5AEAA

Crystal structure of human ncam domain 1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
100
structure length
100
Chain Sequence
LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords NEURAL CELL ADHESION MOLECULE 1
publication title I-Bodies, Human Single Domain Antibodies that Antagonize Chemokine Receptor Cxcr4.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5aeaA00
5I73B 1F90L 1HYRC 4KMTH 5CMAA 1LEIB 4TVPE 1AKJA 5HGGS 4PJ7E 4HS6B 3L7FB 5KVGL 1IGTA 1RJLA 1MJUH 3U7AA 1P4IH 2N56A 2CDGB 1T2JA 1XF3B 3QWOA 2EEDA 2E8YA 1S7UA 2D7OA 2OL3A 3MACH 4G6AC 1Q72H 3TBWA 2W9EH 4NP4H 1U58B 2YD2A 3BAEL 1KEGL 5IFJA 3B83A 5IWLC 1KELH 1OGTA 1U91B 3B9KD 4LVOC 3SCMC 2DI8A 1YECL 1MVUB 4WUUD 4Y19E 1NJ9B 2VAAB 4WO4D 3S3PA 2H9GB 4V1DD 1D5MB 3VRIA 4NQUA 1UWGH 2K7PA 1X5ZA 3KNBB 3QUYC 5FK9A 3EJZD 2WAHA 1BECA 4K7PL 4OCWL 5BVJA 2EYSB 1ZVSA 3RWDA 5TPWL 4HULB 1XIWC 1OLLA 2E7LC 1QSFD 4HK0B 5DI8A 4PJEB 2IAMC 3V5HB 2EIDA 4XXCA 5DRNA 3B9DA 2DQGL 2CIKB 5TDNA 3DVFA 2HLAA 4UV4L 4UT9H 1JWUA 1OAXL 1HXMB 1UVQA 5AD0A 3PL6A 4LCIH 1H3UA 3CH1A 5C92A 1OPGH 3HE7B 3LB6C 4DEPB 1LP9E 1YNLL 2L0DA 4OQTA 5KS9F 4XNZB 3CU7A 2VL4A 3GSWB 2P8PA 2NXZB 3U0PB 5KG9B 5FYJU 2VDML 1NAMH 1NFDA 3FL7A 3FRUA 4GRMB 4OD1L 1MFEH 1QUNA 4Z76A 2AKRA 2QQNH 3D69B 4PYHA 1RPQA 3U9PH 3PWJA 5D70H 3ESUF 5FKAA 4LIQH 3U36A 4D9QD 5ALBH 3A6OA 4PRAA 1VEOA 2M8XA 5I8CB 3MUJA 1RJZB 1Q1JH 3QO1B 4L5FL 4XP9L 1BVKA 1NCDL 4O2FB 4NFDA 2ADIB 1ITBB 1OP5K 2E27H 1UH2A 5I15H 5E1HB 1MFDH 3LKSA 3QIWB 5JTWA 2HH0H 3GHBL 5HYFA 4GS7C 4HPOH 1JYXA 3CC5A 5TE4H 1PYWB 4IRZL 1FDLL 1NAMA 3KDMA 1JPSH 2EDRA 2JB5H 3MNZB 4FP8L 4ETQA 3T4YA 2E7HA 4O51B 2ADFL 4IS6B 3ARRA 1OL0A 1QPXA 4I4WA 2ZZUT 3EAKA 2UY6A 1B2WL 3ARDB 4JPKH 3DX8B 4Z7UF 4OZHA 4FXGA 2N1KA 2GK0B 4G6JL 5L2JA 4PJXB 3CK0L 1LO0L 3U7WH 4MJ4A 2PTTB 3QUXC 1E4XH 3PL6D 3S96A 4QWWC 1QFHA 1YPZE 3I9GL 1OAZL 2Z8WC 4N90E 4XNYL 1ZGLB 4RGND 1A0QH 5K9KA 3TNNB 1UWXK 1GHFL 4WFGE 4P9HH 1IGIH 3QIUA 5CUSL 5E4EB 1SQ2N 1HQRA 4IIQB 3GM0A 4YDVB 3LKNA 4NNPL 2PCPA 4PLJC 5AZ2L 3RU8H 2UYLB 2ENYA 1KCVL 1GIGL 2JF1A 5C0EB 12E8H 4ORGB 3ARQA 3C8DA 4JFHD 1AJ7L 1IC7L 2W0FA 3BP7A 4C59B 4XHQA 4KZEL 3RL1A 1MIEH 2DQJH 3HMWH 4N1HB 2XRAL 1CTOA 4WWID 3G5VA 4DN4L 3VFWB 1BQHA 3MRNB 4R4NC 2W0LA 3MC0A 4HUUA 3GB7A 4PJ7B 4JN2B 5C70A 3B2VL 5JO5A 4XMKH 2FEDC 3QUMA 4R97C 4DEPC 4IOFD 2VLME 4MHHI 4ORZC 1YJDH 1EA9C 1MPAL 5HHPB 1FZMB 4RFNB 1RZGB 4GKNB 3RAJL 2B8OT 2DIBA 4X6CA 3VD9A 4WU7A 1IFHH 2GK2A 3HFMH 1JE6A 3R4DA 3V5KA 4CMHB 1CR9L 1NGYB 5JW5A 5HI4D 5FGBC 4DCQB 4GKSB 4CMMA 1E4KC 5DJ8B 5HGAB 1HHJB 4HFUL 1NKOA 5LWYL 3BX7C 4Y19B 4K2UH 2GAZA 2UUDK 4GAGL 4OCRL 4YNYA 4PJBF 5HDQL 4NKMB 3IRPX 4Q9QL 2KH2B 1TJHL 5DEZA 5HYQA 3QXAA 3QIUD 4JO2H 2AJVH 3DX7B 1H5BA 2WBJB 4LHUA 2O93L 3ECBB 1MNUH 3EUUA 2W65B 5LAXB 3MRPA 4JFOA 4UZGA 1G6RA 1KXQE 3AS0A 4NO0B 1BBJB 2FX7L 1CE1L 4RMTA 2DM4A 3ROLA 3I6LD 3KPSA 2J3SA 2NY5H 5CEYA 3VJ6A 2UVEA 5C2BH 1UYWL 3WEXB 1XGQA 2EIZA 1OGAD 1LP9B 1S7WA 3MLZL 3TO4B 3UTQB 5ITFB 4X0KA 1OAYL 2GSIB 3WIHH 1OSZB 1FNEA 4W4NA 3X3FL 1JFQL 1HDMA 4L29A 4XMPH 1U8HA 3ARFB 4TSAL 2VLLB 1NC2A 4S1RL 1K4DA 1XF4A 3QHZH 4UB0L 3SKNB 1U9KA 1DUYA 2DQDL 3UYRL 5D7JC 2EC9T 1ZAGA 3O3DA 1MJ8L 5SWSD 5IB5A 3HUJA 5IT2H 4RAUB 4NYLA 2NCMA 4IMKA 3VA2C 1P9MC 1JV5A 2BK8A 3HAEB 5D5MF 5E8OA 4XWOC 1BPVA 4I0PD 1A1MA 5E1AB 3WE6B 3KJ6H 4BA8A 1IEAB 4MA7H 1KJ2L 5BJTA 1V7NL 4LSTL 4PTUA 3UZEA 3ZTJH 5MEPB 4NDMA 1IAKB 2J88H 4IRJB 2O61A 1F90H 3WLWC 2VZUA 1NGQL 2YD9A 5KVGH 1GAFL 4L3AA 4PJFF 8CGTA 5E2TL 4NPYB 3BUTA 4R90L 5GS1A 2OTUA 3C6LB 4ONOA 5TDOA 3TO2A 4XXDB 4LHUD 4RFNC 3KYNB 3BMVA 2DJSA 1RUPL 4LF3A 1C16A 5D96B 1F4WL 5IJVA 3BAEH 1KEGH 4P5MA 1YPZB 3TBYA 1S9WA 1V05A 3P4LA 4XTRC 4BK4A 4M4PA 3NIFF 3GSRB 1FC1A 3BSZL 1GXEA 3FO0L 1YECH 3F7YA 4XP5L 1WWCA 3MXWL 2D7QA 4LBEA 4MXQC 4NKOB 2GTWB 1CVRA 5BZDB 1VKXB 3N1MC 2DB8A 2VXVL 4LKCB 2E9WA 2X89D 5ANME 4PR5B 1NC2D 2F54A 2Z31B 4YDIL 3TH2T 5AAWA 1CT8A 2OK0L 4KJYA 4FHBD 4K7PH 4OCWH 3RVVC 2YUVA 4ONHB 3T0EA 3QNZA 4HIIA 5TPWH 1J12A 5DD6B 3HNTL 3B6SA 5CILL 4YHIA 2FHCA 3BQUD 2EH7H 3REVB 3UJTL 5I74C 2DQGH 3V6OA 4YR6B 3PDDA 2ENSA 3BN9C 4UV4H 5EZLB 1OAXH 2ILLA 5B4MC 3CDCA 4JQVA 1YNLH 3TO4C 4M48L 3I85A 3N1QC 1MCQA 5GGTL 4FQQB 3TBTA 2BXYA 2V2TB 4OB5L 1T1WA 5C8JB 2IBBA 3OBAA 2VDMH 4OD1H 1O7SA 4XMLL 4FFYL 4XGZA 5F6IB 2FZ3B 4Z7OE 3DETC 1EAJA 3EBAA 5T3XL 3VFNA 3I3EA 3FOMA 3RVWD 1E4JA 4MD4A 1CGVA 4G7VL 5F88B 3F7VB 5DK0A 2IAND 4ALAL 1Z9OA 4L5FH 4XP9H 1NCDH 5GS2H 3TESA 1G9NC 2C3XA 3VW3L 2MTPA 1TENA 2A9ML 5D6CA 3IB4A 5H37G 3T0AA 3GHBH 5IBLD 1KF9B 4GRLB 4YBLC 4IRZH 1FDLH 4CADA 1QR1A 1H9VA 3CDYA 1YNKL 4Y8DC 5F7EL 4AJ0A 3LKQA 3UPCA 4FP8H 1TZIA 4LGSB 2HLFC 1BJ8A 4XRCA 4YHPA 2LVEA 2ADFH 5DR5L 4RMQA 5BV7B 4K3EL 3T0ED 4GBXB 32C2A 3C6LC 1OAQL 3I50L 1GGBL 2I9LB 1B2WH 2JCCA 1PGRB 3RI5K 2X42A 3JWDC 4AEFA 1FO0L 4WEMB 4Y4KB 4YBQC 3CK0H 1LO0H 5D96C 3EYUL 4ZUWB 5I1JL 3QHFL 3QXWA 2HMIC 1II4E 2QQLL 5AUMA 2DLGA 3I9GH 1OAZH 3G6DL 4KV5E 1P4LA 4XNYH 1TDQA 2ZUQC 3T2OA 1H3PL 3DO7A 1GHFH 3R8BB 1FVEB 3CFJB 2JIXB 3FONA 5CUSH 3LQMA 4X6EB 