QA 4JG0H 1P2CB 2C9AA 5BW7A 2A73A 3CZFB 2BNQA 5KS9B 5EU5A 4OD3H 4XCYA 1LDPH 3A6BH 5BO1H 1ZGLB 2EDEA 1QBLL 2JIXD 4HUXB 2QKIA 3O45B 5C09E 1VFAA 3MV9D 3VXUD 3SOBH 4ZAKC 3TA3B 3OMZA 3QNYB 4E5XB 2YPLE 1Z9SA 4JHAL 3BDYL 3TBWA 2I24N 1B0WA 4JM2D 4KGJA 3T4YA 1JPGA 4JM2C 3FO1A 4WUUB 2B5IC 1RPQA 4NUGL 3S88L 1E6JL 4Y19A 1VFUA 4J4PD 1CT8A 4P4RB 4TVPL 4XPHL 1EBPA 1ONQB 4YFLI 2P46B 5BVJB 5EU3B 4G6FB 1AGCB 4KTDL 5J6GB 1W0WB 1MREH 2NYYC 5H2BB 1EDQA 1QFHA 5DJ8B 1YPZF 3QA3A 2N1KA 1KEGL 3VWJC 3ULVH 4G42A 3O8XB 5CBAB 4ODXA 5IMKB 2D7NA 4JFED 5LAXA 5L2JA 4OGAC 4F7CA 4I5BB 5K9KA 3UBXA 2OK0L 2APFA 1MFAL 3PWPD 4H5SB 5IB2B 5I1DA 4KMTL 4Z76A 4D0BA 1S78C 3IETB 4H25A 3ROLB 4AM0A 1FGNL 1G1YA 4JB9L 4R7DB 2XA8L 4QNPE 4HWZA 1MRDH 2CJUH 2NY4B 1FO0L 4P59L 1CU4H 5I8CA 1IGCH 1SYVA 1RIVL 4N0UA 2B0SL 4JQVA 5GGVL 3OKEB 4G80A 3TWCL 5E8NA 4PP2A 4CADB 5ACZB 4DVRL 1NLDL 4LDEB 3B8SA 3MRIB 1J8HB 1CDCA 3C5ZD 3EOAB 3BRFA 1AH1A 1MFBH 3C5ZC 4WI5A 1ZWIA 1NCUA 1W72H 2EIEA 3PNWB 4L3EE 2BVTA 3GMLB 1YEJL 1JNNH 3KXFA 3I3DA 2DTSA 1TJIL 3HRZA 5EU4B 1A1MB 4NBZB 3QCTL 4EKXA 3D39A 3X11A 3GKWL 1MY5A 4PJEA 2MFNA 2FX9L 1X7QA 2DM2A 5H37H 4Q9RH 4PJCB 4ZS7L 5I0DA 4JZNA 4J3XA 2ZG1A 3UYRL 1RQ5A 1KPRA 3PUCA 1ZA3A 5H35B 1C12B 3GNMH 4S1RL 4LKCA 4X7EC 1IM9D 5CEZE 3IDUA 4RFEB 5CLTA 3V52H 5CKGA 2X89A 5BQ7B 1MQ8A 4FQ1H 5B38G 4NWTH 2V5SA 1OM3L 4U1MB 2HLAB 5JHDB 4PGDB 3DUUA 4JVWA 3V4PH 3QXTA 4LSPH 2V2XA 1NAMA 3QUMB 1JWMA 4PLNC 4NN6C 3GRWL 3P9MB 4NYLA 5HYJD 4ESKA 1ORQA 5FYLD 3GSOA 4NKDB 4ELME 3BP6B 4MMXC 3UJIL 3T0XA 1LO5A 2XQYK 2D7QA 4QHNB 3AS2A 1LK3L 3P73A 1S9VB 1N4XH 1TVHA 4OZFG 4GH7B 1GPOH 4CGTA 3C09C 3L5XH 1S7UB 1JPSH 4K3JH 3WNMA 3SCMC 3VG9C 2HLFD 1G9NC 3KPPA 1EPFA 4QOKA 2J4WH 5CP7B 3DXAD 5MEQA 1KC5H 2Y5TA 4POUB 5GS1A 4YEFA 4JFOB 1JI1A 2HVKB 4IMKA 5I2IB 2Z31A 2DQUH 3WJLC 3FQNA 2DBLH 4NDMA 4KI5D 1B88A 1FYTD 3RTQB 3V6FA 3CCHB 4HJGB 1DBMH 2QJDA 3I84A 4L4VB 3QULA 2VWEE 4XNXH 1E4XI 3D85D 3B5HA 2ZCHL 1FIGL 1NFIB 5TFSH 3CVIL 3O81A 5C7XL 3M1BB 1OGTA 3FRUB 4PP1D 3TPKA 3WJJC 3UPAA 1D5IH 3DO7A 3Q1SL 1KTLA 1ETZA 2R29L 4JO2L 4MSWB 4PP1C 4R90H 1WWBX 2W1NA 1B9ZA 2ZWLT 5AG8A 3ULUE 3OKDB 4JFYA 2IC2A 5F1KC 1P9MC 35C8H 5T5NG 3HNTH 1TXKA 5DUPH 5FCUL 3GSXA 1F58L 1LE5A 2AKRA 5C09B 5C0AD 3OGCA 2WWKO 