4QO1B

P53 dna binding domain in complex with nb139
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
199
structure length
199
Chain Sequence
PLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis, transcription
molecule keywords Nb139 Nanobody against the DNA-binding domain of p53
publication title A nanobody modulates the p53 transcriptional program without perturbing its functional architecture.
pubmed doi rcsb
source organism Lama glama
total genus 49
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qo1B00
3D07A 2ATAA 3D05A 1HU8A 4LOFA 2MEJB 2IOIA 2J1WA 2P52A 5G4OA 4G82A 3VD0A 1EANA 1IO4C 4IBZA 5LGYA 2BIMA 4LOEA 2IOMA 1HJCA 3KMDA 5ECGA 3US0A 1E50A 2IOOA 2J6WA 3IGKA 5G4NA 4AGLA 3WTSA 4KVPA 4L18A 1UOLA 2X0UA 2J21A 2YBGA 2X0VA 2AC0A 4MZIA 3WTXA 5AOMA 4MZRA 1H9DA 3WTYA 4AGOA 2GEQA 4GUOA 4LO9A 4L0ZA 2ADYA 5AOJA 3EXJA 1HJBC 4AGQA 3US1A 3TS8A 4AGPA 3WTVA 5KBDA 3D09A 4G83A 2FEJA 3WU1A 2WGXA 4IBTA 2J1ZA 3ZMEA 5AOIA 1LJMA 2OCJA 3VD2A 1GZHC 1GZHA 5AOKA 4IBVA 4HJEA 3Q01A 3WTWA 1T4WA 3WTUA 2J1YA 5LAPA 5A7BA 3EXLA 4IBUA 4GUQA 2RMNA 1YCSA 2BINA 2H1LM 3Q06A 3D06A 2J20A 1EAOA 3QYMA 2VUKA 3KZ8A 1KZYA 4XR8C 2BIOA 3D08A 5G4MA 1CO1A 4IJTA 4A63A 2BIQA 4IBYA 1TUPA 1CMOA 2BIPA 2PCXA 3IGLA 3WTTA 4IBWA 1TSRA 2X0WA 5AB9A 4L0YA 3Q05A 1EAQA 3QYNA 2XWRA 4AGMA 2AHIA 5BUAA 2J1XA 3VD1A 5AOLA 2XWCA 5ABAA 4QO1B 3D0AA 4IBQA 4IBSA 4AGNA
chains in the Genus database with same CATH superfamily
4V1DB 2WVTA 2YPLE 3ZPDA 1ML0A 2OTWA 1ADQA 2DYPD 1FPTL 5GRYA 1NC4B 1AYOA 1X7QB 3X17A 1IO4C 4YGVA 2YRZA 1RL1A 2F53E 2APVA 1KYDA 3I6GB 3E8UL 3FJTA 3UEZA 4XP6L 1U4EA 4MMZC 5LG1A 4F57L 4OGAC 2XRAH 3HHRB 3UTZB 3INUH 4FNQA 1Y0LA 3IDNB 1ZS8B 2YD9A 3LB6D 1TVBB 3NCYP 4D3CL 1PL3A 4L18A 4JDZA 4FQCH 5KSUA 1RULL 4YNYA 4PWEA 4GSDH 4RFEB 1UC6A 4R2GB 2O5ZL 1O7DE 3V4VL 2QL1A 4JN1L 3F83A 4PWHA 2DEXX 3ULVD 2FSEB 4TPRL 3SDAD 4JY6A 1LDPL 5ISZD 2XZAL 3TT3L 5IOKA 1A3LH 3UYRH 4V2BA 5T1DL 3WUWA 2ZX5A 4NM8L 4KWUA 1GZPB 3FZUD 3T0AA 3WEXB 1AG0A 2XNAB 4QPEA 4N8VG 2E7DA 5E1HB 3Q2CA 4HOZA 4GS7C 2EYTB 2GTZB 2MTAA 3GI8H 3QDMB 2VXQA 2DMGA 3O6FB 3Q8BA 4RQQB 2N4IA 3MRMB 3SPHA 5ITFA 3BKJH 4YO0A 1E2VA 1YEKL 3LNIA 1ZVYA 5D1XD 1K85A 4JG9A 5GJSL 5IG7B 3TBVB 4D9LL 3QZWG 2QADC 4EKJA 4LOUD 3LQAC 4AQ1A 3N43B 3B4NA 1FLRL 3A6OA 1JUFB 1BEYL 2EUVA 5FYLE 4ABWA 4XNUL 1BYOA 4AYFB 4GNKB 2BNRA 3MRDB 2E8YA 5AWNL 1YMME 3VXUE 1VLXA 4N8UA 4K2UL 4U1GB 4TLSA 1GR7A 2QR0A 4DO5A 3KPLB 3GIZH 3AXLB 3CDCA 2RAMA 1SXBA 2UYLB 3DTUB 3I9PA 1B9ZA 4W6YB 2QQNH 5E1AA 1OW0A 1PYWA 4PJBF 3NZHH 2DWEB 4JFPA 2EC8A 1TZHB 2GUOA 4HIQA 3WNMA 2UVEA 2F9BT 1MI5A 3VXMB 2NW3A 4AQ1C 2CPCA 4F7EB 1JNLH 4KDTC 4TSCH 4OKDA 4CVZB 5HHVH 2DICA 1ONQB 2G2PA 3HLKA 4UDUA 3T3ME 3RWIA 4R90L 9CGTA 4JHAH 1E0OB 4KZ0A 2VISB 2AI0L 1RJLB 3NJVA 3TN0A 2J6EL 4EPSA 4AJVA 1KIQB 5DCCA 3GXFA 3LEYL 4PRPE 3D07A 3KPRA 2GK2A 3MJWA 4OBRA 1OAZH 4PEEA 2HT2C 3UTPE 4YWGH 5A16A 4A2HA 2CO4A 1KY7A 2AGJH 2EKSA 4Y2DB 2IADA 1EZLA 1QYGL 1ETZA 4W4OC 2ZKHH 4WI2A 4M7LH 4YHLL 5I73C 4B7IA 3GXTA 3JWOH 1FN4B 1I1RA 3KS0H 2CLZA 5H8DA 3RTQA 4N26A 2EIMB 4KNQA 2G3NA 2NR6A 1CICC 2BOLA 3TA3D 2BNRD 5I1CL 1VCAA 4EJ1C 1IL1A 3TN0C 3TONA 1BIHA 3TIEB 2VWEE 3RTLA 1FIEA 2PYFB 5KANI 5KSBE 5T1KD 2AQSA 3NN8A 2OSXA 5AZUA 3HHSB 2W65A 4KQ4L 1TLKA 4X7TA 1U42A 5AL8A 3MBXH 3ZYZA 4YAQA 4EIZC 4KRLB 1FNFA 1FZKA 5DJXB 4ZFFB 1F3DH 5JDSA 1ZT1A 2QHRL 3QDGD 2DTML 4EQ3A 3UP6A 1A4KA 2NR6C 5FM8A 4LRIA 5D7SH 3L6FB 2YKLL 3O6LH 5BO1L 3EOBB 4AQEB 1FZMB 3VO0A 1XF4A 1F3JB 5D5ME 5IMMA 4JUTA 5I26A 1HNYA 1TCRB 4ZNCD 3EGDB 1DQIA 4MNQD 4U6XB 3ROOB 2XZQL 1BAFL 3OR7A 4M5ZH 4L3ED 4NENB 3UZVA 2XC8A 3LRSA 4YC2B 2KDGA 3X3FL 5GRJL 1RPQA 1L9QA 3KPRD 2IGFH 2IH1A 4E5XB 5I1GL 2W9DH 2ZUSA 3SE4C 1KJMB 2YUVA 2CBQA 4X7EC 1M42A 3ZRSA 4QYOA 1TVHA 1AR2A 3CDZA 3I9GH 1AQMA 5F3HA 7PCYA 2ZF9A 1WRFA 4Z7OB 5KAQG 1CTNA 4FQ1H 5IUCA 4V1DE 3TF7C 4XTRD 2HWZL 4HXAL 4ODSH 4X0KB 3RTQD 4MDIA 3QEUA 2H45A 2PCPB 2WW8A 1SVZA 2R0KL 3NJFA 3U7YH 4B60A 4JRFA 1UOKA 4PJAA 4K7FB 5SWZA 2Z65C 5M94B 2GITB 2K45A 1SXNA 2OR8A 3EDDA 4N9GB 1AO7B 4MBOA 3T3MF 5AB1A 1L4IA 1F1DA 2H0FA 1A2YA 2BK8A 5DT1L 1HCZA 1KPRA 3DVNB 1E28A 1PLGL 1T20A 4PTUB 4WW2F 1UKQA 5DRWB 4DKEH 5KTEH 2PLTA 2PXYD 4H25A 1MWAA 5CHNA 4YHOL 4YHPA 3T8XA 4B9CA 1DQJA 2MCPH 2ZXGA 3LKPA 3MV8B 3ARGA 3VH8G 4OQTH 1J05B 4KK9C 4N0RA 1NAKL 4B96A 5IJDC 5DS1A 4AENA 1ZPUA 2P48B 3QE5A 2LT9A 5E51A 3PJSA 2UZPA 4OZGE 4ZFGL 5F44A 4OTXH 2BSDA 1F00I 1R3KA 5I19L 4KKNA 5J56B 4KQ3H 5IBTH 3H85A 1BWWA 1E6JL 4MXWH 4CMHC 4PJGB 2FZ3A 1R1CA 1BW8A 1LP9A 4OFQA 3U6RB 4KI5E 4TULL 4U1NB 1X7TA 3NCYS 1WBZA 2BP0A 4HUUB 4Q97A 3ARGC 4Z9KB 5K9KA 5DR5L 2GJ6D 4QEGA 3RDTC 3P11H 2E56A 4QRSB 2VMCA 4CW1A 2QGDA 1LE9A 4JRLA 1KN4H 3VXSA 1GGBL 1BQUA 2NZ9C 3P4NB 2ZXWB 6CGTA 2V2WA 5F70A 4KFMA 4OM1L 2KQMA 3UAJD 5SWZD 4QRUB 4XO4A 1L9NA 5D5MF 4A7TA 5AVQB 2QPUA 2DH3A 1RFDL 1EHKB 4LPVA 2N0KA 3WV0A 3VXME 3PWVA 5KJRL 5AOIA 3APCA 1OLLA 1XFPA 1YEEH 3VE0B 3GBNL 3BO8B 4ZFZA 1EFXA 1NEZG 3FL7A 2DD8L 1NGYB 3KPQA 4XBEH 2EDJA 2VITB 4RMBA 4X7SL 3H2QA 3WTWA 5C3LD 1RUKL 2J4WH 3QRBA 3ENEA 2AK1L 1OP5H 1SLXA 