3L7EB 3NTCL 1CDIA 3FAWA 3O45B 3VXUA 4H8WC 2Z31C 4NNPH 2WMPA 5AZ2H 4EI5D 4LSRL 1WZ1L 5T5NG 4NN6C 3STZB 3MLWL 1KCVH 5GS0L 1GIGH 3E6HA 3RUGF 4HD9A 3M17A 1CI5A 1H8NA 1AJ7H 1IC7H 1YDPA 4G8FB 3L3KB 4KZEH 2VITA 5B39B 4LLVB 1A3QA 2AAVA 2XRAH 2R56L 4HPYL 4DN4H 1RD6A 4HGKC 4UIMB 3B5TA 3HHRB 1N3NA 3B2VH 2XWTB 3VXRA 3EDDA 5BS0E 3WUWA 3DXAE 3HC0B 5LCVL 1MPAH 1KCLA 4ZUTB 4RAVA 3RAJH 2IGFL 1I85C 1VFBB 3SDXE 1GGIL 3SPVA 1CLOL 4N0CC 2LTQB 3S97C 1ZHLB 3SQBA 4PTTB 3EGSB 3HZYA 1BOGB 3L5WB 5GS2D 3BZFA 3MRDB 1CR9H 5C08A 2DQFB 4YHZL 4GG8A 2BVPA 5DURB 4CU7A 4QY8A 3V95A 2C1OB 3OXSA 1CICD 4E42A 5D93C 1R3HA 4P2QA 4R2GC 4HFUH 5LWYH 2BNQE 2X44D 2V9QA 3V0WL 4OCRH 1A1NA 2H3NA 5HDQH 5ANMB 2G9HB 4L3EE 3U9UB 1A9BB 5HJ3A 3L3IA 4Q9QH 4KJPD 1TJHH 1NGXB 1N4XL 1Q9KB 5A16A 4P5TB 1LGVA 3CDGA 3QEQA 3HAEG 5JMOC 5CIPH 1RIUL 3ZE0E 1JIBA 4NN7B 2MMXA 2FX7H 2AQ3A 1CE1H 2IADB 3AGVA 1D9KC 5IVXE 3UTTE 2GHWB 5IBTL 1UYWH 3MFFB 3QEHA 5HGDA 3AY4A 3C60B 1S78C 3MLZH 4X99A 5CLTA 4IHOA 5IR1B 4OZHF 1ITCA 1OAYH 4XNMB 3X3FH 4KGLA 4XCNB 1BVZA 3DGGB 1ZANL 1JFQH 2P44B 2KBGA 2Z4QA 5LJYH 5JW4R 4TSAH 1UZ6F 3F5WA 3MV9E 3VXRD 4S1RH 1XGRB 3PWVA 3RHWK 4UB0H 2DQDH 3DURB 3C2AL 5GQBA 2FATL 3UYRH 4CRPA 4BFIB 2HFEB 1ORQA 3RIFF 1AP2A 1H3TA 1MJ8H 4LCWE 1PG7X 3BWAB 3TA3A 2AV7B 4KZDL 4AEIL 1F2QA 3OJ2C 4JDZB 2X4TB 3TBSA 2X4OB 4AM0B 5KSBF 3GMNB 4P2QD 1KJ2H 3BH8B 4I18A 1V7NH 4LSTH 2AGJL 3OHXB 3WFHB 4R96B 1N7ML 3GUTB 1U8LA 4OIIL 1K2DA 3I75B 4QO1A 4QHUB 15C8L 1I7RA 4HS3B 2YPVL 4OZGE 1NGQH 4Y5XA 5FF6B 4UQ2B 2I24N 1IM3B 1QLRA 1GAFH 2JJVA 3MREB 2ZCHL 1GC1L 1QRNA 3DV6A 5E2TH 4H1LH 1B88A 4R90H 1EFQA 4N5EC 2JK5B 4LPVA 1T0PB 1YEDB 4ZSOA 1T1ZB 3FT2B 3OKOA 4F33B 2LTQC 1F4AA 2I26N 1RUPH 1DANU 5L8JB 4KDVA 4TVSa 1F4WH 2YA0A 3MRHA 3IKKA 4NCDA 2CGRL 4KKBC 5EU3A 4PRDB 4XPBL 3L5JA 2CDEB 3JV6B 1VPOL 3ALWA 4JLRB 3QPQD 3LRSB 3BSZH 3FO0H 4WDIB 5ADOL 4XP5H 1DQQB 4NRZB 4HGWB 3MXWH 3O4LA 4OBRA 3NA4A 3IDXL 5IV2B 2VXVH 3WN5A 1SYSA 5B38A 4YDIH 1GSMA 2OK0H 5CFHA 4LP5A 1FZJB 4NHCL 3SGDI 1JYNA 3SGKC 1VGKB 4P5TC 4PJ5A 3WNNA 1DQDL 2ZPKL 3HNTH 1YMMA 5DYOA 5CILH 2APXA 3BN3B 3UJTH 1OD9A 5GRXG 5EU5A 4NN7C 3VD7A 5EZJA 2R1WA 4PD4K 5F21B 5EUOA 3SDAB 5I66A 1G0DA 2ITCA 5GZOD 5BS0B 3Q6FA 4M48H 3DXAB 1FL3A 5ISZB 5GGTH 5ID1B 4W6WB 3SOBL 4OB5H 3ULVL 3BZEB 2CXGA 2K3TA 1JGVL 2ID5A 2NLJA 4LVEA 1S9XA 4WTXA 1JYVA 5ESQA 4Y2DA 4MVBD 1T4KB 4XMLH 4FFYH 1QRND 1DBAL 2BNUB 1NEZB 4PP2B 4QGYA 5T3XH 1KIPA 4NO3B 4Z18A 1T66D 3P77B 4ONFL 3MGAA 4PY8I 3CSYB 1T7WA 4G7VH 5DF0A 2FSEB 2DI9A 1LO4L 4ALAH 4U33A 4D9QE 2BNQB 3VW3H 2BC4B 4OAWB 2NNAA 3RDTB 2A9MH 3MUY1 3NN8B 5GGTA 4YHOL 4C57C 4L3EB 2E6JA 3VWKC 5H35B 1E27B 2GI7A 1P84J 2CRIA 5F7EH 1YNKH 3T1WA 4F9LC 1XCTB 4WW2C 2XIDA 1T83A 1Q9OB 1E28A 1KXTB 3CFCL 3VGAB 5DR5H 1HI6B 1B6UA 1LNUB 4FQIL 4K3EH 4FQHB 1BVLA 5DEGB 3UROR 3VFRB 1QLEL 3DJ9A 1L6ZA 4PJCA 5I9QB 1OAQH 3I50H 4OIBA 5IVXB 3UTTB 1GGBH 1NUNB 5B39G 3LKOA 1QOKA 5CZXD 5D1XB 5C0DA 1FO0H 1WQVT 5BXFA 4J12A 2A73A 3TIEB 1FQ9C 3EYUH 1T89A 3KPQB 5I1JH 2R2HA 3QHFH 5A2IH 5FAAA 2QQLH 3CXDL 3GSXB 2Y36L 3BP4B 3MV9B 3CSGA 4LPYA 4JPIB 1YYML 3G6DH 3JUZA 2HT3D 3BO8B 3QI9C 1H3PH 2R0WL 4RGNE 4N9GA 4AIOA 2WV3A 3CPLA 4RDQF 2IBZX 1ZS8A 3NTCH 3VI4E 2AI0L 5F9WB 1FLTX 4C4KO 5KJRL 2X4PB 1NFDE 3RA7L 2AERT 4XBPA 3MV7E 4LSRH 1WZ1H 4LCWB 2X9XA 4OJFL 3ZZ1A 3MLWH 3KYKL 4CVUA 2DQCL 1Y0LB 5GS0H 1WCQA 2ESVD 2MFNA 3FB8B 4HMEA 2PO6B 4KK6D 1HINL 3RL2A 1VEPA 3BFOA 1G7MA 1MY7A 5JOPE 3GI8L 1JF1B 4F58L 2R56H 3MRKB 4HPYH 4FZ8L 4DQOL 1YA5A 1WIUA 3IT8D 2AJUL 2Z92B 3CAFA 3PNWB 4Y16B 2E3VA 4OZGB 2IPKB 5F3BB 3CZFA 3MV8E 4PS4L 3RKPA 4E9LA 4EN3A 4KK9D 4TUOA 2OZ4A 1VADA 5T3XD 5LCVH 4KI5D 1T22B 5ACMA 5JPNB 4BYHA 2IGFH 1GGIH 1CLOH 2DMBA 2VWEC 5HYJD 4GG6A 3MJ7B 1VB9A 3KWWA 1M7IB 1U41A 5DTFA 3CUPA 1KN2L 4YHZH 2G2RA 3K0WA 3QDME 4PJ8C 1A4KA 1WWWX 2X41A 2ZSVB 1WSST 1TCRB 5C0JB 4MA1B 4L8DA 3MCLL 3TBVA 1WFNA 5D7IA 1NCCL 4Z7NF 5GHWL 1UQSA 4CVXB 3V0WH 4NRXB 2M2DA 3O8XB 1MCRA 2EDBA 1N26A 4WNQB 5C6WH 2P4AB 3MBEB 3WJJA 3K81A 5CD3A 3QFJE 1N4XH 4S2SB 2OTWB 5GGSB 2YRPA 3TVMA 1WIPA 4MX7A 4U0RC 5CD5D 5TQ0L 3O3UN 3RVUC 5ERWB 1RIUH 2Y6SC 3LQZB 5MEOB 3GKWL 5IBTH 2ZUWA 1BJ1H 1EVUA 4TUJB 4C83B 4PG2A 4MDIB 2Y72A 3O6ML 4I48B 5D7SL 1OW0C 1OTTD 1WT5C 2XWBA 3BDBA 4YFLI 1ZANH 4P46A 4AENB 3IU4L 1AKJB 3KJ4C 4EN3D 1WAAE 1FSKC 2VLJA 3FMGL 3IDIA 5IMMA 1H15A 3CVIL 3CMGA 4TTGA 5C0BA 3RGVA 2XA8L 3CVHB 2IMMA 1VENA 4Q6IB 2IQ9L 3QZWB 2R2EA 3Q0HA 4K23L 5GS0D 2J8OA 3P40A 3BP6A 3C2AH 3QWOB 2FATH 1S7UB 4X6CE 4OCYL 3ZDYF 2FGZA 1Y6MR 2OL3B 2FJFB 3WHXB 1RI8A 4KZDH 4YO0A 4EDWL 3HLAA 4AEIH 5HHQB 5IM7B 2EDTA 4HWBL 3U30B 1CBVL 5ALCL 5EH1A 2AGJH 4MDJA 1N7MH 2P42B 3F7QA 4QRQA 2APFA 4XCEA 3BUYB 4PRNA 4YIQB 3C5ZD 4OIIH 2WINB 4WGVB 4Y16C 15C8H 1DZBA 3LVEA 2YPVH 5CEZL 1BZ7A 5KN5A 3ZSSA 4KKNA 2ZCHH 5T1KD 1GC1H 4A6YA 3WCYA 2I9TA 5IMLA 3T4AB 3TP4A 5BVJB 3BIKA 5DI8B 1JZ6A 5DMKB 2A6JB 4PGDA 4JFDD 1IVLA 4KKAD 4FA8A 2YEZA 5TDNB 1U36A 5EDXA 2CGRH 2HLAB 5CJBA 3MNVA 4XPBH 2X40A 3KPSE 4JR9L 3IVKB 1JWUB 5I30L 4D0DB 1VPOH 3H3KA 3S3JA 4EUPB 3UMTA 5ADOH 1Q8MA 4RGNB 3IDXH 4OFYA 