4QO1B

P53 dna binding domain in complex with nb139
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
199
structure length
199
Chain Sequence
PLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nb139 Nanobody against the DNA-binding domain of p53
publication title A nanobody modulates the p53 transcriptional program without perturbing its functional architecture.
pubmed doi rcsb
source organism Lama glama
molecule tags Apoptosis, transcription
total genus 49
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qo1B00
1HJCA 2BIMA 4AGPA 5AB9A 2OCJA 4IBWA 5G4NA 2X0VA 5A7BA 1CMOA 3VD0A 4GUQA 2J1YA 2BINA 5AOJA 4L0ZA 2X0UA 4AGQA 3EXLA 3QYMA 2RMNA 3Q05A 1YCSA 2IOIA 1UOLA 4MZIA 4XR8C 2VUKA 2FEJA 4IBSA 4AGOA 3TS8A 3D0AA 2IOOA 2H1LM 4KVPA 2YBGA 3WTWA 3KMDA 4IBVA 1CO1A 3ZMEA 1E50A 5AOMA 3WTVA 3WTTA 2WGXA 5LGYA 4G83A 2AC0A 2J21A 1EAOA 3US0A 4IBYA 1KZYA 2BIQA 4GUOA 3Q06A 1H9DA 4IBQA 1LJMA 2IOMA 3WTYA 2BIPA 1GZHC 3D08A 2X0WA 5BUAA 2GEQA 4IBTA 4LO9A 1GZHA 4IJTA 3WTSA 2ADYA 2ATAA 4L18A 3WTXA 2AHIA 1EANA 2XWRA 2MEJB 4L0YA 5AOIA 3IGLA 2J1WA 2J1ZA 4A63A 5KBDA 1IO4C 1HJBC 5G4OA 4QO1B 5ABAA 3WTUA 1EAQA 3VD1A 4AGMA 5AOKA 4AGNA 2PCXA 3VD2A 5LAPA 5AOLA 3D09A 4IBZA 5G4MA 4LOEA 3WU1A 3KZ8A 3EXJA 1TSRA 4LOFA 3QYNA 5ECGA 1HU8A 4IBUA 4AGLA 2BIOA 4MZRA 1TUPA 3US1A 2P52A 3Q01A 4G82A 1T4WA 2J1XA 3IGKA 3D07A 4HJEA 3D06A 2J6WA 2J20A 3D05A 2XWCA
chains in the Genus database with same CATH superfamily
4P57A 3KCPA 4M3JA 3BD3A 3JWNH 3QCUL 3VFNA 3CIQA 2WBXA 4GXUN 4TL4A 3R0MA 3CVDA 1IEAB 3LKSB 5T8IA 4DAGH 4JDTH 4LXFA 5BOJA 3RWGA 1MZZA 3WJJC 2JK5A 5DRZB 1S5HB 2NW3B 2F74A 3BPOC 3VXUD 3NZHH 2R7EB 2HLFD 3BN9D 4I18B 2YS4A 4MYPA 1CICA 1BVNT 1F3DH 3TA3A 3D39E 1MNUH 2PP7A 3ABMB 3RB7A 2R0WH 4OTXL 5CINH 5EORH 3L5IA 2FIKB 4GKOA 5EF0A 1KPUA 4RX4D 4LPYA 4CN4A 2Y07L 3IU3B 3N41F 3T3MB 4E5XA 3CZNA 4YHZL 1RZ7H 1UZ6F 3AG4B 3KPQB 4NQED 4R83A 5JHLA 1LK2B 3KHQA 4JMXA 5EIIB 3LNHA 4QYOB 2VGLM 1PMYA 4OSUL 3FPYA 3BUYA 4ONHA 5F9AC 5I66A 1RUKH 2EP6A 1VZIA 1AQMA 2DLGA 4FQXA 4U1SA 1A6ZA 2EUVA 2DEXX 1UFGA 4J6RH 1H3PH 2HPOA 2ITFA 5K1JA 3MR9A 3TO4B 3DPDA 5ITFB 3LQZA 2PTVA 3O0RL 3V4VH 1YYCA 4JHZA 1W0WB 3DYPA 5KYUA 5FCUL 3T3ME 5FF6A 1P9MC 1FAKT 1GZQA 2BXYA 5E1AB 3H0TA 3ZZQA 3TN0A 4KFZC 2FATH 3VFGH 2HZHA 2QPDB 4GW1A 1XAUA 2FZ3B 3SODB 4LEXL 3T77A 3KYKL 5ALCL 4NWTL 3BD5A 4JHVA 2Z35A 5F6IC 3SBWC 5AKRA 2NUTA 2QTVA 1RIUH 4PGDB 4PG2C 4YSEA 1KEMH 3POHA 3GSNB 4LHUA 1T0OA 3ZHDA 4JCLA 4L3EB 3NPZB 3H7LA 4WJ5A 1ITBB 3KLAA 4M5YH 3QJUB 3RIAK 1A2YB 1RIVL 1F0LA 2BNRA 2HAZA 4N2NA 3ZMNA 4OCSH 2CWRA 4GMSL 4Z7QB 4NIYE 4GRLC 1SLWA 5DUPL 4JPVH 2IXQB 4KQ4L 4DP7X 1VJSA 3JUYA 8FABA 1UQSA 1G6VK 2HWZH 3ARXA 3KLSA 1EO8L 3IXAA 4XP6H 3L4UA 3UO1H 1HT6A 4MLSA 1TU2A 4ONGH 2L8AA 2Q3XA 3VQ1C 3JTSB 3DX1A 5AVYB 3CFIC 3TZVC 3DTXA 3QJFB 4L3EE 1I9EA 2XWCA 3H9HA 4J1UA 4WWPA 1QNZH 1E43A 1CB4A 4ZD3H 1SN5A 3DUUB 5FA3B 4DN4H 3WELA 4ZUVA 2I85A 2C9AA 2IALA 4Z7QE 4P5TA 2DI8A 4TRPH 5FDWA 4IIQB 5CCHE 3ESMA 1DN2A 4TUOA 4TUKL 3EGXB 2VERA 5TE7L 1T22B 3B3BA 1O7DC 5D2NA 1N10A 3WHXB 1NFKA 2EDOA 3S36H 1CVSC 3BVVA 5KBPA 3T2NL 5JDSB 5GZNC 3NCYS 3MJ7B 1J9QA 3S34L 4DT2A 1KXVC 5AW9B 3MLSL 4Z3HA 1B88A 3MJWA 5DUBB 2DYPA 3DI2B 3BLBA 2FH8A 1XGUA 5DT1H 2B59A 3T0WA 5EUOB 4EIBA 4DGUA 2Q6WB 5G5DB 4ZTPL 1QKZH 2A0LC 3O9WB 4BE5A 2BJMH 3VQMA 3ZDZF 4G80B 2GT9A 4HZ1A 4OM0H 4AYID 4JN1L 3BRDA 1S7RB 1HFUA 1FFPA 4L8DA 4UAHA 2X28A 1Z6JT 2NX5D 3LKNB 1NLBL 2YAMA 3MRGA 2JKRM 3ARED 3EOAA 2JKTM 2X2JA 2BSEA 3OZLA 1Q1JL 2GY5A 2F68X 4MQXD 5I18H 1QFWM 1DN0B 2ZUQB 1MIEH 4KI5D 4PY8J 3FS9A 5EUOE 2GIXA 3ECWA 3CFKB 2XWRA 1SY6L 5KSVB 2YSSA 5HTSA 4PLKD 5K9OB 4HFUL 1VLXA 2G2RB 1MCEA 4G7YH 3WNPA 4FZ8L 4U3XA 2E6JA 4XBEH 1M53A 2ZYHA 2LU7A 2VLRB 4H25B 4YJZL 3U6RB 3FQTB 1OANA 3IPBA 1IV8A 5EBLB 5H37A 4B9ZA 1S5IH 1T04B 3EG9A 4MX7B 3HPLA 1HNYA 4APQA 3ZKQD 1G9HA 1TMCB 4M8VA 3FOMA 3FU6A 4WI3A 2XQBH 2PYEA 5D6CB 5F7WC 3X1GA 2BSSB 4UM9B 4JRYD 3QXVA 3QG7H 1HS6A 3Q5TA 1A6TA 3LY6A 3BC9A 3GEFA 2Q8BL 2QL1A 2BS9A 3WNKA 1WV7T 2I26N 1R46A 2BOLA 3BDYL 4YFEA 3M1BB 4Q74A 3MRIA 3P4OB 4HF5L 2VLRE 5IWLA 4IRSC 1MCBA 3ABLB 4FOMA 4M8QA 4HXBL 5EU5B 5JPMC 3J07A 4OZ4A 3MBEA 1SOSA 2C1OB 3QDMD 3STZB 1TSHA 2A6IB 2X09A 4K23L 3N40P 1VACA 5EU4A 3B2UD 5KJ4A 5MEPB 1OP5K 3UTQB 1JI1A 1VZGA 1NAMB 5B4MC 2R39A 3NACL 4CC4C 1YNTF 3VQ2C 1SQ2N 4WCYH 5HJ3B 5IKCB 4F91B 4L23A 1KXHA 1CL7L 4OTXH 3P73B 1FN4A 3GPEA 1X6NA 4C4KT 1IGFL 4IS6B 1O6SB 1OPOA 1MCPL 3V52L 3JV4B 5BRZB 3S3CB 1R3HA 3RDTA 5I8OL 1IM9A 1WGOA 1X9QA 3GMPA 5IVXF 1M42A 3HI5L 3MYJA 1KUMA 4P23B 2EE2A 2F8XC 3M8OL 1I85C 1W8NA 4PWGA 2MJWA 3QRLA 2YARA 3GSOB 5DRXA 3WFBH 5DZJA 3ZHFA 4KMLB 1FVCA 4JFZL 4IBQA 1NBVL 1MI5B 5BQ7A 3FRPA 2YKKA 4WDIB 5FCUH 2WLLA 1SJHB 5F3BB 1T5XA 3ZJAA 3R1GL 1BOYA 2WD0A 3LN5B 4OFYA 5BRZE 1UYWH 1KJ3L 2JV6A 3DX7B 3NGBB 2G30A 4V1DB 5AKTA 3OKOB 5AVTB 4F58L 5C6WH 5KVMC 5ESAB 2F1EA 3DROA 4LEXH 4YSOA 1UEYA 1JK9A 3KYKH 4PJIF 5IVZB 5EEUA 3KS0J 1NAML 2HVKA 1I8LC 3JT0A 4L4TD 5MEQB 2V5RA 2Z4TA 4KXBA 3W5MA 4PGEA 4W6XB 5JMRA 3BCFA 4TQEH 1BDYA 3FQWB 1TTAA 4BZYA 2J55A 3RKDC 2XA8L 