3GZQA

Human sod1 a4v metal-free variant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
152
structure length
123
Chain Sequence
b'TKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural and biophysical properties of metal-free pathogenic SOD1 mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 29
structure length 123
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gzqA00
3KBEA 3QQDA 1L3NA 3ECVA 1SXZA 1IBHA 2Z7UA 3LTVA 1EJ8A 1CBJA 3GZQA 4MCMA 1OEZW 1DO5A 1B4LA 4FF9A 4OJAA 1P1VA 2Q2LA 3CE1A 1OALA 1E9PA 1SXBA 2AQQA 2C9SA 2Z7WA 4MCNA 3MNDA 2C9VA 3ECWA 3S0PA 4BCYA 3F7LA 2AQSA 3K91A 2JLPA 4U4IA 1SXAA 2ZKYA 2K4WA 1IBDA 1F1GA 1E9QB 1XTMA 2AEOA 1HL4A 3KBFA 5KBMA 4A7GA 3GZPA 2WZ5A 2ZKXA 1SXNA 2ZOWA 1Z9NA 2R27A 1SXCA 1F1AA 2AF2A 2ZKWA 1OZTG 2WZ6A 4A7GF 3KM1A 1F1DA 1IBBA 2E47A 2NNXA 3QQDB 2AQNA 1QUPA 2GBUA 3GZOA 1COBA 2VR8A 1E9OA 1F18A 2XJLA 1E9PB 3GTTA 1BA9A 4A7VA 3CQQA 1PZSA 3KH4A 1RK7A 4OH2A 1S4IA 1JCVA 1SXSA 1KMGA 2VR6A 1YAZA 2Z7ZA 1UXLA 2Z7YA 1YSOA 1E9OB 2V0AA 1AZVA 1JK9A 3ECUA 3L9YA 1OZUA 2C9UA 2XJKA 2AQPA 3SODB 2E46A 2SODB 3HOGA 1OAJA 1HL5A 3GTVA 2JCWA 4A7TA 1TO5A 1SOSA 3L9EA 1BZOA 1N19A 1IB5A 1SPDA 3HW7A 1UXMA 2APSA 2LU5A 1XSOA 1B4TA 1Z9PA 1Q0EA 3GQFA 1SDAB 5CU9A 1YAIA 2WWNA 1U3NA 1IBFA 4A7SA 5KBKA 1PTZA 1DSWA 2AQRA 3H2QA 4N3TA 3HFFA 1EQWA 1SDYA 1N18A 1XTLA 2WYTA 4L05A 3T5WA 2WYZA 4B3EA 1CB4A 1ESOA 2VR7A 1E9QA 3RE0A 2AQTA 2WKOA 3F7KA 4A7UA 1SRDA 2WWOA 1PU0A 5KBLA 3KH3A 4BCZA 1MFMA 3MKGA 3KM2A 1JK9B 4A7QA 4BD4A 1FUNA 2GBTA 2WZ0A 2GBVA 4N3UA 2WKOF 3CQPA 1TO4A 3PU7A 3H2PA
chains in the Genus database with same CATH superfamily
1IQDA 2J4WL 4RFEB 3FTXA 4NQCD 4ODVH 5DD5L 5B3NA 1ZTMA 3VRIA 1FCGA 4UTBA 4DKEH 5AW1B 1FZMA 2X70B 3BAXA 2I69A 1I9JH 2FJUB 4GKNA 2NY4B 4GNKB 4H2AA 4URKA 1BW8A 3OGOE 2BWDA 5IB5A 1UT1A 2Z31C 3H4FA 4QRPB 1YMMA 2I07B 1G87A 3CFJA 4HISA 5AW9B 1LEKB 3TBTA 2DL9A 4PRHB 4BGDA 4HXAH 4FULA 4MB5A 4P5MA 3MLVH 1JHTA 4XB8A 2BMKB 2FO8A 2X28A 2XN1A 4JFUA 1CFSA 1NAML 1D5XB 5PAZA 3WJJC 3OLEA 4IRSB 5TE6H 4KMLB 2XIIA 1FFPA 3IETA 4YAQA 2YPLE 1VZIA 2Y3NA 3WTXA 3PJLA 5T3XL 3CC5A 4LHUA 1NSNH 4P5MB 4XMTA 4GO6B 3LH2H 3GFUA 1OAQH 3QDJA 5AB1A 4UAOC 4AI7A 2ZIDA 1PZSA 4GBXD 1NIEA 2FWUA 1WAEA 4NJ9H 3AB0B 4WEBH 1JG9A 2XFGB 3CC5B 4LHUB 5KYWB 1MFNA 1AKJA 1T04A 1N6UA 3I3EA 2PPEA 4JRYB 3RJDA 5F96H 5IT2L 1MCKA 2XWXA 4BFBD 4GUOA 3MLSL 4EIGB 2VMJA 3U30B 5IHHA 3NSFA 1T04B 2JI1A 3OMIB 1MXGA 3ZXAC 3UO1H 3UJJH 2IBZX 3LXCA 4EKJA 1E30A 3QJFA 3O2DL 4R7XA 5E00A 2FECL 3DPDA 3G08B 4E0RA 1VF5C 2BP8A 1PTZA 4K71C 5D4QA 4L4VA 3W39B 3VG9C 1RKRA 1Z5YD 3ZE2F 4P05A 4GAJH 4Q89A 2OX5A 3Q0HA 2HJKB 4OJCA 5KVEH 5E6ID 2MH4A 3BAJA 1XSIA 5DRZA 2CK0L 4Z76A 5HDQL 3GF8A 4KAQH 2ADYA 2KZ1B 2N1KA 3L6FA 4YC2C 2XACC 3DVIA 4ODBD 4N5EC 3SPHA 2FYVA 4LSQL 4B9FA 4YXLH 1DJIA 1TTRA 4L9LC 3RI5K 3V4PA 2VM3A 4FZEL 4P4KD 4FQXA 3TFKD 1IAKA 2F7QA 2V3DA 2YMTA 1F42A 4H8PA 1JRHL 5KSAA 4PRBB 1N6QH 1CXEA 1A8JH 2XBZA 4X2UA 1T80A 2M26A 3SJVE 4NAQA 5F1NA 1JHLH 4B0MB 1T66C 2WW8A 5CLZA 2LABA 2HH0H 4A2FA 4F9PC 4AK1A 3QXDB 4Z7QF 3OKOA 4N2MA 3TNMA 3LQAC 3O3DB 4KMQA 3N2JA 3ARFD 5F1NB 3TV3L 1MY5A 5IY5B 3LX9A 1TJHL 4UDTB 1KWGA 5JXED 1ONQA 2XV6B 4DZ8A 3POCA 2VWEC 4OKVA 1P1ZB 2X05A 4M43L 3OHXB 4DEUA 3S6CA 3ZTDC 3TNMB 1Z66A 2FATL 1MLCA 2BWIA 5TF1L 2VLKB 4LLYB 3FO9B 4HOMA 2VN7A 5F7YC 1L0YA 4I0KA 3F7RA 1AZUA 1DVZA 1IBZA 3BT2H 4DZBB 2DM7A 4LSPL 3TXAA 4PRIB 3QZWB 4WHYH 1MLCB 5BJTA 4FG6D 4ZK8A 1SNRA 4DVRL 3DX6A 2TRYA 1Q0YH 3PAVA 2WOBA 3RAJL 2WJ5A 4F80A 4BV1A 3WTWA 3OMNB 4R90L 4A7VA 2DQCH 3Q7JA 4BZ1A 3BIBX 5JTWA 2E9IA 2YKLH 1CS6A 3CFCL 4MNGE 4P23C 4X7TA 3AQYA 3QUYA 3DX6B 3AGWA 4HZAA 3JV4B 3O2VH 4JGJA 3U48A 3WHE1 1S7QA 1ILSA 3VFWA 2XXCB 4JFDB 4L18A 2H3KA 1N59B 3C6SA 4J3TA 1B0RA 3AXLB 5HI5D 3WGVB 5JHAA 1WTLA 1J5IA 1SJMA 1GY2A 1C5DA 3AWFA 1S7QB 3OKMA 3QIBA 4KRLB 1BV8A 1U8HB 2WO3B 4LGPB 3VFWB 4A67A 3O8XD 4K8RD 2F54D 2FNBA 3FT2A 2XWJA 3EGSB 3QDGD 1FVEA 3F6JA 4WUKL 3ROOA 3HZMA 3X3FL 1WEJL 1CLOL 1MZZA 5KOMC 2WQAA 3OKMB 3QIBB 2WLIA 2WYZA 4Z7VA 1GJIA 1AOHA 1FC1A 4HJGA 5BNXD 1LO2L 2ICEB 3FT2B 3H1ZA 3ROOB 1GVIA 2IPTL 4M61A 3W9EB 1IC7L 1T1ZB 2H0PA 4PWKA 2F08A 1JWSB 1SHSA 2FAUA 3GO1H 1S9VA 2Y1VA 1GS6X 4IIQB 3W37A 1BF8A 5GRVK 4IBUA 3OJDB 3TBCA 3HC3L 4DWHA 1PKQA 4RSYA 3OZLA 1LD9B 1S3RA 5DD6A 3EO1B 2X4UB 2XU9A 3BLKA 2OMBA 4IMLA 2X7LB 3MV9E 2FR4B 3S5YA 4DCQA 1HSAB 4Z7UB 2FQGA 1DL7L 1JWUB 3T08A 3PAYA 5DMIL 4AYID 3C5JA 4JN1H 2JQZA 4NXSA 4IMLB 3N55A 3RFZA 2C9SA 5DRNB 4FQPA 3A6CL 1FGVL 4DCQB 2G9KA 4K0OA 4HBCL 2K6WA 2MQGA 5AUMA 3ISRA 5E56A 1HINL 4JFHE 1ZAGA 4K3JH 4JM4H 3U2SA 2ODIA 2ERJC 4J3BA 4HIQA 3OKDA 2F53A 4R5VA 4HOXA 3WFBL 4RA0C 2Y7QA 4IKJA 3L5WA 4U1SA 1MRDH 5GGUB 1ASOA 4F58L 3RNQB 1T5XA 1P2CA 3THML 2GEQA 1A4JB 3C5ZC 1CLZH 4M9OA 3WS6C 1KF9B 5KVFE 2J8UA 1KG0A 1HESA 2GBAA 2P4AB 3DV4A 4KV5E 3D4ZA 3SCMC 1G0YR 4OJYA 3A6BH 4QCIA 5F3FA 5DRXA 2Q6WB 3SDXB 5I6KA 1QRNB 2YARA 3O9WB 4JPVH 3ESMA 1FNFA 5L2KE 2WVUA 5I30H 5E03A 1J1XL 1WAAF 3PWNA 4CU6A 4WUUE 5HYEA 3WAJA 4LB8A 5MEQA 4IOFD 3UPAA 3BAKA 4JRWA 1A7NH 1S4IA 1SJHB 