3FRPA 1PKQA 2PYEE 5EFIA 5E7FA 4EVNA 2DDQL 5IB3A 1HKLL 1NFDB 2AEPL 2VLJD 3FRUB 3Q1SL 3WUZA 3MV7B 3ARGA 4Z76B 2AKRB 3CMOL 3EJZC 4NHCH 1INQA 2QR0B 3TF7C 5B22A 4ZNEA 3T65A 3ARTA 3PWJB 5L2KA 1UCBL 2DWEB 1DQDH 2ZPKH 2EDOA 3O2VL 3U36B 4OGYL 4PRAB 4JY4B 2X1XR 4Z7WA 1BVKB 2FBOJ 3X17A 4Y0GA 5T1LA 3LKSB 3MV8B 4YHNA 5DQJA 1G7IA 3CC5B 5EOCL 4XAWL 1I1YB 4DZ8A 3SOBH 4K7FB 3ULVH 1JGVH 3DVGA 1EZVX 2CO6B 1RZFL 2MJWA 4AH2A 3ARED 4M6OL 1GZQA 1BD2A 3P9LA 1DBAH 3B9VA 4WGWB 4ZQKA 4HUXA 3LS5L 4I4WB 3V8OA 1CXKA 3QDMB 1NANI 4ONFH 1W0WA 4APQA 4NO2A 3O9WD 4FXGB 4NRYA 1LO4H 2MKLC 4KRLB 1AE6L 2NW2A 4XZUA 1O0VA 2J7LA 4YHOH 3S96B 2J2ZA 5CINL 3U30C 1KACB 2BJML 4L8CA 1FFOA 5IFHL 4NM8L 3QFJB 5CLWA 4IMLA 3ZKND 4OFYD 1J86A 2SEBA 3I6KB 1TVDA 3QIUB 3CFCH 3WS6A 1WBZA 3ARGD 1WBXA 1TVBB 3OJVC 4FFZL 4FQIH 1R5VA 1ZTXL 2PCPB 4KVCL 2F54E 3LRHA 1QLEH 1CGUA 2AS5M 2OJEB 1CS6A 5DWUL 5L2KD 2R1XB 3IXAA 4LCCB 4RFEB 3QIBD 4J3VA 3CFBB 4G8GB 5E95B 1XH3A 3BP7B 4XXCC 5DJDA 5DMYA 3RL1B 2CUMA 1A6PA 3CXDH 3EYOA 3U0TA 3G5VB 2Y36H 3PL6C 3R0NA 4HUUB 1YYMH 4QCIA 1IAOA 3QUMB 1QZ1A 1AGEA 1ZLUK 1MFCL 4RGNC 2R0WH 1RY7B 1F8TL 1FZOA 2ITDA 4HMCA 3SKOB 2DYPD 2AI0H 1K85A 5J4MA 4X6CB 5KJRH 5CZKA 2W9LA 3RA7H 3ZE1F 4WU7B 1FBIL 4R7NB 5B8CA 4IRSB 4OJFH 3BPNB 1TXKA 1P2CA 3KYKH 3ZDXF 2DQCH 4APQD 3LV3A 3V5KB 1PVHA 3KPNA 4MZ3A 5JW5B 3V79C 3EJYD 5FUZL 2JB6B 4P4RA 4YUEL 1MI5E 1HINH 3PDOB 2BY3A 4FXKA 3DVNA 2IH1A 3GI8H 4F58H 1RULL 4FZ8H 3EOAA 3EKCA 3PWPD 5A2LH 4DQOH 2GAZB 4JFXA 3ULVD 3K2MC 2AJUH 2QSQA 4YNYB 1NCAL 5C09A 4PS4H 1LEKB 3HZVB 3MCG1 3JWOC 1MQ8A 3VFUA 2X4QA 3SDDB 1L9NA 3RPIA 5IW6A 1H5BB 1AQDA 1YY8A 1K3ZA 3MRPB 1EO5A 1P84K 3E8UL 4JFOB 5KSVA 1NL0L 1G6RB 4RRPG 1KN2H 3FB5B 2CK2A 3KPSB 5AEAA 5CEYB 2JCCE 5HI4C 1N8ZA 1TFHA 3ALXA 3MCLH 5EU4A 5JZ7C 4BFEA 1NCCH 1H3VA 4QRSA 4X0KB 5GHWH 3RWIB 1FNEB 2PYEB 3NBNA 4PJGF 1QTYT 1HDMB 4L29B 3EO1A 1FFRA 4D9LL 4WFFD 5E99L 5L0QB 4G3YL 4YK4B 4JKMA 1U3YA 5E70A 3QIUC 5HI5D 3GZKA 5HDOA 5TQ0H 1IC4L 3QULA 4KI5F 3VXUE 3MRIB 4FMFA 2P5WE 3EYSL 4X6DA 4ZXBA 4NYLB 1U8JA 3GKWH 1UH4A 2ATKA 4JZNA 3OKNA 1FFPB 3SHSA 1A1MB 5I8EA 3FT3A 5IBUG 5BJTB 3TN0A 3O6MH 3DX6B 4PTUB 5D7SH 3VFGL 1IT9L 3ALPA 4WEBL 2BOBA 3RX7A 4LKXA 3IU4H 4CGTA 4P9HC 1J8HD 3FMGH 1FPTL 3CVIH 4JG1L 3STLB 1RMFL 2XA8H 3FB6B 2DICA 1Z0NA 2IQ9H 2OTUB 5DHXB 5TDOB 3TO2B 4K23H 3LKPA 5TJWK 2VABA 4GXVL 3VFMA 3DMMA 4OCYH 4M03A 5B3JF 4UOW1 3VXSA 4PREB 4LF3B 4M7LL 3BPNC 2YD4A 4KROB 4EDWH 1QRKA 4WI2A 4JM2B 1F45A 4P5MB 5C08E 4X6FA 2VISA 3GBNL 4HWBH 4WY7L 1CBVH 1S9WB 4L4VA 4BUGA 5ALCH 3BZ4A 1BJ1J 4GUPB 2VDRL 1MCWM 2F53A 1RJCA 2BXZA 3N1GC 3W11C 1YNTA 4LBEB 1EEZA 4QTIL 4ZPVB 5CEZH 1JPFA 5DJZA 1G7QA 3IGAA 4BQBA 2F54B 4YDJB 2E7MA 1CT8B 4JFYB 4KJYB 1X5YA 2FWOB 1FJ1B 3MJ6A 3QNZB 4LSPL 3E2HB 4N1EA 1IEBA 3IF1B 3RWFB 5E00A 2DL2A 5EIIA 4X5WA 1DE4A 4HWBA 3QEQE 5JXAL 4ZXBD 4DZBB 4JR9H 4HUKB 5HHME 1Q9LA 5I30H 3BXNA 4PJDF 5C0CA 1GYAA 2X4NA 3K4AA 4MQXC 3X14A 3MJGX 3J8F7 1ZV5A 2DDQH 4TSBL 4KI1A 1HKLH 5C9JA 2AEPH 3Q1SH 2BSED 3T3PF 3CMOH 1ZHKA 3LDBC 4XGZB 2UY7A 3FOMB 4NKDA 1UCBH 4ODBD 1N2RB 5HYIA 2HFTA 3ESVF 3DMMD 5J12B 1AXSA 1MI5B 3O2VH 4FFWC 3AM8A 3VXSD 4HC1L 5FEBA 4OGYH 2NY5C 1F4XL 3WIFA 4KMQA 4IMKC 4PJIF 4ZOEA 3DWTA 2BCKB 5EOCH 4JANA 1MFBL 4QTHB 4CADB 4XAWH 3TYFA 5IMKB 2XNAB 2DD8L 4JREB 2D9QB 1TZIB 3BHBB 1I7ZA 2AV1A 4RCAA 1ONQA 1RZFH 3H0TA 4M6OH 2GJ6A 2RCSL 4FABL 3ULUF 3LS5H 5GS1C 1IGFL 3W81A 2JCCB 2P8LA 1C8PA 1IJ9A 4LL9A 5JW4M 2HVJA 4ZFGL 2A77L 5H2BA 4W4OA 1BQHG 2HT4C 1AE6H 3RGHA 2D0GA 4PGEA 1OHQA 2OP4L 4F2MA 2FL5A 5CINH 2BJMH 3DRQA 4OFVA 3H9HB 5IFHH 5CEZD 4M8QA 4NM8H 1P4LB 1AIFB 5D71L 3U48A 1FCCA 2HTLD 3U2SB 3DO7B 4HAFA 1FYTA 3O4LE 3FONB 4OLEA 1M7DA 2XV6B 2IFGA 4FFZH 3VXUB 1ZTXH 4KVCH 2P5WB 1J1OL 1DBKL 1TMCB 5DWUH 5CP3H 3T0EC 3E6HB 3VA6A 3FQNB 3WJLA 3FT4B 4PJ5E 2C7UA 5E9DE 4HWEL 1YMME 3IS1X 3IYLW 1YDPB 2VR5A 3QFDB 2VITB 3MLTA 3V6OC 1R5IA 2C3VA 1KPVB 1XGPA 5EUOE 1HYSD 1YUHB 2HJKA 1KLGA 4JQVC 4TTDD 4LHUG 2PXYA 4JY5L 1MFCH 5HYEA 3QT2A 1F8TH 5GPRA 4MGXA 1LO5B 5GRUL 4ESKA 1BQUA 1EAPB 2E6PA 4NUGL 4LCUB 3SPVB 2D2OA 5AYQA 2OXHA 4UNVA 1FBIH 2CRMA 1P53A 2XI9A 2FEEL 2HG5A 3HZYB 3CSPA 3TGXA 4EI5C 1MEXL 1DQJA 5C08B 1MWAB 4GG8B 4U3XA 4XC3L 5BRZE 3CX5J 3QH3A 4QY8B 5FDYA 1R3KA 4DJMA 1F02I 4YUEH 3ZKQD 3OXSB 1HHGA 3RX5A 1HHHB 2NY1D 4X7FC 1RULH 1A7RL 4Z8FL 5K9QG 1JTOA 1T1XA 3C8HA 3S34L 3WXVL 1A1NB 1DFBL 1L9MA 1NCAH 2H3NB 4MCYB 3SKMA 1WEJL 3L3IB 4YBHA 1DVFA 1MJJB 3OSKA 3P0GB 1FYTD 1GPOL 1VFAB 4OI8A 1FNAA 5CWSA 3NIGF 4R4FL 2FBJL 1IGYB 5EZOL 3QEQB 4H25A 3E8UH 4Z7UE 1NL0H 4ZPTB 5IGXL 2R39A 2BSRB 3MJ8A 4NQDA 4XVUC 1UZ8B 4PJCE 5HHMB 4G42A 2GFBB 4JFED 3WO4B 3ZKXB 4ODWA 3CXHK 4P4KA 4IHOB 1KXVC 4OFIA 2ED9A 3A67L 5LGJA 1S5HB 5C0GA 1UJ3A 4N0RA 4PRPA 5AG9A 2Z4QB 4PGZA 3GBML 3FAXA 4D9LH 4WWKA 3F5WB 5TE7H 1IQDA 3MOQA 2DIAA 2PXYD 3CFKA 3ULVF 4KJPC 5E99H 3B9EA 1FNGA 4G3YH 5FGSA 5BOZG 5H8DA 1HHKA 3X12B 3S5LA 1IC4H 3VFOB 1PFCA 5GXBB 3ZTJG 1QP1A 4FTVE 1AP2B 4G6FB 3EYSH 1A22B 3TA3B 3QA3A 4X4MA 2YWZA 5IKCA 2ZG1A 1LHZA 3DNKA 2P7TA 3JTTA 3FB7B 1MQKL 4I18B 3NCYP 3DX9A 1FGNL 