3GZQA

Human sod1 a4v metal-free variant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
152
structure length
123
Chain Sequence
TKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural and biophysical properties of metal-free pathogenic SOD1 mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 29
structure length 123
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gzqA00
1ESOA 2XJLA 2E47A 5KBMA 2K4WA 1YAZA 3GTVA 1TO4A 1E9OA 2WZ6A 3GZOA 2C9SA 1IBHA 3H2PA 2WYZA 3KBEA 3MKGA 2AQNA 3KM2A 3KM1A 2JLPA 4OH2A 3KBFA 1KMGA 2E46A 3S0PA 1FUNA 1E9QB 1QUPA 3T5WA 4OJAA 1L3NA 4N3UA 1IBFA 1Z9NA 2APSA 2R27A 3L9YA 4A7VA 1BA9A 3F7KA 1UXLA 3K91A 1CBJA 2AQTA 4A7UA 2AQSA 1B4LA 1N18A 2WWOA 1IBBA 4A7TA 1BZOA 1SRDA 2ZKWA 3ECVA 4N3TA 1F1GA 1JK9A 1F1AA 1SXBA 1XTMA 1DSWA 1AZVA 1YSOA 3QQDB 4BCYA 2GBUA 4MCNA 4MCMA 2WWNA 1Q0EA 3H2QA 3HOGA 1OAJA 3GZPA 1N19A 4FF9A 3GZQA 3L9EA 3RE0A 1U3NA 3QQDA 1COBA 1IBDA 2ZKXA 5KBLA 2ZOWA 2AF2A 1SDYA 1OEZW 2WKOF 3ECWA 1PU0A 3HFFA 1E9QA 4A7GF 1JCVA 2GBTA 2C9UA 4A7QA 1IB5A 4B3EA 5CU9A 2VR8A 2JCWA 1XSOA 1SXZA 1TO5A 2WZ0A 5KBKA 1SXNA 1OALA 2C9VA 3PU7A 3GTTA 2XJKA 1Z9PA 3CQPA 2V0AA 3KH3A 2ZKYA 1SDAB 2AQQA 1EQWA 1DO5A 3F7LA 4A7SA 1PTZA 3CE1A 2AQRA 3LTVA 1E9PB 2NNXA 3CQQA 1SXSA 2LU5A 1S4IA 2VR7A 4BD4A 3MNDA 1EJ8A 1P1VA 1HL5A 1OZUA 1OZTG 1MFMA 2Z7UA 2Z7WA 1SXAA 2WZ5A 1E9PA 1XTLA 2Z7YA 2WKOA 3ECUA 1F18A 1HL4A 1SXCA 2AEOA 3HW7A 4U4IA 2Q2LA 4A7GA 1UXMA 1SPDA 2GBVA 3SODB 1SOSA 1B4TA 2AQPA 1PZSA 4L05A 2WYTA 1RK7A 3KH4A 1CB4A 1F1DA 2SODB 3GQFA 1JK9B 2VR6A 1E9OB 4BCZA 2Z7ZA 1YAIA
chains in the Genus database with same CATH superfamily