1HCVA 3FL7A 3M07A 3LS4H 3MV7B 3FT4B 1JMXA 4FG2A 3I9AA 2XX1A 4YHML 2WNWA 2P42B 4I48A 5MEQB 3EJCA 1UH3A 2VXVL 1XGQA 5C0ND 1UURA 2IPUK 3HUJE 3GTVA 2F5AL 1MHHA 2GJ6E 3NJKA 2Q8BH 3MA7A 3INUL 3QQ3A 2AVGA 4LDEB 1NCDL 3ECBB 4I5BA 4ES9A 3WXWH 2A99A 1S9YB 4NQUA 1R33A 2ITCB 2WAHA 1IEAA 2EO7A 3RUGE 3ARDD 2BZ7A 5DQ9B 1X5YA 1XFPA 3OC5A 2WLZA 4JJ5B 1IBFA 5LBSA 2VISB 1KPUA 3ILQD 3QARA 5L6YH 1NLDH 3IE9A 4ABWA 3MLPA 5EIQA 1ED3A 1KIQA 3VXSA 3ZRFC 1ZJAA 2A9MH 4OF3A 4CVXB 4DTGL 1WS8A 4BM7A 5I76A 5CZKA 3H9ZA 1E9QA 1YEDB 2WVVA 1ODUA 3BN9D 4DFIA 1VGKA 4WWOA 3IFOB 2C9AA 2XT1B 3VXSB 2ZUQC 1S2EA 2ZWSA 4NQDE 4IRJC 1QD0A 4PJGF 3TA3A 2DDQH 1DJHA 3CPLA 3DTUB 4GAYB 2Y7OA 3S7GA 4PJDF 1LLAA 1C08B 3CVHB 5GRZA 1VGKB 1TO4A 2ADFH 2ZP9A 4Q9QH 2ETWA 2UWEF 3HC4H 3SKJL 1JZ6A 2J1ZA 1AIFA 4IHOB 1RHHB 3TX4A 1OEZW 5SWSE 3V4VB 4N2EA 2E9BA 1XO8A 1WBYA 3GI8H 1V3MA 1HI6A 4ZZKA 3MLXH 3DX2A 3K72A 2OI9C 2D2CC 4H1LB 5D1QB 3MRNB 4Z95H 2C9VA 5C0RH 1IZKA 4ODUA 1AIFB 1XEDA 1CGVA 3IDYB 2PCYA 1ZWIB 3TYGL 2CKBB 1V27A 3IMSA 4WO4C 4K23L 3AQZA 1YQVH 1CI3M 2A9NL 2DD8H 3X13A 1ZLWH 4KI1A 4UQ9A 1D5BA 2AEOA 5K9OB 4F2EA 3SE8H 1G7LA 4FABH 3WIIL 4FKKA 3FFCD 4X5LA 4TLTA 1EZVX 2BS71 3VH8A 1XZ0A 3MZGB 1TJIH 3MRQA 1Q0XH 2DB8A 2NYKA 4R97B 4FP8L 1C8PA 1D5BB 4HETA 4TVPL 5DT1L 1G7LB 3BDYH 4XP5L 1CFVH 4WTZA 1IAIM 4DKAA 1KNOA 5HDBB 3VH8B 5CILH 5FYLH 2VLMD 4ZMXA 1R75A 1BFTA 5HHNB 4BFFA 1JFHA 3DVNB 3CZGA 1KUMA 1E9PB 2LAAA 3Q5TA 4X80H 3S5LA 4NFDA 1MAMH 4PRNB 4WHTB 2AJZB 3L8QA 2RHEA 1FFOB 1KNOB 1QBLL 3RIFF 4XP9H 2W80C 1MCEA 5D6CA 4GMSH 5AVXB 3VB9A 4W1TA 4X6DA 2B3IA 4NC1E 2HG5B 2DI8A 4ODVL 1NBZA 4HUKB 4ZI8A 1QBAA 5LN8A 1I85C 1S9XB 4QOKE 1G6VK 2KQNA 3QEHA 5CSZB 2W0FA 3F85A 1ZLVH 1FVCB 3FPYA 1ITBB 1MF2L 5FHAL 3QW9A 3BUTA 1U8PA 4IKLA 3D30A 1T0NB 1KXTA 3L4WA 3RZCD 2EE9A 3DX4A 3RWJA 3SKMA 2B4CH 3U79A 4XMWA 1W0VA 3QEHB 2WHVA 4G5ZH 2E7DA 2YRZA 3DTXB 4N6RA 1AC0A 5ESAB 1II4E 1A7QL 1JF1A 4DF9A 3N85H 4HXAL 2BSTB 3SDAD 2G5RA 3X17A 3ZHFA 1VLXA 3SKMB 1CE6B 3MLVL 1MCJA 5DC9B 25C8H 3ZKND 1NGZB 5KSUA 4OQTH 5B39G 4N6RB 1BD2A 3WNPA 2E8YA 4YBQD 4K8RL 3GJEA 3D9AH 5TE6L 3QJUB 1XIWC 1NCGA 5EIVA 4NFCA 1RZ8A 5KZCD 1E2WA 3B5GA 3AGVA 3QFJD 1BD2B 2YUVA 5CIPH 1H3GA 4RCAA 2Z7UA 4JGMA 2PF6A 4G9FA 1FG9C 1HEJC 3MRPA 2BX5A 5IJCC 5ACZB 5ICZA 3MYZA 2CKNA 2X1OA 3L3GA 2COQA 1T66D 5IKCB 1HK6A 1RZ7L 3IF1A 4OFYD 2PXYB 3OZ9H 5EEXA 4I4WB 2EDYA 3BQUC 3BVWA 4PBVC 3E1F1 3MRPB 1YMME 1HXMB 2W60A 2A9AA 4AGMA 1ADQH 4HALA 3RDTB 3L3GB 5D2NB 2P1YA 2XICA 2Q2EB 3WE6B 1IGYB 3KPSA 2VGLM 5JYLA 3KBFA 1SLXA 1QTYT 3BWSA 3TASA 4I3SL 5FECB 2HG0A 3ETBJ 2F8IA 4KROD 2FECI 2BRRH 3PXLA 1CVSC 2VITA 3L4ZA 3NGBC 4HS6A 1MCFA 1YJDH 2NDFA 2XWRA 3B2XA 2QVMA 1OCZB 4MCZB 5DJ6B 5F9WB 4AUUA 1WISA 3NFSH 2AK4A 2E74C 3VFUA 4HS8H 3T6XA 3QISA 5KVEL 4XWGL 12E8H 1NAMA 2VITB 5HHXL 5EEUA 5T1DH 4AM0Q 3GJFA 3MOBL 1TZGH 4KAQL 3GTTA 3MBED 2AK4B 1QTPA 3LAFA 5J5EA 1KXVC 1L0QA 1TQWA 3II1A 1CICC 1RK7A 2NTSP 1CFTA 4FI7A 2C3VA 3B9KA 1NTDA 2EYRB 2WP3T 4NGHH 4NAMA 4X9YA 4XGZB 2H6UA 4QJ5B 3CX5J 2YOAA 1AQKL 5I1GL 3ZRCC 4R8WL 1I7ZB 1JNLL 2CRYA 4N26A 4YO0A 4AE0A 5KYUB 1XBRA 3QAQA 3HOGA 4MB3A 3FH5A 1JRHI 1Y7VA 4XMVA 3RRQA 4CN6A 3UCQA 5AAWC 5FYKD 3TU6A 2WBJD 1KULA 1OQXA 4M6NL 4PV9B 4JPWL 5IV2B 1NDMB 3BVNA 2EIBA 3TGXA 1M56B 4FX5A 1A1MA 3KEDA 3IFNH 5DJCB 1LVEA 2A73A 4X42A 2N7AA 1S9WB 3EHBB 2HLFD 3ARBA 1CXHA 2QSCL 1XTLA 1KYUA 2H26B 3O2DA 3UTSD 5KSBF 2AQ1A 4B3EA 1ZTXL 3F83A 5ADPH 5F88A 2X2JA 2Z0BA 1IGCL 3HNVH 1D5ZB 1EXUB 1BXXA 3BT2L 3R18A 2D9QB 1TQCC 3AY2A 5BRZD 5K9KA 1MFMA 4FI6A 4UAHA 1QSFA 1UOLA 3MRHB 4FTDA 2L7JA 4UQBA 1I3VA 2C5DC 4FXTA 1FFNB 2BIOA 4KTEL 1AZNA 4HOZA 3PHOA 1MUJA 3JWOH 4QF1B 1QSFB 2DQCL 3WHE0 3BEWA 5DUML 1NEPA 2YKLL 4WSGA 4Q9CA 4N2HA 2GYSA 1PY0A 1RK1B 2R2EB 4L5FH 1NAKL 2ZKMX 3FQYA 4EF3A 3ATDA 1T5WA 4OZIA 2WLJA 3T8MA 4ORZC 4MJ5B 3UC0L 3MO1A 1H9VA 3PABA 1I9RL 2FLMA 3GBML 3U2IA 4D9QD 4P5TD 2RQEA 1OAYL 3TN0D 3ULVC 1T5WB 2K4WA 2WWKO 3GMMB 5DHVH 5TFSH 2VMFA 5GSRB 2XVLA 3RPKA 1UGNA 4F1ZA 1AXSA 3DXAD 2AANA 1HS6A 2UUDK 3EOAA 1IRAY 1TVBA 5I8KL 3L2MA 4YPJA 3SGKC 2WXKA 3EFDH 4HDIB 2BSEA 1DBKH 1UH4A 1MJ7H 2ZUTA 3UH8A 1G5AA 1IAOB 3SCMD 3DJTA 3AABA 1WFMA 3GGWB 5A16A 2Y5TA 4I0PC 1Q9WA 1AGBA 4TUOA 1FJ1B 5G5DB 2EQDA 4KZEH 4M8UA 1BLNA 1JZJA 1QG3A 4HUVA 4AUJA 1DUZA 5J1AB 5JDSB 3RILA 1Q9WB 4IBLT 1AGBB 4BFOA 4NUGL 2DPKA 4LVEA 4PP2B 7PCYA 4HEPG 1G9MC 3H53A 3IEAA 5D7IA 2Q86B 2Y06L 4MJ6A 1XGPB 4HUVB 4TSCH 1YEEH 1A1NA 3MROB 1ID5I 4JN1L 1BFOB 1GAFL 1H3WM 1A7PL 4PJ9A 2CO7B 2A1WH 2CDGB 4LSSL 4HJEA 1ACYH 3WNJA 5CZVH 1PD6A 3QIUD 4PI2A 3NP4A 3FQNB 4CNIA 3JZYA 1U6AL 3P3SA 1FRGL 4K3JL 2VR5A 4JM4L 4XN5A 5EUKB 5C0EA 1BDYA 2VC2H 2F74A 4Z7VE 2HWZL 1SJEA 2Y07L 4L05A 1NGYA 4FOMA 5F1OB 1DLFH 4X8XA 2X87A 2YUXA 1S5IH 1IE5A 4ZPVB 2AKRB 3I02B 5KOVC 1XVSA 1SF5A 3TH3T 5IFAH 1GHFH 3FSWA 1FYTA 3ARPA 1JD9A 1PKQE 1NGYB 1E4WL 1VEPA 2J12B 4E41A 1GKEA 4IRJD 4MQSB 4JPVL 4WY7H 4UZSA 1UXSA 1F5WA 5BPPA 1A6AB 1D9KD 5EBWB 4M93B 1RUQH 4LAJH 4LPCA 3LN4A 1A3RH 5KN5B 1A7NL 3LRSB 3ARSA 1EBAA 4IW4C 1M7IA 4K7PL 4XODA 3LS4L 4H0GA 3WTTA 2JIXD 4PCKA 1HH6B 