5AEAA

Crystal structure of human ncam domain 1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
100
structure length
100
Chain Sequence
b'LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURAL CELL ADHESION MOLECULE 1
publication title I-Bodies, Human Single Domain Antibodies that Antagonize Chemokine Receptor Cxcr4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 20
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5aeaA00
2JLLA 5GQBA 4F7EB 5IGXH 1TQBB 2VABB 3D9AL 5DJDB 1QVOA 3KR3L 3BQUB 3OG4B 4P48A 3RWHB 2WNGA 4NO2A 3G04B 2ED9A 3SGJC 1MRDH 2EXYD 4F7PB 5JR1H 1MJ7H 4OD2A 1I7ZA 2XWJB 1MF2H 1UC6A 3MNZB 4HDIB 3G5YA 4UDUB 2HTLC 1GAFH 3LKOA 3WD5H 3AXLA 2ZCLH 1U8MB 4TNWK 3T4AB 1FIEA 4WFEE 1GPOH 5D71L 1LHZA 2NQCA 2ZJSH 4FTVA 2V7HA 5I9QC 3QCUL 1RD6A 3MRHA 1U3YA 4IOSD 2AW2A 1BQHB 1WAAE 4MB4A 4ZOBA 1CE1H 3RZWA 3X11A 2EXWD 2A2QT 5D1ZA 4PRHD 3FQXA 2VLMD 5D7JA 4C55A 4MZ3A 1JUFB 4F9PC 3GFUA 5DMKB 4Z76A 3CVIH 3FOLA 2DI8A 3SJVE 1C8PA 2VXUH 3RNQB 2IH1A 4X6CF 3ULUD 1F6AB 3VWJC 2RFXA 1YEFH 2D7TL 4JFPB 1N7MH 3L3DA 3AB0C 4E5XA 4Z77B 5ISZD 2FX7H 1QRNB 4WFFE 4ZFZB 4NOBA 2GK0A 1FVCB 5JW5A 3CAFA 1L4IA 2CDEB 4OFIA 1A9BB 2W65A 1B0RB 3RVWC 3LPWA 4XX1E 3B2UD 1OAKL 1KN4L 43CAA 5BXFB 4M8VA 1DBML 4PRDA 4JPKL 4NYLB 2B4CC 2IADB 5SWSA 4QRPD 2GJ6B 5DO2C 3F7RA 4PRNA 4DGVH 1ADQH 4HWEH 5T1DH 2VXQH 3IRPX 4FNLL 4K94H 1VDGA 3V6FB 1VCAA 4ONGL 3PL6A 3K2MC 1I3RB 5ID1B 1HQ4A 5D5MF 1FIGH 3HZMB 1SEBB 4LHJB 3FT2B 4CU8A 1K4DA 3EYSH 3I02B 3WNOA 2IPUK 2NX5A 4LGSB 2V6HA 4D8PB 3KHOA 1BQLL 1IMHC 5DMIH 4WENB 3BQUD 1A3QA 3CMOL 1TLKA 4QKXB 5IHUH 4BH8B 2O61A 5FDWA 4OZIE 1NBVH 4N0FA 4BZ1H 4PY7B 3D3VB 2BJML 1CDCA 5DD0L 4U6HB 4RWHA 2XKNA 1MJUL 4Y5XC 1UJTA 2CK0L 4WW1B 4Q2ZA 3ZE0E 3X14B 5HDQL 1IGTA 3DIFA 2YZ1A 5CZVH 3GSNL 3FN9A 3SKOB 3GKZA 5EBWB 3BZFB 1F90H 1BJMA 3U2SB 3MACL 4D9QE 3QHZH 1BBJB 3QUXB 2O26U 1U8IA 2D7NA 1GVIA 5BOPA 5E6YA 4U3HA 3OB8A 4MXQC 1GGIH 1P2CB 4GXUM 1MPAH 2P7TA 3LSOA 2YA0A 2Z91B 2JB6A 4LVHB 4OGYL 4XCFL 4HFUH 5AD0A 4JLRA 5D6CB 3TT1H 5DSCA 3GGWA 2YMXH 3E6FA 4I1NB 4P5KB 5JOPD 3C60B 1DEEA 5MEOB 4KKBC 1G7MB 3H42L 4KDVA 2DYPD 1F4YL 2WBJB 4WNQA 1VPOH 3FB8A 3VFSA 5IP4A 1YDPA 1V7NH 5CGTA 3SE8L 2FEDC 5FUOH 2IJ0C 2P5EB 1MVUB 4P3DB 2AV7B 4ZO7A 4DAGH 3BO8A 2QSVA 2FIKA 1ZLWK 4HUUB 4WHDA 4L3AA 3E6HB 5F1NB 3MRMA 4C56B 5B4MC 4RAUB 2ESVA 3ARBA 3P0VH 3LD8B 3MMEB 1AGFA 4URTB 4Y0GA 1MAML 3ZSSA 1EO8L 2APWA 3JWOC 5FYKH 2HT3D 1UCBH 3HPJB 5ANMB 4I3SH 3K1DA 2J4WL 1U36A 1BQUA 3MLRL 3MBEB 1U93B 1OGAE 1A6UH 3PWJB 4P2QE 5EO9A 3AM8A 1NEUA 5FO9A 4PUBH 4QRRB 3V0AC 3UDWA 3ZKMD 1IJ9A 4OFDA 2XZAL 3LS4H 4F7MA 4DGIH 2C1PA 3PWPB 5SWZB 5C2UB 3QULA 5D72L 3P11H 1VFBA 4UTBH 1G7QA 3VJ6B 1I7RB 5GIRB 5DA0B 4HUXB 2OK0H 5JLZA 3KYMB 4NRZA 2F5BL 1N5YL 4TUOA 3F7PC 4Z8FL 3MZTA 1CT8A 1HCVA 5LGHH 3QRFM 2BOBA 4N90E 3T65A 2CUHA 3RRQA 1LE5B 3KPQB 3EYFB 4PJ5A 2RIKA 1SMOA 3TFKD 4Z95L 1CG9B 2X1WL 2J5LC 3QDJA 5D9SA 2Y5TA 4JFOA 4CW1B 3ARGD 1JPSL 1N6QL 2J8UB 3FO0L 1KPRB 1QO3B 2E6PA 4XZUB 2R0KH 4XRCA 1NAMA 5FM5M 5T3ZH 4KY1H 4RX4A 1VFUA 4U6XB 1BGXH 4JFXB 2J6EL 3DX6A 3QZWA 4JPIB 4O51A 3T0WA 2FHFA 4KKCC 3HA0A 3DMMA 2YA1A 3VXQB 4HZLA 2VR5A 1CD9B 2YWZA 5HHPB 3RZCB 5C09E 4PJBB 1EO7A 3HMXL 4EBQL 1LO3H 2P5WE 5E4EB 5DS8A 4P49A 1IARB 5H94B 5D7KD 3OSKA 4W68A 4E41E 3RWEB 4QNPE 3C60D 4OCYH 3NPSB 4KJYA 4F7TB 2VAAA 3UPCA 3D39B 1MCOL 4LPXA 5MENB 1HILA 3ZKXB 4OQTH 5J6HB 1A6VL 2VJXA 4MS8D 3DV6B 3LKQA 4P23A 2C4FT 4PRPE 4ETQB 2P5ED 1LNUB 3QG6A 1FGVH 5EN2B 2Y06L 4HC1H 1UXWB 2KQMA 2QADC 1EZVX 3BP7A 4WWID 5JXED 3NIDF 4LAQL 4N0UB 2DIJA 2UWEB 4KI1A 2DQGL 3GSOB 4C56D 3DARA 5BVJB 3GK8L 4HD9A 4HWBA 3RNKB 3TC9A 4L3CB 4Y16C 4UQ3A 1D5XB 4P3CH 1R3IL 3HNTL 4QXUL 2A77L 3BN3B 5I16B 1FZMA 1QFWI 2AKRB 4DCQA 3QUML 3PXJA 3ARYA 3VXSE 3MRJB 2VDRL 3L3JA 4H1LA 4RFEA 2VMFA 1P4IL 4QRRD 4BH7B 5KVDL 5HYJE 5SV3A 4GW4B 1OCWL 4LDOB 3PWPD 5SWZD 4DEPC 3QDGA 3FT3A 4MDIA 1AQDB 1CLYL 3B9KB 3LN4B 3Q5OA 5JPMA 4XPBL 2AV1B 4U1SB 4APQB 2XG5A 2OCFD 4U49A 2O5ZL 1J9CT 1GZPA 4I0PC 4P57B 2Z31C 2PN5A 4GUPA 5DD5L 1N4XH 2PTUA 3GNML 3RBSA 1BHGA 3B2VH 3N9GL 3PWVA 2A0LC 2ARJQ 1S7XA 1J0YA 5GGQL 4P4KB 5JIPA 1MCWM 3P73B 3H2WA 5EZLA 5E8OA 1ERNA 1OGAA 4PV9A 2V9TA 3ARXA 4JY6B 5A2JH 5BV7H 1CFQB 2AI0H 2YPVL 1A7BA 3TPKA 1P1ZB 1B0WA 2Z92A 1XF3B 2GJZA 3EIFA 2X4UB 4KDWA 5TDOA 1V8HA 1PKQA 3JWNC 1UZ6E 3ILPA 3FQTA 5E6ZA 3SHSA 1SBSH 3L3KA 4NJAL 4O02H 2NCMA 2OR9L 3VFRA 3VD7A 2VDNH 1S9WB 4MQSB 3FHQA 2X41A 3AREC 3N85H 2XPGB 1GHFH 3RZCD 4N0CD 5HDBF 5C0DB 4P59H 1U3HC 3HB3C 4OLUH 1RZ7H 4PD4K 5D7IF 3W2DL 1T83C 1EFQA 5EORH 1KXTB 1J0HA 1NCAL 3QRGL 3D85A 1KIQA 2VLKB 4MAYD 1XCTA 3IFPA 4PJDE 3M45A 3T77A 3JXAA 2NXZB 2BMKB 3OAUL 3NH7L 5TFSH 3D39D 1RJYB 3EJYC 1X6LA 1ZA6A 4RFOL 5TQ0H 1KB5B 3WXVL 4MCYA 3RIFK 4D0CB 1JZ4A 2SEBA 3TZVC 5I6XB 1PX3A 5FIEA 2PYEE 5C0JB 4NNYB 1MIEL 1AFVH 3PHOA 4NQSA 3I6KA 4XMLH 2WWKT 3B83A 4YC2B 1K2DA 2V2WB 2WSKA 3MCKB 3WS3B 1ORQA 1AIFB 3LB6D 4XBEH 4YJZL 1SY6A 4KAQL 3TBYB 4ZPVA 4JZOA 4N1CA 1PY4A 1NUDA 4G9FA 2NZIA 4OV5A 4MAUH 5DVMA 3QAZC 2WP3T 5T3XL 4ZS7H 5MI0B 2JIXB 3C2AH 4I18A 