1MI5E 4YWGL 1YEIH 1IAOB 3QWRD 2X4PA 4WY7H 5D7EA 4YEFA 4LLVB 3KEHA 3LEYL 3CDGA 1RIVH 3AMKA 3EJSA 4PJ9C 3FFCD 1KJMA 4GW5B 3HPJA 4GMSH 4HT1H 1YNTA 4J4PD 4L4JA 4V1DE 3V5DA 5DUPH 1NCAH 2YUXA 1ACYL 4WHCA 4KWUA 4XN5A 4KQ4H 4HSAC 3QQ3A 2NXZD 5CFHA 2Z8SA 4FMKA 2OMNA 2DJUA 1AR1C 5IHZA 5HDBF 1EO8H 3QAQA 1NFDF 1QLFB 3PNRB 4U6HA 5JR1H 1ETJA 4ACPA 4JHWL 1FI8C 1LO0L 2JJTA 4GW4B 4ISVB 1W72B 2X6MA 2PPDA 4WV1A 4NQXA 1W0VA 5DJYA 3BOVA 1HZHL 5IVXA 4HFWB 4RA0C 5F89A 3QNYA 1ERNA 2IANA 4Y2DC 1Q9KA 2WTPA 4PP1D 4KK9D 3V55A 5JQIB 2YAPA 2FSDA 1U42A 2GW5A 3O81A 3FSWA 3BGAA 3QFJB 1GOHA 1DVFC 5TE7H 2MTAA 1ZHKB 3UIYA 3GXUB 2C34A 4JG5A 3MRJA 3EYVA 3T2NH 2BW4A 2UZXA 1P7KA 2ZWLT 3QUZB 2BVOA 2WQ8A 1FNEB 4JZOB 4RGMB 3K0YA 3MLSH 3ESNA 4PJIA 4A67A 4PRAA 4HUXA 1ZANL 4JB9L 1ZRUA 2VUYA 1Q9WB 2EECA 4PHXA 5CZVH 3BEWA 1KB5L 3RGVA 4XO9A 3NCJL 4ZTPH 3DV4B 1Q90A 3QFJE 2NY2C 1A6AB 1DBKH 4F2EA 1AHWC 2V5YA 2AV7B 1Q94A 4PM1A 3ZZSA 3EJZC 1ZHNB 3SGJA 4ELDA 4OFPA 4GFTB 5E5UB 1OSEA 3GSWA 3LRKA 3HRZB 3CIAA 5A1AA 5C2UB 3TTSA 1I82A 2WLYA 1LD9B 5C6TL 3EO1A 3P77A 4Z18A 5B1AB 3BKML 4DP9X 1ORSA 4GI8A 2FRGP 4M6NL 1NFDA 2DS4A 1YEKH 2B9BA 3Q5OA 4OD3L 5DS1A 5AUMA 3TV3H 1U4FA 1CZ8L 1E0OB 1B0IA 1F3DJ 3C5ZD 5GSVB 2LABA 4HX1B 3D8MA 4O4YL 1G7PB 2GI7A 4N0FB 5I1JL 1DJSA 3TN0D 2R2HA 4AYSA 2CLRB 3ARYA 4JFEA 1TQBC 2VIRB 4KPHL 5FECA 1J12A 3EYFA 5I8EA 4ZMOA 1REIA 5IW3A 4ZTEA 4KO9A 1JWUB 3DUSB 1A25A 1ED3B 2EYRA 4MNHA 3JZYA 5EUKA 2MPAL 1ZT4B 5SWQB 1UKQA 3GIZL 4LHUD 1UWEH 4YE0A 1JNHA 4QHUA 2K9FB 4JK0D 1A6UL 1GC1C 1WD9A 3OJVC 4ZFOA 2OKMA 1PGRB 2ZWNA 3ETBF 4M93C 1IAIL 3V4PL 2YQ2A 3SDDB 2JLPA 3I2CL 3LHAA 4DKFL 1K8IB 1JYVA 2OR9L 3NMEA 2Q8BH 1LXMA 4ZOBA 2ERJC 4N8VA 1N6QL 5IB2B 4ZXBC 5HI4C 4Z7NB 1OTTC 3GBML 2Y7NA 2WN2A 2CK0H 3EJRA 4LNRA 3BN9C 3QE5A 3TO2A 3GRBA 4HXBH 4OH2A 4DZ8B 1BOGB 4HKBA 4LEOA 4P5MB 4UZGA 1EK3A 2WNKA 1QLEL 3PXHA 4KDTC 5FM5O 3REVB 2E7LA 4ANWA 1OPGL 4FG6D 1IC7H 4MQ7B 4K23H 4P4KC 2OMVA 4O02A 1JIBA 2I9LA 2N56A 3GLEA 4KAQL 3NACH 5E2UL 3BYTA 2X4QB 1W6LA 1WCQA 1UGNA 4G8GD 4JY4A 5DC0A 4AT6A 1KB9K 2Z7UA 1CL7H 4P5TD 2NQ3A 1RL1A 3QZMA 1FWXA 4Z7NE 3MROB 3QUXA 1PLGL 5C0GA 1MCPH 1OGTA 3FSZA 3KPMA 5HDOA 1XBDA 2X4SB 5IVNA 2XUWA 1NBZA 3GMMA 3QUYA 4YEEA 4F2MA 3VWJA 1J5OH 4LRIA 4IRZH 1MJUH 2VQ1A 3SD2A 1E9QA 5GRZA 2XQYA 5I8OH 1IBFA 1RZKL 2EDFA 1KGIA 2G3MA 4AM0A 2XPYA 4K2UL 2JCCF 3BP5B 1IBGL 3M8OH 3OKNA 5CZRA 3NCMA 2FJFB 1RV6X 2QSVA 2WKLA 1U92A 3CVCA 1I1FB 2BHZA 4PRPD 4HIEB 4JFZH 3ZDYF 2J8UF 3RLSA 3GBLA 1DHKA 3ULUD 2H32B 5D1QC 3R1GH 2H2PC 3PP4L 1KJ3H 3IDUA 1DEDA 1CGVA 1HQRA 1E9OA 3LRGA 3K4DA 2BSTA 2AEQL 1FLRL 3OMIB 5I1AA 4HGWA 4OLYH 1JF1A 2BSED 1MDTA 3GUFA 2YBRB 4RMSA 4UF7C 4KU1A 3RQ3A 4PJBB 1S8DA 3L3DA 3QDGA 1O6VA 2XA8H 1NC4A 4WWKD 5AOKA 1L9OA 2V9UA 3LEYH 2R9HD 4MJJA 4WZ9A 1T4KA 2OMXA 2QMJA 4BFBD 3OKLA 1KPRA 1BD2D 1NC2B 5AQ0A 1LLAA 1VFBA 4X4MA 1ETZB 2WUBH 3BUBA 4PJ7B 4D8OA 1GPOL 5ECGA 4AV4A 3D51A 2DQDL 5IHHA 1ACYH 5LVEA 4WLCA 3UTSD 1PY0A 4H13C 2OX5A 2R59A 5H8DA 4NKIL 1NGQL 3CHOA 4K7PY 5TQ2L 2IADB 1FO0B 2MQ0A 3UGEA 3VRIB 1GOFA 5EO9A 3EFDL 1JGLL 3MLTB 4PJBE 3SE9L 5LBVA 2A9CA 3R4RA 3LH2L 5FB8B 5LGHH 4ODTL 4AKPA 3PJNA 4OCRL 2E5EA 1HZHH 4Y16A 5JHMA 3PDOB 2JCCA 4UUJB 4DGIL 2AJZA 4MMZC 2R51A 2NDGA 4WENB 2W65A 4EDXB 4NAMA 3ZQWA 4PJ7E 2XETA 1PVHA 2IH1B 4XXDB 3ZO0A 4U1NB 4A2FA 3IDYC 1QBLL 2K8QA 1X4YA 2X4NB 2Y7QB 5TFSL 2J8UA 1BXUA 3BEVA 1G0XA 1QUNA 3CC5B 3M86A 2VE6B 3VFSA 3WHE1 3RVUC 1Q72H 3MBXL 1G7JB 1CXIA 1MUJB 2EYSA 2XQ0A 3GSUB 3WNNA 5FKAB 2OMTB 5H94B 1ZHBA 1N0LB 2GSGB 4NUQA 3IN2A 1ZANH 2BP3A 4E5XG 1EUTA 1CFVL 3DX6A 1KB5H 3IJHA 6TAAA 3NCJH 2FD6H 1E42A 4RAVB 3U4KA 1L9QA 2A2QT 5C3IA 5J13B 1MCRA 1QRND 3CSYA 2DBLL 3MBWA 2H9GB 1FO0L 3S8FB 4N25A 2XOTA 3MRHB 1HVXA 1CLYL 3NIFF 4IBYA 2ZUUA 3K3QA 5I24A 3F6JA 3DMMD 3RDTD 3QORA 3ZDXF 5E99H 2WY3B 5DEZA 4JN2A 3CBKB 1NFIB 2ZXEB 4AQ1A 5HYJA 1NGWB 4PLKC 3RU8L 1UUSA 1XH3B 3H9ZA 4WHYG 5ELIA 2MSPA 3U9UB 3C08L 4GAAA 1AHMA 3CVHA 5C6TH 5AAWA 1UWXK 2Q3AA 3BKMH 1CDBA 1FPTL 2ZOKB 1MCKA 4Q9QL 4M6NH 5DK2A 3ESVF 1CZ8H 3MRDA 3P4NA 3OHXA 2X9ZA 4WGVB 3US9A 1LL1A 2ZONA 5AWNL 3R19A 5CP3A 3TBWB 3ATAA 4LQFL 2K3HA 4NKMA 1Z3GL 4KPHH 2EADA 2WSPA 5GZOC 2V9TA 4XB8A 5ABAA 3WE6B 3M17A 4JPIB 4OQTL 3UPRB 3VD1A 2CJ3A 1N8ZA 3UC0H 5D1ZD 1EGJA 3SDCA 3MRQB 3F05A 3F04A 3FT0A 1YUKB 4PJGF 1MCSA 1VZHA 4LHUG 3RWJA 2ZNWA 1OP5H 2MPAH 2C3GA 1F6AB 3BGMB 4WK4B 4PGCB 3GNML 3GIZH 1UZ8A 3MNZB 4ZMNA 1TQUA 2WWMC 2AQRA 1BQHA 4HV8B 1HQ4B 3BUQA 1IAIH 4JO1H 3TBYA 2BVPB 1I8KA 1BZ7B 4PJ5B 3V4PH 2EINB 3I2CH 4CBZA 4DKFH 4YSDA 1IJNA 2OR9H 3IJ9A 3BE1H 1K6QL 3L9RB 4J3BA 1N6QH 4IJ3B 2FO8A 2A74A 3B2UC 1FH5L 3GBMH 4KVCL 3WXWL 4M7LL 3KCWA 1AC6A 2K7QA 3B6SA 4I0PA 4N0YL 1NMBL 3UP1A 4F2FA 3T4AA 3HN3A 1A6WH 4LMQE 1RZ8A 1QLEH 3ESUF 2PPCA 3HZMA 1A1NB 3AB0C 2X42A 1CQKA 2YRPA 5CMAB 5DZPA 2JKNA 2NY4B 1WWWX 3B9DA 4KAQH 3U46A 2IAND 4CILA 2E6QA 1OAJA 2VLJB 4PJ5E 3CMOL 1GH7A 3EH5B 4N2BA 5IQLA 4QCIA 1A4BA 3SYQA 2FO4B 4HD9A 2C1PA 1AD9B 2FLMA 2XSKA 2AK1H 3EAKA 2D7MA 5LAXA 2IBZX 4MAYA 5E9DB 3L7EB 4YSSA 3ASNB 4WI9A 3WTWA 1FORH 3OZ9H 3LNDA 1JFQL 5FOBA 4LDEB 3P2BA 3RWIB 