4LSUL 4LVOC 1J0YA 3DX1A 5DYOB 2VUOA 4MAUL 3LN4B 1SYSB 5L8LB 4MLSA 3VTTA 3TJHD 5ID1A 4XZUB 2QFRA 2NR6D 4ICXA 2K6YA 4FAAB 1KTRL 2LE9A 2WO2B 2EYTA 3RL2B 2F53E 1FFTB 3B9VA 3KXFD 4QO1A 1U2YA 5JA8B 5CZXD 5IESH 3EH1A 4PJ8C 5HHQB 2VW7A 4WNJA 1PGRB 4CVUA 2NY2C 3V6FB 4F2MA 4ZUWB 1A2YA 1QLRB 1RJCA 2EYTB 3D39B 4KH2A 4NM4H 4E5XG 1NLDL 2FD6H 3WO4B 5L6YL 4H88L 4FMKA 2J8UE 4NQCA 2XQ0A 3FZUC 3MFFB 3QUGA 4X4ZA 4XAKD 5AW2B 5I0DA 4LEOB 2FO1A 1H3XA 2A74C 1NM4A 2A9ML 1Q9OA 2JJUA 3LZLA 3NZSA 4PS4H 4D0BA 5JR1L 2PN5A 3A4EA 1YC8A 4RBPK 1BREA 3LQAL 3S98A 3R7RA 3VXUB 5DVMA 4X98B 5DO8A 2LTQB 2ZCKL 3EGXB 4QY8B 4LLWA 1EUTA 1VACA 2DDQL 3FCTB 5EUOA 2NPLX 3LB6D 1HOCB 4N1EA 1CZ8H 5JO5A 1S46A 4MDJA 4Q9QL 4HWZB 2G3MA 4F8TA 3HC4L 4NS0A 4DK3A 1ET8A 4OIAA 4JQXC 4KKQA 2W9DL 1JNHB 1TR7A 3CMOL 1VACB 4HH8A 4RMWA 4ADGA 2GITB 4TOYH 1MCIA 4KGLA 4LESA 3BPOC 1QFWH 1RVFL 2YFOA 4RGNC 2OYPA 2Y69B 4WVRA 3MLXL 3B6SB 3KLHC 3N3EA 3PPEA 5T3ZE 2VDOH 5F7MC 4UV4H 2NXYC 5K33A 3LHPH 3HW7A 5EEYA 5M95B 2JMRA 2I7OA 1RIVH 2BW5A 5IUSA 1E4KA 4U7KA 3FUIA 1NIBA 3L7EA 2E27L 4M3HA 1JPGA 1YQVL 1QEWB 2EZ0C 3STZA 1S78D 2VDPB 3AUWB 3MNWB 4GUQA 3O6FC 3TO4D 4D9RE 5I2IA 4FABL 5FUOL 3FONB 3B2VH 3ZTNH 2YJQA 3OAZH 3L7EB 2VDRH 5T5NF 2EVFA 2WTRA 3SKOB 3STZB 3MODL 3ULVH 5CGTA 2ESVB 3N1QC 2G75A 3S37X 3UTQB 2VJ0A 3BDYL 1FC2D 2DWSA 2ED9A 1PX3A 1JK9B 5C1MB 2W0KA 4ZTPL 3QJVB 2VDQL 3DUSB 3F64A 1KN2H 1M7XA 4HQQL 4PRPD 5C0JA 2J6EA 3O3AA 4X80L 1OAKH 1MAML 5AZUA 2H41A 2V9QA 4NOBA 4TS6A 5EOCJ 3CXHJ 4O51B 1RI8A 3K71A 4XP9L 3UZEC 1DHKA 1QI4A 2CIKB 1VSCA 3EW3B 1JZHA 3QCTL 4GMSL 2YPLB 3HE6B 4J8RB 4YSQA 4C55A 4X8GA 5IBTH 4YL4A 4MZIA 2KUTA 1U3HB 3ALWA 3TBBA 3RWFA 1P4BH 1N5YH 3BQUD 2J88H 1U8NA 5C0DA 3UTTE 2AXJA 3FYIB 4XXWA 1NC2B 4NPYB 1U58B 1EK3A 1OL0A 3U6XA 1J0ZA 4OTXH 5KBMA 3U9UA 3HC0A 3MHZA 4J3SA 5I75B 4Y4FC 1NMCC 5D70H 3W0WB 4MB4A 2CSPA 3VXNB 4P2QD 5AKTA 3RVTD 5J9PA 2CCLA 4Y19E 3KL5A 4L3CB 2EXYC 4P9HH 3LKOB 1JJUA 3D6GA 5CR1A 2OMZB 1AGFB 1A47A 5CJQH 2ZOKA 1AIZA 3D9AL 3SQBA 4KKRA 3VXPA 3GBEA 4PLJC 5GHWH 2B9AA 1CICD 1SY6H 4NBYB 2G5BB 1SXSA 2OTWB 1OTUC 1OGAE 4X6DE 3BCFA 2ZXBA 5G4OA 4PB0H 4NNPL 2Q8AL 1BAWA 4KJQC 5CKGA 3QG6A 1OD9A 4QTIH 3LY6A 4R0LC 2OR8A 4U6VL 1LEGB 1H6UA 3QFDB 4XNAA 4E2OA 2P80D 3Q6FA 3ME0B 3BO8A 2IDTA 2VTFA 1IE4A 1HSBB 1W8EA 2JFCA 3T6QC 4WENB 2ENSA 2CA4A 4UNUA 2AXWA 3P11H 3EH5B 5IW6A 2DQUH 3H9SD 2IMNA 2P5PA 1OSPL 1DCLA 3Q6FB 3TH2T 5DTFA 1F45A 2L3BA 5FOBA 4Q4IA 1P9MC 1SMDA 3LXAA 4CMHB 4ETQA 1OP9A 1OO2A 4YPGB 1TSRA 2ZCZA 4PV8A 3WI9A 1PLAA 3ZL4H 4AYDC 1T03H 5F3HB 4LU5H 1LK2B 3EJUA 4R4NC 4KOBA 4P3DA 4Y16A 1TTUA 5IVXA 3BP5B 1B0GB 2XZQL 3MV8A 4YQXH 2XUWA 4GI6A 1R9FA 4QNPF 2OCCB 1R3LB 2VAAA 1IKFL 1REIA 5FCUH 5T1DL 4E9RA 3CFDA 2CD0A 3VYNA 4ZS7H 5IVXB 3QDGA 4X8JA 3H2PA 3MV8B 4WF7A 1TQBC 4G9FE 3BUBA 4OAWA 1L3NA 1JNNH 1W9XA 4NAJA 1EDYA 4P9ML 3V4LA 3FCSA 1YEJH 3FUDA 1JFQH 1VGEH 5I8OH 1WT5C 2J2ZA 2Q2LA 4APQB 3LIZH 2QKIB 5CZRA 4H4NA 2X6VA 4PVLA 3IJSB 1YDPB 3GMQA 4XPBL 1PEWA 3L17A 4HU2A 4OGQC 1V3JA 3FCSB 1MEXL 5JW5A 2OK0H 4DN3H 1T1WA 2QELA 4NUPA 2J2ZB 4MNQD 4JO2L 3SYQA 2Z93A 3KPSE 4KKCC 2I9LA 5D4HA 3GLEA 2VUKA 4XO5A 2ZX5A 4G42B 3AG1B 2GW5A 1G6RH 4PJ6A 4QT5A 4B6ZA 1U8IB 5TE4H 2NW3A 3T3MB 4XCNB 4JPKL 4YXKH 1AFVL 4KZDL 1OSEA 2QSTA 5AAMA 2ZKHL 3CFQA 3FUEA 1HHKB 3EF4A 4QT5B 4JFED 2BHUA 4U3XA 5F70A 5LWYH 3CU7A 1CXFA 5TH2A 1VRSA 3DC0A 2BSSB 4ELDA 5T3XE 1MCPL 1DBJL 3UBFA 3IYLW 3T4YA 3FT3B 4RGOH 3GXTA 4PIBA 3NABH 4UTAH 5FOJA 4K7FB 3MJWA 1N0LB 3U0PB 3EBGA 5D96B 2HLEB 2OAAA 1M1SA 4JO4H 1KMGA 2VR6A 4EXPX 5DVPA 1OGTB 4XVUC 4DP6X 4XHQA 2PTTA 1MREH 4F7EB 1I9IH 2HPOA 1PCSA 2HVJB 2ADJB 1VFAB 4L5FL 1NM9A 4C83B 4GW1A 4HH9A 4NQSA 1GMIA 1DQJA 4G8EB 4Y5VA 1NKGA 1I1CA 2AJ3B 3F12A 3WN5B 2E59A 4X6EB 3MGOA 1LE9A 2KKQA 1MFDH 1KB9J 4HHAB 4XO8A 4XMUA 2G30A 4PGDB 1TVHA 4OGXH 3SE9H 4GW1B 4Z6AT 3I74A 4Z7NB 5L4MA 4ALAC 1IBYA 1RJZB 1TQVA 4Y5VB 2C7UB 5TFSL 1JIBA 5KUKA 2VT0A 4EDWH 1QABA 2HT2C 5IMLA 5C0IA 2R39A 1KIPA 5J13B 4Q9BA 5IQ7H 5HI4D 1MFCH 3BQVA 3EFDL 2IALA 3F84A 2OJEA 4OD3H 3VFMA 3MRIA 3FB6B 4J4PA 2ATKA 4WZ9A 3GMNB 3NEEA 5ICYB 1DBKL 3CZEA 1XL6A 3IFLL 5E1IA 5IHZA 2VSCA 1HH9A 3EFOA 2GI0A 1KIPB 4MXVF 4EOWL 1T1YA 4G83A 4KI5E 2WZ0A 3FSVA 4ABQA 2ZG2A 1BQLH 2X4TA 4FQHA 4W6WB 2YD8A 3ARDA 4IYKA 2VN3A 1BZ9A 1HH9B 1UOWA 3EFOB 5L7XH 1MAKA 3I2CH 3WXVL 4AIOA 2OCJA 3OZKA 5MEOA 2DMKA 2QR0B 2ZXGA 5ENWA 2JI3A 3AREB 4OZIE 1GSMA 2O6DA 1V10A 1DCEA 5IB2A 4P46B 4WSKA 3N41F 1EAOA 1Q1PA 2DIJA 4TSCL 1YEEL 4LCCA 1JTOA 4MD5A 2OMTA 3ROLA 4QXGH 5IK3B 2Q76A 1KSRA 1MFEH 5FGRA 3SE4A 3GKWH 1EVTC 4V11A 1SLVA 2A1WL 2VQTA 1OQOA 1OOWA 2B1AH 4KNQA 1PJWA 4IQHA 4LCCB 2BERA 4M00A 4PJBA 2OMTB 1AD9B 2B59A 4S1SL 5DJYB 5KS9A 4R84A 4FQJH 5AYTA 4LLDB 2AV1B 4QI3A 5IW3A 2AEPL 2IOIA 3HUJB 3GI9L 1UACL 4ORGA 3GDBA 4EUPG 3DPBA 1I1AB 1SF3A 3GDCA 3HRZB 4MYPA 4E42B 2YD9A 1DLFL 2CR0A 4N2DA 3HFML 3UL4A 2X9ZA 5C0GB 4W9CC 1C12B 2X0WA 1KIUB 4KRPD 3RUGB 1NOFA 2JKXA 3HMXH 4N9GA 4X7SH 2Z31A 5DMKB 4NZRH 5BZXA 2PCPB 4JM2F 1FA4A 2A6IA 2CHNA 3EJPA 5MERA 4PTUA 5EA0H 5C0BB 5D7IE 3RY4A 4QRAA 4JCLA 1RUQL 