1HSBA 1T5XB 1ZT4A 2BM3A 2ARWA 5DVLA 3U30C 1FSKC 3QRGL 5C7XL 4PRBA 4PMEA 3ARUA 4XRCA 2VT0A 5J89A 3O9WC 4HKJB 1WBYB 2J5WA 5B38G 1WAAA 4BK8A 4F9LC 1QSEB 2H4EA 4L3CB 4XMKL 1WQVT 2J5LC 2EAEA 4N5EC 4HULB 2ENJA 1QLFA 1TITA 4WZ9A 3ZUCA 1QI5A 2YUWA 2XZZA 15C8L 3NOIA 5F71A 1B4JL 3S2CA 3S9DB 1JVKA 1I31A 1RUMH 4NQTA 3VXSD 4Z23A 4Q9QH 1JHTB 1T22A 3ZKQD 2NZIA 3F7VA 4UOQA 1DVXA 3DJRA 5GSRB 4X9FA 2I5YH 3E2HB 3FRUA 4UM9B 1KTJA 4KK6C 3CUPB 3NSFA 4ZO8A 2J88L 2BSCA 3QNYB 4HWNA 4PTTA 5FV1L 4OZGF 1VADB 5C07B 3Q8AA 4JDTH 2EH8L 4MA1C 2DPKA 4HC1L 2IOIA 5ACLA 2EXWD 5EEUA 1Q1JH 4ZSOB 3RIKA 3C8KB 4HK0A 2WVSA 4XPHH 3R18A 2WWNA 3BW9A 2HLEB 2WLYA 4KI5F 2R1XB 3KD4A 4NKIL 5BVJA 5T1LD 4IHOB 3UGUA 3N43F 1Z0NA 3DURA 5IB1B 1P7BA 2DW5A 2CUHA 3C9NA 4B9KC 1SN5A 2EVGA 1GCFA 1SMAA 4NWUH 1WZ1L 3FSWA 2X1PA 2AQPA 1C8PA 4HJJL 1KNOB 5IFHH 1OZTG 4MLIA 2WAHA 3NJGA 4DKDC 5D96C 4KU1A 4DF9A 4IK6A 1SHXA 3ZTJH 5I76B 4RNRB 4JGNA 1Z3GH 3AREC 3HS0B 1NJ9A 4U6VL 1HVXA 3EKCA 4U3SA 4OLZL 4A7SA 2VN5A 2EO7A 3FUEA 4KOCA 4KTGA 5ICXA 5TDPB 3NPSB 2KZ1B 3E0GA 1YEDB 2IG2H 1E9QB 1TTBA 2BDNL 4KY1H 2EIKB 2Z0BA 2DLFH 4DK5A 5J57B 1NCOA 1G7QB 2D7OA 3DGDA 5GRWA 2ZP8A 1TVDA 1AO7E 4H8WL 1BFVH 3NZ8B 3J2PA 1R5IB 2VDLH 1HHKA 4A7VA 3N3EA 5I8KL 2IALB 5CCGE 1BZEA 1F58H 1J1PL 1AIZA 1AZRA 1EXUB 4X4ZA 1SBSH 3N5AA 1A4BA 3PNWB 5F1IB 5DQDH 3VFSB 3MV8E 4KKCD 3X1NA 4AH2B 5HY9B 1RP9A 1Z66A 3O3BB 2XDHA 2H0JA 5HDWA 3REVA 2E75C 1TT6A 1YMHA 4GLRH 4K3DL 4YSEA 4RFNB 1ZTXL 4GRLA 3SN6N 1NDMB 2DQFB 1FQ9C 3AT8A 3OJMB 5IT2L 1AQHA 1KXQA 4H1LB 4Z7IA 4FZEH 3DSFL 3NJMA 5ITBL 3B9EA 4GG8A 5CFHA 5TDOA 5H2BB 1GCYA 4EIGB 4JQIA 5K9JL 1SFDA 1AXTH 1IGCL 1K2DB 3FCGA 1JGVH 2EYSB 4MD0B 2JK5B 5B1AB 3QZMA 5C0BA 2DV6A 4PJGE 4U6TA 2D7QA 3B2UC 5I1AB 4G42B 1NIDA 2C1OA 1R75A 3LEXA 5AB9A 2XTLA 3UZEC 5KW9L 1FHGA 5EOTB 1KEMH 4YHKL 5MERB 1XF3A 4YHIB 4JO2H 4OD2A 4DUVA 4GRLC 1IEBB 2PP7A 3DX8B 1A8JH 4UT6H 3SQBA 3IYLW 2V17H 2XXGA 4NXSA 1MCBA 5KBKA 4K23L 5ETUB 4PJEB 4MNHB 3VXUD 4FFZH 4P06A 5AVRB 2A4EA 3ZR6A 2NXYC 3C09C 2ZG2A 3EGSB 4G6FD 1ILSA 2FQFA 5T3ZE 4AI7A 2CK2A 2O72A 5GRUH 3SQOH 1FLTX 2APSA 4Y9CA 2AZUA 5DUBB 1A25A 1J9SA 3A5VA 3IFNL 5FW6A 4MCNA 1OCCB 2FBRA 3G5VB 1FAIH 2OYPA 4PJ8A 2OA9A 4EF3A 5AZEL 1LK2B 1CL7I 1MG3C 5CEZH 1N2RA 3L4XA 4YLQT 1GY1A 4LZKA 5EN2A 1A7RL 4MD4A 3ZLQC 5CD3A 3RPKA 3MXWH 4D0CB 3CVCA 5E6IB 3ARBC 3L8QA 4POZC 3QDJB 3CV5A 1JZ4A 5JMRA 1T7VA 3KLKA 2NY1D 3F00A 2L8AA 5EBWB 3S3PA 4AEIL 4O2FB 2WY3B 1R34A 3L4ZA 4F7CB 3F05A 4U0QB 5CEXA 3QXUA 3EO1A 3HZVA 4PRPD 5DHVH 1MKFA 1BGXH 1YYML 5AZ2L 1QSEE 3UTPD 2FWUA 5F7EH 1NC2A 1DFBH 4PJ8C 4RGNC 3UO8B 4DUWA 2VO8A 4FQXB 3VSQA 1P1ZA 4FMVA 5H37A 4CN6A 3FO9A 3FPYA 1ZKAA 4RAVB 1NFKA 5FFGA 2WTPA 4JO5A 4BCYA 4HJEA 3KLAA 1XGUB 2YAMA 3T6ZA 3DMMA 2NYYD 4AW4A 4M62H 3T0EB 1NC4A 2DQDH 3GSWA 4X5XA 2H6UA 3ZDZB 2HX7A 4XX1G 4Y19B 1ZGLB 3QA3A 4Y8DC 2PPFA 1UXSB 3AT0A 3PWNA 1LHZA 1RVFL 5CLZA 4YVUA 3CX5K 4PUBL 4DTGH 5KVDL 4JY4A 3ELAT 4L8CB 3BDYL 5T1MA 3GSUB 2AJUH 5L7XL 3C12A 4ZSOE 4UT9L 1HZKA 3RWCB 1CCZA 2ZXDA 4KO5A 4C83A 4IDJL 4PJGF 3UPRB 1KN2H 2ZYHA 2C4XA 5C2UB 2NY5C 1PIGA 2OMZA 1NMCC 4MNGA 2X6UA 1KCUL 4G6MH 4M6NH 4MRBA 3TJPA 5C2BH 2Q86B 3PHAA 4ISVA 4P9HL 4A2DA 1RPUA 1MRCH 4NBZB 2VABB 4ZTOL 5LXGH 4PRNB 5J9PB 1YPZA 3QDMA 3T4YB 4RQQA 4KKZA 4M48L 4P4KA 3TEUA 4GAFB 1PX3A 3KJ6L 5D2NC 3TVMA 5BCAA 2WNWA 1H6EA 3ZTNH 2ATAA 3BGFC 2JTYA 3BUYB 5ADPL 3LS4H 4U1KB 2JXMA 3DOIA 3DX9B 2PTTB 5C0AB 5LNGA 2X3BA 2YPVA 1SEQH 2BIHA 3GHEH 4I3SL 5CP3H 3PPEA 4FS0A 4R7DA 4V1DD 4EN3A 4GPVA 2VZUA 1E4KA 2DQUL 3RG1C 1NBZB 5J6SA 3DMMD 1Y1UA 5IHLB 2JKWA 2X09A 3BWZA 1NC4D 3QORB 4JHZA 3MUGB 3JV4A 2EKJA 3KJ4B 4FI6A 4GBXB 3MRPB 4M7JL 4NHUA 3IETB 3QQ3A 4Y1TA 5F0LB 3IWUA 5ERWA 3OKEA 1MFMA 4J3OH 4GW4B 4BKLA 3RX9A 4GO9A 4XP5L 4PRAB 2XUWA 4P4KC 1AJ7L 1FRGL 5GGSB 3RVVC 2BMKB 2YUZA 4JZNB 1WDAA 5DMJB 5GZOA 3H4FA 3LNHA 4U1HA 5ABDE 1MHPL 1Q9LB 1ZT7B 3FTGB 3WEAA 1KCRL 1I7UA 1E4KC 5ANHA 4R2GD 4MAUL 3S88H 3WLWC 3RGHA 3NFSL 4GB9A 5K5YA 2OQJB 1JOIA 3ETBF 4MB3A 5JOFA 3WFHB 3WIHH 1YDPA 2RBLA 4XNBA 4IKLA 1YEJH 1E4XH 1TFPA 5GQBA 4IOSD 3CDYA 3AS2A 4GKZB 4ORGB 4XVJL 3HEIB 5DHDA 4UQBA 1I1AB 1XCWA 2FJGA 2O30A 3QDMD 5GZOC 4Z3FA 1UZGA 2FQEA 2QV2A 3IMWA 2ZPKL 3L1OL 4KMLB 3WN6A 4DZ8B 3TVMD 4RBPK 3CZGA 5CBAA 3GT6A 5F21B 4FRWA 1DFXA 4F15C 4HCRL 1JHKL 1NAMB 2H1LM 4R9HA 5J3HD 3VFOA 2ZXBA 4EN3D 5JOPD 1KV7A 2VXTL 3Q9PA 4OCWL 3KZ8A 1DJWA 4PJEE 4PY8J 2IFGA 5DJDA 1DSFH 1CXFA 4DP7X 2Y6TE 5EEXA 1T83C 1LM8V 4JM4L 3QG6B 2ZX8A 4A2EA 3HHSA 4O58H 3VYOA 4FZ8H 1Z3RA 1MFEL 2DWDA 1RUQH 4LPXA 3T4AC 4EDWH 2FO4B 1FGNH 1F2XK 4R26L 5E8EA 3KH4A 5DD3L 1NCNA 4EUPH 1N3NA 4L1DA 5EZIH 3VXMD 1VGEH 3MUJA 4UYQA 2Y7MA 2DLIA 3OM3B 1ASQA 4DW2H 3LPWA 1DL7H 2BP8B 1CE6A 3LN4A 2IIJA 5HYFA 1ES0A 2Y36L 4NGHH 1FZMA 1F3JA 2CIKB 3HC0B 3QFJA 3QDJE 4ZPVB 2HPOA 4Z18A 5D2LB 4B5EA 4AZUA 4JFZH 3JXAA 2DLHA 4NENA 1HKLH 3MV9B 4XMZA 5EBMA 4X98A 5EZJA 2YXFA 4MQXC 2N1TE 4Y5VC 1JXJA 3ZDYB 2CLVB 2DI8A 4N90E 2DI9A 4GS7B 4OZFA 1M57B 3F7KA 3TIDA 1DZ0A 4DGIH 4NIYE 2BP5M 1RH8A 3HA0A 1KJ2H 4DCQA 3NSXA 5IB3B 5LGHL 4Z77A 1MHEB 2C9VA 5FGSA 5IQOA 3W39B 2WANA 