4AIZA 4GRLB 3O3DB 5E8NA 1U95B 2ZX5A 5DLLA 2YEZB 1K5NA 1RZKH 2VZSA 1ZGLP 4XC1H 5H35A 4K2UH 1X5IA 2XBDA 1NCOA 4K7PL 2GJRA 3KD4A 2DY2A 1A66A 4NO0B 3WOVA 1BX2B 2RIKA 1HWWA 2VLJE 3IMWA 3F83A 5B38B 1J8KA 1IZJA 3E9TA 2E7MA 2G60H 3FJTA 1RMFH 1U6AL 1GGTA 4YDNA 1MCCA 3ARBD 4LAQH 3T6VA 2CDFB 3O3UN 2R56H 5E9DE 4XXCC 5IFAL 5EBMB 1WFIA 4OCNC 5TH2B 1HEJC 4OCLC 1G0DA 4ODVL 1CYWA 3PP4H 5M95B 4NQVA 1WTGT 1JGVH 4WRLA 5DYOB 2IGFL 3EJPA 4HIJB 2ATAA 1FLRH 4PP2A 3TV8A 5EZLB 2BM3A 2ZUTA 4Q2ZA 4OJFL 3FT1A 4UTBL 2X2UA 4M4PA 2C9XA 2VSKB 2E47A 2PW2B 2V5SA 2JH2A 1NEPA 2WQAA 3DSFL 1U8LB 3K2UL 2IGTA 4WI4A 4PW4A 3IJSB 4E9WA 1UXLA 3MLRL 4S1SL 3KBFA 2FWUA 4HMCA 1KV7A 1H6TA 3PJLA 2VM4A 5ICZA 3ULVD 2O1AA 2ORBL 1CDYA 4FXTA 2I9TB 4HKZB 2D2OA 2YR3A 1GW0A 2YN3A 1IE4A 4JFED 4DP1X 4GO8A 5F70A 1NMAL 5E08L 2R27A 3F58L 2Y36L 5H37G 1KYOJ 5C86A 4YO0B 5SWSA 3UCQA 2I07A 5IG7B 2JKJA 1E6JL 4NKIH 4QXVA 3ZX1A 3W9EA 2BCKB 2WCSA 4PP1C 5AOZA 2N0MA 4JFDB 3NIGF 3ZVVA 3EFDH 1NDMB 1MCOL 4LKCA 4PD4J 5CGTA 1FLTX 3RFRA 2APFA 1BZQK 1JV5A 1MFNA 5EO0A 3ULSA 5IMOB 1V27A 1D5ZA 3BSZL 3CVBA 4Y9EA 5DK3A 3VXOB 4BFIB 1YY8B 1JPEA 4FYRA 4HZAA 4N2OA 3S0PA 4DGIH 3BW9A 2E27L 3ARZA 1OSPL 4Y5XB 3E8VA 4MDJA 3VFWA 4X50A 4L29B 1P1VA 1WAAE 2VDKB 3BPCA 3BVDB 3MA7B 3U0WL 3ZMRA 4ZMVA 4DGVL 1TDQA 1Z32X 2OYLA 3B9AA 3WS6A 1TEFA 1CICC 1G7QA 1E2WA 3CTTA 3TA3C 4HGKC 3C6LA 3I3BA 5B1BB 4DQOL 4LBEA 4JFDE 5INCB 2R1YB 4DTGL 1CFTA 5CHNB 1RK1B 2YAEA 4U3SB 2GCYA 1IQDB 4K94H 3T1FB 2R4RH 4L5FH 4JCMA 1AZZC 3FQ2A 3MBXH 3I6GB 1VPOL 1U91A 2GBTA 3MJGX 4PREB 3WFDH 2GTWA 2E7BA 4DERA 1LEKB 4QY8B 3HFFA 1HYRC 3ALXA 4OI7A 1Z9PA 4FQXC 1OLZA 3L5JA 4IKKA 5I15L 1CFVH 1PZAA 2BCMA 3IDJB 1M9WA 4XODA 1Y6KR 2ZYRA 1PZCA 3D52A 5LXGL 3BAJA 4JFPB 3QXWA 4KDWA 3KPLB 1CLYH 3PRZA 1SHMA 2I24N 4JFXB 5CP7A 4IKIA 3VFRA 1MY5A 2BNQB 1TPXB 3DJ9A 1PTZA 3CBJB 2CZNA 2B5IC 3NRFA 5JPMB 2GVYA 2XWBA 4ZPVB 1OGAD 3TN0C 4H0HB 4M6OL 2JJWA 3DV6B 4R96B 4AV0A 1RP9A 3NJXA 2RALA 3FRPG 2VDKL 2ADYA 1Q9LB 4X4KA 1MRCL 5PAZA 1OSZA 3D85A 2OZ4L 1T21B 2O93L 3WO3B 1WCBB 1N7MH 5I6KA 1Z7JA 3OJMB 2ENYA 4UBDD 3THMH 1QR1A 2Q76A 5BV7C 4MBRA 4O2CB 1NCBL 2IMMA 3WFEL 4K73A 2F53A 2BNQE 2XKNA 2Z93A 4FEMA 4Q9BA 2LU5A 5GGRB 4OQTH 2J6EH 4NXSA 2WWOA 3B9EA 4XP9H 1V10A 4YSAA 1YDPA 5KYNA 3CFEB 2PPEA 3K6FA 4M62L 3W11D 4BFGA 2P3YA 4QI3A 5EH1A 4Y19B 4ZNEA 5A40E 3GNMH 3QDGD 5HYFA 2QADD 1MNNA 4GT7A 4XTRC 3WIAA 3MFFB 4UAOC 3LIZA 3QJHB 4XB7A 5F93C 1MHHB 2MWCA 4PJAB 1Q0XH 1DVTA 3AW5A 3IMSA 1JHTA 4OZIB 1LEGB 5CZKA 5IESL 4A04A 1AE6L 1H6EA 2FVNA 4U7MA 3L3GA 2VR3A 1GOGA 5BMFH 2VO8A 5HPOA 2B4CC 4B96A 2X6VA 1FH5H 1ZTMA 3WXWH 4M43L 2GIMA 1WAPA 3GM0A 4M7LH 3G08B 4PRHB 4N0YH 3VH8A 1PL3A 1QI4A 4B41A 5BJTB 3PG2A 3ZTDC 3IYLW 4P5TC 3X11A 5MP6L 2AKRA 2P8MB 4Y19E 5F7KC 1H3VA 1DBMH 1ILSA 1NGZA 5KSBA 5DMKA 1XB8A 4G72B 4UTAA 1T7VA 2VLLA 5D2NC 2P5WB 3QZOA 3ATEA 4PJAE 1ORQB 3QR0A 4K4KA 4Z5RB 1XR9B 2VL5B 4R4BA 4HIHA 4RNRB 4NO2B 4R7LA 4AYBA 3FH8A 4TNVK 4OZIE 2QQQA 2X4RA 2HUHA 3Q9PA 5L0QC 4ELMB 1ADWA 1DLFL 5F3FA 5ACZB 4TL5A 3RWFA 3IVKB 3Q2LA 1NZRA 5GRYA 1JV2A 4PRHE 4PJ9B 1G6RA 2C9VA 1R34A 2PUQT 1G5AA 1FZJA 3ZN6A 3P9LB 1NPUA 2NNCA 2KI6A 2WSDA 1YPZF 4TUUA 5TDOA 2KPWA 2EDNA 1MFAL 2Y25A 2CIIB 2OZNA 2J25A 2P5WE 2X70B 1SLVA 4FFZH 3CCHB 1B90A 4RISL 1KJ2L 5I1EH 1H3GA 2E0PA 3L7FA 1CLOH 2KERA 4XRCA 1J0YA 2F19L 5EWIL 1AGBB 25C8L 4ELME 3IMVA 1NL0L 1DJZA 4Z3TA 5K9JL 1DZBA 1KTLB 5HYQB 5I1IH 4XBGB 1SJXA 5F6HI 4LIQL 4XVSL 4PJ8A 1G5GA 4Y88A 4PJEF 3JYBA 1QEXA 4ODVH 1FIGH 1G7LB 1OB0A 2QJDA 2IGFH 4OT1L 4WWKC 2KLRA 1BWWA 5L2KB 5HYJD 2FECL 5T1MA 3VG0H 3IDIA 4UTBH 1E6OH 3D34A 2WNXA 1AD0B 3GSRA 2NY1D 2DWEB 4KX9A 4ZUWB 1BHGA 2HT3D 3APNA 1ND0A 5C1MB 1W80A 1V7NL 3PUCA 2VO5A 3MRNB 4FMFA 4NIKB 2I32A 1E3XA 4A7QA 1FJ1B 1A4KB 1TR7A 3TJEH 4S1SH 4BE6A 5I16A 2ADIB 3TOPA 1WHPA 3OX8B 5FO8B 3NEXA 1MCWM 1JWMA 4ONFH 3FCTA 2YXVA 5ESQB 4Z0XB 1X5ZA 1KBKA 2EDLA 3MCLL 4JLRA 2BWQA 1NMAH 2O26U 3KJ4C 1HYSC 2DQUH 3BD4A 2PO6A 3BAEL 5L2KE 4BFNA 2FBJH 5IBTL 4LRNH 2E75C 1E6JH 1AHWB 1XIWA 2CRZA 3P4LA 3FB6B 2P48B 1UD5A 1BF2A 1ZMYA 4QWWD 2Y23A 5BO0D 1MCOH 4NHUB 2XPGB 3WIHL 1H3XA 5IWLC 1HHKB 1NKGA 1IFHH 3F7PC 4L1BA 5E0QA 2D3VA 1YPZA 3VE0B 3E3QC 4N8VG 3GB7B 4NOBA 5D2LF 1OSPH 1PEZA 2ED9A 1IL1B 1JE6A 3QIWB 4ENED 2VL4A 4DGVH 4R7XA 1AZUA 4FL4C 1IGIL 4XOAA 1EO5A 4WFGD 3EUUA 3F85A 4QEGA 1OTSD 1DANU 3B9KA 2E3VA 4BV1A 1EH9A 3SYPA 2V2WA 3N43F 4NERA 1JPGB 4N0CC 4JDEB 4PJEA 4YR6A 1WO2A 1ESOA 1UWXH 3T6XA 3TS8A 1NINA 2QVTA 3WDIA 4CU8A 3C8HA 5D7JD 2RQEA 4H44C 5DQ9B 5F7LB 1F4XL 1VPOH 1Z9LA 4WFEE 1INDL 3QJSB 2XG4B 3MJ8A 3RDTC 2AJ3B 5D7SL 5B7FA 4ZODA 5I15H 1UTDA 4IEFA 4EVNA 1CLCA 5DD1H 1P5UA 1YMMD 4F15B 4LCYB 3VXMA 5CFAA 2VJ8A 3JVFC 5AYTA 4AVJA 2J5LB 2ZX9A 3RFZA 2NNAA 4OIIL 1I7RA 2HT2C 3FHAA 2XQYG 2ERJB 5CILH 5BVPH 4NO5A 2TSAA 1IC4H 4TLKA 2HJFA 3ARQA 3HC3L 1M05A 4HCRA 3C60A 4YAQA 1WIUA 3MLWL 1G1CA 4TM9A 2Y4SA 4KJWD 5F88B 1CGTA 5DGQA 2OI9C 1R33A 3IM1A 3I6LE 3BFWA 4M6OH 4MDRA 3UADA 3K8LA 2YUZA 1E3ZA 2H8PA 5D70L 5F7YC 3TBSB 4OZHB 4LSUL 3FT4B 4P4KB 1TVHA 4DP5X 4YN3A 5E1GA 4I4WB 2OZ4H 3TBVB 4NQEB 3EH2A 1F8TH 1HCZA 2ICWA 