4I77L 3VFGH 5C07A 1IT9H 4WEBH 5L8KB 1U8LB 1X6LA 4I5BA 1K2DB 5FB8A 2C9AA 1PY4A 1DVFD 3RWEB 1FPTH 1QLRB 3PIQA 4JG1H 4O2EA 5FKPA 1RMFH 3TZVB 2R4RL 4WJ5A 1KYOJ 4MQ7A 4ELMF 2HTKD 4X9BA 3TT1L 5D1QD 4U0QB 3FFCD 3OKOB 4GXVH 4GG6E 1RFDL 3H9SA 5D4QA 4M7LH 4NQDD 5D8JL 1I3VA 1E4XI 4CAGA 1T21A 3OX8B 2IPUK 3GBNH 4WY7H 4ODUB 3OZ9L 4LLYB 1L0YA 3H42L 4P4KD 2HVKA 2VDRH 5K9OA 4I2XE 3BD5A 5D7IE 3OWEA 2DM2A 3O4LB 2V9TA 4QTIH 5HHOD 5DHVH 1SYSB 1MOEA 2LU7A 2Q6WB 4YPGA 1K6QL 4U31A 2DIJA 4OCNC 1MRFL 1KB9J 4HJGB 2CPCA 4LSPH 4PJ5B 4ZO8A 5E9DB 4KTYA 2XTJD 2YD5A 5MP6L 1YMMB 5DYOB 1TVHA 3S37L 2Q7NA 5JXAH 5EU5B 1KCKA 5GRVK 1FVDB 5F7LB 4M00A 2R1WB 4FQXB 2EECA 4XVTL 3ILQD 5EUOB 2I27N 4M02A 5I66B 2GITB 2ITCB 2K7QA 2J8UA 2V2WA 3WNOA 2MQ3A 3Q6FB 5C07D 1C7SA 1FL3B 3O3AB 1AC6A 2PKDA 4LEXL 2P1YA 4XH2A 5HGHA 3S36L 2RGSA 4GRWH 4RX4A 2RQ8A 2EDYA 5HHXL 4TSBH 4JRYA 3SDCA 5ESQB 4Y2DB 5F6HJ 1L0XA 2WBWB 3BPCB 1LWRA 4D9RD 3LH2L 1U42A 1A8JH 4HQQL 5C0BE 3ZHLA 2LAGB 2CJUL 5BRZB 1ZXQA 2OQJA 4WHCA 1UEYA 4UMGA 4YE4L 3KLAA 4HC1H 2UWEA 3H9SD 4MA3A 5DZNA 5D5ME 5CJOL 1F4XH 1SJVA 3KPMA 3KYAA 4F57L 3TA3C 2HN7A 2NNAB 3MR9A 5HGBB 4JAMA 4YHKL 1H3XA 3UYPA 4TVPL 1UCTA 3RVXC 5IB2A 1OWRM 1MFBH 4I18C 4L8BA 4ZFFB 5GZOC 2A74A 1HH9A 2DD8H 5T5FL 4GQ9L 1E28B 1I4FB 1IZJA 4MD0A 1CGXA 1T03L 1N0XL 1CFVL 3RZCA 4Y5XC 4Z7UB 2RCSH 3OKDA 4MVBC 1BVLB 5DSCA 2RR3A 4FABH 4HC1A 2PTVA 5IW1A 1C5BL 4PJCB 5ENWB 1IGFH 5SV4A 3HC3L 4L3CA 1T66C 3DHMA 3LKOB 3NMEA 4HAGA 4AL8L 5C0DB 5GSRA 4ZFGH 2A77H 3LEXA 5BXFB 4JDTL 3ETBF 2A73B 2VO5A 2OP4H 2R2HB 4P2RD 3NIFE 1NC4A 4AT6B 3WUWG 2AJSL 3WMSA 2AK1L 5FA3A 3TNMA 5D71H 4U1MA 5LGKA 3ZLQC 5EOCJ 4RX4D 4QHLB 3LPGA 1YQVL 3CPLB 4JRYD 4JQXA 1ZS8B 3WN5C 4X8XA 3QUZA 3C09C 2XN9D 3CGTA 4DVRL 4FTVB 3IU3B 1J1OH 4IDLA 1DBKH 1O5DT 3DO3A 4G8IB 3C08L 3GSUA 4ZNEE 1XEDA 2QHLA 5L2KE 5DJYA 3CFEA 4HWEH 1ADQL 5CZXC 5C2UB 3ILPA 3MLSL 3VXOA 5I16A 4P23A 2DQTL 4J3SA 3KXFA 2X70A 2I25N 3KYMA 2FH6A 4Z7WE 1XZ0A 3VU2A 4L1DA 3C5JA 1KJVA 1RJYA 1MSPA 4S0SD 3CZFB 2VJXA 1WTGT 2A6DB 1I9EA 4JY6A 3O6KL 4FMKA 2HT3C 3I6GA 4JY5H 3WFZA 1VADB 3UTSD 3VRJB 5GRUH 2NY0D 3KHQA 4K9EL 2RAMA 4NUGH 4NKQB 4Y2DC 5I1EL 4GG6B 1BD2E 3KWWB 2B39A 1MEXH 5DTFB 3CUPB 3SJVA 4KRPD 2G2RB 5DJAA 4XC3H 2P8MA 4TPRL 1A4KB 4MB5A 3GJFA 1I1CA 4U1SB 1M1SA 3TBVB 4I2XB 4KK6C 5D7IB 4PJAA 1A7RH 2C4FU 1MRDL 1NC4D 1UQSB 4Z8FH 4O2CB 3S34H 3WXVH 1DFBH 2YOCA 5K59E 4XCCL 1WEJH 3B5HA 1DL7L 3OKMA 2VDNL 4WI4A 4G6AD 4KK9C 1GPOH 1WK0A 3NCCB 1T83C 4KI5C 4Y5YC 3TVMB 1HHIB 3BYTA 1SBBA 4R4FH 2FBJH 4MX7B 5EZOH 3JWDL 4RZCB 1WZMA 1F00I 5IGXH 4PRBA 1S5IL 1CGSL 1X9QA 3BW9A 3VGHA 4X4ZA 1RU9L 2Q86A 3KXFD 3QUYD 3QXDB 1T89C 3HMXL 4BSJA 1WZKA 4HS6A 3A67H 3OTTA 1Z2KA 2FYYA 4P46B 3UPRA 1WBYA 2VLRB 3GBMH 5I1GL 1P7KA 2CDGA 5TF0A 4H8WL 3IDIB 1AGDA 1H15B 2Y5TA 5C0BB 3RGVB 4O00A 2WP3T 3BI9X 2R2EB 4RGMB 2W0KA 1ZVYA 2X4RB 3PV6A 5D5MB 5CD5C 3D0LA 1CGTA 4YO0B 3HLAB 5K93A 2KQNA 4L9DA 4PRHD 1NJ9A 3GEWB 1N5AB 1IL1A 1MQKH 2VAAA 2H9GA 3QRFM 1TPXB 3TCXA 4HEPG 3OF6A 1NGWB 1FGNH 4I77H 5DJ2B 5B38G 4QRQB 4Q6YA 4XCEB 4PRNB 4PJFB 5DQDL 4UBDC 4LHJB 4YZFF 5J1AA 4AEHL 4JFZL 3CX5K 1U8QA 4LASL 3FHAA 5C09E 5IHBA 4EN3C 3VCLA 1YC7A 1ZA3A 2R4RH 4A6YB 2I9TB 5IMLB 3QPXL 3TT1H 4M93B 3ARUA 3BIKB 1JP5A 5SWZD 4I1NB 5GS0C 2W38A 1M05B 4HT1L 1HXMA 4PGDB 1RFDH 4M62L 1JZ4A 1VERA 5D8JH 2R9HC 4N8CL 3BDXA 2N7AA 3HE7A 3MNVB 4UI2A 1NFKA 3OZ9H 4QRUB 3GSWA 3E3QE 3U0PA 3H42H 5KG9A 3NGBB 1KIRA 5D7LE 4GRMA 5D2NE 3AS2A 3D69A 4PG9B 5K9JL 2Z93A 2XKSA 4JGUA 4EVNB 1K6QH 5GGSY 4UTAL 4JFQA 3ARGB 2C5DC 1MRFH 4IOIA 4ZFZA 5EC1B 4WV1A 1RJZA 1WLHA 3TVMC 4O2FA 2ADIA 5MP6H 3S37H 1NGPL 3KPPA 4OZFB 2D0FA 4G7YL 4Z7WB 1CIDA 5I1KL 1R6VA 4KKAC 4X6DE 1W0YT 4XVTH 1KJMB 4LLQA 5T1LB 3AB0B 5DQJB 3NZHL 3OF6D 4O51A 4PG2C 4ZS7L 1X5XA 4IS6A 1U8IA 5D7KE 4ZOAA 4LEXH 4DZ8B 3S36H 2EDEA 1SMAA 4NUJB 5HHXH 3DVGB 4P46C 4PJ9B 2YC1A 3LPWA 3ARDA 1GZQB 2L7JA 3HI1B 1BD2B 3LH2H 4CN4A 4ZQKB 4U3HA 4HQQH 3RGVC 1P7HL 2YUZA 4PJXA 2EKSB 1R0AL 3NABL 2CJUH 4R0LA 1DQLL 1I3RB 1W0WB 2PTTA 4YE4H 1SVZA 4NRYB 3HS0B 5CJOH 4F57H 1MCPL 2XG4A 3HE7D 2NW2B 5LQBL 4XZUB 1OF2A 3THML 3TNNA 4YHKH 3SKUD 2NXZD 4TVPH 4L4VE 1FFOB 1TPXC 3IFOA 5ESAB 3PUCA 1NUGA 4YDVA 5T5FH 2DM3A 2X9YA 2FJHB 5IW3A 2F53E 5K33A 4GQ9H 1JJUA 2SEBB 4F7TA 1NLDL 1T03H 1N0XH 2WWKT 1CFVH 1WBZB 1WBXB 5C0EA 1R5VB 4TRPL 2MPAL 4CDHA 3AREC 4ORGA 5GZNC 1C5BH 4F3FB 4DK3A 4BM7A 3HC3H 4M93C 3IXAB 4AL8H 1CG9A 4JB9L 3VFWA 3QIWD 3O9WC 4JDTH 3MRNA 2Y06L 1CLZL 3GMRA 4OD3L 4R7DB 4CDGC 4PJ7A 4JN2A 2EICA 4RFOL 1AO7A 3EYOB 4BELD 1CXFA 1CCZA 2AJSH 2AK1H 5HHPA 4U3CA 5C0CE 1RZGA 2ZNXA 4U6XA 1DUZA 1RZJL 2ZJSL 7CGTA 1AGEB 1ZGLP 2ZOLA 1NLBL 1RK0A 3ZKNC 1YQVH 1FZOB 2ITDB 1GC1C 3ZT5A 5CJXA 1V3JA 3FQTB 3ZYZA 3DTXA 3ARDD 1NGYA 4MJIA 4DUXA 4DVRH 5DC0A 2HT2D 1CGYA 3VMOA 3ARGC 4M61A 4DCQA 2AJ3B 1KTDA 3MLUL 1P2CB 2EDHA 1HHJA 3C08H 1FP5A 2EDKA 4DUWA 3KPNB 4I0CC 5EBWB 3QYCA 1TJIL 1MCWW 1ADQH 3D6GA 3MLSH 4MCZB 1MJ7L 2DQTH 4JKPL 4FXKB 2IH1B 3UP1A 5E8PB 1OP5H 1OCWL 1OT2A 4OUUA 3TLRA 2BVUA 3OG6B 4FQ1L 3AB0C 5KSAB 5C09B 3DX7A 2WBJA 1HWGB 2R0KL 3O6KH 