3GZQA

Human sod1 a4v metal-free variant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
152
structure length
123
Chain Sequence
TKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural and biophysical properties of metal-free pathogenic SOD1 mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 29
structure length 123
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gzqA00
1SXZA 4A7QA 2E47A 2JLPA 3GQFA 1RK7A 1IBBA 1N19A 2VR7A 1B4LA 3GTVA 2JCWA 1AZVA 2NNXA 3F7LA 4B3EA 2AEOA 2K4WA 3L9YA 1E9QA 2Z7WA 1KMGA 2WZ5A 5KBKA 1PTZA 2ZKYA 1YSOA 1SXAA 2WKOA 3CQPA 1F1GA 1YAIA 1E9OA 3KH3A 2SODB 2Z7UA 1E9PA 1Z9PA 2WYZA 3RE0A 1S4IA 1CBJA 1SXCA 2ZOWA 1F1AA 1DSWA 1XTMA 1Q0EA 2WWOA 3KM2A 4A7GF 5CU9A 2APSA 2V0AA 1L3NA 1OALA 2WYTA 1B4TA 2GBVA 2VR6A 1UXLA 1PZSA 3ECUA 4OH2A 2AQTA 2R27A 1COBA 2AQPA 3GTTA 1PU0A 1TO5A 2Z7YA 4L05A 1BA9A 1F1DA 1CB4A 2WWNA 4N3TA 1IBHA 1Z9NA 3CE1A 2ZKXA 1IB5A 1E9QB 2WKOF 1UXMA 4A7VA 1HL4A 3MNDA 2AQNA 4BCYA 1EQWA 4A7SA 3K91A 3CQQA 2ZKWA 2C9VA 1N18A 4MCNA 1TO4A 1JK9B 3KBEA 3SODB 3H2PA 5KBLA 2AQRA 3QQDA 1OAJA 3KH4A 1QUPA 2GBTA 1IBFA 3HOGA 1IBDA 1SRDA 3KBFA 3KM1A 2XJLA 3HW7A 2C9SA 1F18A 5KBMA 1FUNA 2C9UA 4A7UA 2E46A 1JCVA 2WZ6A 2VR8A 1ESOA 4BCZA 1SXBA 1OZTG 3GZOA 3ECVA 1SOSA 2Z7ZA 1E9OB 3F7KA 3LTVA 3PU7A 2XJKA 4BD4A 3S0PA 1SXSA 2AF2A 2Q2LA 1U3NA 3GZQA 3L9EA 1E9PB 1SXNA 2LU5A 1DO5A 3GZPA 3H2QA 4U4IA 1XTLA 1SDAB 4MCMA 2AQQA 4FF9A 2GBUA 4A7TA 1SPDA 3MKGA 1HL5A 4N3UA 1XSOA 4A7GA 1JK9A 2WZ0A 3HFFA 3ECWA 2AQSA 1MFMA 1YAZA 4OJAA 1EJ8A 3T5WA 1OEZW 1SDYA 1P1VA 3QQDB 1OZUA 1BZOA
chains in the Genus database with same CATH superfamily
4LCIL 4LCWA 1G7QA 5IQMA 3V0IA 1SJXA 2VDRH 4R4ND 1IBBA 1M6OB 1C08A 4C58B 5CLYA 4QYAA 1MDTA 1QYGL 2J1XA 1RZGB 2FO1A 1E9QA 2CRYA 2G2PA 5HHPB 5B8CA 4I5BA 1WFUA 5B1BB 1CL7I 3FT1A 4PJEB 4L8DB 5IJKC 1BVNT 2A9NL 2R29L 1MQKH 5KYWB 5AZ2H 3HNVH 5MI0C 1MPAL 4KMTH 2X2UA 3X17A 4NO3A 4MHHG 1P4IH 3IAGC 3EF4A 2CLVB 3E80A 3ZDXE 3WY4A 4C57C 4XNZB 1AYRA 2DMHA 4OF6A 3V5HB 1QRNE 3NFNA 2EECA 5BQDA 4BZ2A 4P5MA 5IOKA 4MJIE 1H3UA 2ENSA 1INQA 1EFXD 3NQIA 5D1XB 3FOLB 2WYHA 3EYFB 4J1UA 1UM5H 4F7KA 3CBKB 3GNMH 1H8LA 4M5YH 4PJBA 1SEQH 5J6GB 3U46B 1BA9A 3CFBA 1IBHA 4O58H 1D6VL 1FL5A 3GT6A 2CIKB 1AMXA 3QUKB 2XBDA 2Z0BA 2NLJA 1EMTH 3GSRB 1I1RA 2DM3A 5HYJE 1F4HA 1OAKL 2CO4A 3S6CA 3BI9X 2M1KA 3NZHL 4U49A 4HJSA 1P2CB 3BPOB 5L88L 4FERA 4IU3A 4JGJA 3H0TA 1GGBL 4N86A 2DLHA 4PAZA 3WXWL 2AQRA 3IJ7A 1L7TL 2R0WL 1OM3H 4MTMA 2GT9B 4ONFL 3ARYA 3BKCH 3IS0X 5F3BB 3RVVC 5D4HA 1USZA 2AMGA 1I1AD 2ZAGA 4KVNH 5AWNL 4UILH 5KBMA 4HHGA 2W9DH 4IGBD 3V0DA 1IC4L 5KSUB 5M95B 2VN5A 1NA8A 3RL2B 3DPBB 4N2MA 5K9OA 2BP0A 1UXWB 3FSVA 4L3EB 4ODSH 2G9KA 5GRVK 4QHMB 5DF0A 1BZ7B 5E8DL 3R06B 1NC4A 3AG3B 4O02H 4OZFG 1QABA 5E8PB 4AGLA 5ABDE 2F9BT 3T4AC 2LLNA 3VTTA 4N1CA 4D9LL 5JDSB 2FBRA 5DS2A 2DIAA 2CO1A 1QFHA 2TRYA 4KK9D 2ROYA 1QASA 3QUZD 4W81A 4ZAKA 3LXAA 4EN3D 3BVWA 2LAAA 3HFFA 2QADB 2Y07H 1A7NH 4YDVB 2QDWA 3RJOA 1JD7A 3NSYA 3P73B 2FSEB 4ZO9A 4DAGH 3B37A 4N0YH 2VISB 2L7QA 5E5MB 1AHWA 1FPTL 3NTCH 1IM3A 3VI4B 1ZA6B 1OY3B 3RA7H 5JNYA 3DHJA 5D7JB 5KBKA 3LN5B 3NJLA 3MFFB 1EK3A 2F53B 2WSKA 4JO2H 1N7MH 4CBZA 3OR7B 4OGAC 4OGYL 5A6MA 2FJFA 3MJ6A 4NWUL 5HD8C 2OM5A 3HNTH 1KBBA 4JHZA 1ZA3B 4FCAA 1AMYA 4K3GA 4NNXB 5I8KL 4BSWB 1BV8A 4K4KA 1A6WH 1GGYA 1MFNA 1QQDA 3A4FA 3WNPA 3MCG1 2OYLA 3FN9A 3U7YL 5E1QA 4UT7H 3FFCA 5AVQB 2HG0A 4P57A 4NT6B 3QCTH 2OMUA 5TH2B 1MEXL 3PHOA 5C1MB 1A22B 2ZKHH 5I16A 1N67A 1YY9D 3BRDA 2JNZA 2P3YA 3KJ4B 3FYEB 2Z65C 4KX7A 2HZHA 2C9AA 3KPSE 1F97A 4FQXA 4FJZA 2JE8A 1KULA 1UM4H 5FM8A 3DHUA 3TN0D 3VACA 1G7JB 1G5GA 2AEPH 2VW6A 4O51B 3CZKA 4K7PL 4XWGH 1UB6A 4Y2DA 5SWSA 1NTDA 3EYSH 3GLDA 2OCFD 5FYJD 2N7SA 4LCIH 3V0JA 4XXDA 3VTMA 3VFWA 1UWXK 3IKCB 4XCCL 3V95A 3WO3B 2HLFD 1QYGH 3V4PL 2OZ4H 2BSSB 1KJ2B 2R7EA 4JY4B 3CIAA 2NZ9D 2ARJA 3OG6B 4NQCB 5DMGD 3SKNB 4WUUD 2EIMB 4MS8D 3OAZH 5AVSB 1UGNA 2KLSA 4WHYH 1OD7A 2C9SA 4Q0XL 4B60A 2F1AA 2WXHA 1SUHA 5DHVH 2VR5A 4OVVA 3P54A 4S10A 5T5NG 3F01A 1MPAH 1NGWA 5E23A 4R4BB 3PWNA 4EDXA 5TE4L 3FU3A 3L5XL 2HKHL 4GG8A 4FXKC 1S7TB 3UG3A 3HG1B 2YZ1A 4JANB 2FEDC 3L3JB 3C5ZD 4PVLA 3U2SA 1HHHB 2LABA 3TO4A 4ZSOB 4K9EL 3ZDYE 4HC1A 2VSMB 1K85A 5IB3A 5FA3A 1N4XH 2VWEC 5I73B 5IMMA 1U58A 5E8NB 1CO1A 4EUPA 3E1ZA 3RL1B 3PNRB 1U3JA 1D6VH 4GT7A 2AEWA 3SBWC 2N1TE 4Y4HD 3ESVF 4KKBC 2ZYSA 1DJHA 1MWAL 4KKCD 5DJXA 1TXKA 4GB9A 3VJ6A 2K9UA 1A7RL 1MI5B 3NZHH 1AI1L 3AXHA 5L88H 2CCVA 3QQ4B 1GGBH 1SXAA 4Z8FL 3D3VE 3WXWH 4ADJA 1L7TH 3D39B 2P48B 4G6JH 4I1RA 2R0WH 2GITA 5E9NA 3SDCB 4ONFH 1JPGA 2EP6A 5BV7L 3QK0A 1P1ZA 2X6AA 4M8QB 5AWNH 5ECGA 3UBHA 1ITBB 4FTVB 5HDOA 3K2IA 1L6ZA 1C5DA 2NNAB 1YEFL 1IC4H 1ADQH 1ZE3C 1IEAA 3V8OA 2IGLA 1AR1C 4OAWA 1H3TA 3CLWA 4KO7A 5FECB 1RLBA 1XGTB 1RD6A 3O9WA 4I4WB 2VM9A 5E8DH 4ZUTB 5LG6A 1O6SB 1CL7L 3MJ8A 2FGWL 5I0YA 4HQQL 4D9LH 1INEL 1K3ZA 1OSZB 3MREB 4MJ5B 3W9EB 3ZRFC 4NO2B 4X83A 4QRQB 2YGQA 2A38A 3S5LA 3AWEA 2APWA 2J2ZB 3BAWA 4KXAA 1AHMA 2VXQL 2A9CA 3S37L 3OL2A 5DEJA 4MB3A 5D4JA 1H19A 4M56A 4B9JA 4C47A 2HN7A 