2XDHA 2HFFB 3MRKA 5BV7C 1A3RL 3GHEL 4MD0B 5J12C 2V0AA 2B15A 2YAFA 3CX5K 1YUHB 3NIFB 2D7OA 2CR3A 2GC7C 4G6MH 5H4ZA 5DK3A 3IJHB 1KJ2H 4L48A 3RVWC 2GY7B 3I3DA 4JQIH 1N19A 5CJOL 4NFBA 3WJJA 5IOPB 5DFAA 4YMPA 1VFUA 5FGCE 1CC3A 4DKFL 3B3IA 3TNNB 1PDKA 4GQPH 2VZSA 4LIQL 5T5FL 1DQTA 1NBQA 2V8LA 5MP6L 5DS2A 3H3PH 1RUML 1PZ2A 4WHCA 3X14A 1PDKB 3ZY7A 4OW6A 3L95B 4UQIM 2UYLA 2PR9A 4PS4L 3BZFA 3TBYA 4X0NA 4E41E 5B39B 2WUCL 4AQEB 1OTTC 4AUYA 4PJHB 5BUAA 3LQZB 4QTHB 2N1TE 1DE4A 5DUBB 1TZAA 3D85A 2DI7A 1R34A 3HJ0A 1X44A 1T6VN 4L37B 2HTLD 4JFFA 2XTJC 3VVWA 1A14H 4EZMA 4BXSV 4PW3A 1T3FA 1WD8A 2Z1KA 3MJ9L 2PR4H 1CZ8L 3GZQA 3QJZA 4I9XA 4PJ7F 5FXCH 3WJLC 3LNDA 3D85B 4FF9A 1FIGH 2NSQA 2VQ1B 4IBZA 2MPAH 3LN5B 5LG1A 1KTCA 3QJOA 3Q3GB 3U4BH 4M6AA 4ZXBC 2HTKC 3GSQA 1T3FB 3F6IA 1CFQA 4NM8H 4PCYA 3ILDA 1QFWL 3BDBA 2LU3A 5DC0A 5I8EB 4YGVA 2ENJA 1PSKL 4UV4L 2X5PA 3TVMD 2VLJA 4NRZA 5C08D 4F2ME 4JY5H 4J8QA 1LJMA 3GSQB 1ZKAA 3D3VA 4OGAD 3STBA 3BH4A 4PJFA 4L9LA 3QFJA 4XBEH 4NQCE 3X3GH 5KBNC 3AACA 5E1QA 1KCRL 4X9GA 4XAWL 4WGWB 2QHRH 3X1GA 3B2VL 4AV5A 1FO0H 3MUY1 4PJFB 4PJXB 5CBEB 4H25A 2IG2H 1NA8A 4F9PA 3ULVL 4UIKL 3ETTA 2DH2A 5E08H 2BIPA 2VSMB 1AO7D 1OB1B 5T1KA 3CZKA 3IFPB 2QPEB 5EIIG 4EQ3A 4PLJD 2EE3A 2V7HA 2PO6D 1OTUD 3VXTB 3LKRB 3WTSA 4C56A 1OAKL 3P9LB 3J8F7 4P04A 1ZMYA 4BFRA 2DYPB 2OULB 5AVSB 5CWSA 4UQAA 3MCYA 4QKXB 1HL5A 4O02H 5DO2C 1WZ1H 4LL4A 2FEDD 1QZ1A 3BX7C 6TAAA 1N5YL 1P4BL 1JZFA 4Q6IC 4ATTA 2EE2A 4WW2C 4I0CC 5D7LA 3FQ2A 2DIEA 4MMZC 2VE6B 3OKEA 2FK9A 1G9ML 1KELH 1I3GL 1FAKT 2E7BA 2MFNA 2IANB 2QLVB 4G8GA 4LBAA 2D3LA 4M5SA 3HN8A 1G84A 4P23A 1BQHB 1MW3A 3U6XS 3SY6A 3NCEB 4WW1B 2XN9D 3DO7A 3FQUA 2VIRB 3BW9A 4R4ND 3QZBA 2UV3A 1LO4H 5AYUL 4X7DC 1WS7A 5D1ZC 2F18A 2WOYA 3MLRL 4Y2DC 4Y5YB 5E23A 3MRGB 1SUHA 1U8LB 2WLYA 1I1YB 3FQUB 3BFQG 3OXRA 5CJQL 3HAEB 3D0LB 4X6FB 4NLHA 1HEZA 3DURA 5EC2B 4YHNA 4AKPA 4GOSA 4Q0XH 1ICTA 5GHWL 5DFWH 1PY9A 4ANVA 1HAWA 2DQGH 1T21B 5DXWA 4PB0L 1M4KA 3GSRB 4O58L 1PIFA 3ECWA 1KCKA 3HCVB 4KKLD 1INQB 5CEZD 4GRLB 2ALWA 1NGPH 3DDFA 3O81A 1ZSHA 4KKCD 5BV7H 2DQUL 2PABA 5CP3A 4JEGB 1I53A 5EFIA 3VNYA 1UM6H 4HPOH 3ML8A 2P8MA 3VSUA 3IDIB 4M7ZC 4ACTA 1WH0A 2ADIA 1S7XB 5DS1A 4GPVA 3BP7A 2Y36L 3QFGA 3BUQA 4ICWA 3O11A 4TNVF 4A55A 4DN4H 3QDMA 4QHUA 1ERNA 2ARJB 4NQEA 4K2UL 4TVPE 4CSTA 3FTUA 3OTTA 1OP3K 4JRXD 1N7MH 2XWTA 4HEPA 3F7PC 3OF6D 2EXTA 4V33A 4M62H 4PJ5B 35C8H 5IIEB 1B4JH 3BLPX 1HILB 1RZKC 3PHQB 3O11B 2OMVB 4MAYD 2B5IB 3QDMB 4R96A 4QHUB 4UT6L 5TGBA 3VD2A 4EN3D 5FK9A 4PREA 4ZMQA 2BNUA 2K70A 5E8EB 1AGDA 3NZUA 1WZMA 3DXAA 3H54A 4FL4C 3SKNA 4WDIB 1JNNL 4Q74A 3PDOB 4J3UA 3WKPA 5BVPH 3C5ZA 3WIHH 1YEJL 3FO1A 3BJLA 3WS6A 3SODB 2BNUB 4HX1A 3Q9QA 1A0QH 5CIPA 2FX8H 1KCVL 5TF0A 3SCMA 4Y4HD 2NTFB 4GUPA 1BWWA 4UNTA 1G9NL 4DO6A 3V6ZA 5GQBA 5JDJA 3U7YH 5A2IH 2OK0L 4HJUA 4KITB 3QXTA 5H2BB 5CIPB 1CURA 4XC3L 5KVGE 2I7SA 4U3CA 3QC5X 2IH1B 2BNRD 2FZ3B 4N3TA 4UF7C 3ARRA 4GW4B 2K3HA 3R0MA 4RFNB 1XCTA 1KCUL 2HA1A 4FFYH 2NXZB 3GHPA 4V1DB 1DVFB 2DEWX 1RERA 3SY0A 1ZCRA 4TULL 1LHZA 5LWYL 5F9OL 2F54E 3TBWA 3QDGE 4UDUA 2H3XC 1DBAL 2DOCA 1UQSB 2ZYSA 3A67L 4WK4B 4F24A 3SY0B 4EI5C 1FNAA 1VJSA 4RGOL 3MUGA 3GBLA 3NABL 4ELMA 4GRWE 5JOPE 2JWYA 3MNVA 4KY1H 5DR5H 5ECJE 4JO4L 3CXHK 1KGJA 4F57H 4UDUB 3HPJB 4KVPA 2GCYA 4B41A 1IM3A 1U3ZA 2D31B 3QJHA 3KLQA 4ELMB 5EBLA 1U8CB 1AI1H 2GJJA 2DKUA 3K91A 4ZUVB 4HUUA 4E5XA 1S7SA 2GCYB 4IRJA 1UWGH 4ZQTA 1UYWL 2A77H 2CDFA 5EBMB 5EF0A 1TJXA 2D3VA 5CN1A 2R1WB 1VZHA 3QRGL 5D1XB 2F7IA 1MFDL 1YEIH 5DHXB 2V8MA 3CXFA 4XNXL 3SE9L 2XA8H 2EUZA 3KPNB 2ZXAA 3QQ4A 4HK0A 1KPVB 3G6DH 1I8KA 3LMJH 4HUUB 2V5MA 2OJZH 3AS0A 3HHSB 1IC5H 4LLVB 5FYJH 3QORD 5IQ7L 2XY2A 4P8QA 4OJFH 1QQDA 1TJGL 4JFXA 1ZGLM 3DX9A 2A4EA 5DJDA 3SD2A 4CSZA 4HFWA 4WO4A 3KXFA 1OKEA 3TT3H 4F5CA 2EUVA 3IVKA 3ENEA 4GEIA 5CEYA 1NFDF 5C8JB 1B0IA 2VKXA 4FYRA 1IILE 1U8QA 4YHKL 5AFAA 3CK0H 3K8LA 4WHDA 4WU7B 5TDPA 3I2CL 3RWGA 1AZVA 2H1PL 5DLMH 3COOA 3KYNB 3MXVH 3VM7A 4ZDHA 4YR6A 4GG6F 1RPUA 1K3ZA 1XAKA 4Q9RL 1MLBA 4LRIC 3RA7H 1CDGA 1N67A 4OV5A 4YFLI 2H32A 3AZUA 4LRNL 1WBXA 4KX7A 2AAVA 4X9FA 3RWGB 4QXGL 3DMMB 4GAAA 5F7BA 3H6JA 5E51A 3T6VA 4B9GA 3VQ1C 4F7CA 1BJ1H 1KB5H 4CGUB 3IE4A 4YK4C 4CMMA 4XT1C 3IDMA 2IO5A 3ZDYE 1ZT1A 2YHGA 4FFTA 5HJDA 3UZQB 2DLGA 1JVOA 1BVLA 3VXQB 4FQJL 1S7RB 4F7CB 3MVSA 1A5FH 5BS0A 4IBQA 5FF6A 1KC5H 1QPKA 2DKSA 3D12B 4CMMB 1HYSC 1ZTXE 1G7HA 2Q7NA 1ZT1B 3S5ZA 1RV6X 1HJBC 1BVLB 4ERSL 3KPOB 5KBLA 4Z7OF 2IAMC 4GSDH 1OTTD 2ORBL 1LO3H 1I85A 2FDBP 3OG6B 4P5KA 5DHVB 1CGYA 2FEEL 2VL4A 2X38A 4U2YA 3HMXL 1FUNA 2CHXA 2CGYA 3G3LA 3LZFH 3Q5YA 5CP7B 1SDDB 4X7SL 5SWZA 1DQVA 2EXWC 5DJZA 4H2CA 4I18C 1LWRA 2DLFH 4OF8A 3CTTA 4FNSA 4P5KB 1AR1B 2WMPA 2DIAA 5EA0L 4HZ1A 4DJMA 4U31A 3OMAB 5I1EH 5L9DH 3DIVA 2YEVB 1P1VA 4JKMA 4PY7B 3K8KA 4PPTA 2X6BA 2HTKD 1AMYA 1O7DC 4GKSA 2OQJB 1CT8B 4P57A 5HGDA 4Y1AA 4P59L 3D4CA 4S0SD 2KDYA 1XIWA 3E2HB 2BC4A 4NO0A 4HPYH 1KTDA 2WQUA 3EYVB 4HV8B 3KR3H 4NIYE 4EIUA 3RTLA 1Z9MA 4QHLB 5EG6C 2QGEA 3CHPA 2MWCA 1QUNB 2E4FA 4Q14A 1KTDB 4WW2F 5C9JB 1THCA 4A7GF 2RFXB 