1BQSA 1MAJA 4HPYL 5EUOA 4P9ML 1M4KA 3A67L 3B9KD 4ZXBB 4WU5B 4ZMAT 2VXVH 5GZNC 1I7TB 4L8CA 3BP4A 3UTZA 5D1QA 4CVXA 1NCCH 3ROLA 2V7NA 4KPHH 5FM4A 4HKJB 4ZUVB 5FYJE 4MHHI 3THML 1CZ8H 8FABB 2HFFA 2E9BA 3IS1X 1A6TA 4LBEB 1UH4A 5ESAA 5EA0L 2XA8H 5HD8C 1RZGB 3ZT7A 4U6YB 3TVMD 4IRSC 4P4KD 3MRRA 1QLEH 1HZHL 1VENA 2DM7A 3AUVA 4NBYB 1QVOB 3PF2A 2ZPKH 1GGBH 4NO2B 1E6OH 5CJQL 3OAZH 3Q5YA 2XRAH 4WHYG 4RMTA 4I2XE 4OD2B 4EUPH 1I7ZB 3AY4A 1A5FL 5D93B 2ZOLA 3G5YB 4QXGH 1A4JA 2BFVL 4YHOH 3LKOB 4KRNA 3AXLB 1EEUA 1G1CA 1ZHBA 4LVOC 4ZYKA 4FTVB 3X3GL 3G6AA 2V7HB 3ZZ1A 2W0FA 2YUVA 3A6BL 3MRHB 2OP4H 4X9HA 4UBDD 4ZAKA 3OGOE 1XT5A 2CXKA 5ETUA 2VLKD 1WWBX 3TCLA 3X11B 5T5NF 3TNMA 4J4PA 5D1ZB 5GS0L 3FQXB 5D7JB 1JMZA 4Z7QF 4JHAL 2QQNH 5ADPH 1QBLH 1IAIL 4Z76B 3FOLB 2DIAA 1EIBA 3CFCH 3PDOA 2IH1B 4OKDA 1WFUA 2NW2A 3U0WL 2RFXB 2X40A 5A2IH 3L9RA 2NPLX 4MA3A 4F37F 3L3DB 2A9NH 3SCMA 2ICWA 4E5XB 4QRTA 2VH5H 1ZHNA 1UQSA 3GHBH 4EQ3A 2X1QA 4MD4A 4OZHA 4F33A 2GK0B 4YHZL 5KSBF 1I9JL 3V4VL 5JW5B 1AGCA 1D6VH 1HHIA 2W65B 2LV4A 5C7XH 1AD9A 5B39A 1CDGA 4PLKC 2YPKA 4L1DA 43CAB 2HG5A 1MI5E 1LK3H 1HOCA 1I9IL 4PRDB 1SVCP 4LSTH 2QQLL 3SKNA 4NM4H 4ZOEA 1IC5L 2R4SL 5SWSB 4OJFL 4H26A 3D2UD 3K7UA 4PRNB 4B7LA 4PGBA 1JYNA 1GIGL 1J1PL 1TITA 4KROB 4PB0L 4XHQA 1NGPL 4K23L 3PL6B 1G9EA 2EDYA 5E2JA 1EDQA 2ZUXA 5JIHA 1HQ4B 1UCTA 4K07A 5C0CD 4XB8A 1K4DB 4OZGF 3QUXC 4OGAC 3WFZA 5LXGL 2NX5B 4MWFA 3C6LA 1BFVH 2C5DC 2IBBA 4WI9A 4LSQH 2O61B 3ULVH 1FJ1A 2DQUL 5FDWB 3QI9C 4YH6A 3GRWH 2YSSA 4N0FB 2EH8L 3TA3A 2WBJC 3WJJA 3ZMRA 4R4NC 4YGAB 3UO1L 2XKNB 2EE6A 4WCYH 3QISA 4Q2ZB 4H5SA 3C8HA 1MJ8H 4FTVD 1IGTB 1YPZE 3DIFB 2K3TA 2XN9D 5J3HC 5J0BA 1RULL 3JBG7 3O6FA 4R97B 4PGJA 5EC2A 4K9EH 1NL0H 4OCXL 2IBZX 3R1GL 2W38A 2BXYA 1U8IB 5D1ZD 1NEZA 4WI8A 5B8CA 4G6FB 3RGVA 4P3WA 5T5FL 5CSBA 2YD2A 2CRYA 1DSFH 2P7TB 3LSOB 3MBEC 3TM6A 2JB6B 5K9OA 2AK1H 3ZHDA 4LHQB 5C71A 4HF5H 5AD0B 4JLRB 4WHYH 3U1SL 2JJTC 1NLBL 1E6JL 2KZWA 3BMWA 4KRPC 3UZEA 5DSCB 3GGWB 3E6FB 2OTUA 1DEEB 1MFNA 2EDKA 3NN8A 4S1SH 2ILLA 1FE8H 2IQ9H 1X5XA 4U3XA 5J9PA 5KSUA 1KYOJ 3P2TA 2MKLC 4WNQB 2F53A 3FB8B 3VFSB 5JXAL 1YDPB 1E0OB 1E4XH 3SE3A 5GS2D 1OTUC 3U82B 3QFDA 3FL7A 5C1MB 3IJYA 2OX5A 4YDIL 3BO8B 2FIKB 5GGVL 3O4LE 1AXTH 1UM6H 1I1FA 5DEZA 4YHKH 3MRMB 4R3SA 4ZPTA 3RUGA 5KVGL 5C0NC 2ESVB 3ARBB 5I1GL 5FUCE 4TSAH 5I1EH 3QQ9D 4WUUE 3ZKQD 1AGFB 1MCWW 3ORJA 4I3RL 3ARFA 5JIKA 3AMKA 7FABL 3I50H 4KROD 5EO9B 5FO9B 2DTML 4LRNH 4F7MB 5DQDH 4GO6B 1I1YA 2R29L 2C1PB 3BAEH 3QULB 1OSZA 3IDUA 1EUUA 1RMFH 5C86A 1K8DA 4GAJL 4W4OC 3RWFA 1G7QB 4PJIE 4QHMA 2CK2A 1FH5L 2X89D 15C8L 4BM7A 1ZWIA 4GAYA 3ABZA 2VDKL 5JLZB 2D03H 4NRZB 1EEZA 4XVJH 4UT7L 2XACC 4TUOB 4KK8C 1NCWL 2DQJH 1P84J 1IAIM 1AGBA 1F2QA 1I8LA 3L95A 1CT8B 4NQXA 3T1FA 5EU7E 4R9HA 1UH3A 1OARL 4OIBA 2BOBB 1B4RA 1WJ3A 3T65B 5IBTH 1A0QH 2HA1A 4YDKH 4PJ5B 2RJMA 1DBAH 3BT2L 35C8L 3UTOA 3GBMH 5E9DD 1XR9A 2DM2A 5B38A 4PJFA 2XQBH 3QDJB 5D9SB 2Y5TB 3Q1SL 4JFOB 2F8VA 4M1GL 4JDVA 2E7LA 1KB9J 3NVQA 5DT1H 5A2FA 1TPXC 4XRCB 1NAMB 4FRWA 4JKKA 2NY6B 1JGLH 3K0WA 3DROA 5SV4A 2F9BT 3DX6B 2W0KA 3QZWB 4O51B 5FM8A 2DLFH 3DMMB 3B5TA 1H8SA 4HZLB 2RGSA 3ULUF 1MQ8A 4U1LA 3SDAD 5SWQA 4G6FD 5HDLA 5H2BA 1FBIH 2G2RA 4Y8AA 1A6PA 3VFMA 3AGVA 5DS8B 4WHTA 1WV7T 2NNAA 1H5BA 4PBVC 3K81A 3PGFL 3MBXL 4W6WB 3RX8A 1GXEA 4KJYB 1RVFH 2PCPA 2MFNA 3PHSA 2VAAB 5IVZB 5TF1L 1HILB 1MCSA 3LEYH 4HIEA 3ALXA 1YPZA 2OM5A 4OD3H 5CEZE 3LKQB 4P23B 4XVTH 2EZ0C 2XZZA 1QSEA 3QG6B 3FAXA 4YGVA 5IVXF 2H1PL 5IROC 3BP7B 3MROA 4XMPL 4R8WL 3EDEA 1H3PH 4NFCA 4KJQC 1UENA 4G6JH 5FFLA 4LPCA 3ARBD 5DXWA 3VGEA 2GCYA 5DUBA 4UQ3B 3NCFB 4JKPH 3IU4L 3EDFA 4FFWC 4NP4H 1B2WH 3GMQA 2XWTA 1VHPA 1FZMB 4DCQB 1EAJA 5CMAA 2B7DT 3L3JB 4H1LB 3NABH 4RFEB 1VEOA 5FA4A 1FL3A 4MGXA 4X9BA 4EI6A 4BQ6A 1NSNL 1ADQA 3QDGB 3FT3B 4PJGA 4MDIB 2VN7A 2QSTA 3F58L 5JPMB 3KXFE 4M5ZH 4MD5A 1IGJA 5EIIA 3H3PH 3NGBB 3O4LA 3BPLB 1GZPB 3KHQA 4GUPB 1KBGL 1BD2E 2OJEA 4R0LC 3X17A 5FA3A 2WLZA 3OAZK 2LE9A 1QEWA 3HUJA 3KPRA 3PWVB 3U7YL 1S7XB 2XZQH 4PJ5D 2RAMA 5EOCH 4FQIH 5EZLB 5E8OB 1OGAB 2BHUA 3B5GA 4PV9B 4EQ2A 5I6XC 2AEQL 4LCWA 2Z92B 3BEWA 4Y4HC 2GJZB 4I0KA 1KJVA 12E8H 5TDOB 3FQUA 4ZUWA 1PKQB 1K3ZA 4RX4D 3PV6A 3ILPB 3FQTB 4YC2C 1UM4L 3L3KB 2O93L 3VFRB 2CGRH 2Q6WA 1QSVA 3DMMD 1T7WA 4F57L 2RBLA 1DBKH 3G9AB 2FX8L 5DD1H 3V8OA 1MCLA 5MI0C 3ZDYE 3D85B 1KIQB 5EG6C 3VXME 3CK0L 4FMKA 1XCTB 2J2ZA 3IFPB 3T77B 3H9ZA 4KK9C 4ZXBC 2E9IA 1ZA6B 3IF1A 5BZDA 2DB8A 2VO5A 3LH2L 4MCYB 4RFNB 5C0AE 2SEBB 4JCLA 2A6JA 4X6DA 4UILH 4PJAE 3QUKA 2CDFA 1TXKA 4D9QD 3PHOB 4XP1L 4NQSB 2QL1A 1K2DB 1A7NH 1F3JA 1MNUL 3STLA 1ORQB 2BY1A 2XV6B 4LARH 1C7SA 3T0VA 3RVVD 1OHQA 5E95B 1V7ML 1FRGH 3RWDA 4ZPVB 4JZOB 3O9WD 4GQ9H 2DQTH 4G9FB 4OV5B 5DMJB 4TTGA 2Z8VC 4NFBA 4QO1A 3DVNA 4ZFFA 4I18B 4ZO6A 3WXWL 3CXHK 5CGYD 4GBXA 2OMBA 3BVNA 3QDGD 4J3XA 1IGML 3U6RA 4G6AD 5EUOB 4N9OB 4S1QH 2Y6SC 4NGHL 4V1DE 3DSFL 1OTTD 4NN7C 1FFQA 2NR6C 4Q9CA 4DN4H 4Y5VA 1CGTA 5DHXB 2Y1VA 4L8CB 1EJ6A 3BP4B 3UTZB 5D1QB 4CVXB 3ROLB 2V7NB 5DZLA 4M6OH 3MO1A 2YK1H 2HFFB 1MFDH 4YUEL 5GZOC 1A6TB 