2QADB 1ZTMA 5IGXL 3LIZH 3T0EE 2FCBA 1HINL 1URZA 3ZDZE 3PUUA 5CLWA 1B0WA 4NZUH 4E68A 1MN4A 4Y19E 1SDDB 4K94C 5JUEL 5EZOH 1IX2A 2M8XA 4BQCA 4BH7A 1V7NL 2MWCA 4I0PA 3AG2B 4FFVD 1OB1A 1P4IH 3MGTA 2CO1A 2QVMA 3MNMA 1NQBA 3MV01 2WGXA 4K5OA 5A6LA 3MVSA 5D8JH 4WQOA 2I85A 1RZKL 1OAKL 2B8OT 2E5EA 2FTAA 3HHMA 4QYAA 2V8LA 1CTMA 1KGYE 2X6VA 4JFYA 1T66C 1G7LA 2ZCHH 3QUHA 4NKDB 4E36A 5FXCH 5F89B 2AQ3A 3BLBA 3BH8B 3ARDA 1CYGA 1KBBA 5E4IA 5DMKB 3FOMB 4CMMB 1QLRB 1CD1A 2C3GA 1QHOA 3MGOB 1M7DA 4LCIH 3QFJD 4N86A 5E8NB 3UACA 4L9LC 4I0PC 3L3OC 2YD0A 2BRRL 3V0JA 3V10A 2VC2H 4APQB 5J6HB 5HVHB 5IOPB 4PJEF 3L08A 2XN0A 3MAWA 4UIKL 3MNWA 4AG4L 1JZ5A 3CVHA 3O6KH 4JRXB 3RP1A 4GG6B 2QVKA 5BQDA 2Z31A 4KTDH 4OCRL 1A21A 4LASL 4O2CB 1G9NC 3MBWB 1RZ8A 5C0AE 3GMOB 3KVQA 4UTAA 1ZHKA 4WNSA 1WE5A 4JR9H 1TYEB 3ECWA 2ZWNA 3QUYB 3QO0A 4O00A 4XN8A 3SPVB 5E8OA 2O5YH 3M1BB 3CZEA 3B5HA 5EC1B 1UACH 2IWKA 4JHUA 1CICB 1G9EA 4ELDA 5E2JA 1MCPL 1UTDA 1C16B 1C8QA 1AO7D 3O41B 2DYRB 4M1DH 4C57C 1QNZH 3LZRA 1I7RA 3COOA 2JI1A 1IKNA 4N2DA 1MAKA 3ILQC 1FO0H 4RSVA 5D7JB 5DJ8A 4AGNA 1CR9L 4KJWD 2Q10A 2WBXA 2MQGA 3LH8A 3BPOC 4JKMA 3MV8D 2CA4A 1J5HA 3ROLB 3RAJH 3IN0A 4JO1L 3CZFB 4XMPH 3ARDD 2BOCA 3CNKA 1OAXL 3VXPB 3HZ3A 5E2UH 4X4MA 1INEH 1JDAA 1T5XA 4PV9A 4FYSA 3DNKA 2Z8WC 1XCTA 4J8RB 2W9EH 1MZZA 3JUYA 5F1NA 2QFRA 2HLFC 1NM9A 4WEUD 1IKNC 1I9JH 4QNPE 3ZDZF 4PH8A 1JI1A 1HHJA 3C8DA 3FAWA 4P2QB 4ZUSB 2MCMA 4PG2C 3VH8A 2Z31D 5EF2A 3KBHE 1GGCL 3PJLA 1A6TA 2BS9A 1FFQA 5ADOL 3CX2A 5IQNA 2OYKA 4RDQG 4WI0B 3FSOA 3WXWL 2DL2A 1PS3A 1U8KA 2PO6C 5I1KH 4WSKA 2OM5A 1LWHA 3MRJB 3H9SB 3HC3H 1DVZA 1L9MA 3WJMA 4YX2H 2C3HA 3AS1A 1LTXA 1IAKB 2HFFA 2AXHA 6PAZA 4HBCH 3N1PC 4QTIH 2EDYA 2A1WL 3N1MC 5J11B 2XTJC 2NSMA 4HIHA 5DMIL 4I4WB 4OF7A 5T3ZD 1D9KA 1ZA6A 4X6CA 1IBHA 5C07A 4Y8AA 3DJTA 2FX9H 4OCMC 4QIRA 1Z5HA 1G6RH 3LNGA 2JJSA 3K2UH 3R0MA 3UAAA 4Z7VB 4QCIA 1FFNA 6PCYA 3ECQA 1B4RA 3VB8A 3QZBA 2WUBL 3IJHB 3EFFA 5HHXL 3X12A 2AV1A 1RZJL 3GJEA 4KRNA 4FFWC 1JV5A 2K9UA 2HXAA 1JFHA 2X4NB 1FUNA 3AACA 2R29H 5D2LE 3B6SB 3PHOA 1M1XB 1I8IB 4NO0B 4ECNA 4JCMA 4OFYA 3BZ4A 3LDBC 4X6EA 3SYQA 1QA9B 5CJQH 1D9KC 2GIYA 3IRZA 3RVXC 5I0VA 9PCYA 4RLDA 4KAQL 2IBGA 3ZDYE 1CFNA 1OCZB 1CGVA 3SO5A 1MCQA 3AY4A 1DBMH 4OFIA 3GK8H 2JJSC 4YXKH 1ORSB 2CA3A 2PCXA 2LTQB 3NFNA 1T0MA 4KVCL 1KTCA 4LRNL 1NGPL 4CGUB 2OSWA 4CMHB 2F2HA 5FA3A 3JWDL 3CFJA 5IB4B 2DIAA 4FXTA 4X9YA 5EO1B 3T5WA 3NEEA 5BS0B 3VD1A 4QTHA 3MXVH 4M3JA 3L9BA 4BFBD 5AAWA 1XR8B 5E00A 3RDTB 3N44B 3X3GL 3EYFA 1QW8A 1CF8H 1ZLUH 4UTBL 4LEXH 3QISA 1P4BH 4NZFA 5FIEA 5B39G 4WFFD 5B4MC 3FC8A 1L7TH 4RZCA 3ZU8A 4W1TA 3CBJB 1FC2D 1BMGA 5C07D 1A7OL 2EXYC 3GPSA 3ULSA 1FJ1B 3I50H 3AUWB 3ZTDC 2O6EA 3BYTA 2ARJB 4J6RL 4Q2ZA 2MMXA 4XH2B 1UENA 3E6HB 4FC3E 1OSZB 1XMEB 4QNPF 2ZAHA 3V6OA 5A6MA 2Y24A 5I30L 2RR3A 3CIAA 2J6WA 1D6EA 1QBAA 3WXVH 5AAWC 4K0OA 4OLUH 1GSMA 1VFAB 5GSVA 3WFDH 3PABA 3BSZL 2XN2A 3DK2A 3VFWA 1A64A 3RLSA 1CU4H 3VFMA 2BVYA 4LSVH 3MV7B 5DUPH 1K2DA 1WA0X 4G8FB 3DJ9A 4NDMA 2D03L 3D8MA 3K6IA 5F9WC 4UM8B 3MBEB 4PRIA 2NXZB 5I2IB 1CGTA 5KSAC 4N0UA 2BX5A 2ZOUA 4HV8A 4JRXE 3V4UL 4Z76B 4WK0B 5J7CC 3U30B 1UJ3A 4JPWH 3OD3A 3L2NA 5IMKB 5IJVB 5K93A 1XD1A 3SODB 3TX4A 2P49B 2WXOA 3O9WB 4MBRA 1WZMA 1W72A 3BWSA 4NYLB 1MI5E 1DQKA 1IEBA 3JQOB 3BH9A 3FB5B 3LHPL 2ICWB 5E2VH 5DLMH 2D9QB 2B1AL 5DMYA 1UUSA 3D33A 3K1KC 1R3LA 5BQ7B 2X53A 3GNMH 4JZJB 2XV2A 1PDKA 4JFHD 2C9XA 1IQWH 1W9XA 3JV6A 3L5IA 3SJVA 4YEFA 4AQ8A 2R4SL 1V3MA 1MW3A 1UJ3C 4P23A 1GW6A 3FB6A 5D2LF 2GJPA 3SEPA 3T2PA 1NCUA 5DJZA 4HUVA 2J20A 2BVPA 4WDIB 4WHTA 5GS0H 4XT1C 2W0LA 1CLYH 1JP5A 2HTKC 1ZGLM 1P4LA 1D5BB 4FP8H 1XGRA 5HJ3B 5ICZB 2VW6A 2F08A 2X2IA 3HUJB 5JW5A 3D30A 5AL0A 2J8OA 2BWDA 2WM0A 2RALA 1JXKA 4MJ2A 3FT4B 5E8PB 1JRHL 1MY5A 2AJYH 4XAKE 5KYUB 3I6KA 1L9OA 4NNYB 3T77A 2B4CL 4ODVL 4AQ8C 3BESR 3SO3C 1WISA 4P23C 3BIBX 5DURB 2KLTA 3WIAA 2LU4A 3TCXA 4OLWH 1J12A 4I87A 5F9OL 3ATEA 4P2QE 3MLYH 5ABAA 4XCEA 4JMXA 1O5PA 4HK3N 4K73A 1UB6B 5D96B 3KCWA 2WLLA 2EADA 3GINA 4YPJA 4X9GA 1E3ZA 2OMUB 3QEGH 5ESVA 5FF6B 3AREB 3VXRB 4W81A 3EDEA 3MN8A 3H9SE 4PBVC 5I6XB 3NIDF 1KDJA 2R1WA 3MFFA 1L0PA 3CFCH 4PLKD 4XCYB 1SYVB 1R0AL 5DC0A 1JGDB 1LMIA 4HIJB 1S9XB 1WC7B 4HHGA 3BT2H 4TL5A 1VFMA 5B1JC 1BVLA 2I07B 3RBSA 3MCG1 3SJVD 4XNZB 4ODWB 3PREA 3VQ1C 5HYSG 1EXHA 3A4FA 3CXHJ 3E6FA 4WWNA 4AK1A 4DEWA 2AC0A 4Z7VE 1EVTC 4G3YL 1GMIA 1J9RA 2EZ0D 1LEKA 1RSFA 1P7KB 5ANMA 1NBYA 1JXFA 2QKIA 4WUKL 3FBKA 3VQMA 2IWGA 4YDKL 1MRDL 2ADGA 1P84K 4J3XA 4AVJA 4JDEA 5FW7A 1ACCA 5IMLA 1JZJA 1ZVSB 5E6ID 2F7PA 1JMZA 4NP4H 1GAFH 1DQDL 2NNAA 1U21A 2XA8L 4Z3TA 2CJSA 4ELMA 4LSUL 1R3HB 2VW4A 1IKFH 1QQDB 4PGBA 3HAEH 5DQ9B 3QCTL 4LDLB 2H8PB 4QWWD 3W2DL 1AC6A 3KWUA 1ASPA 2ITDA 2D31A 6FABL 4GQPH 5IHUH 2CPUA 2VSCA 1DBJL 2G9HA 1MCSA 4N90D 5GS2D 1S9YA 2FBOJ 4K9EH 3CFDB 4HXBH 2IF7A 3B34A 5BS0E 4FG6C 4S2SB 2P43B 1R5VB 3MTRA 3VWJA 1NBZA 2PR4L 4QDGA 2B15A 3S48A 3T0ED 3K81A 3FQRB 1N4XH 3BIAX 5GGVH 1LEGB 2X4SA 3F7YA 5JXEA 3S5LB 4QHKJ 2ZXCA 1NFIA 1G94A 3I3EA 3MRIB 5CCHE 4PRAA 1OTSC 4IJTA 3SPGA 4CN1A 4UBDC 5GGUB 3AMLA 4K7PX 