3GZQA

Human sod1 a4v metal-free variant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
152
structure length
123
Chain Sequence
TKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biophysical properties of metal-free pathogenic SOD1 mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 29
structure length 123
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gzqA00
4BCZA 2C9SA 1YAIA 1XSOA 2WZ6A 2GBUA 1BA9A 1UXLA 1CB4A 2ZKWA 1BZOA 2WKOA 2WKOF 1HL4A 4A7UA 3T5WA 3KM1A 1Q0EA 1DSWA 1JCVA 3KH3A 1IBFA 2Z7YA 3PU7A 1EJ8A 1SOSA 1RK7A 2R27A 2VR6A 3CQQA 3MKGA 1E9QA 1JK9B 4A7GA 3GQFA 4L05A 1YAZA 2AQPA 1SXBA 1E9PA 1SPDA 2V0AA 4BD4A 4MCMA 3GZOA 1COBA 2K4WA 4N3TA 1SXSA 1E9OA 3HW7A 3L9EA 4MCNA 3SODB 2GBTA 2JCWA 1YSOA 3H2PA 2E47A 1XTLA 1QUPA 1OZTG 3ECWA 1MFMA 1Z9NA 2ZKYA 1L3NA 1PZSA 1OAJA 4A7SA 3RE0A 1HL5A 1Z9PA 3CE1A 4U4IA 1E9QB 2AF2A 2APSA 2WZ5A 1ESOA 1IBDA 1SDAB 2SODB 4A7VA 2WYZA 4FF9A 1DO5A 2JLPA 3S0PA 2C9VA 1OZUA 2NNXA 1F1GA 2VR8A 3F7LA 1KMGA 1SXAA 4A7GF 2WWNA 1TO4A 2AQQA 1F1AA 2Z7ZA 2AQRA 2WZ0A 2Q2LA 1B4TA 2ZOWA 3KBEA 1F1DA 2E46A 3HOGA 4B3EA 3KBFA 2AQSA 3LTVA 1PTZA 1S4IA 4OH2A 5CU9A 1SRDA 2GBVA 3GZQA 3L9YA 4A7QA 1F18A 1TO5A 2AEOA 2AQNA 1OEZW 1OALA 1IBBA 3KH4A 1CBJA 2Z7WA 2WYTA 1FUNA 3HFFA 3MNDA 3ECUA 2XJKA 1UXMA 1N19A 1XTMA 3GZPA 3QQDA 1SDYA 1EQWA 1PU0A 1SXNA 4BCYA 3F7KA 2Z7UA 3CQPA 1IB5A 2C9UA 1SXZA 2AQTA 1U3NA 5KBLA 3GTVA 3KM2A 5KBKA 4A7TA 1SXCA 1B4LA 4N3UA 3GTTA 1N18A 1JK9A 2XJLA 2LU5A 2ZKXA 1IBHA 3QQDB 5KBMA 2VR7A 4OJAA 1E9OB 3K91A 3H2QA 3ECVA 2WWOA 1P1VA 1E9PB 1AZVA
chains in the Genus database with same CATH superfamily
2DLIA 2PXYD 1JZHA 5JW4M 3CX5K 5CGBA 3CVHL 1U3JA 3FHEA 1A9BB 2NY6C 4BQ9A 1UXLA 2BS71 3AAZB 1ZY9A 3P4MB 4M4RA 2HMIC 1AZZC 2PW2B 2HTLD 1UOWA 5EIIA 2I9LA 5FYLL 2GYSA 4ONOA 3R0NA 4TOYL 1X5IA 4JJ5B 1L7TH 5J9PA 4HJ1A 5CWSA 4AM0A 4L3CB 4P5TB 3THML 4EZKA 3N55A 1XF5A 4NPKA 2WWMD 4MYPA 3X3GL 1PY0A 2YGPA 3W56A 5IJVB 2K4WA 2WLIB 2OYLA 3GHBL 5K69A 3FHAA 4P2QE 4IBWA 2WQRA 5G55A 3ULUH 4J8QA 3CLFH 2P9RA 2APTA 3VA2C 2YXWA 1U8LB 1E5AA 3ZZSA 3NJGA 4PTTB 1QR4A 3TONA 3VCLA 3S88L 4HS3A 3CSYB 2QSQA 3PNRB 1BFOB 1HL5A 5CSBA 4DP4X 5C9JB 2VO8A 3GWJA 1J8HB 1V7NL 2NXYD 3P69A 4FXKB 4K7PY 4WUUB 4GI9A 5AKRA 3RPIB 1MFBL 4PI0A 2YC1B 4PHZA 3IJ8A 4FNUA 4S2SA 2E4FA 3N43B 1OAXL 4PRBB 4KKCC 4JY4B 3N50A 2QFPA 3V5DA 1KY6A 3SPCA 4CADA 3RL2A 2X4OA 2BRQA 4HUMB 3ARSA 1GA2A 1FORH 2VM3A 3NABL 4KMTH 1OGAD 1G9MC 2E46A 2JMRA 3N43F 1J1XH 4WK4B 4WU5B 4TSBL 4ZFGH 4MNGB 1YYLH 3C60B 4H25A 2DB8A 3V0WH 4M6NH 3K2MC 3VU2A 4DPBX 2E7DA 4JFDB 5DJDA 4ZFFB 5HYSG 2FBRA 2FNBA 1O7DE 4R0LA 4OFQA 5I6XC 1JHLH 1MVFA 4OF5A 3FT4B 5JW4Q 2EKSA 3N1PC 1I8LC 4Z5RA 3PRZA 3BJ91 4F7EB 4HIEB 1ZA6B 3SDAC 2GY7B 1ZA3A 1KJ2L 2AK4D 3QDGD 3D0AA 5DVNA 5CLWA 2NR6A 2F54D 4E42B 3UC2A 3NJLA 1XGRB 2BFGA 3ZTNL 3N04A 1HESA 3ZE2B 1CDUA 1MH5A 2VDRB 4PJIE 3RY6C 3SEPA 1N18A 3MJWA 5F9JB 3TNMA 5JHBA 2VLJE 3C6EA 4OFKA 4A2EA 2YBRA 1UD5A 2CUAA 3S3DB 4M7JL 2Y7OA 1G7PB 4LB8A 4ZMZA 3QNFA 2XQBL 3SPVB 3U9WA 1FC2D 3C2AL 2FR4B 4RX4D 4WNSA 1CTOA 1Q0EA 3UX9B 1S7RA 2B2XH 4BGDA 4AYFA 4MCYA 2YC1A 5F9WC 1F11B 2X1QA 5EOTA 4G9FE 4QHMB 5IROC 5KVGH 3IDUA 4A04A 2C9PA 5JPMC 2VSKB 1ZT4B 1L3WA 1THCA 1VADA 3AQZA 4N9OB 3RY4A 4JRFA 4X6DB 3OR7A 2FO4A 4QRPB 5DSCA 4KI5E 2APBA 2X70A 2BH0A 4XCNB 4TPRH 4C83B 5E4EB 4RBPK 1RZJH 4GRWB 1BECA 4BSVB 3KNBB 1H9DA 4ETQA 4MASA 4IRSB 4JM2F 5DLLA 4AQZA 2JE8A 4ENZA 3IGAB 5J1AB 4FFYL 3F2LA 2FIKB 5I5IA 3PP4L 1A6WH 3PWUB 4R3SA 2YQGA 5DT1H 5FM5O 4AG4H 1GYAA 4Z7VE 1X3DA 2F74B 4XWOD 5L2KD 3NJKA 1KCUL 4GW1B 1JZ3A 1HE8A 1ZA6A 2RFXB 2FLMA 4M93B 1KTBA 5I1AB 2XV2A 1UD8A 1MJJA 3AWGA 4WHYH 5IK3B 2GJJA 3S0PA 3ETBF 1AD0B 3OHXB 4KO7A 2FTAA 5I1KH 2NNAB 1U0QA 2P44B 4PJGF 4JHVA 43C9B 1J9RA 4YHKH 2EVHA 4QR7A 4GSDH 5KJRL 3ZSTA 1HC1A 1G1KA 2GITB 1S9WA 4MJIB 1F1DA 5CMAA 1C12A 2YS4A 3EH5B 4Y16A 4XVSL 2XN9A 2CLVB 1AXTH 2X4OB 2YHGA 5F7EH 2GPZA 4Z18A 1N5YH 3GJFB 4HCRL 4X5PA 2XY2A 4HDIA 4WFEE 2QADD 2GHWB 2E76C 3MRMA 1FVCB 3CG8A 3V8CA 4ZXBA 1OHQA 5KSBB 3Q01A 4JFZL 2H47C 3II3A 1XGQA 2Y6TE 2Y2WA 3UEQA 5C9JA 2H9GA 3I3EA 1JYXA 3WSQL 4QRRE 3WS3A 1TNNA 2VNCA 3UBGA 4PP2A 4Z0BL 3N85H 3EHBD 3NSYA 2MEJB 2DIEA 3T8XB 1PJ9A 5T3ZD 1DVYA 5D71L 4AH2B 2XVBA 2EIKB 3FU9A 2R0WH 3U7AA 1XSKA 4XP5H 2NY5H 5EIIG 1I7RB 5IKCB 1DUYB 4LBAA 3SE9H 5ITBH 2KZWA 1FG9C 1BM7A 3BAEH 3MLWH 2GIYA 3AVEA 3FONB 1YAIA 3VW3H 3FOMA 3QCUL 5E8PB 4XI5D 5D7SL 2CIKB 3CN2A 2G0KA 4JRXE 2R0LL 2ZXQA 4IDJL 4HYTB 2UZPA 5I8EA 3VDCA 4ONGH 4IRZH 4M6OL 2A83A 2WLLA 4X5XB 3TH3T 5FPIA 2I69A 3VFRB 1PDKB 1EXHA 4NHUA 1OP4A 1FFPA 4XP5L 3QUHA 5F9JA 4H20L 3MJGX 4CSZA 1REIA 3FO0H 3HZ3A 3RDTB 5DMKB 5E6ID 3WIFB 4QRUA 3GSOA 4QXGL 2DQUL 3CIAA 4GAYB 3RVTD 3S3JA 4QTIH 1EZLA 3QORB 1I3UA 3T2QA 1T5XB 1NFIB 4KKAC 3HE7A 3CSBA 5D1ZD 4JRYE 1CGWA 1FZJA 4X6FB 5CJ5A 4TRPH 2ZP0T 2N0MA 3HG5A 4HWZA 4U1NB 2DQIH 4EUPB 3JT2A 3FO2A 3GJEA 2IO5A 1XEDA 2OMUB 4FI8A 4X9IA 1VDGA 5D72H 1YEKL 4PGDB 3RJOA 4XE5B 4P9HH 5KYWA 5AZ2L 4M4PA 1E9QB 3B9KD 2R1YB 1Q9KB 2VDKB 4G59C 1A7OL 4B9FA 2MJWA 2VTFA 4BH8A 2MH4A 4R2GB 