1FFNB 2W65A 5LAXA 2CRYA 2DM7A 3NH7L 4K9EH 3RPIB 4NO0A 1KPUB 1J0JA 1IGJB 1IILE 4N68A 5CSZB 5I1EH 1YY8B 4JFFE 1I8KA 2YRZA 3S35L 4E41A 2CKBA 3WEXA 2GJ6E 2JLLA 1LP9A 2O5XL 5ESVB 3D2UB 3UTQA 3UEZA 4TPRH 5HPMA 5ITFA 4APQC 1U3JA 4QOKB 4P2OA 3HAEH 4Z77A 4GXUN 1VA9A 4M9PA 3CJJA 4TVPD 1N8ZB 2WW8A 5D7LB 3ARFA 4QRSB 5D2NB 3OPZL 1MRDH 2EXWD 1DCLA 3RY4A 4XCCH 3EO1B 2XY1A 1DL7H 5DVKA 5GGVY 5F7MC 5HBBA 1UWXH 4F7PB 1FYTE 4RAUA 3JWDH 2NYYD 3WS6C 2JJTA 5E6YA 4C56B 1S9KC 3V0VA 1S5IH 4X6DB 2Y1VA 1CGSH 2HKHL 3BEWA 4Y19D 2CR3A 1U8JB 4JZNB 1REIA 2NR6D 1IAKA 4IRJA 3NA9L 1QA9B 5I8EB 1RU9H 2I5YL 3LCYA 3TN0B 2OR8A 5DRZA 5A3IC 3HMXH 4H26B 3WS3B 2XQBL 4D94A 5GRYA 2BOBB 1AQKL 1UKQA 2EC8A 2VL5A 3EFDL 4XXDA 1VGEL 2WBJD 5I1GH 4KXZH 4H8WH 1G7LB 3D39E 3KYNA 2VR4A 3OKEB 3FO2B 3NFPB 4HV8A 2HYMA 4NO0D 4YHLL 3OR7A 3LKPB 1E4WL 3GM8A 4KK8D 5F71A 2H1PL 3OKYA 1FAIL 2VABB 5HI5C 1X5JA 4E41D 5B4MD 5B8CC 4JZJB 3D25B 3TO4D 1J0KA 2GY5A 4OZ4B 3HMXA 4P2OD 3O3BB 2AEWA 5DVNA 3CD4A 1XGYL 4Z78A 2VISB 4NWUL 2DKSA 2ADGB 4L4VB 4RIRA 5FM8A 2C4FT 1Z3GL 1XCQB 5BZDA 1VKXA 1JMZA 4DW2L 3FRPG 3ARFD 4PFEA 2F53B 3DETD 1UKTA 5HY9A 3KLHC 5DQDH 3L5HA 4HWZA 2UUDH 2WZPD 4AEHH 4JFZH 1EEZB 4ONHA 5J7CC 2ZUTA 4LASH 3T08A 1JPFB 5DJZB 1G7QB 5DD6A 2BHZA 4L9LA 3RIAK 5EUKA 3QPXH 3REVA 5GSVB 4YR6A 4B7IA 1IEBB 1N6VA 4WI3A 2D03L 5EZLA 5EIIB 1B0RB 4HT1H 5EZIL 1Z0MA 1DE4B 1U8PA 4M62H 4N8CH 1N5YL 1CLCA 1H8SA 3QDGB 5AWNL 4Z7NE 4IRJD 3F62A 3E3QC 3PGDA 1Q9LB 1TJGL 5C0CB 5C8JA 3C2SA 3GMQB 2X4NB 4LGRB 1FGVL 3IFNL 3X14B 3DUUA 3OB8A 5K9JH 3HG1A 3C6LD 3SBWA 1J1XL 5I1HL 4PRPE 4UTAH 2DKUA 4O5LL 5IEKA 2PW1B 3F7VA 5DVOA 4NQXA 1IC5L 2ZG2A 3QWQB 4X7SL 1AXSB 2NZ9D 1CE6A 1NGPH 3DUHA 4HIHB 4N90D 4JE4B 2H8PB 2VYRE 4XT1C 3WIFB 4G7YH 4GRLA 2VB5A 5DFVD 5I1KH 5CEXB 4ZXBC 4X4ME 1JNLL 4OF5A 4CNIB 4YLQT 3VD4A 3NZHH 4TNVF 1A2YB 4OZIF 4JANB 4ZS7H 3TN0C 3MV01 1RZIB 5GGUB 2Z31D 1CGWA 3TYFB 5J3HD 2OI9C 1I7ZB 4GBXA 4LFHD 5EBLA 4JFFB 2I9LA 1J05B 4KAQL 2GJ6B 3I84A 4Y4KA 1PSKL 4QRRB 2ZSWB 1R0AH 3NABH 1DQLH 5EORL 3QCUL 1W2KT 1FIGL 4LQFL 3DMMC 2PUQT 2AXJA 4BKLB 1A6VL 1MCPH 5DUML 2VLMD 5EU7E 5LQBH 1AFVL 4F2MB 2F9BT 1BEYL 3THMH 5AYUL 4HKXB 3CFJA 5GJSL 3INUL 3LMJL 5I1AB 4M8QB 5FO9B 3VRLE 3O45A 1FYTB 3PWUA 1NLDH 3MLVL 3GHEL 1QFUL 4M7KL 1X6NA 4Q74A 3LPFA 4ETYA 5IHZB 4TRPH 2MPAH 2VIRA 3W82A 5HHVL 4G8FA 6FABL 2P47B 2ZUVA 4PJEF 4R9HA 1A47A 2C7UB 4JB9H 2Y06H 1CLZH 4OD3H 5TF1L 4GRLD 3F65A 4RFOH 4JO3L 4I3SL 3HC0A 5DGQA 2X5PA 1A6UL 3OGOE 4M3JA 4ZUTA 2HJLB 3D39B 1CL7L 5CBEA 1RZJH 1VFBA 2ZJSH 4LPTA 3AROA 4K7PY 1NLBH 1ZHLA 4GBXD 2HTLC 4J4PD 1U3HB 1BOGA 4OLZL 4JHBA 3ISWA 2JELL 2WSKA 3MRDA 3QWRD 5C6TL 4LSUL 1I75A 2C1OA 4Y4KD 3O0RL 3LD8C 3IDYB 1QSEA 3U1SL 3MLUH 1DQJB 4X4YA 4MXVE 1ZT7A 4WENB 1TJIH 5C0IB 3AC0A 4ZOCA 3AM8C 1JI1A 2CUIA 5E6IB 4EI6A 5ANMA 2G9HA 1MJ7H 2VN7A 4Q9BA 4JKPH 2M1KA 3K8KA 1CZ8L 1OCWH 3O41A 1GOFA 1T1XB 1NGXA 2JIXD 4FQ1H 1HYSC 1Z6JT 1X5GA 3STBA 2R0KH 4FNLL 4L4JA 4TTDC 3CVHL 4DVBA 3NH7H 1JN6B 2NY6B 5CWSB 1WICA 1LMKA 1J11A 3S35H 2OL3L 2PTUA 4X83A 2AXHA 2PN5A 3C60A 2O5XH 5GRJL 4G42B 4YAQA 2BY2A 4PJHA 4PJXF 4M4RA 4LRNL 4OCSL 4QXTA 7FABL 4W4OC 3P4MB 1JHLL 3QUKB 2OBGA 2RBLA 5I76B 1XGRA 5LGJB 4LMQI 2YZ8A 4PRPB 3HPLB 2X09A 4NC1C 4WWKB 4I13B 1IQDB 1N6UA 3DURA 3CFKB 3EYQD 4BFIA 1PDKA 2LE9A 1FNGB 5FUOL 1YN6B 5F9JA 2QSTA 1HHKB 5DURD 2X4TA 4LU5L 4WVRA 4AM0A 2OLDA 1LE5A 1JBJA 3BRGC 1ZSDA 3GMNA 5KZCB 2IG2L 1IKNA 1CD8A 4PB0L 2HKHH 1M71A 4W70A 4S0TD 3WFHA 3UCRA 3PWLB 3VG9C 3WJLC 4G8EA 3NA9H 1BX2B 1J1PL 3U4AA 4QHUA 2ED8A 2I5YH 4RWYL 3H2WA 5I19L 2O5ZL 5F3HB 5FF6A 4OQTL 4UQ2A 1IM3A 3EFFB 2XQBH 3L3DB 2E7CA 1AI1L 1AQKH 4OCMC 4WHTB 4UILL 1MCHA 2V2XB 3EFDH 4P5TD 1VGEH 2JK5A 5J11C 1YEDA 3FT2A 2BNRA 4FS0A 4XI5C 4AIXA 4O2EB 5DRWA 5SV3A 1QSZA 4NBZB 2Z35B 2PXYC 3HB3C 3ZE1E 1BWWA 1T0NB 2FX8L 2FJGB 4YHLH 4MQ7B 1J9CT 2GUOA 1E4WH 2H1PH 1FAIH 3ZDXE 2ATPA 4PRDA 4DFIA 2HP4A 4OCXL 2CDEA 2VRAA 3C60D 2GEEA 1AGBB 2DI7A 4JLRA 3LRSA 1T21B 5T5NF 4WDIA 1XGYH 3SJVE 4NWUH 2DBJA 4HGWA 5ICYA 4Y89A 1Z3GH 3KAAA 4DW2H 2HVKB 3JWOL 1B9ZA 1PY9A 3ARBA 1QBML 2J6EL 4PJAE 1X5FA 5TFSL 3VDAA 1BREA 1VCAA 1JHTA 1X5LA 1ZHNB 5ACZA 4I8DA 1VGKA 5C0ND 4FXLA 2J12B 1DVFC 1OM3L 1TTGA 3PQYA 4EKXA 4M5ZL 2HTKC 1IM9A 5KOMC 2D03H 5EZIH 4JGJA 5E4IA 1TCMA 3GJFK 3SDAA 3ZHDA 4G5ZL 1HK6A 4G43A 1N5YH 1NBQA 3MYZA 5AWNH 5ISZA 2V5YA 5DJCB 3OB0K 2F74A 3BZEA 1TJGH 4EOWL 4OF3A 1J0HA 4P4KC 5IFAL 4EZMA 3MROB 2Z9TA 1FGVH 3IFNH 4XH2B 5HGHB 1NEZA 3UZQA 3G6JF 5GGVL 1J1XH 2V6HA 1UJ3C 1K8DB 5I1HH 3FTGB 3P77A 3SDCB 5DLML 4WWKC 3CSYA 1EHLL 4I3GA 4O5LH 4WUKL 4IBLT 3ZYIA 2FSEA 4PGBB 1IC5H 3UX9B 1LQSR 2OQJB 3SO5A 4V2CB 4OAWA 4X7SH 2F19L 2V5RA 2FR4B 5H35A 1E27A 3Q5TA 3KPMB 5JLZB 2HN7B 3MR9B 1XCTA 1JNLH 1RIHL 2FRGP 3LN4A 4KHXL 3ILQC 1Q9OA 2YSSB 3ABZA 4N0FB 3QUML 2C4XA 5IJKC 4YC2B 2A74B 1HEZA 1LNUA 1UM4L 3NPSC 4FQHA 2B5IB 3WYRA 5IMOA 1ZVHA 3CDFA 4MD0B 5E08L 1MH5B 3RZCB 3HR5B 4KAQH 3T2PA 3FQRB 5D1XA 4K94L 5J56B 1PSKH 4ZUUA 4PRIA 3VH8G 3TIEA 5EORH 1MFAL 3QCUH 5EN2B 5I75C 1FIGH 5E6ZA 4LQFH 3SDAD 1ZA6B 3CFDB 4K8RL 3D5OF 3DSFL 3LEXB 