4YWGH 3ILQC 1HH9A 5ESAB 5DURB 1BEYL 4OIIL 3MYZA 4TVPL 5GJTH 1O7SA 3MRRB 1AJ7H 3C5ZD 4JO2L 1G7HA 1OGAD 4P2QD 3DRTA 2YD4A 3V8CA 1IKNC 2ATKA 3QHFH 1CFSA 1RJCA 4NQTA 4YXLL 3OX8A 2XNAA 4OF6A 2XXCB 1FO0L 4GSDH 5DTFA 2ZOLB 3CFDA 3S37X 1A4JB 4MXWH 4IJ3B 4ZOAA 3C08H 3E2HC 2EDOA 1ZHBB 4RAVA 4ZYKB 1TQCC 1N5AA 3QR2A 5ADOL 2D9CA 3G6AB 4DVRH 2W0FB 4DFHA 3STZA 1RZJC 2NY3C 4N90D 1YEIL 3MC0A 4ZAKB 5I1DA 2ADFL 1DQJA 5ETUB 2OL3A 3TCLB 3JVGC 3TNMB 4GQPH 1KSRA 3HKFA 1WIOA 4GG6F 4PJXE 1MHHA 8CGTA 2HRPH 2A83A 3MRBA 3PDOB 5GRUL 1X4YA 3HMWH 2HMIC 2B39A 4Y4KC 1YNLH 2NW2B 2Q8AH 1EHLL 1EBPA 1VEMA 4OQTA 5JTWA 3RWGA 3L9RB 3C87A 4NQDE 4MA3B 4RGMC 5D2LE 4YHLL 3LHPH 4XPFH 3QUYA 4NN5C 3SCMB 4Z0BL 1U41A 2ICWB 3VGAB 4QRTB 1ZHNB 3VI4E 4R2GB 5F8RC 4HC1A 5EZJA 1UQSB 3RHWF 5C09D 5HYEA 4MD4B 4OZHB 3PDDA 1EBAA 4F33B 1U58A 3QEQE 5ALCL 5EULV 1AGCB 1HHIB 4EDWH 1I7UA 4HT1H 3KS0J 1AD9B 5B39B 2B4CH 1YEHH 2J8HA 2ZG3A 3AS2A 4G9FD 4FFVD 4JDTH 1CLOH 2YPKB 3DX7A 4QXTA 4GXVL 1T7YA 1H3TA 4S10A 5DK2A 2I5YH 5L0QC 2HG5B 3NCCB 5BMFH 3EO9H 1HOCB 4JFYA 2D31A 4JY5H 3SKNB 4WU7A 4L4VA 4H26B 4YBQC 1B4JH 3B5HA 4PGBB 4Q9RL 2AABL 2Q76A 1R0AH 1QR1A 1I8KA 4P2CG 3DO7A 3HR5A 4UOW1 4R97C 4BZ2L 1FVDA 2ARWA 3DX9A 4NZJA 4X99A 2NYYC 1L0YA 4JM4H 2VDMH 5DURD 3W82A 3DX8A 4NZDA 1ZMYA 4K8RD 3LDBB 5GPRA 4MWFB 1NFDE 2J8UF 2KUTA 1XF1A 5I1JL 1T2XA 1DFBH 3EYUL 4Z7UA 3TO4D 2VUOA 1KEML 1FJ1B 5A16A 2O5YH 1A22B 4EOWL 5C8JA 2YSSB 3V4PH 3MSPA 4ELMA 3TA3B 3GO1H 5K59E 4JGMA 1JIBA 1YEEL 5CZKA 1OLLA 4PJBF 2EDDA 1CU4H 1HYSD 1D5IL 3HAEG 4H5SB 1V05A 4OTXH 4UT9L 5JW3H 2BVEA 4DTGL 1AHWC 3O6FB 3AC0A 1TVHA 5EC2B 5TDPA 1ZEAH 1B88A 3MA7A 4BSWA 2HKHL 1JYWA 4LPWA 5JA9A 1IILE 1L7IL 3G08A 1X4XA 1PFCA 3MXWH 2X2YA 4M1CD 1NEZB 2VXSL 3QG7H 5B8CB 1QSFA 4KTDL 4XNYH 3RGVB 3FHAA 3UEZA 3BEVA 5K9OB 4ALAH 1VB9A 4ZO8A 1N0LA 2N7AA 5I1CH 2ZP0T 2A73A 2X9XA 2UWEF 4RNRA 2X9YA 1NLDL 2OTUB 3NN8B 2BK8A 5J9PB 1JGVL 1J1XL 5KSUB 1ZA3A 4ZFGL 2F53B 3MLTA 1DLFL 4UT6L 1FV1A 2EE2A 2XG4A 1YJDC 1GL4B 3QFDB 2KDGA 3SE9L 4XI5D 3BRGC 3IJYB 1FSKC 1YYML 3LMJL 3W0WA 3HI6L 4CU6A 3JWOH 2OJZH 1I1FB 2OSLA 1NCTA 3RUGB 4ZPTB 2NY7H 3BP5A 4WWKA 3V9FA 2CJUH 5IUSA 5SX5H 4AEEA 5F6IB 1CGSH 4HX1A 3QSKB 2PYED 3KJ6L 2ZUSA 4LCCC 3ARFB 4ODBD 4WY7H 4Y2DA 4S2SA 5E6ID 4OLVL 1WICA 5FCUH 3EKCA 2MMXA 3CPLA 1CD1A 1M71A 2IMNA 1I1YB 4RGOH 1UACL 1T2JA 1JRHL 4X6CE 3V4UL 1FFRA 1WFTA 1OSZB 2VZUA 4UINH 4XAWH 5DFTA 4ZFOL 4O5LH 5FF6A 1K85A 3PWUA 1K8DB 1BBDH 2F19L 3OXRA 5CP3H 3RWFB 4QHMB 5T1LD 2BVTA 1ZWIB 4GAYB 1OT1A 3F7QA 1EEZB 3C6LD 4XP6H 3MOAL 5IB5A 1AGBB 3O3BA 3GMPA 3L95B 4NQXB 3T1FB 4Z7NF 4OM0H 5F9OH 5HHVH 2AJXH 4H88H 3TA3D 1XR9B 5GHWL 5B38B 4PJFB 5HYSG 2DJUA 4EUPA 5FYJD 4EEEA 4JDVB 4PS4H 4LSPH 4FQLH 5GRJL 4WI3A 4KHXH 4J3WA 2J8OA 3GHEL 4X7SL 1K6QL 3O6FD 4YZFF 1J5OH 2XT1B 3HZKA 3DROB 4I4WA 3PWLA 3B4NA 2HVKB 5AYQA 3NACH 5D5ME 4U1LB 3WFEL 5SWQB 3RGVD 1IFHH 3O2VH 3INUL 5H2BB 1S9YA 5HYFA 5E94A 2BSED 3GSXA 1FLRH 2G2RB 1JNLH 3VFMB 2UV3A 3BN9D 2VDQH 2WUCL 4KKLC 4WHTB 4KMTH 3OHXA 2NNAB 1RZ8A 3QO0A 1H5BB 1RK0A 1DE4A 4XWGL 4LSSH 4NHCL 1P6FA 2PCPB 3HG1E 5C0RH 2F53D 3HAEH 3HHRB 1YPZB 4HIEB 4WEBH 1IKFL 4IRZL 1JV5A 3CDGA 1LD9A 4QCIA 1OP9A 1X5IA 3U36A 2WBKA 5GGTH 3VXTA 1QSEB 4D3CH 5HGBA 4JRXA 3O2WL 4K3DL 4O00A 1KFAL 2CIKA 4YGVB 1JP5A 3MROB 1OQXA 1VACA 3RAJL 3GIVA 4BELD 2VRAA 4E9LA 2GCYB 4O2EA 4I0CC 3VXUE 5DUBB 3M17A 4PYGA 2BSRA 3D0LA 1AI1L 2KKQA 4P2OD 4WW2A 1FFNA 3GMQB 2XWTB 1E28A 3ARFD 1JPTL 2AJSL 4B5EA 2X7LA 5CMAB 1Z0NA 1KT2A 2V5TA 5FYKU 5FA4B 4PG9A 1FL3B 4EI6B 2VZ3A 3BGFC 3VRLF 1S5HA 5FO7A 4WO4A 5ID0A 1OPGH 4NUGH 3QUZC 4PJGB 3U48A 1QACA 4ELKA 4UTAL 4Y4FA 3S34L 2YRPA 4HJJH 1W2KT 3MJ9L 4MD5B 3BUTA 1IGJB 4LHUG 5EIIB 3N0PB 3O4LB 1IGFH 3OR7A 4JO1L 4HKZA 1JZ6A 3WFBL 4LCIL 2OJEB 3D9AH 5FA3B 3KR3H 3HE6D 1QYGL 4JFDA 1QEWB 3HUJB 3KPRB 3SGDI 3Q6FA 2BDNL 2V5MA 3CFJA 3KPOA 3GRWA 5E2UL 1IBGL 5KSAA 4LCWB 2NY2C 1MLCA 4YR6A 2AJVL 3BEWB 4YLQT 3QPQD 5D71H 1KOAA 3BH9A 1KJVB 3KGRA 1QBAA 3QCUH 3FQUB 4ZUWB 1K4CA 5GSRA 3PV6B 2XTJB 4PLJD 2NY0C 4EDXA 1MCKA 2RQ8A 4HK0A 2Q6WB 3V0WL 4QRQA 4XNZB 1MFBL 5E8DL 1J86A 3X12A 1JNJA 4R96A 3HZYB 2X6MA 4ODTL 1B3JA 5IQ9A 4JPWL 4LIQE 3BDBA 2BSTA 2D7TH 1D6EA 2HH0L 3TLRA 1P53A 3WLBA 2WWKO 1A14L 5BZDB 2EXWC 5JDSA 4MQXD 5EU6A 3ZKNC 1SJVA 3RJDA 2F8OA 1P7HL 1VGEL 2A6JB 4AQOA 4OCLC 4NZTL 1VFAA 1P7QA 1T89A 3PIQA 4TSCL 4X6DB 3QUKB 2CDFB 2C9AA 5ILTL 2WP3O 5C08E 3K74B 3OF6D 3C8DA 5JUEL 1OAKH 1KN4H 1F3JB 3STLB 5DUML 3REWA 5IJKA 3DUUA 3GIZL 1DBMH 4JPKH 3RI5F 2RB8A 5IM7A 3RWDB 3BZEA 2P48B 4P2RA 5DJ2A 2EIBA 4MSWA 2AK4A 5DEFA 2EEBA 4E42A 3DVNB 4PTTA 1NANH 2AJZA 3CFKA 4U7SA 4FNLH 4YX2L 4ZFFB 3O3UN 4ONGH 4GBXB 2BOCA 3BVNB 3U6RB 5F9WC 4QF1A 1G7PB 2VWEC 4JM2D 4Y5VB 1F8TL 3O4LD 4C54A 4IRJD 3FRPG 4ZAKC 5IBUB 3MO1B 1BQLH 2HP4A 3JWDL 1Q0YL 1ITCA 5AG9A 1HH9B 3CMOH 3VGHA 1T7XA 3KPMA 5IB2A 4WUUD 3NOIA 1F6FB 3VFOA 3NIDE 2I9TA 3QIBA 2B0SL 3DTXA 1CXFA 1G7HB 3U4EA 2BJMH 3H3KA 5DD0H 5E00A 5I74B 2PXYA 3DRTB 4MD0A 5ABDE 1MJUH 5IV2A 3T1WA 1PSKL 1ACZA 1G6RL 2CK0H 5B22A 2ATKB 1CFSB 2GUOA 2XTLA 3VRJA 4NIKB 3DOSA 3OX8B 2XNAB 