4QO1B

P53 dna binding domain in complex with nb139
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
199
structure length
199
Chain Sequence
b'PLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nb139 Nanobody against the DNA-binding domain of p53
publication title A nanobody modulates the p53 transcriptional program without perturbing its functional architecture.
pubmed doi rcsb
source organism Lama glama
molecule tags Apoptosis, transcription
total genus 49
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qo1B00
4IBQA 2YBGA 4AGLA 1GZHC 2J21A 4IBZA 5AB9A 3WU1A 5BUAA 1UOLA 2MEJB 5KBDA 3Q01A 1GZHA 3D07A 2J1XA 3Q05A 3VD2A 2J1ZA 4IJTA 3Q06A 3WTVA 3D05A 3US1A 4HJEA 1EAQA 4GUQA 3QYNA 2AHIA 2BINA 2J1WA 5AOJA 1T4WA 2X0WA 3ZMEA 3D08A 2IOIA 3KMDA 2X0VA 5AOIA 4IBSA 4AGOA 5ABAA 3WTXA 3D06A 4LOFA 4AGMA 2ADYA 5G4MA 2BIQA 4LO9A 3WTWA 2PCXA 1EAOA 3D0AA 5AOKA 1KZYA 2H1LM 5G4OA 1E50A 1TUPA 1H9DA 1LJMA 3WTUA 5ECGA 3VD0A 2X0UA 2XWCA 3TS8A 5A7BA 3EXLA 1IO4C 5AOMA 2GEQA 4L0YA 3KZ8A 1CMOA 2BIMA 2ATAA 2J20A 1YCSA 4IBTA 4G82A 1CO1A 4GUOA 2IOOA 1EANA 2IOMA 3WTYA 3WTSA 3IGLA 4QO1B 4IBUA 3WTTA 1HJCA 4A63A 2FEJA 3D09A 2BIOA 5AOLA 2OCJA 4L0ZA 2WGXA 4IBYA 4MZRA 2XWRA 2J1YA 4L18A 2BIPA 3IGKA 5LAPA 1TSRA 1HU8A 4AGPA 4IBWA 3US0A 4AGQA 3QYMA 4IBVA 5G4NA 2J6WA 4AGNA 2VUKA 3EXJA 2RMNA 4LOEA 4MZIA 5LGYA 3VD1A 4KVPA 1HJBC 2AC0A 4XR8C 4G83A 2P52A
chains in the Genus database with same CATH superfamily
3BSGA 3V7AG 4TUJB 2VOTA 4Y4FA 1TZOA 4LVHC 3L7EB 4JFFB 5BVJA 3L3DB 3FN0H 3DO3A 1SJXA 3QA3B 3EOBB 3QQ3A 1YAZA 3TURA 2WLMA 3N44F 3KLHD 1ASQA 1R0AH 1XF5B 3TTYA 3DMMA 5EOQL 4OZGB 3ELAT 4PG9A 4A7GA 5EC1B 1CFVL 2VAJA 4OF0A 2IGTA 5HGBA 3BW9B 3TYGL 3B9VA 3GMQB 4UV7L 3M88A 1YA5A 3WMSA 4G9FE 4HKBB 5JA8B 1W80A 2I60L 3KPSA 3UTSA 3BUYA 4AKPA 4KH9A 3QARA 1JZJA 1FN4A 2YPKB 3T4AC 4TKWA 3CC5B 3LKPA 3MACL 5FUCC 1EBAA 4KDVA 3EO9H 3ZKSD 4WK4B 2YN5A 1YNTA 3T71A 3T8MA 4P23C 3IGAA 4AZ8B 5B39B 2YK1H 1OGAA 1DSFH 3QHFH 3BIAX 2QHRL 1E28A 1QHQA 5F7WC 3MLVL 5KBMA 3V6ZA 1KV7A 3PQYB 2X40A 3OQRA 5ALBL 4XMWA 1PIFA 3QH3B 4LSSL 4R90L 1C7SA 1NWOA 2FBRA 3HE6D 3DUUB 3DI2B 1TENA 1USQA 2AP2A 2D7MA 2Y2TA 3C87A 3DDGA 4FNQA 4HH9B 4Y2LA 1S9WB 4N8VA 3ULUE 2Q20A 3D2UB 4Z7OE 2A5UA 1S8DA 1H9DA 1TUPA 5D7IE 3HI1A 3KWTA 4FTVB 2EE0A 2XXMB 2GVYA 3U7WH 1NBCA 3T1FB 4QEGA 5I71C 3LPFA 2ZX7A 3O6MH 5E94A 1SEQH 3Q13A 3NIFB 4KTGA 1UYWH 3HN3A 4PG2C 3MREA 4XMKH 1OZUA 4E9RA 3T4AA 1AGDB 2WNWA 1SDAB 3VW3L 2QVKA 1SFHA 3EGDA 5AKRA 1LMKA 3M8OL 3BKML 4GEJA 3QJXA 4LKCB 5EIIB 5HGAB 2CG9X 3G7TA 3DPBB 4EE2A 1TTAA 1JK9A 4XP1L 1J9RA 1F6LL 1NZRA 2Q3AA 4F7PB 1UJ3B 2ENPA 1GGIL 2ZF9A 4YE0A 2BM3A 2ESVD 4L4VD 3GBNH 2VSKB 2W0PA 2R51A 4HPYL 4Z3GA 5TE6H 4RISH 3P0VL 1UD4A 4HFUH 4MAUL 3DHMA 3BO8A 3Q1EA 2YEQA 4GXVH 1EV2E 1IGYB 2Q76B 4PG2A 2Q87A 3G9AB 1I3UA 1RP8A 2VDKB 2ERJC 3VQ2C 1P1ZA 4R7NA 1R3HA 4J3OC 2KLTA 4NUPA 2BY1A 2P5WE 4PLOB 5DZOA 3BP7B 4YAQA 3WEAA 3EFOA 1A47A 5IB1B 1ZWIB 1XH3B 1XH0A 1WGVA 3L5IA 3PV6B 5EZIL 4IDLA 3WSQH 2O61A 4FQXB 4GXUM 3DYOA 1QP1A 3ARWA 1ZT1A 4ZS7H 1LD9B 2VLKE 3IDGA 4AMKH 2VW4A 3QUKA 4WU7A 2BO0A 1HH9B 1ADQL 1JHLL 1TJXA 4AQZA 4BKLB 2XXGA 1GZHA 2H0FA 3A6BL 4LVOC 1KTRL 4JO5A 1HX0A 4NNXB 4RRPA 1AJ7H 4P4KC 4D3CL 5GRJL 5ESAB 5B7FA 2F0CA 1M7IB 1EZSA 5IVZB 3WTVA 5KS9B 2ICEC 3CXFA 5FGBC 5KN5B 3G5YB 2W59A 5ICXA 3ZDZE 4OLXH 4YEFA 3F58H 1ACZA 1CDJA 1R5VA 3C08L 2D3JA 3QUXB 4ELKB 1BQHB 2Q3ZA 2VRAA 3ZDYF 2QKIB 5DHVH 1AIFB 3EH4B 3JSSA 2VDOH 4Z3HA 5CHNA 1K4DB 1CL7I 3O6KL 3WN5A 1OVZA 5C0CA 1FG2B 2MHAB 3MLTA 3SCMD 4LIQL 5EEUA 4PJEB 2FO8A 2A6IA 4XPGL 5DURD 2FHCA 2VN3A 1BD2D 4KKCC 4IMLB 4JFXB 3DYPA 4DT2A 2V17H 4JJHA 1D7CA 2GJJA 3DX3A 4ZX3A 4RMQA 3VA2C 3TWYA 4P4KA 3IJEA 4EBQH 4OCXH 4H8PA 4YMPA 2H47C 4YS4A 4PJCA 4DN4L 2C9VA 3JV6A 4N3UA 4X98B 3VFUB 4FNRA 1FHNA 2PXYB 4FQ1L 4MQTB 1QEXA 3BZFA 2C3HA 4OCRL 5BV7H 4GAJH 1KB5A 5GSVA 2VDLB 3MV01 5GGSB 2YWZA 1HILA 5EU6E 5I30L 1CGYA 1A3RL 3SN6N 1G7HA 4FABL 4KNQA 3K0WA 1DO5A 1G9ML 4JPQA 3QORA 4QYOA 4OLVL 5T8IA 1RAMA 1JNHB 1A7QH 1A6VL 5FWQA 2ZUTA 1RK1B 4G6FB 3OKDB 4JN1H 5LNEA 5D1ZI 4QRUA 4FJ6A 5D4HA 2X89D 5BXFB 1WCBA 1S78C 3RA7L 3QUZB 2CU9A 5L2KE 1GVIA 1TXKA 4JS7A 5TFSH 2XWBB 1L0YA 5L2JB 1OPGH 1K2DA 3FZUC 4AGPA 2X4PB 5F0JB 5C0EB 3VQLA 4U31A 3O9WB 1ROWA 3HBGA 1DE4A 1MG3C 4R2GC 4YFLF 5B4MC 3SE9L 2O30A 3POCA 1NKOA 2E3VA 3BP6B 1EFXB 4ZODA 4FQHB 3QJQB 1HNGA 1DBBH 2GC4C 3HG3A 3WL9A 4YXHH 4QI3A 4XXWC 1FGVH 3E80A 3IS1X 4WI0A 3H2WA 4IK6A 2BVTA 3UTPE 1S6NA 4HZAA 1KEGH 4PJHF 3NFNB 1ZA3A 3QWRA 4O2FA 4XAWL 5A3IC 2DDQL 3MROB 4IIQA 3H9ZA 2JB5L 4M9OA 4K9EH 5HBBA 3SDAC 4XXDA 1BZ9B 1L9MA 2XNAB 8PAZA 1YMHB 1VA9A 1MY7A 4OGQC 2F5BL 1EO8L 4NWTL 4JM2C 4G9FD 1MW3A 3N6YA 2HJLA 4HMEA 3SD5A 5JR1L 5L88L 3W5MA 4ZT1A 4Z78A 5F9AC 1G0DA 3T0EC 1DVYA 2VDPB 4ZDHB 3G6JF 2IANE 1A6AB 2DMHA 5SX4H 3WHXB 3KLKA 4QGYA 2CMRL 3VB9A 4DP7X 3II1A 1KIPA 2WLKA 5TDPB 3RWCB 5HYJE 1JZ6A 3PHAA 4RBPH 4IBSA 1PPIA 4KKLC 4FFTA 1CDUA 3L3IA 4U1JB 4XXWA 4Z7WF 5A43C 5C0BA 2AQ1A 5HHME 3PAVA 3HOGA 1BZOA 1XB8A 2X3AA 3MV9E 2OL3H 4UIMB 4ANXA 2D2OA 1GKEA 3FFCA 5IB3A 1IJ9A 