5A2JH 1LEIB 1Q8MA 1OAYL 4YO0A 1B3JA 5D6DA 4U1JA 3UDWA 1V3JA 4R4BB 3UTOA 3BWAB 1WFTA 3RAJL 1VENA 4RAUA 5F3HB 1A6AA 1A9BB 1LP9E 4UNTA 3WMSA 4I3RL 1SMOA 4JZOB 4Z7WF 1AXTL 3UROR 1HINL 2ATKB 2WQRA 3THML 2R9HD 4KKLD 4QRSB 1D6EA 2CIKA 2R9HC 1QSZA 3MTRA 4KKLC 1ERNA 4L3CB 4TNVF 4X5XA 5T3XD 3ISWA 1KIPB 3MRRB 4Z7NE 4OZHB 4RFNC 1FNSL 1NC2A 4FQQB 4GJTB 4F7TA 5KBNC 1JPFB 3PQYA 4OIIH 5TQ0L 2XWJB 3QUYA 1BOGB 2EDWA 5ICZA 5FHAH 4G6KL 4HIIB 4DKEH 4F15C 3RDTA 1JNLL 2VR9A 3O11A 2P7TA 3BRGC 4LFHG 4H26A 3RWIA 2XG5A 2QL1A 3LRHA 3DWTA 3G5YB 1I1RA 4PGCB 1QUNA 4ISVA 5D6CB 1U8IA 2VDLH 4I2XB 5HYQA 3UTTA 1QSEA 3M45A 5EN2B 1A6TA 1PLGH 1U3ZA 3KPOA 3DARA 3ARBB 2RCSH 1UC6A 1WAAA 4NOFA 5FDWA 3O9WD 3MGOB 3JTSA 3L3GB 3O6FB 2WBKA 4GSDL 4MB5A 5I18L 1RUPL 5DJYB 3GGWB 1N7MH 3KPMA 3QUMH 3DVFA 4APQC 5D7KE 1H5BA 5GJSH 2OMBA 4LNRB 4M48L 1HNFA 1KIRB 2O5XL 4QXTB 5LBSL 3VWKD 2ZP0T 5ADPH 3T0ED 3C60C 2HJFB 4M6AA 4OAWB 3I6KB 4CVZA 4U1GC 1C5DA 4L9LA 3RVUC 3TZVB 1Q1JH 3I50L 4ODHL 3VXOA 2Z9TA 1R3KA 5HPMA 3G08A 4ODWB 3TNMA 1RZGB 2WZPD 1DQQA 5HGBA 3H6JA 1JPST 2CO6B 3MCKB 3HC4L 2BJML 1KEML 4XHQA 1RULL 4FQ2H 4X5LA 1FG2B 5C0IA 1DQML 4L4TD 3QJFA 5EU6E 4JHZA 2LAAA 1E6OH 5F6IC 1CXIA 5FYJE 3FFCA 3MOAH 3FAWA 2R0KL 4GLRI 3QUZA 5KN5B 2DQIH 4JLRB 4PJ7E 4V1DD 5IMLA 5C0GB 4UIMA 4AEIL 3EFDL 4OZGE 2EDFA 2D4FA 3VE0B 4BZYA 2WUCH 1QLFA 3H9SE 3O4LA 3V6OA 3S5LB 4K9EL 3U7AA 1JF1A 4GW1B 4ALAH 2P5WA 1NUFA 2XN9D 5EOCH 2DWEA 2Z35B 1TETH 3ZDYF 4X5WB 3RWFB 2VQUA 3BE1H 1BFOB 5IW6A 1J0ZA 3SDAC 1HZHL 2KQMA 3MROA 3V9FA 4J3SA 5L7XH 4JRXA 5C0DB 1P4IL 3FONA 2UVFA 5C6TH 4R7NB 1P69B 3DX9B 4UU9B 3F5WA 3BHBA 1CFSA 3FTGB 2RB8A 4ZNEA 3M8OH 1OTTC 2ADFH 3B2VL 1VADA 1KIQB 2EDYA 3Q3GB 2EDHA 2GT9B 4KC3B 5DMIL 4WDIB 4WW2A 5IBUG 4CVXA 3F65A 1CQKA 4LHUA 1S7WA 4AEEA 4ZXBC 5FYKE 4OGZA 1ZT1B 3L3HA 2E8ZA 3H0TA 4P46B 1EXUA 3VXRD 4OF0A 4XVJL 1KJVA 4EI5B 3TIDA 4Y4HB 4DGIH 4LFHD 1G7PB 3C2SA 4HK3J 5J1AB 1I3VA 4Y16D 4P5TC 5I8EB 1ZGLM 1IL1A 4YHOH 3HE7A 1EUTA 4TUOB 4KROD 2FIKB 4NHCH 4I0PB 4EJ1C 3CLEL 3MNZA 3IDNA 1TTUA 3MRLA 1EGJL 4G43B 1R3IH 2Y1VA 1UVQA 4MDJB 3WFEH 3ELAT 4MJIB 1UJTA 2Z4QA 2XZAH 3OAUH 4LEXL 4UB0H 3TIEA 3NOIA 4HS6B 3LMJH 3ARWA 2HTLD 2DYPA 2AJSH 2WBJA 2VN7A 3LIZL 3LOWA 4WHYH 3TYFB 2DLFH 2ZSWB 1PKQE 