5HDQH 3VGAC 5DTFB 4Z78A 3CFDB 3AS3A 4R2GC 3GSNH 1JNHA 4M8QA 4RAVB 3NMEA 3MACH 1HN1A 1N5AB 2APFA 4CVUA 3MV9E 3STZB 4X5XA 4YBHA 1KCVL 5I1DB 1I1AC 4OGYH 5CLWA 4RGNB 4WDIA 1DQJB 4XCFH 2OL3B 1MREL 1KCSL 4HGWA 3QFJE 4ZG1A 5E2VL 1MHHB 3H42H 3MRBB 2A83B 1F4YH 5ECJE 3SE8H 1JGUL 1SM3L 3KPSA 3RWGB 3VA2C 5MP6L 2VZVA 3QUYB 3HE7D 3FO1A 2DKUA 5EZJB 3RGHA 1D5BA 1YMMA 5SX5K 2X4PA 4Y88A 1U58B 4IHOA 3WNKA 1I7UB 4RQQA 2KZ1B 1MAMH 1EO8H 4IIQA 3DX7B 4LSUL 2YZ8A 4OGXL 4QXTB 5DK2B 2J4WH 4OKVA 1Z9SA 3MLRH 4NKIL 3VE0A 3MRQA 4JFYB 2D31B 2YA2A 3FTGA 1KLUA 4XMKL 5D7IE 3T0DA 3HC3L 2XZAH 2FL5A 4DWHA 3PUCA 5D7SL 5CEZD 4WU7B 4L4VB 4HS3A 5D72H 4XPHL 5F7NC 2EYTA 2Q76B 5C08A 1QR1B 1I8KB 3DO7B 1XCQA 3HR5B 2F5BH 1KG0A 1FVDB 4NM8L 3DX9B 1N5YH 1TIUA 4HQQL 4X99B 4Z8FH 4TVSa 4YFLF 3ZKMC 3DX8B 2BY2A 3IDIA 1LGVA 2WANA 4Z95H 5J13B 4Z7UB 5INCA 1MWAL 1FCGA 5I71C 1JPSH 5A16B 5C8JB 1N6QH 5DJZA 2EKJA 3FO0H 4DKEL 4CGTA 5BV7B 1QZ1A 4ELMB 1MRFL 1A6WL 4PRIA 4BUHA 2QHLA 4N68A 4PPTA 5J4MA 1DQDL 4GFTB 2J6EH 3U4AA 1NKOA 1F3DJ 1FYTE 1BD2D 4PBWD 2H2SD 3DXAA 2VITA 1QA9A 4HJ0C 4GRLA 5D96C 3ARGC 3HMXH 2CLRA 1TVHB 4EBQH 1ZSDA 3MXVL 5ENWA 5TDPB 4OQ1A 4BSWB 3G6JA 3MA7B 5JQHC 2D4DA 3IETA 2ZUVA 3EOBA 3G08B 5F7EL 4GOSA 5HXMA 2P24A 1E4KA 1WFNA 1T20A 4PJ9C 1QSFB 4OF3A 4PLNC 1XIWD 3JSSA 5ESQA 5DJAA 4RMUA 1MCOH 3BEVB 2KH2B 4EI5A 1A6VH 4NQEE 2ITCA 4CDGC 3Q48A 3MQIA 2DBLL 4ZSOA 2A73B 2G5RA 2J1KA 4RNRB 3JTSA 1OWWA 1IRAY 1L7TL 2Y06H 5GS3A 5FXCH 3QUYD 2YC1A 1ZA3B 4LAQH 3MLTB 3MV9A 1FL5A 4KC3B 2DQGH 1FV1B 4JN1L 2H2PC 4QTIL 3GK8H 2Z93A 4MNGA 2X44D 5D70L 2BNRA 3SEPA 4KJPD 4L4TE 4EN3A 1I4FB 3RL2A 1UXSA 1R3IH 3HNTH 4QXUH 2FATL 2A77H 3W0WB 3QUMH 2OSLB 3NZ8A 2VL5A 2VDRH 3IXAA 3BP5B 3QIUA 1P4IH 4WWKB 1U95A 3UX9B 5KVDH 4KMQA 4ODHL 1OCWH 4FQ1L 4FQQA 5C0AD 3P30L 4HX1B 2NY4C 1CLYH 1ZLUH 3UTTA 2HAZA 4Y2DB 4S2SB 5IT2L 4XPBH 5I73B 4YIQA 3CPLB 2BC4A 4NQCE 1CD1B 1M71B 2O5ZH 1NGXA 5DD5H 2Y5EA 3V5KA 3TV3L 3GNMH 4XTRD 5FF6B 3PWUB 3OXRB 5CCKL 4TPRL 5EU4A 3N9GH 3QEUA 4ZTPL 2UY6A 5GGQH 2HRLA 3NFPA 4OSUL 4JFZL 5FV1L 5A40E 3UZVB 1WC7A 3EYQD 2A6IA 5IB5B 5KSBE 1ZE3C 3O3BB 3GMPB 2LTQB 1T4KA 3CLFL 2YPVH 3D69A 1ZANL 3MA9L 4FN0A 1NGYA 1XMWA 1MHCA 4I48A 5DHYA 1T1XA 4F8TA 5AWNL 5FGSA 4NJAH 4EUPB 2OR9H 2J88L 2IANE 3MLYL 5I75C 4HAFA 4M4PA 4ZODA 3SN6N 2UVEA 3A0OA 3S96A 3RKDD 1CFTA 3HZKB 2Q87A 1IC1A 4I4WB 3PWLB 5IVNA 5IFAL 3W2DH 3HNVL 3IAPA 3PWNA 3QRGH 1NCAH 3N1MC 2DF3A 4F9PA 1DL7L 5KN5A 1QSFD 3FFCE 4RMWA 3OAUH 3NH7H 1S9YB 5E94B 1I1CA 1YN6A 3GSXB 5FKPA 4RFOH 4DW2L 3WXVH 3VWJA 2DL9A 3OHXB 1RZ8B 3QO0B 1RK0B 1WCBA 1DE4B 4JKMA 3VA6A 1A7QL 4K94C 5IJVA 1AXSA 3LEVL 1MIEH 1WK0A 4R6UA 5IMOA 1JV5B 5E99L 3CDGB 1LD9B 4QCIB 4L3EA 4QNPF 3U36B 3DUHA 3VXTB 1OTSD 3TBSA 4P99A 2ICEA 5HGBB 1F58L 3U83A 4JRXB 4KAQH 1DQQA 2CIKB 5BRZE 1A6ZA 3W0WD 1VACB 3X3FL 4WHCA 5EUOF 1G6VK 4HLZG 2IBGA 5T3XH 1JHLL 3T04D 5KS9E 4WWKD 4LCUA 4O2EB 4OF8A 1O7VA 2QR0A 3M17B 2BSRB 1Z9OA 4HPYH 3ZHKA 3D0LB 4WW2B 3IU3A 2AJYL 5I8KL 1FFNB 4P9MH 1E28B 4Z7WA 3A67H 4Y2DD 3RWIA 3WHE1 2CLZA 2X7LB 4NQDD 1KT2B 2IGFL 5DWUL 1JWUA 4PG9B 1H15A 2ADJA 5KANI 1S5HB 5FO7B 4WO4B 5ID0B 5IF0A 2Z9TA 3THMH 2E9JA 4ELKB 4Y4FB 3K4DA 4BKLA 5EA0H 3QDAA 4PR5A 3QWRD 3S6CA 1HSBA 4X4ZA 1T80A 1MRCL 5L2KA 3OR7B 4HKZB 1CBVL 1HZHH 1ITBB 4JFDB 4X98A 2YUXA 5CJQH 1X6NA 4ONFL 2ZOKA 3RDTA 4FXLA 3Q6FB 4Y5XA 2YHGA 3CFJB 3H3BC 1A5FH 1IQDA 4DUXA 5HI3C 3KPOB 2BFVH 4PY8I 3S88L 4FQPA 2K7QA 5KSAB 3AVEA 4CMHB 1MLCB 4YR6B 2OYPA 3T0EE 3DPBA 4JRYE 3BH9B 3X3GH 5JW4Q 3A6BH 4HG4K 2R1WA 1K4CB 2VDPL 5GSRB 4EDXB 2ENYA 4HK0B 2E6QA 4QRQB 3H8NA 1I3UA 3E8UL 3X12B 1RQ5A 5GS0H 4R96B 4HH8A 4JHAH 5CJOL 1IAIH 3WIHL 5HYQA 2GYSA 3S36L 4L8DA 3V6OC 3WN5A 3RJQB 3VFWA 1YNKL 4MLIA 4WUKL 5IQ9B 1K3IA 3U0WH 3DV4A 2PO6A 3KYKL 2BSTB 4UBDC 3CXDL 5F7KC 1O0VA 5KVMC 1D6EB 3WLBB 4LLVA 4AEHL 5JDSB 5EU6B 4GKOA 4PJDF 4YHZH 1X7QA 1VFAB 1P7QB 1I9JH 3PIQB 3V4VH 1JHTA 4JZJC 5D2NC 3VFUA 4TTDD 4CDHA 3CC5A 3ARZA 5JOFA 3CLEL 3UBXI 3REWB 3TF7C 3DUUB 2ADIA 3QEHA 4ZS6D 2VLME 1I9IH 3GDBA 2QQLH 5IM7B 4MVBC 1IC5H 2R4SH 4POYA 4OJFH 4CN1A 3BZEB 4P2RB 2XI9A 5BW7C 5DJ2B 2W07A 1PD6A 3ULUE 4MSWB 1UVQA 2AK4B 5DEFB 4E42B 4ODUA 3DETC 4PTTB 2AJZB 1GIGH 3CFKB 1J1PH 4PB0H 4WO4D 1NGPH 4K23H 4DUWA 4JEGB 1N64L 2FD6L 1CL7I 4QF1B 2BHYA 4G6ML 3S35X 4BSJA 1AR1C 3VGDA 3OKYA 1CTNA 3CSYA 3JV4A 5LXGH 5CP3A 3V5HA 3MOQA 4KVNL 4LLDA 2J7LA 5KS9A 1U8LA 4JFDD 3KPMB 5DFVD 5IB2B 2XXMB 5IW6A 5IVXE 3FRUA 3VFOB 2DQUH 2I9TB 2IWGA 4X5WA 4M9OA 3ULVD 3QIBB 1V3KA 3DTXB 3Q6GL 4QRPE 2EH8H 3U4EB 2FGWL 4XBPA 5E00B 4YHYB 3VD4A 2PXYB 3SDDC 3UO1H 4FXGA 4MD0B 5FHBL 5IV2B 5EOTA 1HH6A 2GUOB 5CZXC 5CEXA 3CDFA 3VRJB 1KCLA 1PEZA 3QNXA 1TJGL 4U1HA 5A3IC 4Z78B 1RULH 3BP6A 2ZUTA 3MFFA 4RRPG 1JNHB 3ULSA 4M8QB 1X5FA 1MIML 5T5NG 2UVFA 3IJHA 4OCXH 4RAHA 3DGCR 3R1GH 1TNNA 4G8GA 1GZQA 4H0GA 5LVEA 1LDPL 2F74A 5T5FH 4X5XB 4FQXB 4JFFE 4LLMA 1OM3L 4WDIB 4DKFL 2UYLA 4HEME 3U1SH 1NLBH 1E6JH 1JBJA 3O0RL 4Q9QL 2YD9A 4HGWB 1P4BL 1Z0MA 2XWBA 4JRYA 5EU6D 3LKNA 5JXAH 3MREA 3VGBA 3KPSB 3H9YA 1FHGA 2JJSC 5KVEL 3HAEA 1JFQL 3RUGF 4PY8J 1T0PB 3ESUF 