3W56A 5DJ6A 5AD0A 4XCYA 3NJFA 1XGQA 3US9A 1LMIA 1A7OL 3QXDB 4TM9A 2BFGA 5BZDA 4ZS6D 1MW3A 2HVJB 1CTOA 1HEJC 4V33A 4B6ZA 2V2XA 1SJEB 2ZXCA 3GJFK 5GS1B 2X12A 3R18A 3CV5A 2L7UA 4OD3L 2VLME 2EDXA 3MOBL 5GJTL 1UJTA 4HEPA 4QXWA 3WTSA 5EBLB 4TTDC 2X0WA 2HFEB 1OTUD 4IDJL 4UM9D 2ZOKA 3STLB 1CGSL 5E9DD 4R7VA 3BZFB 1ETJA 5C0BA 3LSOB 5E2TL 3OHMB 5I8KH 2B2XL 4MNHB 1GMIA 5C2BL 5ANME 3H56A 1ODAA 3UP1A 4WHTB 2Q2LA 1MDAA 3U7YH 2XQYK 5CJ5A 4Z7NE 2IPKB 4GSXA 4FQPA 5E8OA 4LGRB 4J3OC 1MEXH 3N5AA 4X5QA 5BQ7A 3H85A 3ZHDA 3KJ6L 1GS7A 4NO5A 3RNQB 3WGUB 3TPUA 2FHBA 2RB8A 2E7MA 2OULB 1FG2B 4ZT1A 3BKML 5ESVB 5I6XC 4F58L 1D5MA 2F0CA 2G9HB 4FG2A 3RDTD 5EU5A 2W0FA 4IBZA 3C6LD 3FT0A 2W8CA 3MBXL 4HEPG 3PIQA 5EN3A 4K7PH 2N7BA 3KYNA 1WBZA 1BFVL 3L1FA 1L5GA 1XL6A 2K4WA 5I0XA 3W11D 5TGBB 3D69A 3ZE0B 2Y7QA 2NW2A 1B3JA 3GLAA 4XCCH 2BMKA 3V4PH 3NA4A 4OZIE 3UDWC 2D3NA 3L4VA 2AJUH 5HDWA 3BISA 1OP3K 3ABLB 4QR7A 4PGJA 4OFYA 5E6YA 5CCJA 4D0BA 5EZIL 3Q1EA 4Q0XH 1UHVA 5HGBA 2EDFA 4YE4L 2GK0A 3QJHA 2J6WA 3N40F 1I31A 3SBPA 1D5ZB 2ERJC 1MVUA 4DERA 1J10A 4RRPG 5E6ID 4OQ1A 3WNMA 2EKSA 4NWTL 5J7CC 5G55A 5H4ZA 3LQZA 4FI6A 2HKHH 2JKTM 3MOQA 4YHIB 1ORSB 1BXAA 4BDVB 2ZX9A 3DARA 4HFWB 5F1IB 1KIQB 2X4RB 5CO1A 1RZGA 4WJKB 5HHPA 1K3IA 5I2IB 4PLJD 2JKLA 1BDYA 4PJEA 3UTTA 3WO4B 1II4E 4OCRL 4Q6KA 3GJEB 3ATFA 5KYWA 1NCIA 4Y4KD 2E7BA 5C7XL 4NKMB 1KPVB 2GJJA 1FC2D 3FTYA 1MWAH 2P8MB 4BFGA 4PGBB 1YMMA 4F8LA 1BPVA 1FH2A 1V27A 2P9RA 5DZAA 1S78C 3CIQA 4UOZA 1NL0L 1A7RH 3IRPX 2OK0L 2CLVA 1KLUB 3DRQA 5B21A 1AI1H 1BBDH 4D0DB 3MX0B 3RGBA 1FFOA 1OT4A 3PV6B 3VXME 1UD3A 4Z8FH 4DN3L 3RVWC 1WH0A 4ZNCD 3LD8B 2B3RA 2IEPA 5D1XA 3DMMB 3FOLA 4A7UA 3D1MC 3EYFA 4HBQA 4P5TD 1Z1WA 3FHQA 5BV7H 5J6GA 2XI9A 4LP8A 3QFDA 1E6JL 1Y1DA 3DXAD 4HCIA 4V11A 1MH5B 3U46A 2XWBB 4TRPL 1YEFH 4GOSA 1OGSA 3QUKA 3GHPA 3TZVC 2ZUWA 2QQLL 4MNQD 3TEYA 3GSRA 4POUB 3VXSD 1IM3D 3EBHA 3NIGB 3PWLB 1J18A 1CL7H 3EXLA 1SLUA 2FGWH 2OSXA 4V2BA 4IHOA 2VDMH 4CC4A 4HQQH 2WANA 1INEH 3HVNA 3QI9C 4OLUL 4ZOBA 2DLGA 3QQ3B 4HU8A 1HWWA 1NPUA 1NCWL 2C34A 4M6NL 4JHUA 2GY7B 4JRXE 5T3XE 3KNBB 4Z18A 1HJCA 2YXVA 2VXQH 2YPLE 3D2TA 3QDMD 5I30L 5F3BA 3D2UB 4L5FE 1QNIA 1NCCL 3DVFA 1DN2A 2GI0A 3N1FC 4ZG1A 1TZHB 4IRSB 1MFDH 1NPJA 1TLMA 4YHPB 3F64A 5KSUA 3J27A 1A7OH 3RL2A 3DPBA 3FFCD 3RZCB 4GIOA 1UXWA 3EJYD 1B9ZA 1WA1X 4X7SL 1MHCB 1YPZE 1HZHL 1HI6B 1BZ7A 3R06A 1KBKA 4P8QA 4OD3H 5ENWA 5E8PA 5C6TL 3MOBH 1JNJA 5GJTH 3EO1B 4X42A 4ODXB 3RBSA 5KYUB 4TVSa 3HA0A 2ICWJ 3D7PA 1CGSH 3BESR 1ETZB 4CKQA 2OMVB 5FB8B 2B2XH 2XQBL 2WYTA 1JV2A 3CDFA 4YDVA 5E6SB 5C2BH 2CGYA 4U7KA 3P73A 4PY8I 2YD1A 4MAYD 2FSEA 3V9FA 2AQTA 3CZUB 1LM8V 2VISA 5DRNB 2C7FA 4AJ0A 1EJ6A 1FYTD 2A9BA 1R3LB 3VI4A 1YEEL 3DX0A 1ZA6A 3KJ6H 4N9OB 4X6EA 1FCGA 2QHRL 3GXUB 4HKZA 4YO0B 5D7JA 4B9IA 2DH2A 3LN5A 3BKMH 1WO2A 3MFFA 5AW5B 1EHLL 2F53A 1BW8A 3ZKSD 4F58H 1F2QA 2VN6A 3FTWA 4N6RB 1ZLVK 3B9DA 1MCEA 1Q94A 2FJGA 3RY6A 3HC4L 4PJ7F 5E95B 1DLFL 3QPQD 4MQXC 3MBXH 5GS0C 3WKNA 1G7MA 1ZA3A 1ACYL 2AK4D 4LBAA 2EDRA 3WL9B 4BSWA 4H8UA 4XO5A 1CC3A 1WJ3A 3ETBJ 5AB9A 3DETC 4FFZH 4NT6A 3L5WB 1ET8A 3S8WA 1S8DB 5K1JA 3TO4D 4ZMYA 2FRGP 3GDCA 1FAKT 2C1PB 3MNVB 4U1MB 1XH3B 1SXBA 5D9SB 4YE4H 4DP4X 5F9JA 2OMYA 3LKSB 4M6ML 4GMSL 4NQVB 1DJYA 4ADGA 4O51A 4FS0A 4LP4A 1FFNB 1O6VA 4OFQA 4NWTH 4TKWA 5DJAB 4DCQB 4HZLB 1V5JA 4UQBA 5I1IL 1U6AL 4A6YL 1R5WB 2WAQA 2QSTA 4X9BA 3IKCA 2BSSA 1KJ2A 3OAWA 3TJHD 3SKNA 4NQCA 2ESVD 2F54D 5D72L 3HG2A 1SXZA 3ESPA 3CHXA 1L0YA 4NZ8A 4OCRH 1LJMA 1PAZA 1KB9K 2NNXA 2FX8L 5C7XH 5E99L 3H1ZA 4R5XA 2HX9A 4XOCA 4OI7A 3QUXC 5BCAA 5K9QG 4DFHA 3SE9L 3BO8B 1JNNL 2NX5D 2ZCLL 4J6IA 3KPRE 2YAMA 4NENB 4R4BA 1NL0H 3W57A 2OK0H 4F27A 2OL3A 4JFXB 5DD0L 3MCLH 1S7TA 2GY5A 4TL4A 3HG1A 4JANA 1S2EA 4P5KB 1CICB 4DN3H 1HHHA 7CGTA 4LMQE 4ZSOA 3N04A 2BW5A 4WJ5B 3LH2H 2W38A 1FNHA 4DZBA 5IM7A 1S3KH 1E6JH 5E8NA 2CO6B 1MCIA 3HHSB 4TRPH 3RL1A 3QXAB 4MD4A 3Q48A 2OYPA 1W80A 3N0PB 4UZSA 5H94B 1I1YB 2QQLH 3H6AA 2E74C 4X7TB 3B9KC 3FFOA 4NKQB 1ZVYA 1DJXA 2BXZA 1MI5A 2XETA 4UB0H 1XCQB 4GRWH 3QQ4A 2PKDA 3B3BA 4OLUH 2J8UE 3V0HA 2BFVL 4ZZKA 5J06A 1HL4A 4P4RB 3CU7A 4M6NH 4PRHD 4L29A 4BQ8A 2A83B 5I30H 1YNKL 2PO6B 4M8QA 1DN0A 2X09A 5IIEB 1NCCH 4FTVA 3BD5A 4JPSA 2ZXAA 1YEHL 1J8HB 3WIHA 1MZYA 5HYEA 4P59H 3T8MA 2JIXB 1Z5LB 3LKNB 5LN8A 5FECA 1WHOA 3GMRB 1HZHH 2WQXA 3K5SA 1XGTA 4ZUTA 1X5ZA 4I4WA 3K2KA 2KPNA 2CR0A 1CDUA 5C6TH 5IWLC 3IT8D 1U92B 3BH8B 4NB7A 4XNQB 4WQOA 3RIAF 4Z6AT 3MREA 1OSZA 4PRIB 3W9EA 5C0GB 4RMUA 3AACA 2DWEB 4NO2A 3ZDZE 3VX0A 4RBPK 4H1LB 4QRQA 2XJKA 4QHUB 4F5CE 1OE3A 1FO0A 4F7PB 2D7MA 2J2ZA 1QLRB 1MFCL 3IM1A 4KUCF 4XX1G 5B1AB 4JE0A 2XQBH 4MZ3A 4OR1A 2MHAB 3ZLQC 3ZKND 1N8ZB 2KDGA 3BAEL 4GW5B 3QXDA 3SDXF 2EUXA 2HVJA 3S5YA 4HIIA 3BUTA 1YEEH 3FQ2A 4R8WH 5ICYB 2QHRH 1Y18B 3NJIA 3MDJA 2EDNA 1EHLH 4ZX6A 1AXTL 4XR8C 2E47A 1JZIA 3L3IB 2B77A 1WWBX 4PJBF 4X4MA 5DGRA 4UINH 3VNZA 1OGAB 4WK0B 4R2GD 1XEUA 1QLEB 3HC4H 1EERB 3OXRA 4Y5VB 3STLA 1DLFH 1UD8A 2XIBA 1MHPL 4MDJB 4W1TA 2JKRM 1LEIB 1ACYH 2ZX6A 4M6AA 2CNZA 3NSXA 4P2RB 5F9DC 3NIDF 4MNHA 5SWQA 1NANI 