2VLRE 4PLNC 2YD1A 1K8IB 1FLRL 5T33H 1JGEB 4DK5A 5K39A 1L0YA 5JW4M 3RWEB 4ZMXA 2FYVA 4TNWK 1M1XB 5D1XD 1NDGA 3BW9A 3BWSA 3F7YA 4TPRH 4XWGH 3UEZA 5HYSB 1C5DB 1EO5A 2WXRA 4X7TA 3BPLB 3QEQE 4X9IA 2VERA 3UJJL 2DW5A 2E46A 4AQEA 3BUYA 2NXYB 3HBQA 4PPTA 2VW7A 3NSJA 4GAYB 2ICWB 4ZNCD 2WMPB 2WNKA 4GSDH 4EUPA 4IMLA 3IFOB 4QPEA 3DUUB 3MOBH 4CVXA 3VXMD 2WZAA 3GJEA 5CZRA 1IAOA 5FYJU 1GGTA 3AAZB 1LK3H 3O3EA 3JWDL 3MRBA 1Q9KB 1JNHB 2AK1H 1S7SB 4OLYH 2DJUA 3NP4A 3PWVB 3IT8D 4PCYA 3VSQA 3LN4B 1D9KB 5L2KE 4XTRD 2X6BA 5E8NB 4QMEA 4E5XB 5JPMC 4J4PD 2D31A 2ZXEB 1L5GB 1PLGH 3HCVA 3VGDA 2UUDH 5EDSA 1BYOA 4FF9A 4YIQA 2CO7A 3WTUA 2ADJB 3N0AA 1OARH 5KSBB 3TASA 4UM8B 4P2CG 1GY1A 3F65A 3FU8A 5FA4A 1RZ7L 3U82B 2CHNA 4ZPTA 4IMKC 3ZKMD 2GSMB 3R7RA 3OC5A 5CXPA 3TNMA 3UO1H 3TIDA 1DUZA 4XCFL 2RTTA 4XXDA 4JFHD 4Z3EA 4PY8I 4HEME 3TC9A 3TZVC 3CLFH 2WLHA 1DVYA 1MCBA 1D6VH 4G80A 2EICA 4PRPD 3LKSB 2AMGA 3R18A 1TEFA 3ROOA 2X2HA 3EYUH 1VKXB 3QK0A 1HOCB 1SFHA 2K3HA 1MCSA 5DJ0A 4B9GA 2BIMA 2WXNA 4LLYB 5KAQF 4F33B 3IXAB 4ZZFA 5E4AA 5HBBA 1E8XA 3IDIA 1BQLL 3BP5B 5EUOB 4XAKE 1XF2A 4FXKC 1CGYA 1PIGA 3UP1A 4EOWL 4LRIA 2D0GA 3D1MC 3HE6C 1A8JH 3LEVL 1SXAA 3N2JA 1E9PA 2Y5EA 4NM8L 3U36A 5JPMA 4AL8C 2BXYA 3KL0A 2LLGA 2Y2WA 3A6CL 3HMXL 4G7SB 2VM3A 3WIIH 1RZJL 5DRXA 4YSUA 2EC9U 3T0EB 4IJ3B 4K5PA 4MAYB 1JHTA 2ED8A 4JDEB 5LO7A 2QADB 1A4BA 1TU2A 3BN9D 4U1IB 1CLCA 1Z0MA 3FSAA 1NCDL 3IPEA 3RY4A 5BUPA 1HZHL 1YAIA 4KUZL 3CFDB 2Y06L 2A9ML 1MUJA 5HHQB 2F58L 2WSPA 1U8NB 2NY6B 1DQVA 5C0BB 3L54A 2OK0H 1A3RL 1J0JA 4JPKH 3EDEA 4C54A 3NBNA 4HWBH 2YWYA 1SDDB 3IVKB 3LQZB 3KLLA 4HWZA 4U6XB 3Q8CA 3LZNA 3KWUA 3EYFA 3EO9L 4BYHA 4YSAA 1RQ5A 2CM5A 3BIKA 1TJXA 4XHJD 5A6MA 1NBZB 3ERXA 5ECJE 2XACC 4D9QD 4ZD3L 1NC4D 5ITFB 3UMNA 4ORGB 3HNTH 1A7NH 4MJ5A 3D0LA 1IFRA 3LVTA 1D5BB 3N40P 5LAPA 3HE6A 2IPUK 2DMKA 4FFZH 1XSJA 3WTWA 1O5PA 3FFCB 3SDYL 1P7KA 4KV5F 3TU6A 1T89A 4NWTH 5GJSL 2XBDA 3G5WA 1QASA 3MLVH 4P4KB 5FCUH 4APQC 1FZKA 1I8AA 1QSVA 5D7JB 4K7FA 5CZVH 5I0VA 3BVNB 2MNUA 2PWGA 4Y19A 2MNJB 1E3XA 4K71C 3L9EA 5HDLA 4NHCL 1CFNB 4LOUD 3MMEA 4LSVH 2NY1C 3EYOA 3OLIA 4X6FB 5F0PB 2AXJA 4M5SA 3WTVA 3TO4A 3UXFA 1GC1H 3G5ZA 1A3LH 4DK3A 2YC1A 4J7RA 4PTUA 1R3LA 1OM3L 4KFMA 