3BPOB 4YDIH 5GGTA 1J12A 3FO1B 5GGVH 2G75A 4Y16A 5F1SA 1TTUA 1UGNA 1D5BB 1YMMB 2X4PB 5KVGH 1EHNA 4KI5C 5I1GH 2EDBA 1ZLUK 4IHOB 5F89A 4RQQB 5M95B 4ACPA 2VQUA 1Q94A 1GH7A 3D25A 3FN0L 4IIQB 4I3RH 2AK4D 4OKVB 43C9A 7FABH 3VE0B 3MRQB 2E9WA 4JDZA 4U0RC 2DTMH 1KLUB 3DUSA 5F8QC 5JOPE 1EFXA 2FL5B 2R29H 1HKLL 3EJZC 5HI5D 4PGCA 3EYOA 5C6TL 4HS3B 1QRNE 2BHZA 2EIDA 4GAJH 3DNKA 1QBBA 3N1GC 2JJVA 1FH5H 4I0PA 15C8H 4DOHB 2EYTB 2VDKH 1FC1A 2Z31A 5C08B 4P2YA 4BQBA 1XCQB 5I18L 5BS0A 1KG0B 2R2EA 1FVEA 4UT7H 1EAPA 4N5ED 1NCWH 1T66C 4HGKC 3VXUD 3GKWL 4PJFF 1WLHA 4KUCD 1OARH 4GKZA 4KHTL 4JAMA 3EUUA 1BM3L 2GJ6E 3BT2H 3IDIB 3IXTA 35C8H 2UUDH 3MR9A 2PXYD 1OSPL 2FECL 1I85C 3Q1SH 5F3BA 5INCB 4H0IA 5DVLA 4M1GH 5JPNA 5DJZB 2MCG1 5BJTA 3O81A 5CUSL 5F7MC 5C0IA 4PRIB 3R06A 4LVNC 3ARUA 2APBA 2CSPA 1L6ZA 3MRIA 3AREA 4C58B 1RUPL 4EXKA 5D6DC 1U3HA 3DXAB 3ZYOA 2VITB 1QA9B 4GRLB 4B7IA 5DMGD 4X83A 1T83A 1MHPL 2CLRB 2IG2L 1ZSDB 5ENWB 1Q9OA 3G6JB 3MOBL 3IETB 3EOBB 4XP9L 3Q3GA 4FABL 1YPZF 4IM8A 3P9MA 5IFHL 2P24B 1S7VA 2R1XA 3PGFH 3MBXH 1HHHA 3D3VE 1T20B 4U1IA 5J11B 5GXBB 5ESQB 5DJAB 5TF1H 1XGUA 5CIPH 3TZVA 4EI5B 2ITCB 2UY7A 3SDAC 4ZSOB 1DANU 3KPSD 3RIFF 2UZXB 3JTSB 4UIMA 4WI4A 1H3UA 5JZ7C 1C16A 4PJ8D 5DFWH 2H1PH 2YC1B 2AQ2A 2ZKHL 4XMPH 2NZ9D 4R8WH 3GM0A 2DMKA 1QBML 3MV9B 1FL5B 3MLWL 4HMEA 1YMMD 3OZ9L 4TQEL 3VG9B 1P69B 2Z93B 4MNGB 4JFFA 2BNRB 3L5XL 2AGJL 5TE4L 3BSZL 1AC6A 4EN3B 3IU4H 3RL2B 1UXSB 5JW4M 1P4LA 1Q72L 2LABA 4PJGF 1UFUA 3NZ8B 2VL5B 4OLXL 1Q9KA 3IXAB 3QIUB 4K7PL 1U95B 4G7VL 2X4RA 4P5TA 3VMNA 4X4YA 1NSNH 1AO7A 4XHJC 4FQQB 2BVQA 2RCSL 3UTTB 2GKIA 3F58H 3TPUA 5C08D 4EKXA 2P5EE 4YIQB 2BC4B 1M05A 4X9GA 1G0YR 1NGXB 1WISA 3G5XA 1KBGH 3V5KB 4NKDA 2OZ4L 5FKAA 3BH8A 4IRSA 4S1DD 5EU4B 3BOVA 4C56E 4D94A 5MHSD 3U7YH 1AR2A 4QWWD 3QEUB 2X4TA 4G9DA 3NFPB 4G6KL 3KDMA 1CDJA 2VQTA 1WC7B 5ANME 2A6IB 3IVKA 2QSCL 1MEXL 3PG2A 1T4KB 2AEQH 4QRRE 1NQBA 3D69B 4OFVA 4X80L 1NGYB 1K5NA 1MHCB 3PWPE 5SWZE 4NUJA 3STBA 3QPXL 3MRPA 4I48B 1T1XB 5DHYB 5E70A 3AAZA 1UM4H 2RHEA 4UZGA 5IB4A 1BOGA 5I9QB 4DK6A 3GSNA 3DXAD 4F57H 2ZSWA 2FX8H 5D1XA 4FFYL 5GRZA 4U2YA 3S96B 1CFTB 2LU3A 3WLWD 5FYJL 3T2NL 1OF2A 3PWNB 2QLVB 1BECA 3CK0H 5KN5B 4OFYA 1KLGA 4IOIA 1YN6B 5FKPB 4MZ2A 4EI5D 4LOUD 4X4MA 4MA7L 3VWJB 3LH2H 3KYAA 3TN0A 2ADGA 2J8UE 3VW3L 1WCBB 2W59A 1Q9WA 2OBGA 1R3KA 2YBRA 3AB0B 5IJVB 3U0PA 1AXSB 1X5KA 4PJ7A 1J8KA 4RWYL 4XP1H 5IMOB 3MV9D 1S5IL 4L3EB 1MNUH 1XEDA 3TBSB 2ICEB 4PJBE 2WWMD 1DQQB 1HYRC 3UAJD 1V7MH 2ICWJ 3ES6A 1LEKA 1A6ZB 1OAYL 1TMCB 3NCBB 3QFJD 4GLRH 1JF5A 4JVUA 1JMXA 3QIUD 5I19L 2N1KA 4LCUB 2QR0B 1J8HA 3WXWH 3D39E 1EMTL 5J7CC 5MENE 3IU3B 5KSAC 1IGMH 3MLUL 4Z7WB 4FG6D 4NGHH 3RIAF 3DSFH 3RWIB 2CLZB 5IKCA 4OCWL 1JWUB 1H15B 2ADJB 3GJEA 2DAVA 3TJHC 2VXTL 1A47A 5IF0B 3QUXA 1Q0XL 1QHOA 4KRLB 4N0UE 4GJTB 2UWEE 5CS7A 4YUEH 3I6GA 1AY1L 4BKLB 3CVHL 4M6ML 1YC7A 1T3FA 5CGYC 1BEYH 4K9EC 4KUZL 4OIIH 4PR5B 4YO0A 4TVPH 2DQCL 4G6AC 1HSBB 5C2BL 3U0TA 5L2KB 1QNZL 3O2DL 2DRUA 2FGZA 4JO2H 4MLSA 4ISVA 3QH3A 1BQHG 4X98B 3QI9A 1XH3A 2HTLD 4YXLH 3AFLA 2ZOKB 3RDTB 4Y5XB 1FO0H 4R26L 1IQDB 1SJHA 1RJLA 3FO2A 1NUFA 1HCFX 3TH4T 5L8KB 1WEJL 3C5ZC 1FNEA 1XR8A 2EYSA 2PNDA 3EFFA 4LFHD 2VZSA 5ADOH 2FO1A 2Q8BL 2J6EA 4TYUA 1ZKAA 2P49B 2R1WB 1S9KC 3LVEA 3SGEH 1YEIH 2D0GA 4YDVA 5D4QA 3LV3A 3L5IA 2ADFH 4Y2OA 25C8L 3HMXA 3DJ9A 3KPNA 3ARDC 1YA5A 3MV8A 3TT3L 2BVPA 2CPCA 4Y19A 5HYQB 1BJ1H 2JJTA 3JV6A 4F58L 1RFDL 1INQA 4L8DB 4YHPA 3WN5B 3IYLW 5GRUH 3VFWB 1WTGT 4IBLT 1GRWA 3OKNA 1EHLH 3DV4B 3I2CL 2PO6B 2E27L 2ZG1A 4JQIL 5B3JF 2WIMA 4YHLH 2VLLA 1QD0A 4Z0BH 4LLVB 5AAMA 4ESKA 4OLZL 3BYYA 3TJEL 3JUZA 4NC2B 3RVWD 1X7QB 2JF1A 5DJCA 1JHTB 5DJ8A 3F6LA 2WMPA 5ALCH 1LMKA 3RP1A 3MLPA 1R5IA 3VFUB 5I2IA 4YFEA 2F5AL 3CC5B 4DQOL 2LAAA 5JOFB 3ZYJA 3LEXA 4GXVH 2VLKE 3ZDXF 2ADIB 3QEHB 5CD3A 2VSDA 2VSCA 3QUMA 3E3QE 4NQED 1NGQL 4RDQF 1LO0L 3BESR 1KJ2L 5I8EA 4HBCL 1UVQB 1FZKA 4ODUB 4Q9RH 1P9MC 2AABH 1CIUA 4E0RA 3NZHL 4BZ2H 5JDJA 3NA4A 4W4OA 4WV1C 2X5PA 2R8SL 2V5SA 3BPCA 4Z7UF 1FZOA 4NZRL 3CSYB 3EHBC 1ZTXL 1ONQA 3JV4B 5L2KD 3U9UA 2UUDK 3FB6A 3V5HB 2R4RL 4FQXC 4LLDB 4I5BA 4JJ5A 4CN6A 5I1JH 5KS9B 3J8F7 4ELMF 1U8LB 3DVFA 3EYUH 5IW6B 3RVXC 1KEMH 3FRUB 4LLUA 4EOWH 4X5WB 5DF0A 2R0ZL 3CDCA 1FQ9C 1JWSA 2P46B 4KRMB 2VC2L 3VGGA 1YEEH 4OAWA 4XBPB 4KV5E 4FXGB 3MFGB 1JZ3A 5EOTB 4LAJH 1D5IH 1HH6B 5B3NA 5CEXB 4MJIA 3QQ4A 4L8BA 4M7JL 4UT9H 3QNXB 4U1HB 4UV4L 4HUWA 3BP6B 3MFFB 3C9NA 3VD5A 4DTGH 3ULSB 3PQYA 2HKHH 3IJHB 1YYLL 1L7IH 3MUGA 4MXQD 3GI9L 2FH6A 1XAUA 1OGTA 4G8GB 1GZQB 1IE5A 2VXSH 4KTDH 2F74B 3UP1A 1LP9A 2VDLL 1EPFA 1ULVA 2IEPA 5HHMB 1X3DA 4OCNC 4LLMB 1FZJA 3LS5L 1IC4L 5K9KA 1AKJB 2UYLB 2EEDA 3MV11 5HHXL 2XQYK 2AXGA 4KKBD 2VISA 1NLDH 4XCYA 1JE6A 2IAND 1R3HA 2EDRA 2HLFC 2R9HC 2XWBB 3SDXE 5FEBA 2FEDD 1JGVH 1J1XH 2A38A 2B20A 2M8XA 4ZFGH 4JRYB 4DGYL 2P8MA 1DLFH 3LKNB 3MREB 4UT6H 4FTVE 2C3GA 2QADB 1HE7A 2BRQA 4ZQKA 3HAEB 3SE9H 4PD4J 4A2MA 5B4MD 1YYMH 2G75B 3LMJH 3E0GA 3HI6H 2Y36L 2FLRT 4Y16B 3FFCD 3FB7A 3SDCC 3KWWA 1X5YA 2GTWA 5F89B 1ES0A 3FAWA 3UJJL 1Q94B 3KJ6H 