4WSJA 4F33B 3DRQA 2QGDA 3H1ZA 3T65B 2YEZB 1PAMA 3JV5A 5ECJE 2F9BT 3MLYL 2OMZA 5EOTB 3BO8A 1FF5A 3L5WA 2HA1A 1WCBA 3IFOB 3F7VB 3N2JA 5D70H 3VGFA 3BUPA 3BAXA 1R47A 4HBCH 1LXMA 3K8KA 4OLUL 4J7RA 3UTTA 4CDHA 3S88H 3O4OB 4WY7L 3WL9A 5LKNA 2ICWI 4TMPA 1GS6X 3AXLA 2DYPD 3VE0A 3IRCA 3MA7A 1V5JA 4X6DE 1XXFC 1QNZH 3ROLA 1HDMB 3TYGH 4JZOB 1IX2A 4XCYB 3ME0B 1H19A 5AVXB 2ADYA 3T6ZA 1X5MA 4XNYL 2ZXAA 2DF3A 4B9GA 2PTTA 1H3GA 4Y7MA 4YE0A 3TVMA 7PAZA 4FC3E 3NRQA 1AGCA 4PJAA 1UWEL 2WLIA 1ODAA 2P24A 5I0WA 3R19A 4PRDB 1CD1A 1LYQA 3MTRA 4ZFQA 4BH7A 1EO5A 1E6OH 3JZ7A 3LKOA 4OZ4A 1ES0B 1AKJD 4LOEA 2CO2A 4ORZC 1EUTA 3CHSA 5JW5B 4NC1E 1TFPA 4F7CA 4PPTA 4M7LL 2X87A 3I85A 4HOWA 1IC7L 2OL3A 3P30L 4KJQD 4OUOA 4UILH 2BNUA 3HZKA 4J4PA 3WNMA 3LXBA 4ODVH 3M46A 2VDQL 2TRHA 5AWNH 4X80H 1NZRA 3KM1A 5GS0L 1U8HA 2KBGA 2F58H 2R4RL 3KPNA 4QRSB 3KH3A 1ZLSH 2AZUA 5DQJB 2BM3A 3MLSL 4DVBA 1SQMA 2PWGA 3FOLB 4PJEF 1AZBA 3T9WA 1DEEB 1CPUA 3DVIA 4Z7VB 1G7MB 3VXSA 4I88A 1UJ3B 3RUGE 2PYFA 3LEVH 3WFCL 1RUKH 5IBLD 3IDXL 3HEIB 2J5WA 4B50A 4GRLA 4OAWA 3STLA 3U7YL 5KYUB 5F7BA 1IM9B 1MHPL 4NUGH 1E7VA 1BAFH 4IU3B 1Q90A 3SYAA 4HAFA 4Z76B 1SVCP 3S96A 4Z7QF 3WJJA 4NOBA 4Y0GA 2KZBA 4HA1A 4NZRH 4Z95L 5FUCE 2XIIA 1C9SA 4CW1A 2CRYA 1G7IA 3U4AA 1EEUA 3IF1A 4XPGL 3KYMA 5MERB 5E6ZA 4PG2C 1Y7VA 1UT1A 4FQXD 1X5YA 1KXTA 2VXVH 2OR9H 3REWA 4MFHA 3NPSB 3SBPA 1L0PA 5DXWA 4H1LG 3V0HA 6PCYA 4M29A 1T03H 1JPST 5E03A 3D3VD 1HCVA 3BMVA 5FM5M 1MXGA 2D4FA 4PV1C 4WHTB 4JFPB 1CLCA 2FB4H 4PIBA 5E94A 2ITDA 4PU2A 4N28A 1L7TL 5K9KB 1N64L 3RP1A 1PD1A 2V3EA 4AY0A 3CAFA 5FUCC 4X7DC 2XUWA 3AS0A 3BO8B 2VJ0A 2ZF9A 3E3QE 4BKLB 1AR1D 4ZPVB 3V4VB 2VXVL 4OGAD 5AL0A 4WI6A 5ESAA 5LGYA 1INDL 3V55A 4X6EB 1K6QL 1KXHA 2OK0H 3NUKA 4XC1L 5HGAA 4NKOA 5JO5B 3TURA 4LDCA 3VGAC 1JJUA 4I85A 3ZSSA 3UPRA 5IB2B 1ACCA 1JZEA 1NDGA 1F42A 1I9RH 3NIGE 1MWOA 3S97C 4NNXA 4JFED 4P5MB 1S78C 2WLYA 5CD5D 4LOUC 1KIUA 4A6YL 4HUNB 2VRKA 2Z4QB 1BIIA 2R29L 1IAMA 1XDTT 4EZJA 1AZNA 1BGXL 2VM4A 1CE6B 3IMUA 3QUZB 1EHAA 3P3SA 5AOMA 5HVHC 1V7ML 5H37G 1DEEA 4G6FD 2OZ4A 1WF5A 4PJ9D 5D96B 5ACMA 3ARFB 2B39A 2Z92B 1FFNA 4MAYC 2FATH 5SWSD 2KUTA 4R7LA 4LLWB 3MMEA 3Q6FA 2ZKWA 1PVHA 1MFVA 3LMJH 2NX5B 4XPFL 5DVMA 1Q0XL 4FL4B 2I07A 1ZHBA 3WTUA 25C8H 2WBXA 3E6HB 5EHFA 5K9KA 1T0NA 1DJYA 3VGDA 1KB5A 1NLDH 3VTTA 1KB3A 4LGRB 4GQPH 4KROC 3ARBA 2J55A 3P9MA 4G9FA 3B2VL 1D2PA 1TCRA 1KGWA 4Z3HA 4NRZA 3MODH 5IV2A 3INUL 2PPFA 1DBAH 3MJ9L 2VDOB 3WIHL 4FTVB 3EW3B 1UYWH 3QPQC 2P5PA 1COBA 4G6AD 5B7MA 1BFSA 4LRIC 1X7QA 1J0HA 4ZD3H 1GJIA 1S7XA 2OLDA 1URZA 1W80A 4WO4C 1GH7A 2Y6SD 3JV4B 2BW5A 3A6BL 1OM3L 1F4HA 5AW1B 1BPLB 1HXYA 1D9KD 2NY7L 1NFDE 4NCC1 4L4VE 3VVWA 1QR1B 2YR3A 4OCWL 4FLQA 5HYQA 1RY7B 4Q58C 3FSVA 3BN9D 4OGYL 4UYQA 2NY0C 3B9EA 3GS4A 1I1RA 3S37X 4A7VA 1FG2B 2VXUH 4RISH 2BNRE 1HWGB 2F8OA 4ZUTA 1KMGA 4YHIB 1LO2H 3IDJA 3O8XB 3L7EA 1LE5A 4FG0A 3V2AR 4MKTA 4DP2X 2VXQL 2RQEA 3NRFA 5CD5C 1CDBA 5F1KC 4IW4C 1UACL 3U9UB 3Q0HA 3ULVL 3SDAB 5M7QA 2VXSL 4X5QA 3DUHA 3PWNA 4Y1AD 3SPHA 4Y8AA 1FCCA 3TNMB 4TQIA 1MIML 4PRPA 1E4XH 4Z7OB 1BWWA 2QSCL 3BVUA 3G5XA 1FC1A 4JEGB 3IDYB 4LESA 3HUJA 4I1RA 3MRFB 4N26A 4UT6L 1PQZA 3FO2B 1U3HD 1E5YA 2W9DH 1XZWA 1YY9C 4M02A 1G0XA 1A3ZA 3FAWA 1JHTB 2W5PA 3LZLA 4NP4H 4HUUA 4Q2ZA 4R96B 3O41B 5MEND 1N26A 2FL5B 3HE7B 1NBVL 4Z3IA 4AUUA 3BJLA 2FJGB 4OUUA 1UD2A 1GJUA 2H6UA 5TDPB 3SE8L 4F2MA 4N8VB 3QDJE 4Z0XA 4ONFL 5BV7C 5I1DB 4YL4A 2PXYB 3FPYA 3BISA 4AT6B 3NA4A 4LLDB 3C6LC 1WFOA 2GI0A 2R2BA 1EUUA 2NZ1A 3CZUB 3OL2A 4H25B 5AKSA 5HPMB 3L7FA 3VXNA 5F88A 3FXIC 2VR5A 2PW1A 4PM1A 1MW2A 3RFZC 2HLFD 4QXUH 4QHPA 1NCIA 5L4FA 5CCKL 1G6VK 5GS0C 1QBMH 2B14A 3GRWH 4IBZA 4U1SB 5IUCA 4W4OC 4JHAH 3GHPA 3O8XA 4GRWH 3FUMA 5TFSH 5F9OL 4G8GA 4TL4A 3IM1A 2FUQA 3UTSB 1JPTH 1HIMH 1TJXA 1JVKA 5ETUA 2YOCA 1EJ8A 2LGNA 3ABZA 4ZX6A 5CLXA 3IMSA 5DHVB 3CK0H 2ZE0A 5FKPA 4TOYH 3DJRA 3EUDA 4XOAA 1T0PB 1ZAGA 3TS8A 5A3ID 3QJRB 3QAZB 1V10A 3O45A 4XMKH 3PF2A 4X6CA 4ABVA 2FEDC 1BD2D 4XTRD 5C0GA 1G9ML 3FBQA 4XN8A 1MCNA 1E5ZA 4J8RB 2MTAA 4H88H 3EJYC 1QQDA 1QAWA 1AQDB 5EN2A 4NQVB 3FB8B 5I1CL 2EH7L 1WT5C 4IJTA 2F08A 3HAEA 1XZ0B 1EA9C 5DQ9B 4MWFB 3HR5B 4Z3GA 1E8ZA 1IGCH 3HKFA 1JZ6A 5CP7B 3FFCD 4X6FA 5ELIA 4W9FC 1QKZH 5AB1A 1I3VA 2KDYA 1OAYH 1UZ8B 3KEHA 3VFMB 3IJSB 3D0VB 4NI6A 5LAPA 4TQHA 3IDXH 5J6HA 1ASOA 1L9OA 4BK5A 4D8OA 1WCQA 4ZFFA 1GY1A 4Y19E 5FOBA 5G4MA 1U30A 1M2VA 2XFXA 3VXPB 4AGMA 2Q86A 1LNUB 1PSKL 4NQED 4WTWA 1OAKL 3KVDD 4W9LC 5J6HB 1XIWB 4LKCB 1NGXA 1IEAA 2ATPA 2OJEA 5FYJE 1KCSH 1G84A 2XPGA 4G6FB 1MRCL 1E4XL 2ZXEB 3DMMC 3GRGA 3VGEA 2WQVA 3WLWD 1JGLH 5F1IB 1INQB 1CJYA 2XOTA 3HLAA 1XEUA 5BRQA 1MCSA 2YN5A 3W9DB 3AS2A 1AS6A 1ORQA 1P9MC 3GSXB 1CMOA 2C7FA 4A6YH 1FE8H 1ZK5A 4R4BB 5C97A 5DK3A 1BIIB 2QVFB 4FOMA 3C6SB 4ZUSA 5GJTH 5I6LA 3Q06A 1CIUA 1I75A 1SY6A 2ENJA 2D7OA 5DMYA 4EI5B 5EU6E 4LOFA 2CDGA 4P5TC 3RWEA 4APXB 3GMOA 4JM2B 3SKOA 1NICA 5HVGB 4A37A 4XMLH 2ZG2A 2OL3L 1NLBH 3CQPA 4P23C 4PJHE 1C16B 2VDLH 3QR1A 3TBYA 2RGSA 4H8VA 3U2JA 3KPLB 4NT6B 4AOFA 3FQTA 2WBKA 4XPFH 4KTYA 5IY5B 3QRBA 4ZMQA 