1VCBC 3QORD 3KYKL 5MEOA 3LVTA 1KCUL 5F7FA 2IPKA 3PXJA 3AY4A 3THML 3NDYE 3MMEB 3VWKC 1VFBA 2ZOWA 4FFWC 2QVTA 5F7EL 2LTQB 1LP9B 4AWJC 2R0LL 1ETA1 1FG2A 4HPYL 1T1WA 3ARRA 3S7GA 3LZPA 1OALA 3UTTD 2CGZA 2X44D 3L3KB 1TF4A 4XNMB 1TLKA 5F0PB 4WWID 1VSCA 4GMSH 1KIUA 3WJLC 3N44B 4Q9QL 4N0UB 1SLVA 2X3CA 4M8VA 4GQ9L 5KYNA 2XWEA 1U6AH 4A6YH 2MRYA 3OM3B 1F3DH 5TGBA 4H13C 5MI0B 5CFHA 2YD5A 3O6FC 3QJFB 2HJKB 4LOUD 3DTDA 1PY9A 3ABKB 5J12B 5D72H 3FMGL 4A7SA 5CZXC 5BS0B 4Y89A 2VSKB 4Q56A 3GXNA 1RFDL 4EIUA 3WFDL 4CMMB 1D5ZA 2X88A 2P5EB 1G9NL 2XTJE 3OAZK 5E99H 3ECBB 1TQSA 5D1QD 3SE9H 1JNNH 2ZCLH 5BW7C 4W9KC 3NIGE 1OAUL 4FQQB 5DD0H 2QT6A 4YHIA 4BKTC 3HE6B 3EH4B 3HCVB 1JCVA 2E8ZA 1ORSA 4BDVA 1RPKA 3WI9A 3C8DA 4HFWA 4PFEA 4Y9GA 2EIBA 1DJGA 1KIQA 4PB9L 5F1IA 4NQEB 1AXSB 5FV1L 3DBSA 1XD0A 3S0PA 2V5YA 2VW7A 5I2IA 1PX4A 3RIFK 5JW3L 4AEEA 1A7PH 3GJEA 3PAYA 5F7WC 5I6NA 4PIBA 1M53A 5IW1B 1KPVA 5H35B 3DUSA 4WFGE 5J4MA 3QAQA 4TQEL 3HRZA 3S2AA 2Q10A 3MRKB 4PJ9D 3O3EB 3RTLA 4G8EB 2HTKC 1TCMA 2BCMA 3DLQR 3NT0A 4D0DA 2YBGA 3BQUA 3MX0A 3PV6A 3HI1A 2I07B 5JOEA 2BFVH 4JAMB 4KKLD 1BIIB 1XCXA 4R97C 4L48A 2J1YA 1AANA 5LBSA 4CVXB 1BVKB 3SHSA 2BERA 1BGXH 3MXVL 3VXPB 3PQYB 5IROA 4PRPD 4IBSA 1DVZA 1MH5A 2XWBA 4XN2A 3WTVA 5DK0B 2VDQL 1YEHH 4B5EA 5DD5L 3QZNA 4WGVB 2XV0A 3WFHB 4HCFA 3ZIYA 3UIYA 4QJ4B 2VLRB 3R4DA 3HNSL 3MBED 4KI5E 1A02N 2MH4A 2NTSP 3TONA 1YEGL 1CFQB 1O7DE 3UPRB 1PLBA 1YYCA 4ONHB 3HB3C 3LQMA 1OSYA 2WXGA 3UJTL 3UL4A 1RUQL 3X3GH 4MB1A 4RMWA 1OIOA 5DRZB 5HJBA 4DGWC 4L3CB 1ASQA 1MFCH 4HEMA 3IDYC 5KJ4A 4HKBB 3D2UA 3RPIB 2X9WA 1DUYA 3IU4L 3D4GA 4JG9A 1GAFL 1TZHA 3AADB 4IRSA 4BQCA 2XX1A 4YHPA 2UY6B 2X28A 5DI8B 3VRJB 3RZCA 4EBQH 1F90L 3HJEA 1MHCA 3T6VA 4KK6C 3O0LA 2OYMA 1ACZA 5A6LA 4PJDE 2Z9TA 4IBVA 3QJOA 2A6DB 4JFOB 4K9EC 2D7QA 1UH4A 1RKRA 3EO1A 4ODXA 3NCWA 4PY8J 4QXUL 3T9WA 4D3CH 5ITFB 4OCYL 3MCYA 1ETZA 5ALCL 2OMVA 3P0GB 1KGUA 5FB8A 3SQOL 3DX7B 4XP4L 4XNDA 1R75A 1XSJA 4Y88A 4ZUVB 1W6WA 4JQVA 3HW7A 3KYKH 1ES0A 3OQRA 1GTNA 1KCUH 2XVKA 3VXOB 1C9SA 3THMH 4CRPA 4KX8A 5G4MA 5LGJB 4G6ML 2H0FA 3L4YA 2UXTA 1BVZA 3EO9L 5I26A 3IJHB 3C60D 2F8OA 4YO0A 1DCEA 3TBYA 3TBVA 2B1HL 1LXMA 1HE8A 2F6AA 3QUMB 4HPYH 4YDLC 5F9AC 5AAWC 2MCMA 4WUKL 1M3JA 4N6RA 2Z92A 4I85A 5BV7C 3ZT5A 2GBUA 4HUXB 5C86A 1Z0NA 1R19A 4AUYA 4N68A 3Q2WA 3IYLW 4KTEL 4Q9QH 3BD4A 4PHXA 1WF5A 2BVQB 2HWZL 4GQ9H 1GC1L 3LDBC 3BGAA 1DBJL 4AGQA 4M43L 1I82A 2WYZA 2J6EL 3NSJA 3EH5B 2CLZB 3HFML 4FQJL 3AMLA 3IJSB 3FMGH 3ZDYF 2C1PA 3MNVA 3B2DC 4U1MA 4FXKB 1JPTL 1RFDH 2QTVA 5D9SA 5FGBC 3WFDH 4IBTA 5HGHA 5J9PA 2H6UA 3KH3A 1G9NH 3KYOB 4G43B 4PBDA 4K7PY 4RDQF 4KTDL 3W1ZA 3LKSA 3NP4A 4ICXA 2HMIC 2H2SD 4LCCC 3D50A 5DJAA 4DCQA 4HZLA 4DFIA 3IDMB 4UI2A 5I1HL 2X4OB 3H2WA 5ADOL 1R5WA 1YNTF 2ZZUT 4NZRL 1HCVA 2QZ5A 4PB9H 4H26B 1I8MA 3FB6B 1IGIL 5KG9B 3S35L 3QIBC 4GS7C 1I8IA 4PWHA 4HUNB 5I1LB 2KS0A 3JTSB 3T3MB 3A3YB 3K80A 2X7LB 1G4RA 5HPMB 2PP7A 3CDZB 1XVSA 4OLVH 5DFWH 2O30A 1A25A 2PN5A 1J8HE 3FBQA 3O3BB 5F0MB 2CNYA 4HWBH 2PCXA 3CVHL 4XMTA 4XPGL 4TQEH 3BO8A 4BWTA 3ARGA 4PV1C 3F7YB 4NENA 2PP9A 4BEIA 4O2EB 4JFXA 4P46C 5D5MB 4B95C 1ILSA 3K91A 1CICA 1I7ZB 4P5KA 3DO3A 4A2MA 1QAWA 4MQSB 4U4BA 3IETB 1KDJA 3GXPA 5HHNB 3MJWA 4WJ5A 4WNQB 3MXVH 2XVBA 1G1CA 2ATKB 1R46A 3LNHA 4HGWB 5DQDH 2CO6A 5FR3A 3HHSA 3QXAA 2VDQH 2HUHA 5DD5H 3SDXE 3K6OA 4N2EA 3KLHC 1I1YA 4N8VB 4UOJA 4X7TA 4K7PX 3HNSH 5E03A 5FAAA 3N2JA 4FXGC 4XXCA 4NHCL 2ZAIA 1YEGH 3QFJE 3LTVA 4QRPE 1XCQA 1L9QA 1OGAE 1D3CA 3UJTH 4P4RA 1RUQH 1QP1A 4A7TA 4Q9CA 5IK3A 5D7LB 2A83A 1H6EA 2PO6A 5IB2B 3GSWB 5IIEA 3IU4H 2FL5B 3UPCA 4TL5A 5SX5H 2JIXA 3BWAB 1F90H 3GQFA 3GMRA 3VSUA 1T7WA 4KHTL 2R1YA 2E9GA 3IFPB 7FABL 1U92A 3BH8A 4XNQA 3OMAB 4FQLH 4PRIA 4RGND 4D9RE 1S5HB 2ZXDA 4QXUH 5E2UL 2DWEA 4CSSA 4OCYH 4H1LA 1WCBB 1CQYA 4HJUA 4QHUA 4TLSA 2AS5M 5ALCH 4F7PA 4FGMA 5F97E 4PW3A 4JFFA 3SQOH 4XP4H 5GGQL 5T3ZD 1IMHC 5I6XB 1K9TA 5D7HA 1L4IA 2PPCA 4QXTA 2GUYA 2MHAA 5I1AB 3MLZL 1N8ZA 2AVGA 1EO5A 3X1NA 2YARA 4Y5XC 3U25A 4UNTA 1EHXA 2WWOA 4FZ8L 4G6MH 4GW5A 2DMGA 2J5WA 4KNQA 1TVHB 2DBJA 3FO0L 3EO9H 1QW9A 5ICYA 1Q1JL 5JPMB 3GUTA 1MW2A 2ZUQC 1Y18A 4OZIF 3IMUA 2B1HH 3NCYS 4U3HA 2QHLA 4KVCH 1W72B 4WUKH 2G30A 3MV11 4J3UA 3OPUA 1G6RB 3T77B 3KMDA 1NIEA 4KTEH 1MIML 4MDJA 1FZOB 1LEIA 4P2RA 2ZKXA 3PWJB 4WHDA 2HWZH 3O6KH 3QJXA 1GC1H 1BD2B 3E8VA 1DBJH 2VDPH 4M43H 2MOVA 3GS0A 4LARL 4WTZA 4TVUA 2J6EH 2CK0L 4G8AC 2FJHB 2ITEA 3KPPB 3MMEA 3QAZC 2WMPB 3WOVA 4MCNA 3HFMH 4YSRA 4ZUUB 5IVXE 3BH4A 2NY4C 4FQJH 4NUJB 2YD2A 1OAJA 1WVZA 4MJHA 5EHFA 5EEXA 1LP9A 1NCUA 2VAJA 1JPTH 5AOKA 4P3CL 5C0CD 4PCKA 4MXWH 3I02A 5JIQA 3L13A 2ILLA 3L3KA 1NJ9B 5CLWA 4KRPD 4XE0A 4KTDH 2WIIB 4QUOA 2Y2WA 3H7BA 2EIEA 3WSQL 4N0UA 1VF5C 4MMZA 1IE4A 1URIA 1NMBL 1PNCA 3P2DA 5IJKA 4WW2F 2KPWA 1A47A 2VLJD 2C9QA 2J12B 2XN2A 5ADOH 2KT6A 3HC2A 5CR8A 4HK3J 2ZF9A 4I87A 2YA2A 2JB5L 1IGIH 4WTZG 3S35H 4PTTB 1VHPA 4P4KC 2XICA 4IBLT 3TFBA 5BS0A 1KTDB 4P3WA 2DJSA 4CMMA 3TV3L 1ITCA 4Z5RA 1HOCB 4W9EC 2P5EA 3NRPA 4TSBL 3BIBX 3QUGA 3RGVA 3ECBA 3CVHH 4XPGH 1A21A 2WQAA 2VNCA 2JH2A 