3JTTA 1H8OA 4CW1A 4Y4FA 2Q20A 5GJSL 1UD6A 1L9NA 1NCBH 3BZ4A 5EU3B 3WFEH 4XH2A 4Z7OF 1QO3B 2QDWA 4MMXB 5D2LA 1SJMA 5FUOH 1I7TA 1FFOA 5HGHB 1U0QA 1ZWIB 4LLQA 4QOKA 5CJ8A 1CTMA 2Y5TB 4LARH 3RGBA 1SYVB 3PABA 4QRRD 4M62H 1VB9A 2E9BA 1GC1L 4XCNB 5CEZD 5PCYA 4OZHE 3KYMB 1BLIA 2EYTA 5CJOH 5D7KD 3FU7A 4R9HA 5H2BB 4EDWH 3LKPA 1MJJB 1CFQA 2UWEB 2H3KA 3LCYA 4NQEE 3T0VA 1I9RL 5LCVL 4I3SL 3QSKB 2CKBA 4FQLL 4AZ8B 5IIEB 1L3WA 2JJTC 4YLCA 3NA9L 2N4IA 4WV1C 4O2EB 5I28A 4K8RL 1I8AA 3PWJB 2QGEA 4N86A 4EI6A 5KJRL 3VAEA 3ZYZA 2WC7A 4I13B 4E41D 5GGSY 4PS4H 4EXPX 3T0AA 4JVPA 5IHBA 4TOYL 2GEEA 1QBML 3T3PF 4CKQA 1J0KA 3PE9A 4P5KB 2BINA 3BESR 5DHVH 2YZ1A 3UGXA 2LTQC 1CIUA 1QFHA 2CUIA 2UWEE 3ZO9A 4XPFL 2WVVB 4WJG3 2NMSA 4JJ5B 4NKDA 2GSIA 2WLJA 1DLFH 3CAFA 2Q87A 4LT7A 2G0KA 3PU7A 4F7MA 3QEGL 2F61A 1CXEA 2Z8VC 1MJ7L 2BSBA 2QQNL 1A3ZA 1ID5I 2AABL 2E9GA 4Z7UF 4B9FA 3FQUB 1KWGA 4HJGB 2UY7A 4E9RA 3RGVC 3N40F 3VD9A 2XWTA 3AG1B 3ZT7A 4XP4L 1RFDH 2FT7A 2MOVA 1SMOA 4PJFB 5DJDB 2DQJL 2ZUYA 1BFOB 1PY9A 2R29H 4GQRA 3CFBA 1MFAH 4FFTA 5J6SA 1XF2A 1I9IH 1ZIAA 4JKLA 3H7BA 4ZUTB 2KUTA 3TVMD 5JHDA 5J1AB 1KJ2H 4LF3A 2PCFA 3KLDA 1XZWA 2PPAA 2K4AA 3VDBA 2F19H 5EWIH 1LEIA 3LDBC 4JKWA 1NL0H 1MHEA 5K9JH 4W9FC 2OS7A 3U4BL 4MMZB 3HZKB 4XNYH 5CWSA 2ZKXA 3WSQL 1XO8A 1R47A 3IDMB 3QARA 5AZ2L 3NSJA 1SDAB 2X3CA 4RMVA 5KAQF 3FB5B 3IDYB 4PJFE 3PGCB 4Y9CA 3PWLB 3T65B 2IFGA 2LU4A 3FB8B 1EEZB 3BH9B 3CN2A 4EPSA 3IRPX 1V7NH 3LS5L 5DEGA 1T1WB 2J7LA 4PR5B 3B2XA 2HTKD 5CF3A 1J7VR 4QO1B 4DGYL 4I2XB 5IJDC 1RKRA 2CRYA 3FMGL 1FFRA 3CWGA 2DQCH 2IWFA 4QF1A 1SYSA 1AGFA 4MCYA 1QX1A 2RBLA 3P2DA 5AZEL 5D7IB 3D69A 2NX5B 3WJMA 4S1QL 3O3EA 3MCKB 2WXLA 2Q86A 3BAEH 3CDFA 4AWJC 2EDJA 4U7SA 2A3TA 4K3EL 4E68A 2ICCA 3IWUA 5HD8D 4M61A 4X8JA 5T5FA 4Z7UA 5L9DH 1BQHG 3G5VA 3WIHH 4CC1A 2UVEA 4RGNC 1C12A 3DURB 2O5YH 4AG4L 4I2XE 3CPLA 3GI8L 2XTLA 5F7NC 1X7QA 2ED8A 2VISA 5AD0B 3Q0HA 5IHLB 2E7LC 4P3DA 2DEWX 5T1DL 2AJSL 1I1YA 3ALPA 3BP4B 1YN7A 3NJKA 5D7IE 1F4HA 2NX5E 4KJYA 2GQHA 5I6LA 2ZCZA 2W9DL 2D7PA 1ID2A 2X0UA 3LRHA 3G5ZA 4U1KA 2QPFA 3WS3B 4L9LB 4YBHA 1TJIL 4KI5E 1OALA 1ZLDA 4K07A 5K59F 3SO3C 2K9UA 5E5RB 4JRYB 1FCGA 4HALA 1DLHB 4R0LB 1ASPA 4WGKA 4XN4A 1AANA 2JKSA 3QBTB 1F4XH 2H41A 3QUYC 4OD2B 1INDH 3VWJC 1E4XH 4LRIC 1DDTA 5CKGA 1KB9J 1OQOA 2AMGA 4CU6A 3S96B 1XGPA 2DQIH 3OKEB 3UBXA 3OXSB 3OXRB 1DTUA 3N04A 1BJMA 1H5BA 2L7EA 3QDMB 3V0JA 3G6AA 3T4YA 1BLNB 3ZTJG 4GBXA 3WMQA 4DVBA 3HC3H 4S1DC 2OMWA 4JRYE 4J7RA 3WI9A 2WO3B 4U6TA 3MLWH 1LMIA 4UBDC 4PWEA 4UZUA 1F18A 4H8UA 2GUOA 4G9FD 2NYYC 3AB0B 3OZKA 1BAWA 2QQKL 4X4XB 4N0UA 1NGPL 1U8OB 4JRFA 4NM4H 1XGTA 1CD1B 2MQCA 3QO1B 5GJTL 2DDQL 1A3RL 3T8XA 3QDME 2JELL 4F92B 3KPTA 4JAMB 5GJSH 4HJ0C 4U1JA 4A55A 3HA0A 2GHWB 3GXTA 5I30H 4MMYA 2WZAA 3BVNB 1AY1L 1PKQB 4PSPA 1AYOA 4DNLA 5E95B 4Z77A 3LSOA 1T66D 3L3OA 5HBBA 1HHJA 5EV7A 3NP4A 5DTFA 1QFUH 1GC1H 1EXGA 2A99A 2YPLB 5FKPB 2QFPA 4J2XA 1JGDB 3W39A 3RUGF 1SVZA 4ZBJA 3W2DH 4TULH 3OKMA 3GXFA 1I9RH 5LCVH 4I3SH 2BRRL 3H2PA 1QW9A 4FQLH 1U8IB 5C97A 4Z6AT 4QJ3B 2CJSA 4L4TB 3NA9H 3QIUD 1D7CA 3QVAA 4Y16C 3ALWA 3KNBB 4K8RH 5DS8B 1PKQE 5KJRH 1TNMA 2J44A 4DETA 3HLKA 5I8CA 2XZCL 4KXDA 3MRLA 3QA3B 5C3TA 3E6HA 4P9HH 4JO8A 4ZDHA 3O11B 4TOYH 4FQ2L 1QBMH 1TCMA 4CN1A 5AZUA 2YPLE 1XCQA 4LU5L 4NQUA 4LPWA 2DH2A 3FFCB 3ZE1F 4WK2B 3ECVA 1DSFL 5KBNC 1BXVA 5EEZA 4XCFL 4XPFH 1C5CL 1F6FB 4MJ5B 3KPPA 1M6UA 1SEBB 5C0DA 4JPKH 4L4TE 4PRID 2VRQA 2EDBA 2LGNA 2PMZA 4TYUA 1S7SA 3QEGH 1HIML 4YHKL 1KBGL 5DZOA 1MJ7H 2AABH 3E1F1 3S2AA 1QVOB 1RJZA 2WMPA 4XVTH 3S8WA 5CIPH 3L4ZA 3SO5A 3UYPA 2C7UA 5J0BA 4WSKA 2DQJH 1QPKA 1M7UA 1AGEA 3FFCE 3L3KB 3S5LA 5JMOC 5LHDA 4G5ZL 4NXKA 4BSVA 2P7TA 2VMDA 3QORC 5KVEH 1TJGL 4EIZC 4RDQF 1KJVA 4AQ1C 1JTPA 3SYCA 4MJID 2ALAA 5CD5D 3FYIB 5F9JB 3FQNB 4XNMB 3VXMD 4Z78B 3CPUA 2NY1C 2UVFA 5AAWC 7PCYA 1KNOB 2JQMA 3RWGB 5CCKL 2J88L 1L0XA 3W5NA 3RUGA 2UXVA 2JK5B 3JUZA 4JEGB 2YMTA 4P99A 3U4BH 4NDMA 3WSQH 2BRQA 2F74B 3RJQB 3V0EA 3IN0A 3GRWH 1FSKB 3OHXC 5I1CH 3AS1A 4GG6B 2K8MA 3EOBB 3LV3A 3OSKA 1T1ZA 2K70A 1V3JA 4JGUA 2EVIA 4G3YL 3LS5H 5E6SB 3IGLA 3TNNB 5TDPA 2W92A 3EADA 3NUKA 1SBSH 1ZVHA 1KTCA 2FWLB 1S7VB 3SDCC 1KG0A 1YSOA 4UDUA 5AB0A 1UM4L 3FMGH 3FT2A 4LLDA 4XO3A 2JXMA 1X7SA 2ZKYA 1WFOA 1MAMH 3V4LA 3QXUA 2FR4B 3SEPA 4QWWC 5AZEH 3D6GA 3N3EA 4QRQA 2Q7YA 4S1QH 2Y7MA 1Z2KA 4EUPH 2FB4L 1BFTA 4D0DB 4KITB 5IBLD 5IP4A 2FJHA 5LGJA 4GG6E 4WEMB 4DPRA 4RAHA 3PJSA 4KX8A 4M1CD 1U3HA 1K4DB 2BWIA 1ZLUK 5I8KL 4GXUM 2B3RA 5KYUB 2A74C 4WW2F 3NJJA 5FF6B 4ENEC 1GZQB 4I0PC 2CJTA 5KSUB 1KCUH 2WLIB 2ZUVA 1HH9A 3TN0B 3T4AC 3EDKA 3GI8H 4CVUA 3BUDA 3GXMA 3RURA 1C8QA 2ICEA 4XNQA 5T1DH 2AJSH 4PVLA 1RJLB 1M1XA 3UYOD 1L6PA 1OAXH 3CLFL 4NNXA 2OMYB 4WHTA 3VH8G 3O4LD 4L0PB 4XMTA 1JPTL 4P4RA 3HS0A 2Y1VA 3LX9A 5I5RA 1Z5YD 1O7VA 3V6ZB 3IJ7A 2FL5B 4DJMA 4F1SA 4LHUB 2FUQA 1AZNA 5BV7B 5IM7A 4YHOH 2EUWA 4XPHL 1ANUA 2P46B 4Z76B 2EH8L 3CFCL 4JRWA 3A6OA 4MAYC 5JHLL 3GMNA 3MGTA 1NOFA 4OLVH 4J3OF 4CGUB 2OMUB 3GBNH 2ARWA 4Y5VA 3LXBA 1IGYB 4OBSA 4AEEA 8FABB 3L3HA 3VO0A 2NR6A 4XB3A 4UAOB 2IO5A 1XGYL 4HVBA 3N41B 