43C9B 2OTPA 2I9LB 3DURA 4OLVH 2Z8RA 4JDZB 1E4WL 3DUSB 1VEPA 1UA6L 1EFXB 4JFQA 4OF7A 3WCYA 1UACH 3MUHL 1JRHH 3V4UH 4PGCB 3EYOB 1IC7L 2ARJA 3D0VA 1OAQL 1BIHA 4PP2A 2X09A 2F19H 4NKQB 1RIHL 4I0PB 1RZFL 3U9PL 4GRLC 5BRZD 2Z31B 1JNNL 1YY9C 4PYHA 5CEZL 4R0LA 3TYFA 2D4FA 5BS0B 5CP7A 2R2EB 1CTOA 1FVEB 1EAPB 3LRSA 3MOAH 2AERT 5J11C 2Q20A 3IGAA 4GKZB 4JAMB 4G7YL 3CFEA 5SWSE 4XVUC 3V2AR 3IXTB 3CCHA 2X4QA 5FYLE 1VGKA 3MR9B 5GHWH 4D0DA 4RIRA 1YC8A 4Y4HA 1TCRA 3LQZA 5CJXC 4MA8L 5JPNB 1F4AA 5AYUL 2VR9A 2E8YA 2FEEL 5GRJH 5BJTB 4POZC 5C0IB 1L0QA 5IQ7L 3GHEH 3R06B 2VZ1A 1K6QH 4KKCD 4X7SH 1LEIA 3MRIB 3AREB 3UXFA 5FAAA 2JKXA 2NX5E 5HHNA 1U3HB 2R2CA 1CXEA 1LO5A 2ED7A 5KOVC 3WFEH 4ZNCD 3JV0A 3INUH 3UC0L 3IDJA 3MCLL 1FFPA 4C4KO 1Q9OB 2WUCH 4YNYA 1XGYL 1N6UA 3KPPA 3Q3GB 4G5ZL 4XC1L 3PDGA 3LCYA 4XWGH 3P9MB 1S7VB 2R1XB 4NHCH 1HHHB 4U1IB 2AJUL 4LP5A 1F02I 1DN0A 1XGUB 3T8XA 3TZVB 4JRYD 2AJ3A 2OL3L 4CMMA 2DS4A 2OS7A 1WVZA 6FABL 1IKFH 4IRZH 1TJIL 2QADD 2Z4QA 3AU1A 4UIMB 1NDMA 1K9TA 2LAGB 1C16B 4K3DH 3O2WH 2ORBL 1KFAH 4KH2A 3OJDA 5BCAA 1DEDA 4WW2F 3RAJH 5KZCB 1Y6MR 4Y16D 1MSPA 4JFFB 4QHKI 4PBXA 3QAZB 1AI1H 1P4LB 4HK3J 4LK4A 1JPTH 5DRWA 1ED3A 2AJSH 3ARVA 1U8KA 3TYGL 1Q9KB 1IEHA 4OFPA 3SDXA 2X4RB 3H0TA 1EFXD 4P5TB 4X4YB 1AO7B 3FMGL 4MQTB 4TOYL 2BVQB 4XAKD 3D5OF 4UTAH 5LWYL 3S34H 3O3DA 4U05A 4I0PD 3MJ9H 1NMAL 5JMRA 3TPUB 1P5UA 2Z31D 1UKQA 4P2OC 4N0YL 4RMQA 2DIBA 1M05B 5BS0D 3IKKA 4JO1H 4NOFA 3WFBH 3G5XB 4LCIH 2K1MA 1DCLA 3ULVF 4NKDB 5FKAB 3BH8B 2NY5L 5DUPL 1QYGH 4FZ8L 4IRSB 1X5AA 5AZ2L 1A1OA 2ESVE 2YXFA 2X4TB 4HCRL 4G9DB 3CD4A 3KDMB 1N2RA 2BDNH 1J88A 1IKNA 4G8IA 2I26N 3IVKB 1R6VA 1CXHA 3KLAA 5E2UH 1IBGH 2F8XC 3T08A 3BRDA 5E5UB 2AJVH 4AM0A 1K5NB 2WUBL 3KNBB 3LRGA 4NUJB 4GMTL 3WV0A 3MRPB 4LVOB 3AAZB 3BFOA 3ARED 4DFIA 5IB4B 3W39A 2YPLA 1BOGB 3V0WH 3HPLA 3GSNB 3HB3D 1MFBH 5E8DH 2ZSWB 3GSUA 5FV2A 5D1XB 4Y5YA 4TSBL 4MMXC 2DWDA 2W92A 3JVGA 3S4SG 4KK6C 1OF2B 4WGWB 4ODTH 2P4AB 3P9LA 4PJ5E 1CWVA 3V7MA 3EJYD 2EC9T 4JPWH 1KLGB 4U7MA 4JFHE 3QDJE 5DVOA 4IOIB 2HH0H 4GRWH 5HTSA 3P0YL 3TZVD 1A14H 4GMSL 1Y18A 4Y4KA 2LVCA 3TN0B 2ADGB 5GGVY 1VGEH 1Q9WB 1R3KB 2YBRB 4NZTH 3U0PB 1IT9L 4TSCH 3RPIA 1D3CA 3GEWB 4PJ7B 4KKAC 5ILTH 2DN7A 1XGQA 3BKCL 5JUEH 3UJTL 3RVTD 3LN5A 4P46C 1NUNB 5KG9A 5DUMH 4JFFD 3GIZH 5E7FA 2JB5L 1LEKB 3ES6B 4XWOC 4MQXC 1TZIA 1BFTA 3BZ4A 4H20L 3RDTC 2NXYC 3FQWA 1RK1A 1U2CA 1CLCA 1JVKA 4QHNA 4YX2H 1J8HB 4QYOA 3ZL4L 5GS1C 5GZND 1KJ3L 4CJ0A 3WHXA 5IKCB 5AAWA 3GJEB 1F8TH 5DK0A 1B9ZA 2DMCA 4KUCF 5AUMA 3UTPD 3SOBL 1U6AL 2NY1B 5HD8D 3V95A 3JWDH 1Q0YH 1N26A 3I6GB 4X6EA 4NO5A 5H8DA 3WO3B 2BNQA 3TBTA 5EO0A 1T3FB 1OP5H 4YO0B 3LZFL 3U0TB 1FORL 4YHML 5AZEL 1CFNA 3KYNA 4QHUA 4GAGL 1C12A 4JM2C 2B0SH 1OAXL 3WN5C 4ISVB 3QH3B 1HINL 4AYFA 1SYSA 5DEGA 5I1KL 1PSKH 2VLRA 3QI9B 1G6RH 5BVPL 1XH3B 2P47B 2PO6C 2KQNA 1UWEL 3AROA 4QHKJ 2BY3A 4XPTL 1QRND 3QDGE 1HK6A 1M7DB 1QLRA 5F7WC 3B9VA 1SJHB 1RJLB 32C2A 3FO2B 2HFEA 1U8HA 1QTYT 1FNEB 1EGJL 1XR8B 2EYSB 3EFFB 1MCDA 5HYIA 1AHWA 1QFHA 5FGRA 3DBXA 4YDVB 3DO3A 1KCVH 3LV3B 4MXVE 5GISL 2GJ6D 1YEKL 3KPNB 1MREH 5C0EA 1KCSH 1GOHA 3MV8B 3SKMA 4WI5A 2BVPB 4JO3L 4Y19B 5E2VH 2CKBL 3JV6B 4YHPB 1INQB 2BSSA 4KRPB 4LCYA 4U0QB 2FJHA 5EU7C 1ND0A 1JGUH 1SM3H 5CIPA 3OKNB 3QBTB 5CLTA 2DLGA 3ZTNL 1PKQE 2ICES 5MP6H 4XBGA 1KIPA 2IALA 4W70A 1F42A 2VLLB 3Q0HA 1J11A 3BISA 5JO5A 2A9ML 4RRPA 3DSNA 5DRZA 2KBGA 3S3PA 4XCCL 5DJCB 3GSQA 4PLKD 2GHWB 5DJ8B 3N1FC 1R5IB 5I2IB 5CEYA 2YKLL 3D3VD 4LSUH 4OGXH 3LEXB 4HEPG 3VFVA 4NKIH 2B1AL 4KTYA 4ORZC 4O2FA 5MEPA 4YHNA 5CD3B 3BD3A 3QUMB 4XMKH 4LCCA 2BVOA 3HC3H 5D7SH 5I8EB 5TE7L 1X5JA 4XPHH 4WFGE 3WFCL 1FZKB 3OL2A 1S8DA 1RU9L 3IFLL 3EFDL 4E0RB 3SDYL 3QUXD 4OGAD 4NM8H 1ZGLM 4HQQH 2WBWB 4WTZA 3BPCB 4RBPH 1FZOB 1TETL 5HGDA 1ONQB 3U9UB 2Q1EA 2DQIL 3FB6B 3LRHA 4TUKL 1Q9LA 4I5BB 2BX5A 4JJ5B 4G9FE 2CKNA 2MQ0A 3IDXL 2UZIL 2P1YA 3AS1A 3QI9D 2IAMC 1MWAH 5IVZA 2WBJD 4P9HL 2JCCA 4LLUB 4DKEH 5EUOE 1MRFH 1JWSB 1A6WH 4OAWB 4BSVA 4AQ1B 4OZGA 5CSGA 1DQDH 2GW5A 3MGAA 4L29A 5J3HD 1TPXB 1JHKL 3G6JF 4MJIB 2GFBA 3QQ4B 4L8BB 1QG3A 3VH8G 1KEGL 4OB5L 4A6YL 1ZVSA 4Q7DA 1OP3H 1E4XI 4ZUUA 4HUWB 1FG9C 3CMGA 3C9NB 3MXVH 2GEEA 3PQYB 3OKKA 2NMSA 3C6SA 5E5MA 5ICZA 3MUGB 5F7EH 4MYWB 1OGTB 1CDHA 3MBED 4LRIA 4N8CL 4AJ0A 4NWTL 2FWOA 3QDMA 5KJRL 3MV8D 1LP9B 3K2UL 2GK2A 1FZJB 4KRPD 1FFOA 2HWZL 5K9KB 2DBLH 3G6DL 2AXGB 2VISB 1S9VA 4UMGA 3WIIL 4XCYB 1PDKA 3NAAL 1YN7A 1R3HB 4ONOA 1S3KL 1L7TH 1TNMA 4KK5C 4JVWA 1OTUD 4AEFA 2VOTA 2P8MB 5JHLL 2A6DA 4JN1H 1XIWC 1QPXA 2W9DL 4QTIH 5KOMC 4ZQKB 3UBXA 5D70H 2DLTA 4K7FA 3BJ91 3SPVA 1H0DA 2FATH 5C0ND 1A7RL 1I3GL 1N8ZA 5KAQG 5GS2H 3FB7B 3KWWB 4XX1G 1XGPA 3I9GL 4JKWA 4R7DA 1KELL 2GTWB 3RKPA 1A6AA 4ODHH 4HW6A 1ES0B 4FQ1H 1HDMA 4UI2A 3QCTL 1TCMA 3P30H 2X9WA 1QFWL 5IT2H 3MRLA 1Z9LA 3DURB 4I77L 1QOKA 2CO7B 3QUZA 4JFQB 1T21A 2CQVA 1WSST 4NO0A 4UOJA 2ARJB 1T6WA 1HSAA 3D0VB 3TV3H 5D7LA 1EX0A 4OZHE 4PP2B 5CCKH 4TPRH 1BP3B 3ETBF 2NTFA 2RR3A 4LQ1A 5H37G 2QJDA 4KK8D 1T22A 5IW3A 4R0LB 3TYFB 4XPAL 4ZTPH 1F4XL 1JGDA 5CP7B 4OSUH 4JFZH 1C5BL 