1E7UA 2BSSA 1KEMH 4G3YH 1FO0H 4PLKD 3BDXA 5FF6B 1MIMH 2LGNA 3BOVA 3AW5A 4KKPA 1JPGB 4NNPH 2NYZA 3T4YA 2CZNA 2W9EL 4ZQKB 1IO4C 2BP8B 2OMYB 3R19A 1E42A 4JFYA 1SXSA 1YY8B 3ZDZE 3NJKA 3EH3B 2OMWA 3ZTCC 1HHIA 5E6ZA 1N6QL 3QR1A 5ABDE 3CUPB 1URZA 5DFVD 3QR2A 1H6UA 1AOZA 3G08A 3B7TA 4BZ2A 5E8EA 4WJ5A 1GGBL 1S3KL 2NY0B 3FCTA 2LW3A 3R8QA 5JOPE 1MRCH 1S7VB 2WBXA 5LGJB 4DPCX 3QEHB 2DM4A 4HS3B 2K7PA 4UT6H 2PUQT 4YR6B 3IMVA 3OQRA 4NZTL 1JNNH 3C5JB 3K8MA 4NQDA 2VH5H 1B88A 5I19H 2YGPA 2ZCHL 2FB4L 4K55A 2YA2A 3UABA 1HL9A 4ZUSA 4I88A 4NFBA 2XIIA 4R8WL 3OG4B 4HHAA 2IPKA 3ILDA 2YMOA 1QZNA 4EMZA 5IV2B 5KANG 5C0JB 1KLFB 2UX7A 3C5XA 4GBXB 1E0OB 4WGVB 4JKWA 1WBXA 1CBVH 3E38A 3LMJH 1NAMB 4ABWA 1G1OA 1ITCA 2BC4A 2R56L 3MRRB 3UZVB 4PI2A 1KB5A 3WKYA 4JO2L 4ZUVB 1L9QA 5C0EB 5FLUA 3FFOA 2Y69B 5I17B 3W38A 3GSQA 4PV8A 2IAMC 1QATA 3FSOA 5KW9L 5E1AA 4J3BA 2CHXA 3WFCH 5I1LA 4AMXA 1OAUL 3MBEC 1BIIA 3HA0A 4FG4A 5GS2D 3OHMB 5DS8A 3QUYB 3NH7H 2DQFA 1BOYA 1KCRL 2D7PA 43C9A 2C7UB 2BO0A 3HNSL 3FQXA 3VFMB 1SJEA 1JGDB 1RJCA 5EU7C 4F7CA 4NJ9L 1B0WA 4M1CD 4CC4C 5HSFA 3GNML 1OAJA 3CMGA 3DBXB 2FATL 3I9GH 2Y7QB 4U1MA 4DP8X 4O2EA 5K9JH 4G6FB 4KJYA 1IAKA 1MWAH 1NIFA 1RUQH 3P73B 4RDBA 4ZJ9A 4BH8A 5IQ7H 2Y07H 1QBBA 3F64A 3U30C 3LKRB 5HVHC 4ODBD 2IADB 3K71A 4BFFA 3QQNA 2F1AA 2YMTA 3FRPB 4KDWA 3T08A 2DBJA 4JDVB 1OALA 1IZJA 3O3BB 3W5NA 2EDDA 3TTSA 3DI3B 3MRJA 4HJGB 1PNCA 1EGJA 3LNIA 3EGSB 2IXQB 1NBCA 5F7HA 4ZFGL 1Q1PA 2A9NH 2FSEA 4V2CB 5MEPA 4LLVB 4M8QA 2ED7A 3N85H 4YDLB 2MJWA 5ICXB 4DKEH 4FLOA 4GQRA 5F7DB 5H94A 4MQXC 5EUOF 1NUFA 2D7QA 1AZZC 1YEGL 2J55A 4YBLB 5EN2B 1O9WA 4WUUD 1D5XB 1TQTA 2Z7UA 2FNBA 2FUTA 2MCG1 3DROA 1WZAA 2XV3A 2VLJA 3D33A 3NESA 5E1IA 4E2OA 4CC4A 3IU4L 3N0PB 4MA1B 4AJ0A 4Y2OB 1HH6B 2DZEA 3HI6H 1XGQA 1CFQA 2C9XA 2OXGA 4DEPC 3C9NA 3IU3A 4KJWC 4ZXBA 3DRQA 4H40A 2ZOKA 2AK4D 1DVXA 5L7XH 2IBZY 2V5SA 1TTRA 2X1WL 3GI9L 1NGZA 2P24B 3MROA 4JFFB 4KMTL 