4KJWC 2WBJD 3QQDA 4PTUB 4XMZA 2BP8A 4BZ2A 3G9VA 1TU2B 1EAOA 2ZJSH 3HC0B 1D6EB 3KGUA 3MU3A 3CDZA 1DVUA 4J1UB 4ZMPA 1AP2A 5A2IH 3IJYB 1U2HA 1QSED 2MPVA 3HE6A 3JV5A 4G8GB 4OUUA 1NIBA 3PY9A 1LP9F 2FNWA 5C92A 5JHDD 1KGYE 2QLVB 3CBRA 4P5TB 4JO2L 4BDVB 3DGDA 1VRSA 1D2OA 3T2OA 1DFXA 3ZE0B 2QHRH 3R18A 4FXLA 2QQKH 3B5TA 4TUOB 2FO1A 2PYFB 3PLYA 3ISWA 4WW2A 3G04B 4UOW1 3N1GC 4LLYB 5SX4H 3MFGB 5GJTH 4Y4HD 3WIFA 4ENZA 5BV7L 5C0CA 5IROA 1A6PA 1ONQA 3Q2NA 2JELH 5FO7A 1L9MA 5K69A 1XAKA 1YHPA 4JFFD 4KKCC 3ZZ1A 3IAQA 4A63A 4DZBA 2XWDA 4DP8X 5FO9B 3Q6GL 4NT6A 4YXLL 2FTAA 4R2GC 1UACL 1AY1H 4PRPB 1XGUB 4G8GE 3UACA 4XVJL 1R3IL 2GC7C 3VTAA 1J1OH 5F8RC 1LE5B 3SPGA 4DFHA 2DLHA 3ZE0E 3KBEA 1E7UA 3HW7A 3MKKA 4HMDA 4XNUL 1LMKA 4JRXD 3VU1A 3A67L 4H2AA 1N4XL 4LSVH 4TNFA 4HEMA 4C54A 4A7VA 4L8DB 4HJSA 2Y22A 2CDEA 3UL4A 1AACA 2B4CL 3MRGB 1UGKA 1SUJA 3TYFB 3V5HA 4ZSOA 1SOQA 4F24A 1KCLA 1SJEA 4PRPE 4PG9B 3QDHA 3GMQA 2XVKA 5F1IB 3QG6B 2XZCH 1P5VA 2L7UA 4WWKB 2CLZB 4W81A 5F0MB 4FQ2H 4CVZB 2CE6A 5DO8A 1PZSA 5DURD 3WS6C 4LU5H 3ULUE 4XPAL 4YK4C 1BD2B 4XC3L 4ZTOL 2GABA 2VITA 3C6LC 3SYAA 5IEKB 1SDYA 3F3HA 3OF6A 5DSCA 3D3VD 1DSFH 1LP9A 1OAYL 2IPUK 1T0PB 3T8VA 5K1NA 3UTSB 1FA4A 3FUIA 2R0LH 3FTSA 5JYMA 3ARFD 5FUZH 3LZFH 2X4UA 3HPLB 1FNSL 2B2XH 2DOCA 4TTDD 1VFMA 3TT3H 1S78C 3TT1H 1TLMA 1KC5L 3IGUA 4UV4L 1IEBB 1P4UA 1BD2E 3MUJA 3Q9QA 4G5ZH 2FH6A 4RAUA 5E6IA 3IE4A 2DM7A 3KYOB 1TJGH 2DI7A 2BFVL 4P3WA 5EZPA 4M8QB 3UTSE 2OTWB 4YX2L 3EYSH 2Z0BA 3C2AL 1WPCA 4Y9GA 5CCKH 1UATA 2J88H 3IGFA 3M7OA 5FAAA 3RG1C 3BQUD 4Q8BA 4EN3A 3BPNC 2CRIA 5I0YA 1VACB 2OJ1A 4KHXL 3MO1A 4FL4B 3H2WA 2EIBA 1JCVA 3CVIL 3HG0A 3O3AA 3VYOA 5GGUA 3VI4B 5K93A 2EDQA 1QWHA 4R7NB 2AANA 5T3XL 4ES9A 1A1OA 2WWNA 5E5MA 4G3YH 1XH0A 4L3CB 1K3IA 5I1HL 5KG9B 1QRNB 4GH7B 4NFBA 4BH8A 5HD8C 3DMMB 4I48A 4GT0A 4NP4L 3RDTB 4YLQT 4BQ6A 2G5BB 4HWZA 3KWTA 4WO0A 2WW8A 3D09A 1S9XA 3QNXB 3KLHC 1MQKH 2CG9X 4XZUB 2X4OA 1IBZA 2HG5B 1BCIA 1OAQL 4BIKA 3UJTH 4D0CA 1AHKA 5T3ZL 2QSTA 3QYCA 2OA9A 1ZA3A 3P40A 3VI4E 3ZZLA 5BQ7B 4LSSL 1WFMA 2AAAA 3FRPB 4F93B 3SGEI 2JIXD 3QC6X 3VMOA 1XCTB 1QRNE 1T5XB 3BIBX 3U0TB 2WXGA 1CCZA 3DIFA 2FBOJ 3GGWB 2CIKB 3VA2C 5HVHC 2CAKA 3FTXA 1JGUL 2QVKA 1M56B 1UFUA 3A4FA 4XE5B 4G70B 1WG3A 5IMLB 3CLFH 5D1ZB 3NFPA 5DJCB 3HZVB 1JPTH 1SXSA 2EDMA 4KV5E 4YL9A 2WCPA 5C0BD 1LO2H 4IGBA 1FL3A 2AEIT 2V6HA 2JKXA 4ODSL 1D7DA 1TOXA 1OF2A 3QYMA 2X4PB 3OV6A 4XPHH 1KZQA 3DX0A 5DJ2A 2EH8H 3CFCH 2WO2B 1I3RA 4XR8C 1AGDA 3L9EA 2WQUA 3PWNA 1ZGLA 4NUPA 3PGDA 1SEQL 1BG1A 1JNJA 3L5XL 4PV9A 4HAGA 2W5PA 1CN4A 3VNZA 1N67A 1XR8B 2FX9L 3DJZA 4PHZA 5D4IA 1N2RA 2MOQA 3DWTA 4WEUD 5C0RH 3QWOB 1M6OA 1XGYH 4PGZA 3BT2L 4GRWH 4WHYH 1X5FA 3ZIMA 4ZFZA 1A3LH 5BS0A 2VLMD 1TXKA 4G9DA 4NYLB 3LPGA 2HJLB 5F1NA 4TPRL 5CD3B 2Z7WA 4MXVF 5ANMA 4OV5A 1CD9B 3TPUA 3K0WA 4B9JA 4G8IB 5IOPA 2IANB 2WHVA 4L8CB 1Q9KB 3LKQB 3PNWB 3R8QA 4Z3JA 5I1DA 3ZT5A 2WZ5A 3ENEA 2WZ0A 2IOMA 2D9QB 3DRTA 5AVRB 2VDQL 2AJVL 3K46A 2GJ6A 1D5BB 5AVSB 4FRWA 2XQYK 1DUZA 4FTVD 3ME0B 3ARDD 4KNQA 3WTXA 1OGPA 3NJVA 3MRJB 3EYVB 3MV8A 4HH8A 5I23A 2UZXB 5AYUL 1P7KB 1KT2A 5I17B 1CGSL 3QXAA 1AKJD 1T7YA 4OF7A 4GEIA 3CH8A 3GRGA 3LXCA 4N9GB 2IANE 1UACH 1KXQE 5DDHA 4QAMB 5JO5A 4XVJH 1S3KH 4OZGB 2WXIA 4W9KC 4HKJB 2VQUA 5CBAA 1ODUA 4AYGA 2EKJA 4FFWD 3ARBB 5C0EA 3QIUC 1ASOA 4XNUH 1R1CA 3OLIA 2A7BA 2BP5M 1SF3A 1XIWC 4ZS7L 3A67H 1GL4B 5EZOL 3UBXI 1QFWL 1XF3A 2JJVA 4YBLC 4KXAA 4OLWL 2B4CH 1BQSA 4DEPB 1EEYB 3LDBB 1XTLA 2EO7A 4XCEA 3ARGA 4TQHA 2EVHA 2ZWYA 4OGQC 4OZFH 3L6FA 2BOCA 1OM3L 2D8KA 1MQ8A 1NFDB 2LE9A 4OZGE 4B5ZA 1GGIL 3V9FA 3VSVA 5SWZA 3MRFB 4OCWL 3PS6A 2X3BA 3OMZA 1ROWA 1KDIA 1XXDC 2CGZA 5IMMA 1JXGA 3F5WA 3LXAA 1EXUB 4JFEB 3B9KC 3BSGA 4PWKA 4FLOA 1QLRB 1QW8A 3DKHA 1PLCA 3OAWA 3OWRA 1OAYH 2XX0A 5FGBC 4Q6IA 4LCCA 4IRZA 4ZFFA 3N5AA 1T7WA 3O6FD 5FHAH 1FNSH 2KT6A 1VCAA 2B7DT 1C16A 4M9OA 2ED7A 3CXHJ 1JNHB 4KVPA 1K8DA 1VSCA 2YOCA 4Q6YA 5C09D 3WLWD 4ZX4A 1NFDE 3DJRA 4OGZA 3S35X 1TQWA 4AEIL 1I9JL 4L1HA 5CD5C 1P5UC 3ULVE 4U33A 4C8XA 1FGNL 5KAQG 3OLEA 1KC5H 2EO9A 3LTVA 4UV4H 3RFZC 2IQAB 4JFEE 4MNQA 1U93B 3QUMA 3UBXG 3IETB 4HS8H 3C60C 1RSYA 1TQCB 3QPKA 3N50A 1Y6NR 3R06A 2V2XA 4MWFB 4PRDB 1L0QA 3TO2B 4B53A 3KPOA 1QBBA 4X8CA 1AFVL 1FRGH 1F86A 4OJAA 5DFTA 1RJCA 3AUWB 3MJ9H 4FQJL 1D7BA 2EE6A 4DP2X 5BUAA 1ZLUH 5DZAA 2C3XA 4KHXH 4LOVA 1IC5L 3PF2A 4NNYA 4FFYH 4JY4B 3CVIH 1QUPA 2ADGB 4Y4FC 5HHNA 3GHBL 3NEOA 1NEZA 4TN9A 5T3XH 5LWYL 1OGSA 2Q7NA 3VGGA 4IYKA 3QI9D 4XNXL 4LLWA 3X14B 1MZYA 3L1FA 5IBLC 1OAUH 4X6BB 2HXAA 3MRPB 1H8NA 1NBZB 3O45B 4M1CC 1BZDA 4Y2NA 1KPVA 3WG7B 4NP4H 2VQ1B 4ZFOL 1TQVA 1E9QB 2OSLA 1PD0A 1HDMA 5KUKA 4HWBA 3OKNB 2ZF9A 1OGAB 1N12A 4KHTH 2OJZH 1U92B 3PHQA 1CFBA 1OAQH 1UEMA 3S3JA 5T3ZH 4NPYB 1N6UA 4NC0B 3CSTA 3T6ZA 5L4JA 4K5NA 3MOBL 4OF0A 3O41B 2Q8AL 3QJQB 1E4WL 2DZEA 3VXQB 2P8PB 2Y7OA 4XT1C 1L7IL 3F00A 3JWNG 1N0XH 4CDHA 2EXSA 2YAQA 1MLCA 3CSFA 3GMOA 5K9KB 3CFQA 4HZLA 5I1AB 1JGUH 4O02L 3N55A 4W9IC 4G6JL 4GSDL 1U8CA 3CN1A 5T1KD 1AQHA 5CUSL 5DC4B 2O61A 1OGAE 3QQNA 5C07A 1Y6MR 1E65A 5HDLA 4R5XA 1S8DB 1RUPH 4Z23A 3QDGB 