2Y3AA 5C07D 1UVQA 1I8IA 1RP8A 1EBPA 3V55A 2I32A 1S8DA 1SLUA 4FQ2H 1OWRM 3BH8B 1OTSC 3BQUA 2F8XC 1MNUL 3D0VB 2NY6B 3KGUA 1T22A 1XBDA 2AJUL 3WJMB 4UT9H 2VC2B 1JPSH 4ZFGH 4J7RA 2PUQT 3V5KB 3L3HA 2EXSA 2BNQD 4P2OB 4OH2A 4QXTA 2EC9U 3FFCE 3T1FA 4BXVA 4F92B 3K2MC 2NCEA 4DH2A 4OZ4B 2CMRL 2VL5B 3IGAA 4S1QL 1A14L 3G04A 4IEFA 5F89B 4FHKA 2VB5A 1ZPLA 2YAHA 4PJDE 4XWOD 2F61A 3H9HA 5DQJB 5DSCB 3JXAA 1MRCL 4NZ8A 1HHHB 4HJJH 3P77A 3W9DB 3AAZB 1SOSA 3FQXB 4K9JA 2PWFA 1QSEB 3KJ4C 3CSPA 2B7DT 3IDXH 1RPKA 3VFOB 4NO5B 1I3UA 3BYYA 3EKCA 2IMMA 1UXMA 3DX3A 3GMLA 5AVTB 3DX7A 1UOVA 2ZXWB 1P69B 1QFWI 1UA6L 2D3NA 4DO5A 3VCLA 1KB9K 1GIGL 3E6FA 1KXVA 4YS4A 1YUKB 3S9DB 1A4KA 1E7VA 3KWWB 1AR2A 4KKAC 3ESPA 1OGSA 1YG9A 4ODSH 7FABH 1Q9LB 3X3GL 4PWHA 5T5FA 3K1DA 3NZ8A 4JN2B 1PLBA 5FYKH 3UTTB 3DOSB 1IFGA 3PJSA 4OIBA 3NIGE 4XCYA 1LO0H 5DFTA 4HFUH 5FYKU 5BQDA 4A7UA 3NJLA 3F01A 2DMBA 3BGMA 4FTVA 5AW3B 3NRPA 1FO0L 3FMGL 5AAWA 4YHIA 4TQPA 2QADB 4PYGA 4UOJA 3QNZA 3UEQA 4ALAL 5I23A 1Y6NR 4OGYH 4Z3FA 5HXMA 4JFFE 2YMXH 5E08L 2NX5A 3TL5A 1WUZA 4A68A 2B2XL 5FAAA 2XZCH 3WKQA 1E3XA 2HFGH 2N59A 3IKKA 2R1YA 3BLBA 1JWMB 2VDMB 4YHIB 4MWFA 5EU4B 4NSKA 1SXZA 5JYMA 4FNLL 3QNZB 5HD8C 2RB8A 1V54B 4JGUA 3UGUA 3VAEA 1LDPH 4UIMB 3ZIYA 2OP4H 4UNVA 1HL9A 3MJ9A 5SV4A 1JGDB 3HB3B 3BC9A 4E9YA 3OX8A 1L9MA 2EDQA 1S7WA 2UY7B 1JN6A 2JKTM 4NSKB 1OHQA 1B9ZA 4Z0BL 4WFHE 4XOAA 5D7JC 3SQOH 2VLJE 2FT6A 1OGAB 4FE9A 3SDDC 3WUZA 5JHDA 3KYKH 2HFEA 1EWHA 4OIFA 4YDJA 2Q3AA 4HA1A 3QFJE 3IMWA 1NINA 1FG2A 1MIML 2H3NA 1KELL 4QRUB 1OSZA 2GIMA 2NW2B 3VSVA 1TCMA 2MNJB 5I1AB 2J25A 2VDOB 4BQCA 2PW1A 4WJ5B 1F6AB 5DGQA 3N1MC 3K2UL 5H94A 2OZNA 3WL9B 1BHGA 2EADA 4NT6B 2XQYG 2ITFA 3LVEA 1UT9A 1DDHB 3L54A 5CINL 3O41A 1RZPA 5F1SA 2VWEE 1QNIA 5I82A 1J5CA 4C56E 2OMYA 2N0MA 3FT9A 4QHMA 2O6CA 2IH8A 1CQYA 4DP7X 4I2XE 5E6RB 4MHHG 4ZMVA 2VDRB 1CJYA 4XNUH 3SGKA 3FKUS 3O41B 3U4KA 2DQGL 3SN6N 4HF5L 4OLZL 1E5AA 5HYJD 4Z5RB 1DEDA 4UV7H 1HNGA 3B3BA 4I0PA 4ZUUB 3VM5A 1I4FA 1YCSA 2X4PA 5DURB 5D7LE 5GRUH 2EILB 4L4TD 3QIWC 4G8GE 2FSDA 3CIAA 1UWXH 3FTSA 2E9GA 3WLBA 1KJMB 2K78A 4GH7B 1KV7A 4MD4B 5BV7L 1LWHA 4PEEA 5TQ0L 3G5XB 4Z7WB 5DZJA 1RUPH 2NNAA 2O6EA 1IUZA 3MA9L 3VNZA 5C0AD 3JWNE 3FB5B 3QZNA 2BXZA 1C16B 4X6BA 1PQZA 4GP4B 5FUZH 2XN2A 1SFDA 4OZHF 4TLKA 3CV5A 5I73C 5TPWL 2E5EA 4DN4L 3DNKA 3BIKA 5ESVA 1JYVA 1ZA3B 1P5UC 5F0MB 5I19L 2HLAB 1N7ML 2K9UA 3QPXH 1CTNA 3PP3K 5EF3A 1OE2A 2EEXA 1PYWA 1YNTB 5TDNB 1UB6A 4E9LA 4OI9A 5JHLH 3UTSE 3S37H 2FB4L 3P3UA 4X6CF 5LHDA 4NDMB 2D0HA 4LP4A 1U3JA 4OCXL 3ARZA 2CLRB 1DSYA 3MRRA 4FYSA 4L3FA 1F11B 1BECA 1L9TA 4QMEA 1E2ZA 1D5IL 1JDAA 2DJSA 4ZW8A 2BCKA 4PVBA 5E8NA 1O6SB 1GJWA 2FX8L 2MMXA 1WJ3A 4BK8A 3BUYA 4HWBH 5HHOA 5ID0A 3TEYA 4Q2ZB 4EUPA 1DBMH 3VX1A 2X2YA 1UM4H 2BY1A 4OZGE 2BCKB 5FW6A 5BXFB 5AW0B 3R1GL 3C87A 4G2AA 5EPMB 1W6LA 3BSZH 3BFWA 1LYQA 3VQLA 2R56H 3HR5B 3E1ZA 3IDJA 4PD4J 1HHGA 4LCVA 1BZ7A 5LNEA 4FFVC 4L9DA 4HS3A 4FFYL 5MENE 2NNRA 2WYHA 3ULUC 4KC3B 5MENA 5KSBE 2UZIH 1H19A 1JPFA 4EZJA 4D9QE 1KJVB 3FOMA 3ZDXE 4J27A 1GTFA 5T1MA 1HHGB 1K3IA 3QI9D 4LVOB 1J88A 1FLTX 1AGEB 3DXAE 5KAQF 4LEXH 4PJ8A 1JPFB 3NPSC 4UT6A 3C6EA 1KT2B 4MQXD 2EKSB 4KO7A 1NMBH 3H0TA 2B1OA 2D0FA 1WIUA 5DR5L 5DJ2A 5D2LA 5L4FA 1WIPA 1EMTH 2A74A 3DTDA 4ZFFB 1NEZG 2KHAA 1KACB 3G5YA 4Y7MA 3RIKA 4XC1L 1GOFA 4RDQG 4LCWB 3IWVA 2MPVA 2MOVA 3SGEI 4K9EH 3TZVC 3GBDA 5B8CC 5DJ2B 2Z3FA 1YYLH 1XR8B 3N1GC 2ATAA 3GSNH 1Z32X 3BE1H 3G5YB 3WY1A 1WVZA 4ZSOA 3HG1D 3VFTA 3VWKB 1TETH 2RD0A 4FQQA 1TQSA 4WGVB 4NNYA 4R7LA 4A2MA 4TTDD 1L5GA 3HJEA 2AVFA 3G6DL 3LMJL 1BPLB 3K5RA 1KEMH 1AJ7H 4U1JB 4JQXA 4FEIA 3VFTB 1B3IA 1XB3A 2OXGB 2Z91B 1F02I 4WI3A 4DW2H 1ZA6B 2X6UA 4R4BB 2Y6SD 1LDSA 5CHNB 1L5GB 3PWPA 3LRLA 4QD2E 4QHKJ 1G6RB 4GQQA 3HBPA 5GGVL 2C1PB 3QQ9D 3V4UL 4LVHC 5C6TH 5DQDL 5AL0A 3QUXD 5E4OA 2FWSA 3MOQA 2R9HC 3TT3L 2GABA 3RTQD 2WQSA 1HDMA 1A6ZA 2NXYB 2WLLA 3O6FA 5ILTL 2AHIA 5LGHH 3CK0L 4Z3EA 4LLQA 3U6RB 5ES4B 1GOGA 1RK0A 1IJNA 2DV6A 4RFOL 2E7LC 2Z8WC 3MXVL 3KCPA 4TM9A 3L9RB 5GGTH 4XRCA 1EO5A 2C9PA 5DD0H 5A2CA 5HPOA 1VA9A 3LNHA 1U8KB 3SDCD 3NCJH 5F7NC 1KB5L 2CK2A 4FQIL 5DJAA 2O26U 4KTGA 5FO9B 4P5RA 4JZJB 3WIFA 3VW3L 3GMPB 2WZ5A 4J6RH 1Z5HA 1QRKA 2Z4QA 5TK2A 1K8DB 4GFXA 2YEZB 4M1GH 4IRZL 5I17A 2YRBA 2F0CA 3DVFA 2VLRD 3JQOB 3U1SH 3UZEA 3R4DA 4IOIB 4M7KH 3VGAC 1MJJB 4R3SA 2VN4A 1KC5L 3NMEA 5EIIA 5JUEH 1TPXB 2C26A 5E94B 1NFIB 3D2UD 3JV5A 2P48B 4XX1E 5I17B 3CHXA 4B96A 3BKJL 3DKHA 3L5IA 3KXFE 1XZWA 4GSDL 5FGBC 3ERXA 3ORJA 4JMXA 5L88L 1GGCL 2OSLB 5C08A 3L3JB 3LZFL 4FXGB 1U0QA 2NZ1A 2FEEI 2AAAA 2WIIA 4XNQB 1PLCA 2DY2A 2BOBA 5GIRB 1IM9A 3I6LD 1QMUA 5DF0A 1E4XH 4XAKE 1XWVA 4Y4FA 1KGUA 3DUHA 4MX7B 2B1HH 5J3HD 3SHSA 3DV6A 3CUPA 3APCA 4F15B 4UINH 32C2B 2E9WA 3QEQA 5L0QB 2D7TL 4R7DB 4XPGH 2VXQL 4AYFA 2IFFL 1IM9B 3B4NA 3NCYP 3RYMA 4PWGA 4CDHA 4ZMWA 2BSCA 1RZKL 3H56A 2WKGA 4JLRB 4RWYH 4YDNA 3PWLA 2C1OA 2L4OA 2N7BA 1IQWH 1UOKA 2BRQA 3QCUL 1J1PL 1QNZL 1BIIA 1EFXA 1EJFA 1MI5D 2YD3A 3PPSA 4EVNB 1U3NA 3BP4B 4UMGA 1KLGB 2DQMA 4LL9A 4Z9KB 1DSWA 4AYSA 4F7MA 5FKAB 4AVIA 