2NUPB 1PX3A 4PJFA 4JY5L 4WUUE 3ZUCA 5E03A 4IKJA 3QNZA 1AR1C 4DO4A 1G5AA 5HYSB 3WV0A 3NSXA 4WWOA 1U3YA 3QNXB 3TONA 4PS3A 4UQ3A 3T0EA 1IC4L 3E1F1 2NXZD 1FRGL 3QS3A 4H25B 3P3RA 1MHEA 5LBSH 1UENA 2CCWA 2DKMA 2HKFH 3KR3H 3LCYA 4TPRH 3KYMA 3VFRB 2P8MB 1R3KA 4PMEA 2VLJB 4UNIA 3V6FA 4MD4A 4HLEA 2W38A 3KHOA 4W4OA 2XWJA 3HNSL 4YLCA 1U8NB 2PPCA 3GXDA 4NM4H 1ZANL 1ZGLB 1QFWL 4G7VL 4KXBA 4UDTB 2R2EB 1NFDF 2B4CL 5HSFA 2PPEA 3JT2A 1EZUA 4N6RB 5T5NF 1I31A 2VYRE 3BN3B 3TO4C 4KZDH 2H1PH 3LSOB 3SBQA 2XACC 3AADB 1WTGT 3HLKA 6FABL 3B5TA 4JN2A 3UIYA 1YMMB 3FUJA 3EJPA 3EJSA 4AGQA 1IUZA 1MRCL 1P84J 1DZBA 4JKLA 1J0ZA 3HC3L 3DVIA 1OO2A 4UIKH 1JWMB 1U30A 4BWWA 3T09A 1IQWH 1I75A 4OGXH 2GHZA 4WU5A 3AQYA 3B2UC 3DX6A 4LASL 1M2VB 4TQEL 4MJIB 1AGFA 3VXQB 2Y2WA 4JFFE 1YEIH 2DIJA 4DGVH 3JZ7A 3CFDA 2VLKD 3S3JA 1XF2A 4LPXA 4C47A 5HI5C 1FFTB 4OZGE 4JKKA 1PNDA 3RWFA 3SY0A 4CSPA 2WBXA 2ODIA 5J4MA 3NJLA 4X4XA 2P48B 2XA3A 1GS8A 2CRZA 3JWNG 3W9DA 4GRLD 3MLRL 3M07A 3TO4A 1TTRA 2FLBT 4N0UA 4AMXA 3TA3B 4B9PA 1XR8B 4N25A 2VM3A 1QASA 5E95B 1LP9F 3VI4A 4JPWL 4JVWA 4AEHH 3HR5A 4QTHB 4YHOL 4O02L 5FUOH 3SPHA 1QFUL 1NCWL 3EADA 3P4OB 3HHSB 1CTOA 3M1CA 1OHZA 4ETQA 3IMTA 2G9KA 3DHJA 2NY0C 2ATKB 1P4IL 2VH5L 5SWZB 3X11B 1GCYA 4NIKB 5KBPA 3FN9A 3AREA 2LLGA 3PQYE 1OWWA 5ILTL 5AVUB 4WNQA 4QNPE 1DYZA 5SX5K 2NR6C 5EWIH 4BZ2H 3CVCA 4KK5C 3JV0A 3MZGB 4J4PA 3MJ9A 3VDCA 5IQ7L 5I1CL 5EDXA 1SHMA 5C0FB 4KTDL 5FLUA 1XCTB 4FTVE 1FVDA 5CLXA 3UZQB 1I85C 4Q9QL 4KQ4H 4ZFOL 1MAKA 3MO1A 4KXZI 5HHVH 4H4NA 1ORSB 3NIFE 4IHOB 3VXSB 2IPTH 2OR9H 5DK3A 1IVLA 5I1AA 2C9RA 2EH8L 3BFWA 4U0RB 1L0XA 3FCSA 3UPRA 5DUMH 2O6FA 3BC9A 4I5BB 3HZ3A 2BSRB 5EU6D 5F6IB 5HP5A 5C9JA 1DQQA 2H3NA 3RGVD 1S7XA 5MERB 4YSDA 4I1NB 1RZ7H 3TPKA 2XXCB 5CUSL 5TE4L 2AXGA 1HCZA 3TBTB 2NR6A 5FV1L 1SMOA 5DWPA 3T2NH 5ISZB 3EGXA 2VMFA 3MNZA 4RGOL 4PW4A 3U2IA 4P06A 2GCYB 1DJIA 3ZZSA 2PW1B 4AYMC 2BHFA 1I85A 3PHOA 1NDMB 5D72L 2X2YA 2VQ1A 4EI5A 5B38B 15C8L 5CIPB 4H20L 2QTVA 4LHUB 5K9JH 5L2KD 2CPUA 1CL7H 4I0KA 1BAWA 1M57B 1IBGH 2J71A 2QKSA 3L5XH 1H9VA 4I13B 3CCHB 4TOYH 3TJPA 2GTZB 1DQJB 5HI4C 3PWLB 1FH2A 2JJVA 2IPKB 4GT0A 4BQ8A 5AUMB 4L3CA 4U4IA 2VXQL 5AVYB 1DJHA 5CNHA 5JIPA 1Q94A 5A16B 3DX4A 1WZ1L 4LSPH 1QO3A 3FT9A 2ALWA 4JRYB 4V2BA 2O6EA 4AI7A 4F15C 3UTPD 2PNDA 5ACLA 4WWKD 1X5KA 3PY9A 1A6UL 3WY2A 2PCFB 3C6LB 5KJRH 4EIZC 5AKSA 2PTVA 4JQXC 5CEYA 4A7UA 4MB3A 2Y06L 3T0XA 2YPLA 2PO6D 4U3SB 5KS9E 5E8DL 1PZ5A 2Z3FA 4FL4B 1LNUB 5J8OA 2C1PA 5LWYH 5C71A 4A6YB 1XH1A 4X0KA 1FIGH 2Y5TB 2IAND 2G2PA 5GHWL 5C0GB 4M3KB 3ILPA 3PNWA 1ZXQA 4PWJA 3KS0J 3MA9L 5HYJD 1OT2A 4CN1A 4OZIF 2OMWA 1A6PA 1BF2A 3HJEA 1YEEL 3L95A 3FTXA 5D7LA 4NJ9L 2X9YA 4PJEE 1ACCA 2NMSA 3MV9D 3WS6C 1F1DA 5FKAA 1QUNB 5FPIA 4JQXA 4QT5A 1QWNA 3PREA 4OJCA 1IFRA 4ZNEA 1SEBA 2IWKA 3EBAA 4MMZB 3TH4T 4WUUD 2OBGA 4OUUA 4OCMC 3PDDA 5B1KA 1CPUA 2YEVB 3HEIB 1T0NB 3O3EB 2A9MH 5CR8A 4U6YA 3VCLB 1T7ZA 3EO1B 4D8PA 4AE1A 5D1XA 3QW9A 5FO8A 2XQYA 2V9QA 2WLNA 1H6TA 4TULL 3OHMB 5JIIA 1W8NA 5DMGD 4ZQTA 1WDAA 4S0TD 2G2RB 2JCCB 4NKOB 1D7DA 3GI8L 4OAWA 3QRBA 3DA0A 3O2WL 4WO4D 5ES4B 1YECL 2H26B 3PXLA 4QUOA 5ADPH 2Y7LA 5BCAA 4Z8FH 3MPCA 2B5IC 2WXQA 4ATTA 3WS6A 1T5WA 3U6RA 1JN6A 1PYWB 3MV8B 2EDLA 5JOPE 3FO9B 1QSFB 4HOWA 4F2MB 1IT9L 1T5XB 5IBUG 1KN2H 3U79A 3LKSA 2CR3A 3INUL 3MOAL 3MJ8B 3ESVF 1HCVA 1A1NB 1DR9A 1P5UB 1SHSA 2YAHA 3NFPB 4HBCH 3JWDC 4OGZA 4PY8I 5DK0A 3V6OE 1MWAA 4Z7UB 3QI9C 4BD4A 3ULVC 1F41A 4HFWB 4YDNA 3V5HB 1BQLH 4C4KT 3C6EA 1G6RA 3VGBA 4P2OC 1OSPL 2OMZB 1RZ8A 4I18A 4K07A 4Y7MA 2VABA 1ZLWK 5IM7A 3WFBH 3QPQC 1E7VA 4QXVA 4A7GF 3CZNA 3V4LA 4JFFD 2MCG1 3VO0A 2ZCHH 3FFDB 1B0IA 1T7XA 1NFIB 2AEOA 3T04D 1JHKL 4BCXA 4WF7A 1PU0A 4L0PB 4UT7H 1PD0A 2EDRA 1VEOA 2DH2A 2VWEE 5D2NC 5E4AA 5F3BA 2G5UA 5KBKA 1XL6A 1VGEL 4BELD 2GAZA 3GB7B 4L05A 2AJXL 2B0SH 4MD0A 5E2JA 1IJNA 4OVUA 3EJZC 1NPNA 2GUYA 3FS9A 4ZPTA 5FLVA 5A2AA 2VC2H 1YNTF 2P5EB 4A2HA 5EF2A 3QI9A 3DXAA 1JZEA 4JDTH 4M8QB 1DJWA 1UQSB 1S7UA 5HHPB 5MHSD 4DSYA 1XIWB 1BGXL 3U1SH 1TR7A 4WW2B 3H7BB 4E36A 2XN1A 1LO5B 1FGNL 1WVZA 2ZJSL 4LEXL 2X4NB 4LPVA 4YBHA 5F7KC 3PQYD 1VFUA 2WBJC 4PLJC 3H42H 4ZFZB 4IRZH 3NGBC 1HCYA 4F7EB 1A6ZB 4WI3A 1SJVA 2WQ8A 4CW1B 2VR3A 5LCVL 3SBPA 2R69H 4IRSC 1H8LA 5AW6B 4P46C 4DKTA 3D2UD 4C56D 1YEGH 3ECWA 2YD0A 3DDFA 4FTVD 3JWOL 4OLYH 1NEPA 3ZGHA 4G8IB 2QMKA 2Z9TA 1M6OA 1MHCA 3BP4A 1BAFH 3O41B 1XL4A 2HRGA 4E5XG 6PAZA 4DO5A 2HN7A 4I87A 2QDVA 2KLSA 2XN0A 3ETBJ 5DD0L 3RWDA 5EBWA 5K39A 4AQAB 1SOKA 4GUPB 4K5LA 4S2SB 5IROA 3SO5A 3BGFB 5ETUB 2VLJE 3DPDA 4OJFH 3WTTA 3UGXA 4JPSA 5FHAL 5DMYA 2WBWB 2X4TA 4AENA 2EDEA 5F7DB 1R6VA 3AB0B 2Q8BH 3PCYA 1HSBB 3D85A 3L3HA 4KJWD 4IRSA 5GGRB 1JZGA 3K4DA 3VGFA 1Z6JT 2EDNA 4P46A 5D55A 2BSDA 2XN2A 3VSVA 4ZMXA 5GGSY 5IMKB 2IH9A 3TBSB 4RCAA 2F58L 5SX5H 3OR6B 4GG6A 4K5OA 1KGCD 1TSRA 2F53B 3V4UL 5IESH 2AS5M 3BCFA 3C8KB 3GI9H 5ITFB 3BRGC 1YMME 2PYFB 2Y9RT 1OF2B 2UYLB 2AEWA 3NCXA 3GUTA 1JNNL 4NQSA 3FK3A 2AQ3A 4POZD 4QHPA 4ZMLA 3IDMB 1U8LA 1NCCH 2WKGA 3PV7A 5CD3A 4NC2B 3ZRSA 3GK8L 1FH5H 4MQXC 3VD2A 2ZG3A 3JV4B 1J8SA 5SWSA 1IAIH 4MJIE 2HJKA 