4HA1A 4QTHB 5LWYH 2COVD 1H5BC 2JCCB 3MRNB 4FQQA 3B8YA 2EXWD 3CWGA 3HE6A 4FHBD 4BFJA 2V9RA 3DX1A 4LZKA 4JREB 4QKXB 4E68A 4YSQA 1AXSA 5E4OA 3B4NA 4OGQC 5FYJL 5I71C 5M94B 5IW3A 5L2KB 3QI9B 2FUTA 4YEEA 4Z7OE 2JKIS 1PS3A 1UADC 1H9VA 4W9LC 3DUHA 2EDLA 3L3OB 5IEKB 5IW1A 1T0MB 1JZHA 2GG1A 4WFHE 5H35A 1IKOP 3ISWA 3MRKA 4PVMA 2DIEA 3RTQC 2OS7A 4NN7B 1DVSA 3O3EA 3NP3A 4NHCH 2ODHA 4G8EA 3HPLB 1YPZF 1TFHA 1AZBA 2WLNA 1GGTA 4JRLA 1MXGA 2Y25A 2I07A 3GMOB 4JAMA 2R27A 4GUPB 1O5DT 1VRSA 5JOFB 4CVXA 2B0SH 1BVKA 1IGMH 3VXPA 3LPWA 2IDCA 1JTPA 2ADGB 1YG9A 2VDRB 2ZXEB 3PQYA 2X0UA 3CHRA 1JZ5A 1JXFA 3CCHB 4MZRA 2X4TB 5SX4I 4JFPB 5JMOC 3LB6C 1WICA 5DK0A 1DTUA 4S2SB 4QXVA 1NGZB 2IMNA 1E8ZA 4IMKC 1HIML 1BIHA 1GIGL 2VLRA 5JMRA 1KB5L 4KHTH 3QIUA 3FUHA 2OI9C 1NZRA 2XV3A 3L1GA 4AVHA 4UTBA 4AGOA 1CFQA 4NKDB 7FABH 1CDBA 1BREA 3OF6A 5EU6D 3SD2A 5L7XL 2YGOA 4ONHA 2P46B 1P7KB 5E2UH 4KJQC 3FT2B 5DMKA 1Z9SA 2WB7A 5DRZA 1FZMB 1WAPA 4L3CA 4KY1L 2PXYD 5GGQH 3MLVL 3LKRB 3RPIA 4XP9L 1CXLA 2VLKD 4PD4J 1DO6A 3ARWA 3MLZH 5FWRA 2UY6A 4NGHL 4FZ8H 5DI8A 3VRJA 4HUWB 3OJ2C 1D5IL 4FABL 3FO0H 1G87A 1Q1JH 1KF9B 5C9KA 4ZFZB 5D7KE 1SDAB 4F20A 2WKLA 3IVKB 3K0WA 2RCSL 1WQVT 5ESQA 4XNXH 2A6DA 2D3VA 4JFOA 2CM5A 2VN4A 4JFUA 3GSOB 4KJWC 2CHNA 3IFOB 1KXTB 1VADB 4JRFA 1DVXA 3CXDL 5ITFA 4L8CA 1R5VB 2D4FA 4W9JC 3MTXA 1MIMH 1QACA 4GRLC 5FO7B 2VWEE 1M2OA 1AO7E 1U2YA 2EINB 3JTTB 1IL1B 3DX7A 4MYWB 2OMTA 5KSAD 4ZUVA 1EJFA 1MJ8L 4LARH 3FUMA 4ZW7A 5E4AA 3QIWC 3QULB 4N25A 3MLSL 2CK0H 3VXOA 2KBGA 5EORL 3G7TA 5KVFE 5I66B 5LGJA 2Z7WA 1KJVB 3QZBA 1T22B 5LBGA 1GZQB 2ZUTA 2QLVB 2NQDA 3IJHA 2J43A 3MTRA 1P7QA 3Q2VA 1AHKA 2Q8BL 4X9FA 5F7DB 3WEMA 3GEWB 3FTXA 2X05A 1CWVA 3U4EB 1N5AA 5BRZB 3QUMA 4P3CH 2WXRA 1JXKA 3SDAA 2EDDA 4L4VB 4O02B 4N90E 4HUXA 4HH9A 2AXJA 5ABAA 5KZCB 3SO3C 3ARGD 1NMBH 1JWSB 1EAOA 2BVQA 1W15A 2BS71 3BAYA 4RAVB 4IEFB 2ZP9A 4K8RD 3VM7A 2JB5H 3I3DA 5TDPA 2CLZA 4HF5L 3WNOA 3IJSA 2H41A 1XF1A 2A4CA 1HZLA 4LNRA 5LCVA 4H8WL 5JLZB 4I48B 3ATBA 3R0NA 5CZKA 3TV3H 4TSBH 4G43A 3KYOA 3U48A 1NCHA 1CLYL 2D4DA 3BAIA 5AYUL 4ZX5A 2K4AA 2BOBB 2CCLA 1VEOA 3MUY1 2C9VA 3UIZA 2G60L 4TQPA 1XQ4A 3TYFB 1ECZA 2VZTA 2ENQA 3IDMA 2H2PC 4HJGB 2X4OA 3UH8A 3DSNA 4HXBL 2XBZA 1VAHA 2DL2A 1N0XL 2K8QA 4ZJ9A 3ME0B 4F9LC 1WBXB 4H26A 2J8UF 4L8SC 3JV0A 1T1YA 2EXYC 2YEVB 4Z7VE 5FYJH 5I1LA 4HJ1A 2IV9A 1PX3A 2X7LA 3CDZA 2BNRB 1NFDE 3GZOA 3NPSC 3O3BA 1QWNA 1UKTA 3ZRSA 5ACZB 1N3NB 5FHAL 2VLLA 5DZVA 1W0WB 4YBQC 2YFOA 5JIHA 1DQVA 4AENB 3VU2A 1U3NA 2BY3A 3B56A 2XZAH 4O2EA 4O5LH 1NOFA 4M1DL 3H2QA 3HRPA 5FYKD 3EH2A 5EZLB 4JDVB 3C5SB 3QWRD 4JFQB 1BJMA 5D5MA 4PIRF 1I7ZA 3T0ED 2GIMA 2EZ0D 2FIRT 2H32H 2P42B 3IETA 3PE9A 1W16A 1UH3A 1YECL 1YAZA 3W82A 3AS2A 3ZDZF 4FOMA 2YAQA 1M9WA 1TQVA 1L9TA 2ATKA 2LVEA 4HGWA 4JFFD 4LHJB 2H1LM 2H0PA 2ALAA 3CJJA 4F33B 5KWYC 3GSVA 3M46A 4QRUB 3JT0A 4J8QA 3P9MA 4N8VA 1HIMH 4Y8DC 1GIGH 1IC7L 3F5WB 3MNWB 4F8PA 5DHVB 3GMQB 1KB5H 3DGGB 5EC1B 3TVMA 1PEWA 1LEGA 1VFUA 5L7XH 1IEBA 5F71A 3BP4B 2EUZA 4BFKA 4KDVA 3QEQB 1M42A 2LV4A 3P2TA 4B27A 3CXFA 4KY1H 1WZMA 5D7LA 3Q5TA 1IQDA 4ZOEA 3DJRA 1HAUA 3MLVH 3UROR 3BDXA 5IB2A 5FWQA 3FO9B 1G9NC 3GSWA 4XP9H 4WI6A 1OT1A 1OSPL 2FL5A 1PZ2A 2P7TB 2OJZL 3MUGA 1BM7A 2QQKH 3MV9A 2Z31C 3QHFL 5E1AB 4NGHH 2FWLB 3EUDA 2ZXGA 3ARFD 2G2RB 1D5IH 3BWAA 4FABH 1VIWA 5DA0B 1DSFL 4TMPA 3P3UA 4EKJA 1JPST 2RCSH 4A66A 3IFPA 2BWIA 2HVKB 3OB0K 4P3DB 1KXVA 3HE7D 1XGPB 1S5HA 1E2VA 3VWKB 3VCLA 3CXDH 1KCLA 4PJCE 1WCBA 2BVUA 1KENL 3BUQA 1H6UA 5JHDB 5GGUB 4OBRA 3JV6B 4NCC2 1L7IL 4XMLL 1MJ8H 2HA1A 1XO8A 5I1AA 3BMVA 5ADPL 3MLSH 3FRPB 3GS4A 4RH4A 5EORH 4B0MM 3ZO9A 5DZPA 1FN4B 1TVHA 2YN5A 1SRDA 2DM7A 2NY0D 1A4CA 3K81A 5JPMA 4NJAL 2Q8BH 3MODL 2YD0A 1KT2B 2D2OA 4GJTB 2VO5A 1T0NB 4PJ5B 5I0WA 5J57B 3TESA 1NFIB 5LGHL 4TUOB 2DI7A 2E46A 3CFJB 3ZT7A 5FDWA 4ZO6A 1G6RA 4K5OA 2ZXBA 4WV1C 1R1CA 5HYSG 1Z0MA 3T77A 4ODHH 5KANG 1MIEL 3RGVD 5K9JH 1FZOA 2H8PB 3KLSA 3TCXA 2A4ZA 1E9PB 5EF1A 4OBSA 3RU8L 3NIGF 4JVWA 2YD4A 4AYGA 1CGYA 1JGIA 2GVYA 5EZJB 3KPPA 3P4LA 2WMPA 4NS0A 3X11A 4ZUUA 4FYTA 4HF5H 4YDIL 1CCZA 4NUJA 1BECA 2DYRB 3JWDL 4NJ9L 2WZPA 1P1VA 1B0RB 3HZ3A 4H8WH 2BY0A 4PJFE 5C0RL 1MFVA 1MREH 1NJ9A 5I8OL 4K5MA 1T66C 2DI9A 4X5PA 1CLYH 4URTB 4LE8A 3ZE2B 1AZVA 5AYUH 2WIIA 1Q38A 3OKNB 3QC5X 3RWDB 3TCLB 1MWOA 4LQFL 2G60H 1A7QL 2XA8L 4JHVA 5F8RC 3T3PB 1VZHA 4PJ8D 4HXBH 3BMWA 1N0XH 2Z7UA 4HG4J 2GSGB 1DBML 2O61A 4JB9H 4M7LT 1T2QL 4JFEB 4PTTA 1J8SA 1DVFD 4ETYA 2WQRA 3V6OC 4Y2LA 2EYRB 3VDAA 3L5HA 1RJLA 2ITDB 2L4OA 1HOCA 4WI8A 2P45B 5FHAH 4HCRA 4AH2B 1RY7B 2MCG1 1AD0B 1NUGA 3HN5A 2FQFA 3CZSA 4ATWA 2NY3D 1VGKB 4M1DH 2JCCA 3MRNA 3L2MA 3QHTC 4KI5F 4RDQG 1RZIB 2UX6A 4AG4L 2DQJL 3FC8A 3SOBL 1FFQA 3C09C 1FHNA 2I27N 3QISA 4OZFH 2CJUL 1CXIA 4A39A 2E76C 3V4PB 4ZXBC 5L2KA 4KZ0A 2Y72A 3HB3B 2ZKWA 3O4LB 2O93L 4LSTL 4N0CD 3AWFA 4DKEL 1FZKB 2NZ1A 4LPYA 4NAJA 1U8LB 3L3OA 4PS8A 3MJ9A 1GC1C 3IDYB 3FTSA 1QSVA 3LPGA 4LK4A 1FHGA 2X2HA 1MRCL 2VZOA 1C5BL 3HPLA 3GMOA 4PJDF 4GUPA 1SN2A 3D06A 5JOFA 2VXSL 2A0LD 1OZTG 1JYWA 2W91A 1QR1B 2ADGA 5I1JL 4JM2A 