4TSAH 4BKLA 1UWEH 5BS0E 3J7HA 4KKAD 4YDIH 3GIVA 2AJVL 3GIZH 4LCUA 4DEWA 4YXHH 1J12A 5HDLA 1U93B 4HKBB 3ABMB 2FWOA 3B34A 4R0LA 2EIJB 4F7MB 3KJ6H 1NFAA 1QA9B 4NWUL 1B2WH 4BE6A 3VD4A 1A6PA 4M6OH 1ROWA 1J5DA 2OA9A 1IL1B 1NCJA 1OT1A 3PV6B 1LK3L 3NJIA 2FWOB 4XN7A 3U83A 4GIPD 5EF1A 1F90H 2EDFA 3KDPB 4ODTL 5BZWA 3BYTA 3HMXA 4QXWA 4ZFGL 1WHPA 4QAWA 4G7VH 4HKXA 1P9MA 4M8QB 4NIKB 2XKNA 3BZ4B 4H0HB 5HD8D 2Q87A 3UAJD 1MVFA 5EU6A 3V0VB 2IH3B 3OKLB 3WS3A 1FNEB 3LZNA 4NQTA 2Q1EA 1FL6B 3Q8AA 4PGZA 4HKXB 3C5XA 2FLBT 3RWDA 4UQ3B 4Y1AE 5DS8A 1NCNA 5AD0A 2YGNA 5D7JD 3HS0B 5C3IA 1Q90A 1AY1H 3FUJA 1R0AH 2X89A 3RGVC 3GSWB 1I3RB 3GYRA 4GB9A 3PG2A 4JKWA 4N25A 3F58H 3LKSA 4PB9L 4JDEA 1A7OH 1D6EA 3I9IA 4PIRF 3K6SA 4GSXA 2J1YA 4O2FA 2X88A 2IV8A 4J12A 1KJ2B 4Z3TA 7FABL 1WT5A 1VB9A 3AU0A 1C5BH 1L9SA 3EYOA 4NYLB 4ZPTA 2Q7AA 4ZQKB 4Q97A 5E8OB 4YH6A 4GBXB 3NESA 3GSUB 3N0PB 4JR9H 3F7QA 2HN7A 2JXMA 4GI8A 4HFUL 4GYBA 1D2PA 2GK0B 1UA7A 4I1PA 5ABDE 4MVBD 5ICXB 2NUTB 3T0EC 3IPFA 4ZPTB 2NYYD 1VFBB 4XR8C 5K1VA 3JTTB 1F97A 2NY4C 1E4HA 4YUEL 1JGEB 2HJLA 1QHQA 2CNYA 2HN7B 3D25B 3EO0A 1I9EA 2XZCL 4LLUA 2HFGL 2VERN 3FF7A 4LLMB 2W91A 4GEJA 2YLKA 3NN8A 5I18H 3SJVD 1LDPL 3IU3A 5E6ZA 5ANMB 1A21A 2R0LH 1N2RA 1QSZA 4YFEA 3LQMA 5E2UH 2YBRB 3HI6H 3U4EB 4JRXA 2XZZA 4TNGA 4GKLA 2GFBB 3QE5A 2XSKA 2FHBA 3PWUB 4ZX3A 2H0JA 3FB8B 4XP1L 5EMYA 4NQXB 1XSKA 3LV3A 3KYKL 4GW5A 2O30A 1HEHC 4IRSC 4JDVB 3ZJAA 3MNZB 1UXWA 2GUOA 4E9TA 4LIQE 4NP4H 2J8HA 5IM7B 3M17A 5E6IB 4Q58C 1XF4B 2YK1L 5I1KH 4UNIA 2APTA 5GZOC 3KPQA 2R4SL 2QV2A 1F3RB 2AXFB 1F0LA 5FV1L 5T1LD 4F3FB 4GP5B 3DX8B 2BS8A 4PRDB 3WN6A 1ZV9A 5GRJL 3WOVA 3GRWL 3AB0C 2F5BH 4CVZA 4HIHA 3BVUA 3OM3B 4XH2A 3H9SE 1QACA 2TSBA 1D7DA 1OK8A 2NX5E 2JCCF 3LIUA 2BP0A 1QLEH 1FO0A 3PUUA 1MPAH 3MR9B 3K4ZA 3GSVA 3IJYA 2AQ3A 3CBJB 3E0GA 3QEGL 4G1MA 3U30C 4XH2B 5E2TH 1KDJA 5AOZA 3GS0A 1RZFH 1CBJA 2YPKB 4FFZL 4HUXA 1DO5A 1NMAL 4O9HH 1DLHB 4PUBH 2H2SD 3QRFM 3ZE2B 2X4QA 3ARFB 4XNUL 3BZEA 4JBSA 1AHWB 2CO6A 2YPVL 3FO0H 3O4LA 1OK0A 1GA2A 1YN7B 4MZ2A 43C9B 4APXA 1MRFH 5JHDE 3GM8A 3ZX1A 5FPIA 3T4AB 5BOJA 3VWJD 3QJSB 1JGIA 1AVAA 3CSFA 2O5NA 3D08A 5DU7A 3QWQB 8FABB 5IVZA 3MCKB 5IZ7A 4X7FC 3TF7C 1QZNA 1Y6KR 3ISWA 3KPRD 1QO3A 1RUPL 1R3KA 4O02B 2GSIB 4OLVH 1NUGA 3B7UX 2NQ3A 4N1CA 4FJZA 1PW3A 3GUTB 5IVZB 1TTCA 1OF2A 1D7BA 1FNSL 4MNQE 1V7NH 5JW4M 1R3KB 3ULVE 4Z7QB 1B3JA 2VR8A 3NJVA 3LN9A 3G6AA 4KVNL 3QPXL 2IBGA 4GXUN 1EHAA 1YEGH 3SZKC 2H8PB 4KV5F 4R7VA 4TN9A 1I1FB 4AMKH 4DPBX 4KZ0A 4RMTA 4FKHA 5DEFA 4PWIA 2FH8A 4D94A 4KXDA 5KJ4A 2EH8L 3HPLB 4G7YH 3NSYA 4LKCA 4EQ2A 1IKNC 2Z8RA 2FGZA 3O8XB 2VYRE 2F54B 2XNAA 3FUNA 3UBXG 3OHXC 3WEAA 2J3SA 2VERA 2M2DA 3LKQA 4KJYB 1JPTH 3TZVD 4YDKH 5AZ2H 4PJIA 1D5MA 4J3XA 1DYZA 1Z3RA 3LDBB 3NCWA 1BMWA 2WXQA 1EH9A 2VXTL 1P7QA 1UM4L 5JZ7C 3G5ZA 2ED8A 1XR9A 3HFFA 1E5UI 4U1IB 1MIEL 3V0GA 4S2SB 1AD0A 2VO8A 2WUBL 3AS2A 4EAEA 3CSYB 4F8PA 3S4SB 4W9DC 2PYFA 3V0JA 3BSZL 1GGUA 3MNMA 1E27B 1KIRA 3RNKB 3S2AA 1U95A 3C6LD 3ZDZE 2ZSWA 2HJFB 2F7PA 5AW6B 5BV7B 2H9GA 4R5XA 2ZG1A 2OTUA 5L2KD 3V8OA 1WWBX 3VO0A 2WXNA 1GGBH 4FXLA 3BEVA 3T0AA 4A6YH 1KIRB 2WBKA 4OM1L 2XRAH 1LM8V 4HAFA 3ILPA 1G7IA 2EIZB 4UB0H 3KBEA 4TMPA 5CBAB 3AJ7A 2R9HD 4QGTA 4F8OA 3ZU8A 5DDHA 1HQ4A 2YSSB 4LEXL 2XVGA 3WNKA 4AZ8B 3MRBB 5ELIA 1HE7A 4GQRA 3V0HA 4WI0A 2H1LM 2CPUA 1NMBL 3V5HB 1HX0A 5K59F 5DDHB 4AXWB 1HQ4B 4Y4KD 3QIBC 4N0UA 1N5AB 1XH0A 2F19H 1A4BA 1ACCA 3ZMRA 1FAIH 2ICEC 5IMOA 2IDQA 3P69A 2AXGB 1N4XL 4DKTA 1PFCA 4HCFA 4AEIH 1EGJL 4IIQC 4XHJD 3GSNL 3BE1L 5K39B 3LEYH 1A6TB 3ZGIA 2L7UA 1TETL 1UD2A 2R23B 3SGJC 5DRWA 1J8HA 3QWRD 3WJLA 1A9EB 2AF2A 2W94A 1CD0A 5IB4A 3X11B 2CAKA 2WZ6A 1BJ1J 1KEML 1AJ7L 4GRMA 5DMJB 5E5UB 2IPUG 5AVRB 2WGNB 5LAPA 4DQOH 4ZXBA 4XMPH 2GT9B 4KQ4H 1NGWB 1WCQA 4FFYA 2EVGA 4RMSA 4DW2L 4EIZC 4NQDD 1ETB1 2RALA 5AZEH 4WIQA 3LVTA 3STLB 2NY7H 2UZXA 3CDZA 4PGCB 5FKPA 5HYFA 4WEEA 1YECL 4FQCH 4GO8A 2X4RA 1ZIBA 3EYUH 3P3TA 5C6TL 1LQSR 3ZDWA 1S3KL 5I8CA 1IAIL 2Q20A 5D2LE 1CDCA 4UILL 2OLDA 5DHDA 5SWSD 3ARWA 1OAUH 3KPTA 4NJAL 1QFUH 2UZXB 4LSVH 3L5XH 5LGHL 2E46A 1EAPA 2R59A 1L6XA 1U8MA 2X4RB 4PSPA 3MLTA 5C07A 3T0VA 4XVSL 1GGIH 4RMUA 1RZGA 1M1XA 4RGMB 3JTSA 4Z1PA 1E3ZA 3FH7A 5D1ZI 5GGTL 4ZUSA 2VDNB 2ZOLA 1CD9B 2R69L 3E6HB 3T65A 3GMRB 5SV3A 5MI0B 2N56A 4RQQA 4UM9D 1R3IL 3NCJL 1EJOH 4B97A 2LU7A 1ETZA 2V7NA 3O9WC 4LNRA 4W9GC 1LP9F 2M1KA 1U8OA 1HAUA 3EYQC 2A6KB 3GHBL 3T65B 4AYGA 1F56A 4RGNE 2YGOA 1MHCB 2BVYA 4M7KL 1NQBA 2NY3D 3PWPE 4XBMA 1M71A 5GZND 4GG8B 2Y7LA 3VDBA 1FL5A 5DVKA 1T20B 5ACLA 1HIMH 1ZEAH 4MHHI 4PLNC 1EUUA 2DQTL 4QXUL 1H5BB 1INEL 3NJGA 1KLUB 4OCRH 4Q6IA 2WC7A 4IU2A 3K6NA 4PGBA 5GJSH 3LPWA 4MMZA 3EJYD 5E9DD 2X4SA 1XB6A 1T7VA 1AG6A 1XH3B 3ARTA 3KDMA 3KLLA 4LE8A 4HSQA 5FO2A 1NGXA 2VDLL 5CGMA 1H8OA 4BYHA 1S5HA 4LQFH 1KENH 1ODAA 5CS7A 4K5PA 5DVOA 2DEXX 9CGTA 1LQBC 2VM4A 5EDSA 1ADWA 3BOVA 2IJ0C 4UU9B 4POZD 3CIQA 3PS6A 1Y0LA 4O2CA 4QOKD 5D1ZA 3PDDA 3PGDB 3FFCB 4Y2DA 5D5MA 1EX0A 4PJGB 2B39A 2MRYA 4PJDB 4QHNA 3BESR 2KZWA 3D7PA 3DOIA 2QSVA 3CLEH 4ZFOB 2UWEB 1KB5A 4M5ZH 