4NWUL 1NANI 2HG5B 2A74B 3ZYIA 4BELD 2X4PB 1WBYB 2J8OA 2O5YL 1EMTL 1LP9B 2D7MA 4ZTPL 4EVNB 2HKHH 3BEWA 1IGML 3MLWH 1KYOJ 3TO2A 4D9LH 5BXFA 1H15B 1WAAF 2DIJA 3PDOA 4GKSA 5B8CC 5E2UL 3V4UH 5CILL 3OKOB 1MCNA 1CGYA 1YC7A 2AEPL 43CAB 4PJFB 1TLKA 3L1OH 1UEYA 2OZ4A 2X9WA 2A6JB 1U92B 1Q0YL 3KPRA 6FABH 4PY8I 4TOYL 4FQPA 4HXAL 5D7LE 4N5EC 5KZCB 3P0VH 1CGSH 1UKSA 3CU7A 4YR6A 4RMWA 3WXVH 3QEQA 2P42B 3F12B 1T1YA 5DRNA 2Z8RA 2ZUUA 1DVFD 5F7FA 1R5IB 3WUWB 1MEXH 2DAVA 5FF6B 4X7SH 2GFBB 1J1OH 4M8QA 2FEEL 3WN5C 1MOEA 1RJZA 4M1DH 4XVUD 3PDDA 4Z8FH 3L5JA 5LWYL 1DLHB 3VMPA 4AEHH 2V9QA 5C0CB 5J6HB 1BJ1J 4OQ1A 4NN7B 5D7SH 4FFVD 2FHFA 5F9WB 1QEWA 1WICA 1T1XB 3QIBB 5IQ7H 3LEYL 1ZLWH 4HLZG 4PYGA 2I9LB 3QRGH 4QO1A 3QIWB 4MNGA 3NZHL 1L6ZA 3QQ3A 3SKMB 1ADQL 4DTGH 3IDMB 5IK3B 1LK2A 1YQVL 3QYCA 4OQTH 4X7CC 3BZ4A 2VISB 1KJMB 1NCAH 2BNRD 4TPRH 2K3TA 2GTWB 4ZS6D 2YD3A 2VN4A 4ZOEA 5EBLA 2PYFB 1PG7L 2ICWJ 5EU6B 1BD2E 1CICB 2YD6A 3QDGA 1Z9LA 3JBG7 5F7HA 1PX3A 5HI4C 3FFDB 4PJ7B 1IQDA 1A7OH 5ERWB 3RBSA 1T7XA 4PRPA 2EYTB 2VLKD 1KJ3L 3E3QC 3TESA 4X9GA 3MGTB 1F6FB 1G7LA 3H9SB 1XZ0A 3NBNA 1SQ2N 2E6JA 4JHWH 5I30H 1G9MC 2KZWA 1E4WL 4WW2F 3ALPA 4DVBA 3MRPA 4LLMA 2R4RH 4Q2ZB 5HHOD 5CJQH 3BVNA 2B1HL 3UTSE 5IESL 4QF1A 5SV3A 1E4KC 3R1GL 5DQ9B 4RBPK 4WFGE 5BJTA 2R1YA 4LSSL 2W38A 1MUJA 3OF6A 4H8WL 3SE4A 2R69H 1RZ8B 2K7PA 1NCCL 3MUGA 2F5BL 5IV2A 5IROA 3S37H 1U58A 5MP6H 5HYFA 5EO1B 5KSVA 3RWEB 4LARL 1W0VB 4KHXH 2V6HA 2LQRA 4Q9QH 5JIIA 4IRJB 1F4HA 1X9QA 2PYEA 3M17B 4XTRC 4ZD3H 4KI5E 3I02A 3KPQA 1DBKL 4M7KL 1BVKA 1DUZB 4DGVH 3VFRA 4NO0B 2B2XH 2X6MA 3QXDB 4I77H 3F58L 1JHKH 1SBSL 4WEUD 4X99A 5GRVL 2MHAA 4KH2A 3LKNB 2VLLB 4FXKA 2MKWA 4BZ2L 2YWYA 3HCVB 1A7BA 4KK6D 4JFXA 1AJ7L 1J18A 5D72H 4LCUA 4KK6C 3IVKA 4NQCE 3UTQB 2JIXB 3D0VB 3GIVB 4FFZH 3IXTB 1FL6A 3MV9B 4PRNB 3VXUB 3PWJA 3PHQA 5IVXA 1FNAA 3EGSA 4TULH 5E99L 2VIRA 4JO4L 5DD0H 1U6AH 1NUDA 5IBLC 1PKQB 1UB5A 2XZQH 3VGDA 1OOAA 1YY9C 3HR6A 3LB6C 1AE6H 1G6RL 2OTWA 1EK3A 1HSAA 4F57H 3G6AB 1IAKB 1C08B 3T3PE 5AD0A 2NW2B 3OZ9L 5BS0E 5FO7B 2VZ1A 4S1SH 1F2XK 4PREB 3ARDD 1BVLB 4JFEB 1ZGLA 1VHPA 1TQBC 1JHTB 4GW5A 3O45A 1A6ZB 1S9XA 1II4E 2FRGP 2KQNA 3PWPB 1AGBB 5IVZB 3MLRH 1BBJA 4IRSA 4LCYB 1JBJA 4JKWA 1NSNH 2E3VA 2IG2H 