5D1QC 2NXYB 2Y2YA 3B2DC 1MJ7L 4KRMB 4HIEB 3UBGA 3QO1A 2CHXA 2EO1A 1GS7A 1V7MH 4DP5X 1LP9E 4D8PA 4ABQA 3QUML 1P7HL 3VWJC 2FLBT 3EJJX 4C56E 4CILA 5HVWA 1P6WA 2J71A 3FN9A 4X8XA 4R7NB 5MEQA 3PUCA 3ZSSA 1I9RL 1ASOA 1F45A 2XYBA 5JXEC 3LD8C 1E6OL 1IGMH 2A0LD 4KOBA 1TOXA 3MV7E 2PPAA 1BQHB 3BMVA 3GMLB 4R5XA 1A6ZA 4WWPA 4U1IB 3QAQA 5E2TL 2JKIS 4AYGA 3QULB 3ARBB 4XI5C 3NJJA 5J12C 4DFIA 5EFIA 2VDLB 2Q6WB 2QDVA 2DM4A 2EILB 3OHXB 4QY8A 4YDIL 4OFKA 5LGYA 5ILTH 2MIZA 1XCQB 1WCBA 3RZCB 2DDQH 4A6YB 4Y9EA 5HJDA 1LO3H 1KEGH 3V52H 4LIQE 2DWYA 2DJMA 2WLZA 5C0AD 2WWOA 1EERB 3S8WA 2VQ1B 3DX0A 3CCHB 3PL6C 3Q1SH 4W68A 1Z2KA 5E2WH 1SDYA 4Z7VF 4YSRA 1UOLA 3DRTB 2W92A 2KKQA 4F58H 4G7YH 4XNDA 2YK1L 5AAPA 2AJXH 2X38A 3B5GA 4OUOA 1I3RA 1OP4A 1VGKA 4GBXD 1QSFA 4F8TA 1QLEH 2R8SL 3S0PA 1A7BA 4P5RA 3IJEA 4KMTH 2YWZA 2ZYSA 1KV3A 2Z93A 2O5NA 4X8CA 3C5ZA 1G9ML 4PJ5A 1DVFC 5K39A 4Q56A 5C0IB 4PR5B 1BVKB 1F4YL 3BAYA 4Z0XA 4D8OA 3Q6GL 4LVHB 2NY3B 3QXTA 4KGJA 1R3JB 3F58H 4ETQB 4X0NA 1PZDA 2LR4A 5C0CA 2XBDA 3GZPA 4DVBA 3WKNA 1B2YA 1ET5A 3SKJL 4KKRA 1AD0B 1CPUA 2WXMA 1D5IH 1RK1B 4G8GA 5IM7A 2LFEA 3D1MC 3OJDB 3IU4H 1IRAY 3UROR 5CWSB 4Y4KA 5C71A 3MNDA 1ZMYA 1J5OL 1BHGA 4FHBD 4OUUB 1RMFL 1V27A 3CK0H 2FE0A 1F6FB 3WLBA 2YQ3A 2YPKA 3MV9A 3QBTB 1F4WL 3N40P 4QRFA 4LVOC 3C5ZC 4OLYH 3CXDH 3O0LA 5G2NA 3ZO0A 2YARA 4HJ0C 3D06A 3UPAA 1NANI 1RU9H 4DHLA 1WFJA 1SJVA 3FCBA 3G5ZB 4TL4A 3U79A 1G1KA 3REWA 1YC8A 3C2AH 4Z95L 4EXKA 2ESVB 4Y7MA 5IB3A 5IQMA 3QPXH 5D2NB 3VXRE 3PDDA 1MVUB 3L3KA 2BC4A 4Y4KC 3D39B 1LP9F 2OL3H 3DV4A 3CSYB 4MQ7B 5IJKA 1ZDQA 3DYPA 3TPKA 4NRYA 4EI6B 4UV4L 5I66A 4LSPL 1XVSA 2IWFA 3RWGB 1ADQL 1QSFD 3V55A 1E40A 5CILH 2E59A 2O6FA 4FMFA 4NM4H 1NGQL 3KW7A 1C5CL 1XIWC 4QHNA 2APWA 4PJ5D 4P3DB 3QZNA 1PSKH 1HL8A 2H5UA 3TESA 1I1YB 1UWFA 3KLQA 3O2WL 1NM4A 4NKDA 1ICTA 4EZLA 5C0CD 1U2CA 2YSSB 2MEJB 3MCLH 3D2UB 5IJKC 4N0FB 3NBNA 4TNWF 2KC0A 4P3CH 5E8NA 3NP3A 2ZX9A 3LQAL 3ZMNA 1MG2C 4PRHA 1HJCA 4HMCA 3NIFB 1T89C 1WFMA 1ZWIB 1P0SE 4GIPD 5EU4A 3HRZB 2VDML 3MV9D 2FH8A 4RMTA 1JCVA 2XOTA 3FCSA 4O4YL 4PGDA 5TPWL 2R7EA 5JO5A 5KZCD 4GG6A 1F6AA 4NNPH 4N2LA 4G71B 4GRWH 1HEZA 2WP3T 4RA3A 3ZE1B 4ZDHB 2VXQL 5C09B 5TH2A 1TJGH 5KN5B 3ZDXB 5IR1A 2YGOA 1HHHB 2HVJA 4WWID 1LD9A 3KGUA 3TJEL 2R2CA 2VE6B 3HOGA 4Y5XA 3KBPA 3DUUA 3DPDA 4DKFH 4TTDC 4CSTA 1E8YA 3AQZA 3T6XA 1K8DB 2ARJQ 4OQ1A 4ADIA 4XMTA 2CR6A 1PAMA 3EYSL 2EECA 2A9NL 4H0HB 1IVLA 2CCWA 2AK4A 5ENWA 4JFOA 5MP6L 2OMTA 4FKKA 4OZHA 5C0BE 2IAAC 3RVWC 5TTRA 3BXNA 3T4AB 4LSQH 2IO5A 4NC2B 3U7AA 4OJFL 2Y07H 3TYGH 4AKOA 5T33H 3CFUA 3VXPA 3GSVA 4NSKA 2E9WA 3G6DH 3HG1A 1A6AA 1YN6A 1GGIL 3GKWL 3BYYA 2A83B 4N8VB 3QJFB 4ONHA 2C3WA 1S7TA 4PRHD 5AYQA 2IV9A 2FB4L 3DPBB 4HPHA 4YDJB 5FDWB 4APQD 1RZFL 3A23A 2ZCKL 2WQRA 3SBRA 3O2VH 4JRXD 1NIFA 2ZNWA 1R24B 4I3RL 4P2RA 4R3SA 3QZWB 4I2XA 2YFNA 3INOA 5E70A 4B95C 3B9VA 4Y5VB 1JE6A 3MJ6A 2WXGA 1PLCA 5CSZA 5GGRA 1QATA 1X4ZA 1MCWW 3UJIL 5F9JB 3KAAA 4L3AA 3CXFA 3LKSB 3U4AA 3GTVA 1S7VA 2UWEA 1AGDB 1UA6L 3CDFA 5ACZB 3VWKA 2OR9H 3QUYD 4U49A 2OJEB 3SKMA 1AOHA 2ZSVB 4HWZA 2AABH 2B0SH 4FGMA 3U83A 5TFSH 4PJ7B 2X89A 3MJ9H 4AC2A 3EH2A 1ZLEA 4X8GA 3PWJA 1IAIL 1IIIA 5GS1C 1X5JA 4QT5A 1SRDA 3LKOA 5KVFL 3KWVA 2F5AL 4XCFL 2AK4D 2BOBA 4AQAA 4FFYA 3VU2A 4KZEL 1H0DB 5D7JD 2B2XH 2EH7H 5HDBB 2G0KA 3GZKA 1ANUA 2E7CA 4E41B 2MOGA 4B50A 2R69H 3UG3A 5LQBL 2RIKA 4P8QA 1QWHA 2H3KA 2LLGA 3TZVA 3VWKC 1U92B 4JVUA 3S3DB 4IIZA 4XN7A 1B0IA 4PGEA 4WHDA 2X4NA 4I0KA 3MRNA 5J1AB 3GLDA 3OTTA 3DTXA 3HG1D 3MYJB 5CGYD 2QLYA 4H5SB 1AR1C 1SEBB 1ETA1 4WGKA 5D4HA 3SE9L 3EADA 3HE7A 5K9QG 4L9LB 1OALA 2D4FA 4X6BB 3WIIL 1JBJA 4NRXB 4OF0A 4G6JH 2GEQA 3BZ5A 3L3OB 1EJOH 4PJ9A 5I1EH 4EXPX 5C0FA 2ALAA 3I02A 3AB0C 4P2RD 2FGWL 1AE6L 1H3PH 2GY5A 4AGPA 1AKJA 1MJUL 2HFEB 4M4RA 1DCLA 2ESVE 4EUPB 5D2NE 5DRNB 1SUHA 2VR4A 3U9UA 1NGWA 4AVKA 1PF3A 2IDSA 4OLXH 5FK9B 2JQZA 3D39E 4XMUA 1QZNA 2X4UB 3THMH 3WNJA 3RVTD 2DQCH 1JF1B 4HAFA 4XBMA 3LCYA 4EDXA 3L4WA 2IPKB 4TVPH 1FH2A 4UQ3B 5CJ5A 5DTFB 2VDNH 4OV5B 3MU3A 3T2QA 4ZD3H 3DIFA 2IBZY 1YECH 3DTDA 2DAVA 1DLFH 2EIZB 2G60L 4OT1H 1OCWH 2X1QA 3BP4A 2NX5A 5HBBA 4YL4A 2CNYA 4QXGH 1MJJA 1N5YL 4MJ5B 2EE9A 2ROXA 1Z5LB 3I6LD 1ND0B 3CFEB 3TL5A 4LGSB 5KS9B 1KJ2B 1MWAL 2ICES 3CSPA 3TZVD 1SHMA 1HXMB 4G6KL 3F04A 3V4PH 3O8XA 3I2CL 3CMGA 1AGBA 5IVNA 5EZLA 3TO4C 1ZIAA 4WENB 3ARPA 3NIFE 1JYVA 3C6SA 2Z91B 5IROA 5J5EA 3P40A 1SFHA 3POHA 4TQEL 4KROB 3SE3A 3OX8A 2W1NA 2A99A 3QXWA 4G8FA 5CUSH 5FCUL 4A38A 3BP6A 3HE7D 1VCBC 4M43H 3OBAA 4Y9GA 5KOVC 2OMXB 2WYZA 4PJ9D 1Q38A 3MROA 4ZPTA 3ZE1E 1NWOA 3ZL2A 5C09E 1AKJD 1FE8L 5T5FH 4JB9L 3VG0L 4OR1A 3GI9L 1IM3A 3OZLA 1FVEB 2A4ZA 3OZ9H 5L8KB 2ICWA 2VXVL 2JCCA 4JPIB 1AGEA 1WIOA 4BFIA 1TTRA 3EYUL 2RCSL 3ARFA 3LYRA 4QOKB 2G3MA 1RIUH 5ESAA 1KCVH 4BGDA 1NUDA 5IROC 5BQ7A 2PO6B 2Y6SC 3SE3C 4GFXA 3NRFA 4KO9A 4N2CA 1U8LB 1PZ3A 3APMA 3VXNB 4NKMA 3L7EB 3B3IB 2Z4QA 3QEQA 1CFSB 2ZUXA 5EG6C 4AGLA 4KVPA 3D12B 4ZAKA 1U41A 1BP3B 1XH3A 3HFFA 1I9EA 2XQYA 2HKHH 4WNJA 5T3XE 4KITB 4WI3A 1AHMA 3HKFA 3HUJA 4Q74A 3DO7B 2QVIA 5EUOE 3ARFC 3WAKA 5HHPA 1OAJA 2XI9A 