3F04A 3KLAB 1Z9SA 3IKCA 4Y2DB 4JDZB 2V2XA 4N2GA 4YDIL 2ZKWA 2UUDH 3BP6A 4KK5C 3T1WA 2DQEL 4LSTL 4YXHL 3ARGD 4N8CH 4D7PA 4PD4K 3CQFA 4ZFZB 4YX2H 4FC3E 5DJ8A 4LMQI 5A2BA 3BWUC 3KJ6L 2GBUA 4JE0A 1UG9A 1HNFA 3MJ8A 4NENA 5C08E 2J57A 3FT1A 5H4YA 4L3EA 5D1QC 5IROD 4KKPA 4ONHA 2KLTA 3QUKA 2EC9T 5DJ8B 4GLRI 3NJFA 3BHBA 1M05B 3IDYC 5CUSH 2ZCLH 3M7FB 2C3WA 4UYPA 1K4CB 3ULSB 3OJMB 3DBXA 4L8DA 3QEQE 4I3RH 3ULUL 1CPUA 1GW0A 4PJAE 3MRJB 3RZCB 3T2PA 2MSPA 1JVLA 4PJ7E 2VN6A 3HZKB 4TF4A 4M7ZB 2XG4A 3WEBA 2VXQA 1SN0A 3GBNH 1YMMD 2OMWA 2QGDA 4BIKA 2QV4A 4R97C 2ZYHA 3QO0B 5C7ZA 3MRLB 3SDAB 5IOKA 4HK3J 4LZKA 3DUUA 2UZPA 4AJWA 2VLLB 1SDYA 3Q9PA 3WFCL 1ZHNB 3F58L 4BSVA 1A7OL 3L4YA 4NC0B 1NLBH 3LKPA 1PFOA 1DQIA 1R24B 2GAZA 3H6AA 1F3JA 1ZV2A 5I6MA 1FF5A 1W0WB 3LCYA 3NSJA 3RPIB 5AB2A 3CBRA 2YA2A 3TT1H 4N0YH 4AL8C 1KGCD 1CXKA 1N8ZA 3QO1A 1SBBA 3L2LA 5IB3B 3FUMA 4LHUD 4K3EL 3FTGB 4JB9L 2ZYIA 2YD6A 3QDJD 2DL2A 3BXNB 4JR9L 2ADGA 4JANB 1N9PA 1PMYA 1A1OB 3ESVF 1A9BB 1HHIB 3GSOB 1A6VH 1NBVH 1N8ZB 1YNKH 5ABAA 3VFPB 2WINA 4ONGH 1AKJD 1CFMA 3FFOA 5B38G 5I6PA 4Z78B 4JUTA 3CFMA 4RNRA 4X5WB 1E5CA 2ADGB 1XV8A 2O4EA 3FQRA 2BINA 1JHKH 3CN1A 5TDOA 3ISYA 3T71A 3S36L 1Z5LA 3CPUA 5FCSH 1DVQA 2A6DB 2IPKA 4OFIA 3BH9B 3WG7B 3IU4L 3P73B 4X4KA 1NL0H 1X5XA 4LSDA 1CYGA 3HI6L 3IMVA 1QLFB 4I2XB 3FDWA 4KROB 4NHUB 4OLUL 5GS3A 1HT6A 1JZGA 1A6UH 1IBDA 5I66B 4ILDA 1ZT7B 3RIAF 4ZNCD 4MJIA 4L4VD 4UOW1 5JIDA 2RH0A 4EI5A 5EWIL 3LSOB 3UGEA 3UYRH 3L16A 2NNFA 5K5YA 3JT0A 1AP2A 2ENPA 1UC6A 4K5OA 4NZJA 1WIOA 4XOCA 2EEFA 4MJIB 3A6OA 5T33L 3MBEB 4U1LA 1RD6A 3GRBA 5CEZE 4EI5B 3TESA 2JJVA 2APFA 1NPJA 5CGYC 3TWYA 3PIQA 2I60L 4LOEA 1W15A 5CMAA 1HHJB 4WK2B 4Y2NA 3TIEB 1U41A 3ZE1F 1BAFH 3DI3B 4U1LB 3ZL1A 4FQLH 2ZZUT 3OSKA 1ACZA 4GS7B 1F3DH 2CBPA 2PXYC 1NEZA 2PPFA 1MPAL 4FQXD 8CGTA 4H8VA 4G43A 5KSAD 2Z7ZA 3HVDA 2VXUL 2WBJB 1MELA 3L9YA 3RWIA 3RDTC 5D2NC 1LE5B 4KFZC 3BKYL 3PNWA 4PG9A 4JRXE 5FA4A 4BK4A 4DP8X 4CL7A 3SZ6A 2P5EB 1KLFB 1ZHLA 4LBEB 1MRFL 1EO7A 4WJG3 4K5LA 5F9WC 3B5TA 5GS1C 3UTSB 3ZHLA 5LBGA 1J1OH 5FA4B 2P45B 1EQWA 3CDGA 1N18A 3EYFB 3L1FA 3A0OA 1NCWH 3U2JA 1F4WH 1KCBA 5BRZB 3O6MH 4JCMA 3X12B 1HCZA 3EDKA 3CHQA 4JVWA 3IK2A 1OP5H 2WKOA 4RDBA 3EG9A 2A6JA 2AK1L 3OD3A 4U1HA 4LASH 4Z7VF 3E7JA 3KM2A 1Z2KA 4LLAA 3RKDC 5E8PA 3GRWA 1V7NL 2NY1D 2QVTA 3FB7B 3MYJB 5G2NA 4YVNA 3QWNA 4NN6B 5BO0D 1J11A 3WMQA 5KSBB 4KK8D 3N1PC 1JV5A 3TFBA 2C4FU 4G1EB 4GSRA 3TN0B 4LOUD 4CAGA 2GTWA 4G7YL 3A24A 5IJBC 3O4LE 4Z77B 3EHBC 3FTVA 2X1XR 3QIBD 3U0TB 1AHKA 1FZJB 1BBJA 2IAMA 3S96A 3I9PA 2YPVA 1WWCA 15C8H 1EEYA 3SOTA 3WHXA 4G9DB 5DK2A 2ITDB 2CKBH 2P24B 2YBGA 4XPTH 1R3JA 4A2LA 3FTYA 4I18A 1BBJB 3LPFA 3OPUA 1SQMA 4JFVA 1F58H 1IGJA 2AXHA 3SOBH 3VMNA 1RZIA 3KCWA 3L2NA 4PGEA 4YDZA 4NRYB 5DK2B 3MMEB 2I85A 4A2EA 3V8CA 2P7TA 4G8FB 1WBZB 3OAWA 1R3JB 3CVDA 4L1HA 2G4GA 1P4IH 4N22A 1TCRB 5HGAA 3NCMA 1PZCA 1QATA 3F7YA 4PGEB 1KYOJ 1E42A 2IOMA 2IBBA 3OR7B 4ZFQA 2J8UF 2P7TB 3HC2A 1FZKA 2YGVA 4EDXB 4XX5A 1JGVH 1ZD6A 3ESNA 4KK9C 4L8BA 5HGAB 2EDWA 2YD1A 2NSMA 3AU1B 1RFDH 3J07A 4NI6A 1KGYE 5ERWB 3QXVA 1JUFA 3J2PA 4PJEA 4CJ0A 1MHPL 3RHWF 1H3PH 3QIUB 5EZIH 2ITEA 1I7TB 1OT2A 4LAQH 2QL1A 5E2WH 1TZIA 5D9SB 5B4MD 2KL6A 4PJIE 4A1RA 4AG4L 5INCA 1FN4A 3VFNB 3LKNB 3Q44A 1DTUA 2E9JA 4HIXH 3MRFA 2F53D 3L4VA 4X0KB 1MCWM 1OANA 4OD1H 5D7EA 1CLVA 4MASA 5HJ3A 1DUYB 2LLGA 2YQGA 4AQ1B 2K4AA 4LCYB 1EDQA 4NZUH 5INCB 1X5KA 4AEIL 4ZZFA 5HBBA 5AOKA 3N43F 2X2UA 4YNYA 1RZJC 3LEYL 4HJ0D 5DWPA 1GGTA 4KPHH 1O9ZA 3NCYS 1IGTA 5HJ3B 3NT0A 1H8NA 3EOTH 1L7TL 3BVXA 1SRDA 3VI3A 4U0RB 3BSZA 2XTSA 3CDYA 3MV7D 3R06B 1YNLL 2BVPB 1CBVH 4DQOL 1CXIA 2G9HB 2Y2TA 3KL0A 4HXBH 3UBGA 2JKIS 3UPRA 4XOBA 3U7AA 4P2RA 3VFRA 1G7PA 4GY4A 3HE7B 2JIXB 2BY2A 2NT1A 2Y6TE 3WEXB 4K5MA 3ZKQD 2XKUA 3C8KA 3APMA 2NY7L 3MUUA 2IXQB 1QHOA 4JDTH 2HUHA 3UPRB 2DBLL 4LSRL 4TUKL 4NO2A 4QRRA 4P2RB 4XNMA 4YIQA 1MJ8H 2EDBA 3TV8A 3NIDE 1BZEA 1ECYA 1NFDE 4LT7A 4NUJA 2HX9A 1IAII 4N0UE 4MXWH 4BCYA 1JZ8A 1MJUH 5JNYB 4FQ1H 5T3ZD 4NO2B 3WDJA 5IG7B 2GJZB 3WFEH 3WYRA 1RIHH 3MBWA 1GRWA 2FWLB 4GG6E 2GSGA 4H8QA 5D7HA 1T2JA 1F00I 1PBYA 4GMTH 1BVKA 3N44F 1C1EL 4WCYL 2WSKA 3RVXC 3VXSD 3ARUA 4GSUA 3F5WB 3T3PE 1EJOL 1P6WA 4D9RD 4F91B 2XWBB 5FO8B 1EGJA 3IS0X 3RJOA 3GSNA 4JK0D 4PRAA 2NSXA 2RR3A 4BUHA 4KK5D 4OLWH 4NKOA 2OR7A 3VRLF 2B20A 1PZ5A 4M93C 5A43C 1CUOA 1U91B 4Z0XA 3EYSL 2Y7SA 3TA3D 1JCKA 4LK4A 3GZOA 5HVGB 3I75A 4XN2A 3T8XA 4Z3JA 3AMLA 3SDDA 3SE3C 4AYMC 5DYFA 5D1QD 3QZOA 4Z7OE 4WNQA 1VKXA 3DVGA 3UAFA 3VI4A 4OLYH 5JLZB 1AQ8A 3NACH 3UTZA 2ZSVA 5IF0A 3ECUA 3HIZA 5AVUB 4PJCA 2ZOUA 4UBDC 5C07E 1NJ9B 3JTBA 2WXHA 4OBSA 4BFIB 2EUXA 1W16A 3FSAA 1IGMH 2MHAA 1NCTA 3NQKA 3KPPB 1KXHA 4PMFA 3WO4C 4X6DF 1WCBB 2VABB 5IF0B 1QPPA 3TO4B 4H0LC 2OMXB 4L8CA 1Q72H 1EEUA 1RJLA 2O5ZL 2BNQE 5EZPA 5C3LD 2WWNA 4AVHA 5BO1H 5CJXC 1CLYL 4YSDA 5GGTA 3HNSH 5HDRA 3W11D 4H8UA 2LTQC 1MHEB 3CLEL 1NWOA 3KPMB 5CD3B 4TNEA 1YEKH 4H1LG 1OW0C 2GEEA 2BZCA 4XI5C 2PWGA 4AKQA 5HYSA 2G60H 4PRPB 1EHXA 4N8CL 3DOHA 2XBDA 4BH8A 2VJXA 2FJFA 3NJXA 4GXVH 4MA1B 2JKRM 1GZQB 