1A6VH 3HRZB 3BP4A 4JPIA 5BS0D 5DUMH 5ISZD 3BO8A 4U2ZA 1YPZF 1AFVH 1BEYH 3UTZA 5AYUH 4C55A 1L6XA 3R1GL 5GJSH 1UM6L 3QEUA 4BZ2L 3INUH 5FA3B 3LMJH 3TNMB 4U1MB 4R6UA 2YRLA 3L9RA 2VOTA 3M8OL 1C5CL 4BJLA 3L3OA 3MLVH 3GHEH 4RBPK 1CD1B 1QFUH 4M7KH 3QUZB 5D6DA 5CZVL 3QO0A 5IESL 3FB8A 5HHVH 1G6RL 2PO6A 3DROA 6FABH 3MYJA 5J6GA 2BNQD 5M94B 3QNYA 3RDTD 3RNKA 3O3EB 4DWHA 5DJYB 1MFNA 3CFEB 4L3ED 4HDIB 2QTEA 3PNWA 5TF1H 4OZGA 3ILPB 4KDWA 5F3BA 2HRPL 4HX1B 4P23B 4LRIA 3KYMB 1OQXA 4NZUL 1C5DA 3S37X 1MHHA 4JO3H 3DUSA 4I3SH 1KJVB 1RJYB 1A6UH 5JPNA 1JUFB 4HWNA 2XG5A 1CL7H 5KSUA 2X1PA 4JY6B 5J57B 3RVUD 3QQ4A 1S7TB 4H1LB 5ICXB 3T3PE 1I7UA 1M7IA 4JPWL 1GRWA 4MAYB 4OLZH 4HIJB 3UTTD 1RUQL 1I1FA 2JELH 3F7RA 5BOPA 4KU1A 5FO8A 4WHYG 5D1XD 4LSUH 5C6TH 4K3GA 3S36X 3WLBB 3O0RH 1TCRA 3U1SH 1XF2B 1KTLB 5C0JA 3S6CA 3SJVB 4NZRL 3F58H 4ZAKA 3GJFB 3O8XA 3MV9D 1BIIB 4WNQA 1NBYA 3RTQB 3MBEA 3V9FA 3Q3GA 1CZ8H 4S2SA 2XFXB 2VXSL 5GGSA 2XZQL 4F7MB 3OKMB 4FNLH 4RA0C 4YC2C 2VAJA 1O7VA 3CVHH 3S5LG 4LCWD 4MNGE 1HXYB 5D2LF 1MRCL 2B5IC 2IALB 4EEEA 1F3DJ 3LQZA 2ZUUA 5MEOA 1WUNT 3ULUE 1LO2L 3IXTB 3RZCC 4MWFA 3HNVL 2OL3H 4TUJA 2PO6D 4C83A 3J7HA 4JEGB 2A1WL 5GRJH 3T09A 3JZ7A 3NCMA 4I48A 4DKFL 5FM5M 4KRPC 5FDWA 4LRNH 4Y16D 2FB4L 4OCSH 4OTXL 1FG2A 4AENA 7FABH 3BPOC 2Q86B 1FLRL 4CN1A 1JHLH 1CFQA 2LFGA 4XVSL 4U6HB 3CVHA 1AO7E 4Q6IA 2FYYB 3UPRB 4OF7A 3VXTB 3QZWA 2YD1A 5F7KC 1WBYB 1D5ZA 4TULL 3ZL4L 1P7KB 1ZWIA 3S4SA 1AGDB 2Y5TB 1W72A 2VZ1A 5FYKE 2FJFA 5FUOH 4CJ0A 3WHXA 1K5NA 4JQXC 3FFDB 5HHQA 5IM7A 3BIAX 3QUZC 3V7AE 2ADJA 4LU5H 3PV6B 4MJIE 3UC0L 3B3IB 2BVEA 3D0LB 5E24E 1PZUB 4ZD3L 2IG2H 3P3YA 4O58L 4PB0H 2C3WA 4F37K 1EJ6A 5FOBA 4D8PB 4HUNB 4HCRA 2YUXA 3BUYA 4YIQA 3O8XD 4PV8B 4NQEA 3U7YL 1J1PH 1IL1B 2WINA 2X1QA 1ZLVH 2VDPL 3KS0J 3MBED 4RWYH 5I19H 5L7XL 2O5ZH 4EUPH 2EEBA 4P23C 4OQTH 4D0CA 2YA2A 1AI1H 1DDHA 2R2BB 5J1AB 4UILH 3T4AA 1U8QB 2CDFB 2RJMA 4HXAL 3ARWA 4FQCL 3PF2A 3VCLB 3O2DA 1ZA3B 4OI7A 5DMKA 2A6JA 5CJ8A 3HE6A 1CD0A 3JV5A 2EH7L 2FX8H 4MNQA 4BSWB 3IVKA 4OCXH 1EXUA 1TNNA 4MS8D 1A4JA 4D0DA 4E41E 4EUPA 2X6MA 1RK1A 2NXYB 2FLRT 4JRWA 1AKJD 3JWOH 1KIRB 2APVA 1QBMH 2J6EH 3MV7A 5TFSH 5FUCC 3P9MA 1XF5B 2Z93B 1JZ5A 2QR0A 1BLNB 5JOFA 3IDGB 2VTFA 3O11B 2DWEA 2IAMA 2V5TA 4JFQB 1QO3B 1ZK9A 3D3VA 4U7KA 1OM3H 5IP4A 4IOIB 4ZFZB 4WV1B 4JY4A 4NCC1 4M5ZH 1BMGA 1T2QL 2F15A 2W9DL 3KPPB 2XACC 3MV8A 4G5ZH 4MJ6B 4BQ6A 3QDAA 1FV1B 2J6EA 3HKFA 1I1YA 3LKRA 4LLQB 4K7FA 5DT1L 3BGFC 4EOWH 1DSFL 1S7XA 2ICWI 5I73C 3MRGB 5IFAH 4P57A 4AQOA 1U8IB 5IHUL 3E0GA 2R4SL 4NHUA 3E6FA 4GLRH 5GGVH 3P2TA 3QDMA 2YC1B 5DLMH 1EHLH 3AS1A 3L6FA 4WUKH 1ETZA 3ZKMD 1MHEA 5DMIL 4R0LB 5E8NB 3PABB 4I9WE 4RMSA 2F19H 4FQ2L 5JQ6L 4GAYA 3K46A 4H88L 2QEJA 1KEML 1EGJA 3QFJA 3JV0A 1OF2B 1RIHH 4KHXH 1DJSA 3I6KA 5EOTB 5DDHB 4Z95L 3QUMH 3Q5OA 3IJYA 4M1DL 4WW2F 3MV7D 3IFOB 1TVBA 4MNGB 1UM4H 4RSVA 3ARPA 1GGUA 4F7TB 2OJEA 5E08H 2R1XA 3X13B 1VDGA 4LCCA 4K94H 4RFEA 2PW2A 4Z9KB 3CFBA 4G8GA 5M7QA 4L4TA 5JOPD 1MFAH 1G9MC 1MWAL 4ODXB 1GCFA 4K8RH 1CG9B 3DSFH 3MV8D 2C3GA 4NZJA 3GMRB 3RWCA 2EO9A 1WAAA 4G9FB 4ZFOB 3HE7C 2YD6A 3N85L 5BQ7A 1AO7B 4XNZC 4KV5F 3R1GH 4ZO9A 2E8ZA 1UM6H 4BZ2H 2NXZC 3SKOA 3UDWA 4U6XB 1DUZB 1EDQA 2ZOLB 5HVHB 1JNHA 4R7NA 1RK0B 1OARL 2AEQL 3M8OH 4IRSA 1C5CH 3QDMD 1KGCE 3HG1E 3DTXB 1T04B 4MJIB 5CZVH 3T8XB 5IESH 2JB6A 4M61B 1G6RH 5JZ7D 4Y88A 1KTDB 4JCLA 1FVCA 4WV1C 3PDOA 3DBXB 3OJDB 1IQWL 5C3LD 5F7YC 4M7LT 3W2DL 1VFOA 3QIWC 1HILA 2HRPH 2H41A 4BUHA 1LEKA 3QFJD 2Y7QB 4NZUH 3HZVA 4KKLC 2BVOB 1PZ5B 4OUUB 3HZKB 3SDDA 4LK4A 5KVDL 3P4NB 1KUMA 1K4CB 2NPLX 1S8DB 5F1IB 3VGBA 4MA8L 3PJSB 3SDXF 4JPWH 4M6NL 3MSPA 1RUQH 3FB5A 1MCNA 1Z9SA 2FLBT 1I8KB 3ARDC 2L7UA 4G8GD 4E41B 2HT2C 2CKBB 4XP1L 4R0LC 1C1EL 5HPMB 2G5BA 4NZRH 1D5BA 4M6ML 4P2OB 3MJ9A 4OSUL 3NCFB 3RWIA 4Z77B 2PYEA 4J2XA 1A5FL 5CGTA 2LABA 1KENL 3NVQA 4PD4J 2VXSH 2XZQH 3L95B 2XY2A 1YZZA 4OGAD 4QEGA 4XCFL 5E4EC 3OR6A 1F3JA 1INDL 1QFOA 4IIQC 5CSBA 4IRSD 2LU3A 1MRCH 3MRIA 4M43L 5F1OB 1B4RA 1LO2H 3T2QA 3M1BA 3ZE0F 3H3BC 2I07B 3HNVH 3GMLB 4K8RD 3IAQA 1FFPA 2Q3ZA 2A1WH 5IVXF 3V0VB 4AMKL 4DKFH 3DX6A 3BEWB 3I3BA 3W11D 5ID0B 1EEYA 5HDBE 1EFXB 3EW3B 2FB4H 4H0IA 4OTXH 4XHJD 1FLRH 1YEJL 4OGZA 4QRTB 5DRZB 3UO1L 4I0KA 2QKIA 4XVSH 3STLA 3BPLB 4EIGB 3SDDD 3CZJA 3FB6A 2VL5B 2EXWC 3N9GL 4TULH 3ZL4H 3CCHB 4JO1L 2APWA 1ZLUH 2VSDA 1P1ZB 4PREA 4HV8B 1DQML 5CJXC 3OR7B 5EA0L 3U46B 1HIML 3KPSD 4JM2A 4EQ2A 4HLZH 4CMHC 2NYYC 3UC0H 4TNWF 4ZD3H 4JRXE 3IAPA 3L3JB 4O58H 1QSEE 1NCBL 2F8OA 3TM6A 4GUPA 4MQXD 3PXHA 3CX2A 2PYED 4Z78B 1WISA 3U7YH 4RIRB 4NQVA 2NR6C 2VDPH 1AXTL 5L7XH 3C8KB 1F6AB 2EXYD 4ZPVA 4YDJA 5HY9B 4MD5B 4HWZB 4JFYA 2FWOA 3WKNA 1OWWA 1DBBL 1FJ1A 4HXAH 3IF1A 5FHBL 4FQCH 2WBJC 4FFWD 5LBSL 3RWFA 3VXQA 5ICZA 3QISA 4LPWA 2VR9A 1D6VL 4L9LB 3RVTD 4F8TA 4XPTL 5EUKB 5HPOA 2HFFB 1X5KA 2CD0A 4CVWA 5F8QC 4DZBA 4TOYL 3MXVL 4KK8C 1I8MA 1U8PB 3LN5B 2DWDA 1BFVL 2QJDA 1BFOB 1I1AB 3S35X 4GMTL 4P2OC 4KQ3L 2H26A 3PGDB 1K8IB 5F9AC 1NBZB 4PJHE 1EMTL 3OAYK 2BDNL 3ARFC 3DI2B 2BVYA 4Q9CA 3C6SB 3DUUB 3HG1B 4K9EC 1KN4L 