4GAFB 1F8TL 3VH8A 1DBAL 3ESVF 4N1HB 4DGYH 3VFUB 4JAMB 4EI6A 1CXHA 3OSKA 5I8KL 1ONQA 3C2AL 1AGCA 4ONGH 1Q9KB 4QRPE 5H2BA 5EO0A 5DJ8A 2PXYA 1LO0L 2N7AA 5DRWA 3C5ZB 3FHQA 3WHE0 5IMKA 1NEZA 5CBAA 1U8OA 5DS8B 3AAZA 3MA7A 3V4VL 2FR4A 1KENL 2C4FT 4LU5L 2F5AL 1QFPA 3TBVB 3TYGL 3C8KB 3V0VA 5IT2H 2AQ3A 2QHRL 5IM7A 4DCQA 5F1SA 4FXGA 4HJJH 4AENB 4GS7B 2ADGB 3BUYA 3ROLA 1LWRA 4XRCA 2Q8BH 2Q7NA 2XFXB 1MJUH 4JVPA 5K59E 3ZMRA 4JFPB 2HVJB 1EAPB 2HT2C 2ENYA 3MLZH 3U4BH 4CADA 5ACZA 5LQBL 3MLXH 4NCDA 2JB6B 2ESVE 3MRIA 4KJWC 1J8HA 3QEGL 4L5FL 1CGUA 5I73B 4XAWH 1J1XH 1R5VA 5I1GH 4K71B 4PB9H 1DUYB 5FYKH 1N5YL 2H9GA 4PGBA 1GGYA 2QADC 5FEBA 2UZIL 5T33H 1IM9B 4KY1H 3TLRA 3OKLB 1JZ6A 3IAQA 3MLPA 3PHSA 3HZVB 1A1MA 5EU4A 4R4NC 3B9EA 3AUVA 1MCPH 2OX5A 4UTAL 3ARQA 5D7JC 3BT2L 4M1CD 4HMDA 4EN3A 3K8LA 3RP1A 2XN9E 3I6LD 3IS1X 3QXAA 4FTVD 2JJVA 3LH2H 2D9QB 2NY7L 4LQFL 1MCHA 4Z18A 2RBLA 1V5JA 5HYJB 5AEAA 4AT6B 4JJ5B 3A67L 5D2LA 1T5WA 4JZJB 4R96B 4A2MA 3FKUS 3DI3B 2W60B 2ZUQC 1LHZA 4O5LH 5DEFA 1P84K 1LO3H 3QFDA 5BZWA 3ZKSD 3QCUH 2OR7A 1T21A 5DO2C 5J9PB 4X6FA 3VG9B 1UWEL 3G6JE 1SYSB 2VXQL 3TBYB 4EDWH 4U1MA 3RL2A 1IGTA 4JG0L 3DXAB 3ZO0A 1GGBH 2CQVA 4FQXC 4ELKA 1IGYB 2ZCLH 4OGYH 4OD3L 2Y5EA 3WS3B 1LDPL 2BSTB 3A6BL 3F7QA 5TE6H 1FYTB 4OCXH 3EJZC 2MNUA 5IVXF 5L2KD 2X4RA 5E6ID 1PAMA 5BO1L 3VFMA 3BZEA 3D85B 4YBQD 5KSUB 4Y8DC 3SOBL 3AS3A 4YBQC 3IGAA 3KAAA 1CDBA 2FGZA 3D0LB 1OSZA 4N8VG 4P9MH 3RVTD 1W8NA 3SQBA 3RVTC 4ZFFA 4S2SB 4D94A 1HH6A 1I4FA 3GJEB 4OCWH 4PJHB 3VI3F 2VE6A 3MSPA 1KTDA 3B3IA 5CP7A 1TIUA 5HHPA 2ZJSH 4JY4A 3D69A 1MREL 5C0AB 2MQCA 5DTFB 4GKNB 3NH7H 5FECB 5JW3H 4BFBD 3ULVL 1EO7A 1VERA 1FDLH 1Q9WA 1AHWB 2F53D 2UY6A 3HB3D 3OQ3B 1XR9B 2VKWA 4ETQB 3OTTA 1MRDL 2H2PC 3HB3C 2CJUL 3EW3B 5IW1B 1CU4L 3KG5A 4OD1H 5SWSD 1IGCL 2GKIA 4HULB 1CWVA 2Q86B 5T1LA 3VFVB 4KJYB 5C09A 3CFJA 1HHJB 3KJ4C 5E9DE 4PJBB 3VFWA 4EXPX 1WBXA 2YPLA 1MFBL 1I3RB 4K8RD 1XGTB 1GIGH 2X4QB 4LCCA 2O61B 4U3XA 1T2JA 1W72L 2V7HB 4JZOA 3OB0K 1OSPH 2ATKA 5AWNH 1JNNL 3SKNB 5C9KA 4RGOH 1UWGH 2P48B 2X4OA 4WHCA 3ZT6A 4L9DA 3NIFF 1IAIM 4G8EA 1DQDH 3O9WB 4F3FB 3DNKA 2OYPA 1WCQA 4C58B 3O6MH 1F97A 3JZ7A 1JPFA 1BQHG 4HXBH 1U8KB 2XWJA 4IMLB 3K4ZA 4Q7DA 5FYLH 1FVEA 4Q9RL 2IADA 4RX4A 2GY7B 