3QDGB 1AR1C 1CFNA 3CNKA 3HVNA 3DROA 1QI4A 1RIUL 2CO4A 4L8DB 2C8NA 1I1AD 3S5LB 3BYYA 4TUJA 4C55A 2BY3A 2IDSA 1H3UA 3DHMA 1S7RB 4XP9L 2E8ZA 4Z7OE 4HDIB 4V2CB 4D9RE 4IMKA 5IGXH 4K0OA 1DO6A 1CDHA 4MZ3A 2BVTA 3L3IA 2ZIDA 4HXAH 4MGXA 1G7QB 3NZ8B 2CHWA 5D71H 5EB9A 2Q10A 2EICA 4KOCA 3FQWB 1YEDA 3JTTA 4GUQA 2IF7A 4K07A 2X2JA 3ZZ1A 3MNVB 1S7TA 4DP7X 5ISZB 1S78D 1LP9B 4JREC 2R83A 1HE7A 5FYJH 5F3FA 3T3MF 3ARDD 3WD5H 4FZEH 5E6RB 3TFKC 2V8LA 2VH5H 5AVUB 3VQ2C 3KYOA 3PIQB 2VN6A 3V0WL 4OKVA 4B41A 2NXZC 4NNPH 2D31B 5DC2A 4XZUB 2JIXB 5HHPA 3QG6A 7FABL 3R06A 1DUZA 3T3PB 4F3FA 1QSEA 5EUKA 3SQRA 2X1WL 4HJGA 3VXMB 1IV8A 3TTYA 5CJOL 5DRZA 5C0BE 2NYYD 3EJPA 5KOMC 3WJMA 4NZJA 5K59E 3CFIC 1T03L 1BMWA 3JWOH 2D7PA 1TVDA 4TNFA 3I02A 3PABA 3UBFA 2DLFL 5I73C 1GZQB 1EFXD 1H3VA 4U3SB 4IMLB 5J5EA 2MPAL 3L7EB 2AQ1A 3LQMA 3D39E 1DVTA 1OTTC 3GFUA 1KWKA 1PZAA 3BPCA 1OWRM 3AG2B 2NY3B 3WFBH 5I82A 1WHPA 3ARED 1LK2B 1XT5A 5KVFL 2EUZA 1RK0B 2EEDA 1MG3C 1NC4B 2WTRA 1I1AC 3D34A 3GSWB 1Q9WB 3NA9L 3CHQA 2Y25A 3S37L 1ZSDB 1NGYA 4XC3H 3T77A 3BE1H 5IW1B 4CVZA 1F56A 1F90L 4YPJA 5LG1A 1IMHC 3BAJA 1IKNA 1KNOA 4F58H 2EEFA 3V4PB 3BP6B 3S4SB 4FG6C 2HKHH 2Y3NA 1VCAA 4ELME 3UG3A 5LN4A 1X9RA 4GAGH 5C08A 5JLZB 3UDWA 3ZUNC 5TQ0L 3D2UD 1IAKA 2HJKB 4NQCD 1URLA 2AS5M 1OSYA 1D2OA 2BOBA 3QH3B 4CKVX 2QSVA 1U3HC 1NKRA 5IR1A 1J5OH 4Z7UE 1CDJA 2AFNA 4L37A 2PN5A 3GBEA 4PJXB 5IQ7L 1TQUA 2BHZA 3MCKA 4NSKB 5E7BA 4DCQB 5I1HH 4KUZL 2E27H 5AZUA 3OSVA 5AUMB 4E41D 1QTPA 1PLAA 1T1XA 4NO5B 3M88A 4PJXA 3DSFH 5DK2B 4LT7A 4HS8H 3SQBB 3N5AA 1DBAL 3U25A 2E7CA 1ONQB 3RUGF 5IJKC 3I6GB 3LAFA 1SMOA 3V9FA 5GS0H 1TETL 1CLVA 3GJEB 5DHVH 4YSUA 2EQDA 5JW5A 3CDZA 4XN2A 2IANB 2EYTA 2KZKA 2WBJA 4AI7A 1L4IA 3T3MB 5D7KE 3QORD 2XWJA 3OAZH 4XVTH 1Q8MA 3DX1A 2BINA 4QRQA 4X6BA 3EAKA 1KPRB 3ATFA 2AI0L 3ETSA 5IW1A 3BUDA 2HRLA 2FK9A 1AR2A 4N0CC 1NUNB 2H2SC 3D51A 4UOW0 3SO5A 1FJ1B 2V2XB 5HVFB 1KEGL 1HYRC 5I5RA 4KQ0A 4AXWA 1NC4A 1TJMA 4UQ9A 5E70A 3S3BB 1XF2A 2DQEH 4XTRC 2XV6B 1KJVB 3SD5A 5BRPA 2VN7A 4MVBC 1HI6A 4DAGH 5E1GA 4LCCB 4PJIB 3HPLA 1BMZA 3BP5B 3U1SL 4YDLC 3TC9A 3HAEH 4YHML 3ARGC 1OY3B 3MROB 4MD0A 4HLJA 4B96A 5F7DA 4PG9A 1H8NA 4XXWC 3QXVA 2UX7A 1IAIL 1LDPH 4A7QA 5AAMA 1UB6A 4P48A 1QFUL 2VDOH 3HKZA 3MHZA 2IV8A 2IXQB 3FYIB 3CZSA 4X4ME 5FO8A 3ARFA 3NFPA 3ZE1B 3DPBB 1ADQH 5CNHA 2NLJA 3NJMA 5G2NA 2GB2A 4MCZA 1AGEA 1R3JB 3VXMA 4XP4H 1NAKL 1MCBA 2VDQB 3AB0C 3MZTA 3ZE1F 4WI7A 4JAMB 2D7TH 3OJDA 4OY9A 1RPQA 1P1ZB 3D4GA 3HZMB 3VD7A 1SLUA 5F7EL 3RZCB 3G5YB 1S9KC 1JI1A 1W0YT 5EFIB 2F5BH 2CM5A 3QCVL 3TA4D 5C0FA 3IBOA 3QJTB 2FSEB 5F6IC 4ZMYA 2G60H 3QRGH 2HRPL 4KZCA 1JN6B 2K9UA 5AW2B 5E99L 5FUZH 3RPBA 2E9IA 2KLSA 2ZWLT 4HEMA 3N85L 3IFNL 1WRFA 2YLHA 2A9CA 2NNCA 4KZDL 5JIHA 1N3NB 5K39A 3BEVB 3LPPA 2X4PB 2P52A 3VD9A 3FT3B 1SN2A 1EBPA 1MCWM 2P5WB 3DX9B 4RRPG 4F8QA 1Z3RA 3CK0L 3QDJB 1KPUB 5BQ7A 1JK9B 2BIQA 1MRDL 4HP5A 2VITB 2LR4A 3BLBA 1RIUH 2J2ZB 2ARJB 4HUXA 4GUOA 2IC2A 4XVUC 1U8PA 3BAKA 4EAEA 5D7SH 4YSSA 35C8H 3N91A 5F8QC 3C60D 2DWEB 1NCCH 1WZKA 5B8CB 3BHBB 1PKOA 1G6RB 3D1MC 5BJTA 2QHRH 3RVXD 2BK8A 4BZ1A 4LCVA 3ULSB 3RE0A 2WTRB 4GW4A 1O6SB 2B8OT 4QO1B 3TBSA 1KELH 3VX0A 4HK0A 5SWZB 2XTLA 2EIBA 2EIZA 5FA3A 1CYGA 2ZYHA 2QV2A 4L4TD 3V0FA 1HOCA 2DOCA 2IOIA 4PLOB 3I2CL 2L7EA 4D9QD 4ZO7A 4WW1B 1OZUA 3WXWL 2I9TA 3NYKA 3H4FA 5E9DA 3SJVD 1M4KA 4PW9A 5IBLC 5PAZA 2HVJB 1JWMA 1OAKH 1ECZA 1UXWA 3POHA 1UZGA 4YDJA 4ZTEA 1XIWA 4LKCA 1NPJA 2J6EA 2GAZA 1KV3A 3I9AA 5DUPH 3WEBA 5KS9E 1I8AA 4G6KL 1GL4B 3UC0L 4WVRA 3K1KC 4AC4A 5AVSB 2VDQH 4AYBA 3ZMEA 5ID1B 2NCMA 3DOSA 4YDNA 3WY3A 3KW7A 1CR9L 4AQEA 2XXMB 4RAUB 1SY6H 3NFNB 3MX0B 4M7LH 2IAAC 5JIPA 2X4QB 1QSFA 4FQXC 3SE4C 1SXNA 1OL0A 2EH7H 3FO9A 2B3IA 4PJCE 2VJXA 3PHAA 4YK4C 5DVLA 2ZXWB 2XBDA 5AYTA 1FPTH 2VXQA 3QJZA 5HHQA 15C8L 4OCYL 1IJNA 1FO0H 3QZMA 1AGCB 1OSZB 2O30A 5I1HL 1NMCB 5IVOA 4R83A 1XGUA 2DQTH 2AXGA 5SWSB 4R97C 3X14A 4DUXA 5C9KA 1AXSB 4MMXB 4L2YA 3VDBA 4J5VA 4HZ1A 1DSFL 3QUZD 5E08L 4H0LC 2NYKA 1N68A 5MP6L 5E9DB 2JK5A 2DI7A 2ORBL 2Z0UA 4ZJ9A 4JHZA 2M83A 5CKGA 4LCWE 1S9XB 4M62H 1NIEA 3WNNA 3EO1A 1N0XL 1WDAA 2XWTB 2LABA 1QNIA 4H8UA 3EJRA 5B1BB 4XMWA 5E6YA 5DEFB 1CFVH 4OF0A 3ZW3A 1NLDL 3NCYP 3ZR6A 4CBPA 3C8HA 1YZZA 4HMDA 5EU5B 2CA4A 4MMXA 4A67A 2YAQA 2B9AA 4HS3B 1K85A 5IEHB 1NBYA 3IU4L 5HPMA 1QPXA 4MA7H 5E6UB 2IPKA 4XBPA 3NZSA 3QIBD 3CHXA 1BJ1H 4YBLB 2JSFA 1NDMB 4UANA 3QZWG 1U93B 4X7SH 4GKSA 4GKZB 4F9LC 3CLWA 1CICC 3GT6A 3K7UA 4XGZA 3DUUA 4U1HA 3T0EC 1KPUA 1HCZA 1XF4A 3RVUC 4HK3J 1JWSA 1OAQL 1DQQB 2D7QA 4MAYB 4QDGA 4Y2NA 4IKKA 3DXAD 4Y16B 4KVCL 2R69H 3MRDA 2OZ4L 4FF9A 2ZCZA 4TQ8A 2X38A 5JIIA 1T7VA 1PZ5B 3UP6A 3W0WD 5GQBA 5IFJB 5HVHB 1SN5A 2DQFB 3N9GH 4KKAD 5T1LB 3SDAD 3MBXL 1YN7A 4HKXA 1DYZA 2BFVL 4OF7A 3TT1H 3LZPA 3PWNB 5GGRB 1I7ZB 1J1PH 4N1EA 3PWVA 1L0QA 1S2EA 2DLTA 3QUYA 4FKEA 4EI6B 4F7PA 5IK3A 3A24A 2AQSA 4YJZL 1BBDL 5L9DL 4ENED 1JWSB 1N6UA 4P2OB 1DQIA 3GZQA 2BX5A 2PKDA 5JA9A 1OTSC 3VFGH 1BVOA 4MDJB 3I6SA 4N90E 4GMSH 1XZ0A 2UXTA 4FHKA 4WCYL 5DQ9A 2W0KA 1AP2A 5H94A 1UD4A 2Z35A 4JCWA 4WO4B 1W2KT 