2NXYD 2X4TA 4HWNA 2D3LA 3FTGB 4JFPA 3BT0A 3VFPB 4S0HA 3AREC 1R4XA 4IRJC 3W2DL 1OSPH 4M7JL 3QJVB 2OJZH 4NNYA 4S2SA 2JK5B 5AW7B 3EHBC 3MLXH 1CYGA 4DOHB 1VA9A 3NSCA 1GS8A 4J4PD 5D4QA 1J0YA 1DSFH 5F7UA 1JL8A 1Q9KA 5SX5K 4FQ2L 2H4EA 1TMQA 1FYHB 1T5WB 1SDYA 1MWAB 2JKWA 3C75A 3QQDB 4XBPB 4FA6A 5DHYB 1P7KA 1NBCA 4TF4A 1N68A 3SDAD 3CX5K 3IDIB 2X6UA 1VPOL 2YR3A 3BWSA 1NDGA 2IFGA 1KENH 1FZMA 3H9HB 4JEGB 2F7IA 4YDLB 3ESUF 3K6IA 1L7IH 1XF3B 3LKRA 4XMLH 1CLVA 3ILEA 4JLRB 5CCGE 5ADPH 2EVJA 3BWUC 1XZ0B 5BV7B 4TQIA 4DPAX 3UTSB 1EEZA 4HUWA 4APQA 2CUIA 1Z9PA 4ZW6A 3P4MB 2WTRB 3KLAB 1QRND 3LDBB 4NJAH 4ZFZA 1GTFA 3OWEA 4HT1L 2FHCA 1OF0A 2QVMA 3IVKA 2VT0A 2Q2EB 4G6FD 4UTAA 2FX7L 4MJID 5L0QB 5LGHH 3FSZA 1T3FB 2WNWA 3ZSSA 3CC1A 3GSOA 3ULVE 3OZLA 1E5CA 1KXTA 5DJCA 4GI6A 1VADA 3O0RL 4NYLB 1JK8B 2M83A 1ZLDA 5CJQL 1TFPA 2J1KA 3MYJB 3NJHA 4LESA 2VDMB 4OLWL 1MIEH 2OR7A 4R4NC 1IL1A 2R0KH 2XVGA 4EJ1C 5HGGS 5A2BA 5J3HD 3RU8H 2BCKB 2X87A 4HOZA 1D5RA 5HYJD 4RMVA 5I66A 4C8XA 2CUHA 1KJVA 4YDIH 5CUSL 4UAOC 1GZQA 1ASPA 1AFVL 5JHLH 5F7DA 2O5YL 3JWDH 3N06B 4NJ9H 3U4EA 2DKSA 3MRLB 5BRZA 4I9WE 2EIDA 3SGJC 1JVOA 1GSKA 3VFOA 4L1LA 2QR0B 1F42A 3B9EA 5C0RH 5DVNA 5I8OH 1CI5A 4L4VA 4O02A 3RWHB 3QIBB 2CH8A 4KKQA 2Q3ZA 2EYTA 2J21A 4PJGA 4LQFH 4UDTB 1JWSA 4LOFA 1A7QH 2XA8H 3V5DA 2VSCA 2XU9A 5I5JA 2FTAA 4IEFA 5BZXA 3TTSA 2DWSA 1DBMH 2FR4B 1D5BB 2AABL 3O6LL 4B9GA 5F0JB 2X2IA 4LSVL 4YFDB 4FP8L 2YEZA 5HYFA 2YRZA 4P46B 1F6AB 4G5ZL 3S8GB 3ZYJA 3V6ZB 2YD6A 4X4XB 4TTGA 4GP8B 2AKRB 4Y1AE 1SOXA 4CU8A 1WP6A 3CPUA 2E6PA 2BOBA 5DURB 5D1ZA 3UJJL 2X6CA 1ZHNB 4MB4A 3TYFA 4NQDE 4HJGA 2HT4D 4N2LA 1JF6A 1WAEA 3PHAA 4Y19A 1HEHC 4AG4H 2DQJH 4ORGB 2FYVA 3SOBH 4DT2A 1U8JB 3N40P 5B4MD 4U3SB 3SZ6A 4GG6E 1WBXA 2D7TH 4GMTL 4PWKA 1ROCA 4FXGB 4P5RA 2CJUH 4CSZA 5IQNA 3K6NA 4KDTC 4NIYE 3B2UD 1WC7B 1WWWX 4JKWA 3TA3D 4ESKA 2OTPA 4LSTH 3KWVA 1NLBL 1KDIA 4DKEH 1JI1A 2ZXWB 4JPIA 3CN4A 5ACZA 3B9VA 5C9JB 3MV9D 4ZFFA 3A5VA 1W0WA 1AQMA 4PS7A 3HZMB 4AQEB 4AW4A 1MRCH 4H0IA 4KK9C 1C5BH 1TQTA 2F5BL 2RFXB 3QUZC 3C5SA 4JDVA 5EZLA 4EN3C 4PJHE 3BSGA 1LP9F 4JFQA 3TFKD 3OHXC 3W0WB 4KH9A 2OJ1A 3EH1A 3OKMB 1NFKA 2CE6A 4M29A 2VXSH 4PJIB 4CMHC 1ZY9A 3MNZB 3MRDB 3KPSD 5FV2A 1GMEA 5I1JH 5EIQA 2EXTA 1AQKL 1KBVA 3UERA 2DQTL 5B7FA 3N44F 2OZ4A 4C59B 4GT0A 3W2DH 4BK5C 4Z3FA 3VD1A 3EGXB 2XG4B 5F3FA 3MLWL 1BXUA 1XSKA 1KY6A 3MRFB 4QRUA 1CURA 2Y1VA 4FLQA 4K73A 3VD3A 3MNWA 2VMFA 1Z9NA 3F5WA 5ERWB 5DHVA 2YUVA 3GMQA 5I1EL 2F58L 3FQXA 3DGGA 5EC1A 4FQ2H 1MG2C 4QOKB 2JSFA 1YQ2A 3IAQA 4Y5XB 1MRDL 3BP4A 4AZ8B 1CDIA 3QEQA 1VPOH 3SY6A 1XF2A 2Z4TA 5CWSA 3S35X 3HEIB 2AQ3A 3QNFA 2ZUQB 2R8SL 5B38B 2FT8A 2FZ3B 3MQIA 4NN5C 3PABA 3VE0B 3FO9A 3Q9QA 1IJNA 1BX2B 1XMWA 4R96A 5EU4A 2P7TA 3V0FA 1ZT1B 2IALB 5E1AA 3VXRA 3RZWA 5I5MA 1BFOB 4HS3B 5B22A 5EEUA 2R1XB 4OW6A 3CDGB 2G2RA 2IOOA 2KLTA 1E4XI 3MLUL 5KOMC 3QR2A 4HT1H 5IVXF 3R7RA 1XGZA 2FX7H 1F5WA 4P3DA 2GABA 3S9DB 1XGPA 4ZPTB 4LT7A 3VWKA 3O0RH 1C5CL 4GRWB 4OLWH 5JHDA 3PGCA 3Q8CA 1MCKA 5GGUA 2UZPA 2DLIA 3JV6A 4JY6B 4JN1L 4X6BA 4PBVC 2HLFC 1SNRA 1OOAA 1GGCL 4TN9A 2N7AA 3LEVL 2VQUA 4QLRA 3P3SA 1D9KA 2AQSA 2NZ9C 3FRPA 3EZJB 4FYRA 4MS8C 4XO4A 1RCYA 2VYRE 3ARBD 1FN4A 4JX0A 3Q2LA 4O2FA 5D93C 5FGCB 5CUSH 5KSBE 3NZ8A 1ADQA 2A1WL 2H9GB 3G5XB 4OFVA 2ED7A 2O5YH 3D3VD 3QNZB 4BZ1A 2MCPL 2JELL 1T0NA 3AGWA 4PJ5A 2AXWA 3BGMB 4TUOA 1EVTC 3CFJA 4QAWA 1TJGH 1NUFA 3MHZA 4B53A 4ZX3A 3H9SE 1TT6A 4EDWL 1KTKE 5T1LB 2H8PA 3FKUS 1HCYA 1N6UA 3D85A 1E9PA 3MGTB 4QHNB 3GSQB 3JWNG 1UASA 3O11B 5KS9B 2D31A 4TLKA 4X6CE 3CFNA 3C5JB 5GQBA 1YA5A 3E6HB 1T6WA 2C9RA 5EZJA 2A9ML 3GGWB 1MY7A 3DHMA 1VFOA 4PD4K 2AABH 3O6LH 3TH2T 1KOAA 4LSVH 4FP8H 4OJFL 1BAWA 4F2MB 2ENJA 3C12A 2UYLB 4OZHE 2K6ZA 4DEPC 2ARJQ 1VEPA 1DVTA 3L45A 4RA0C 5AOZA 5EO1B 3MA7B 4WEUD 1TU2B 2DIJA 3NSDA 1OQOA 2WUBL 3ESOA 3BVNB 4HIEB 3SGEI 3TC9A 1LWRA 4Z7OF 1KJ2L 2DJUA 3RWDA 1Z2KA 4JDEB 1F45A 3TCLA 2BRQA 1A6TB 2B1AL 3FDWA 5CJXA 4V1DE 3GSNA 2QVFB 4WNJA 3NJGA 1EXGA 2BS8A 1FF5A 2GSGA 3VW3L 4GMTH 5HDLA 4G1MB 1WHPA 4FLRA 3UG4A 8PAZA 5GIRB 2IAMC 1KELL 4WI9A 5TQ0H 2YD8A 1NKOA 3KH4A 3APMA 2OL3L 4JM2D 2NZIA 4QRRA 4PI2A 5J13C 2VDLL 2EYRA 3HOGA 1W2KT 1NLBH 2BM3A 2ITDA 1HYRC 1Q0XL 3F00A 3SCMD 4HSCX 4AH2A 1NAKL 2ISDA 3TJEL 1F18A 1AD0A 4WFFE 4JGMA 3O8XB 4EQ2A 2CHXA 1NWPA 2NXZD 1VGKA 4XTRD 4Q89A 1ESOA 2F5BH 1RZIA 1ZPUA 2WP3O 4DVBA 5A2FA 4Q9RL 2PTVA 3GRBA 4KFZC 4PJAE 2H5UA 4A6YB 2Y9RT 4XN7A 3KPLB 2OI9B 2ZE0A 4NM4L 4NDMB 4R7DB 1UWYA 1AQKH 2OMXA 4PGCB 2DQTH 2FLRT 4RISL 3V4PA 3VI3E 3ES6B 4ZS6C 3QJSB 4JQXA 3O4LA 4NC0B 4WWKC 1FZKA 1PKQB 3MLWH 5EFIB 5AVRB 3GDBA 3SDDA 4ZMVA 2X1WL 2HPTA 5C0ND 2N0MA 4OT1L 4X6DE 3UEQA 3NBNA 5I1EH 2F58H 2HFFB 1I9EA 1OTUC 4URKA 1KIPB 1UEMA 2FSDA 3IJEB 4FNLH 4RFEB 1MRDH 3KPMA 2N01B 3WIHL 1JDCA 2Q7NA 2WKOA 3DJTA 4H8WC 2R8SH 4AE0A 1QR1A 1L9RA 2NR6D 3LEYL 3L7EB 4DGVL 1VERA 3IMTA 4YWGH 3FTGA 5E9AA 3VFPA 1CLOL 1WFNA 1YMHB 2QKIA 3Q6FB 1AGEA 2JK5A 2X9XA 3A6BL 2EAEA 5CR1A 4Y7MA 3SE4C 3F7RA 3OKEB 1SJVA 1FO0L 1UUNA 3BQVA 1Q0EA 1XB8A 2Y3NA 3MLUH 1A1OB 5CS7A 4HKJB 1X5AA 3QIWB 1MWAA 