2QADB 4U49A 3MV9A 2DD8H 5D72L 4YXHL 2YXWA 2WINB 4AQEA 4W68A 1FZMB 1HOEA 4BCXA 1DUYB 3P9MB 4HS6B 3QRGH 1KPRB 2I27N 1CGYA 1V8HA 3L5XH 3HNSL 4XZ4A 5I9QB 2BH0A 3FTGB 3II3A 1GS6X 4RFEA 4YHPA 1TZIA 3BT2H 1JWSB 1R0AH 4R7VA 2BSRA 4YFDB 5BCAA 2QGCA 3TONA 2AQ1A 2X12A 2H26B 3QDGE 4U1IB 4TPRH 4LVOC 1HHIA 4G1MA 3S5LG 3G5XB 3SKMB 3Q2WA 1S9VA 8CGTA 1CYGA 4GJTB 5B3NA 5DD5H 2GJZA 3U0PB 1EZSA 3GINA 5EOCL 2PABA 5F72S 2VDQH 2AJVH 4WO4A 3F7VA 4WI7A 3ZDYB 3B2MA 2ETWA 4I88A 3AABA 2HJKB 5IR1B 3BEVB 1YAIA 1QUNB 1A7RL 3VGDA 1A0QL 1L4IA 2VXUL 4WTZA 4EN3D 3EHBC 3MXWL 1V7ML 5AYUH 2FSEA 4I1RA 4X6CF 3SCMA 1T0NA 3BT0A 2VDOL 3HJEA 5E8OB 3LQAH 1IFGA 2BOBA 4B0MM 1L0YA 5KVFL 5DS2A 1BVKB 1T20B 1J0JA 2FLBT 5CBEB 2DQTH 2CPUA 4ADJA 3DX6B 5CJQL 3QPQD 1UWGL 5ICXA 2WZ6A 3RWEA 2V0AA 4AEFA 3IDNA 2H1PL 3IGAA 2UX7A 2R0ZL 2Y6TE 2ZCKL 4JM2F 3WLBA 5HGAB 3ZDYE 1TSRA 2X40A 2AXFB 2UYLA 2M1KA 2EKSB 1HH6B 4OLXL 4UYPA 3SY6A 1QFWH 3ARWA 3VFVA 4U1HA 1JN6A 4ABVA 4KZ0A 5J6GA 4AQ1B 1NSNH 4JO4L 4QD2E 5HYJB 5JPNA 4N87A 4ZO7A 3ZPDA 4D9LL 1VEMA 4ODXA 3O6ML 2NY1B 4MTMA 3WN5A 1WWAX 4PMFA 4F3FB 3QWNA 4HLJA 1OM3H 5T1LD 2Q9OA 2NZIA 3DVGA 3CNKA 2VN4A 4BKTC 1T83A 5DK2B 4PIRF 5FUCC 2WXPA 3ARFC 4AGPA 3MRDB 2OCJA 5I76A 3T0EA 4W4OC 4NO3A 2A9ML 1AS6A 3QW9A 5HVGB 5GS1A 4RA3A 4TTDC 4N5ED 2IH9A 4JO5A 1VGEL 2IWEA 4RDQG 3WD5L 4QLWA 1CTNA 5HYJE 1W16A 1NAKL 4LCIL 2OAAA 4L9DA 1ODAA 3RPIA 3RWJB 4A2DA 1K5WA 4TNEA 4H5SB 4W6WB 3IXTB 3MX0B 4HS3B 5HXMA 3Q7JA 2XXMB 1HHGB 4AEIH 3V7MA 1BQHB 4IOFC 2H2SD 4MHHI 4YC2C 5DO2D 3CFNA 1H5BC 4X6CA 2SEBA 4M4RA 1I3GL 5HHMD 2QELA 2DJ4A 1ZLVK 3PCYA 1YZZA 1DQMH 4RETB 2V2TB 4FLHA 1F5WA 4GBXC 2A74B 3AU1A 3QHZL 3T2PA 2K45A 3B6SB 1KLUA 1JOIA 5C08A 5CEXB 1BJ8A 2ZG1A 2C9UA 3CVHL 2HPTA 4EI5D 3LB6D 1WTLA 1RZ8B 4FQQA 3G6DL 5BS0D 4NUJA 3D0LB 4JM2A 1OHZA 4HKXB 3FTUA 4AL8C 1LJMA 1XEDA 4HIIB 4JZJA 3V0WL 4FQJH 3VNYA 2ODHA 5IJCC 4ANUA 1WA2X 3A5VA 5D7JB 3ZR6A 4C4KO 5I82A 3B2DC 1IC5H 1TVBB 2QZ5A 2IDQA 2VMCA 1F90L 3MRMB 1K2DA 3OC5A 4H8HA 4BYHA 5LWYH 1Q9OB 1RZJC 2H45A 3GS4A 5JA9A 1YMMB 4LVHB 3HBZA 1EGJL 1N5YH 4UQ2B 3DX3A 3A6BL 4WFGE 3R7RA 2EH7L 3L3OC 4HQQH 3GHEL 3K71A 2GPZA 5BZWA 1GR7A 4YHIA 3CSBA 2V17H 3L2NA 3N91A 1K5NB 1LDPH 4H0GA 2R2EA 4UMGA 1SXZA 4FQIL 2COVD 1NTDA 4YHNA 3B2VL 4MHHG 4RSYA 3JWNC 5J57B 3ARUA 3BDBA 2CD0A 3LMJL 4LKXA 4PJGB 5BOPA 1HZLA 1JRHH 1H15A 2SODB 4NQCA 1GVIA 3MOBH 1P4IL 1AIFA 2LAGB 3FCSB 5D1XD 5E6UB 5A16B 1YMME 2Q8AH 3ZKMC 5DJAA 3S88L 1INQA 2WJ5A 4W9EC 4JFWA 2CGRL 4DN3L 5A3ID 2OYMA 3IKCA 1DQJA 5IV2A 3CLWA 1IC0A 3L4WA 2EDHA 5E6RB 1BAFL 3L5WB 1IKNA 1TTRA 3N42B 4Q2ZB 1KIRB 3OAUH 4G6JH 1OB1B 4GSDH 4J5VA 2O30A 2ZWZA 3ARGD 3BAWA 1T7ZA 1BEYL 1MRDL 2BW5A 4NFDA 5B7EA 1DQQA 1A3QA 1HILB 4UINL 4ZJ9A 4OKVB 3GSQB 4HHAB 2XI9A 4QRRB 1D9KA 2YD4A 4YZFF 3DOSB 3QQ4A 4PJGE 4L0ZA 4HPYH 2NSMA 3WNLA 1THCA 1KIUA 2IDSA 1LK3L 5D72H 5TJWK 2CO1A 4U0RB 4UANA 1EUUA 5LG6A 3MV01 1MFBL 5IJVA 4Z1PA 5IK3A 5L2JA 2Y2TA 2G4GA 3B34A 4P59L 1QATA 2IGLA 4WUUD 1XTMA 5DK0A 4NN5C 3HNSH 2ZOLA 4FGMA 2A9DA 4PU2A 4F5CE 2LAAA 5CCJA 4L1DA 1SHSA 1Z1WA 1C7SA 4G2AA 1YECL 3X13B 5D8JL 4UOZA 2VJ0A 3LKRA 5F3HA 1TYJA 1H6FA 3RVTC 4E41B 1E50A 1EAPA 1KXTA 1ZEAL 3OKDA 4QRRE 1U30A 4LKCB 5CEZE 3GJEA 1S7QB 3RA7L 4F9LC 2AQ2A 4NKQB 4MSWB 5D7KE 1JV5B 5EO0B 5C9JA 2BVQB 3VFOB 3O8XA 1KELH 1S9WB 1S9YA 2DIBA 2W81C 2LR4A 2WAQA 3HG5A 3IF1A 2PW1B 3GKWL 4PPTA 2ATKB 4MDJB 1R5VA 3C12A 5ALBL 5EOCH 4N6RA 3UFIA 2BHFA 4AVKA 4GRMA 1TJHH 4QDGA 4CADA 4AY0A 4L2LA 1G7QB 4PJHF 4JREC 5JW5A 5LNGA 1JZIA 4JG9A 3X2QB 4C83A 4FTDA 4IOIB 2IPKA 4LBEB 2J6EA 2VR6A 4E41E 4BEIA 3SJVD 3V9EA 1IT9H 4AVHA 1A7RH 1PCSA 3ZGIA 3VFPB 3QJOA 4MD0A 4RFOL 1FC1A 1ZTXH 3MXWH 4A2HA 1DE4B 1IGCL 3WMPA 5DRWB 2W60B 5JOPD 5KYWA 1UXSB 3TVMB 5KVFH 3D2UA 2JNZA 2Z91A 3KDMB 5B3JF 4QXWA 3X17A 2PCXA 5TDNB 5CJQH 1BMGA 1UWGH 2K4WA 4H1LA 1YYMH 4PJXF 3BKJH 2ZCKH 2R0ZH 1BBDL 3EXJA 2Y06H 4U0QB 3WY2A 2A73B 3U7YL 1U3HC 2V7NA 3VFRB 5HY9B 5AW1B 1IUZA 2K6YA 2KC0A 4WW1B 4D9QD 2X89D 2E9WA 2MQGA 1X5YA 1L9PA 4MQSB 4D9LH 2VDNL 3ILDA 1MY7A 5EEWA 3AWFA 3O6MH 2CRMA 3GUTA 2UUDK 1B4JL 2ICEC 3HBQA 4IHBA 1XDTT 4GEJA 3A23A 3FW6A 1UVQA 3BPNB 4PTTA 4TLUA 3RL1A 1EXHA 1OSZB 5JLZA 3PAVA 4LPUA 4QNPF 1MLBA 3HS0C 3LEXA 4E0RB 3REWA 5KYYB 3BQVA 1WT5C 2FWOA 2HN7A 3HG1A 3LRSB 4F8QA 4KZEH 4JM4L 5MEND 2VDLB 4JANA 3RZCD 2XKNB 4KKLC 2CO7A 3H42L 4NWUL 5AKVA 3NESA 5DHYA 1VGEH 4AQ8A 4CMMB 4HG4K 2JTDA 2N1TE 4JPSA 1NAKH 1O9ZA 4AH2A 4DKDC 1ZCRA 4KOCA 4LLAA 3N9GH 2DLFH 4Y5VC 3VG9C 1JZ8A 3OJ2C 3DHPA 4PJHA 4IKLA 4UQ3B 3DC0A 4PB0H 4R4FL 2IOOA 4FFZA 3WN6A 2NR6C 2F8OA 2VAAB 1FVEA 4A7TA 1J18A 2C4XA 3QJXA 1JNLL 1URLA 4KKPA 2HT4C 1ZS8A 1JHTB 1A64A 2LW3A 5FS5A 2NCEA 1B6UA 1I3GH 1XGQA 4GS7C 3BFQG 1G84A 4UT7H 1EJ8A 1AMXA 3L3GB 4TSAL 3MGOB 3PL6D 4Y4KA 1B3IA 3QHZH 1R3JB 2GTZA 3R0NA 4MVBC 1NKOA 1UZGA 3CVHH 1B0GA 2CR0A 2JF1A 4GUOA 3DHMA 3PDGA 4ODUA 1NGZB 3C5SA 3I6SA 1DBJL 2XVBA 3V0WH 3HAEA 1GKOA 4N2HA 3VXRD 1J11A 4PW9A 4WW2C 1WBYA 4XBPA 5DA4A 4WI5A 5CP3H 2XZAH 5IROC 1F90H 3WY3A 2XIDA 3I9IA 2V9RA 4K5MA 4OLZL 5FX3A 1J9TA 2BY2A 4F8PA 1SN2A 5HPMA 2B16A 3AC0A 3EDDA 1NBYB 1KTJA 