4NQVB 3MV7B 3VFNB 1M7UA 4FQXD 4KXZH 1UA6L 2BSED 3LZQA 1CF8H 4Q2ZB 3DSNA 4Y9CA 3VE0A 1JV5B 4PIRF 2OXHB 2UXFA 1U4EA 5DI8B 2AVFA 3S5LG 1LQBC 4EZMA 4U33A 2LQRA 3MRRB 2FWOA 2O72A 3B2MA 3O45B 4FQ2L 1ZIAA 4XVTH 3ZL4L 1EJ8A 1A64A 3L9YA 4LPWA 2R8SL 1OGPA 1EAQA 5HHQA 1SYSA 4J3OF 5IOKA 4EZLA 2I5YH 2QDWA 7TAAA 2QGBA 4ZMQA 1E65A 2MWCA 3QG6B 4X5PA 4PRIA 2Z8RA 4JCLA 4XWOD 4WSGA 1I1RA 5I6XB 2XN9D 4WY7H 3GZKA 1O9ZA 2FLMA 1RHHA 3UBXG 4HH8A 4Y16B 3ECBB 5ICYB 3QXWA 4U0QB 4UTCA 1B88A 5SWZE 4L8BA 4NJAL 4PJIB 1GYWA 1AANA 4U1MB 7PAZA 4BH7A 5DJ0B 1HHHB 4EOWH 4H5SB 2QR0B 2WLYA 2A9NH 1BBJA 2G3MA 3V0VB 4OLWH 2XYBA 3TVMB 2E9WA 5I8CA 1TPXB 3FT1A 1J88A 4PJCF 4XVUC 1JWSA 2BXZA 2DB8A 4FFZA 5EU5B 2WXHA 2RA1A 2H32H 1PG7L 4LCWA 1BYPA 4OFYA 2YR3A 2AXHA 2JKWA 2PP9A 3VXSE 1SVCP 2PXYD 2FJHA 3JWNH 1IC1A 2WQVA 3FU7A 5KANG 1CFQA 1QRKA 2PABA 3NACL 3QUMA 1JOIA 1TTUA 3BAYA 1WBZA 4AVHA 5D7SL 3VI3A 4QHNA 1A4KB 3ASOB 1F11A 3CHRA 3WY4A 5T1LA 4CRPA 4JPVL 4N2IA 5GJSL 1ETZB 5IEKB 3OKMB 2Y7QA 2WAHA 3F65A 1FJ1B 3AW5A 4EVNA 2A73B 4FDWA 5GQBA 2HUEA 1N0LB 5F1KC 4G42B 5HYQB 3MI6A 5ISZE 2BP5M 4G6FD 2D0HA 3MKKA 3WO4B 2X7LA 5FGSA 1QWUA 3HC0A 5TE7H 5IFAH 3W9EB 2DZEA 4GRWH 3DVNB 3Q7JA 2H9GA 3E6HA 4TQPA 5LAPA 2PCPA 3QUZD 4FP8L 4I0PB 4ZS6C 3UO1H 4IBWA 3ES6B 2VN6A 1ZEAH 4KI5C 1Q9KA 1GW6A 1K9TA 3DBXB 3CFCH 3O9WD 4KZEH 4AC4A 3T8XA 3VFMB 4YUEL 3P77B 4ZZKA 3RLSA 4P5SA 4LIQE 1EFXD 2YRPA 3BE1H 3BQUC 1A6WH 1IKNC 1NFKA 2EVGA 3F7YB 1BVKB 3U0PB 5T3ZL 1AZZC 4JRYE 4U3HA 5ALCH 3H9SB 1I1YB 3HAEA 2PYED 1TZGL 5F9OH 3MYJB 3GPEA 4BRVA 5I1IH 1OAJA 2VERA 4KJYA 3QDGA 2FWSA 4XOBA 4PJ9D 3W81A 3QUYC 1XSOA 1WISA 4JPIB 3SKJL 2CO4A 3OXRB 4H40A 1MFVA 4XPBH 3R4DA 3UBXI 4NCC2 3Q6GH 4Z18A 1ZHNB 4XBGA 3GTNA 5J11B 2D7QA 4ZX5A 2IWGA 4OFDA 1CFNA 2DY2A 1BJ8A 3VFPA 1U8PB 4TNVK 3NPZB 4NN5B 2NX5B 2OS7A 1VFBA 1IKNA 3RWIB 5DD1H 4X4ME 1CK0H 1FO0A 4HJ0D 5BO1H 1AH1A 4PJFF 5FO2A 3BUQA 1K3IA 4NQEB 4GLRI 4KMLB 4ODWA 4NUGH 3QEHA 2O6DA 3Q43A 4TVPD 3FU3A 4AYBA 3GC3A 1BPVA 1R3JB 1RZKH 3QJHB 4H7VA 1ZLWH 2DIEA 5FIEA 2Q86B 5C70A 1MOEA 5T1KD 2C7FA 1JF6A 1KWKA 2B59A 5KANI 4NUJA 4GXFA 1V7NH 4U6XA 2WXIA 4TVUA 5IBLC 1IC7H 1FZOB 3SGKC 3GKZA 5EF0A 1U8CB 2XSKA 2YAPA 4ZUTB 5DTFB 2AKRB 4YSOA 1G4RA 5JTWA 4K7PY 2WCSA 3DOSA 3HC4H 1C5BH 3ARSA 4GIPD 5IFJB 1EHLL 4FERA 2D4FA 1TTFA 2F2HA 2JH2A 2Y4SA 4P0DA 1E9OB 2JCCE 3G6AA 5F1NA 1F86A 2VLJD 4GS7C 4TTDC 1DANU 4K71B 4U1KB 4UT6L 1NFAA 1UOVA 2DQCL 2LU5A 4YZWA 2FR4A 2E4TA 1UWEH 1W0WB 3SDYH 4BHUI 3ATDA 3IDJA 2O4EA 3QGVA 1K8IA 1N67A 3ROLA 1N4XL 4HJSA 3QRGH 3MV8E 4IKLA 1EAJA 1QSFE 3NH7L 4F8LA 4F2ME 5TK2A 5I73C 4MXQD 4LNVA 3O3BB 5FA4A 5IB4B 4EN3C 2VDRL 5MP6L 2XPGA 2NY4B 1MJJB 1ONQB 3IAQA 1YMMD 1BLIA 1LQSR 1PKQA 3MOQA 1SHWA 4FG4A 4XNAA 4GIOA 3OLEA 4PW3A 2PWEA 4Z7UE 4RZCA 1F18A 3RZWA 1CZ8H 5BRPA 3LN4A 3VD1A 3HFML 4DEPC 2OSXA 4LEEA 4J3TA 3Q2LA 1FFOB 4OD2B 4Y5VC 2WN3A 1XXDC 3RTQB 4FA7B 4MJID 5E9DB 2BVEA 4DIXA 4GRMB 4BINA 2CM5A 2J8OA 2ROXA 4GSXA 1A9EA 2AK4B 2J5LC 1NANI 4MB1A 2GTWB 4XCFL 3B7TA 4HC1H 1NC4B 3VI4F 4AYFB 1HESA 4EN3A 2KKQA 4H1LB 4QXGL 2YAQA 3TO2A 2BOBB 3TA3D 2VSCA 1B90A 1D6EA 2HLFD 4CJ1A 1JTPA 2P5EE 2VDMH 4JRWA 4QHLA 3BPNB 3OLDA 5BZXA 5GS0C 4AKQA 1MF2L 4PJGA 2HRPL 3PHQA 4N85A 4PJDB 1V27A 4XNMA 1KPVB 1CFSB 1BHGA 2GK0B 3BMVA 5SWZD 1E30A 5IUSA 2YD5A 5E1QA 4ZK8A 1TJMA 5HXMA 2OZNA 1X5JA 1G5GA 1UJTA 4R8WL 3QZBA 4XP6H 4HKXB 1BXUA 2BDNL 5FCSH 2BVQB 2IEPA 3T3PF 2E75C 3GO1H 3OC5A 2Y6SC 4PJXA 3KYNB 5J7CC 3IPFA 2O93L 2DQHH 3ECUA 3GGWA 3PDGA 4Z0BH 5IW1B 2YAFA 4YHYB 3N44B 4LSUH 4UQEA 4HK0B 1WYJA 3ARBC 3REVB 4C83B 3VXSD 1C5CL 2YUVA 1ZLVK 5LHDA 4B6ZA 2GTQA 2GT9B 1KCBA 1L3WA 4PWKA 3JVFC 3WNJA 1OB0A 1X9UA 2J44A 1JIBA 1TQUA 2IOOA 4HAGA 2ZCZA 5KVDL 3F7LA 1W72H 1GC1L 3KYOB 3QPKA 3F84A 4M6ML 4UINL 3ROOB 4DGIL 4JDEA 1WT5C 2IQAB 3CSTA 1JCVA 1NGZB 1NIDA 3S3SA 1L6XA 1INDH 3V0WH 4KPHH 4DTGL 5ISZD 4I3GA 3A6CL 2DAVA 5DC9B 2MIZA 1F3DJ 2MNWA 1L5GB 1FNEA 4ZW5A 1URZA 2F53E 1ES0B 4RSYA 5GGVH 3U9UA 4LHUD 1WIPA 1UB5A 4O2CA 3ARBA 2Z8VC 3BZEA 3ALWA 1H3VA 4MNHB 4KFMA 4Q6YA 4MJ6B 1KTKE 3T5WA 1CB4A 2ZXBA 5DGQA 1FL6A 5MEPA 5L0QC 3ENEA 4I2XA 4YXKH 3IDYC 3CVHA 1I8MB 3T0DA 2GIMA 3TZVB 4WDIA 1RZGB 2RQ8A 4HDIA 1WT5A 4UDUA 5DDHA 4H2AA 3MV7E 3FTSA 4P4RA 4TQIA 4WTZG 4OM0L 4JRYD 3GBMH 4G6JL 1EK3A 1I7ZA 4JLRB 4XC1H 1QR1A 3ZKXC 3VU2A 2X6MA 3C6LD 3TFKD 2F7OA 4FEIA 4GAAA 4WGVB 2F19L 3U4EB 4GQ9L 1VERA 2XA8L 4HSQA 2FX9H 4ADIA 4Q6IB 3FUKA 3P40A 5IHUH 5A40E 1U8KA 3QYNA 4DN3H 1AD0B 5FKPB 3VRIA 1JNLH 4WVRA 3IXAA 1Y0LB 4N2MA 5C0IA 3D18B 5I24A 2C9QA 3QXTA 2NY5H 2XG4B 1HDMB 3FQUA 3P73B 4GQPH 4DJMA 2IDFA 3N1PC 1F4XH 4GMTL 3IFLH 3K71A 1OWRM 4PJIE 3AY4C 4M6OL 2VTFA 1U3NA 1SBSH 2G2NA 2ZYIA 1OTSC 3AWFA 2WSDA 3DRTB 1UUSA 4RNRA 3SODB 5D6CA 3ISWA 3CK0H 5E99H 4EDXB 1HSAB 4OCYH 1WE5A 4K23L 4LAQH 3TV8A 3WTUA 3CDZA 2NCEA 3LQMA 2IH8A 2KZWA 2FIRT 4NPYB 4YBLC 3TBWB 3WI9A 1BV8A 1FNSH 4XCEA 5DJZA 5EBLB 5FECB 1NAKL 4ZMPA 5I1KL 3VXOA 2Y3NA 3SJVA 5ITBH 2H45A 5HVFB 1SN2A 4HUUA 2DBLL 1P0SE 4EI6A 1R24A 4HWZA 2OYLA 2VLMD 4MNGA 4X42A 3KJ4C 1F4AA 3HPJA 5LNDA 2CLZA 2NYYC 1OAZL 1K85A 3CX5J 1NGPL 1OAUH 5AVVB 