2CKNA 4JFDE 4DN4L 3ILQD 5DHYA 3VXUB 4JRYE 2EEAA 2UY7B 3IDIA 5EMYA 3DV6B 4XHQA 4WSKA 4GBXB 3W11C 3IMVA 1OP5K 1ZCRA 3H9HA 5DS8B 2WN2A 2IXQB 1ND0B 4JN1H 1XF3A 3RRQA 1GGCH 3ZL2A 3LEVH 4I3GA 4XPBL 4JLRA 1BFTA 4HIQA 5LAXB 4PUBL 3UTSA 1ED3B 3FQTB 4CN6A 1INDL 2WVTA 4HJ0C 4YNYB 2VMEA 3VGHA 1T21B 2WTRA 3KLAA 4F9PC 5G4OA 3VXMD 2MCPH 1I7UB 2JELH 2VO8A 2GK2A 2WYIA 2WNKA 1T3FA 3FNKA 3ARPA 5E6IC 4Z9KB 1JYVA 2XNAB 3SPCA 3D0VB 1MCLA 1PZUB 4NYLA 1JK8A 3KBFA 4P2OA 3MYJA 4EDWH 3BT2L 2LLLA 3UGUA 3QRGH 4C56B 2DYSB 3U0PA 2HJFB 5D1ZD 5E70A 5F6HI 2CRZA 1M7DB 2Y7LA 4I1PA 2BCKA 2HRPL 3EF7A 1GVIA 1J1PL 1XX9C 3MRBB 3VVWA 3WYRA 4Y19D 3WTUA 1YYLL 2LU4A 1OARL 4PLJC 2ADJB 5HJDA 4HUVB 2WSDA 4W9DC 1R33A 4P2AA 4DO5A 2GYSA 2P4AB 5T3ZL 2EJ1A 2BSTB 2EDHA 4OJFH 3C5XA 1NQBA 3WMQA 1D7CA 3MRLA 2ITFA 4RX4D 1P6AB 4CW1A 5CN3A 4HALA 2ADYA 1PD1A 4Z7VF 4JRXD 2DI8A 5T3XD 2WOYA 2QR0A 5I6LA 2DF3A 3RVTD 2YPLD 4L8SB 2WUBH 2BSBA 3RWHA 3QIBA 4CKVX 4NBYB 1KJ2H 5K1NA 2BY2A 1NBZB 1P6FA 2E4FA 2MNUA 5E4IA 2B1AH 1OW0A 3MROB 4NPYA 4AITA 4ZAKC 5CMAB 3VRLF 3WS6A 4BJLA 4CILA 4I2XE 1G0XA 2AEOA 2CA4A 3VW3H 1D5BA 4YE0A 1KELH 4CGUB 4P46A 1F6AA 2OL3H 5A2AA 1JNHA 5ICXB 4NP9A 2VDLH 3CDCA 3V6ZA 2CUAA 4X0NA 1AHWC 5HJGA 2AEIT 1J0JA 3EDDA 3IJ8A 2P47B 4WZ9A 4ZFQA 4NPKA 2AKRA 1NAKH 3TJEH 4BE6A 4LDCA 5DUPL 2D0GA 3GXDA 4E5XB 3WFCL 1M6UA 1ZHNA 3TEWA 2CSPA 4IDLA 4BKLB 2FATL 4K71C 4YR6B 3EOAB 2FGZA 3WN5A 4HOWA 5E94B 4JN2B 1BM3L 4KNUA 5EPMB 4B9PA 4NQSB 2JV6A 4ORGA 3VH8G 4JZJC 4Q9RH 4D7PA 1U8JA 3I50L 4U3SA 4OD2B 5GGVH 2BSRB 4EE2A 4FXGA 2ZP0T 3RUGB 2W65A 3N91A 4FFZA 4RISH 3MKKA 2CDEB 2JKSA 1CR9L 1ULVA 5E8EA 3EJYC 1BXVA 3ISRA 4IHBA 4YFEA 1SLWA 5C9JA 3LRMA 5CEYB 3VXRD 4XMWA 5LBSL 1KPRB 5JIKA 4OT1H 2BW4A 2YSSB 3ARDD 5BO0D 2I7SA 3ZDWA 4YH6A 1BQLL 2RFXA 4G9FB 1A6UL 3ZKQD 1DFXA 2Z31B 5L8JB 4HZ1A 3W0WA 1UKSA 2W81C 3OKMA 1G84A 1W6LA 5FXCH 4Y2DC 4PJIA 3JWDC 4GRWE 3AT8A 5EUKB 3MNZA 2D73A 3MRDA 4LHQB 3D33A 4PJCF 3LEYH 4G7VL 1F8TL 4DGVH 4WI4A 1CLOH 3ALWA 2FH8A 4AMWA 4QHLB 2F61A 3E8UL 2XG4A 3EGXA 3K8MA 1D9KD 1XCTB 3A6BH 3HS0B 3MRFA 5E0QA 4R7LA 2XN1A 1TVDA 1FO0H 5ERWA 2WKGA 3BDYL 3EYOB 2VDNB 2BP3A 4XMKL 4CU7A 3BVTA 4N2FA 2BNUA 3EGDB 3QPQC 2CCWA 4Y5XA 2OQJA 4DN4H 2F8VA 5MHSD 1AGFB 2IO5A 5DHMC 3KXFE 4AX3A 1QPPA 4HFUH 3ZZQA 3LS4L 2ZWKA 1GOHA 4DJMA 5FO9B 2ZOOA 25C8L 5B38A 3VFRB 4YHZL 1GOGA 2BZ7A 4XP1L 2BHUA 4X5RA 3V55A 3D85D 3VE0A 3TO4C 3WFEL 1BEYH 1D2PA 5KS9E 1KACB 1FBIH 1ZT1A 2IALA 4WSGA 2N4IA 3KPRD 4PUBH 2PWHA 5DJZB 1BFOA 2VR7A 4HS3A 4KO5A 4XB3A 1UTDA 2J56A 3CDGA 1A8ZA 5MEQA 4ZS7H 3V7MA 4X99B 1RP9A 2VDQB 2DMBA 3MV7B 1ZGLP 4GXUN 2OMWB 3UX9B 4ANWA 2B14A 1QSEB 1ZMYA 3AWGA 4AV0A 4ODWB 4ZPTA 4PJFF 5CINH 4PGEA 2B1OA 3DVIA 5GZND 2FQEA 3BT2H 3AQZA 1UCBL 2IOIA 4KK5D 2MSPA 3BVXA 2X53A 1PFCA 2HRPH 3FZUC 1J1PH 3BHBA 3TJHC 4ZO7A 4PRAB 1YYLH 4U31A 4LLMA 2N1KA 3VFTA 5T3ZH 3VXQB 1P84K 1QI5A 3MJ7B 3K5RA 3UBXA 3AS0A 2WXJA 1XH1A 3BGMA 1ZLWH 2C9XA 4PYGA 1UXSB 3G9AB 3B2VL 4GW4B 3J2PA 4MRCA 1DZ0A 4KKNA 4RSVA 1YRKA 4DP6X 3MGTA 3GSQA 5C08B 1GY1A 2ZD0A 3O11A 3WTXA 3K1DA 1SDDB 4LB8A 2MQ0A 3GGWA 4LVOC 2A73A 4FHJA 1CE6B 1DJIA 1BZEA 1TQWA 2BWQA 1PIFA 3QZWB 5CN1A 4F2MA 2OXGA 2UYLA 4DP9X 4PS3A 1T04A 2OXHB 4YQXL 1JOIA 1RK0A 2VZSA 3C09B 4G8GB 5EO1A 1PKQE 3MA7A 1Q9WB 4B9YA 3UBXG 5CEZL 4HIEA 4UWQB 3BVNA 3HHMA 4BSVA 1T1ZA 3RFZA 4P06A 5DUPH 5EOTB 4Z76B 5CZVL 1DBKL 2C1OB 4JDEA 3SDDD 3T4YB 3WFCH 4ZXBB 3HG4A 1A6TA 3LPPA 1NICA 2NSXA 2FATH 3RWCB 3BLBA 3T1WA 2GC4C 2Y69B 1ZXKA 4NRXB 1BSIA 3PCYA 4ZUWB 3FTZA 1CUOA 3N1PC 4N2IA 3QRLA 5D70L 3SY0B 3I50H 2A2QT 2VDPB 2MOGA 3LIUA 4G1MA 3EGSA 1A6VL 4X5LA 4PVNA 4YPJA 5F93C 2YO3A 1QATA 2EO9A 3IGFA 3V4VB 4Q2ZB 4Z95L 4QGTA 4K8RL 2HP4A 3VFMA 1EZVY 4E41A 3M17B 2IBGA 5C2UB 2DQ6A 1X5GA 3O8XA 4IOSD 3HBGA 1E27B 4Z7UB 2A9DA 3L9YA 4XHJD 3AREB 1LYQA 1DBBL 4XWOD 4OIAA 1BQLH 1A6UH 2EEFA 4PV9A 4R0LB 3EHBB 3OKYA 2NY1D 4GSRA 4D94A 1XIWD 4J12A 4GINA 1HXMB 1G7IB 3KPLA 3RPKA 4A2HA 5HHXL 5I0DA 4NDMA 4G7VH 1F8TH 4R7DA 4FX5A 4PGCA 5SWZA 4XZUB 3N85L 4RWYL 5C8JB 3KWWB 3E8UH 3U30C 5EFIA 1TTRA 4TYUA 2P49B 5CLZA 1K6QL 2IQ9L 5MENB 3BDYH 4ZYKB 4R2GC 3N43B 2HFFA 3QXVA 4XMKH 1ZJAA 2PCFB 2ZP8A 5DHDA 1KIPA 5AFAA 1FGVL 3IJEA 1ID5I 1C12B 1ZANL 4RFEA 1PU0A 1QFOA 5IF0A 1I3UA 4TVPL 4LHUB 4QJ5B 3LS4H 4BXVA 3QORC 1T83A 3HLAB 3IU3B 4U1NB 4P2OD 5FYKL 4C56E 5KJ7E 4MMXA 3JVGC 4YHZH 2I32A 4OLYL 4P49A 4XP1H 3L7EA 2Y2YA 2Z34A 4JFZL 2XTJD 4LEXL 3BN3B 4PN6A 3WFEH 1YMHA 3WFZA 4BFFA 3Q6FA 3X1EA 5H8DA 5D7IE 2BZCA 1I7TB 2EILB 4HJTA 5B39A 4Y4FD 3H2PA 5BZZA 4KY2A 4JHBA 4QF1B 3OKEA 3ZL4L 1EZVX 1IGYB 1HYSD 1O9VA 2ED9A 2MMXA 1A1OA 1MY5A 4L4JA 3RWJB 3QIWA 3RB7A 5JPNB 1J12A 3CFKB 5HGDB 3VXUA 2UY7A 4UQ2B 2JB6B 2WBKA 4UAOB 3DV6A 4KKZA 5GS3A 1CDJA 4CVZB 4GBXA 1SFDA 5E2VL 1X5LA 5DS8A 4A68A 5L6YL 1ND0A 1K8DB 3B2PA 3FU8A 1A64A 1KN2L 2J88L 3BAKA 3PJSA 2K70A 4WFGD 5CHNB 5LAXA 1ZV2A 2V2WB 1QLEL 1ED3A 3FQTA 5HVGB 2H45A 3VSTA 5I6MA 3SDYL 4XNUL 4U3XA 4YNYA 5IESL 3K46A 2ZWLT 5B39G 2NW3B 2Y1ZA 4EZJA 2VMJA 5DJYB 4G9DB 3FW6A 1I7UA 3I3EA 2WLKA 5F6HJ 3HS8A 3T5WA 6TAAA 3ATAA 2XNAA 3D0VA 3B2VH 