1G7IA 1QKZH 3O8XD 4WFEE 3NRQA 4EVNB 1KB9K 2HT3C 3RIAK 4XVUD 5A43C 4G1MB 2W0KA 3BP7B 4AEEA 2K1MA 4KC3B 3T2NL 3RFZA 3MBED 5E6YA 1S5HB 2NXZD 3T0XA 4QXWA 1TDQA 5CP7B 4GJTB 3SIKA 2DQHL 3LDBB 3WD5H 4Y16B 3O6ML 3UGXA 3VM7A 1UM5L 1CLCA 4H8QA 3TP4A 3CZSA 5DC2A 4YSCA 1QTSA 3P9LA 5EV7A 1A9BB 4H26B 1RUPL 1BD2A 3QCVL 1Q72H 2K3TA 3CIQA 4URTB 3ZKMD 3L4YA 5JXAL 1A6UH 2H32H 4I1PA 1ZVNA 4H2CA 1F11B 3HJEA 3NJIA 3FDWA 4J7RA 4M7KH 1Q9KB 2XFXA 2OW7A 2HH0H 3D0VA 2V9TA 4UU9B 3HI1B 4PJ7E 1EAOA 2A9CA 4PHXA 1MFCL 1MNNA 4KJQC 1N6VA 3FT3B 4GO6B 2LAAA 4YFEA 5F72S 1WTLA 2DQEH 4EO5A 2P5EB 1S7RB 2DOCA 5TDNA 1RK0B 3GJFA 3MACL 2VLME 3NIFF 4FJZA 4JN2A 5D7LB 1NSNH 5HDBE 3K6SB 3LEVL 2OMYA 4QI3A 4ZAKD 1HWHB 4IOFD 4E41E 3MOBH 4HX1A 1NEZB 3GSRA 5AD0B 3F01A 3VD3A 4CDGC 5CINL 4N2FA 3IGAA 5FA4B 3ZE1F 4OZ4A 1Q0EA 1ORQA 3FFDB 2J1XA 4JG1H 4XN4A 3ZIYA 5CBEB 4TN9A 3BFOA 3AC0A 3D9AL 1C5DA 1AMXA 4I1NB 1J8RA 1R3HA 5B38B 5FO7B 4PCTA 4YSSA 2R39A 4ZS6D 1BXAA 3BZDA 3P02A 4P5MB 2NT1A 2XG4B 3V5DA 4HS6A 32C2B 4JFEB 4ZX5A 1G6RB 1V3KA 1XEDA 3RWDB 5AQ0A 5KSAB 1URLA 4G9DA 2EDDA 4KO7A 2WBKA 1BD2D 1A6WH 3HNVH 3GMNA 3NCBB 4G5ZL 5IFJB 3VXRD 1YEFH 1U93B 3JVGA 5JPMB 1IM9A 5GGRY 2AZAA 1G0YR 3K4ZA 2X2HA 4Y1AA 2I9TB 4XP1L 1UCTA 4OF5A 5B3NA 1RZIB 2FBJH 1AH1A 2HRPH 1EZSA 1NMAH 5EUOF 3V9CA 4K8RH 5IHZB 4NQVB 4XGZA 5E0QA 1GHFH 3ZRCC 1ZJBA 2APXA 1H3TA 4L3FA 1MQKH 3CC5A 3UJJL 4L05A 1YYLH 2RA1A 4A7UA 5KVEL 2NY6B 1KXTB 4CC4C 4GQRA 2NY0C 5K69A 2EEAA 3CLEL 4ZO6A 4NS0A 4HIIA 5KS9E 3FU0A 4IKKA 3JVGC 2YMOA 3D3VA 2BVQA 3A6BL 1KPUB 2A6DA 1WZAA 3H7LA 4ANWA 3CFQA 3D5OF 3M1CA 1S5IH 5HYSA 5CN2A 2AJVL 5INDB 1LK3L 2HSIA 4LLVA 1E9OB 3BMWA 3AU1B 3QUKB 1WFTA 2CH8A 4W93A 4JQIL 3VI4A 5I1HL 2RMNA 4PJ7F 3P2BA 3IEAA 3SO3B 1YNLH 5DK0B 4ZUTA 4RDBA 3HBPA 3NJNA 2IH3A 2YAOA 4QAWA 3T8MA 3GSNH 3HFMH 2VLLA 2H2PD 4R4BA 5C8JB 4OZIA 2RFXB 4KKBD 4D7BA 3FTSA 4ACTA 3J8F7 4H88L 4NCDA 1CQYA 1JFQH 4QOKE 1IM9D 2VDKH 4Y1AD 5C86A 4S1DD 3BEVB 5KYWA 4RRPG 4RFOL 3AUVA 3NGBC 4R0LB 4ERSH 3ZTEA 2FX7L 3ZE2B 2GT9B 1E9PB 2AAVA 4HWBH 3FAXA 3IDYC 3KHOA 3HNTL 2ITFA 4YSDA 4FQLH 1MCEA 1VFBA 3Q05A 1JHLH 1OAUH 3HE6B 4TUKL 2D2OA 4ODXA 3TNNA 4I7ZC 2IPUK 1A9EB 1E5YA 2YLHA 1W0VA 3ISYA 3A4EA 4L5FL 4IHBA 4YLCA 1LO0L 4F1ZA 3S34H 2UY7A 1AD0A 4H8PA 5JYMA 4JFFA 5K1VA 1G4RA 1RHHA 3OJDA 1E4WH 3IFLH 1XXDC 4ZT1A 5I0DA 2C1PB 2KERA 1KG0A 3KBFA 4X6FB 4TF4A 4PB0H 3CLWA 1XQ4A 4FFZA 5JUEH 4XVSL 3GUTB 1M71A 2BHFA 2DKUA 4G80A 4KXDA 1AQDA 3SBWA 3TPUA 3QWOA 4Q6IA 3FOLB 5DU7A 1CK0H 1U8MA 3JVFC 5LUMA 1YY9C 2J43A 2GJJA 3RZCD 4LDCA 2XG5B 3WFBH 4FMKA 3GMRA 3X11B 5GZND 1X5ZA 1XSKA 2HG5A 1YUKB 2EEBA 1E7UA 2G75A 2I7OA 4LCCA 3TFKC 2BNUB 4XWGL 3UDWA 1H9DA 2VR3A 4GSUA 4QHLB 3D18A 4EBQL 1T04A 1PU0A 5KS9F 1H3WM 1K5WA 1TO4A 2NY5L 2A6IA 4MXQC 3ZQWA 4CC0A 4AMWA 4HU2A 4N6RB 1FPTH 3SBWC 2P5EE 1TNNA 3AMKA 4V33A 3WEBA 2WQVA 1PZSA 3HMWH 1OGSA 3E7JA 5D7LE 5K9QI 1QPXA 2XX0A 3E8UH 4HDIB 5DHVA 4PFEA 1LJMA 3ECBA 1FNEA 3OLGA 4HQQL 4F57H 1QNIA 1K6QL 1CYXA 1TTAA 2G30A 2NY3D 5FWQA 3U9WA 3BDBA 3B2VH 4JCWA 2YEVB 5D1QB 3LXAA 1IGYA 1MF2L 1IEAB 2YZ8A 2P8PA 4ZX4A 5KAQF 4R4FL 1FYTA 1RULH 2E6JA 4B27A 2WXHA 4GYBA 1JGIA 4GUQA 2ISDA 4JFXB 1BZQK 3E9TA 3QWQB 2O5ZH 4XCNB 1JPFB 4WJKB 3FF7A 1KXVA 4MAYB 5GS3A 4PWFA 1QRKA 1SY6H 4WHYG 3ZE0B 3PGFL 3UEQA 2P8LB 4GW1B 4LLYA 5T1DH 1Z9OA 4W6WB 4NM8H 3GB7B 2AFNA 4MA3A 3SKNA 4LHUB 3O11A 1QTYT 3TEZA 4JKPH 3NUKA 1A1OA 4JFEE 5DJAB 1G9HA 3BQUA 3NAAL 4JO3L 4OVVA 4A63A 5JA9A 2LGNA 3BUBA 2KL6A 1WSST 3DBSA 1HQRA 2Q3XA 2E46A 3CFMA 1TTUA 3PNRB 4XMLL 1VJSA 4D9LH 5CEZD 5I71C 2WQUA 4S0SD 3HBQA 3VW3L 2HT4D 2YPVL 3D39D 1FLRH 4UQ2B 3FU7B 1BEYH 2BPBA 1AZVA 4XNUH 4TVUA 3PL6B 2F15A 5DHXB 1N6UA 2Y7OA 4C4KT 3R8QA 3S3JA 4XPGL 3HAEB 1UM6L 2Z7YA 4PJ6A 1FCGA 3QJOA 4X5LA 1W8NA 2CWRA 3MUHL 1RP8A 3UXFA 4Z8FH 2WUCL 4K3EH 5KSVB 1DVFB 4LPUA 5TE6L 1XTLA 1J18A 3WO3B 1ITCA 3SDYH 1A66A 1E50A 2VZVA 4ZUUA 3U9PL 3QPKA 3GBMH 3HI5L 4JQVC 3V95A 2CO6A 3U0WL 5CR1A 3H8NA 3QZPA 1DE4B 4R90H 2YBRB 2DI7A 1RAMA 5ID0A 2XJLA 2AI0H 5EPMB 2JIXB 1KYOJ 2J6EH 3QUZA 3LEYH 4L0ZA 5AOJA 4LVOB 3B56A 1I8LA 1BF8A 3BQUD 4N0CC 5I9QC 3OAYH 1ROCA 2XQBL 4F91B 1YN7A 1U6AL 1U8CA 2PTVA 2DYSB 3PV6B 1Q9OA 3L5XL 4YHLH 1IJ9A 5LGJA 3NACL 3ZO9A 1BBJA 4BQ9A 1LYQA 3VFRA 3WIHA 4BJLA 3ZE2E 4NUPA 5I1CH 1CT8B 1D7DA 3H6AA 1EHLH 5GISH 1CXHA 5T5NG 2UZIL 4LLQB 1X7SA 3AG4B 3QUZC 4JM2B 2I26N 2W91A 4IU2B 1H0DA 1I8LC 3R8BB 1KTLB 4FNLL 4YQXL 1UH4A 1ZCRA 2ADFH 1CFTA 1RLWA 2FT8A 4K5NA 3MA7A 4NB7A 3V79C 3SKUD 3OC5A 4XO8A 1XIWB 5JIDA 5E5MB 1KENL 5HGHB 1WP6A 3EBIA 1QHQA 5DO2D 4F2MB 1CZ8L 4BFJA 4WSGA 4S0HA 1EEUA 4OIAA 5HI3D 1CO1A 5FKPB 5HI5D 2VAAA 4AUUA 1B4TA 5LHDA 1QFWI 4WIQA 2DQIH 5LDUA 4ODHL 3L3IA 5DJ2A 2WLKA 2GBTA 1XZ0B 1E90A 3MLUL 2CRMA 3NH7L 1QLEB 2B3IA 3WDJA 4J3OD 3NMEA 2VDRH 5IY5B 3DOSB 1SXAA 2HKAA 3KYAA 3VFUA 5I17B 1LO4L 4P2YA 3WL9A 3X3FH 2OK0L 4G8AC 3TJHD 2QQLL 4M5TA 5I1GH 1RJZB 4BK5C 1BBDL 1WYJA 1KC5L 3PFUA 5F93C 1NGXA 1XF5A 5MEOB 4Q14A 2WBWB 5HSFA 3KM2A 1DQQA 1UM4H 3U6XA 5HYJB 3LTVA 2HWZH 3ZK0A 2HTLD 2PYEA 3GHPA 1FBIL 3W11C 4YHZL 1OTTD 1HTYA 4FNSA 1VFOA 2BVOA 3BQVA 5I75C 2R0KH 