4FI6A 5IHBA 4UU9A 3FF8A 1FVEB 2V9RA 4I87A 1EQWA 2IPKB 4XBPB 4L5FL 1E65A 3VH8B 3H54A 4YDVB 5K1JA 1FNFA 2WQUA 2ZUQC 3PWPD 3TWCH 2WO2B 4YLCA 2C9QA 2JELL 2J72A 4IIQA 4DZBA 1EMTL 1RD6A 3O4LA 3SDDC 5K9OA 2ZOLA 4OB5H 3CUPB 3QFGA 1W0WA 3RGHA 1AHWC 5A7EA 4DP1X 2B16A 3MRPB 3L5XH 4Q0XH 1T6BX 2YKKA 3QEHA 4UQEA 4OFIA 1WUNT 3VTAA 2QVTA 1RP8A 5L8KB 4GLRI 5J4MA 1R3IL 3VYPA 5CR8A 3UJTL 5CWSB 1BP3B 3ARFC 3D69B 1MAML 4AUYA 5C07E 4KI5F 1D6VH 5LUMA 3ZDYE 5FCSH 1IBFA 3UYPA 4AYGA 3CHOA 3K6IA 3SN6N 3QXAB 3S36H 4EVNB 1D5IL 1XGUB 1OP9A 1IARB 1QI3A 4DUVA 4DIXA 3DV6B 4WW2B 4LHUA 4L9DA 3TO4A 3BUQA 3FQRB 1K5NB 3T0EB 2CSPA 4MCMA 1QPPA 3VAEA 2PCFB 1FHGA 5F3BA 5EBWA 3GJFH 4YZFF 5GS2D 4OZFH 2QADB 3EBHA 4MWFA 1I8UA 3D2UA 5ERWA 2P80A 1XCTB 4HKBB 5TE4H 1DBMH 1TU2A 1X5JA 2VXQH 3DARA 3RTQD 4S0HA 3WHE1 4JO2H 3DOSB 2WWKT 1WFIA 5I8CB 4I89A 2JKRM 3I6KA 4PRPE 1E8XA 1XB6A 1KEGH 1NUGA 2VZ3A 4GKOA 2BIIA 4AGPA 5FHAH 1RSFA 1ZT4A 4AV4A 2J44A 2XQ0A 4MDIB 3EOBA 2XKUA 3IS0X 2GIXA 5DR5H 1TYEB 3IEAA 1DANU 3BP5A 3OWEA 4JRXD 4WFHD 3HZYA 1Q9LA 3GMPB 4FP8H 2ZG3A 3L3GB 2VSMB 5GJSH 5CU9A 2WLHA 2VERA 1RZGB 1O9WA 3M07A 3HRZA 4OGYH 2GJZA 3UJIL 3QEGL 2C3WA 3IKCB 2VKXA 5E9DD 1N7MH 1DJSA 4KTGA 4AE0A 2ED6A 3BPLB 4L5FH 3OG4B 3RDTD 2E74C 1CS6A 1MI5B 4XI5C 3A0OA 2OMTB 3MDJA 5ANME 2BSEA 3CSPA 3IF1B 4GT0A 4PRIE 1NBZB 2ZAHA 4HHWA 4M1CC 3RBGA 4AUJA 5J11B 5FB8A 4JPIA 4FQXB 5FWRA 4XCYA 1A47A 1RUQL 3O41A 1WV7T 4LPWA 1XWVA 1DQLH 3LYRA 4ELDA 4WFGD 1KJMB 1N59A 4BFGA 4LSRH 1RZ7L 3D39A 3U4BH 3I3BA 5ICZA 1T4KB 3P73B 4GP5B 2ADIA 2CH8A 1KENL 2G0LA 3C60C 3OG6B 1RZ8A 2EEXA 3PQYA 3N42B 3ECVA 3HUJB 5T1KA 2XA3A 1ZHLB 4BA8A 3WE1A 2HRPH 5JNYA 2G60L 3QRGL 4CGTA 2VABB 2BP5M 1XSOA 2Y07H 2IALB 2HRGA 1N6VA 1OARL 3LNDA 4NBYB 2BXZA 3MACL 2QZ5A 5ICXA 4KNQA 2D03H 4MXVE 5BRZD 4Y5XB 5LDUA 3HS0C 3QFJA 4HIXL 4MNGA 2HH0L 1Z9OA 5FEBA 3RA7L 3RTQC 1X9LA 3G6JB 4LIQH 3S35L 5J6SA 4P5TD 1P7BA 4ZMXA 4PJ7B 3FNKA 3FB7A 4M7JH 2CGZA 1FGNH 2ZPKH 4CADB 3PG2A 2Z9TA 2A77H 4YHIA 1B2YA 4IGBA 3QZWA 3WEMA 5J1SC 4LSSL 5JNYB 1X7SA 1J9CT 3HI6L 5IQ7H 2W91A 3QG6B 1WA2X 4E9WA 2XZQL 1GGBL 1FI8C 3N1FC 4A1RA 3IVKB 4WV1A 3QUXB 3RGVD 1WZLA 3VWJD 2C4XA 3NTCH 2IFFH 3LXAA 3MUY1 3BYTA 1TQWA 5H37A 4E5XB 3I9GL 4XN9A 3UPRB 3D52A 3INOA 3FTWA 1SJEA 2Z1PA 4TV3A 5F7WC 1LEIA 3WO3B 3ZQXA 1ZTXL 4PJ9B 1I8KB 3K0YA 4HJJH 2Z93B 3ARUA 4PSPA 4X8CA 4FA7B 1QRND 4WI3A 5CD3A 3PL6D 1XD1A 4ZTOL 5IJVA 1T80A 3QDHA 2W59A 2WVTA 2HLEB 1A22B 4KMLB 4PCTA 3ASWA 5FO7A 4EN3C 3VXRA 1M53A 2MQ0A 3BMWA 3E0GA 1MFCH 4HFWB 5DZOA 5F72S 1E3FA 3ZYIA 4RMBA 4OZIB 5DTFB 5ES4B 3QQ9C 2EH8H 2G3XA 1ET5A 3DTXB 2CHZA 3SGEH 1ZGLM 4U6VH 1AXIB 1HEJC 3G9AB 3ZTJH 2NQ3A 4JN1L 2W92A 2QV4A 1FA4A 1CICD 1UB5A 2H1LM 1D9KC 3MLZL 4MD4A 5T3XH 1A9BA 2N59A 1T22A 3F12B 3CDGA 2VCOA 4X6BB 4DZBB 4PCYA 3UO1H 4YFDB 1HH9B 3KH4A 4WNQA 2ADFH 1E7UA 4I48A 1X4XA 4BH8B 3VSTA 1JDAA 1G9NC 4ZXBC 3N9GL 4AGOA 1WS8A 1PU0A 2GC7C 5B7EA 1OE3A 1Q0YH 1XGQB 3UBXG 4O9HH 4H5SB 1EHXA 5JTWA 5B4MC 4B27A 3WFDL 4KU1A 4DKEH 3SCMB 4Q9QH 4B0MM 1QSZA 2A9BA 5AW0B 3QJFB 3OKMB 3EOTL 4EBQH 1DBJH 4Z78A 1NDTA 3IAGC 3ILEA 1G5AA 3W2DL 2FX7H 2UWEB 3BCFA 3HHSB 2CR6A 3VXSE 1I3GH 3HI5L 2IH3B 2Z65C 3MFFA 3TFKD 1MCWW 5GZNA 1DE4A 1ANUA 3R7RA 4IBLT 5DD5L 3O11A 5KUMA 4CL7A 4M3JA 3APDA 4KH9A 1IVLA 1N10A 1IIKA 5LCVH 3RUGB 2FHFA 4A7UA 2V7HA 1E4WL 1A2YB 3VFWB 5FV1L 3UYPB 2DYPB 4I0PC 2JJSC 3BH4A 4FTDA 3UZQB 2Z31C 3LN5A 4HIPA 2OXGA 4L4TE 5I8EB 4F7CB 5E95B 1RIVH 3L3IB 4A2DA 4AIXA 5DYOB 1TZIB 3MR9B 4N20A 5LAXA 5E56A 5JXAH 4PY8J 3WDHA 1N59B 5ICZB 4AKQA 3FB6A 2IQAB 3NN8B 4KY1H 5AW5B 2ZNXA 4HS8L 4YC2C 7TAAA 5EZIL 4LCWA 4P2OD 4XXDB 5FUOH 1VZGA 4RGMC 3L3JA 4HWBL 4EN3A 1ZXKA 4ONFH 4LLYB 2FRGP 4QRPD 1JZ7A 3WHXB 5IHUH 1B3JA 2Q8AH 5I6MA 2HAZA 6FABL 2LW3A 2YPKA 3MBWB 4XWGL 5L0QB 2XXCB 5GXBB 2WJ5A 1K3ZA 4JCLA 4PJ5B 2FJHA 2NMSA 1THAA 3WN5B 5BS0A 1MFAL 1NAMB 4Z76A 2CDGB 4EXKA 3QS2A 1LD9A 3L3GA 3UOAB 2OSXA 1EZSA 3OBAA 2OR7A 4HIHA 4XMUA 3TBBA 1P6WA 5DRWA 3VG9B 4MJ6A 4R4BA 4AVIA 4PW3A 1A0QH 2DQCL 4KHXL 3HR6A 1TO4A 5I8KH 4LCYB 4YSPA 4BZYA 2FWLB 3K5RA 2DQEL 1D5BB 1F02I 1TZAA 4JANA 5CEXA 5IVXE 2A9AA 3L2MA 3FCTB 1PL3A 3MLRL 4GSDL 4R9HA 3PAZA 5FF6B 5KJRH 4GKNB 4XBEH 1DBKH 5IVZA 5GRJL 5LN8A 3TBTA 3V7AG 5E51A 2WINB 5T1LA 3VFGL 5A2FA 4L0YA 1NPNA 1JRHH 5A6MA 1VIWA 5D1XB 2D2OA 1QO3A 3PQYE 4MJIE 2BCKA 5JORB 3HUJE 2FECL 4U1LB 1FGVH 1KXQA 5BZDB 1DP0A 3BT0A 3L1FA 4PIRF 4H2AA 3IMRA 1GYCA 3ARVA 4NIYE 1SXZA 3PYCA 4OIIL 3LKNA 3C6LA 4FFYH 4OFDA 1Y1DA 3WJLA 4OD1H 5GS1B 1FLTX 2ZUYA 2YARA 2HJFB 1QI5A 4TNVF 3GO1L 4FEMA 3FCBA 4ELMA 1BEYH 5I9QB 3WXVL 5KUKA 2JB5L 3WOVA 4OD2B 5GGTL 1GOHA 4Q0XL 1NGYB 5TE6H 4J3OF 3ZDYF 5IEHA 2XU9A 1N8OE 2L3BA 3BC9A 2F8XC 3LKQA 4D0BA 2IV9A 3SGKA 2H0JA 4BFBD 1OTUC 3W81A 2FWOB 3MUGB 2Q20A 3KCPB 3NSDA 3IJ9A 1ETZB 1H6FA 3ZHKA 2J20A 4WKXA 4NJAL 4F24A 4GINA 2D73A 1ND0A 1I31A 3CPLA 3FO1B 3MJ8A 4Y5YB 5LXGH 3QEHB 5I1GL 1DLHA 1RMFL 2GJ6E 2QVKA 5TQ0H 3TCLA 2WB7A 3P4NA 2VLRE 3GXFA 3BUBA 5SX4H 5E0QA 4WWKD 1OB1B 4Y4HA 1BF8A 4Q97A 4JDEA 1OSPH 4QJ4B 4AW7A 3TWCL 5JHAA 3OKNB 4MSWB 3RWEB 1DDHB 4APXA 