2EYRB 3VWKB 2VDPH 2VITB 5IFAH 3MMEA 3T0EB 3G5YA 4IOIB 4JFHE 3E6FA 2BK8A 3GNML 4OZFB 1H3PH 4ZO9A 5ETUA 2BMKB 1XGPB 3FOMA 1F3DH 3NPSB 5CBEA 3V52L 5K9OB 2WANA 4FQ1L 4NWTL 5JW4Q 3T08A 1R24B 4NFCA 1RIUH 1ZLSH 4L4TB 1IC5L 1D5MA 4PJCF 5GGTA 4ODBD 3K3QA 3V4PL 3QUXC 4X4XA 4ACPA 4LSPL 4HIXH 1FSKC 4KK8D 4V1DB 5MEPB 4L3EA 2J6EA 3E3QE 5JPNA 2VLKE 1AO7E 1CD1A 3LKRA 1Z0NA 4L29A 4RMUA 3GJFK 3MUHL 5KW9H 4OAWA 2DQJH 4BSVB 5JDSA 4ZUVA 3M07A 2FDBP 1OAKH 2P8LA 2WIMA 3O3EB 5CFHA 5DVNA 4R2GC 1N4XL 1GOGA 2XN9B 2IAMC 3MCKA 4IDJH 1L9MA 1GPOL 2MKLC 3L5XL 5HHOE 1FG2A 1JPSL 4K3JL 5LGHL 1HHGA 2F8OA 2IBBA 3ZT5A 3G5VB 2EDOA 4KTEH 4AIXA 1P4BH 3LPWA 2X9YA 2J4WL 1KC5L 1YNTB 1HHHB 2C3VA 1EEZB 5F7LB 1PY4A 4HZLA 2DQUL 5DJZB 2DBLL 4MA3B 5C0GA 1DBML 3BXNB 4Z7VB 1OAUH 2PETA 4XNXL 3HE6A 3UPRB 5DHVA 3S5LA 4RNRB 5T1KB 5TFSL 3G9AB 1F3JB 4MX7B 1YZZA 1OY3B 4HUVB 4KV5F 4HGMA 1EZVY 1D5IL 3OL2A 5T3XH 1WEJH 1MHEA 5KSBB 4R90L 1HDMA 4Y4FC 2FBJH 4UNUA 1I8MB 1YEDB 3WNKA 35C8L 5C08E 3HNTL 3VXRB 4F9PC 3ARPA 4ELMA 2DIBA 4HH8A 5DUPL 1BPVA 1X5LA 4Y16B 1Q9LA 3ARFC 5D1XD 5A40E 5BMFH 1KLGB 4PJ8A 3FTGA 1AR1D 4KROB 5ISZD 3VFTB 1AR1C 2VDNH 4OQTA 1JYWA 3CH8A 5HHME 1K5NB 3BGMB 3TO4D 5CCKH 4NQEB 2VXSH 1GL4B 1IAOA 5FDYA 3TNNA 3NVQA 3RJQB 4LSVH 5HHQB 4PIRF 4QHLB 1G0YR 2NXYC 1RUMH 1WLHA 1JMXA 3SE3C 1MFDH 1GXEA 4OIIL 2D03H 5J1AA 4O2CB 4PJXE 3KYMB 5FHAL 1GGIH 5I8EA 4XPAH 5F7WC 4DKEL 1BBDH 3U0PA 5DHXB 5E8EB 4U05A 3BGAA 1CDGA 2CDFB 4MA7H 1RZIB 3FAXA 1MF2H 7FABH 5J57B 4OZFH 3TJHC 1HILA 1HXYA 1ZHBA 4WWKD 3MRMB 2VDLL 2OI9C 3N85H 4FHBD 4LPUA 2FEDD 1JWSB 1PLGL 1QP1A 4OZHF 3G04B 4AH2A 3OJMB 1QR1B 2RCSL 3C08H 3TT1H 1ND0A 3QQ9C 4KQ3H 3U1SH 1A9EB 1N7ML 1MAMH 3QUML 2BVEA 2ZSWA 2BX5A 4RGMB 1ZHLA 5GJSL 2A74A 3D6GA 4L1DA 1FL3A 4P4KA 3BIBX 1LP9A 4TUJB 2JJSA 3B9KA 3TVMA 1DVFB 5CEXA 5ADPL 4DKAA 1RZJH 4UQ3B 1Q1JL 3MRGA 2NZ9D 3SN6N 3RWDB 5LKNA 3Q6GH 3WIFB 1TENA 4GG6E 43CAA 1NCTA 4FQ2L 1FPTH 1KCLA 2VR5A 1T03H 1E6OL 3S4SA 3MOAL 1YUHA 1A1OA 3R8BB 3SDCC 2XYCA 2DQIL 4PRIE 4UAOC 3F12A 3VCLA 1KJ2A 3NCFB 2HJKB 3WUWA 5IBUB 4GKZB 4ODVH 2BNRB 4IDLA 4D3CH 5TDNA 2WUCL 3OPZH 3TBSA 5DURD 4MA8L 1WC7B 4Q74A 4PJGB 1OW0A 1NCWH 4X6EB 4ALAL 4Y5XB 4RA0C 3AFLA 3QWRD 4HGWB 4P5MB 1A7QH 2C26A 3FQWA 5EOCL 1KXQE 2R0WH 