4OFVA 1IQDA 4Y4FA 1O6SA 4IRZA 3KCPA 2UY6A 4JL2A 2B20A 2B59B 2YMXL 1J48A 3T2LA 3MR9B 4GUPB 2Z4TA 5FFOA 4P5KB 3A6CL 5G5DB 1SMDA 1CL7L 4AWJC 5DFAA 5AVXB 5CZXC 4JPKL 3BGAA 2VDQB 5D1QE 2XTSA 5EUKA 1Z5LA 1PLGH 3IMTA 4JG5A 3IDMB 4MCYA 3M8OH 3VSUA 1EVUA 2EUWA 2P7TB 2FJSA 3OG4B 4LFHD 4YHOH 3LQZB 1G9NL 4XPAL 5DZVA 2AV7A 5EBLA 5HYQA 2JWYA 2H0PA 5JHMA 3O0RH 3LIZA 4XAWL 2D7MA 2OL3B 1CURA 5CMAB 5IQ9A 5JQ6L 2X5PA 3ZE0E 2GAZB 4OGXL 1K72A 2AVGA 3IF1B 1CIUA 1VKXB 4AOFA 2F19H 2WOYA 3ZE2F 4Z5RB 3BVVA 4HBQA 1CIDA 1MCLA 2X7LA 3KPSA 4FG4A 1F2QA 3CVHL 3N2JA 1A1MB 1E6JH 2K78A 3AAZB 1CI3M 4ZQKA 4Z7AA 4N4YB 1T4KA 4TULH 3EYQC 4F7TA 4R5VA 1FYHB 2ZSWB 3B2PA 5DR5H 4CSSA 5DRZA 1JDCA 2V2XA 4QHPA 4XXCA 5ESQB 5IB2B 4F7MB 2PYED 4UTAL 1X5LA 3IT8D 4I9WE 2B08A 5DRXB 2IDUA 2W0PA 5IHBA 8PAZA 3MLPA 4UMGA 1GGBH 4KKQA 5D72L 4X6DB 4AMKH 4Y4FD 5EN3A 1I7ZB 3EH3B 2JCWA 4PN6A 3FT2B 3V5HB 4RCAA 1JPTL 3LKRA 4BELD 1NUNB 1XR9B 4PSPA 5EU6B 3F64A 2AJ3B 3CSGA 3BD3A 5GS1B 4GRWB 4ANXA 3MREA 3NCXA 1GC1L 4U6HA 4MJ6A 3H7BB 1RFDH 3GSQA 5EOCJ 3BRDA 4S10A 1U3HA 1GJUA 2XWTA 5KJRH 3IN2A 2VLJB 4KKLC 4XXCC 2VSMB 4TUOB 1PKQA 3GBNH 3LN5B 2DD8H 3U1QA 1IGIL 3KLHD 4EVNA 1B0RA 2ALWA 1WWAX 4YR6A 4K3GA 3RHWK 1RUKH 4KROD 2AK1H 4K7PH 2N7AA 5JIIA 3EH5B 2ED9A 2EDKA 4LKCB 3QRGH 3RI5K 1E5BA 3IKKA 1SJEB 4Y16A 3QG7L 1FO0A 3DRQB 1CYWA 5TQ2L 5CS7A 3KPSD 5HGBB 2IQ9L 4FL4B 2Y1AA 3AB0B 4XMKH 1TFHA 5IESL 3VTTA 1IGJB 1MUJB 1ZANL 4LDEB 4TM9A 3BEWA 3DBXA 2CIIB 1GOHA 4G7VL 4AYBA 3T0VA 1OOAA 4JFDB 4DN3H 5I0WA 3MUUA 1R46A 5I1JH 2Z34A 5IMOB 1B4JH 1NPNA 1E8WA 3EW3B 1ZV2A 4PVMA 1QEWA 1BFOB 4WGWB 1KJVA 5ICYB 1GZQA 4JZOB 4P46C 1HCYA 2A2QT 4S1RL 3ZE0F 3WS6A 4NRZA 1IT9H 1BQLH 4I8DA 1U8JA 5KUMA 2J88H 2K9FB 4Z7WE 3E1ZA 5AD0A 5EIIA 4NNXB 2I32A 4MQSB 2R2EB 3ALXA 2KQNA 1P4UA 4PG9A 1U3HD 3QXAA 4GKNA 1ACYL 1T1WB 3P73B 1PD6A 4AL8L 4KFZC 4CU6A 4IEFA 2B14A 3WG7B 3LVTA 4EI5C 2O61A 2OCJA 5DJ6A 2VNCA 1T21B 4NKIH 1BJMA 2A6KA 4Z78A 2YAQA 3SCMA 1MCKA 1Z9SB 3KYMA 4C54A 1N12A 4QRPB 3TO4B 3UL4A 1PD0A 4HFWB 4PJFB 3WNLA 2C3VB 2XETA 4OJDH 4P5MA 4Y16D 3MDJA 3S4SA 3SDCB 3U2JA 2WCPA 3MLTB 4FQ2L 3FH8A 1MW0A 1ESOA 3H9HB 1F4XH 4YVNA 5E6RB 3M86A 5AW5B 5DA0B 4DWHA 4OLZH 2XPZA 5HYJE 1RCYA 5TD4A 3DYMA 4X4YB 2XT1B 2WPGA 3SCMC 4LL1A 4ZMPA 2BDNH 3ZKND 4XE0A 2XVKA 3ABMB 1XH0A 3OKKB 1W0WA 5J06A 4J3VA 2HVKB 3GMPA 3ZQ9A 1SJMA 3P4MA 3C87A 3QHFL 2QQQA 4JL1A 1MFUA 5FKAA 1J1PH 1CC3A 4HT1L 1OF0A 1XV8A 4PLJC 1FIGH 3D2TA 2C26A 2D7TL 2O6CA 2CD0A 1AHWB 3D25A 4I0CC 1P5UC 1U58A 3CFNA 4K3DH 4MA7L 2O93L 4XO3A 5DEFA 3LRGA 5FYLH 5TE7L 4AXWB 3GIVB 3HB3D 1YC7A 2PWHA 2NY2D 3TBWB 3BZEB 2CKBH 2VDNB 5AKSA 5IEHB 3H4HA 1DN0B 2OCFD 3PHQB 5E9DA 1M1SA 5I8OH 1IGCH 3NA9L 5FO9B 2DQTH 1PBYA 1F6LL 4OZHE 2OTUB 5C0NC 1QRNA 2NPLX 3U4BL 4M8QA 4JFED 4PVBA 4ZXBA 2X4OB 5JHDA 4KNSA 3WJJA 4IMKC 3H9ZA 3FW6A 3KPTA 4ILDA 2RFXA 3L3GA 4XHJD 3K71B 5GGQL 2X4TB 3MV11 4YHKH 3F5WB 1MHHB 1W72L 4JKKA 2Z92B 3IE4A 4Z7WF 4G6AD 2FR4B 3V4PB 4FHJA 3VXOB 1M6OA 2AJZB 5B39B 5E0FA 2YAHA 3RE0A 4TQ8A 4X6DE 1ET8A 1L5GB 5CIPA 2XWDA 4K23H 4LU5H 3SY6A 2N1KA 4HSCX 2FLRT 3OB8A 3QQDB 3MGAA 1GPOH 2GCYB 5D9SB 4PS8A 3C08H 1RI8A 1XSIA 3SPIA 5ID1B 3T1FA 1YUHB 4AV5A 4BZ2A 5EU6E 4CL7A 2YJQA 5TGBA 2WXPA 2XV0A 4GRWE 4ZXBC 2PUQT 3OKOA 4QXVA 1ZLWH 2NY6D 2CDEB 5DVMA 3E1F1 5IKCB 4F33A 1A0QL 4H0LC 3IFNH 3HZKA 4L1SA 2HN7A 5I8EB 4NC1C 4G8EB 3SBPA 1KIUB 3QYCA 4KK8D 5E6SB 4X5WA 2UWEE 3F85A 2VOTA 4PP1C 5F97E 1AFVL 1QUNA 2D7PA 3ASOB 1A7RH 5EDXA 2GSIA 3CPLB 3VFNB 4H8WC 2EYRA 3PWUB 4E0RA 4PS4L 3BVNB 1JWMA 4KRPB 2OFQA 1BXXA 4P2OA 5E9DD 3WDIA 2OV0A 4DVRH 3APNA 4JANA 1QRND 2E7LA 5JHDD 4M93B 4XVOA 4FTVA 1PZUB 1FV1A 2WCSA 2ZUQC 3SOBL 1P1VA 2NY4B 5CGMA 5E08H 4UUJB 4KI1A 4ANUA 3JWNG 4JFDE 1LWJA 1INQB 4M1CC 3MRLB 5CZRA 1EAQA 2A9BA 1HIML 1S7SB 3HVDA 5DWUL 3HPLA 3U7WL 4QXTB 3IPEA 2LU5A 1BREA 3QVAA 1J7VR 5FYJL 4C4BA 4KUZH 1TNMA 5GHWH 1U30A 2BLFA 1VEMA 1HXYB 3HE6D 4RH4A 2E7LC 4LOFA 2C9UA 4KZDL 2J1WA 4PUBH 5GPRA 5AB0A 1WBXA 3TCLA 5KVDH 5AUMB 3LSOA 4TRPL 1G43A 1IKOP 2BCKB 3QQ4B 4KX8A 4RRPA 1MFVA 1J87A 2ITCB 3B7TA 4UT9H 3U4KA 4NLHA 2CGYA 3IDUA 4FQJL 4OZHF 5HI4C 3AM8C 3RILA 1NCBH 2H32B 2DM3A 1H5BB 2D4DA 2VR8A 4IDJH 3ULUC 3QAZC 1R17A 4LBAA 5E4AA 1KCUH 1U91B 2VDPL 2IQAB 3LS5L 5GIRA 4QRPE 1HOCA 3S6CA 4PJFE 1JWUA 3WY4A 3STZB 2W0FA 4DN4L 4QKTA 1OPGL 1OGAB 1S8DB 3EZ8A 4MA8L 4P2OD 4RGMC 3RA7L 4BK4A 5HPMA 4X6DF 3BPCA 3AFLA 3L95B 5GS0D 3VYNA 3G6AB 4MMYB 1T6BX 2NX5E 4M48H 4AJ0A 3KWWB 4HZLA 4FTVD 3KJ6H 4A37A 2A38A 3L3DA 4EQ2A 5MI0B 4G83A 2CALA 2QZQA 3QFDA 4GRWF 3WJLA 5ADPH 4ZZKA 5DD6A 2V2TB 1BPLB 4ENED 1T5WB 5DZPA 3MJ8B 4OH2A 3ZMEA 1PZ2A 3DX4A 4HG4K 5DJYB 5A2AA 5KBMA 2EDEA 4Q9CA 5BZDB 1HI6B 2V9RA 3ARRA 4XBPB 2PABA 1F8TL 1VERA 3IDGB 4B9FA 2UWEF 3NGBB 1NCJA 4RESB 3DX7A 4DZBA 1XGTB 2TRYA 3OG6B 3HJ0A 4ZW6A 4IJ3C 2ADJB 5IJCC 4G9FB 4XP5H 4LLWB 1AJ7H 3DETC 2G3XA 1J1OL 3HS8A 3PHSA 3WI9A 1HILB 1GY2A 2NQDA 1Q8MA 3IVKA 3WJLC 1AQKH 4PB9L 4HUXB 2F54B 1QR1A 4R84A 4XR8C 1KCRH 3RKPA 1D5XB 2ZCZA 4QRQB 3FHQA 4ZK8A 4PBWD 2NTFB 3BRFA 2X4PA 5HDRA 5BVPL 4MAYD 1T1ZA 1VHPA 4ONOA 2XVGA 4QRAA 4TVPE 1MXGA 1PZBA 