5IFAL 4ICWA 3WXWL 2CJTA 3BEVA 2XKNB 4ZSOA 1KNOA 1HXMA 3RWHA 1K3ZA 4HGKC 4NC0B 5LKNA 4FYSA 2LAGB 4Y19E 4ANXA 4ONHB 2XTJE 1BBDH 4GRLD 1WWWX 3MA9L 1ETZB 3HAEA 5GGRB 1K5NB 1IUZA 1J48A 3TGXA 3MXWL 1D6EB 2KDYA 2FJHA 2XPGB 4XN2A 4X80H 3RWGB 2FX8L 4O2CB 4M61A 4W6WB 1HZLA 2H2SD 2W1NA 3K74B 4HV8B 5EU6D 3S5LB 2D2CC 1BOGB 2O5XH 1YMHA 1CR9H 5CZXD 1DDTA 3BT2H 4RGND 3SKJL 5JORA 1UT2A 1BYPA 1JK9A 2APBA 4ABUA 2CMRH 5LG6A 2K9UA 1PZUB 2CBTA 4MXQD 1J0IA 3N3EA 2Z0UA 3R0NA 4GW1B 4CU8A 4Q9QH 4OGXL 1U8OA 4FLHA 3IPBA 3RL2B 1R0AL 5B8CB 2GK0B 2WOBA 4OZFB 1R3HB 4OU3A 2C1OA 2ARJA 2P5EB 4XPAH 1SHSA 3JWOH 3PWNB 3AGVA 3EOTL 2JMRA 4RQQA 5CFHA 4ZMOA 2CDGB 1SY6H 4R7DA 5IB3B 4KQ3H 1SMAA 2GBTA 4NC2B 1RK1B 3MJ6A 1DQQB 3OC8A 4NQDE 1SGKA 3QUZB 3V5HB 2D8KA 4I0PD 3UL4A 4UILL 4MSWA 2X4QA 1UASA 2Y1ZA 1H3VA 1ZVSB 1JK8A 2NNRA 3EUUA 5LG1A 3VI3B 3RP1A 1T0NA 5I76B 3W5MA 1XMEB 3OB8A 4WV1C 2JJVA 4E9LA 5TE4H 2EH8L 3RAJH 4E41A 1KZYA 4QTIL 1MFEL 1AXSA 4G8GD 4H88H 1MJ8H 2PWEA 5GGVH 1KDJA 3EBGA 4OLXL 2HRPL 4TUKL 3BUQA 5I6XC 1MH5B 1WK0A 5C09A 2WNGA 3TWCH 3CZGA 3QZBA 2Y6SD 5DK0B 5IF0B 3AY2A 5IBLD 5A16B 1QEWB 3QRLA 4W9IC 1WAEA 1WV7T 4Z23A 4LVEA 4XH2B 4G7RB 3VWKB 4BE5A 4JKPH 1CC3A 4F37F 1T21A 5IW1A 1WFIA 4Q6KA 4WK2B 1HX0A 2V7NB 4JLRA 5BS0B 3QDMB 2CLZB 2HAZA 1A21A 3GXDA 1O6SA 2WTOA 3EYVB 3BP7A 3CMOL 5DQDH 3T6WA 1FCGA 1DCEA 3X13B 3WY4A 3ULUL 2WAQA 2AEQH 2K78A 5E6SB 4PJ8D 2ZUSA 2PP8A 1QEXA 1ZLSH 3D05A 3F7QA 4P23B 1BLNA 3V4PB 2WLLA 4H1LB 1LL1A 1PZ5A 2ICWI 2IOIA 1VFUA 4BV1A 4WV1A 5F96H 2DY2A 4X4YA 1R17A 3DMMA 4HJIA 4TQHA 4X7EC 4PJGB 2XZCL 3D48R 5DD6B 5D4QA 2X4SA 3KPPB 4GW5A 3SGEI 4HF5L 2B2XH 2OTUB 4AYEC 2DWXA 3RPIA 2LV4A 3ULVF 4EQ2A 1U3HC 3DDGA 5T1LD 4XP6H 2ATPB 1LO3L 1S7UB 1P5VA 1UZGA 2P8PA 1ES0B 3HE7B 1BQHB 3RWFB 3L1EA 2IC2A 2JKLA 4QRTA 1AFVH 3MCLH 2GBUA 4PJCB 2MQCA 4O9HL 1XSKA 4OFIA 4JN1H 3QZWB 4FN0A 43CAB 1YA5A 4AG4L 4IBYA 4QXGL 5G4NA 3SDAB 2CU9A 4GUPB 2Q1EA 5LQBL 