1CBVL 1TU2B 2I7OA 5AOLA 3VRLE 3ARGD 1AO7B 4YXHH 4LGSB 4MMZA 5F7LB 1QX1A 3AU1A 4HW6A 1ZIBA 5F6IB 5DVKA 1UA7A 3NZHH 5EBWB 2WGXA 1YMMB 4HC1H 4LSVH 3QORA 5C09B 3MRFA 1LJMA 3D7PA 4JM4L 2DYPA 2Q8BH 2CO1A 3PAYA 4X98A 2EXWD 1ZVYA 2ZSVB 2I07B 1B9ZA 4FHBD 4UQ2B 4AW4A 2XI9A 5GGVH 3UFIA 2UZXB 3BPNC 3CXDL 1A6WL 4EDWL 1PPIA 1LQBC 2ZSVA 3KBEA 4YXHL 4WWOA 4RA0C 3SJVB 3CSFA 2VAAB 3KL5A 5JZ7D 4AEIL 3FOMB 2EIDA 3BPLC 3MAWA 1RJZA 4M8RA 4FA8A 2GJ6D 4HJ0C 4MJ5A 4Z78B 1KG0A 2IMMA 4S11A 1MUJA 2Y06H 4R3SB 2WUCL 2WY3B 3IAPA 1M3JA 1S7VB 2B59A 2YRPA 4EDWH 4BCYA 3OZKA 2PPAA 1U3NA 4KFZC 5D7JA 2R0KH 3LZQA 4JM2C 5DMIL 2BC4A 1GXEA 2XPZA 5BO1H 3FUJA 1TEFA 1FZKB 4FYSA 3ULUF 1UB6B 1AGFA 3W0WA 5HGHB 2GSGB 3FMGL 1FLRL 4UNIA 1DLHB 2IH1B 1D5XA 1RH8A 2ATKA 4BBWA 1RERA 1RUML 3GBNL 5HDWA 4PGCA 2WLKA 3ZLQC 4F15B 4BGLA 2ZUQB 3MLTB 4H1LH 2ITDB 1FVDB 4JPVH 1QRKA 3SBWA 5CEYA 5I1IH 4WJG3 1P5VA 1FZOA 2GEQA 5DO8A 3BD3A 5ANMB 2HN7A 3OKDB 3G6AB 4Y4KC 3WU1A 4EMZA 4O9HL 3V4LA 5AWNL 2ZUXA 4HBCL 1FJ1A 4UIMA 4FG6D 4FRWA 4NX0A 5CZVH 2UY7B 2AXFB 4P3CH 4MA8H 3BH8B 2AAVA 2FAUA 2OYMA 3V6FB 2VL4A 2BSTA 5I75B 4U7MA 3ISWA 5B7FA 3SY0B 3VACA 3ZTNH 4FG4A 2FL5A 2VW6A 4JKPL 4ORGB 2IG2L 3VB8A 4U1HB 5AZEL 1KBBA 4TVSa 2EC9U 1BZDA 4E9LA 1MFMA 3QZNA 5GS2H 5M94B 1NMCC 3FB8A 4FQCH 2Z91A 5FW7A 3ZE2E 4N0UB 2OJZH 5IQ9B 4TXVB 1K8DA 2CUMA 2PYFB 2FIRT 3RRQA 3E6FB 3DX3A 3L54A 4PRPB 4TSAL 4ABQA 2J57A 3F04A 1HEHC 4RVBA 4Z7AA 4WF7A 5MENA 2HPTA 1MVUA 1OB0A 3QDGE 1AGBA 1M7IA 5L8LB 4ADGA 5BRZB 3BIBX 3GXPA 4ZUVB 5I8OL 4DPCX 1J7VR 3GMMA 3AUWB 4ZQKA 2DRUA 3E80A 4D9RD 5JIQA 2IDCA 5IR1B 1NCWL 3QEQD 3OVUB 5AG8A 5EA0H 4JY6B 5ESVA 3CLFL 3NGBC 4XX1E 1SHSA 2CK0H 2XZCH 1QSFD 3BVDB 1XGPA 5I30H 5T3XL 4WO4D 3TF4A 3ECBA 4CU6A 1GGTA 3KL3A 2XBTA 3IDNA 3L9RB 3HI6H 3TBCA 3UYOD 2H3XC 3QCUH 4Z3JA 4BQCA 3FDWA 2AQNA 3ZDWA 2PO6D 5DZPA 4TQPA 3ZQ9A 5C0RH 1LO0H 2G9KA 5B21A 3QNZA 2I27N 5EPMA 2NNRA 5GGTH 5CGYC 2JB6B 1SHMA 3NIFB 1SDYA 1KWGA 3BN9C 4NO0D 2DJSA 3BZFA 3MV8B 4PJCA 4RGNE 3CH1A 4LPVA 1BZQK 5F3HB 5FECB 1RHFA 2XWJB 2X44D 5DLML 1N0XH 2OSYA 3FO9B 1LP9E 2K0RA 2OTUB 2AV7B 5AVTB 3SOBH 4AKPA 1Q4NX 3US0A 2R8SH 3RNQA 3BKJL 5E8DL 5KVEE 3ULVF 1WE5A 3APCA 3MOAH 1G9NH 3E6HA 4ZFOL 3NK4A 3ORJA 1MLCB 2PYEB 1R5WB 3U6XA 4FEIA 1CB4A 1RUQH 1NWPA 2CBQA 2UXGA 1ID2A 4CVUA 4JK0D 1HHGA 3VWKA 1AFVH 1QRNA 4H8QA 2YJQA 3MFFB 3QUMA 1ZVSA 5DF0A 2PO6A 5FW8A 2KLTA 2R4SL 2K8QA 2YGOA 4YHZH 5FHBH 1R33A 1OPGL 3B83A 3OMIB 4EI5D 2BFVH 3C6LD 1K8DB 3OGCA 4ACPA 4KKRA 1TJIL 4HFUH 1E6JL 4N8UA 4XC1H 3JTBA 1HH6B 1X5XA 2EIZB 2OZ4H 2ADIB 4JHWL 3P73A 3LDBB 2QPEB 1NJ9A 2H26B 5FA3B 4RGOH 4U1NA 5HY9A 2OMWA 4FXKA 2ESVB 3LKOB 4P8QA 2BWQA 1RFDL 3M7FB 1NIFA 5D8JL 4PS4H 2BNRA 1LEKB 5EORL 3DX7A 2AJVL 3A6CH 1II4E 1CF8L 3B9AA 2FT6A 4J12A 2QKIC 4JQVA 3IBEA 2E6PA 2EAEA 3D85D 3BH8A 1CYXA 4RFEB 1SEQH 4TL5A 2J88H 4U1JA 4YWGH 3BVNB 3W11D 4IDJH 3WCYA 5DJ6B 3EHBC 3ERXA 2HVBA 4PY8I 3HZVA 4WJ5A 3QG7L 4L4VB 1RK0A 2G2RB 1YNLL 2HFGL 4FLHA 3TIEB 5I8KL 2P5WD 1TTUA 1R24B 3MLXH 4WJ5B 1TJGL 4PJBE 4B3EA 4BFKA 1G4RA 3UZEA 4M5YL 1D5XB 2EIMB 2IH1A 4F7MA 1X6NA 3P0VL 4MS8D 4R7XA 5GSRA 1I8IA 2L04A 5JUEH 4LNRB 2J8OA 4AEEA 3CWGA 1JTPA 4PJ5E 2R69L 5T3XD 1DVZA 1LWHA 1M7IB 1VPOH 4CW1B 5GIRB 2EKJA 5I19L 5I6PA 1IFHH 3I84A 1CGSH 4XN1A 1HILB 3ZDXB 1TDQA 2Q8AL 1A65A 3C5JA 2ZJSH 1FHNA 2VUKA 4UU9B 1ZV9A 4LOVA 3SDXE 3OJDB 3OAYK 2CRZA 2IAND 3KM2A 4J2XA 1JBJA 2VDNB 2G4GA 3LOWA 1ULVA 3VRIA 2P48B 3VYOA 3C5JB 4QRAA 3GMQB 5I71B 4HIJB 4MCZB 4B7IA 3FU7B 3HS9A 1G9NL 2E9BA 1EO8L 3BAYA 3GRBA 5GIRA 1I53A 3HVDA 5GRYA 5TPWH 4AL8L 3F12A 1G7HA 2OZNA 5FOBB 3GLEA 2QKSA 4KTDH 3A22A 1S7TB 4KQ4H 3S6CA 2X4RA 5F7DB 3BQUB 4P23D 1KT2B 3LEXA 4NJ9L 3M17B 2IBZY 1FO0A 5JXEC 2HJKA 2EINB 4CGUB 3QRFM 3TEWA 4LF3A 1V7MH 5EEYA 3WTYA 4V11A 4PJDA 2QR0A 2YAFA 3DUUB 4JO4L 5GHWH 2ZPKL 5D1QB 1MFDL 3VSQA 5IIEA 3GPEA 4O5LL 2WQXA 3PUCA 2R1WB 3NVQA 5C0DA 3FT9A 3UG4A 2DKMA 5I1EL 4YR6A 2H8PB 4NM4H 1PZDA 2Y36H 2YKLH 1I8KA 1RLBA 1KACB 3T1FA 3TO4D 5IP4A 1N6QL 3FQTB 2VW4A 3H9SD 1CDYA 1KN4L 5E2UL 2HXAA 1LGVA 1FWXA 3LH2H 2VKWA 3QR2A 5GRZA 3VFSA 5BUGA 2X9XA 2YN3A 1JP5A 2FBJH 1LK3L 1H5BB 3CZFA 3QFDB 5DDHB 2ZCKL 4NXKA 4Y4KD 4PJ7F 5LBVA 3NAAL 4N86A 1BAGA 4PB0H 3UTPD 3VDAA 4P5SA 4RWYH 2V2WA 3I50L 2C9VA 3MSPA 2GEEA 2ZNWA 2FR4A 2GT9A 2YAOA 2LV4A 2VLJA 4JDVB 2WWNA 5E1IA 5IW6B 2WO3B 1CFTB 4TLUA 2G2NA 3V8OA 3ARYA 3BPOC 4G43B 4JFFD 4PJHF 4JO2L 5AL8A 3VXNB 1VJSA 1MLBA 5FIEA 4P59H 2MKLC 5E1QA 1J0ZA 5IFHL 1XGZA 2PWFA 3UAJC 5KS9F 2EZ0D 5E2TL 1OLZA 1O0VA 3FPXA 1MWAL 2AJ3B 2ICEA 2BXYA 1XGRA 3CFBA 2Z7WA 5HJ3B 2Y22A 2FJUB 2ESVE 1EWHA 1OF2A 3VFPA 4G2AA 4XHJD 3OJVC 3QO0A 4JY5L 5HDQH 1P4LB 1KPVA 2J8UF 5DEZA 1AO7D 5D4HA 4G8GD 2C1OB 4XAWH 4C56B 3ZKNC 1GGCL 4UINL 4TNGA 3DIFB 3C5ZB 2E7LC 4XXCA 4NWTH 2HG5A 1NDMA 2MNUA 2RH0A 4Y2DB 1A7NH 2VJ8A 1BAWA 2C9XA 3ENEA 2KC0A 5DMKA 2VWEE 2PTTB 2J1YA 3X12B 4LHUG 1VFUA 4E9VA 4PJBF 2WLLB 5DU7A 1AZVA 4XN7A 3SDAA 2QQLL 3BP7A 2C9SA 3AREC 1JWMB 2OCFD 3MUJA 4HAGA 3EYSL 2Y24A 5F7UA 4H44C 1BA9A 3CXHJ 1MF2H 3EF4A 4NYLB 5EU6B 5LBSL 5I1IL 1IC4L 4RAVB 3WY2A 4EZMA 