2F1BA 2IWFA 3L7FA 3QIWA 4JKKA 4KXZH 5F7EH 2GC4C 1D2OA 3CQPA 4OKDA 4KTDH 5HI3D 2F58L 1EPFA 3DRTB 4YHYB 3UBXI 2YC1A 4OIIH 5DMGD 3TBVB 3V6OC 1I7RB 4B5EA 2EDJA 1P7KA 2IWEA 4UQDA 4MXQC 2X0UA 4S10A 4I3RL 4P49A 2MOGA 3P9MA 4PV1C 4XCEA 1CL7L 4LCIL 4G6AC 3QEUA 2J1WA 3ZYIA 4HWEH 5D5ME 3TCTA 3G6JA 1NZRA 2H6PB 5KYYA 1P5UA 2BHFA 2AJXL 1NCIA 1AYOA 5FM5M 3VXMA 3EH4B 4HIJB 5CCKH 2P46B 4XCEB 1F1GA 2EDMA 4P2QB 4KKBC 4AX3A 4LARL 1RUAL 5I71B 2ALAA 2EH7L 5DUJA 5EO1A 2ZKXA 1ZT4A 2P8PA 4F7PB 5JMOC 1JZEA 2WQVA 2R8SH 4WFGD 1AQDB 2CU9A 4R6UA 5EOTB 1JDCA 4HLJA 4YE4H 5BW7C 4ZW5A 1JK8B 2HKHH 3BD3A 2OYLA 1J18A 1DJZA 1BD2D 3HLAB 3K3QA 2P8PB 3MRDB 4MRBA 3QXAB 5LXGH 2XQYK 1AXIB 1QHPA 5F6IB 3RZWA 3UBHA 5JXAH 2E56A 4YHOL 2YGQA 1P53A 4L3EE 4L29A 5CEXB 3KLKA 1FWXA 3HE6C 4OF0A 5IFHH 1J5HA 5AYQA 2PXYD 1U3HC 3QR1A 1CF8H 5JW3H 3UBXA 4CADB 1A6VL 4CDGC 2ICWJ 4G9FD 3FOLA 4M1CC 4U3SB 1BZ8A 5F7KC 3VFSA 4CKQA 4HP5A 4JS7A 2A5UA 1FVDA 4WWKA 3DROA 2HT3D 1RPQA 3DGGA 4RZKA 3K0YA 2OL3H 5I75C 4ONFH 1S7VB 3DSNB 3U4AA 3MJ7A 5JQ6L 2UY6B 1JTTA 4WWKB 1GZHC 5KTEH 5DK0B 5BZDA 2D03L 4JNXA 4L4JA 1NL0L 4WI4A 3GC3A 1UUSA 4UOW0 4DK5A 3WTUA 2BM3A 4UQ2A 3V0AC 1A6UL 5E1AB 1BXAA 1E6JL 4B9CA 1YYML 3RIFK 3V6BR 4Z8FH 4TUJA 4G3YH 4KNSA 2ID5A 1P4LB 3RGHA 2AK4D 2VUYA 5EORH 5HYJE 1HOEA 4LMQE 1DEEB 4AY0A 4KTYA 1OV8A 2HKAA 4Z18A 2IDCA 1DJGA 1ORQB 4LP8A 3HLKA 5C0CA 3CSBA 3TZVA 5B8CA 3EAKA 1J8RA 5T3XD 1EVUA 3MBXL 3B9KD 1CXLA 3SYPA 4FQLL 1EEZB 4JFYB 5C0AE 5ACMA 5C6PB 3VE0A 3OR6A 4RWHA 3L3OB 2YQBA 3DO4A 1N68A 4JPQA 4MNQB 2E6PA 4KI5F 2MCMA 1PF3A 1AS7A 2DYSB 2BVOB 3S0PA 2OW6A 1AMXA 3EHBD 4CMHC 3FRPG 4XBPB 3IXAB 3RVUC 2KYIA 5D4JA 4AIEA 4OZIF 2IDUA 2GTZB 1RUKL 1UB5A 1WZAA 3LD8B 1T0PB 3ARBD 4NP9A 5HHVH 5DZAA 2H1XA 2DQDH 1J1OL 1HE8A 4RAHA 1QR1A 1M6OB 4JFEB 5EF2A 1YEFH 4UZUA 1X9RA 2ZF8A 3BAEL 1U8JB 3L3IA 4HBQA 4J1UB 4RMRA 1Y18B 2AV7A 3HMWL 2JK5A 1Z3GL 1QP1A 3O6ML 4G11A 5GGQL 1XGRA 2ZICA 3CLFL 3RDJA 3TEXA 3ALPA 5SX4I 2P49B 1QR1B 2E7LA 3QYMA 5EZOL 1JV2A 1QSFD 5I6NA 1KCSH 3V0IA 1YO4A 3Q48A 2QKIC 4APQC 1CYWA 1R3HA 2H2PD 3QG7H 4UMSA 3RVVD 1FNLA 4DESA 4ZUTA 1Q4NX 4KK9D 3NCXA 5D8JL 1DN0A 3P0VH 3OPZL 1CK0L 3CVHL 2BY3A 2ICWB 3ILEA 3KAAA 4M48H 4OM0H 5D72H 3AT9A 1R3HB 5I1IL 5IBLC 3ZUCA 2JSFA 4ZUTB 1G9HA 1ZLUK 3V4VL 1P4UA 2QZ5A 4AV0A 4WU5A 4NKIH 1QLEB 3FRUB 4MFHA 5D7IF 5IQNA 3CNKA 2VH5L 1JYWA 3T2LA 4BZ2L 2V17H 4D8PA 4QHPA 1CFNA 5C70A 1TKWA 3DX0A 3GZKA 4YSAA 5FGBA 3CHRA 2WGXA 2LLNA 1BEYL 1FL3A 15C8L 4PWFA 4WK0B 4AEFA 1DSFL 4ODXA 2WSDA 2R0WH 4Y2OB 4WU5B 2CKBL 2XWZA 1DR9A 4KZCA 4XPTL 2BSED 4MQ7A 3U7WH 5E0FA 1EAJA 4ZO8A 3MPCA 3VFVA 5G55A 3BKMH 3MTXA 5EOQL 3N1FC 4ZOCA 4KJPC 5D96C 5IBUG 4P2YA 3BGFB 1P4IL 3VD5A 3OB8A 2A7BA 4ZS6C 3VJ6A 5I1DB 2ROXA 3LRGA 2RMNA 2XKSA 4NBXB 5J1TC 1SMOA 2IWKA 4LKXA 5L8JB 1EO8H 3KW8A 5F9JA 1YPZA 4DT2A 5C3TA 2V2WB 3UROR 1JGVL 2AGJL 1IBGH 1R5WA 3IJEB 4RISH 2N3JA 3WN5C 1R5VA 1RFDL 3DGDA 1T2QH 3PQYA 4OFVA 1LEIB 4AL8L 2V2TB 1UT2A 4MA8H 4DP0X 4PJ9D 1X3DA 4R7NA 5EO0A 5F9JB 4Y5VC 1H3PL 1R5WB 2X4OB 2ZWKA 4TV3A 5E4EB 1UCBH 1CO1A 4LAQL 2NUPA 5DD1H 1TQTA 3BVTA 3PQYB 4MCYA 5J13C 5IR1B 2HVKB 3ASOB 5A2KH 3FU3A 1E50A 3C75A 3Q43A 3CH1A 4HIXL 4QWWD 3CN4A 3KVPA 1MH5B 3V9CA 3P4NA 4OD1L 3TYFA 3WU1A 3GZPA 4WV1B 5EZLA 2NUPB 5HHPA 1QKZL 1FIEA 1VADA 3V10A 4X9IA 4KRPB 4YSSA 1SJXA 2YAOA 3D18B 3QH3A 4G6FD 1ZE3H 1WYJA 2VKWA 2BIHA 3CH1B 3MRCB 1FYTD 1UH2A 1O7DE 1F1DA 3N41B 3P4NB 3V0DA 1ZOXA 5A3IC 5EZLB 2DQFA 2YAPA 3CC1A 1J8SA 4OF7A 4PY8J 4E41D 3EOTL 1FQ9C 2JE8A 1A7RH 3CU1A 3QAZB 1UWXK 2XPGA 3AREC 4ENEC 3QH3B 2VM9A 2AEQH 2HMIC 5F7FA 4P46C 4HIEB 1N10A 2Z92A 3OXSB 1QBML 2BCMA 4FMVA 3RGVA 4JL1A 3ZT6A 3EOBB 4PJEE 1LXMA 4DOHB 2ZXDA 2APXA 5PCYA 5AL8A 1HFUA 4JDTL 4LGSB 2Q10A 2W9EL 1H6EA 1BPVA 1J7VR 5IHUH 4BKTC 3BPCB 3D05A 3VVVA 4LCCC 5DHEA 5EUOF 3RGVB 4XCCL 3DARA 4M1DL 3IRZA 4JM2A 3WFDL 4TPRH 4E9QA 2P3YA 4MNHB 4RFEA 3HEIB 4MXWL 5LAXB 4A6YB 1OOAA 1I1AC 3HZYB 4ZNEA 1MJUL 3HRZC 4FNUA 4NCC1 3F65A 5GS0L 3WFEL 4IS6B 3OWEA 4OLXH 4ZD3L 2QMKA 3FU7B 3T0EA 2RCSH 4JM2B 1ACXA 1BZQK 2X70A 2HT4C 3U36B 3I6LE 3SBRA 5F0JB 3O0RL 1KBGH 1U9KA 4Q7DA 2J55A 4GMTL 5GRXG 4QYAA 2OSYA 2AI0H 4ZOEA 3ZT5A 1AOZA 2CM5A 2BY0A 4QRPA 3T0EB 2Y1AA 4LP5A 3RWCB 1KTLB 3VI3E 3T0DA 2CLVB 1J5OH 4G7QB 2R4RL 3V52H 1DQLH 1OPGH 2I07A 2WWMD 3UG4A 2FGWL 1LEKA 3V5DA 4PRHA 1BIHA 5B1CA 2VO5A 4HJSA 5B38A 3SQRA 2Z34A 4A7QA 3VXRA 1MI5E 1XGYH 2GPZA 3DA0A 3FSOA 3L1OL 2BMKA 4HKZB 4QEGA 1D5XA 3V5DB 4AMXA 4IRSA 2P8LB 3O6LH 5B38B 5IEKB 1L4IA 4KWUA 5F2FA 3VXRB 5EO9B 3JYCA 4OLYL 3FHAA 3L81A 4JFPB 2AABH 3NACL 5GZOA 3R4RA 5EOCH 4OGZA 1TEGA 4J3OC 3TVMB 1UCTA 4PSRA 1EDHA 2O72A 2ZXCA 5JHBA 5KVMC 4M7JL 4P5SA 2Z0UA 5HY9B 3T09A 2JLPA 4JREB 4LXFA 3VRJB 5SWQB 1W72B 3FHEA 5KYWA 1AS6A 1IEBB 1OCWH 4DGVH 4JRYA 4HJ1A 1Q72L 5C2UB 1SGKA 1ZLEA 4JFZL 1I82A 4WKXA 3RX7A 3WLWC 2EO1A 4LHQB 1KDIA 4X4MA 2MTPA 3INOA 4G82A 1MFBH 3HNTH 1FDLL 2CCWA 1AO7B 2P5WB 1P6FA 5FHBH 4JAMB 3G08A 2PYEA 5CN3A 4DPCX 1KCLA 3QQDB 2NLJB 4L0PB 2ED6A 3BWZA 3W39A 2PO6B 3S3CB 1A3QA 4DP2X 3AQDA 3WO3B 1U4EA 1KYOK 3WKMH 3L4XA 4OFDA 5I5IA 4GINA