2NY5C 3LRSB 5I1LA 4GS7C 3U7WL 3QZWG 3CXHJ 3OG6B 5MEND 3CLFH 2M26A 3IGAB 2WQRA 1ZANH 1INEL 3MA9H 4MCZA 3CFEB 4JY4A 3CCHB 2X4QB 1IM9A 1VGKB 4D0DB 4RIRB 3IS0X 5AWNH 4JREB 2B5IC 3JZ7A 4Y4HB 2J88H 3SQOL 3MLYH 1FO0A 1TCRB 1S7WA 3CFIC 3LQZB 2C3XA 4MJID 3MV7E 4X4XA 5T33L 1JI1A 3O41A 1LEIB 5EO1A 4NFDA 4A2LA 3PQYD 5IFAH 3OQ3B 3HNVH 5HHNB 1CD0A 1LO5B 2HT4C 1DL7H 4U1NA 1G9NL 1CF8L 3IDJB 1FFPB 4DW2H 4HAGA 4YNYB 3NBNA 3KPPB 4P5TC 3V52L 5GGRY 1I9RL 3HC4L 3P4OA 4XCNA 1A7QH 3UYOD 4APQD 2O5XL 1MCIA 3LEVH 4PRHA 1DN0B 4OCSL 3T8XB 2AJ3B 4CMMB 4CL7A 4YBLC 4PJCA 1MY5A 1IM3A 4NRYA 1NDGA 4H1LG 1HHGA 5E99H 4G43A 2Z4QB 3AU1B 5GGRA 4ZNEA 1NDMB 3D48R 1F58H 4KJQD 1CXLA 4LGPB 4HXBL 2PUQT 2LVEA 3OJDB 3UPRB 3X3FH 1ETZA 4J8RA 4Z7WF 4XH2A 4FQ2L 4MJ5A 3DRQA 3OB0H 1JHLH 4FFWD 5ISZA 1LK2A 4OBSA 3MJ7A 3BD5A 3RU8L 2QQKL 5E1HB 2AJYH 5I8KH 5T1MA 1U8PA 2B1HL 5DRWB 1ED3B 3I75A 4Q0XL 1YECL 1U8KB 2IGFH 5DWUH 5K9JL 3SDXB 3H0TB 4S0SD 4F2MA 1AP2A 4NN7B 3TH3T 4LIQL 1ZVHA 1OAZL 2F53E 1BF2A 2FX9L 3O3DB 3I84A 5I17A 4UDTA 5D1XC 3IRZA 3NCEB 4OZFG 1MRCH 3QXUA 4NCDA 4XNXL 2FYYA 2CLVA 1CBVH 2ZG2A 1JL8A 3QXAA 2NXZD 1CFBA 1PBYA 4OM1L 3RUGE 4MB3A 1A1OB 1MH5A 3C09C 5L8JB 1X5LA 3NIGE 4ONFH 3LKSA 1N2RB 5HVHC 3O6LL 4G8IB 3TN0C 2QEJA 3S88H 1J18A 3KLAB 4Y4HD 5ICXA 5I8CA 2FDBP 2VTFA 3N1PC 4AM0B 1TJHL 4MNQE 4PGDA 3E2HB 2VDPH 1TQCB 1UZ8A 5EU3A 3BKJL 5M94B 7CGTA 3W39B 5HGHB 2YPLB 5H37H 3HPLB 1EVUA 2NY3B 3E8UH 3GSUB 4Y5YB 1I1AA 2JIXD 3FZUC 5CJOH 3GB7A 2DWDB 3KG5A 3WIHH 1KTKE 1HIML 3CGTA 3S36H 3DVIA 4Z7VA 1QFWM 4KK9D 1OW0C 3P9LB 1YNKH 4WUKH 4MNHA 4ZXBD 4TUJA 3KYKH 3CXDH 4PJFE 4F15C 1EEQA 4M03A 3UJIL 5FGBC 3MV7A 1Y18B 4Y4KB 4YXKL 4M1DL 2M2DA 3LQAL 4AEHH 3F7VA 3C8KA 4J7RA 5F7LB 3HLAA 4RGMB 5DJYA 5BQ7A 4NN5B 2AEWA 5IBLD 2NY1C 3RPIB 3HI1A 1V3LA 1AE6L 1I1RA 1RHFA 5DC4B 1XGQB 2Y07L 3CLEH 3LN5B 4N8VA 5KG9B 3QJFA 2DYPA 1AGDA 2Q3ZA 1J1OL 2DL2A 1YUHA 1EJOL 1NMCC 1RZKL 4YXHL 5TE6L 5L0QB 1TZIB 1KIRA 3BZ4B 4KGJA 1ZK9A 2X4NA 3DHJA 3ZO0A 1T03L 3NCMA 3FQWB 1RK1B 1T5WA 4QHNB 4TTDC 3T2PA 2Y6SD 2D7QA 4Q6IC 4QYOB 1N64H 2FD6H 4WEMB 1CK0L 2NR6D 4PJHA 4OIAA 3C5JA 4G6MH 4RBPK 1QUNA 3K8MA 5KBNC 3WHXB 2EE9A 3EGSA 4OUOA 5KS9F 2E8ZA 3OGCA 2IPUG 3MRFA 1QSEE 1WT5C 5DK0B 4ZFOA 4J1UA 5GZOD 2KL6A 5AUMB 3ILQD 1MQKL 4KVNH 1KTRL 5D7JD 4X6EB 4NO5B 2BNQB 3TBTB 1PKOA 2KPNA 3CSPA 3GSWA 5EO0B 4HFWA 3K8LA 1YZZA 4MMZC 1F11A 1IL1A 1CFNB 3EDKA 3KYNB 4QHUB 1RAMA 1C12B 4U1KA 3Q6GH 2I27N 3DVGA 2FGWH 3R0NA 1SYSB 5DEGB 5FHBH 2VLRB 2PKDA 3EYVA 4NC0B 2VZOA 2FO4A 1OP3K 4KGLA 4FOMA 1EXUA 3QA3A 2R0WL 4XNMA 1QLRB 4PJGE 1FN4A 1TJGH 3CX5K 5DFVC 5EOCJ 3H7BA 32C2B 3BHBA 2HFEB 1U8HB 1MIMH 2YPLD 3HTLX 1U0QA 4OZFH 2NY3D 5LJYH 3ARGA 1AHWB 3IFNL 3DBXB 1LDPH 3W9EA 3GBNL 3BDXA 3RY5A 3HUJE 3KPRE 1OM3H 5SWSD 3VD9A 5FYLD 4DKFH 4PJ9A 5DJXA 3RY6A 2MCPL 5C0EB 3O0RH 4Q9QH 3SKMB 1KTLA 1P4BH 5B39G 2HMID 3PL6D 4M62L 4LCWE 2BSSB 4MNQA 4LCYB 2FJHB 1ND0B 5CIPB 1W8NA 3N06B 2OXHA 3EOYG 5KVEH 1JFQH 3QWOA 3LKRA 2MWCA 2XTJE 2YRLA 4XBGB 1KIPB 2IALB 5DZNA 2NX5D 2APXA 2WLYA 5JO5B 2B2XL 4LASL 5DRZB 2D0FA 2PYFA 4UNVA 3WDHA 2HFTA 1WIPA 3DHMA 1FSKB 3GSQB 4GG6A 5CEYB 4PGZA 3H9SA 5HPMA 1ZXQA 2P8PA 3FN0H 3BGAA 3VFVB 5JXEA 4BFEA 4XP5L 5MEPB 4O2FB 1DUZA 3GM8A 5E8PA 4YHNB 1ZT1A 4HWNA 4PJEA 2UZYB 4G8FA 4YBQD 4LCCB 2BVOB 3N1QC 1HKLH 3L1OL 3D18A 5C6TH 3BKYL 3LY6A 3CH1A 4KJWC 5L88L 3P40A 4NKMA 2CRMA 2BRRL 1S8DB 4GG8A 4Y1AA 4X6DE 3RWCA 5HY9A 2HVKA 2NYYD 2EH7L 5I18H 3MJ9A 2X70A 1NBQA 1MCJA 3VWKC 4N1HB 1DQTA 4M7ZB 2BNQD 5ITBL 2HTKC 1UWGL 3GKWH 5HGDB 4KHTH 5I76A 1TZHB 1E4JA 4S11A 1BM3H 2DM3A 1Q9LB 4HIHA 4RSVA 4LPYA 1OSPH 5CD5C 5FYKE 3QEGL 2JCCB 3VU2A 5JW4N 3I6LE 4M93C 5C9KA 1NEZG 5CUSH 5MERA 4BSVB 2EIEA 3WE6A 4OZGB 1RPQA 3O45A 4R4FL 1GC1L 1NGWA 4L29B 1RUPH 2GFBB 5DD3L 1BOYA 1ZVSB 3VXPA 2QSQA 4ZUUB 2ESVD 1PVHA 1MHPH 2IG2H 2K7PA 1BFSA 2FLBT 3MOBH 3OKKB 3C6SB 5E5MB 5ICZB 4XP9H 4FABH 5IFHH 4N8PA 4HXAL 2FWOB 3QDMB 2W60A 1G9NC 1W72L 4Q6YA 5DJ6A 1JPFA 2PW2A 5ERWA 1FFOB 5IW1A 3WS6C 1KNOA 1S9VB 3OAYH 1YN7B 5DJ0A 4MAYA 3MLSL 2ZKHH 1GCFA 4PTUA 5T3ZE 3RX5A 1QBMH 3WFDL 3MLWH 2A6DB 4J3UA 3OZ9H 1RSFA 4TRPL 2PETA 4OUUA 4TQEH 3UBXB 2PF6A 2V9RA 3L5XH 2AGJH 4K7FB 5TE4H 3BSZH 3SPVB 4RGNE 1H0DB 4JANA 1Q72H 1N8ZB 1DLHA 4JFHD 3QDJD 4OLXH 1OQOA 4PJ8C 4K7PH 5D8JL 1Y6KR 4MB5A 1XGPB 4G7VH 5TGBA 5DQJA 4R7DB 3MLXL 1A6AB 3P4MA 5LGKA 4JREC 1HDMB 2D9QB 4PV8A 2RCSH 1KN2L 5HI4C 1REIA 4CAGA 3BGFB 3MRLB 2NY6D 4ZTOL 5C07A 3ZYZA 1CICC 2X4OA 3QUZB 1RV6X 5L7XL 3W5MA 1T21B 2WV3A 5SX4H 4G3YL 4NO0B 1A02N 1OAUL 1ZHLA 4FMFA 1HSAB 2OZ4H 5D7LB 2F54A 4X6BA 5B3JE 4H0HB 5HGAA 3HZYA 2NTFB 2A74A 1UB5A 3BW9A 4NWUL 1T22B 3S5LG 1U91A 5C3TA 5I15L 1JGDB 3MRKA 4D9RD 4G6KH 4JFEA 3RTQC 5GS0C 5TF0A 5I1LB 1DQLL 2QSCH 1MEXH 1HXYA 3NFSL 4LP4A 1FNLA 4MCZB 4X80H 4WIQA 2DJSA 3VXNA 4JY4B 3P4LA 1G6RA 4P23D 4L4VE 3TVMA 1IM9B 1F3RB 3QPXH 5EIQA 2ATPB 2NY2B 3ZDXE 3QHTC 4NHUA 1A7PL 1FDLL 1KUMA 1FO0B 1S7WB 2QHRL 5JQ6L 1OB1A 4X4XB 5J89A 2NY0B 3EW3B 4FFYH 3AMLA 3O41B 4HIXL 5EO1B 1UM5L 4ENEC 1BIIA 4RMRA 2YUWA 5FYJH 3L7FA 3T2NH 2V5YA 2V17L 3FCTA 4D2NA 4U1NB 1L9MA 