1Y6NR 4YPGB 4PW4A 4R0LC 3W39B 1K2DA 1E2WA 3MRNB 1PAZA 3AITA 1Q72L 3S5LG 4EN3D 3L6FB 4YDIL 5SWZA 5F7HA 1JHKH 3CUPA 5GS1C 2KERA 3PL6C 1SQ2N 2ALAA 3T4AA 3HBPA 1U2CA 3M6DA 3KWTA 3P3TA 2VWEC 1KUMA 4Y1AA 3Q6GH 3WFHA 4MQSB 1M7DA 4R4FL 3HE7C 1IUZA 4NFCA 5CBEA 3PXLA 4M6NL 2R0KL 3QQ4B 5K9JH 1UKQA 4G1MB 2YUVA 5D1QD 5F9OH 4UZSA 3RWDB 2D7TL 1YUKB 5E5MB 4F57L 2CLRA 4OGAC 1AJ7H 2HG0A 1EHKB 3SSGA 1JE6A 2R2HA 5D5MF 4Y2LA 1KBPA 3RI5K 4Z9KB 3WNKA 3ZDZB 1WFUA 4NC2B 4UT6H 4ORGA 1MCPL 3VA6A 2BZ7A 5F1IA 4MQXD 4JO1L 1U6AH 4F5CA 1GYVA 4DEUA 3RU8L 3UYRH 4Z5RB 2JLPA 2IAMB 3WIFA 3A4DA 4RLDA 3P2TA 5J56B 4U3HA 4TVPD 3JWOL 5AYUL 5GGRA 2Z8SA 1CL7I 1PG7L 1PX8A 4NAMA 5E23A 3WBDA 2R51A 2RALA 3ILQD 4GRMB 1EFXB 3JVGC 3SDCC 5JYLA 4KUCF 4JCMA 2W9EH 1MSPA 5BVPH 2V5MA 3QI9B 1NCTA 3WMPA 3QK0A 2P8MB 2DH2A 5E0FA 4IU2B 2H2PD 3DHJA 4UOZA 3HE6B 3NEEA 1AYRA 4PLKD 5CR1A 5D2LB 3WKQA 5ABZA 4FQ2L 1HIML 2MNWA 2L0DA 3QQ4A 1WIUA 4PJ7E 5EU4A 5BV7H 3EDFA 4JG0H 2AABH 4PQXA 4QHKI 5KBLA 2YPKB 3MBWA 4AZ8A 2FO4B 4QRPA 4X6EA 3II1A 3CVCA 3JV4A 1KELL 4KROD 2MQCA 5FWQA 1GC1H 2COVD 2N7SA 1WK0A 2XT1B 1TPXB 3C5ZD 1L9MA 3Q5TA 2EEAA 2R1WA 3MV7D 3P0YH 1HHKB 5C0AA 3VI3A 4R6UA 3J27A 3U48A 1JZFA 3LZFH 4LMQE 4P5TA 1NCDL 1RJZB 2ZICA 4B9YA 3Q8CA 1HI6B 1IGML 1B4JH 2A74A 3HG4A 4OIFA 1M57B 3P0GB 1BWMA 4YHLL 1T89C 4GBXD 4WGVB 4GAJH 3BRDA 1AFVL 3H9HB 2XZCL 4IK7A 1U95A 5I30L 3UACA 3ZJAA 5LGKA 4YZFE 5AVZB 1P0SE 3OD3A 2VZOA 3PWVB 3D4YA 3O3AA 4K5OA 4L9LB 3GI8H 4LPYA 1GPOL 1U8QB 2XN9E 2HVKB 3PP3H 4QXVA 4PJ9A 3PWPA 3QZBA 5K33A 1DN0A 3ESOA 1VZIA 3OAZK 4JL1A 3TA3C 5K5YA 1P4IH 4EF3A 2EDBA 3FTXA 4XBEL 5ALBH 4UT9L 1E4WH 2V5RA 3KLKA 5IMOA 4IOFC 3GMQA 3ZBMA 1PX4A 4D0CA 4DOHE 3CDZB 3LMJL 3SY6A 5IMLA 4BEIA 1L6XA 2D0GA 2JLLA 4JFOA 4W6WB 4GKZA 5FXCH 4LARL 1ZDSA 5CINL 3BFWA 4JQVC 2E86A 2WCSA 4ZUWA 3RWDA 3KLLA 2HJLB 4LDEB 3R18A 3DI3B 5JOEA 5F7YC 3HC4H 4JPSA 5DJ2B 5DJ8A 4YWGL 1YPZA 5CBAB 4P46C 2NUPA 2VH5L 3Q2NA 4HZLA 2VMFA 4Y1AB 3WFHB 1DO5A 3X3FL 4KRMB 4ZK8A 3CDGB 3KR3H 4DSYA 1ZEAL 1P69B 1YN6A 4NXSA 4ZS7L 3WGUB 3IGKA 3B2PA 3ARZA 3FCSB 4HSAC 4GQ9H 3GRWA 2X09A 1LE9B 2XTJB 3FO1A 4FE9A 1FG2A 3RY6A 3DTDA 5J11C 4L8CA 4N0FA 1UG9A 4C54A 1SRDA 3GSNB 1GW6A 4YHMH 3T71A 3C2AH 2YA0A 3CJJA 5F7KC 3ATEA 1AXSA 4KDVA 1IEBA 4Q6KA 1F45A 1XF3B 3NP4A 3OLGA 1UTDA 5AAPA 1XSIA 7CGTA 5BO0D 3ECUA 3KPMB 2DWEA 3UG5A 3QXTA 3BUTA 2GG1A 3LKPB 1EAOA 1MCQA 1ZTXE 1V05A 4I77H 5C0DB 3CFJA 4TTDD 4G8EA 2ARJA 3A3YB 3CCHA 4HUXB 4UTAA 4BZ2L 4K5NA 3GUFA 3JWNE 4G8FA 1GMIA 4OM1L 1J05B 4Z8FL 2EYTB 4RGMB 1NGQH 1JGUL 3KS0H 5BV7B 3SDDB 4PJEA 1T0NB 2XIBA 5I76A 1GRWA 1M9WA 5TPWL 5HHNB 1K8IA 4X5RA 1NOLA 4HCFA 3V52L 5I1KL 3T6QC 2KS0A 4JRYA 1LP9F 1U8MB 1FAIL 2R2EB 1Q0XH 3ABLB 1M7XA 1WP6A 3SYOA 1NCOA 1RHHB 3MXWL 2J8UA 1A6UH 3W5MA 2O6PA 4NQUA 3DRQB 1BOGB 3MYZA 1ED3B 5DJ8B 3ZZQA 5CBAA 3GUTB 2WWKO 5D2NC 2DM4A 5JHMA 5KZCD 5ICXB 1TZGL 4PD4K 3QYCA 4OI9A 1E2VA 1VFBA 4JGUA 1AC6A 2ZAGA 4IBQA 4NIKB 1KXQE 2DAVA 1E9PA 1KENH 3EOYG 4R26L 4XNXH 2V5SA 4PB9L 1EAQA 4IOIA 4WW2C 2PP8A 4K3HA 5TE7H 1WZ1H 5D96C 4KITB 4L8BA 5KVGE 5FM4A 3GPSA 2DMCA 1TEGA 2UUDK 2Z8WC 5C7XL 3EDEA 3Q7JA 3MRRB 5K9QG 4WEEA 2Y4SA 2MHAA 3EH3B 3FQRA 4TUOB 4HGWB 5B8CA 4BUGA 4YUEH 1EHLH 2QHRL 5KVGL 4K73A 3RDTA 2NY2C 2KI6A 4AEFA 1I8IB 2PWHA 2VQUA 3QNXA 4QJ5B 4R84A 4YE4H 2FYVA 4PG9B 4YGVA 5F89A 3U4KA 4WTXA 1U8PB 4PCKA 4CKQA 3L13A 2VLLA 4PRPD 2WVUA 3FSOA 1OV8A 3SE3A 4RMWA 5BUAA 4G3YH 4NQSB 1F2XK 3US9A 3HRZB 4HCIA 1YYMH 1A7BA 5CEYB 5C2UB 2FWUA 3MRKB 3ZHFA 4Z3TA 1N4XH 1KY7A 3U46A 3V6ZB 2NY6B 2J6EH 2FX8L 4KZEH 3L5WB 3GSQA 2XDHA 3A5VA 1AAJA 1TENA 1C5DA 3AJ7A 3FZUD 3TZVB 1MRFL 3AMLA 1AQHA 3JXAA 4P2YA 3B5TA 1CGVA 3H9SA 3WS6C 2YEZA 4X9YA 4K7FA 3KPSA 1KDIA 1QKZL 3BSGA 3BWUF 5DVPA 5LHDA 1P2CB 2HFEA 1OOWA 3I6KB 2C1PB 3WS3B 1TF4A 4E5XG 2R1YA 4Z7WF 5CZVL 3EADA 2Z31B 3WFZA 3NH7L 4PJGA 5KSBA 3O2WL 4ERSH 3CTTA 2HUHA 5D6DA 1ZJBA 4GP8B 5EWIL 4XZUA 5HHPB 1N0LA 3VX1A 1PEZA 1MEXH 3AY4C 3ZHLA 4NZDA 1SJXA 5BZZA 4Z7VA 3S4SG 1A7OH 4JPQA 3FUNA 2HX9A 2K45A 4HALA 1FNAA 4WK0B 4XX5A 4GEJA 4OV5A 4PJFF 1FORL 1FRGL 2N01B 2XWBB 5CMAB 3QHFH 1EFXA 3LS4H 5D72L 2LAGB 3D9AH 2HVKA 1KJ2B 3ESNA 3DK2A 4CN1A 2F68X 3DBSA 3GDBA 3JBG7 3KHOA 4HHGA 2NNAA 4QT5A 5KOVC 1XH3B 4JDTL 2CO6B 4P2RD 3N41B 5HGBA 3ALPA 3KYKH 2BP8A 3QIUB 4I9XA 3V6ZA 5T1KB 1UGKA 1W9XA 4KI5C 4M43H 3BGMA 2CIKA 1RK7A 4YDIH 3MKGA 3QCVH 2C7UA 4YEFA 3GQFA 1AKJA 3VXRB 1QNZL 4PGCB 2R7EA 2CCVA 3FTVA 5KJ7E 4FGMA 4JDZA 5KZCB 1IGYB 2UY6A 4X8JB 3SDCD 4AGQA 5TK4A 4GW5B 4N2KA 4JPVL 1BM3L 4O2EA 4WY7H 1NFAA 4AH2A 3LNIA 4FNQA 4ENEC 1QA9B 4CVZB 5CZXC 3U7WL 4NHCH 4N8PA 5EEXA 5DSCB 2JKIS 1WWBX 2YUZA 1QHOA 1R0AL 4JZOA 1MQKL 4XVJL 3NESA 4EIUA 5J89A 3E8VA 2GJZB 4QRBA 2FCBA 2BDNH 3VWKC 5A7BA 3HBZA 1ADQA 1Z6JT 4CDGC 5J13B 1O6VA 3QZWB 2F19L 1WZAA 2IDTA 2R56H 3NIGB 1YNTA 2VDKH 1E4JA 4N6QA 1G7MA 1SEBA 3EFDH 1WEJH 4Z0BH 4KKQA 4LLMA 3NOIA 1ETA1 4IOFD 1TVBB 2H3KA 1CZ8L 4P2AA 1KFAH 3K81A 4F93B 3BKCL 1J1PL 4TNEA 5EZOH 4DCQA 4R7NA 5EF2A 5DRNA 4GKLA 1OP5H 5DMJB 3MVSA 5F44A 2XTJC 3PGFH 1JXFA 1QTYT 1A25A 4JFEA 1OSZA 5HHNA 4Q9RH 1QBBA 