1EIBA 2OSYA 2YFNA 3CNKA 2WD0A 3KWTA 1V8HA 4IW4C 2ZUYA 3W3BA 4CC4C 4XNYL 4GSQA 1FL6B 1M7DA 3F7VB 3EDFA 4LEEA 3MRBA 3U9PL 4AV4A 4KI5D 2ADJA 4U6HB 4MNGB 5BMFL 4B7LA 2BSTA 4Z7WE 1JDDA 5C97A 4HDIB 4GG6F 3IXAB 5DEFA 5KYYA 4K94L 1DEEA 3EDEA 4RDBA 1D6EA 1IVLA 1I1AB 3OZ9H 5FFGA 3EIFA 4PJ9C 5CEZH 4N20A 4L8SA 1FV1B 4WWNA 2FO8A 3RIFF 4XPAL 1L3NA 1UOKA 1DBKH 3IF1B 1NBZA 4HHAA 3DX9B 2RQ8A 5DT1L 3FQRB 4OF8A 2IANE 3SBQA 3MROA 3ZGIA 3EO0B 4N6QA 3SD5A 2DQFB 2UWEB 4DP1X 3ARSA 5L4JA 5F1SA 1IAKA 4TUKL 5D70H 3JT2A 4PJHF 3ATEA 5DJ8A 4UZUA 3TP4A 4NSKB 2WXQA 3D8MA 2DDQL 2JJVA 4ODBD 5K59F 1A6VH 1FRGL 2PW1A 3QUZB 4EN3B 2WXFA 5ICXA 2P5WE 1NCBL 3RI5K 5KEZA 3BYTA 4N2NA 4HULB 4Z95H 1L0PA 4K8RH 4XP6L 1G9HA 3ROOA 4LEOB 5D7JC 3B5GA 5EF3A 4NKOB 4OUOA 4E5XA 3X3FL 4FA7B 3D4ZA 4BKLA 2EDWA 4UV7L 1DBBH 1OT2A 3EOAA 3SBRA 3U7WH 5E94A 4JN2A 5TF0A 1OB1B 2LQRA 5KANI 4NQSA 4FULA 4WJG3 2UV3A 3GIZL 2YC1B 4QRBA 4WIQA 2O6DA 2WNXA 4RMTA 3G6JB 1FWXA 3MLPA 3EYQC 5HHXH 2DQEH 4P23A 3RUGA 3D18B 2Z93B 1LO5A 1LLAA 4KK8D 3DX8B 2CDEA 3N85H 2D03L 4RWYH 5AVXB 5IFHL 1B0IA 2FECL 1B4JL 4OB5L 1IAOB 5CEYA 1K6QH 1IC1A 2MFNA 1KPRA 2IQ9H 4GKSB 3K72B 3MRHB 4NN5B 2QFRA 3K2UL 4QMEA 4LVNB 4F1ZA 1LE9B 4BK4A 2GHWB 4G9FA 1BZ9B 5KVDL 1ZANH 5EU7C 5TDOA 4R83A 4O4YL 4XOEA 4UQEA 2ZIDA 5JXEA 5FGRA 2QQQA 4U1SB 5EUKA 5FYKH 4YDJB 2NYKA 5IBLD 4OLYH 3TN0B 1BP3B 1QD0A 4QIRA 5E5RB 8FABB 1CPUA 2PYEE 4LEXH 5ISZE 1BQRA 3S97C 5AVUB 3FL7A 4ZW8A 2FYYB 3C60C 1JGEB 5I23A 1XCTA 3HS0A 1TDQA 3U9UA 1HNFA 3ZL4H 2WW8A 4H8HA 3EYOA 2NNFA 2HT3C 2K0RA 3LH9A 4QY8B 4XMVA 1IARB 4HWBA 4PRNA 1AACA 3EGDA 1A14H 4WUUB 5AAPA 4HGMA 1A3LL 4G7YL 4PWIA 1AGFA 4H25B 3DIVA 1OTTC 5D93B 5F1OB 2J72A 5I1KH 1NCDL 5EBMB 2Y7MA 3BP5B 5FO9A 2GSMB 5E2VH 3ULSB 4DKFL 5L6YH 4BM7A 2H32B 4JO8A 2H3NA 2ITCA 1KTBA 3SQRA 4KZEL 2J88H 1IAIL 4R4FL 3AU1B 2IMMA 4OU3A 1FFPB 1IFGA 2YAOA 5DJZA 4LSDA 3RWGB 4BXSV 2EADA 1QLEH 4X6CF 3SDYH 3C5ZB 1A4KA 4XNUH 5IESH 5ICZB 1AQHA 3D6GA 4X99A 2O4EA 3MV7A 2OMWA 1SM3L 3RVXD 2EE2A 6PCYA 2XQYG 3O3AB 5D2LB 1QSEA 3T8VA 4AKOA 1KB5B 2H2SC 3DOSA 5IBTL 2GTZA 4ODWA 3Q1SL 4OZHF 3RYMA 3HZVB 2DB8A 3DNKA 3FSWA 4MJJA 5IP4A 2A3TA 1FL3B 2M8XA 4Y4HB 1IM9D 4XNYH 2OAAA 4OIBA 1QG3A 4DEPB 2QPSA 3QUML 3IS1X 3AT0A 3U9PH 3L7FA 3LXBA 4PRAA 5KBPA 1W0VB 1EUTA 2EDYA 3K6SB 5BMFH 2XN0A 2XIDA 3QFJD 5EOCL 3FU7A 3VXQA 4QRPD 3MJ7A 4IKNA 2XN9E 1WGVA 2CBTA 5E1HB 3KS0J 3QRBA 1OGAD 1XGRB 1RHHB 4FNUA 4K94H 1QKZH 3QS2A 2Z64C 5I6KA 1CTNA 4S0TD 1UXSA 2B5IC 4BUGA 4IKLA 3ZR5A 2OX5B 4GW4A 4BKSC 4XPAH 2E75C 3HAEG 2QBWA 1SOQA 4E41D 3L6FB 1DO5A 1X3DA 1Z9LA 4Z7UE 3T0DA 4JPVL 1JNLL 5J13B 5DT1H 2XY1A 5C08A 1N6QH 4AVJA 2DWDB 5LCVL 4XODA 1XSOA 4J3SA 5MERB 4JY5H 1HINL 1RQ5A 1SDDA 3W81A 2ENPA 2Y0SA 4TUKH 3SYAA 1UACL 4G80B 1CE6A 4JNXA 2O5XL 3U0WL 4U6XB 4PJAF 2DDQH 5I9QC 2X41A 3I84A 3QZWA 4D9RD 1OE2A 2OP4L 1NCBH 1TIUA 4MA7L 4OZGA 1DLHA 2OXHA 5L9DL 3A6CH 4G8GA 3VI3F 4XP6H 1Q9WA 1AG6A 1R6VA 2AJXL 1PTZA 5EOTA 2FNWA 3OGCB 4JDTL 3US1A 2C1OA 2Q86B 2K45A 3RWCA 3AY2A 4WDIB 5EC2B 4UV7H 1LGVA 5F6IC 4WWKB 4X6DF 5LDUA 1YEIH 4NRXA 5ID0B 4U1HB 4GH7B 4FXTA 4ZUWA 1ZJBA 3GIZH 3FFDA 1N9PA 5BOPA 3FONB 1J5CA 1DSWA 2EDQA 3EFOB 4NHUB 4R3SB 1IAIM 2RMNA 4L37B 2J6EA 4IBWA 3LN4B 4UM9B 4YN3A 4M5ZL 2X40A 2VXVL 5E9DB 2D03H 4X8JB 1B4TA 3AY4C 4YDKL 3V4VA 3E7JA 4Q2ZA 5IFHH 4OB5H 1B4JH 4FKKA 2FEEI 3C08L 1AGCA 3FPYA 4YSDA 4L2LA 1KXQE 3M17A 4UT9H 5HYIA 3QO1A 1CD0A 4X7EC 4Z7QB 1E27A 3ZL1A 3QUYD 3QHZL 3U7AA 2A5UA 3NACL 5DXWA 2FT7A 5KVDH 1E9QB 4R0LA 4O4YH 2BNQE 4I5BB 5GGVY 2LGNA 3QDJA 1L9MA 1A6AA 1G7IA 1HXMA 4HH8A 1X7QB 4ONGL 1OKEA 4HAGA 3RDTB 5A7BA 3P3RA 4NI6A 2QPUA 3C6LB 4GKZB 5GGRA 4XZUA 2WZAA 4Z3HA 3Q43A 4QHKI 4XN4A 4G3YL 5C8JA 2DM4A 1VGEL 4B0MB 3RVVD 3P3YA 3GB7B 2GIYA 1RUKL 5C0FB 3AXLB 3S98A 5MENA 1DQJB 4KDWA 4ZYKA 2WJ5A 3FJTA 3A6OA 5E0FA 2F8IA 2PCFA 3CZEA 1BMWA 1CMOA 1C12A 1U4EA 1A3LH 4A2GA 4GQRA 4LHUA 2OCCB 3D4YA 5LB1A 4U6YB 1NCDH 4QWWC 4Y9BA 3HLAA 3IU3A 3NJVA 1UOLA 4U1NA 2WLIB 4DKFH 2QLYA 5JZ7C 1FL5B 3AT9A 2NY2D 1S7UA 4Q6IC 4KZEH 4FG0A 3VD5A 5E6IB 1IAIH 2ZCKL 4R4FH 4OZFB 4W9ZA 3DPDA 1I3VA 4IYKA 2IWGA 3MV8E 4YZFE 1I7TA 5JIDA 2WBWB 1MUJB 2VITB 4MNGE 2DQMA 1RPQA 4EZMA 3KWXA 4AC2A 4M02A 1ANUA 3RWJA 4A2FA 2X3BA 4R5TA 3MYZA 5JPNA 1N19A 3CFKA 5IBTH 3U2JA 1FIGL 3IJYB 3HRZC 3Q1SH 4UQ2A 2JB6A 3AMKA 4ELME 2HB0A 3H53A 4CVZA 4TSCL 4Y4KB 1EX0A 1EPFA 3BQUC 4OGAD 3SGJA 1VFMA 1WBYA 5HD8D 3QJQB 2X1XR 1HHGB 5K9OB 3QUMH 1MJJB 2ZNWA 3PWPE 4WFHD 2UWEE 1AJ7L 5CHNA 3TIEB 4AIOA 3QPXL 5C09E 3FUNA 3DIFA 3TBSB 1PCSA 2V2WA 3DC0A 3QEUB 4E9SA 5IROC 5DK3A 5EOCH 3UAJA 3OVUB 4CN1A 3WIAA 4PJIF 4FFYA 5DJYA 1EFXA 4Y9FA 4P5TB 5C0AE 1NIAA 1X4ZA 2OSWA 3X14B 1A65A 2B7DT 3DXAB 1GCYA 1Z7JA 1ID2A 2X89D 4ZDHA 1HJBC 2X10A 2EXWC 1ZLWK 3AJ7A 4JPVH 2EC9T 1JNLH 2BIHA 4MNQB 3ZYOA 1FL6A 1AHWB 1JVKA 5LCVH 4N3TA 3VXSB 1IM3B 2H1XA 4J3XA 1HINH 4X8GA 1U8CA 3KAAA 4P2QE 1UACH 1TNNA 1P4BL 3OJDB 2K1MA 5DLLA 4ODUA 3G6JE 2O5XH 4IOIB 1F4YL 3U0WH 3L54A 1G1OA 1S6NA 4K71B 5HVHB 4HDIA 3IXAA 3UABA 4DK3A 2OP4H 4IRSC 4P23D 1RIHL 3QQXA 4KAQL 1PAMA 3QDMB 4MA7H 4JZJB 1SJMA 5F7NC 