2D73A 3EFDL 4TSBL 1L7IH 4G8IB 3HI6L 4NWTH 5I1LA 4LHUD 5CN3A 1NIEA 3MSPA 5I6PA 2XJKA 2I7SA 3FU5A 4R7XA 2MPAL 1N7MH 1KIRA 5DI8A 4LP5A 4EIUA 1K5NA 5D4QA 3N42B 5D93B 3G04A 3LPGA 5B8CA 1NLBL 2M83A 3LZOA 4I89A 1O7SA 4Q6YA 1FNGA 3OKDB 4PREB 4HCRH 1JHKH 1PD1A 2WZ0A 2JV6A 3WHE0 3D4GA 3K6NA 4ZI8A 5DJCB 2FNBA 2AAAA 2Q7YB 4B6ZA 4I9WD 3CZNA 2ETWA 4P9HC 4QXUL 3FYIB 3G6JB 2FL5A 4XMXA 2I69A 4GI9A 3ESNA 1F90L 4ZMOA 2JKTM 4O02B 1ZHBB 2P5WA 3MRGB 5CKGA 1OANA 1I9IH 1JWSB 4IKNA 4PS3A 4YFDB 1CJYA 2PPEA 2ZJSL 5B8CC 2OAAA 3JT2A 4PJFF 4UT7H 4R26H 3V6ZB 1CFQA 3WIFB 3II2A 1BZ9B 1FH5L 3L9RA 4POUB 5HHQB 4QO1A 5K9OB 4PU2A 4RDQF 1J0HA 3N85H 3GQFA 3VFTA 2X0VA 3PIQA 3MI6A 1XMWA 5DK2B 3W3BA 4N25A 5MEPB 1A14L 4ZNEA 3VD5A 2YAPA 2VDKB 4AYID 4EIBA 1IBFA 3C6LA 1LWRA 3PWPB 3WELA 2Y36H 3OXRB 3ZYOA 3GSXB 4FXGB 1HJBC 4HGWB 4L4TA 2KT6A 1PNCA 5SWSB 1FFOA 2JIXD 2JJVA 4GMTL 2E47A 4AYDC 4FXKC 5SV4A 1H6TA 3ARSA 3U82B 2VQUA 2VERA 2Q1EA 4QF1B 1N26A 4WGVB 3CFIC 4ZUWA 3PP4H 3PV7A 3KDPB 5B7EA 1RIVH 4YDVA 4P5TB 4RAHA 4UIMB 1HSAB 1MH5B 5FUZH 5SX4I 4DH2A 3ABZA 1FFRA 1SXCA 2WZ6A 4WV1A 1BOYA 1BX2B 2WMPB 2WO2B 4G2AA 4JFQA 5EU5B 1FF5A 5TE4H 3IBEA 2AP2A 5CLYA 1HINH 3JV0A 5LB1A 3ZT5A 4HS8L 1HN1A 1ED3B 3Q2LA 1RKRA 4LNRB 4UAHA 4XZUB 2GJZA 4AM0B 2AXGB 3N1GC 5FOBB 3KLDA 1RJCA 1DLHB 3UBXB 2D7NA 4QKXB 1V7NH 4JM2D 4LF3B 1Y7VA 4Q6KA 1XTMA 4FA6A 1VENA 4YPGB 1GKEA 2E3VA 3EIFA 4OCLC 4DO6A 5F7DB 4OKVA 1EWHA 2OX5B 1E65A 4UAOC 5I15L 3MRBB 3HCVA 5EO9A 2K4AA 4WV1C 3CVIL 3IAPA 4KTYA 4HPOL 1K4CA 1D5RA 4I48B 3C6LD 5IEKA 3RX7A 2JKNA 4HJGB 3CU1A 4PQXA 3U2IA 2W59A 7FABL 1UUNA 1X9QA 3F7LA 5DZLA 4F5CA 4L4TD 1Q9WB 1UFUA 1I8KA 2QHLA 5CJXA 1SYSA 1OGAE 1LQBC 2IMNA 4N68A 4ODUA 2IAMC 4BFGA 4TNWK 5ALCL 4PJXB 2KBGA 3U0TB 2R0WL 5DWPA 5F6HJ 2YD2A 2BO0A 3PDOB 1SMOA 4NJ9L 2XRAL 4AG4H 1T80A 2DLGA 1AGFB 4F20A 4LASH 4JGUA 1HHGB 2FYYA 4WO4B 1USQA 1YY8A 1AP2B 2IOMA 5IVOA 3GRWH 2X28A 3MUZ1 5I9QB 1NCCL 1SQ2N 4I5BB 1G7HB 3BIKA 5I1IL 4GSDL 3STLB 4U3CA 4EAEA 1E5CA 2A9MH 3QZOA 5IW1A 3L3HB 3F6IA 3V4VB 1NDGB 2FT7A 2N3JA 3RUGA 1A02N 3SHSA 1A3LL 5F3BB 3UYRL 3FQWA 1WWWX 4KV5E 1H9VA 4UQDA 4OCYH 5K1JA 5IVZA 4Z7QB 5IHHA 2XQYK 2AJ3A 1ZHLA 1MCPH 3CPUA 3B3BA 2WZPD 1S78C 3T0WA 2WSKA 1U3JA 2Y2WA 1BWMA 5L2JB 3VRIA 3IFPB 4YUEH 5EWIL 1SJHB 2F7OA 4W9FC 1ET7A 2PKDA 1U8PB 5D7KD 5C70A 3BKJL 2F54E 2VLRA 4IRSC 4NT6B 2V9QA 3RWEB 5MENA 1ZD6A 1AZBA 2BVEA 4PGCB 2CM6A 4JO1H 5BXFB 3N91A 3NABH 2E7BA 2EVIA 4Q9BA 4Y5YC 1EZVX 4WF7A 4MJIB 4ACPA 3RL1A 2ODHA 1ZDSA 4YBQC 3BFWA 4LKCA 5G55A 1N19A 1V3JA 3TO2A 1B0GA 3MOAH 1PFCA 3LKNA 3GIZL 1IC4L 2FIKA 1ZSDA 1RZKC 3FB7A 5KYXB 1P7QB 1YNTB 4IOIB 2YAEA 1QWNA 2NUTA 4LPYA 1CXEA 4XPTL 5IB5B 5ADOH 2K6ZA 2YRLA 3RWJA 3ES6A 1J5CA 1ZK9A 1WA1X 2VUKA 1T3FB 1SLUA 4WTZA 5CM1A 4TSCL 1OP5K 3D85B 5HHVL 4JHBA 1C5BH 1JJUA 3R06B 4HKXB 3ARTA 4JFFE 1O6TA 1P2CB 1UT2A 3G6JE 4I1RA 4AX3A 5DSCA 3AVEA 1BF2A 1W80A 4F2FA 4JHAL 3K8MA 4KBPA 1S4IA 2A1WH 5CU5A 3EOTH 2J55A 2EDTA 2ZWLT 3Q13A 1E5ZA 3QNFA 4KXZH 1ZK5A 5DMIH 4D0BB 3EDKA 3AGVA 1QI3A 1N10A 3CDGA 1YHPA 1OAZL 4FFYL 2EDMA 3BVTA 2AGJL 1S7UB 3GXNA 4NERA 1H3VA 2KPNA 4LEBA 1I8MB 3W0WB 5LN4A 5MEND 2VN7A 4LSSL 4M7LL 2VLJD 5AW8B 1OQOA 1HKFA 1FZOB 5HHXH 3RDJA 2BNQA 1V5JA 3AU0A 3PWPE 1RZJH 3O2DA 3CN4A 4FYRA 4JY5L 1D5ZA 2UV3A 2H3NA 4G82A 4YIQA 4FN0A 3K7UA 5DS8B 5GGVY 4DQAA 3GSOB 3K6DA 1NA8A 2BSSA 4L4VB 4NJAL 4WW1B 1DR9A 2AEIT 3UZQB 2H47C 2R2BB 1J9CT 4KAQH 3MBXL 5DHYA 3G5YA 3JZYA 5KYNA 1RZGB 4KV5F 1DUZA 2JI2A 2R69A 3VM5A 3VXQA 4EKXA 2MJWA 4LRNH 2C7UA 2XKNA 3FQ4A 3VYPA 1I1FA 3WY1A 2WWKO 3N40F 3HR5B 3PQYB 2C8NA 4EI0A 4L37B 5D7SL 4AUJA 3EO0B 2EDFA 4GKLA 3E80A 5A3ID 2VERN 3VVVA 5FB8B 4QGTA 4X8JA 4QHMB 5IW3A 4PJCA 2OP4L 4J1UA 1CD0A 2Y25A 4E9YA 4UQAA 3L1GA 1FVCB 3TBCA 2NW2B 3BP5B 2XIBA 4M5ZL 1BCIA 1FZJA 3BUTA 5JQIB 3EF7A 4MX7A 1HDMA 2JKLA 3DC0A 1D7CA 3FRPB 4GT0A 4BSJA 1HC1A 4J6RH 3WGVB 3ALWA 3LV3A 3MLZL 2ATPA 1TQCC 5I30H 3JTSB 4FQ1L 1DBAH 2LOEA 5EOCH 4PY7B 5BRQA 2BNQD 1OT1A 3AWFA 4ODSL 3S3SA 4NUJB 2GBAA 4UINH 4P4RB 1QO3B 3CBKB 4WJ5A 3BSZH 2C9SA 3U7YL 3UC2A 3QP3A 4LLAA 2OMWB 4QRPD 2ENYA 1FNLA 3FQTA 5F88A 5TK2A 5AW2B 2EE0A 4BCZA 2V33A 3H0TB 1WFOA 4PJXE 4NX0A 2D03H 2GTWB 3DHUA 5LAXA 5LDSA 3G6JF 1VACB 3RPIB 3L5WB 3SDCD 1MCRA 2X4OA 4BSWA 2IDTA 1USZA 4UOJA 2L0DA 3ILPA 1DSWA 4WWKA 4DKEL 2BIQA 1T6WA 2VL5B 4AIZA 4YFLI 5J1SC 4MRCA 3EAKA 3G5XA 2YD8A 3H3PH 4APXA 43CAB 4PV1C 1L5GA 2FWOB 3II1A 3QNXB 4MD5B 4P07A 1XGPB 3A24A 4HEME 1NLDL 3BN9C 5JHLH 2OMVB 1MCCA 4OTXL 25C8L 5H35B 3FN3A 1W16A 3JTTA 2LV4A 2DLTA 3IXAB 5IBTL 5E94A 4IDLA 3G08A 4NEHB 4UNIA 5T5FA 4P46B 5FM5O 2P52A 5F7AA 3JWDC 1KIUA 5C3TA 3T71A 1M7XA 2CRZA 4YSPA 3B7YA 2DKSA 2FO8A 3P11L 4M61A 2ADIA 3L81A 5HHNB 1S7QA 4MJIE 2ZTBA 4N2OA 1HH9B 2A73A 2DQMA 3M17A 5BV7C 5JW4N 4EI5B 3OL2A 5DO8A 1JRHH 3QWNA 3EFOB 1I7TB 1OD7A 4KO6A 1M53A 1N59A 4YSQA 5F9OH 3BAIA 2AXFB 2R0LL 2WTRB 4M8UA 3I75A 2PCFB 1PQZB 3VFPA 5CFAA 5D6DC 3UGEA 1KGCE 1KJ3H 1K4DB 4WWKD 3HNSH 2IXQA 5C0JB 5JDJA 1K8IA 5C08A 4BKTC 2BSRB 2J2ZB 3MRKB 4FQQA 1ADWA 3FQNA 4OSUH 1JZHA 2QVTA 3G7TA 4YN3A 4R5TA 4Q58C 3RIFK 1H8LA 2EXSA 3F7QA 