1TETL 3WFDH 4HD9A 3QIBA 3BE1L 5CGYC 2FEEI 4PBXA 4Q97A 4QT5B 1ZT4A 3CMOH 1GHFH 4MAYC 3QIWA 5L7XL 3T77B 3OR6B 4GMTH 5C6TL 4IS6B 3SKMA 3QI9C 2EDKA 5EUOE 1MVFA 2XTJC 2APVA 2NQCA 3I6LE 3KLDA 3RHWK 3V0WH 5E03A 3M8OL 2ADFL 1DN0B 2GTWA 1NBQA 1YEKH 3VA2C 5HGDB 3HI5H 2HT4D 2D2OA 1NDMA 5EU6A 4OLZH 1CICA 2WWKT 3U79A 1VFBB 4X4YA 3DMMA 2GY5A 1LEKA 2X4UB 5D1ZD 4ELMF 3F7YA 4WO4D 4Y5YB 5KG9B 4PJ7A 2AJUH 2VZSA 4MJ6B 2Y7QA 3U82B 5GZOC 3OXRA 4OZGA 5GIRB 4DGIL 4YDKH 1D5XB 2DDQH 4HAGA 4NUJB 3MGAA 4HKJB 1IFHH 1PG7X 3H9SA 2Y6SD 4X0KB 3HFMH 3NFPB 1G1CA 4YHOL 2OTPA 3DYOA 1FFRA 3NFNB 4X7FC 5EUKB 4MLSA 3P4LA 2IAND 4NJAH 4NHCL 3OGOE 3PV6B 2K9UA 2CR6A 1R3IL 3C6LC 1I1FB 3ZTJG 1IBGH 2BVQB 3WFEL 1ED3B 3WNPA 5L2KE 2YXMA 3ZL4H 2XZAL 3OAUL 2AVGA 3QHZH 4LLWB 4UB0L 3LMJL 5IVOA 2GJZB 2WBWB 2G5BB 3GMNA 2AJSL 2X4SB 3DHJA 2DLFL 1X4XA 4L8SC 3MRFB 3DI2B 1J9CT 1W0VA 4XPTH 4TTDC 3VDAA 5F71A 3ZE0F 1K2DA 3SGDH 4IRJA 4NZJA 1KB9K 1X3DA 2HKHL 1M05A 4HKXA 2HKFH 2KUTA 3MLWL 4O51A 7CGTA 3BP5B 2D31A 4PV8A 1BP3B 4D9LL 1KCRH 3TBTB 4CUCA 1DUZA 2ZG2A 3V4UL 4NKOA 1UKTA 3QXDA 3NIGF 4R3SA 1M7XA 2ARJB 3L1OL 5EIIB 1AXSA 4XBEH 3BEVB 2VLLA 1NFDE 6FABL 1LP9F 3QO1B 1KG0A 5SWSE 2XKNB 3P0VL 1CGSL 2EDDA 1S8DA 2ZSVA 3FO0H 1J7VR 5KOMC 3WXVL 4W81A 2P44B 4ZOCA 3ARDB 3DUHA 4LLUB 2Z92A 4Z7NF 3GIVA 4NZTH 3IXTA 1MEXL 3MCLH 4ZAKA 4X7SL 4LEOA 1J1OL 4N0CD 1D5BA 1BWMA 3L3OA 4XZUA 2ZUXA 4M1DL 3WKMH 4Z8FL 2PCPB 5TE7H 4AEHL 4JM2A 3MUJA 3IXAB 4BK4A 5F8RC 2OR9H 1PKQA 3RWJB 2YHGA 5D7SL 3WFHB 1T3FA 3MJ9H 1R5WB 3REVB 4CN4A 2ADIA 5IQ7L 2X5PA 5EOQH 3Q5TA 1GOFA 3QRGL 5D96B 3REWB 2DLGA 4JREB 3VWJA 4OI7A 1E27A 2AV1A 4DTGL 1KPVB 3TPUB 2DJUA 1BVLA 5JXEC 3FQUB 4QY8B 4OQTL 3WDHA 1NCAL 4TPRL 5IVZA 5E70A 2DS4A 4RAHA 4WVRA 4KDTC 1KB5B 5GS0H 2Y4SA 4G6AD 5JQ6H 5D7LA 5IFJA 3VFUA 3BQUD 1F5WA 5CJOH 1KUMA 1NMBH 2VLJE 3EO1B 1A7OL 1JYNA 2FX8H 3CFKA 3IDJA 4OI8A 1YEIH 4E42A 4CDHA 1F11A 4LBEB 3C5ZA 4NC2B 4ZDHB 4JHWL 4LAQH 5I30L 2VXVH 2CLRB 3AU1A 2DKMA 2OJEB 5DGRA 4HJ0C 2CUHA 2Z8VC 3P77A 4ZUTB 2R4RL 5EU7C 2ADGA 5CJQL 2MQ3A 2FNBA 4DN3H 3UZEA 4YDJB 4PJ7F 4JEGB 3HUJE 4Z7UB 4XP5H 4OZGF 4HKBB 4MD4B 2R69L 1ZLUK 5GGRA 2Y06H 5I8OH 5D7IB 4ZYKB 4RZCA 2R2BB 4NT6A 4IBLT 5C86A 4OCSH 3HI1A 4FTVB 3S37L 3GDBA 3NIDE 3SJVD 5MP6L 