3GKWL 3RZCC 5L9DH 4XMPH 3PXHA 1I1AA 5DVKA 2JTYA 1TTGA 1FV1A 2AJXH 5CCKL 3B6SB 3HG0A 4IGBA 3S34L 1E7UA 3OJVC 4JDTH 4HX1A 3IF1A 5B7MA 2B3IA 1AOZA 2UVFA 3DX9A 3FFCB 4F80A 1GZHA 1U3YA 2OMUB 3FQRA 2GI7A 3PHOB 1JGUH 4N8UA 1J1OL 2DQFA 5D6CA 2B16A 2R2HB 5D7KD 5JXED 5ALBL 4HCRL 3A24A 1E9OB 2YUWA 4H5SB 3K71B 2EC9U 2Z4QA 2ZKMX 3GEFA 4M5ZH 4EN3A 3QUZA 2VXVH 4GRWF 3M86A 1WAAA 3FTVA 1RZ8B 4YDKH 4GLRH 2HKAA 2DKMA 1AQDB 1NC2D 3C08H 1A3RL 1AO7D 5FYJE 2XCMC 3ELQA 4XN9A 5IB4A 4MAYB 4LEOA 4M6OL 3OLDA 4PB0L 4NKOA 1SJHA 4XXDB 1QRKA 1MRFH 1FYTB 4KKBD 2WLMA 4M61B 3GMPB 3NACH 2D9QB 4L23A 2VXTL 1OB1A 3MLYL 2ARJB 2YWZA 4I7ZC 4G1EB 4EN2A 1TZ8A 5I76B 2YC1A 4PJXE 4MD0B 4AJVA 3P40A 3MJ9L 4ONGH 3D18A 2Z93A 4LLDB 2VR9A 3MR9A 2NY6D 2GHZA 1CE1L 3MRQB 3DX8A 3RIKA 3DYOA 1CD1B 1J9SA 2AK4B 3JWOL 4N90D 4G3YH 1VGEH 3PWNB 4TLTA 4XBMA 5KAQF 3CU1A 3T6XA 1IAOA 5KS9F 3LZQA 3QDGE 1ZK9A 1QMUA 3K72A 3MRHA 1YUKB 3SKUD 5FW6A 1AR1D 2O5ZL 4KMQA 4BGDA 3TO4B 3CZNA 1LE9A 4JFYB 4Y5YC 1BZ9A 1MLBB 2APSA 15C8L 5IB3B 1L6PA 3VQMA 1CXFA 1WZAA 5IMMB 4U1SA 3C6SB 4LFHG 3SE3C 1S9VA 1GR7A 4GEIA 4HUCA 3TN0A 2VN3A 4CGTA 3OV6A 8FABA 3HNVL 4KWUA 4H40A 5F3HB 2ZCKH 4KMTL 5DJXB 2XTSA 4F92B 1X6NA 2FYYA 2EE9A 1Y6NR 1JGEA 3CE1A 1V3JA 3H4FA 1SMDA 4LCYA 1IB5A 2BOCB 4PMFA 5IHZB 5JHBA 4UANA 3NAAL 4JJHA 3CLEL 3MRJB 4XVUC 5DMYA 2OLDA 5LVEA 2NNCA 2ZT9C 4WNSA 2ESVB 1I3RB 2F54B 1T5XB 4WUUA 2XC8A 5EUOA 1NM9A 4OUUB 5HXMA 1FIGH 2CLRB 1BYOA 4H25A 5ECJE 1XH0A 3ARGC 1P1ZB 3GNML 2FEEL 1MW1A 3BP5A 4TSCH 4IS6B 3ULSA 4JHWL 4FQ1L 1Y6KR 1KTRL 1F41A 4U33A 4K8RC 1CICC 4UTAL 4KX9A 3AU1A 4NERA 1FNEB 1AJ7H 1J9QA 1FFPA 3QPXH 2ODIA 2ICWB 3UAFA 3RWGA 5A2IH 3OWRA 3FB7A 4DP7X 1PZ5A 3JVFC 3MJ8B 3C5ZA 5ICZA 5CILH 2F5AL 2X2JA 2ZOTA 2YA0A 3B7UX 2YJLA 4ADIA 4B97A 3O3AA 5D2LA 1LK2B 3DV4B 4BRVA 1KB5A 3TJPA 2GJ6E 1NCJA 3EJCA 4UILL 3SYPA 4AUJA 4XXCC 1YEWA 3OTTA 4L4TE 5AD0B 4ZMNA 2DYPD 4XCYB 4Y4HA 2OCJA 4MJ6B 4LVEA 4OVUA 3OPZL 2X3AA 1FCCA 1P4BH 1W0VA 3AU0A 3K6SA 4B9ZA 2PO6C 1F4YH 1B4LA 1BXXA 1RZ7H 2K8MA 4B9CA 1DBAL 4LOVA 4PRHB 2HX7A 1XGRA 1RHHA 1P6WA 1RIHH 4KAQH 2ZOKB 3HR6A 4IJTA 1I8LA 3VXTA 4N0RA 3GKWH 4KOBA 5DA4A 5BRQA 2Y07L 4PG2C 2OX5A 1A7NL 5CCKH 3S34H 3W5NA 1KEMH 1BPLB 3L6FA 4LCWE 2VRQA 1NDTA 2R2EB 3T0EC 2IBBA 2EZ0C 2DWDA 5DDHB 3PF2A 2EEBA 5BQ7B 1IEHA 1J1OH 1NBYB 1KB9J 4ICWA 4X5XB 5ALBH 4HCRH 4AUUA 2AJYL 3NCEB 4XPTL 1D5MB 5C3LD 2XXGA 5EU5B 4K5NA 3VFVB 1A9EB 2H3KA 3P77B 2PPEA 3AM8C 4MS6A 3VTAA 1A3RH 2BX5A 2A7BA 2MJWA 3FCUB 1F3RB 5C07E 4EVNB 1L5GB 4M6OH 4PB0H 3OGOE 1NSNH 3V0WL 4JFTA 4PPTA 4WDIA 3NG5A 4KRNA 3IPEA 1ROWA 5T3XL 4IIQA 2PWEA 2VXTH 3UTOA 3MLYH 4U1HA 2P52A 2B4CL 4PJBE 3FONA 4L5FL 1TETL 3EFOA 4NHUA 3MJ9H 4ZFOA 3CFIC 4R2GB 3LX9A 3FO2B 3MACH 3QJHB 1T4WA 4UM9A 1WDAA 1B0GB 2CR6A 5T1KA 1CIDA 2C3GA 5E9DA 2HCZX 4X8JA 3ARFC 3JWOH 4KZDL 3AS3A 3QORB 2HUEA 3FS9A 4J28A 3NJXA 4L18A 4BZYA 3LQZB 2AW2A 4R7XA 3ARQA 1RJCA 4CVWA 2EABA 2O5ZH 4XRCB 3DURB 4TNGA 3TZVD 1XV8A 1B2WH 2OZ4L 1BF2A 15C8H 4L1TA 3DI3B 1FA4A 3QNYB 4QHKJ 2AQ2A 2BK8A 3SE4A 2W0PA 4MCMA 4MMZC 4UQDA 3UTTB 4K94C 1PVHA 5TK2A 3RDTA 4GP5B 1X7QA 4WHCA 5CSBA 2W60B 1U8NA 3C6LA 4GKZA 1TSHA 2WLHA 1JZ3A 5FFLA 2NY0C 4R90H 2VIRA 4W93A 1YMMB 1ZVHA 1I7RA 1Y7VA 3FSOA 4U1LB 3GB7A 1QHOA 5J12C 3DRQB 3EJPA 5DCCA 5C0FA 3AXLA 2V3EA 3NAAH 1FFOB 3CLEH 3UO1L 1GZPB 1DQJA 1M4KA 2XUWA 3QCUL 4FZEL 3UAJD 3PWVB 3KEDA 2Q76B 3WTWA 2VM4A 4DP5X 1CXEA 1KGWA 3RGVC 3VMOA 4JZOB 4WO4D 1N4XL 1PSKL 2IVFC 3QFDB 4ETQB 4U6YA 3ZPDA 4CNIA 3UPAA 4F9PA 1ZVSB 1N5YL 2WLIA 5HHOE 4JHWH 2KI6A 4FQ1H 5E51A 5HJ3B 3D9AL 3HE6C 2R59A 5D1QB 5BUAA 2IWFA 5E6IA 2DN7A 3G6AB 4UTAH 1UT9A 1VEMA 4OZFA 2C5DC 5LXVA 4GO9A 1JZ2A 4PP1C 1FIEA 3N0AA 1OAQL 3KPNB 3MV01 4FXLA 5CKGA 1E5YA 1DQIA 1MUJA 2D7NA 2VITA 5IV2B 1P5VB 4IHOB 3TPKA 2F5AH 1HQ4B 4GKNB 3VX1A 2E3VA 4G6JL 2YLHA 2JJWA 4Z7WF 3A47A 4W9FC 1IKFH 2MEJB 3IJYA 1MHEA 4YDNA 3KDPB 1CB4A 4PJ8C 1S7QB 2YRBA 2J25A 2ZONA 4N85A 4Y4KA 1ADQL 4A38A 3FFCE 4HZAA 2WXNA 1E5AA 3DYPA 4BZ1L 1HHGA 3OPZH 4MQXD 5GS0D 1M1XB 4M5SA 1MJJA 4PJ9B 1RPUA 5I19L 3S3CB 3TIEA 3ARTA 4OCSL 1CT8B 3KW7A 3UBGA 3WHXB 3TBSA 4LOEA 1BZDA 1AIFB 3QEUA 3L16A 5ENWB 3NFSL 3EJRA 4NQUA 1DBAH 5CBAA 2DM2A 4DPRA 1Q9OB 5TTRA 4UNIA 3DECA 3PAUA 4P5TA 3DKHA 3X14A 4PRPB 3DXAA 1OV8A 5SWSE 1QBLH 1FUNA 1JV2B 4X7DC 4YBHA 1NBVL 1H3XA 3QIUC 1QR4A 3IDGB 4MNQA 1CDCA 1F56A 1HTYA 1LD9B 3MBEB 3VXSA 1IV8A 3PREA 1HESA 4K0OA 2YQGA 2HH0L 4X6EB 4OLXL 1DUZB 1N59B 4HKZB 4LFHD 5EEVA 3OJDA 3WHE1 5C6WH 5HBBA 4IOIA 2AJYH 2IH8A 4YPGB 4XPTH 3P30L 4GXUM 3HUJB 3RB5A 4QTFA 2VE6A 1D2OA 1Q94B 2FJGB 3MLRL 1UH2A 2FT6A 3MI6A 5GRXG 3ULAB 3ZKMC 3NCBB 3P4OA 4LGSB 3GSNL 3QDMA 4JZJA 3DVGB 3QWQB 1G7MB 3ARXA 1RZKL 3GINA 1A66A 3B6SA 3CD4A 1OCCB 1ZTMA 4NX0A 3V0WH 3B5HA 5KW9L 1CBVL 2BP5M 1HKFA 3CX2A 3QUXD 2A0LC 4WY7H 5T3XH 5F2FA 3BGFC 1J5DA 2CO3A 2B4CH 2NXYC 4A2EA 2R2HA 1YSOA 4DW2L 1GW6A 4L5FH 2P8LB 1TETH 2OPCA 1E9OA 4G70B 4H5SA 3K71A 1HWHB 5L8KB 3D09A 1CYXA 3ULVD 4FEMA 5F9JB 2OMYB 1LWHA 1OAYL 3QYNA 3K1KC 2GQHA 2JFCA 4HP5A 1RZ8A 3GIVA 4U2ZA 4WI0B 3KL0A 4KZDH 3IGLA 1AQDA 5JHLA 1KZYA </