5I8EA 3L3OC 1FZMA 4OGAC 3RNKA 2J5WA 4S0HA 5AD0A 4JO2L 2KDYA 3PAUA 3SCMA 2KI6A 4DQOL 5K59E 3FQ2A 1W9XA 3SKNB 5JYMA 1BD2A 5FHBL 2J1KA 3H56A 1ZXKA 3TBBA 4PTUA 2K8MA 4JL2A 3LJ3A 2OZ4L 1RZFL 3O2DA 3EJYC 3NDYE 1A14L 3UP1A 4HETA 2AV7B 3CDFA 3P2TA 5E0QA 1N8ZB 4R5VA 1I8AA 3P4LA 4NDMB 1U2YA 5C0DA 2ZUSA 1SXSA 2DEYX 1YJDH 1QNZH 3LMJL 2WCPA 4K2UL 3EO0B 5A1AA 4NGHH 3S8WA 3ARPA 4N28A 5H37G 4N2KA 4K94H 4AZUA 2I7SA 3P1VA 4GLRH 4BFIB 1KY7A 1M3JA 4GI9A 5HHOA 1FVEB 1WITA 4OFQA 4H8WL 5GGRY 3QDHA 4OF3A 3IK2A 2KQMA 2A0LC 3OHXA 4I9WD 4AYDC 1RIHL 3UPCA 1G7PA 1S3KH 3KBPA 4HS8L 4TUOB 2F7PA 5BS0A 4DZBA 3TESA 2QELA 1J0KA 4EUPG 5H35B 1G1KA 1JGDA 1QYGL 3LKOA 3MRMA 4OIFA 1DCEA 4OCSL 2WINB 4E42A 3ZE1B 25C8L 2V5YA 2WO2B 3DRQB 4NZTL 1KJMA 3GXPA 2UXGA 3GXMA 4OCWH 4Y9GA 1HC1A 1JF1A 2D73A 3R1GL 1G7QB 2ZCLH 4NQDB 2VSMB 2RFXB 1AXSB 1EGJH 2DLHA 2KT6A 3ULVF 3UAAA 1BFTA 4M4RA 3WCYA 2QQKH 2R0LH 1U93A 4UQ2B 2JJTC 2P5ED 4XBEH 4X9IA 3QDMD 2WBKA 3P0YL 4UANA 4ODXB 5AOZA 3TCTA 4AOFA 1HZHH 5AWNL 4FFYA 2NX5E 4OSUL 3S6CA 1QSEA 1CDHA 4JAMB 4HEPA 1XIWD 1RJZA 4NRYA 4ZW3A 4MA8L 2CQVA 3QJUB 5GGUB 1JNJA 1YEHL 4NQEE 4MA3A 4YDVA 1G9NL 3WY1A 3FNKA 5LG6A 3TH2T 4P3DA 3ULUC 4X9YA 4OI7A 1GMEA 3P3YA 4GO6B 4Z9KB 1U8JB 1GJIA 4XP5H 1Z9LA 3QR1A 1DQML 2WSKA 4Z0XA 2KQNA 1J11A 4MMXB 1BXAA 3PWUB 4PJHB 4K8RC 4FD0A 5E8PA 3OPZH 2ITDB 3BAKA 2EEDA 3PGDA 2WQRA 1DVFC 2QLYA 1ZJAA 4WWID 2W9DL 3S36H 1TSHA 5E08L 3GMLB 3ECQA 4OTXL 5MEOB 1G4MA 3HPLB 1B0GA 4LEOA 4Y89A 4PWHA 1E6JL 4RGNB 1YEWA 1D9KD 2CGRL 3BPOC 3IVKA 5DO8A 1ID2A 4L2YA 2A4CA 1YYLL 5DD5L 3BAEH 3KGUA 4ODUB 4GW5A 5CBAA 3MCKB 3WGUB 2Z7WA 2DLGA 5GZOC 3SQRA 3HHRB 4M3JA 3BLPX 1AP2A 5DRXB 1ZKAA 5D7IA 4GG6F 1N26A 4M43L 2APFA 3BRDA 1JK8B 3HNVH 1MIEH 4JR9H 4YDJA 2ZD0A 2W0FA 5KSUA 1EQWA 3D50A 1CUOA 4GKZB 4TUKH 5FO7B 3ZIYA 1AOZA 2F53D 2K3HA 3M86A 3FRPG 1DVFA 3US0A 1D5BA 2XG5B 4HV8B 3P4NB 4NHUB 2YD6A 2CNYA 1A7RH 3NCYS 1XGRA 3WFEH 2J4WL 2M2DA 2FT8A 4BK8A 3PAYA 5GGTH 4ONFH 1ZLVH 3BP5B 3MRDB 1ZK9A 1AO7A 4UM8B 3BXNA 5FFGA 5L4IA 3NJKA 5EPMB 4QRTA 1I3GH 3NJJA 2ENJA 4DK5A 4X9FA 3CZLA 2P4AB 1RZIB 5I76A 1HXYB 3X3FL 3TEYA 2CWRA 3UDWC 5GISL 1E0OB 4MX7B 1NEUA 2ZWLT 5IF0B 3VJ6A 4OF8A 3IPEA 4C55A 3FOMA 1OLZA 5G5DA 3N43F 4CKQA 4HVBA 1NFDB 3ZYJA 3B2PA 1T80A 1QLRA 5CZXD 2NW2B 1G7JB 2EUXA 4FHJA 1KLGA 4UOQA 3MGOA 3VXMA 2P5WA 3OAYK 1IVTA 3V5DA 4RFEB 4TSAH 2FD6H 5KWYC 4PJDE 1RMFH 4NP4H 1Z9MA 2A99A 1DJSA 1GS6X 4Y16D 3UBHA 2DQJH 3GLZA 3BUPA 1NA8A 3D06A 1BJ1H 2GITA 4LOUC 2G0KA 1F1AA 4I3RH 3V4VA 5HGGS 1AS7A 5GRUL 4YHNB 3BUIA 3MRCB 1AYRA 3S96B 5HDQH 2ZKHH 1I8LC 2E4FA 4GRLA 4KAQL 2IG2H 1GRWA 3PP3K 3TVMD 2IIJA 2XI9A 1AE6L 1BQUA 1RUQL 4XNXL 4JQIA 3MODH 3UDWA 2ZNWA 3JYBA 1N6QH 2HMID 3MLZL 1MNUH 1TVBB 2VDLH 3IU4H 1LTXA 4N2OA 4R7DB 3SE8L 2LTQB 2R29H 3D69A 4PTTB 3EW3B 3WIHA 2AF2A 4JFDB 3ARDB 4HWEH 3DJ9A 1RJCA 1KPRB 3VI3F 2CKBL 2BFVL 4B9KC 1AI1L 1TQCB 3LKNA 4Z23A 1P2CB 1MFEH 1LP9B 3EYSL 4YX2L 2NW3B 3BKCH 5F9JB 1X7QB 2BJML 2JMRA 1NBVL 4PRHB 2RJMA 2X3CA 3OBAA 4PUBL 3H7LA 1S7RB 4BH8B 3OXSB 4X2UA 5FM4A 3I50L 3RVVC 3U9PH 1UXWA 1I8LA 5DZ9A 2UZIH 5JQ6H 3DX7B 3LYRA 3MRQB 4FHKA 3K6SA 5IMLB 2X4SB 1L9TA 1R5IB 1T1WA 2KZKA 5GGQL 3T2OA 3AACA 1E2VA 4ZXBB 3SDCB 4JUTA 4O58H 1IBYA 4KHXL 2FIKA 2VXVH 3GRWH 2VXSH 4I0PD 1HQ4B 3SGDI 2R0ZH 3WNIA 2G5BA 3LD8C 2LU3A 3ZDWA 5EU6A 2APWA 1E4WL 2VITA 2ZUXA 5F3FA 2I85A 4LVNB 5D2LB 3F7KA 3MLYL 5KYWB 4CVXA 3LX9A 4YQXH 3D7PA 1LEGB 4XZUA 2WUCL 3A67H 3UG4A 4NBZB 2G3XA 4HJGA 4KRPC 1KJVA 4HF5L 3DV4B 5KYUA 1NCGA 3H9SD 4MLIA 5IJVB 4F91B 4QRPB 2VERN 1JCKA 2YRBA 1JZ7A 2X41A 4LSDA 3Q05A 1OARH 4FYSA 3LEVL 1KEMH 4ZUWB 1FV1B 5CZVH 1CLYL 3NJXA 3OMIB 5BZDB 2VDPH 5JHLA 4ENEC 4Y2DC 4NLHA 2I07A 4KI5F 4WUKH 1N19A 2AMUA 3LEXB 3QQNA 4H88L 4JFQB 2CK2A 1QNIA 1WV7T 5IHZA 1C8PA 4HA1A 4N2FA 2EIEA 4HGWB 4UBDC 1J1XL 3MLWL 4XE5B 4Y9EA 1KB9K 2OMUA 3DOIA 4YPGB 4ADGA 1F3JA 3BEWA 4O9HL 3F6IA 4E0RA 4JM0A 2MCAA 3S7GA 5ACZA 1AOHA 4Q0XL 4TVPH 5F7EL 2YAEA 2ID5A 2NX5D 3QWOA 2WV3A 3AQDA 2F8IA 2HVJB 3V0DA 2CIKB 4IM8A 1YEJH 1KB5L 1T21B 4YDZA 2D9CA 3V4PA 5F7UA 1OGTA 4NQED 1LWRA 5C0RH 1MI5B 4I4WB 4M7KL 1ID5I 1VFAB 4P9ML 1MWOA 4ZFGH 4FFVD 5B7EA 1CD8A 1R5WA 2FBJL 2WZ0A 5IFHL 1IO4C 1K5NB 3TN0B 2P24A 1JGEB 1KTLB 2IANA 2P28B 3W2DL 5EOQH 1FFNA 1XMEB 5CILL 4OVVA 3RNQA 3TYGH 1H5BA 1RJYB 3BUDA 4WO4C 1F6AB 4GUCA 1YQ2A 4W9JC 1SJHA 1WD9A 2I60H 5CFHA 3NCFB 2CRYA 3CFJB 1QFWI 4U1IA 2WIMA 4WWPA 4ZUSA 1G9HA 1U33A 3T6WA 4X4ZA 5L9DL 5LJYH 1FAKT 3VH8A 1BBDL 1J0JA 1KY6A 4O5LH 4ISVB 3UL4A 2ZSWB 1OSZA 3MACH 3G5VA 3HB3B 3A0OA 3KWXA 4PHXA 2HKAA 2W80C 2XY2A 3ARGB 4FMKA 5IHLB 2H2PD 2QHRH 1UM5L 3MLVH 1TT6A 2GJZA 2J7LA 3VX1A 5ALBH 3W11D 1ROCA 4JGJA 2R23A 2NY4D 4R90H 3R06B 5LG1A 3JVGC 4NRXA 1LK2B 2ICWI 2CUMA 2V9UA 2FTAA 1TZAA 1E27A 3OG4B 1JPGB 1LO2L 2A77L 1XGUB 3FB5B 5EO1B 4WO4A 5IWLC 4UU9B 2AV1A 4IKKA 3DIFA 1JUFB 2G5RA 1GGYA 1D5RA 3H9HB 2AEIT 2NNAA 3ME0B 4WFGE 3RTQD 3ZQXA 2AQNA 5E9DD 2B14A 2BSSA 4ONHA 3VW3H 1NAMB 1XGYL 2MOQA 3EIFA 3WS3A 1IEHA 1DJYA 3M8OH 3BIBX 2VZUA 3BKMH 3QCTL 2DQTL 5E4EC 4AYSA 3KL0A 3ZE1E 3RWHA 3OAUL 2AK4D 4P2AA 1RY7B 2AQQA 4XP1H 4NQDE 