3L16A 2RR3A 5I0YA 1H6UA 2PWDA 4KDTC 1IM3B 5HHMB 3ZMRA 4PVBA 4X7EC 1OAUL 1T1YA 4RSVA 4ZFZA 1B6UA 3LRKA 2X9ZA 3D2UB 5ERWB 1TMQA 2PF6A 3UTQA 4B5EA 4BFIB 4O2FA 3UTTD 2X4NA 2XIDA 1SUJA 2XBZA 3PXHA 3EKCA 3GKZA 1F3JB 1UURA 4X7SL 4LSVL 2J4WH 2BCKB 5JORA 3T8MA 4F7EA 3V6FA 4ZYKB 4WUKH 1E6JH 4QHNB 2YRLA 1KF9B 2OP4L 5ISZA 4JFEB 3UJJH 1KCWA 1DBKL 1JVOA 1OAQH 4GG6E 5FHBL 2Q87A 1KIQB 2WWOA 1U36A 1BVKB 4GQRA 4YDZA 1FNGA 4D9LL 3CSTA 4CC4C 2EC9T 5EU5A 1AIFB 2YMXL 1G4MA 3MBEB 4JANB 3K4AA 4MX7B 4XNUL 4BZ2A 3F6LA 2AITA 4LGPB 1TYRA 1LE5B 5JIKA 3RHWF 2K6YA 1ZLEA 3SE8H 4NQCA 4YHLH 4LVHC 4NDMB 5DO2C 3DVGB 3TEZA 3HC3L 3EF7A 4PJHB 3RWHA 3IFOA 2NCEA 5DUJA 2Q3AA 2DIBA 3DGCR 4JUSA 4Z77A 4AJWA 2VR6A 1M7UA 4HOZA 4JFZH 4K71C 1U3ZA 3SPVA 3ZL1A 1A1MB 4CJ0A 5J8OA 4U1IB 4MB3A 5JQHC 3PABB 4M1GH 1OXYA 4MB1A 2WQSA 3ZE1E 4ESKA 2VLRB 3LV3B 4HHAB 3TT3H 1FYTB 3GXMA 5BXFB 1YEHL 2IADB 2AEIT 3DIVA 5AOJA 3FN9A 4K9EC 2QZQA 5L9DH 5HGDA 3FSAA 1SGKA 5JQIB 2M26A 3O9WC 4MS8C 2VAJA 1NL0H 1U8JA 2OFQA 3TN0C 3H7BB 1IGYA 4XCEA 5C0IA 3IETA 2P5EA 2XWEA 5H94B 3LQZB 4WZ9A 4U1MA 1GAFH 1E40A 1IKOP 3QQXA 1I7TA 5EBLA 3CZNA 1M6OB 1UHVA 3FHQA 3UPAA 4DN4H 1TTFA 3TEYA 4DVRH 5DYOA 2WVSA 4FQLH 2WBJD 1BQUA 3TP4A 4MZIA 1WSST 2VR8A 3VFWA 1JMZA 5EA0L 6PAZA 2X4RB 5MI0C 1L5GA 2VISA 3L4VA 3MLVH 2QQNH 4CMMB 5FKAB 3WIAA 1GAFL 1CG9B 1U3YA 3CGTA 3VXOA 5ANMA 1E90A 4NPYB 3MI6A 2FVNA 4R90L 2N7BA 3WKPA 1P7KB 5D1ZB 2CQVA 2F15A 3ZPDA 1BG9A 4U6HA 4M5ZL 1AQMA 4R7DB 4ELKA 5CJXA 5TK2A 3BZDA 3PJNA 1HK6A 3IGAA 1OAZL 5HYQB 1F3DH 1F90H 2OS7A 3BEWA 4O58L 5I0XA 5ADPL 2DQDH 2JTDA 4XNMA 4BWUA 1RZKH 5J13C 2HTLC 5FDWB 2EJ1A 4W6XB 5JO5A 2E75C 2C9RA 4PTUA 2EDQA 1G6RA 5BJTB 5DS8B 3I2CH 1U58A 3MRIB 4OCLC 3TPUA 3TM6A 2OCCB 3U7YH 5FKPB 5BUPA 2LTQC 1MVYA 1AQKL 2WGNB 1UB5B 5C7ZA 1QLFA 5DWPA 1CXFA 4PD4J 4NI3A 5JR1H 1WH0A 5EUOF 1BVNT 1SLVA 2C7UB 3MLUH 4QTHB 5L2KA 1AQ8A 4TSCL 1BZOA 2X7LA 3EOTH 1HL4A 3MUUA 4W9KC 3ULUE 2NXYC 3T08A 1A6UL 1BYNA 3MXWH 1EMTH 4HF5H 2CUHA 1EDHA 1DQKA 1OPGH 1EGJA 1HYSD 3F3HA 3VD2A 3CVBA 2BWIA 4M1GL 4N2LA 4YH6A 1GTFA 2BOCA 3PY9A 2WW8A 1NOAA 3M86A 3LZOA 2AK1L 1SMDA 2X89D 2WBJC 4ZFOB 1QFPA 3AGVA 1JF1A 2CIIA 1SFHA 2AMUA 4FCAA 4WFHE 3QARA 1TTRA 5TE7L 4P57A 4GW1A 4DW2H 5ABDE 1YMME 4JPKL 2GCYB 3ZTCC 1QSFB 4NWUL 4UV4L 4BSJA 5DJYB 3VMPA 5E8NA 1L7IH 1ZWIA 1RJLA 4EIGB 4GIAA 2FIKA 2Z31D 1KTJA 3B43A 3QGVA 4M93C 5IFAH 3WMSA 2BP0A 1JXJA 2FGZA 2WINA 2HSIA 5TE6L 4FQIL 1T7YA 4RCAA 5DK2A 4FNPA 3NFPB 2XSKA 5DRNB 2RQ8A 2ADJA 1SYSB 2CMRL 4HSQA 4FYRA 1T04B 4FLOA 1QRNB 1GGUA 1ZT7B 4CU7A 3T04D 3MV8D 1YDPB 3GF8A 4HUWB 4ZFGL 3MCKB 4UQ3B 3VQLA 3CFDA 4OZFA 3ISRA 2PYEA 5E2UH 3B37A 3PL6A 3MRNA 1G7JA 2OXHB 4TVPL 1JPTL 1JZJA 3W1ZA 2X6UA 5F2FA 1JG9A 1MHPH 4NUGL 4V2BA 2E3VA 1KTRL 5KN5A 1QEWA 4U1KA 2QKIB 1KBVA 3LHPH 3L4XA 3O3EB 2DQDL 3A4EA 3V5KA 5DD1L 1S9VA 4CVWA 4Q89A 2P7TA 1I1FA 2Z7UA 2HX7A 2YGNA 1I1AA 4OZIF 4Z0XB 4GW5A 4R4NC 3RG1C 1PCSA 4NEHB 1YY8B 1I85A 3QA3B 4JFYB 1FYTE 1EEYB 2DWTA 5KBKA 4Q8BA 5FUZL 4IRJB 1R17A 3G3LA 4NQTA 3NDYE 5C70A 2FYYA 4WV1B 1NIDA 1MHEB 3SCMD 4P4RA 1S3KH 1AZCA 5JHLA 4L8CB 1N2RA 4L9LC 1N3NA 2ICWJ 3B7TA 4Q6YA 3IJEA 4LL4A 1L9PA 2GBUA 1OM3H 4AC2A 3EZ8A 5D1QC 4HZAA 3MV9D 4J3UA 4LSPH 3D0LB 4RESB 2XRAL 2B4CC 3PGCA 3NJJA 4ZW6A 1E28A 4QRFA 1OAYL 1WICA 4Y9BA 3ZKXC 5IB4B 3DO4A 3DXAB 4NERA 3DIDA 1IRAY 2RAMA 3CBJB 2I7SA 2W65B 2OAAA 3FSWA 5ACZA 2GT9B 3W5NA 4ZUTB 3RZCA 1Q9OA 3BSHA 4KRPD 2P5EE 5JXAL 5D7IE 2H5UA 2Z91B 4J6RL 4RMVA 1PX3A 2P45B 4JFOB 4DQOH 4F27A 4F7KA 1WA0X 2QVIA 4KVPA 5FS5A 1P5UB 4QO1A 3SODB 3B2MA 2VMDA 1HHHB 1XVSA 2LT9A 1LO5A 2X41A 2Z64C 5AOZA 1HILA 1ZLVK 2ZXGA 4MNQB 3KYOB 3A23A 2WLMA 3VXUD 1T7WA 1JF1B 4PV9A 2Z6FA 1YY8A 4JFYA 5CU5A 5KBDA 1MQKH 3KLHD 1MNNA 1IJ9A 1MDTA 3ARFD 3IGUA 4AQ8C 5I17B 3VQ1C 3VNZA 2PNDA 2J1KA 3UTOA 3VFTA 2CKBB 2ROYA 1RZQA 2D4DA 4N2CA 4BXSV 5KVEL 5JOFA 1B3IA 2WXRA 3KPRD 4ODUA 1CC3A 3VU1A 2AQQA 2IDQA 3B2VH 3O9WD 3HZYB 2OSLA 4NN5C 4A2LA 4PN6A 3ALWA 3F7VA 5IJBC 1KT2A 4UTBL 3B2DC 3B5HA 1AHMA 1MQ8A 5EC2B 1EV2E 5CD3B 2CPUA 5TD4A 3GSNH 1P84K 4ZQKB 3O6LL 1JWUB 4QTIL 3EH2A 3QDGA 3RU8H 1FFNB 4M7ZB 4Y8DC 4MLIA 3ARXA 3S48A 1OEZW 3UADA 1UCTA 4JFDD 3LB6D 1ZOXA 1S7QB 4HX1B 1Z9LA 5I6XB 3DX7B 1FUNA 1YO4A 1CE1L 3KXFD 3IRPX 3B9DA 3C5XA 4NQDE 1B4RA 2F53E 4XNMB 4PY7B 3OC5A 3LKRB 1T5WA 4FQCL 2IWKA 1VZHA 2D7NA 3BUYA 2FB4L 4LHUD 2PP7A 4GAJL 2PR4H 2Z35B 4XNAA 4A7TA 1TETH 3ZUCA 4HWZB 1ORQB 4FJ6A 1F4XL 3FN0H 5DJAA 4K9EL 5I15L 1QPKA 1EGJH 2VAAA 1S7QA 4HX1A 3JWDH 4OQTL 4WNQB 4L1HA 2WO4A 5DQJA 3DJZA 2CBMA 1K6QH 3H9SB 2NT1A 2V17H 3ETTA 4LVOB 4FA6A 1U91A 1KB9K 3U0WH 1A21A 4M62L 3QZLA 2YAEA 1MI5E 4OT1L 3UCQA 3V0DA 5FLVA 4JHBA 5DCCA 4KO5A 2HN7B 2D3LA 5F0LB 1R24A 3LRSA 1JPEA 1DQQA 3B9KC 1KJVA 4CNIA 4ODWB 4XRCB 5DWUH 3BSZA 1G7LA 4QHUB 4KVNH 3FONA 5C08D 4KX9A 1YAZA 5DJ6A 4P46D 2AAAA 4XNYH 4M9PA 1CLYL 3OXRA 2V2XA 4Q4IA 3GZOA 2VDRH 3HTLX 1AXTL 1R5VA 3WFBL 1A7NL 4D3CH 1J1OL 3RWFB 1MI5A 1JYNA 3GSUB 2OBGA 1XGYL 3U0TB 2AJZA 1WFTA 3QJXA 5C3TA 3N1MC 5TQ2L 2IDFA 1TPXC 3O8XD 2F7QA 1W6LA 2QKIA 5CZRA 3SDXB 3L9BA 3ULUL 1G6RH 3IPEA 