1N2RA 4W68A 5C71A 3GSNA 4UUJA 5IEKB 1MI5A 1TZHA 2HT4D 4KROD 2EDQA 4NQXB 3KYOA 4JM2D 4JM4L 5ADPL 1T2QH 2JJTC 5J0BA 1CE6B 2W9DH 4WEUD 4Y4HA 2BCKA 4QTHA 5AAMA 1Y6KR 5IMKA 4J3XA 4X80L 2XNAA 3RFZC 2FGWL 1UGNA 5DT1H 2PNDA 3BHBA 4IRJC 2FH8A 1DSFH 3VFSB 4YDKL 3GBLA 3KHOA 4N9OB 1N0LA 2F54D 4LLWB 5IHUH 2R4SH 4O9HL 1XR8B 4KUCD 4P2CG 3VE0A 1JTTA 5EBLB 1J0YA 1SEBA 2FEEI 4YEEA 1ZGLM 2LAAA 2BNRE 3BE1L 5DMIH 4F7EB 5T3ZE 3AAZB 2R15A 2D4FA 3G08A 3GMOA 4FQ2H 4XC1L 3NAAL 5CKGA 5JQ6H 2NZ9C 1FC2D 2Y07L 4H88H 3H9HA 1KEMH 1AIFA 3LSOB 5DFVC 3U2SA 5EO1A 3UBXB 1BZQK 1SEQL 4Z95H 4YZFE 2BMKA 1N64L 4LLMB 4M1DH 3V6FA 3V7AG 3BZDA 2OZ4L 2P5WA 4WFEE 5C0AA 5J3HC 3PWUB 3QBTB 3BH9B 3A6CL 1CLYL 2AK4B 1MI5D 3FQNA 3FT4A 2VIRB 3NFNA 4L9LC 5I0DA 3MQIA 3QFDA 4Y4FB 1JMXA 1WVZA 3G9AB 4KK5D 5FA4A 1MWAH 3PQYE 5JOEA 1KPVA 2JE8A 1B4JL 2NY2B 1YUHA 3D87B 3ZSTA 4M6AA 5GRVL 2NY3D 3GRWA 3N85H 5IG7B 5DHYA 1HSAA 1LDPL 5ISZE 1BAFL 1LO5A 4CUCA 1EAPA 1BGXL 4LCUA 5CBEB 2APBA 4XBGA 3RY6A 2YR3A 5ABDE 2WIIB 1E6OL 4Q97A 2BOCB 5F6IC 1OARH 2AEQH 3UYOD 4XVUD 43CAB 4WIQA 1NFDF 2F8VA 1MWAA 2G75A 2K1MA 2MSPA 1QFPA 2AABL 4JRXB 3NIDE 3H9YA 1QSEB 1NCWL 1Z5LB 1HHHA 3DARA 3OAUL 4U1GB 4X4YB 2DQEL 1IQWH 4D0BA 4LDOB 1ZT7B 4UIKL 3V0AC 3W2DH 3SY0B 4EI6B 4MCYA 2QHRL 4WU5A 3HN3A 4GRLC 4PGCB 5E5UB 4P99A 4QRPA 3O41B 1MJJA 1JPGB 3W5NA 2BSSB 2LVCA 4LNRA 1VFAA 5KVDH 3TH3T 4RA3A 4EXPX 3VGGA 3VXUD 1F11A 1IGYA 4JPVL 4B53A 1K3IA 2P5WD 5BV7C 4MA8H 4DVBB 1QBLL 1TETL 3QQ9C 4ZPTA 4M6NH 2BSRA 1Q0YL 4GBXC 4FRWA 4J4PC 1UZ8A 2GFBA 3D9AL 1HWHB 1JF5A 4Y4KC 4CW1A 4XP1H 1QQDB 4IOSD 4PRIE 5I0ZA 3QDJE 1C1EH 2VQUA 2XTLA 4M6MH 4YAQB 4OSUH 4PJHB 1S5HA 1A5FH 4NNXB 3DRTB 3VDBA 3CLFL 4QXTB 4LOUC 3MUGB 1Q0XL 1T80A 4J8RA 3OKKA 1KENH 2Q20A 4U1KA 2VUYA 1NBVL 4XCFH 3X12A 1INDH 3VFOA 4K07A 35C8L 4A6YL 3A6BL 1NH6A 4M43H 4HFWA 1G84A 5F9JB 1ZEAL 3OXRA 5C08D 1QSVA 1QBBA 5IUSA 3SDYL 3MA7B 1LE5B 3FB7A 1ZSDB 1KIQA 2VQTA 5AG8A 4AMKH 4M8VA 1LVEA 1M71B 1J0IA 4JHZA 4G8EB 2NY2C 1KCUL 1VACB 4HBQA 1YEJH 3JV4B 4LFHG 3UO1H 3RWEA 5ACLA 2H45A 4JKLA 3OL2A 3TZVA 3EO0B 4HIEB 5D72L 4FFVD 2OSLB 3N9GH 5C0RL 4J1UB 3QEQD 4JO1H 2BNRB 4R4BB 5A2FA 5DRWB 4XVJL 1QPPA 1DQMH 3EYQC 5EA0H 1HIMH 2GUOB 4X6CF 5INCA 4MAUL 5HHMD 1GH7A 3Q2CA 2P49B 3OX8A 2ATPB 1CXEA 4ODUA 4LLYA 2D31A 1S7QB 1AXIB 1NCBH 2DMCA 5HHNB 5ICYB 1XT5A 1AXTH 3T77B 1KBGL 2Q6WA 3NPZB 2ZCLL 3ARBB 1RZJC 1SM3L 3BEVB 2DMKA 1JHTB 4HJGA 5ACZB 1RUML 1DBBH 1ULVA 5FHBH 5E9DA 2O26U 5LBSH 3MRQB 4F9PA 1D6VH 2YXMA 4XPTH 4KGJA 1RQ5A 4G6FD 5EG6C 1F2XK 3TA3D 3PQYB 2A83A 1UKSA 1FVDA 4RAHA 4FQXA 4TOYH 3BKYL 3LN9A 1IM9B 3MXVH 5KS9A 1I3GL 2DJUA 1QFWL 3RVXD 4EJ1C 2GITA 1X5IA 5TH2A 1BFVH 3SGJA 2WBKA 5DRXA 3AUVA 2IBGA 4G43B 3C60C 5HXMA 1NGZA 4GMTH 3O3AA 3VWJA 4KQ3H 2F74B 3JSSA 1EMTH 5JR1L 4EDXA 2BDNH 4K55A 3BPCA 3TZVD 5F9OL 2EYTA 2E7BA 3EDKA 1BFTA 1OT1A 5BRZA 1KN4H 4CN6A 1VESA 3JUYA 5DJ0B 5C0NC 5D1ZB 4S11A 1CFNA 5JHDA 3OJMB 4LLAA 4FZEL 4C54A 4Z7VE 5LG1A 4JM4H 2Q76A 2IJ0C 5ADPH 2COQA 2X4SB 5HGBA 3GSVA 4URTB 3HUJF 5MENA 4Y5VB 1CQKA 1IKNC 4ZFFA 4QF1B 4OGXL 4X80H 5LVEA 2FGWH 3O4LD 1M6OB 3SE3A 1HOCB 1WIOA 1V3MA 3LN4B 3RWJA 1I4FA 3K74B 4NQEE 4LSVL 4Y8AA 1M4KA 4ZUSB 4YDKH 4AG4L 4BQCA 4Q58C 1HEZB 2UV3A 4Z7UA 2OR9L 4O9HH 1AHWB 5JORA 2FIRT 2W07A 5IMOB 3TCLB 4PJ5D 5ENWA 5E9DD 3PGFL 1YMMD 5JXEA 5SWQA 2AEIT 5FFLA 3GJEA 3BE1H 4ZUUB 3DV4A 5JNYB 4OLVL 4PRIB 4NJAL 4WI6A 3QDJB 2HFGL 2XKNB 1T6VN 4FQXD 2BVTA 4MNQE 2FIKA 4XC1H 3NAAH 4AT6A 2AJXL 2Y07H 1RZ8A 4LVHB 4QHMB 3O6FB 1BWMA 2H32A 3K8MA 2FECL 3UTZB 1KB5B 5J9PA 4QHLA 1SEQH 3QEUB 1N64H 4Y2DD 3NCYS 3BYYA 2OZ4H 5IB1B 4FTVA 3IU3A 2VZOA 3L9RB 3PHQB 5BRZD 3L3OB 4EQ3A 1H8OA 3A6CH 4G8IA 3VFVA 1CLYH 3ARZA 3OAZK 1JVKA 3QO0B 3D85B 2QV2A 4KUCF 4JO4L 1LE9A 3D3VE 3DROB 3MYJB 5J6GB 3QNYB 3Q48A 3O6LL 1P7QB 4KQ4L 1B6DA 1TQBB 2ZWLT 3RNKB 4WHDA 4HEME 4HJ0D 1B4JH 4LSDA 3SDAC 1DLHA 5SX5K 1T7YA 1U92B 2A6DA 1C5DB 1HE7A 1SVCP 1J5OL 1KTRL 1LDPH 1MHHB 3DUSB 4XAKE 1BAFH 1JI2A 3B5GA 3GK8L 3H7BB 4ODTL 3VRJA 3OKLB 4KXZI 5JIKA 2HKFL 2BVQA 1BGXH 1U8MB 3RBSA 2VXQL 5KSUB 2IEPA 2MWCA 4P5KB 1E6OH 3FQWB 3QQ4B 4BH8B 1A9EA 1I7UB 5DEFB 5HVGB 5FO8B 1I1FB 5E94B 5JXED 4OBSA 5IK3B 4LLDB 2AABH 3QXTA 1NCWH 4MJ2A 4U1SA 4PJBA 2YPLA 3ES6A 4I2XA 3OAUH 2DQEH 4RMUA 3RDTC 4UIKH 1BM3L 5KOVC 4O2CA 4ZAKB 1I8LA 2QHRH 1NBYB 1SJXA 3Q3GB 4OZIE 2EH8L 5F7HA 1ROWA 2QADB 4GQPH 3RNQB 2HWZL 1X7QB 1HHIA 4HKBB 3VGAC 4JPVH 1X4XA 3BRFA 1A3LL 4FTVD 3F6LA 6CGTA 3B9AA 4NQCE 2J8HA 1QBLH 1TETH 4LVNB 4RZCA 1LEGB 3AS3A 1Q0YH 4PJ8A 5I9QC 2FX9L 3PE9A 2VE6B 3EHBD 4MWFB 4DKEL 5D1XC 3D9AH 4G8GE 3IDJB 2JCCF 4L4TE 3QXDA 3PGCA 1QEWA 1ACYL 4OLWL 4OFPA 4HJJL 4UBDD 3IDNA 4ODSL 4XPAL 5F8RC 1I1RA 5FDWB 3W0WE 2G60L 5FYJE 5DK2B 3X11B 1FG2B 3CLFH 1DN0A 4MNHB 5EPMA 2VLRA 1CFQB 1Q0XH 2YMXL 4X4XA 1WJ3A 1RHHA 1FNSL 2KUTA 1NBVH 3N0PB 1D5ZB 2ARJA 1ZWIB 5DUPL 5F9WC 4RMRA 4JFPA 3S4SB 2X4RA 5FM5O 35C8H 3KR3L 4JVPA 1W72B 3D0VB 3A6BH 5D5MA 4A6YH 2R9HD 2RHEA 4Z7VB 5DD3L 1K5NB 1OVZA 1ZEAH 3CLEL 4P59L 5CBAB 1T1YB 2ADJB 5D6DC 3SDYH 4MQSB 3L3HB 2YPLD 1N5AA 5I17B 2PO6C 3QB7C 1XGUA 3GSQB 