1EO5A 4YLBA 1NC4D 2DWTA 2YGOA 5HY9B 3F12B 2GIXA 4TQ8A 5FYJL 2UXVA 1GGIH 1MREL 1UM6L 2GJPA 3NABL 4PJGF 4N4YB 5HDBF 5JXAL 2YD8A 3JVGA 5EO9A 3L1EA 2X87A 1R33A 2O5YL 4HPYH 1F42A 4MAUH 1F6FB 5H37H 3WTXA 2Y72A 3L7EA 4JFFA 2JKRM 3ASNB 1OANA 3GDBA 3QA3A 3EOBA 4LOFA 5K1VA 1EDYA 1YPZB 4N86A 1KXHA 2H7WA 1XF5A 4PLKD 3RL1A 5EC1A 1NIEA 4Y4FB 2EICA 4PJXF 4P5TB 3KPLB 3BW9A 3LNGA 5BVJB 1XXFC 4A2GA 1CYXA 3FMGL 1J9TA 5CFAA 3BVTA 4PJ7B 4PJHE 5EZIH 4HPOL 4PG9B 2NT0A 3MLXL 4EUPH 4JKPL 3S4SG 3JQOB 3QZWB 2YPKA 1ADQH 1JHLH 2FQGA 3CDCA 2E7BA 1FA4A 4MVBC 3A6BH 1H3GA 5D8JL 3UTSB 2D2CC 4AZ8A 5B39A 2AEPL 4RGNE 1FN4B 4XBMA 1Q72L 4D3CH 1QBBA 3OC8A 5GRJH 3TLRA 1JD7A 1QMUA 4Q97A 3OAYH 3PQYA 2YKLL 1YNTB 3BN9D 5C0AB 3IGAB 3QH3A 1PL3A 2BIOA 1OGAB 3LXCA 1JTTA 3DUUA 3Q8AA 2AQRA 2JV6A 4ES9A 1E28B 5CIPH 1S9WA 3C08H 4LVHB 3V6ZB 5K33A 3D2UA 3CHXA 4P9HH 4FTVA 4X9BA 3T1FA 1IILE 3HI6L 4LFHD 1NIBA 1KJ2A 3O6KH 3ZRCC 4BUHA 1IBBA 3VWJC 3HI1B 1BX2B 3PP3H 4LIQH 1F4WL 1JPSL 4XPGH 3WMPA 2XOTA 1G94A 2WQAA 2IDQA 1I1AC 1Q0XL 3ZSSA 3ZT6A 3GIZL 5I16B 3FYEB 5HGAA 5EIIA 1T03L 2CR0A 3DPBA 2YGVA 3HRZC 4OLZL 4PI0A 1PZ3A 3ZR6A 5BOPA 1JWUA 5C07B 1WWCA 2HAZA 3TZVD 2DM4A 4DN4H 5IMOB 2MQ0A 4FQ1H 4P23B 4DW2L 3IM1A 3WIAA 1OTUC 3BVUA 1JK9B 4UTAA 5AL0A 4XN5A 1MFUA 4ABWA 1OAXL 1BVLB 3EH5B 1ZVSB 2KZBA 1RPUA 3BAXA 2Q6WB 3FUEA 3V8OA 5I30H 2DLTA 1XSKA 2NRDA 4GFTB 1A3RH 1J0HA 2HSIA 4FABH 2N59A 4K55A 3U48A 1J10A 2IO5A 3EOYG 3FUMA 3L3KB 2Q76A 1JG9A 5D96C 3RHWK 2CBQA 1NFDE 2HX7A 3VWJA 4YHML 1SF5A 3LQAC 1X9QA 4OLVH 1KF9B 5FYLE 4LLMB 5I71B 1A6VH 1TQBC 3BO8B 1I1AA 1RFDL 3QUXC 4WI6A 5EN2B 3MJ9L 3KLAA 3MRIB 5IB1A 2BERA 3CBJB 2QKIC 1XH3A 4X8JB 1P1ZB 4R7NB 2HLAB 5F7BA 4GPVA 4MJ5A 3RA7H 1CD1B 2OK0L 2BSEA 1OGSA 1LD9A 5BZWA 2YFOA 1DSYA 3EFOB 3IRCA 4BSVA 1JGVL 2VZ1A 2D31A 2ITEA 4NNXA 3SE9H 4BFFA 1ZT1B 3VD5A 2Z31B 4E2OA 1E5UI 1Z66A 3IDGB 3ATEA 2OULB 2WQUA 5ESAA 3CFBB 2R2BA 5H4YA 1M7IA 5IVZA 3ZSTA 1BLNB 5KS9A 3G5YA 3RU8L 2GQHA 1TDQA 4XAWH 2DDQH 4JFDE 1UA7A 2JB5H 3QUXA 4L1LA 4V2CB 5BQ7B 3CFEB 1BQHA 2IADB 2CD0A 1V5JA 2QKIA 4NNPL 5FM5O 1CTNA 2LE9A 4B9ZA 3SE6A 5EZLA 1YY9D 4DZ8A 2F5BH 3DX8B 4D94A 1FG2A 2LHAA 4NWTH 5JR1H 2R9HD 3WJMA 5L88H 4R0LC 2BHYA 4PRHE 4WI5A 4IMLA 3J27A 4JFXA 1UC6A 3V9EA 4DFIA 5JPMC 1S5IL 3LS5L 3UTTB 1FF5A 2D3VA 2CMRH 4N0FA 5EEVA 3NRQA 2J1YA 3OKEB 3FQRB 5C6WH 3D30A 4LVOB 3UIZA 3UXFA 1I8IA 2PXYA 4JCMA 4P4KB 3IJEB 4KX8A 1WWAX 5CJ8A 4WEEA 4QHKI 1I1FB 1UA3A 1WUZA 2ICEB 4W68A 2A1WL 5GGSA 3L4UA 2G30A 1SZNA 3R0MA 3BZFB 1XGQB 5LBGA 5D2LE 3MTXA 5EU4B 3W82A 1HZKA 3WKQA 1JNHA 4XPAL 1IC4H 3NEXA 5JW4N 2JI2A 1G7HB 4PD4K 1FRGH 4QRPE 4WFGD 5IW6A 2EXSA 3Q9QA 2E46A 4ZO6A 4QYOB 5BXFA 2IWFA 2OJEB 2VWEC 2OW7A 2HT4D 3QO0A 3PJLA 3KYKL 1O5PA 2YLKA 3QRFM 3HNSH 3KDMB 3P3TA 4NQDD 5ENWB 4N1HB 4KKZA 1ZANH 3O9WA 4G7VH 1LL1A 3L9EA 1FL5A 2B4CH 4UNTA 2K6YA 2H4EA 1K2DB 3BP6A 1EFXA 3K6NA 4FQHA 4DAGL 4J6RL 2GSIA 2DQIL 1HQRB 4B9IA 3BKJL 1T3FA 5HDWA 4ODVL 1T0OA 5DEZA 3QZLA 2OMYB 4LPCA 6FABH 3NFNA 3IJHB 3ZBMA 5JHMA 3T77A 3MROA 4XCYA 1MRCH 3ZHLA 5JHAA 1CYWA 1FNFA 3NMEA 1HKFA 2F7QA 3WFDL 3HC3H 5KVGL 1Q0YL 1MI5E 1YRKA 3DYMA 1BZ9A 4YJZL 2XNAA 2WSPA 2DWSA 1ZA3B 4L48A 3AS1A 2VT0A 2XTLA 5KYYB 3OWEA 5GRZA 3QWNA 4OZHB 4PB9L 4LASH 1GZPB 4TQEH 4XXDB 5AOMA 4YDIL 4OD3L 4NENA 4ZDHA 1A6AA 3WHXA 3EUDA 3W5NA 1BWWA 2HJLB 5IVNA 5F89B 2CHNA 5TDPA 5KTEL 1A8JH 1MJ8L 3RURA 5IKCA 3CD4A 4R2GB 4ZMNA 3MLRH 4RGND 4JJ5A 3CZUB 2DTML 2X4OB 1KIPB 4RMUA 3MRNB 3ULUF 4UIMA 3VG9B 1ZPLA 3R8BB 4Z7OF 4JPWH 5D7IF 3L3IB 4FLSA 5TF1L 4O02H 1MWAL 1QFUH 1NCWH 2IVFC 3N9GL 1OAQL 4PP1D 3F83A 4JJOA 1UOWA 1G6RL 2OSYA 3C5SA 5FYKL 2YGQA 5HYSA 3FFCB 4Y19A 3OF6A 1P4IH 4ORZC 2VH5H 3SDAB 3OZKA 1NDTA 1LO0L 4BEIA 3QNZB 5ILTH 5GIRB 3AY2A 2JB6B 4H0GA 3CFQA 1ZOXA 3EDFA 4LPUA 4JM2B 5HJGA 1OP9A 5I5MA 2P8MA 3GSQA 3VB8A 5IQ7H 2Z8WC 5I1CH 4KTDH 1MDTA 2VLJA 4D7PA 2F8OA 3EFFB 2BY2A 4BFGA 3GSNB 1MHEB 4Q9QH 3DHUA 3PGCB 1U8NA 4X5WB 3PF2A 3IETB 1R3KB 5ABDE 3QO1B 3V6FB 2R2EA 1CVRA 3JWDL 5DD6B 5F0MB 2AGJL 1PJ9A 2XWJB 3ULVL 1O7DE 3L3JB 4GJTB 3WLBB 1FFQA 4BA8A 3KXFA 5LKNA 2YS4A 3TA3C 4JREC 1AR1B 3S3CB 1J1PL 3W56A 4J8QA 5TE4H 5CUSH 1P53A 3STBA 3JUYA 2J43A 3NCYP 4BZ1A 9PCYA 1JWMA 2Q5BA 4JN2B 1DQVA 1VZHA 4N0RA 4WIQA 3WUWB 3L4CA 4RGOH 4MAYC 1XD0A 4Q58C 3ZE0B 4GQZA 3U30C 3FULA 3ZE2B 5D72H 3WJLC 4Q52A 3V0AC 1M2VA 2DW5A 15C8H 1DQIA 2YSTA 4MJIA 3VXQA 1T6VN 2FX7L 4H20H 2GEEA 1X5LA 4A66A 1YPZE 4DPCX 3IT8D 3AS2A 4UILL 3DX6B 1JTOA 4RQQA 4BIKA 3QUHA 4KK8D 2YHGA 3NDZE 2VXQH 2MCPL 2YA2A 4PJ7E 5IOPB 2W9EL 3QRLA 1WZ1H 4IKIA 3OKKB 3SY0B 1XR8A 3TA3A 1FBIL 3NIDB 4X4XB 4PV9B 4NHCL 3TO4B 4ZNCD 3P4OA 1A6UH 3HHSA 4BCYA 4JFDD 3ARDD 4L5FL 5JORA 3QHTC 3UTSE 4MAYA 1WICA 2ATKA 3QAQA 5KZCB 5LNGA 2Y06H 3SO3C 3T3MF 3VMPA 4S1SL 2GBAA 4YHKL 5AG9A 5JXEC 1ZK5A 4E9XA 1I8KB 3QXAB 2WN2A 4N2LA 4YBQD 4ETQB 5E8DH 1UASA 4ZOEA 5C0AE 5E6IC 1J05A 1KYDA 1OGAE 4YH6A 3MMEA 1TMQA 4R97C 4PRHD 2DMGA 32C2B 4KGJA 5C0FA 1X5ZA 5GHWH 4NEHB 3ERXA 1XCTA 3MA9H 3MJGX 3DVGB 4ONOA 3L48A 3QZPA 5LBSL 3UBFA 5IIEB 4PY7B 2L0DA 1ORSA 1YEEH 1MG2C 3SDCD 3KPPB 1C5DA 4JFVA 3VD3A 2JLLA 2J88H 2XWZA 