3FQNB 1BLNB 3MLYH 3EUUA 3VFNB 3ARWA 4LVOC 1M6UA 1G1YA 3EDDA 3OKKA 4MCYB 3L3KB 3K0WA 4IU2A 3QWRD 1LO4L 4KXZI 4WU7B 2QBWA 4ZTPL 1QBAA 2ARJQ 1BOYA 4MTMA 3HLKA 5GSVB 4M1CD 4NUMA 4NNYA 1WHOA 2ETWA 3L4TA 4ICWA 2A4EA 3MRJB 4B9IA 1A9EA 2OMYA 3HG1A 5HI4C 4GNKB 1TTBA 4YFLF 3DUSA 1R1CA 4HKZB 2R2BB 4LCIL 3WJMB 3TJHC 3BKYL 2IEPA 4FMFA 4Y5VC 2G75A 1A3LH 2IVFC 2DKUA 4WJKB 3VWJB 2CWRA 4WLCA 2VSDA 3IJSA 2YXMA 3BIKB 1DJHA 2JCCA 3FFCA 3P1VA 4ODTL 5DJYA 5D7IA 4HH8A 2BP3A 1A0QL 3DVFA 4OJCA 3T4YA 4GRLD 1F86A 5LG6A 4GQ9L 3MKKA 4IHOB 4H20H 5CN2A 3X1NA 3UO8B 1FV1B 3DO3A 3GMNB 5D7IB 4IGBD 1EEYA 2DQGH 1U6AL 2A1WH 3KPOA 4PJCB 5C6TH 1VFMA 3IWVA 4PWJA 1ZK9A 4GS7B 2G75B 5AEAA 3W9EB 2C3VB 2NX5E 2FQDA 2OMTA 4P59L 3ABKB 4NHUB 3EHBB 1JFHA 4LEOA 4KXCA 2O72A 3US1A 2VLRA 3LV3A 5JDJA 1FLRH 2YXFA 5DGQA 4Y1AE 5DZLA 2F7RA 3L1GA 4JREB 1N70A 4OLZL 4PRIA 2P8PB 1LK2A 4DN3H 3C9NB 3OF6A 5FYLD 1F97A 1EFQA 1MCOH 5CUSH 3H6JA 1K3IA 3QI9D 2A6JB 4QRTA 2O6FA 2HKHL 2K7QA 4QRRB 2MCG1 3TTSA 1BYPA 1S9XA 4B6ZA 3OB8A 2A9ML 2VGLM 5DDHA 4G82A 5CCKH 1EHLL 1JGUH 1O6SA 1YN6B 4BDVB 4U3SA 3O4LB 1T5KA 1ZDQA 3O2DL 1OO2A 4NKMB 2DEWX 1BCIA 4Z95H 4P2RE 1X4ZA 2X6CA 4I1NB 4KKBC 1J1OH 4DN3L 1IAII 2AKRB 2AQ3A 5ITFB 1TNMA 1FFOA 3DWTA 3FK3A 3FTGA 4ELMB 3EYSH 3CU1A 4NJAH 4XNQA 3BGFC 3U79A 4JHAL 4MJHA 3F7PC 1DUZB 2B08A 3DVNA 2B0SH 5L6YL 1MHCB 1ZWIB 2AJXH 1IAOA 2YJLA 3G5ZA 4FL4C 1TZGH 5DD3H 1N67A 3OMNB 4RA3A 1HZLA 3L5XL 4DESA 3U0PB 1WISA 4ODWA 1K4CA 5BZXA 2R0WL 4EI5C 3HHMA 3SY0A 1W6WA 5A16B 3BEVA 3SKJL 4PWFA 3SKNA 3DX4A 4LOUD 4LCCC 4P23B 3DA0A 5IB1A 2GITA 2Q6WA 3BQUA 1A1NB 2D2CC 4OD3L 3MJ7B 3T0EE 3LQAC 4L9LA 5TDNA 4I5BA 4R5XA 1UATA 1JGIA 1T66D 1HSAB 4XCFL 4ZX5A 1EVTC 4CBZA 4AG4L 3BIAX 3U9UA 2OQJB 2FSEA 2BIPA 1E2ZA 3NZ8A 1UOLA 4NNYB 2O5ZH 4UOJA 2ZWNA 4P49A 3HR5A 3L8QA 2JFCA 2QEJA 4ZZFA 2DL9A 1PD6A 4QD2E 1BREA 3GBML 1VB9A 2NZ9C 3KGUA 3VH8G 3BP4B 1KYDA 4NCDA 1U92B 4YO0A 1DBML 3LKRA 5I1GH 4KC3B 4KPHH 2DIJA 2EVIA 4N2MA 1QOKA 3L1EA 3ZXAC 3AT8A 3PFUA 3QIWB 2Y69B 1MFBH 2ZUSA 4UDTA 3WHXA 1QASA 5IWLC 1VADB 4IIZA 1KXVC 2BVQA 1JMXA 4WKZA 3GRWL 4MVBD 1QW9A 4JM2A 3SKOB 1C5BL 4I9WE 4PBVC 1IO4C 1QLEL 1UJTA 2X0UA 3P02A 5CKAA 4FQJH 1IBGH 4OLZH 3ES6B 1EZVX 3QPQD 4PBWD 5HI5D 1T3FA 2VITA 3LX9A 2OSLB 4JZNB 1G7LB 4QHUA 1LDSA 1F6LL 1IILE 2EXYC 3PP4H 4KXDA 3TIEA 4F80A 1J9TA 3QNYB 1YEJH 4QIRA 5ILTL 3FU5A 3V9CA 1XF2B 1JTOA 3NIFE 3X3GH 2O61A 2H6OA 4YHNB 1G7PA 5BO1L 5SWZD 4XB8A 5DRXB 2JNZA 2IWGA 1XH3A 1L9RA 5BCAA 2YXVA 1A1OB 4N22A 1YN7B 4DO6A 2IBZX 4YOKA 1EDYA 3VG9C 1A1NA 1MY7A 5DC4B 3OHXA 3SBQA 3I6LE 1QVOB 5E8EB 4NKDA 1LM8V 4TNVK 4EOWL 1LEIB 3P11H 4K3EH 5D2LF 2HKAA 5CIPB 2F54B 4JFDE 3O3UN 4O2FB 1HHHA 5EBLB 2V9UA 2WTPA 4OW6A 4HPYH 2DJ4A 1MRCH 5MI0B 4NQVA 4RAUA 4UB0H 4RFOL 3DK0A 4N2HA 4UDUB 4R2GC 3UGXA 3ASOB 1CYWA 2F6AA 5CLTA 4ETQB 2H4EA 3SZKC 1A7RL 1NUDA 4LEBA 4H40A 5KYXB 2FO1A 4ZMNA 1ZJAA 4F20A 3OPZH 4NN7C 4I48B 4JGMA 4GQQA 2X1XR 3ESUF 2VDNH 4LHJB 4O2CA 4X5WB 4I18A 2D9CA 3VI4E 4Y5XA 2YD4A 4G5AA 3M1BA 4U7KA 1AG0A 2E5EA 2H6PB 2DI9A 4NLHA 2J8UE 4OFPA 5C08E 1RULH 4OLXL 5PCYA 1CQYA 2H32H 2AEPL 2IGFH 1J5IA 1DJGA 3D30A 2WBWB 5CXPA 4PJHA 4NO3A 43CAB 1GCYA 3BKJH 1UZ6E 3KJ6H 4ZW8A 2NTFB 4HIHB 3TCTA 32C2B 2V3DA 4Y88A 3QT2A 3UMNA 3DO7A 3GDCA 1F4WL 1YQVL 1FDLL 4YMPA 1GIGH 4WHCA 1M71B 1EPFA 2P28B 2NY6D 4X7FC 3MYJB 4NRXA 1BQSA 2AVGA 1J8RA 4X6CE 1ROCA 5JA8B 3IGLA 2XY1A 4K71B 4FQXA 2VZ1A 3ILPB 1ZLWK 1IZJA 3CHRA 3G04A 4LEOB 5CILH 3SGKC 1WFMA 4FQ2H 2N3JA 3GZPA 1KLFA 1M42A 2E8YA 3O4OC 1RUAH 1UA6H 3UDWC 4F92B 3GTVA 4PWGA 4Y4FA 5IIEB 1PKQA 1IEBB 1E30A 1KB9J 3WMQA 5HDOA 3UAEA 1EXGA 1JZIA 3W82A 4XOCA 2KZ1B 5I75C 3IDNB 3BVTA 4O02H 3WJLC 1HINH 1S9YB 1HEZA 1U8NA 4ANUA 1B2WL 3HI5H 4NQQA 3EH1A 1EK3A 4BHUI 1XX9C 2UZIL 1PG7H 4PV8B 2PCXA 4Z7OF 4FFWC 2GFBB 1W72H 2V6HA 2ZKHH 2ITEA 3OC8A 3W38A 5T33H 1RIHH 5T1MA 2LU7A 4HKZA 1MELA 1PZ2A 3LIZL 3FOLA 1G7HB 5KSBE 2EDTA 3C8KA 4S1RH 4WFFE 1UKSA 2A9DA 2JV6A 3OAUH 4WWKB 4MDRA 4F58L 4WUKL 3K6DA 1W72B 4N6RA 2XN9D 3HPJA 4HJEA 1G94A 5BQDA 3FFDB 3D25A 1O9VA 1X5ZA 2VLJB 2X4UA 4KRNA 3S35X 3SBRA 5EFIA 4DTGH 1YNTB 2I9TB 1LEGA 4UDUA 5DRWB 1RZKC 1L9TA 1NGQL 4PRNB 4B95C 4MAZA 5KJ4A 4M8UA 5A2KH 3MUZ1 3COOA 2G30A 3U1PA 2G3MA 5EV7A 3V4UL 4K8RC 4XPTH 3BWAA 5C0BB 5C0CD 1J8HA 4WUUA 4JFEE 3LIZA 4EKJA 3IFPA 4AQ1A 5C8JB 2FQEA 2VMEA 3K80A 5JQ6L 1CGTA 1F00I 3IN2A 4QWWD 5K1VA 4I0PD 1U8LA 2K6ZA 2P24B 5CP3H 2VB5A 4D7PA 1IZKA 4NCC2 2XCMC 2W0PA 1CFVL 2EXTA 5FYKE 3TO4B 1OAZH 2QLYA 1SDDA 2ICCA 1VKXB 1R5VB 5DUML 2Z4TA 4F7MB 1AS7A 1MJ7L 1OGAE 3IDGA 4FABH 3ZKND 1A5FH 1O7DC 1YEHH 2YD2A 3IKCA 4YHNA 4ZQTA 3FAXA 5JW4N 1G87A 2PP9A 5ISZE 4GUPA 3ULUD 1Z5LB 3K2UL 4WEBL 4A66A 2X7LB 3H9YA 4M48L 1ZTXH 4GO6B 4OZIA 2GJRA 5GS3A 4GG8A 5C3IA 2ZX6A 4HUCA 1U4FA 3V4PL 1S46A 5B1KA 4M7KH 1F6AA 3RQ3A 4JRXB 5JPNB 4KQ4L 5K9OB 4EE2A 4E9SA 2F8IA 4PH8A 3QISA 2XNAA 1TKWB 4KOBA 2DLEA 3MBXH 5I8CA 4X9FA 2C9AA 4GXUM 3QIUC 4GSRA 3WO4C 1BEYL 3UBXA 1O6TA 4K94L 4MB4A 1GVIA 2CJ3A 1KOAA 2R4SH 4PWEA 4F3FB 3QDJD 1MUJB 4IEFA 1KCVH 4BSWA 4OKVB 3HE7D 5D1ZA 1ITCA 1EZVY 1DBBH 3AS1A 4POUB