4HUWB 1FNEB 3BZDA 4KHXL 3CAFA 3GSNB 4W6WB 5HTSA 4Q9QL 1NEUA 5KSAD 1QPXA 1BD2A 1FVDB 4U2ZA 4DUVA 4MHHG 2R2HB 3BPNC 2OJZH 3G5ZA 3U9UB 1JYVA 4ZD3L 3LKPB 3MREA 4EQ2A 4LF3A 2OXGA 1IC7H 2FZ3B 4WI4A 4HLZH 5IB5B 4M43H 4DGVL 1OPGH 1MLBB 3MRCB 3HZVA 2B2XL 4NO2A 5F44A 4I77L 4TTGA 2X7LA 2ZPKH 1OL0A 1JHKL 3K0WA 4LK4A 3SBWC 2ED7A 5KANI 3EDJA 5IHUH 1OP9A 1V3MA 2AXHA 4OCLC 1CFQA 3LV3B 2VABA 2GK0B 1MHCB 5AUMA 3OV6A 3CD4A 3QPQD 5D72L 5I1EH 4JZJA 3UTSA 3K7UA 1XFPA 4YBLB 5E6IB 5L2KB 4XHJD 4FFZL 2FL5B 4U7KA 3QFJD 4D9RE 5DJAB 4K9EC 4TULL 3IFOB 1JHLH 4KHTH 3WDIA 5DD0L 2FWOA 1U6AL 5E2VH 5D5ME 2CRMA 3SCMA 1MFEH 3P3YA 2XZQL 3TBYA 1AE6L 3WEXA 5H94A 1CTOA 3FRPG 43C9A 3WJLA 5EBMA 5JDJA 3BZFA 4F57L 2JJUA 1IGYA 3KPLA 3P30H 4KQ4H 3IDGB 3ORJA 2ITDB 5CLWA 1EEUA 3LN9A 4S1SL 3GBNH 1NGQH 1P6FA 1X6NA 3L95B 3S36X 3KLAB 4JM2F 5KSUA 1CDYA 2IMNA 3AY4C 2EDRA 3MLRL 2ID5A 2F53B 1MCCA 1KB5H 5SWZE 1DL7H 3WJJA 1NSNL 2RHEA 2IG2L 4H0GA 5DFTA 2R23A 3SO3B 3LQMA 1FE8H 2ZUYA 4DGYL 2C3WA 1YYLH 1P9MA 4Y89A 4NQCA 4TNVK 3SEPA 4ORGA 4ZUSB 2EE2A 2P5EE 4ONGL 3O2DA 2R0ZH 3ARGD 4HKZB 5EIVA 2PTUA 1U0QA 5DTFA 3ARGC 4R0LB 5FECA 2K7QA 4KKBD 5HVFB 4XB8A 3P9LB 4YXLH 1K9TA 4XT1C 4HS3B 1G7HB 2HTKC 1NUNB 3PGDB 1BJ8A 2JELH 1MWAB 3QDAA 4R6UA 5IT2L 1CLOH 1I7UB 3MRHB 4HJJL 4YXHH 4OBSA 3P4OA 4XC1H 4X9IA 2Q8BL 2H3NB 1XR9A 4ZPVB 4ETQA 5M95B 3JVGC 1MJUL 3S98A 3BFOA 5BS0A 3AXLB 3F7PC 5L0QB 3C9NA 4JCLA 5IJKC 5JZ7C 4WTZG 4CKVX 5B4MC 3MLZL 3VFVA 4MNQE 5E2WH 3U4BL 1HQRB 3MLXL 1XH3B 2APXA 3RGVD 1S7QB 2AXFA 3GSNH 4AZ8A 3BOVA 2ED8A 1Z2KA 3UTZA 2DF3A 4XAWL 4NNPH 3VXTA 1J1XL 4G7YH 5I1GL 2OL3B 4PB9L 5FYKL 1I1YB 2I07A 2CRZA 4W4NA 5B38A 1LMKA 5FM8A 5T33L 4PG9A 3NGBC 3SKNA 4KY1L 4D9QE 3U6RB 1OD9A 1S7XB 4P2RD 4Z77A 3KYOA 2E9BA 2V2WA 4QRPA 1V7NH 2AJVH 1FNLA 3V5KB 1MCPL 4F3FA 5JW5A 1JP5A 4APQA 5FK9A 5IVNA 1D3CA 4YHKH 5IJVB 1HWGB 1U8KA 1JV5B 3LH2L 1FYHB 2ZUTA 1VPOH 3C60A 1C7SA 3FQTB 4NJ9H 4N8VB 4U6VH 2ADJA 4O5LL 5IF0A 2XTJE 3MOQA 1LO3L 1YDPB 1MRCH 3ARYA 1K4DB 1JPTH 3QCUL 2BMKA 1XGPA 1JZ4A 4FQCH 5C07E 3JV4A 4AIZB 4MXWH 5ENWA 1GGTA 2YWZA 1HSBA 4JJHA 2ESVA 4MQSB 4EDWL 1HOCA 2EDJA 3GFUA 4O2FA 2AJ3B 5LCVH 1GGBL 2NY6D 2ERJC 5I16B 3NPZB 4UDUB 2NY6C 2ZCLL 4OGYL 1OP3H 5GRJH 5TE6L 1I85C 4OCXL 1JUFA 1INEH 