5FECA 5IK3A 4KKLD 3V6OA 3QIWC 4Z7UE 4MA7H 1M1SA 1G7PA 4UAOB 5F93C 3VW3H 1KF9B 1A2YA 2DQDL 3HFML 2DD8L 4ELME 3P4OB 4XCNB 5J1SC 5BOZG 4PRHB 3LQAC 4RWYH 4J3OC 5CHNA 4PJCB 1IM3B 1S5IH 1W0WA 2GAZA 4NRYB 1NDGB 1HHGB 4JZJA 5D2NA 5KSVA 2XY1A 4G43B 1QFUL 5GGRB 1HHJA 1OAYH 4CADA 1ETZB 1X5GA 2X4SA 1FAIL 1OT2A 4J8RB 2EDWA 4XH2B 4MJ5B 1G7LA 3DRQB 5I19H 3S4SA 1NH6A 5ISZB 1QSFE 1LK2B 5F6HI 3MJ7B 5ACLA 5BW7A 1EMTH 3MLUH 5T1MB 4FZEL 1LE9A 1U8PB 1AC0A 4QOKA 3T0AA 3I75B 4OCWH 5K93A 5F9WB 1RUAL 4JQXC 2VXTH 4W6XB 4F2MB 4HIIA 1AP2B 5GJSL 1Q0XH 3BWAA 2P45B 5D7LD 1AY1H 3HS0A 3BPNC 1HNFA 3CVHH 1UB6A 3D2UA 4M6MH 5I17B 1DVFC 4UDTB 1CDYA 4KUZH 4Y5YC 2DQCH 2GY7B 5HVWA 5C2BH 3P3YA 1W0YT 2ZSVA 4B0MM 1QNZH 2YD6A 3D85D 2FYYB 5JNYA 2CLVB 3O2DH 4TVPD 5IWLC 3W0WE 4XP4L 3QXAB 4XNUL 5ICYA 4GW5A 1WWCA 2YR3A 4KXZH 5C0CA 1MH5B 4R4BA 5C0BA 4YK4C 5GRVL 1PJ9A 4WFGD 3SDDA 1MWAA 1IM9D 3LKSB 2NY2D 2YEZB 4R26H 5ICXB 1A3RL 4S0TD 5I8CB 1WZ1L 4ZD3L 4PLOB 2E5EA 1WEJH 3ULUL 4PGDB 2NY0D 2Q8BH 2XICA 4LMQI 5IVOA 5DK3A 5I30L 1UZ8B 5EU3B 5LGJA 4GKNA 1MELA 1IGIL 25C8H 3P9WB 2NW3A 4X7CC 1I1AB 3TT3H 3GB7B 3KJ4C 2XN9A 4M6NL 1S7SA 4F58H 1RFDH 2OI9C 5CINL 4Z7VB 1VADA 1GGTA 4MNHB 1FAKT 4TUJB 3I2CH 3WEXA 2EKSA 2E27H 1N59A 4JQIH 5ALBL 3ZKND 1NANI 5D1QD 3H7LA 2DI9A 3MV7B 2DOCA 1DDHA 5EDXA 3FB5A 2JJSA 1OL0A 3F7VB 5JMOC 3C8KB 4JO4L 3HLAB 3OBAA 4OLZH 3TJEH 5DJYB 1FPTL 5BQ7B 4M7LT 3HI1B 3CX2A 5GGSY 5DYOA 1GGCL 2F5AH 1QR4A 4DQOH 2ERJC 1J0JA 5EZOL 4N8VB 3QJFB 2DYPB 1AGDB 4LSDA 4MDJA 1HWHB 4FQJL 1X4ZA 3LPGA 1HKFA 5IBUG 1NGQH 5GGSA 1LO0H 1YUHB 2JELL 1KIRB 2XIDA 1KJ2H 5IOPA 4HBCH 2X4NB 5J1TC 3DYPA 1T5WB 2DQFA 4U7KA 3CFBA 5ITFA 5K33A 1GGYA 2DLIA 3NZHH 4PJHB 3SO3C 3C5JB 3FFDA 3VDAA 2R8SH 3EGSB 4HSQA 4XC3L 3L3OA 4ZAKD 3OGCB 3SKUD 1FL6A 3MRFB 4NZRH 4XVSL 1ZTXH 4NRXA 4ZFOB 5C9JA 1DBJL 4J1UB 4JRXE 4KDTA 2Z35A 2R4RH 2EC8A 5KVFL 4J4PD 3OKMA 4NO3A 3U4BL 3IDGA 3GSWB 4HFWB 4G80A 1F11B 1IL1B 2X89A 1CS6A 4U1KB 1I85A 2R0ZH 5HHQA 3DGGA 1H3VA 3DVGB 2EECA 1KXQE 2W0PA 3WBDA 2VC2H 5I71B 5EWIL 2DLEA 5HVFB 3EYVB 4PG2C 3SCMD 3HNSL 5F6HJ 4YQXL 4N9GA 2FO4B 2YD5A 3QCVL 1EXUB 3QA3B 4R2GD 4M7JH 4XNMB 1QHPA 4HS8L 1FN4B 4K3GA 4KFZC 4UV4H 3H7BB 3O4OB 3BHBB 1U8JA 1D9KC 2BERA 1GC1C 5D6DA 1LP9F 5E9DA 5J8OA 1I4FA 4BJLA 1MY7A 5TDNA 1YYLH 5D96B 4JJHA 1JPST 4W4NA 3GI9H 2GSGA 5FK9A 3ARGB 4F3FA 1I1AD 3W9EB 5EUKA 1DZBA 4OCMC 2VDLH 4JFDE 2AP2A 5F88A 4JHWL 2VDOL 3LS5H 5IB1A 3OAYK 3UYRL 1DQML 1IC4H 4PJ9B 5DJXB 4BA8A 5HHXH 4OD1L 3ULVE 5TH2A 1U8NA 1KTLB 3SDAA 3MV7D 3DI3B 4MNQB 4DGYH 1EV2E 2L7JA 1JZ7A 3IDYC 1JZ5A 5FOBA 3MJ6A 3QWOB 4NPYA 3LKRB 4WRLA 4YPGA 4M7LL 4JN2A 4M7ZC 3VH8A 4BQ8A 4QRSA 1MCFA 2Y36H 1TDQA 2PYFB 4RDQG 2A6KA 4HULB 1WQVT 5E4IA 3HI5L 4GG6B 3UJJH 1IGCL 3H9SB 5HPMB 2P8PB 1WAAA 5ESVA 4MQ7A 4GW1A 4XXCC 5E8PB 1DUZB 2ID5A 3A6CL 1ZT1B 1TVDA 3IT8D 4PJEB 1Y0LA 1E4WH 4G8FB 2NY4B 4YAQA 1UA6H 1JF1A 3SJVA 2DQEL 1IC7H 3D18B 4JB9L 1S78D 5EU6E 3CH1B 1OAQH 5I1HL 4MA1C 4NKMB 4M4RA 1RIHH 3U9PH 1RZFH 4GG8B 4Y1AB 3SE4C 1JNNH 3RWCB 5HY9B 1PX4A 3TBWA 5CEZH 1A1NA 3MLZL 2X70B 4P0DA 3O6KL 4IOFC 3WSQL 3KPLA 2BP3A 3OMZA 4LRIC 4ERSL 5I76B 4G7YH 5JOEA 1CXKA 4P2RE 4HIHB 4ODVL 4NCC2 1H3XA 2AK4E 4LQFL 3HRZA 1G9ML 4UV7L 1U3ZA 5EH1A 4MA8H 1UJ3C 2VL4A 5AYUH 5L6YL 4LKCA 5MERB 5I75B 3WE6B 5IQ7H 2EYRA 3O45B 4HJ0D 5LBSL 1NGWB 3OKLA 4J6RL 5E1AA 1KPVA 3PP4L 4KVCL 3VFTA 1KTDA 3L7EA 3VXPB 4KV5F 3UC0H 3FKUS 2BXZA 3L5WA 5EBGA 3MCLH 4KZEL 2HT2C 3S37L 1Q38A 1XGYH 2AAVA 4PJ9D 4FP8L 3EBAA 4G5ZH 4XC1H 3WIHA 2W60B 2AXJA 5DJ6B 5DZOA 2AJUH 1JPFB 2FBOJ 2PW2B 4MNQD 1BAFL 2OL3H 5ERWB 5H35A 5IW1B 3K4AA 6FABH 4RISL 4GRWB 2P8LA 1TJIH 4OZIA 1KNOB 4HG4J 4NCC1 3ARSA 4JGUA 1MOEA 5DJ0B 2APTA 2GITA 4MAYB 2ORBH 2Y7QA 3CZJA 4AL8L 3NCJL 1TFHA 2H2PD 4PTUB 1MCHA 3ALWA 3PGDA 5J12B 1RI8A 4OUUB 1DJSA 3T0EC 3VG0L 4KZDL 4NJ9L 3SDXF 2FIRT 2IFFL 4R90L 1VERA 2YRZA 3H9SD 3ET9F 1L9NA 4JANB 1DLHB 3HRPA 3TYGH 4ETYA 3O8XC 5TGBB 2NY4D 5DQJB 3WKML 1T1ZA 3P4MB 4IEFB 4HK3N 4TULL 3GSVA 3FMGH 4PV8B 4TOYH 1KCKA 4CUCA 3O9WA 5LWYH 4JQVC 1SEQL 3KPSE 5C07B 2E7MA 1NMAH 4Y1AD 1CLZL 2X4OB 2EXYC 4N0YH 4R7NA 1LQSR 3OWEA 1EO5A 1ZHLB 5DR5L 4EUPG 2NY5H 1YMME 5DUPH 4FZ8H 1FP5A 2F54B 4X6BB 5AZ2H 4LVEA 1V3JA 5EBLA 5HGAB 4LPVA 2A74B 1UB5B 2D2OA 3BW9B 3EOTL 1U91B 3BD4A 4HCRH 2C3WA 3MRKB 4JFEB 2DQHL 5TQ2L 1SJXA 4LLAA 4UAOC 1UG9A 4L4JA 4Q58C 4J23A 4QHLA 5E08L 1HXYB 1T6VN 3VXNB 2WUBH 1G6RB 1U9KA 1H8NA 3TVMB 4GMTH 1BMGA 1QSED 3C5ZA 4NHUB 3BDYL 1YEJL 3D1MC 4P2QA 4DOHE 3ULUC 1WWAX 2HKFL 1EVTC 1OB1B 2DICA 3B9AA 1DTUA 5K9QI 4TSBH 4OZFA 3QYCA 4FS0A 1BIIB 1UWXH 4OLWL 4UNUA 4FQHA 5MHSE 3L7FB 3ARDA 3FCTB 3CH8A 2ZUQB 5FECB 4X6FA 3GMNA 5IK3B 2ZUWA 2MHAA 5E2WL 1NCDL 3P0YH 1P7KA 3B2UC 4GMSH 2K9UA 2DKSA 5GRXG 1BVZA 1A2YB 3ARTA 4NBZB 5EU5A 1IT9H 4H25A 4PRIE 4XXDA 4M6AA 2Y4SA 4AK1A 2W1NA 1YEGL 4W81A 5CHNB 1WIUA 3BKCH 1W0WB 2AEPL 2GAZB 3UJTH 4XCEA 4JZJB 4GRMA 3DXAE 5D2NB 5KSVB 4S1RL 1WITA 3KPRD 1QP1A 5DDHA 1HHJB 5BO1L 2JB5H 5CILL 5F96L 1OVZA 3G6JE 1WBYA 4MJ6A 4CADB 1NCNA 2X4SB 2COQA 5IHZA 4H20H 4KQ3L 1G7LB 3S4SB 4LCWD 1XF4A 5C09A 4KTEL 3ZE1F