4N5EC 2E56A 1LDPL 4LKXB 1W2KT 2DEXX 2DWYA 4QR7A 3UPRB 5FUCE 2B7DT 5LDUA 5JXEA 3MRFA 4ODBD 5C07E 3LAFA 2GY7B 3D3VB 3PPEA 2NY0B 4RESB 4Y5XB 5E6IA 3JTBA 3TBTA 5C9JB 3H4HA 5ISZA 4B3VA 2LR4A 4QRPD 4TULH 2BVPB 3EG9B 4NI6A 2GCYA 2ZT9C 4MDIB 4JBSA 1CGSL 2Y7OA 5B38A 4MS8D 1NDMA 1H3UA 4LHUA 2HTLD 2F15A 1YECH 2XV0A 3BLKA 4EEEA 3UX9B 2GK2A 1T1XB 3TV3L 3OG6B 3CCHA 3PHOB 1NGXA 4L8CB 3IXTB 1PLGL 1DQJA 1EJ6A 2RB8A 1UZGA 4LCIL 2IPKA 4BGLA 4HJ1A 2UUDK 3B8YA 1QFOA 3OQ3B 1WUNT 4Z7QB 5A16A 1IT9H 3BVXA 2ZIDA 3DIDA 2CDGA 4G1EB 5F7HA 2PWFA 3INUH 3MOAH 3ZHFA 5C1MB 4L3CB 1PMYA 2NZ9D 3DGGA 1BQKA 4B41A 2XWXA 2PCFA 1Q94B 4BK5C 4FJZA 3QUML 2XBDA 1QO3B 4WHTA 3FJTA 3SYPA 3R7QA 1MI5D 2UZXB 3LZFL 3QS2A 4L2LA 4Z5RA 3ZIMA 3HCVB 1OSPH 1INQB 5CEYB 2K9FB 1U36A 4MDRA 4NSKA 2KYIA 1OLLA 4QRQB 3CN4A 3TN0D 2BY3A 5IB2B 2BIMA 2GC7C 4A6YA 3TCXA 1JYNA 3AAZA 3ZRFC 1HHKB 1BG9A 1JHKH 1P6FA 2XVLA 3ILQC 4KV5E 4KUZL 5DFVC 5C0GA 4NXKA 5C0JA 1MKFA 4LLVA 3ZUNC 4N2GA 2NNCA 2VR8A 5C9KA 3UTQA 3U2SA 4OLUL 4X4MA 1VGEH 2GI7A 4JO4L 4KJPC 2AJXH 5DCCA 1ZVNA 1KCWA 1MUJB 2OMWB 3R18A 3BVVA 4BK5A 4YFLI 3GF8A 2NZ1A 2ZKYA 3L95B 3UTTE 4F15B 5I26A 4MMZA 3KJ6L 2QT6A 3UJTL 5CCKL 5E2VL 3HB3D 5JIHA 4XAKE 3MLUL 4XNUL 2AJZA 2KPWA 1T0NA 5F1OB 4QT5B 3O3EA 1BGXH 3NJVA 3OJ2C 2ZJSH 1FGNH 1KLUB 3EHBB 4I0CC 4LEXH 5D1ZC 4YIQB 1ZA6B 4E9LA 1OOAA 1ZDQA 2HRLA 3SZKC 1DBKL 2FJFA 4RMBA 3ZY7A 5IMMA 3AZUA 5LCVH 4QDGA 4D8PB 1BYNA 3FB7B 2G2RA 4P2CG 4RMVA 2NY7L 4PY8J 1PEWA 2NNRA 4CMHB 5F7YC 3JWOH 2H26A 4IJ3C 3T0AA 1UVQA 2QFPA 3I75A 4P2RD 1ULVA 2RBLA 4TSBL 4FA6A 4N87A 3Q5TA 1TZHA 3VFVB 2DWEB 1RCYA 2WWOA 4OAWB 2SEBB 3P69A 4XPHL 1KSRA 1KCVL 3MV8A 5DD0H 1DJZA 4M8RA 3FO9A 1J7VR 1QSFA 2Z7UA 4L1HA 4ECNA 2K1MA 4F2MA 5LB1A 6PCYA 1T5XA 3ALXA 1JN6B 3US1A 4L4TB 1CF1A 1FO0L 3MJ8A 4G43A 5FHAH 3IN2A 1IE5A 5D1ZA 1A1NA 1P5UA 3NFPA 4YO0A 4Z7UA 4FHBD 4HFWA 3V5HA 3H6AA 3D08A 2Z4TA 4HS6A 1EHXA 4YPJA 4QGTA 2BCKA 3D25A 3ARXA 3EBIA 3G9VA 2OMZA 1HZLA 1NM9A 2F58H 4XC3L 2BZCA 1FP5A 3ZMRA 3V4UH 4KTYA 3BVDB 1U92B 1G1OA 3FFDA 4GP8B 4JHVA 1NFIA 5HD8D 1JNNH 1IAOA 1D5MB 1FSKC 3NSDA 4Y4FD 1ZAGA 3UG3A 5GZNC 3I3EA 4P5TD 2V7HA 3Q5YA 3ULSB 2B5IB 3BD3A 4P48A 5KVFL 2GUOB 4UTBA 2XWCA 3GK8H 5E1IA 3BYYA 5TQ0L 2HX9A 5ANMB 4LSQL 3GB7A 4OZHE 4Z6AT 4FAAB 1BM3L 2YUWA 5D6DA 3O8XC 2QSTA 2OSWA 1UA6H 2N7AA 1SXNA 2FK9A 2P5EA 4U1SB 3PRZA 2E6QA 4B53A 2Z91B 1FG9C 3UTSD 1UQSA 4ZPTB 2NTFA 3ZL4H 3UEZA 4LCUB 2Q10A 1FI8C 5CJBA 4M48L 1YNLL 4PRPB 1PZBA 4CN4A 1WF5A 2R8SH 2X4NA 2BNQB 4FG2A 4P2OB 4ZFZA 5I1DB 1CLOL 4F7EA 1A6ZA 3HZMA 1OGAD 2NQDA 3AB0C 4KOCA 4ACPA 3I9PA 4FOMA 5GZNA 4GW1B 3B9DA 1DQTA 5AZUA 2IQ9L 1KENL 2YO3A 3NIFF 4HZLB 2ALAA 2W94A 3FFCE 4LSVL 2VE6B 1R3IL 3RY5A 4G8IA 4NJAH 3O41A 5DWUL 2BSBA 4HJTA 3O8XA 1ZSDB 1J86A 4OBSA 2H5UA 5JIDA 5CJXA 1JYWA 5D2NB 1H3TA 4UT9L 3ETTA 1TITA 1PY9A 4AQAA 3BP4B 4GUPA 4S2SA 1QX1A 3CQQA 1A7OL 5ETUA 1BEYL 2RTTA 3AMLA 4NZRL 4TM9A 1PG7H 1MQ8A 1T89C 1QTPA 5JDJA 4OZFB 5C07D 4P23D 5F7DA 3AQZA 3O81A 2VO8A 4BQ6A 1HSBA 5GGRA 2R59A 3NACH 4QCIA 1PQZB 4OUOA 3NIGB 4DCQB 1B0RA 2X4TB 4AENB 2AXFA 2WBJB 4W6WB 5D7SH 5IMKA 3TBSA 3NGBB 3VSQA 3OR6A 4JPVH 2F53A 2MPVA 1YUHB 5ITFA 3GZOA 2PYFA 5BVPL 1OF2A 3I6GB 5C97A 4GG6B 1MCCA 5I0ZA 5E6ZA 3L1OL 5IJKC 5I6XC 4F7TA 1OK8A 1OK0A 2QZ5A 4G7YL 2IOIA 3ZE0E 3TFBA 3JV4A 2EKSB 3ZE2E 5LN8A 5KSBB 1T89A 1THCA 3FQ4A 4H13C 3MV7A 1CJYA 3KGRA 4FP8H 5CD3B 2D0FA 2OXHA 3NAAL 3NRPA 2ADFL 4LRNL 4MGXA 1D6VL 2FUTA 1T2QL 2B0SL 3MRRA 1JV2A 3W3BA 4QWWC 4YUEH 1CICC 5KS9F 3GFUA 1ASPA 4HUKB 4OJAA 3B5HA 2NLJA 4AUYA 2DBJA 1P4BH 1OD7A 5BMFL 4TL5A 3NIDE 5T3ZH 2CHZA 3QG6A 1TZGH 2P1YA 3VU1A 2F1BA 2DMBA 2W9LA 5IJKA 2Y69B 3G08B 5HHQB 3QNYB 2ZOTA 3TL5A 4LNRB 4FULA 2LU7A 3ECBA 1QSZA 4Y16A 5ICYA 3N43B 3SKJH 3A21A 4PRIB 4PJIA 3F2LA 3RDJA 1TMCB 2GBUA 4NXSA 4J3OD 4U1MA 1JERA 4N26A 5F7AA 1RHHB 2FEJA 5DJ0A 3D09A 1HHHA 3VXNA 2UUDH 5I6MA 1QLEB 4I88A 2QR0A 3V0VA 3H2QA 1NCOA 4ICXA 5DXWA 4L0ZA 1BAFL 1AQDB 5C0CD 1CICA 2YQGA 4BFEA 3UTTD 4YE4L 5DU7A 3CVHL 1MLCB 3GBEA 4JRXB 3APNA 4XAKD 4X7FC 3WY3A 3ESUF 4U49A 1QLFB 1WA2X 1ZS8A 2VUYA 2P7TB 1JWSB 2Y1ZA 4P4KD 4C58B 5IUCA 3PGFL 4LCWB 5EEZA 2E9BA 3STLA 4HD9A 4YVNA 4HU2A 1ADWA 1A4KA 2FJHB 2Q7NA 4JM4L 1LGVA 5DZNA 1ETZA 3OKMA 1CFQB 1FJ1A 3FTWA 3AITA 4ERSL 4MD5B 3RFRA 3D3VE 1OHQA 1N0LA 1F11B 3SBWA 5HYQA 1QI5A 1MCHA 1EHLH 4NC1C 1ORQB 2DMCA 3CXHK 1MN4A 3W9EA 1WO2A 2NQCA 4LLQA 4DWHA 4AQ8C 3DVNA 4U1GC 3JWNC 2ITCA 4Z95L 4KKCD 2EXYC 2DQCH 4UT6H 5FFOA 2X2HA 4I0PA 3TF4A 1RLWA 2B3RA 2BPBA 4POYA 4YC2C 1DBML 2Y5QA 3DBXA 2MSPA 1IAIL 1BXVA 3P77A 1HFUA 1RI8A 1OE2A 4G72B 1N4XH 2ATPA 3FCBA 4LBEB 4B0MM 2HFTA 3B7UX 3NH7H 4XPTL 4F3FB 2VXUL 3AUWB 3LRKA 4Z7QE 4N8VG 3T8XB 3U0PA 1BVKA 2CO2A 2VDRH 1XCQA 1I1YA 1MXDA 4RMWA 4XVSL 5F7LB 5MP6H 1OSEA 2ZOOA 5GS2H 3EYOA 1NDGB 2E27L 4XWGL 2FQDA 3H1ZA 1IFHH 4HKJB 1NMAL 2DD8L 2ED7A 3B9KB 4JPIA 1EXHA 3HFMH 1CCZA 1JGLL 4AQ8A 4A55A 5JW4M 3WBDA 1P9MA 4KJYB 1AZVA 1KYOK 4NKQB 2X70B 4O4YL 1A4JA 2DQMA 3QNFA 1L9RA 1K8DB 1S78D 3ZPDA 1SXAA 1OP5K 4X5RA 4X6EA 5EMYA 1KB3A 3FZUD 3DTDA 1NBZB 2YEZA 4V1DB 1FCGA 4XCFH 3WEMA 3HZYB 1D5ZA 3RWIA 