2R2BB 3W56A 1MKFA 1DQVA 2E6PA 1PDKB 3V9CA 4HJIA 5HHPB 1JPSH 3A6BH 1H3WM 4ICWA 4PCSA 4PN6A 3UERA 5BNXD 2EH7H 5J6HB 2X9WA 3ZGHA 2W07A 3GHEH 3FO0L 4HULB 2IQ9L 1EAQA 1I3UA 3ESPA 3BHBA 4NPKA 2A83B 3LIZL 3BP6B 3RILA 4ZW3A 3CU7A 2YEQA 1A65A 1CGWA 4FQIH 5JXAL 1R17A 3B2VH 1ES0B 1RZGA 3UZVB 4QJ4B 4G9FB 4L8SB 1ZSDA 1KTKE 4HH9A 3SOBL 2OJEA 3QNZA 1P4IH 4OF5A 5AG9A 3MUHL 3RNKA 2E74C 3I75B 3L95A 4ZMLA 5L6YL 3S88H 3NK4A 3QO0A 1KTBA 2CGRH 4DN3H 2F8IA 4XN7A 4FNPA 3RYMA 4LSQL 4QUOA 2K6ZA 5TK4A 3VD5A 4DQAA 1DJHA 2X1WL 3SDXB 2W9LA 4PGBA 1ZJAA 1J8HA 3FAWA 4UTAL 1BAFH 2ZOTA 4CBPA 3OGCA 4B0MB 1F4WH 4XBMA 2G4EA 7TAAA 3IDIB 4DEUA 1LO5B 1WBXA 1RXLA 1BEYH 3TBTA 4N2AA 2ICES 1AQDA 5IW1B 1KCSL 4UINH 4OJCA 5BZXA 4Q0XL 4N2GA 4G9FE 4QRTA 4OF6A 1P6WA 4N20A 2WQSA 1Y18B 4AXWA 5EPMB 5JZ7D 5ERWA 3RNQA 3ZRFC 3NG5A 5IY5B 1MFBH 4MB3A 3FQRB 3MAWA 1IBBA 1G6RL 1G7IA 3KPRD 5D96B 4R97B 2F7OA 4LPCA 3R7QA 3SDXE 1FYTD 4UU9B 5EC1A 4AYMC 2DJSA 1RVFL 3QIUB 4S0SD 5IUCA 2QPEB 5DVMA 2JB6A 3KXFA 4U1LB 5D8JH 4QHMA 1YUHA 4IBVA 3EYUL 4IHOA 4KKBD 2IBZY 4JY6A 5E6IC 4POUB 3AVEA 4EZLA 4YBLB 1E40A 2EE0A 1EDHA 1URZA 2IH8A 2VZUA 4P46A 3VVWA 5B8CB 2UZPA 1NM4A 2G2NA 2W0LA 1CLZL 2ZSWB 2R2CA 4C59B 2YC1A 1IIKA 1GZPA 5ETUA 2Z64C 3DPBA 4HJJL 3RX9A 5LQBH 1I1AD 1EHAA 3BVUA 4POZD 3VYNA 2BP0A 1O6TA 1BBJB 4H26A 2EEAA 3K2IA 2R69A 3GKWH 3MA9L 4EN3C 3OQ3B 3ROOA 2D2CC 5MI0C 5AKSA 4M29A 5ALBH 5GRUL 4PRIB 3VRLF 5J9PB 3MRRB 2ESVA 4Y1AD 4YVNA 1JZHA 4M1GH 2R1XA 3ETTA 3OBAA 1WZMA 2ZICA 4F7PB 3ZKSD 4NZDA 4WU5A 2CCLA 3DSNA 1V3KA 4I8DA 4X6EA 1OE3A 4PJEB 4KH9A 3SKOA 3FPXA 4RFOH 3IFNH 1KLGA 1IGCH 1IGJA 4IOSA 3CQPA 1SBBA 1H3TA 3BVWA 3MRBA 1NEZG 3BH4A 3QH3B 4YHML 3L3IA 2VCOA 4UNVA 4NAJA 5DLMH 1ZPUA 3HZ3A 4Y0GA 3VSQA 3A24A 4C58B 1ZV9A 4MJIB 1P5UB 2AXGA 2IC2A 3VXMB 1UJ3B 2QKSA 4PRIE 4X83A 3WJLC 1DEEB 5I19L 5IMKB 4HETA 4HBQA 1BBDH 3ZK0A 3AT9A 4TQPA 1GGBL 2Y2WA 3EYOB 2WKGA 3M6DA 5JIIA 2X88A 4YAQB 4PJEE 2GFBA 3SHSA 2ATPA 4EXKA 3L3JA 1AO7D 4FG2A 4PUBL 1R9FA 2VDNH 1DL7L 1OTUD 5HI5D 4ZMTA 3ZXAC 3IFOA 5BZDB 1A7QL 1MW1A 3MCG1 1B4JH 2HRGA 1LO3L 1R5WA 2VWEC 2C7FA 2X9YA 3GJFA 3MNWB 1F4YH 2WVTA 4MLIA 4WWNA 5GRVL 4MJIE 1ZLVH 5GSRB 2ZAGA 3VXME 2APXA 3NT0A 1CTOA 2NLJA 3BWAB 3HG2A 3TH2T 4X99A 4P3CH 4F7TA 3MRCA 4IGBC 3H3KA 4Q52A 1JTTA 2DH3A 4JM4H 5EU7C 4UT6H 5FGSA 4XH2B 1A6VH 5KTEL 1JYXA 4YBQD 2CNZA 3H42H 1GGCH 1WICA 1WVZA 4KROD 5DO2C 4HHWA 5JUEH 1J10A 3VFUB 3S9DB 3CZUB 3ZR5A 1CPUA 4Z0BH 3KG5A 2R29A 4L37B 1EMTL 3FONA 1UA6L 5I6XC 3GZPA 3CD4A 4KUCF 1BIIB 4LLUA 4EI5C 1JNLH 3DOHA 3BVXA 1GS8A 3LHPH 3LKPB 5JNYA 3V0AC 3ZRCC 2VXSH 1FNAA 1FDLH 3S7GA 1SQMA 1UC6A 1MREL 3INOA 3SSGA 4HCRL 4PRBB 4TSAH 3CN3A 3LNGA 3O4LB 1JDCA 2VN3A 3BIKA 4FULA 1OSYA 2DLIA 4X9FA 4CSPA 2CO2A 1ACZA 3B43A 1ZPLA 5FYJL 3S3PA 4FXKB 4RH4A 3MGAA 3NQKA 3VWKA 4Y1SA 2C3WA 2XXGA 3HNVL 1TZGL 5JOFA 1DBJH 5TK2A 1XGRB 1RPQA 3FCBA 5IF0B 3VD4A 2EDEA 3FU9A 1OQXA 3FUNA 4BH7B 5T33H 1BVOA 4GMTL 3BGFC 1EEQA 2W1NA 4HUWA 2P5EA 3ES6A 5FCSH 3L5HA 3HE7A 5C0JA 1AG6A 3EJQA 3Q2CA 4U6XB 2P49B 2DWYA 3DETC 3QZWA 1FE8L 2WBJB 2MEJB 1P1ZA 2VC2H 3IDGA 3O4LE 1FNGA 4DP4X 4F7MB 1A9EB 3C5JA 1JZFA 4HSCX 1CGUA 5EOTA 2JI1A 4NUGL 3FO0H 1GTNA 2IQ9H 1Y0LA 1EDYA 3S4SB 5BXFA 3O2VL 3CGTA 3KVQA 3NBNA 4YHLH 1FFNA 1QSEB 5CO1A 1XB6A 3I85A 1R3KA 2WYIA 5BW7A 3Q6FA 2FCBA 5JHDB 2CKBL 3W1ZA 1JP5A 2PXYD 3RWHB 5ESVB 4FQCH 3UTTA 3UC2A 5IW6A 5B1CA 3NCFB 1LEIB 1WUZA 3ETBJ 4X6FB 2DMGA 2WTOA 1MHEB 3ARGC 1RJYB 3TFBA 3QIBA 4YIQB 4Y4HB 3CSGA 3SDAA 4LSQH 5EOCJ 1C08B 2P43B 3HB3C 4JFFB 3EO0B 4P06A 2H0PA 1PYWB 3NFNA 3QUKB 5KSAA 2HMIC 4UTAH 3FT3B 1A9VA 4LQ1A 4MD4B 4Z3EA 2NNRA 4TNVF 5D5MB 5A6MA 1QSEE 5ID0A 1ADQA 3PHOB 4HK0A 4G42B 3RX5A 2C4FT 1R3LB 5IB5A 5JHDE 1KCSH 3PHAA 1C5BH 5EN2B 5E2VL 5C7ZA 3KYNA 4GKNB 4JRXB 4Q6IC 5GS0L 2CR3A 1BVLB 4WNQA 3BVTA 4ETQB 4XNDA 1JFHA 1PZBA 3JWOH 5FA4A 3Q05A 1T6BX 1G6RH 2OTUB 4QF1B 1SYSB 1WWBX 3STLA 3GSXB 4FAAB 3FB7A 3N1MC 4JGJA 1BXAA 4JFFE 4GSXA 1FZOB 4GB9A 4A2EA 1QZNA 4D9RD 1RVFH 1FG2A 3QZPA 3O3BA 2CLVA 3OKKA 5KVDL 5D5ME 1B6DA 2FX8H 2DQFB 5E00B 4Z95L 3GTVA 3RPKA 3EYQC 2NSQA 3V95A 4R3SA 3FO1A 5AOMA 4Z7UB 1TF4A 2CHXA 1U3ZA 5EG6C 5DURB 1CLZH 1B2WL 4JRXE 4LCWA 5LDSA 2UZYA 1NCGA 1DBAL 3CDYA 1XHHA 3US0A 5JDJA 3RVVD 4HJJH 2V8MA 2VISB 3QRBA 2P45B 3D3VB 5FYKL 4U1MA 1I1YB 1OZTG 4W9DC 1YN7B 3GO1L 3Q06A 2DICA 4P04A 4R26L 4F1ZA 3ARFB 4H88L 2WQRA 4X7TA 3L2MA 5GRUH 3ZKXC 4XWGL 4AENB 4HPOL 3G5ZB 3DBXB 2ITCA 3IDXL 5LO7A 4K3DH 4YZWA 4XI5D 3WHE0 3WIIL 4IJTA 3WTSA 1LQBC 2A1WL 2Y0SA 3FFDB 2FHCA 4P2RD 3VX1A 4A6YA 2X53A 1WUNT 2X9XA 4HIXL 1G1KA 5E5LA 4FXGB 1I7UA 4KTGA 1P2CA 4GI6A 2WLMA 4YHMH 3X3GL 4TV3A 3D3VE 1E5UI 4BUGA 4UYQA 1ZLSH 1YEDA 5KN5A 1S7WA 2K1MA 4BK5A 1H5BB 4YDLC 3I9PA 3MMEA 3G6AB 3T4YB 2PTTB 3VFTA 5T5FL 4CJ0A 4P2QA 1GGBH 3BQUB 1UCTA 2HX7A 1P0SE 3DDGA 3TEXA 3UAEA 4DVBB 5AVQB 2XG5A 3NSYA 2CK2A 3V6BR 3VSUA 4F9PA 5L4FA 4J6IA 3TZVD 4ABWA 1WZAA 3TJHD 1YLBB 3US1A 2NZ1A 2OXGA 4GKZA 5JQHC 1U8HA 3QXTA 2WK2A 5E7FA 2Z8WC 3NPSC 3RZCC 1LO3H 1CFNA 2A77L 4OLUL 1V05A 4N2DA 4JPQA 2P80D 4GG8B 3CHSA 3CUPA 2C3VA 2FBRA 3T8XB 5HHQA 2Z31D 4U1JB 3KL5A 