1NGWA 5DJ2A 2P5EE 5FOBB 4PJFA 4NQEB 4N0YL 1KCUH 2Z91A 4LRIC 5T33L 2BRQA 4D0CB 5C9KA 1UACL 1DDHB 5D72H 1WCBA 1RIVL 1YQ2A 3TVMD 1YYLL 3SE8L 5C0RH 4ZUVB 1UB6B 3DSNA 4RWHA 1U3ZA 4NT6A 1IKFL 1M05A 4KPHL 4XVJH 4LHQB 4M5YL 4N0UE 4U1LB 3HE6B 4MNQB 2MHAB 1OTUD 1FFQA 2EC9U 4MAUH 5FV2A 3T1FA 4A2MA 3T0BA 3TPKA 1MHPL 1EXUB 4QRUA 4LVOB 4OZFH 3SCMB 1A4JB 4B41A 1ND0A 4MA1C 4BQ8A 4KH2A 2N7BA 2IQAB 4XPHL 4ZAKC 4PG9A 4P46D 1RK1B 3O8XC 2VLRD 1NEZG 5IEHB 1KBGH 2FHFA 3MBEC 2ZCLH 4JGMA 4R26L 5C0BD 3HNSL 1SM3H 3P9MB 2KPNA 3RGVD 3VFPA 1DEEB 1JHKL 2DQIL 3FOLA 1XIWB 5EC1A 1RUMH 5JOFB 1KV3A 1CN4A 2IAMB 4HUWB 4OKDA 4YXKL 3D3VB 3QAZB 3QG6B 5HYSA 3G5YA 4LVNC 4OZFA 4ZYKA 3S7GA 1ZHBB 3BKYH 4D2NA 3JTSA 1I3GH 1P5UA 1QFWH 1KJMA 2DQUL 43C9B 2W60B 3B9KA 3K4ZA 2OX5A 1UG9A 4HZLB 3L3GA 4MS8C 1HQ4A 1A7NL 4G6KL 3U83A 1IGML 1NKRA 3LKRB 4MMZC 4WO4A 5JR1H 4NUJA 4V1DA 1S7XB 4PJ9A 4YGAB 3P30L 1F4YL 3MLXL 4P57B 5GZND 1G7PA 2M26A 1QLFA 3HI1A 5JIHA 5F9OH 1U8NA 5DO2C 4NHUB 3E6FB 3IRZA 4Q6IC 4UU9A 5F72S 4YWGL 2EKSA 2X05A 1DANT 1FZKB 1I3RA 1UXWB 1QSFA 1JGLL 3L6FB 2QQQA 1ETZB 5E2UL 4ODHL 3HS0A 4IJ3B 4NN5B 1MHEB 5IB4A 4FZEH 4NC2B 1SYVB 5FXCH 4RRPA 1PEZA 1V3LA 4GS7B 4GAYB 4Z7QE 5EWIL 3VD3A 4MHHG 4OZIB 3EDEA 2HAZA 4OGXH 2CLRA 5ESAA 1FYHB 2AP2A 2FJHA 4R3SB 5E7BA 5DD0L 4LSVH 4J23A 5E03A 1R24B 4AG4H 5INDA 2B0SL 3IJYB 2H2PD 4HG4J 2GTZA 3CXHJ 4NQCB 1NUDA 2OR9H 3V5DA 1IEHA 1JNJA 4E0RB 4F3FA 3PGFH 4UDTA 2XQYK 4HF5L 2PW2B 1OOAA 4K7PX 4C4KT 4OLVH 4L4TB 3HE6C 4NJAH 4R7DA 2HFGH 3ZKMC 3QUXB 4KC3B 3W0WB 4KTDL 2AJXH 5T1LD 4FG6C 1AR1D 3RWCB 1YMHA 5EU6E 4QNPF 4H5SA 5BQ7B 1SMOA 3ZDZF 1JWSB 5MERA 4PJ9D 1XF1A 5DZOA 3FQTA 5T1DL 5C6PB 3V4UL 1BD2D 3RUGA 5F7WC 1JNHB 4PGJA 2CK0L 2AJ3A 1U95A 3C9NB 3W9DA 5E8DL 3H8NA 2NX5E 1KPRA 5EBWA 3EDFA 5H94A 1MIML 3V6ZB 2CH8A 3QAZC 4JO4H 1Q94B 1FVCB 4MCZA 3O6LH 2P5EB 3MGOA 4KQ4H 4OF0A 5E8PA 2R23A 3K1KC 4R97B 3UTPE 4PBWD 1HILB 4YPJA 3WNPA 5KSAA 1IGCL 2DOCA 5EUOF 1J5OH 1FFNA 1CFBA 4J3TA 3GK8H 4ODTH 3V8CA 1X5AA 2CKNA 1KPUA 2HKFH 1IGJA 2R1YA 3G6JE 2VXTL 2VXQH 4H0HB 5CSZA 1MHCA 4N0UB 5TGBB 5HTSA 4GW1B 3N06B 2CMRL 5ESVA 3D2UA 5HI3D 4QOKA 4X7EC 4LAJH 1XFPA 4X9HA 3FO1A 4AQ1B 4IJ3C 4NN5C 5A3ID 5D7LA 3UXFA 4KRMB 5D2NA 2AQ2A 4R8WL 1BM3H 2G5BB 1D5BB 1A02N 2NQCA 1AGFB 2APTA 2CR6A 3QZWG 1FL6B 5TE7L 2EH8H 1F13A 5JDJA 3VXMB 3S4SG 1WWBX 4F7PA 2IF7A 1A6AA 2HWZH 4JVUA 3TEUA 4FQJL 2AJZA 4POZD 1A3LH 3OR6B 1F3JB 4C56A 1FIEA 4U1HB 1HNFA 1EO7A 5CGYC 4LQ1A 1I9RL 5C0AE 2FX9H 2ZOKA 3ZO0A 3AFLA 3M1BB 4DKEH 4LCCC 1KNOB 1OQOA 4PJCF 1QA9A 1SHMA 4E5XB 2Y23A 3M07A 3ZMRA 1J87A 4OLWH 1ACYH 4H26A 3WS3A 3KLHD 4HJJH 4XPAH 4ODSH 4ZOBA 3WD5L 1EEYB 2G60H 4UINL 5KSAD 5C09D 1MCIA 2DLIA 2YMXH 1G7LA 2QKIB 5KTEL 3OKEA 2Q3AA 2YPKA 3FO2A 3NFPA 3W5MA 1FNSH 3D18A 3LEVL 2VSCA 3W9EB 3UDWC 5D7JB 5DUPH 2FO4B 2FO1A 3KR3H 4OGAC 5JW3L 1CDBA 4KFZC 4K94C 5FYLE 5KSBA 3TIDB 5DD3H 4UNTA 2YUWA 4IRSC 4JZJA 3D25A 3D2UD 4GAJL 3CLEH 4P59H 4OZ4A 4QOKD 3O3BA 3EIFA 4QHNB 4EUPG 3T3ME 4LSQL 5EC2B 2ADGA 4K8RC 1XCQA 1OGAA 5D7LD 1G7JA 3VFTB 4YJZL 1P6AB 1MF2L 4KDTA 5F1NA 4NQVB 4N0YH 4TN9A 2GT9B 4Y1AE 4OKVB 4XHJC 1FAKT 3PP3H 1A3RL 5T33H 1UACH 5F7FA 4BQ9A 2GJJA 4QRPE 1RIVH 3SDDC 4LAQL 1YYLH 1XR9A 3SE8H 5GSVA 4YGVB 4PBVC 2QQKL 1H5BC 3VXQB 3WKML 4C56D 1IKFH 4TSCL 1C7TA 4KPHH 5ICZB 4KWUA 1B0RA 3BESR 4M5YH 2A6IB 1W8NA 1NDGB 5SWSA 1OTSD 1SBSL 3QNXB 1QVOA 3WL9A 3T0DA 3B8YA 4GG6F 4BH7A 3QDGA 3UPAA 1MHPH 4I0PA 1I8MB 5IF0A 5A2KH 3WHE1 4MJ5A 2DWDB 5EU6B 3TN0D 5D7KD 4U6VL 3GMQA 2PR4L 4KJQD 4XPHH 3GDBA 2H26B 5D7IF 3CIQA 2XPGB 2EXYC 2EZ0C 2Q8BL 4R26H 3HNSH 2PW1A 1N59A 4OM0L 1JHKH 2DQIH 1KCRL 1CQYA 5L0QC 2NX5B 4N8VA 5D2LE 4YK4C 3BJ91 2ORBL 3GSNB 4UUJB 4YXKH 5A43C 5I74B 1TZHB 2A38A 4HIHA 5CJ5A 1QNZL 4QYOB 3RVTC 1BP3B 2H8PA 2B20A 3KYOB 5E2WL 3TV3L 1X3DA 4NM4L 2VMFA 3TH4T 5CEXA 1B3JA 3U6RB 3MRFB 4DK6A 4L4VD 2DQUH 1EVTC 4Y4HB 4CNIA 1A2YA 1LD9A 1A7NH 1D5XB 1JGUL 1RZIA 2F53D 3P0VL 4G6KH 4ZO7A 2NY3B 1IGMH 5GGUA 4DGYL 1T2XA 1HSBA 3PP4L 3T2NL 1CL7I 3G6JB 2W59A 3P30H 1U8OA 2X89A 1F4YH 3MLXH 4JFFA 4HH9B 1J05A 1H3WM 4QRRA 4YWGH 2ZSWA 3VE0B 1FHGA 1GL4B 2EYRB 3TYGL 1JGLH 1SEBB 3R06B 3BQUA 1UJTA 5E2UH 4ODHH 4HUVA 3GKZA 2IH3A 4BKLA 2GY7B 4QKXB 4KROC 3QDGD 3G08B 4JM2C 3WIHA 5J1SC 3GMOB 4NGHL 5C0CD 4HKXA 1EBPA 4YBLB 5EWIH 1T5XA 1EHAA 5I1AA 5FO9A 4Z0XA 1J8KA 4X8JA 3G5ZB 5EO1B 3RQ3A 1CDCA 1FH5L 1QYGL 5DD0H 3RWHA 3IFLL 2BMKB 4NNYA 2B0SH 3NZ8A 3V6FB 4CVZB 5IHZA 2BZDA 1UT9A 5KANG 4DOHE 5C0AB 1HNGA 4OV6F 3FHQA 5DD1L 3SGEH 3E2HC 1YY9D 4HF5H 4S10A 3MRCB 3MX0A 3NFNB 3P4OA 2LU4A 5C1MB 5JA9A 2IANA 5KAQG 1FNHA 5GRZA 5FA4B 5IROA 1S3KL 4KTDH 2EE6A 2I60L 1F3RB 4JG0L 5KS9E 2ZUQB 2HJLA 3D39A 1A14L 3QCVL 5DHYB 5EULV 1HSAB 5C7XL 3ROOA 4P2YA 2A6KA 1U3HA 4JHWL 3MV11 5T1DH 1BQLL 4JFFD 2PETA 3V4UH 4XBGB 2GJ6D 4RQQB 3WNMA 4NN6B 4QRRD 1OAUL 2CK0H 4GKZA 3BKML 1UA6L 1JWMA 5E8DH 2YHGA 2G75B 4IDJL 5C0IA 1MIMH 5J12C 2V5MA 3RWGA 5E6IA 3FQUA 4WHYH 1HCVA 5JHDE 4D0BB 4P3DA 4KK5C 4Y1AB 3WIIL 4Q9RL 4Z7WF 4Y4HC 4WU5B 3DPBA 1IGCH 5MENE 4BZYA 4QRPB 2NY3C 4WTWA 4JREC 4LNRB 1QR4A 5CGMA 4AIZB 3MZTA