4R2GD 1AZUA 4UZSA 5B4MD 5CEXB 3D5OF 2E7DA 3CUPB 4IOFC 4QXGH 3VFPB 4NQEA 4JFSA 2DEWX 3BQUB 1VFBB 5TDOA 1P7QA 1XMWA 1R3JA 1UH3A 3QJHA 4MWFB 3HBPA 1FO0B 1MF2H 4RSVA 4RDQG 1X44A 2HRPH 3GJFK 4U3CA 3QZOA 5A3ID 1GTFA 4ODWB 3LIUA 3QEHB 3MX0A 4ZOBA 1FZOA 3FFCD 1KDJA 1U8CA 4AVKA 1NUNB 3SDAD 4NX0A 3QUYB 2OJZL 3FU0A 4TLTA 5DTFA 2AKRA 2G3ZA 3PXJA 4M5SA 5CP3A 1O6SA 5JOFB 4FX5A 3CX2A 5IFJA 3O0RL 5KSVA 2PWHA 1SN0A 4PRBB 4WFHE 4JM2D 4R8WH 2BDNH 1OE1A 5GRXG 1CDYA 2ADIB 3O2VL 3NCJL 2EVHA 4I9XA 3DOSB 2R1WA 4U1KA 3UZVB 4RRPG 3VD4A 4S1DC 1U8OA 1GYCA 3OJMB 2WYTA 1UZ8B 2MQGA 1RIUL 4HXAL 1C5CH 1DVSA 3SQOL 5F1NB 3BDXA 4Y0GA 4KKLD 3RL2B 7FABL 2AFNA 4GW4B 4FFYL 3S3BB 5KVDH 1SUJA 3IDJB 5AB0A 3RPBA 3AG1B 3O3BA 1GC1H 3UGUA 3ROLB 4U2ZA 4M6MH 4UINH 4L4TE 1FFPA 3TCLA 2CHXA 1JD9A 1ONQA 1A6WL 2F74B 3RVTC 5AOJA 1AR1D 6TAAA 1Y1DA 1YLBB 4MDJB 3DGDA 1GZQA 1JP5A 3CVIL 3F04A 4KK9C 3NEEA 1IEAA 3AU0A 4DTGH 3IPBA 3A6CH 2V2WB 2L7UA 4KY1L 3T8VA 1W8OA 2WXKA 4KO9A 4OD2A 4RZCB 1PF3A 3U46A 3ZK0A 1E2WA 3LN4B 2WOYA 1RQ5A 3LZNA 1TQVA 4GRMA 3S36X 2XZAL 1AY1L 1GYVA 4MJJA 1AGEB 3ESPA 2YBRA 3S3PA 1NC4A 1V3KA 1YHPA 4BE5A 4IRJC 5ANME 1AQMA 3CHOA 4H1LA 3KPRB 1LWHA 1T04B 2EYSB 3A4DA 2BOBA 4PREA 1QPPA 4OM0H 4G6JH 4PW9A 4W6XB 5I73B 5ID0A 3DUSA 3ULUL 1NBYB 1UWGH 3TO4D 1CK0L 4EN3B 2PKDA 4XNZC 1C12A 1Y1UA 3QJSB 3UAJC 4M6AA 3ZKQD 4FNPA 1KPVA 3QSKB 1D6EB 4DGWC 4K8RL 4NO3B 5KZCD 1BIIA 2F19H 4OF7A 2CHDA 4QRBA 4PRPE 4PJGB 4GQ9H 5E7BA 2XA8H 3BWAA 4MFHA 2CO7A 2BNQE 4DEPB 4BXSV 3WKML 2W65B 1ZD6A 3DJTA 2AXWA 2QADB 4Y5VB 3CBKB 4HKXA 3B2UD 4M6NL 1X5AA 1CLCA 5T1DL 1CFBA 2DICA 3KYNA 5CN2A 3BFQG 2PP8A 1KGIA 4IRJA 5IW1A 2W92A 2B9BA 4GMTH 5HI5D 4W1TA 4QF1A 4M6OH 4HK0A 3RX8A 5HYEA 2J5LB 3K2MC 3REVA 4C83A 2X2JA 5D2NE 4ZTPL 3QC6X 2GT9A 2KLRA 3GHBL 5GS1C 2PTUA 3FN3A 4OBRA 1BJ1J 5D1QC 4N24A 3UAJA 5FK9B 3BPCA 1T20A 3M7OA 5LGYA 1XQ4A 4K23H 5D5MB 2DQDL 4AK2A 5BRZB 4HW6A 1HTYA 3BZ5A 4NQTA 4N8UA 3KYOA 4UZGA 4WW1A 3ROOA 5EOCL 1HINL 1NGZA 4TUUA 1NAKH 5A2LH 4GFXA 5I1KH 5LO7A 1NIFA 2DBLH 2GY5A 2D9QB 2NY0D 3MBXL 5DRWB 4DUVA 3U82B 3THML 1L9SA 1OAZH 2OPCA 1J87A 3NIGE 3U6XA 1IBFA 4XMXA 4EMZA 2X2IA 1M42A 1L5GA 2H8PB 2XUWA 2DIAA 3LTVA 4JO2H 2ENYA 2NR6D 1ES0A 2W0LA 4DQOH 2OYKA 2R1YB 4AV4A 4P5RA 4KK5D 5ICUA 5D9SB 5DJ6A 4KROB 4XCNB 2UX6A 5FHBH 3V4VL 1BIHA 5GS1A 1FNEB 4GG6E 4MJ6A 3B37A 4QO1A 1QHPA 5DHYB 5DVPA 4KO5A 5FOJA 1GTNA 2NSXA 3SGEH 1X5YA 2OZ4H 1RZFH 4O2CB 1F90L 1A65A 4JQIL 3RDTB 1A14H 2W60A 4PJBF 3L81A 4YDLC 4XNBA 5KSBE 1RZGA 2X1OA 4XO9A 2GIYA 4F2EA 1RUKL 1WTLA 5FR3A 2V2XB 1EX0A 5MEPB 1NC2B 4P3CL 4I2XB 2GKIA 3LMJH 4K2UH 3WG7B 2JKNA 3MRJB 1CGUA 4WDIB 1HOCB 3QPXL 5EUOB 5F1IB 1IC5L 1UFUA 2ARJB 1LXMA 4HUVA 3D34A 2UXTA 2BSTA 4HJIA 3F62A 2VDML 3U4EA 1I7ZB 1LVEA 4H8WH 1QR1B 3KL3A 4KXDA 2ICCA 4Q6IA 2R0WL 1FL3B 4WK2B 1RIHH 3B5GA 2E86A 2X4RB 4HS8H 5ABZA 1TCMA 2AEQL 5DJDB 2NSMA 3CZJA 3RY6C 1Y0LA 1DJXA 3D18A 2B2XL 2UWEA 1CBVL 4PMFA 3X2QB 2YPLD 1S7WB 1QYGH 4FXGB 4GUOA 3PUUA 4OCSH 4AV0A 2XG4A 1HDMA 1VFMA 25C8H 3P73A 4Y2OB 4XMUA 4NZTH 4PRAA 3ZOAA 3IGLA 3VRIB 4PRIE 4AG4L 2OFQA 3IXAB 3R1GH 5HI4D 2Y6TE 3GMMB 5DJAB 5L0QB 2C5DC 1LEKB 3DRTA 1BZQK 4N22A 3K71B 2QZQA 1WHPA 4LBAA 4CVZB 3NQKA 5CCGE 1GXEA 1HL4A 1SOQA 1EZLA 1HSAA 1BQ5A 1XT5A 3PNRB 4ZO7A 4POUB 2EE6A 4GYBA 3P0YH 3SBRA 4PBXA 3D8MA 4RNRB 4NPYA 3MU3A 5AWNH 4JRXE 1GSKA 1U4FA 4OSUH 5EBLA 1MELA 3LPOA 1U8HB 4QTIL 5GJTL 3BD4A 1UD5A 4MA8H 3QCVL 3TGXA 2F08A 1W72L 3CDZB 3DTXB 3VGAC 4JY4B 1YEHH 5LBVA 2NY5C 4E5XA 1G9NH 4LCWE 4RAUA 1CLVA 3NYKA 1UZ6F 5E8OB 3VXOB 4WFHD 4N9GA 1UACL 3CFTA 1DQMH 2I9LA 3KLQA 2WLIB 1OTTC 5JHLL 4NQCB 1R24B 4HWZB 3SDXB 2YBGA 1NAMH 1SJEA 2K70A 5IQMA 1OP5H 5AB9A 2RD0A 4QMEA 3L7FA 5I8EB 5J1SC 1FZMB 3RNKB 2W9DH 5FUZL 5E08H 3HUJB 4OTXH 2YQBA 3F3HA 4M7JL 4XNYL 1RP9A 4JFHD 2EE3A 3IBEA 3RP1A 3ISYA 1E6JH 2OP4L 5TJWK 5TGBB 3TM6A 2CGRH 3E6FA 1N8ZA 4NDMA 3K6IA 3WHE0 5DD5H 1Q9OB 4Z7UF 4L4TD 3EO0A 3I9GL 1V3LA 2NDGA 3V4PL 3GJFH 4YBLB 1J9QA 2VMDA 1DN0A 4LLDA 2GFBB 3WEOA 3SDDC 2YJLA 4BFIA 4B0MB 4M43H 1FVEA 4KKBC 4W9IC 1N3NA 3UG5A 5KSAC 4P2QA 1B4RA 2Q7AA 3WENA 1EDQA 2QSCL 2XC8A 4DOHB 3IDUA 3J8F7 4TUOA 3RKDC 3HG2A 5HHOB 3L3OB 5ECJE 4JG1L 5ERWB 4CJ0A 1D7BA 2EDFA 2GB2A 2WINA 4DN3L 4WHYG 3DRQA 3QIUC 4MKTA 2J4WH 2WVTA 5BS0B 4DZBB 3FRUA 1BYOA 2RFXA 2EVIA 4K94C 3FAXA 4W9HC 3DOHA 1U21A 3QBTB 3MGTB 1J9CT 2EO7A 4OF5A 3M7FB 4JVPA 3AXLB 4UQ2A 4CMMB 1RSYA 4G8FA 4R26L 5EU7C 1MH5A 1WFNA 1QA9B 4ODXA 3RVXC 3X3FH 3UPAA 4V1DE 4ELMA 1YEFL 3S34L 3SPIA 3I02A 4M4RB 3VXRE 4BUQA 3Q9PA 1JS4A 2YD3A 5GISH 1U93B 3ZO9A 4JAMA 5JQHC 3N40F 4FQCL 1CQYA 4PRPD 5GGUA 3DXAD 3FF7A 3RTLA 4CADB 2BNQD 1QSEB 4P2OD 5LAXA 2IWEA 1JGUL 2R0KL 4N90E 1U8JA 4X4YA 3OJDB 3QIUA 3EKCA 4OFIA 3QPQD 4WLCA 4MMXA 3SYOA 2BIPA 4MA3B 4YDVB 2JSFA 2VDNL 4FMFA 1EBPA 3MFGB 1U6AL 1NLBL 2L8AA 5DT1L 2J56A 3INOA 3GMLA 4EIBA 3CSGA 5GRUH 4D9RE 3HPLA 4N2AA 1PG7W 4KAQH 4X6BB 1MLBA 1R75A 2AJVL 1AE6H 4YSUA 1RUQH 3C6SB 4XNXH 2R56L 1M05A 3EJZD 1E4HA 4F1ZA 3APMA 3MLZH 3SE8H 5K1NA 2JI1A 2J21A 4ODUA 3MCKA 1OB1B 1R1CA 2H6OA 1VJSA 5F96L 1H3WM 5I6NA 3IVKB 2MEJB 3FONB 5DC4B 2EIJB 