3V6FA 4RRPG 4XGZA 3A0OA 5KTEH 4HISA 4PWFA 5HHOD 4YSCA 5GZND 3RL2B 1K85A 5CIPA 3WO4C 2D31A 1OD7A 1YCSA 1KCBA 1XV8A 2G3ZA 1EMTH 2JIXB 5A6IA 1UA6H 4GO6B 4ORGA 2A0LD 1HNFA 2XN9A 4LL1A 4ZO9A 1TFHA 4V11A 2X4TA 1HEZB 1P7QA 1CO1A 1F42A 4X5XB 3IRCA 4HCRH 1WAEA 1JVOA 3GEWB 2BK8A 4ZPTB 1MVUA 2NPLX 4NSKB 3B7RL 4HAFA 1O75A 4NN7C 5C0BB 3GRWA 3NZ8B 5A2JH 5I8CB 4ZO6A 4AL8L 3T3MF 5FYJH 4P46D 1YO4A 2UV3A 1X5HA 4IQHA 1EFXD 4WO4C 5FLUA 2X7LA 3IFLL 2IG2L 3VXSD 2R23A 2XV6B 5F1OB 5E2TL 5AFAA 1U8KB 3IK2A 3JWNE 3VJ6A 1LQSR 1IVLA 3QNFA 4GMTH 1RZJL 4E9QA 1X5KA 3CX5K 3BZEA 1EHXA 3KPPB 3P11H 4TLSA 1OW0A 1FE8H 2EXTA 3ASWA 5F7MC 4I9WD 1T1XB 1XD1A 2XYBA 1UADC 5C0BE 5E51A 4EUPA 4RSVA 4NN5B 1RJZB 1SDDA 4BQ9A 5G4OA 4OGYH 5AW3B 3MLUL 3PPSA 3V4VB 2B0SL 2M26A 2XTSA 3O2VH 5DD6A 3NA4A 4IOSD 4KJPD 2ZX7A 1WFTA 2CKBH 2IVFC 4TNWK 1JVLA 1A8JH 2VUOA 1ACXA 1ET5A 4H1LG 3HOGA 3OJDA 5B1KA 5JPNC 3PV6B 2KS0A 4RFNC 3VXPB 2LLNA 5ID1B 3U25A 3NABH 1HI6B 3NZHL 3ZUCA 3LKSA 1IEAA 3ARDB 4FTVB 4QRPD 3GLDA 1HL5A 4IRSD 5DVOA 1KN4L 2VLME 3EGSB 5HHXH 4GQZA 2UY6B 1I8IA 5CCGE 2R0WL 1T83C 5HYIA 1S5HA 5JZ7C 1AKJB 4GKLA 5EN3A 3K1KC 3T0EC 3D05A 4ZYKB 2R7EA 3QUHA 4I18A 4Z7QF 5GS1C 4GIPD 3LV3B 1T1ZB 2J12B 5B4MD 4UV7H 2NUPA 2OMZB 1QTPA 1RUQL 2FIKA 1HL4A 1N59B 1NCUA 1ZSHA 2J1YA 2Z0UA 2XHNA 3DVNB 5DJ0B 5E2VH 5AOJA 1RUKL 1Q0YL 3K8MA 5GS0H 2CA4A 4APXA 2GIYA 2C9RA 5I1GL 3C8DA 2LLGA 4FTVE 1NCIA 4X9BA 3KPQA 1LK2A 3QS3A 4PQXA 3T08A 4QYOA 4X5WB 3ZE1B 4BKSC 1BM3H 3UPAA 1NOAA 2Q7YB 3L9YA 4UQCA 4JFTA 1JVKA 2F08A 4JFOB 3WFHB 5INDB 4A38A 5KVDH 5LGJB 1S7TB 1SXNA 2Z8RA 1YEEL 2BHUA 3DDFA 3TO4A 1DJXA 5ITFA 3MPCA 3VFGL 3W0WA 1N3NB 1W0WA 3OKYA 1L9TA 1TITA 4YPGB 4JO3L 4D2NA 4J8QA 1RIUL 4JM2C 1DQLL 2RACA 5FYKH 4JZJC 1VENA 3TEWA 3GO1H 3ZE1E 2I25N 3ZRSA 2YFOA 4H88H 3O6FB 3TNMB 4XWGH 3CHXA 4M5YL 4ABQA 5EUOF 4R5TA 1IM3D 4HPOH 2DMHA 3G6JB 5M94B 5DZLA 3IDXH 4PGDA 1CFSA 5C09B 2XWXA 3GSNA 1Q38A 2ZSVB 3HAEG 2XN2A 2A1WH 3HUJB 4L3EA 4JPVL 2A6JB 3RKDD 5DI8B 2CO3A 3MGTB 1X9RA 2HWZL 3NCWA 4HIXH 4XP5L 4Y5VB 5E2WH 4QT5A 3ESOA 2YKLH 2WTRB 1CK0L 4ZMAT 4BFOA 1RURL 4OVUA 3UO1L 3X3GH 2HVJB 1L9RA 4HWEH 3L3HB 2IXQA 4A7SA 3IJEB 2FJGB 1QBAA 3E7JA 3VUAA 1QNZL 4U1GB 5C8JB 1JSYA 3H55A 3G6JE 4GS7B 1EQWA 4TKWA 5E1IA 1AR1D 2NQDA 1I3VA 5SV4A 5C09E 3JTSA 2E76C 5GGVH 4ESKA 3CDZB 1MIMH 2MNWA 3HUJE 2VOTA 3LZRA 1A9BB 2P8LB 3FYEB 1KY6A 2DJMA 4J3TA 3ZHNA 4GAGL 5FA3A 3DO3A 1YN6B 3EFFB 2R83A 4Y2DD 2KQMA 4M7KL 3QI9B 4IIQA 2ZG2A 4J27A 4YOKA 4KROC 1EA9C 3QIBD 3EGXA 3L1EA 2W80C 4WI6A 1T22A 2E8YA 4K94C 4H8WC 1IKFL 5DJ6B 1JF6A 2XZQH 1D9KC 1DVFD 5IBUG 3WHXA 1Z9SB 5DT1L 4ZW8A 5JDSA 2PNDA 2VW4A 4NRYB 5DYFA 4RIRB 1MWAB 2F0CA 3PUUA 3DJSA 5DUBA 1IX2A 4NN6C 4M9PA 2J73A 5EUOA 4JDZB 3MREB 2Q6WA 5G5DA 1PX4A 4BZ2L 3O9WA 1ZVNA 2VLKA 3PGFL 4U4BA 3ZSTA 2GITA 2NY2D 3QGVA 1N64L 5I18L 1I8MB 2AQSA 2F54D 4M8UA 1S7RA 1E8YA 3ZYOA 4QRFA 3H1ZA 3EJZD 3PWVB 5T1KB 4R6UA 4FADA 4Z3IA 3LKNA 4LGSB 1MFUA 3QC5X 2GI0A 3O8XC 3Q3GB 3FHQA 2CHZA 4EZJA 1E28B 2OP4H 1DN0A 2VNCA 1LHZA 1P5VB 5CLXA 3KGSA 4NQTA 1PG7X 5FGCB 1F58L 4NENB 3CFKA 4S1RL 1QPXA 2IG2H 5KSVA 2V5TA 3K6SA 5DVLA 4GRWF 2G2RA 4XMKH 3P4MB 5DSCB 1SFHA 3DX8B 3G3LA 4K5LA 2YGQA 4BD4A 3RGHA 3M7FB 1RZJH 2XC8A 1WC7B 2VLRA 2XQBL 4H25A 4WVRA 2HRLA 3FQTA 5EIQA 3U6RA 2AHIA 5TTRA 4HJTA 1VCBC 3RVXC 1T04A 4MX7A 1VAHA 2WVSA 4JQXA 1AIZA 1DR9A 4BK4A 2UXGA 3NSCA 3W37A 1D5XB 2BS71 3MLUH 1XSOA 5D6CA 5FGCE 2B0SH 5C0IB 5JW4R 4QTIL 2BSSA 3SPJA 4KTYA 1F1DA 4UI2A 4UM9A 3TBCA 3ZE2B 5F7HA 3S8GB 2GBVA 4YDJB 1PZUB 5GGQH 4MA8H 1QEWB 2G75B 4ILDA 4K55A 2ITDB 2O6EA 5F7AA 1J8RA 3M1BA 1IAIM 2G9HB 1G9MH 2H4EA 3P4OA 3OTTA 4PRNB 3B37A 4ZXBD 5HI4D 1AKPA 1OTTD 2YWYA 3BPLC 4WCYL 2WP3O 1KN4H 2C1OA 4K8RD 4EN3B 1IFRA 2YD6A 3STZA 3IMBA 5MI0B 2A6IA 3IGKA 1MH5B 3MRKB 7CGTA 1W8OA 5MEPA 4QLRA 1FL6A 4IM8A 4KC3B 3ILPB 3P30L 2FECI 3ZE2E 1HOCB 4P4KD 4LL9A 1VGKB 2CQVA 4IK6A 5GGUB 4X7CC 2BIMA 5HJ3A 3PFUA 5IKCA 4HUKB 1A1OB 5IT2H 2BNUB 1DO6A 1QSFD 1MFVA 1RUQH 3X3FL 3P73A 1TZ8A 2HYMA 3ATDA 4HIPA 4AQ8C 1Q0YH 2DWXA 1O6SA 3I9GL 2V37A 4PI0A 5I1GH 3EGDB 3JV4A 5BRZA 1RIHH 4I48B 2GTQA 4XO4A 4EOWL 4UZSA 3FQYA 3WFBL 2AQ3A 2K7PA 4BFFA 1UA3A 1ZXQA 2X4OB 3EZ8A 4Q89A 4ADIA 1AQ8A 4P23A 3RP1A 2H1LM 3RVVC 4D0CB 5T1LB 1YEEH 5IJBC 3CQFA 3MTRA 3GSOA 3WY4A 1UYWL 3NYKA 3GDBA 4Y4KC 1MI5A 4MCMA 2OTPA 5BRQA 4WFFD 4WDIA 1KIQB 1SJHA 5MERB 5F3BA 3GZKA 1DJWA 4JO3H 5I1KH 4PLJC 3LN5A 5E9NA 5IQ7H 4XI5C 5F2FA 1DQLH 2IV9A 3DX7A 4V1DA 1P7QD 4TQEL 3OKOA 5D1QD 3B8YA 3RWCB 4CJ1A 2H2PD 1I8UA 5ESAA 2WXNA 2X6UA 5IVZA 1GCFA 1YEIL 4WY7L 4B95C 5MEQA 4LGRB 2IEPA 3K6NA 1XF4B 5HDWA 3DGGB 3FN3A 3FQWA 4UIMB 2I60H 4HT1L 4P5SA 5L88L 3GSVB 3O6KL 3BN3B 1NCAL 4MXQC 4FS0A 2EXWD 3NK3A 1IAOA 4LLVA 1OF0A 1AGDB 4B9CA 5JHAA 5HDRA 1RK0B 5HHMB 4XP5H 2WPGA 1CK0H 1L5GB 1E4XI 1RURH 4XE0A 3QZWG 3IU4L 1ZV5A 2RH0A 2VWEE 5JR1L 4KGJA 1WIOA 3DHUA 3NCBB 5JIDA 3TJHC 4D8PB 4XCYB 1OAKH 2GY7B 4EI5B 1NM9A 2ALWA 1FL5B 1AZBA 2ILLA 3HCVA 3HNTH 4FJ6A 3C09C 4BCZA 5BS0B 4F7EB 5C0NC 1A5FH 1FV1B 3FO2B 5F1NB 4OIBA 1U8QB 5EU7E 4JZNB 4OZFA 4O2FB 4JX0A 5ANMB 4WF7A 1GGYA 4GW4A 4ISVA 1W72A