1MY7A 3FO2A 4NN7B 1R0AH 4H7VA 3BDXA 4JPVH 4LCUA 3AT9A 3FQUB 1DJYA 2J8UB 2APTA 1EBAA 2QTEA 4XOBA 2CUMA 3U0PA 3UBFA 3W0WE 4PJXF 1RUAH 1CGWA 2HMIC 3BGMB 4WUKH 1XGYL 2GSGB 2E9JA 4GXVL 2H0EA 4OIIH 1MRDH 4IW4C 1OB0A 5JIHA 4ATTA 1YQVL 4IS6A 3HZMB 4P2AA 4ZW8A 1P5UB 1H8OA 3EHBC 3OKMB 1VEPA 3STZA 5KANG 4OJCA 1TU2B 1DQDH 4KKAC 3FMGL 4L4VE 4KRPD 4NFDA 3FTVA 5F6IC 2XA8H 3RU8L 1KWGA 2YQBA 3G9VA 3SDDA 4LSUH 3WN5C 2R27A 1QVOA 4XB3A 2GTQA 5JORA 1JK8B 2MKLC 3W2DH 4NQUA 3BPNC 3LOWA 4Y4HA 3QPQC 3MNVB 3ARQA 1DBJH 2NY4D 1NDTA 2HLAA 5LBSA 4HALA 4U6YB 1Q1JL 4NO3A 3PQYE 3BUIA 2C4FT 4F7PB 2V7NB 3QJHA 1G6VK 4XPHL 3L4CA 2YC1A 4LMQE 4XNQB 2B4CC 1KCLA 5DQJB 4U4IA 4JKLA 5AAMA 2OJ1A 3V7AG 3SDDC 1JXGA 4NWUL 2CBPA 5EHFA 1VDGA 4HH9A 3QWRA 3BE1H 4KJYA 1DJHA 1A3RH 4ZYKB 1LO2L 1NCHA 2XWBA 1KLGB 4Y4HC 3W81A 2H6PB 1J9QA 4CRPA 3DECA 1S9VA 3KL5A 2QEJA 4HIPA 1CG9B 3S7GA 5J6GA 1EHNA 2YD4A 1C9SA 1Q94A 1JTOA 1UGNA 1YNTF 2ATKA 3B37A 5I8CA 1ZXQA 4FYQA 3QIBA 2B1HH 1U0QA 1B4LA 5FO8B 3DX6B 1TETH 3E8VA 2EINB 4M6ML 2IANA 2OXGA 2ICEA 3PGDB 1I9RH 1UB5B 3KPPB 1G7MA 3K8LA 3N0PB 3IRPX 4PVLA 1EXGA 1NFDA 1E6OH 2ZOKA 2EDXA 2X3CA 5E2TH 1BFVL 3JWNC 1TJXA 1RIHH 1JZFA 1Y6KR 1BJ1H 4IGBC 4YDIH 4QHUB 1JMXA 4LCYB 1F58L 4CADA 5F1SA 2W60A 4HS3B 4DEPC 1YJDC 3MHZA 8FABB 2X1WL 1BLNB 4R83A 5CD5C 5DQDL 5HPOA 3CFKB 3DV6A 2YRBA 2WTOA 4N8CL 4XWOD 5TF0A 4DPBX 2ZUQB 3O45B 4NKQB 3NEXA 3EJRA 4NPKA 4ONFL 2Z3FA 1FFPA 4QRTA 5LXVA 3HG0A 2OTPA 2YK1H 1UZ6E 4DO4A 1MWOA 1EEZA 3EYVB 3WKYA 5CCKH 3KDMA 6TAAA 1ZHBA 1QBBA 3KLSA 3Q8EA 3QWRD 1AXTL 3LPFA 5JZ7D 4G9FD 1G9MH 4UYPA 1UWEH 2BVTA 2CHZA 2X3AA 2CUIA 4N3TA 1M05A 4M7ZC 3GSNA 1F4YH 4CNIB 3Q6GH 4W9ZA 3CBRA 3NJHA 3CH1B 4NQSB 1TQBC 3SGDI 4PRDA 5INCA 3C5JA 1GGTA 1KEML 3HG5A 4G43B 1V3LA 1NAMH 1E27B 2R9HC 5DD0H 4XBGA 5EC2B 3QIBD 3CMOL 3DUSA 1YEGH 3QUXC 4G1EA 3KL0A 1OTUD 2IAND 2V17L 2BJML 2ZUWA 2SEBA 3CZJA 4FXGA 1UOWA 4QAMB 5H37G 5SWSA 5LN8A 2FHCA 1DVTA 3QAZB 3T3MB 4K8RD 4FFZL 2YOAA 1VZIA 2ZUVA 3HG4A 4NO5A 1E5AA 4WW2B 1UKTA 3U2SB 3SQOL 3IFOA 1U2HA 4PJDE 2MCAA 4JRYB 2G0LA 1IGTA 5FM4A 3V0AC 3EH4B 1CQKA 2F7RA 4P5TA 2XBTA 3MRCA 1DUYA 2A77L 4G70B 5IK3A 2XZCL 1UXWA 1U36A 3WY2A 2WVVB 1U3NA 1YVLA 4L8BB 2EEFA 3BWAA 4N6QA 5E7BA 3SGKA 5CEZL 5EU5A 1T0NB 5EO0B 3VGEA 4TMPA 3OPUA 3MXWL 4UV4H 3UTTA 3DSNA 4LSPH 4NPYA 1JVOA 1ADQH 2I9LB 2PP8A 3SZKC 3UTQA 2A74A 3LY6A 1FVDB 2XN9A 5MHSD 2MOQA 1ITBB 3O3EA 2J8UE 3KPMA 1KB5A 5D55A 3OGOE 2P1YA 4WEBL 1DYZA 3H9YA 1WD8A 2WLIB 3L1EA 4GOSA 4XNYH 2QZ5A 3S37X 5F7EL 2EDRA 3WTYA 4ZUVB 4AIEA 3OR6A 5E1GA 3ZIMA 2CO2A 1KWKA 1AD9B 4BUGA 4KTEL 2MPVA 3OGCB 4GH7B 4QRRB 3SGKC 5CAYB 3Q44A 4A39A 5AW0B 4CVXB 3PWPD 3AROA 5D7IA 2VIRA 3SDAA 3LQAH 5IP4A 5KBNC 2P80D 5SWSD 2DQDL 4AYEC 2LQRA 1ZEAL 2A74C 3PJNA 1V10A 4ZBJA 3VJ6B 2VDMH 1IUZA 4NOFA 1NCIA 3O81A 5IVXB 1JZ7A 3SYAA 1UZ6F 1CS6A 1AGFA 3WTUA 3P0YH 3LB6C 2CO7B 3QJUB 4P5TD 3AQXA 2VXQH 4BDVA 2JQMA 4NQCB 5D1XA 1U8IA 3VCLB 2Y7QB 3DXAB 2FJFB 1FL3B 3FUKA 4WTXA 1KN2L 3MLVL 3ULVC 3SDAC 1QBLH 1HYSD 1YAIA 3HLAA 1JL8A 1THAA 3UOAB 4U1MB 3WFZA 1SY6A 4G6ML 1XGQA 4M6NL 4NC0B 2WCGA 4PV8B 1TMQA 4HUKB 3UTTD 2D9CA 2FJUB 3RJDA 3X1EA 3FZUC 3X13A 3FFCB 3EYSH 3ZHKA 1MRCL 1YG9A 3ATBA 1JIBA 2IJ0C 2XN9D 3QI9B 4LEOA 3NFPB 5MP6H 1GKOA 2JB5L 5DJ0A 3DGGB 3Q3GA 5FHAL 2NLJA 2WXQA 3IU3A 3FB8B 3WAJA 2WINA 4J3TA 4NT6A 4U1SA 1LE5B 2YGVA 5D1XC 4NO2B 1XF2B 3ZTNL 4WO0A 3P3RA 4FI7A 4LOUC 1EV2E 1BOGB 4OJFH 5KVGE 1A5FH 2Q3AA 4PJDF 3U4EA 2BSTA 1XT5A 3GHEL 1QWUA 5HXMA 1A3ZA 3EOAB 4WI9A 1DJZA 1MNUL 3CJJA 3GKWH 3WE6B 1OHZA 4HUWA 1Y1DA 2HJKA 2UZXA 3S35X 2FB4H 3DHPA 4B41A 4U1JA 4OZGB 2GB2A 5EU3A 1RZFH 4U1LA 2CK0L 2ZCKH 1EMTL 1MLCB 3MMEB 4RWYL 1OLZA 1UFGA 4I3RH 1UQSB 3ZL1A 4FXKB 1H15B 4WO4D 2E74C 2VLKA 4KJPD 3B5TA 3TNMB 2ORBL 1NCDH 1MFBL 2J8UF 1RJYB 3UJIH 5L0QC 4K5PA 4LCWB 3UCRA 1MSPA 1P2CA 1J9TA 1ZTXE 3S88L 4F8QA 4HWEL 2C9AA 4J4PA 3WTXA 1CVRA 3TA3A 4N2EA 4BM7A 3T1WA 3RX8A 3WIHL 4HSQA 2COQA 2PETA 1JV2B 3VGAB 3L1FA 4WHCA 3VI3A 2IPUG 1AZZC 2XXCB 1IAIH 3QR1A 5T1KA 3VXTB 5IV2B 4D0BA 2CBOA 2Y5TB 4DK3A 4WY7H 3BLKA 4BH8B 5KVFH 1NMBL 2R23A 2F5AH 4XCFH 1MIMH 1OM3H 5GXBB 2YN5A 2G2RB 2H9GA 1T5KA 3M1OA 5CJOH 3PRZA 4IU3A 2WWMD 5J4MA 3IKCA 5LQBH 2Z7WA 4TNGA 3L45A 3QDGA 1CBVL 4E5XG 4WU7A 3TA3C 5D1ZB 3ULUE 4GAAA 2AANA 4OZFG 2X44D 4P9MH 2Y7LA 2P24A 1DSFL 3Q06A 4KH2A 1KBVA 4HKZA 3QQ9D 4MNQA 3SE9H 4F24A 4L3EA 4LLMA 4TLTA 3R1GH 4WCYL 3P0VH 3WIIH 4O58L 1GH7A 2Y22A 2B5IC 5BZWB 3AXIA 2DBLH 1IBBA 4JRYE 1LEIA 1OW0C 1FL5A 2IAMB 4H8HA 1MJUH 1UVQB 2DTSA 3MRFB 4JAMB 1PX8A 1SHWA 1EEYB 2VLKD 3BFQG 3F2LA 4NQEB 1XF1A 4C58B 1VGEL 4FLRA 4U7SA 2QKSA 4KUCF 1DL7L 2GYSA 5A2JH 1KLUA 3VQLA 2JJUA 1GRWA 3V0VA 1QFHA 2NUPB 3DX1A 4N20A 1ZY9A 3EO0A 5AW3B 4B9ZA 1N5AA 5IW6A 4J4PD 4NGHL 3FONA 5C0GB 5SWQB 4ELKA 4N85A 1HHIB 1JZ6A 3WEMA 1XCXA 4MWFB 5JIQA 3RB7A 2YFOA 2ENPA 2VH5H 4IRZL 1MLBB 3BP5A 4JFZL 4MCZB 2AKRA 3F12B 4R4ND 4A7GA 1KULA 1BAWA 1HKLL 5DYOA 1CMOA 1G7PA 2RQEA 1UWYA 4LKXA 2G60H 1KLFA 2JELL 4YDZA 4ZFQA 5LWYL 1LQSR 1CDYA 4XN2A 2UX7A 4NCC2 1H8SA 3SYPA 3BUPA 1WHPA 2CLRA 3LZQA 4TNVK 1N5YH 1MJ8H 2XPGA 3QCUH 2PXYA 4QRRE <