3CZEA 5DRXA 1O75A 5J6SA 3DK2A 4MJHA 1QSVA 2CKBH 2BFVH 4ZOAA 1JK8A 1AI1H 4GKNB 3S35X 3RWJB 5EZJB 2X2UA 1ZHBA 3BESR 2WBJD 4PLJD 2JXMB 4S11A 4GKZA 4CBZA 1KYUA 5FO7A 3EYSH 2C9UA 4Z3IA 4YX2H 2R7EA 1OL0A 3D85D 4HV8A 2BJMH 4IRSD 1NBVH 4WSJA 2DLIA 3GS4A 4P46D 2JVUA 4PUBH 2TSAA 4NHUA 1C16A 4YDJB 3EOTL 3GXNA 4PB0L 1KIRB 3I50H 5HGDB 3I74A 3KWVA 1OT4A 1KBWA 4QHUB 1DVFB 2X05A 5JO5A 3GPSA 2EH7L 3CVDA 3MRDA 2EACA 2WNKA 5FB8B 3L9RB 5GGQH 1XGRB 4ZD3L 4UM8A 3MBWA 3CZFA 1GY2A 4KHXH 1DEDA 3BPOB 5EPMA 3S8FB 4LXFA 2RGSA 3P9WB 1AAJA 3TX4A 1WHOA 4PYGA 3B34A 1RZIA 1AO7B 1ZHKB 1E4WH 1N5AB 4OKDA 4I1PA 1IGFL 4R4BA 3O4LA 5DZJA 5L4JA 3QXDB 3FCTB 5IF0A 2UX7A 2XQYG 3MLYH 4QPEA 1FDLL 2KS0A 4AYGA 1NFDA 3KPRE 4NYLB 4F8PA 2WUCH 2NW2A 4E9QA 1G7JA 4HIEA 4HF5H 3K2KA 1ZLUK 4G11A 4KO6A 4RFEA 2VKWA 1MY5A 1TQCC 1CO1A 4PJIF 4BSWB 3LEVH 3L2MA 1CLYH 1KLGB 3MGOB 3VXMB 1KJ2L 4B95C 3E8UL 4PJGE 4PRID 4H88H 3LY6A 2MQCA 3FQNB 3DGCR 4DKDC 4R83A 1HEZA 3SE3A 5FM5M 1J1XH 3MLWH 1PAZA 3MRCA 4MQXD 1RPQA 3S96A 2WQWA 4O9HH 3V10A 1U8QB 3NZHL 3V0FA 4CU8A 1E5BA 3OMAB 1KBPA 4M00A 2X38A 4HLZG 3OKLA 3V4VB 3LN5A 4Q0XH 1TVBA 5F7EH 2W95A 4ZXBC 2BSCA 4JRXD 1AHKA 3QVAA 1Q9LB 3G5XA 3R7RA 1IZKA 5FW7A 1Q0EA 2BNUB 4UTAL 3SEPA 5GGTA 1AHWB 1KB5H 1KPRA 1Y6NR 3AG3B 4P5KA 4LCWD 3FFOA 2C1OB 3IFOB 1ASOA 2EO9A 3D69B 4M7KH 5K59F 1U3HC 5D5ME 3N85L 2H3XC 5C3TA 1P2CA 4P9MH 5BRZE 4FJYA 4FYRA 3I84A 5C0NC 1N2RA 2FJUB 2FBJH 5IFHH 2Q2EB 3LZLA 2EZ0C 2VDKL 1X7QA 1SDYA 4XP4L 4FCHA 3RX5A 1IRAY 4BH8A 1A4BA 5JIMA 1P4LA 3GJEB 3W2DH 2ZUQB 3M17B 3DX7A 3BISA 1R19A 2LVCA 3MRQA 4HCIA 5CILH 2EJ1A 3T3MB 4BFJA 1ERNA 2VLRA 5IMLA 1B9KA 2X4SA 1R5IA 5CN1A 1G43A 1I53A 3BYTA 4ZXBA 3SDCA 4FLOA 4UMGA 1DO6A 5AYUL 3NTCL 3FSWA 4XX1G 4CDGC 1KB9J 1HQ4A 4PEEA 4XVUD 5L9DH 3CBRA 1BBDH 4ANUA 5HHNB 1M71B 2G0LA 1U3HA 1IGML 2DI7A 2EDKA 5D2LA 5KYWA 1XH2A 5CD5C 1WZKA 3WHE1 1GIGL 2IBGA 1UM5H 2NZ9C 2XFXB 2VITB 3HG1B 3LQAL 4TMPA 3U0WL 2FHFA 5AVZB 2UZPA 5IJVA 1XO8A 4JFUA 4GKSA 2MTPA 4I2XE 4IMKC 4QRPA 5EUOE 5KYXA 4CVXB 4XZUB 4B5EA 4ZMYA 2BOLA 4HJGB 4ZUWA 1LO2H 2A77H 1MCJA 2R29A 5KYUB 4OQ1A 5BZDA 1PZUB 3QULB 3LH2L 2OMNA 2XQYK 4U1HA 4F57L 3LEXA 2COQA 5KUKA 4PSPA 2VDQB 1TYJA 1ZGLP 2H0JA 2YMXL 4YPGA 5D7JC 1F58L 3D4YA 4AXWA 1XGYH 4NKMB 4FQIL 1X4XA 4OV6F 3QCTH 5IHZB 2DQTH 3BEVA 4K3DL 4ZS6D 1KCLA 3OAUH 4KI5D 1DVQA 2VRQA 2EP6A 1KBVA 1AFVL 1F3JB 1MFCL 3BEWB 3C2AL 3LD8B 4Y7OC 1AKJB 3CN0A 4FNTA 2YSSB 4AH2A 1N9PA 5C8JB 5FYJH 1T21A 1JZHA 1UM6H 3K8KA 1X6LA 3NABH 4IMKA 5JXAH 3FDWA 3PP4L 3QWOB 3BQUD 1MI5A 4R96B 4K3HA 4XPFH 4XHQA 1VFAA 3Q48A 4KRPB 4N90D 4OM1H 2O5YH 4YSAA 5IG7B 1OAKL 2EDTA 3ARGC 1K6QL 1OGTB 2PLTA 1K5NA 1XB3A 3TN0A 1UKQA 2GHWB 3GEFA 1HYSC 4A1RA 4OT1L 3N06B 4K5PA 1KTLA 2CR6A 4ZTOL 3QUYD 1INEL 3QYMA 4JO8A 3VFSA 4Y2DB 4Z77A 2WGNB 4DPRA 1B2YA 1CE6B 4UQIM 5INDB 1G1CA 1BZDA 2P24B 4D9RD 1NSNL 1RJYA 2BMKA 3P3UA 5LGJA 1F6AA 2UY6A 3PJSB 3T2LA 1X9LA 3VACA 4YLQT 4NQCE 5CGYD 2P52A 3I6SA 3HC2A 4PIBA 2X6AA 2ICWJ 4HPOH 2ZAGA 2GI0A 1QFPA 4M1DL 3MLXH 3CU7A 4JKPH 2BLFA 1UOLA 1VAHA 4U1LB 4AW7A 1E8ZA 3L54A 3ARFC 4UQ9A 4ISVA 4ZI8A 1U8IA 3HUJE 4GI8A 4ZUSB 1X5IA 3CHPA 5D8JH 3D51A 2AEPH 2UV3A 1SLXA 3VYNA 1Q72H 4NKDB 1Q8MA 3ARGA 3O0LA 1GHFL 3CFUA 2CJUL 4KWUA 2I69A 3FKUS 2YKLH 4F5CA 4GUQA 4B9CA 5F9WB 2CLRB 3R06A 5TQ2L 4JMNA 3TT3L 5IBLD 4G8GB 4TLSA 1LM8V 1JPGA 3EJCA 5JNYA 1SM3L 1XGUA 3FB5A 4HCGA 1Z0NA 3WNOA 1JUFA 2ITFA 3HI6H 3LDBC 2YUZA 4KMTL 4MASA 1MCKA 4QKXB 4DOHE 1E27B 1KCRH 2ZXDA 3PL6C 3ME0A 1WBXB 2DM2A 2ZXAA 4BQCA 4WTZA 1JPSH 3NJHA 1XGTB 1WIOA 1Q0XH 4A2EA 3GIZH 2VDNB 4TTDD 4XXCC 5SX4I 3D6GA 4HIIB 1T03H 1LE5B 3ZQ9A 5BS0E 2EE9A 2V5SA 3OAZK 3TS8A 4NO0A 4ONHB 4OLZH 5B1JC 2CJTA 3WS3B 1SLWA 4DW2H 1KUMA 5DLML 3EYUL 2ZXWB 2N01B 3AABA 4IU2A 4MZ2A 1OAXH 3NQIA 2UVFA 3RILA 2R27A 4EN3D 4DK6A 2R1XA 1UXSA 4UYQA 2EO1A 1G9EA 5GXBB 3LKRB 2BZDA 4HG4K 4W9KC 1IARB 1YPZA 4YHMH 3L9BA 1QSEE 4FLHA 4N2CA 2ZOKB 1RFDH 3KPLA 4P5TA 3W0WA 3MJ9H 3WKNA 1CGVA 3MR9A 4XXCA 3CFKA 4LRIA 1JDDA 3T4YB 4BJLA 5I0DA 1G0XA 1VCBC 1VIWA 2DMKA 3EBHA 4PJ7A 3RL1B 5B1JA 3QEGL 2OK0H 3KPNB 2Y1VA 3GYRA 2H6PB 5E4EB 3QZWA 4WHYH 1MQKL 3K4ZA 4TN9A 3PHSA 1JGVH 5CAYB 1CE1L 1DVXA 1JJUA 1LDSA 2RMNA 1NEZG 4GO8A 2DM7A 2Z7YA 2O5ZL 3HAEG 1MSPA 3N2JA 4O5LL 2OMTB 4EI0A 3FQXA 3QG7L 1ZLUH 4QAMB 3K80A 4QXWA 5C0AA 5GS0D 3NJIA 4P8QA 3RU8H 4J12A 4ZYKA 3F6JA 1KMGA 4P57A 4ANWA 4IGBC 2FB4L 4JZNA 4NNPH 2V8LA 4LDCA 3CMOH 1KG0B 1LWJA 3BWUC 3OLIA 3EYFB 4D0BB 5DJYB 1BX2A 3MBEC 4MSWB 2Y6SD 1ZT4A 1KJ2B 3T08A 5EFIB 1QEWA 3C5ZB 1S5IH 2ZWZA 3LS5H 5I16A 2ZP8A 5DVNA 2YQ3A 4OLEA 3EJUA 5CJQL 1NKRA 3HW7A 2FZ3B 3QJRB 3P0GB 2EINB 2XHNA 3ARBD 4RAVB 5C07A 5F72S 2LFEA 1RL1A 1NOLA 5IMOA 4P23A 2JK5B 1O9VA 2CALA 4TYUA 1UOKA 1GCFA 2JNZA 3NSFA 4ZMOA 1NC2D 2BWDA 1BSIA 1BVLA 1JWUB 1ZVSA 3ESMA 4TLKA 3V0EA 2A1WH 2Z31C 2XKNB 1AO7E 4IGBA 2Q6WA 4A39A 4HUCA 5EORL 1ADQA 2GJRA 3FUDA 3S35L 3L3KA 4K7PL 1GA2A 3DETD 2OMVB 2UWEF 3MBEA 2K6WA 1LE9B 4XPAH 4LLMA 3IJSB 3GMRA 5EN2A 2LFGA 3MRIA 2PUQT 4RH4A 3VWJB 1E90A 5BQDA 3KE0A 4X8JA 3PIQA 2HLAA 5IK3B 3HNTL 2WMPB 1DJGA 1CD1A 3VXME 1I1AB 4B9JA 3ZMNA 2OSLA