5F7EH 1NANH 4BSVA 3QDMD 1UYWH 1H3UA 2YUXA 4R97C 5EBGA 3EDFA 3BO8B 4P9ML 1IZJA 2AJZB 2XN9A 3VI4F 2X70A 1XF2B 4U1IA 4G9FD 1BIIA 3SDAA 3OJDA 2DB8A 4OM0H 3KPSE 5MEOB 4OCWL 3G5VA 5I74C 4KI5F 1EEZA 2ZJSL 4PV9A 2I5YH 4Y2DD 3S35H 5D1XB 2C4FU 1P7KA 5DJZA 2AXGA 4YDVA 1WCBA 3NH7L 4JDVA 1U3HD 4LL9A 4Y2DC 4K8RH 5BCAA 5JW3L 5ISZB 2NY2D 1MWAH 4NQSB 3EO9H 2I9TA 3BXNA 1FDLL 3UX9B 4OFIA 3RGHA 1B2WH 1MVUB 4Y4KD 3RNQB 5MI0C 3G6JA 3TO4B 3F7VB 3VXSD 3K1KC 4HUVA 2V9TA 4U1HB 4ZXBA 1KSRA 3CX5K 4PJHF 4U1LB 4FQHB 3MRBB 2VXTH 1BQHB 4MCZA 2IPKB 4OD1L 5DJDB 3OHXB 1NL0H 1T22A 3HPJB 4UBDC 3CU1A 1H5BC 3QIUC 4P5TA 3PGFH 3VD4A 3GUTA 1QLEH 2DM7A 4ZSOE 1KLGA 4IJ3C 2XWBA 3FB6B 5CSZB 4RAVB 5GGUA 2OL3H 5HHXH 3H3KA 5DMGD 5DJCA 1LEGA 2BVPA 5DMJB 3WHXB 4WWKB 3WIHH 4EDXA 5EORH 1ES0B 1OSPL 3T3PF 5AWNL 4RGOL 1UWGL 4PJ9D 4CVUA 4J1UB 5HHQA 4NC0B 3WHE1 4JFDD 3VFSB 1DQDL 2FD6H 3O6ML 1UXWB 4QLRA 4PJBF 3QUZC 4N1EA 4HXBL 4K7PY 3ABZA 1NGYB 5FYLL 4LPYA 2APTA 1SJHA 2XWTA 3ULSB 1X5GA 1YMHA 1JK8B 2VDPL 4MNHB 4HUUA 1RZIA 5IFAL 3N06B 5MEND 1U8MB 1FHGA 1QFWH 1RK0B 1U36A 3IKKA 3LN4B 5B8CA 2FSEB 5DQJA 1TZIB 3OAYK 1H3PL 4NNXB 1WBZB 3G04A 3SDDD 2VLMD 2AEQH 2X4TB 1QR1A 4NQVA 5DDHB 1MIEH 4MA1C 1RIUL 4N0FB 1ZLSL 5E9DA 2NPLX 4U6TA 5GRVK 3OKKB 3PWLB 4H1LG 4GRLD 5FFLA 4QHMA 4X7TA 4HIXL 4HH9B 3UAJD 3RPIA 5HDQH 5FB8B 4Y5VB 4POZD 4N0YH 2FECL 5K59F 1I1AD 3WN5A 4U6YB 4POZC 2W0LA 5KW9L 5DA0B 3DGGB 1I1AC 2DQJL 3NA4A 2GJ6D 4KMLB 5DURB 2X4NA 3FT4A 5INCB 4LVOC 2QQQA 1ITBB 1OAKL 3S9DB 3MO1B 4F9LC 2PTTB 2VDQH 1LNUB 3FB7B 2R4SH 4IDJL 5EU7E 4GW4B 4NRZB 2VRAA 4NHUB 1QR4A 5I0ZA 2UY7A 3V7AG 4KTEL 3RI5F 1P4BL 2YUWA 4PD4K 4X9FA 5IB4B 1P1ZB 2NR6C 4AQOA 5EB9A 3UMTA 1NCNA 3PL6C 1EFXB 4GKZA 5GXBB 1OAUL 3D25A 4PBWD 1OAQH 5T5NF 4UZGA 1E28B 4YC2C 4OIBA 1PZ5B 1VA9A 1AQKH 4PY8J 1PDKA 3MJ7A 4WFHD 2CLVB 2EIZB 4M3JA 2FIRT 3T8XB 3JWDH 5T3XL 1DDHA 1X5FA 4HDIB 1WEJL 4TVSa 4WO4B 5D1ZB 4EUPB 2CLZA 2VZTA 2FBJL 4JANA 4NZRH 5GGRY 3U4EA 2VLKA 3O4OC 1UH2A 4F7PA 2V5RA 3BH9B 1AO7A 4GBXC 4U1KB 4POYA 5FYKU 3GMRB 4JPIA 4Y2OA 3T77A 3BD4A 1RZFH 4RCAA 3VFOB 3STLA 1U8QB 5BMFL 1N6QH 3G6JF 2IANB 5F7UA 5HVHC 2VDNL 4WWID 3CDGB 2VZ3A 1DQTA 4QTHA 2NZIA 4OSUH 5HHOA 5HGDA 3FZUC 5CCKL 5KSBF 2VXSL 5IHLB 3GSVA 4MLIA 5DJ2A 4PJAB