1A9BA 4JMNA 2Q8AL 4LDLB 1HINL 3ISWA 2E8ZA 5D1ZA 5EU7E 3M1OA 2VLJE 1LNUA 4M43H 2H26A 2XSKA 3CXHJ 5JHDB 1FZMB 3OR6B 2IH1B 3ZX1A 3G6DL 3ZRSA 3I2CH 2QT6A 4O02A 3VRLE 5KYYA 2BY2A 3UC2A 4AQ8C 1UWXH 4ZW5A 5BZDA 2B59A 1UXWB 2V6HA 4PTTA 1U8HB 3D85B 2AJZA 3X3FH 4O5LH 4JY6B 2P52A 2H5UA 1MFAL 1TJGH 2VXTH 3QUXA 1ORQA 4ZSOE 1VACA 1NEZB 2VXQA 2AEWA 5IM7A 4L18A 3L5XL 5DJZB 5DO8A 3WY3A 4QRAA 2HFFA 5I71C 1RU9H 2X38A 4OFPA 4LKXB 2J4WH 4J39A 3TBBA 2J43A 1BJ1J 2WSDA 2W95A 1MIEH 3PAUA 4HWUA 1UEYA 1FLTX 3D25A 1J86A 4FLSA 1KJ3H 1PKQB 1B0GB 2BNRD 3RI5F 5BNXD 3V6OC 1C16B 3W0WA 2BIHA 5GGQH 3QIWC 1ZE3H 5KYUB 2CGRL 4BWTA 4ENZA 4Y9BA 4UOZA 4A6YL 2DMBA 3BE1L 4OF5A 3ULUD 1PLBA 1RZFH 2UYLB 2DI8A 2XT1B 3U9PL 3ZZQA 2EUVA 3MLSL 4QXTA 3AUVA 2CIIB 5D7LD 3OKOA 1BJ8A 5T1KD 4AZ8A 4WEBL 1J05A 4AUJA 4FABL 1UB5B 3FOMB 4JFZL 4YE4L 4AEFA 3EDDA 2OJEB 1YAZA 5JMRA 5ECGA 3CXHK 1MJ7H 5DJ2B 3QJQB 2X5PA 4DIXA 1QWHA 2X70A 4PJFF 1R6VA 3HFML 1A9EA 2N0MA 1XD1A 5F9JB 4W9EC 2BOBB 1LEIA 4DGWC 4RGOL 2AXGB 3M1BA 3DGGA 3JVGA 3F7VA 5T3XE 5IKCA 1DANT 3I02B 3MRGB 3BSGA 4TRPH 1KSRA 3NGBB 4X6CB 4ENED 1E4HA 3FULA 4FQQA 1DBAH 5E00A 5IVXB 4R2GC 2YKLL 5HYJA 2A6DB 2VDML 4N22A 2K4AA 2WBJB 4E41E 1Y18B 1XCTB 4BHUI 4ATTA 3BSZL 1CXKA 4MXVE 5FM4A 4U0RC 3G6AA 5D1XC 5BCAA 5T33L 3IB4A 5C3IA 1TJMA 4K9EH 2F68X 1KT2A 1WD9A 3BH8B 5KVFE 1M57B 4FQXB 3RFZB 3D3VD 3DVFA 2OYKA 5C09E 4U1LA 5H2BA 4ZW7A 2IQ9H 4TPRL 4XWGL 3TZVB 3HHSA 1BAWA 3Q2WA 3TEXA 2DWYA 3VG9C 4NI6A 2KQMA 5DYOB 4O51A 4OFKA 1W2KT 4GSDL 4PW9A 5I0WA 2OMTA 4YX2L 2VMEA 4EN2A 4R7NA 5AQ0A 5EOTA 2XWXA 4Y88A 25C8H 3UG3A 4PJEB 2YD7A 5GRYA 2BERA 3D2UB 1YC8A 2NYKA 3WBDA 2QDWA 4WDIA 3U79A 3C6LB 3IAPA 1LK3L 5B1AB 4XTRC 5DQ9A 5JW5B 1CTMA 1SDAB 5DJYB 4OV5A 2IBZX 4OLYL 4J4PC 4AJWA 4CVWA 3PAYA 2YGNA 4PQXA 4HGWB 3K46A 2XOTA 1M6OA 4B5ZA 1CDBA 2NOYA 5HHME 4AIXA 2XVGA 2WVVB 4O4YL 4YHMH 4WHDA 1AD0B 2D0FA 2GUOA 4GNKB 1IILE 4LIQE 2ESVD 5LNEA 2AXHA 1OGAD 1OARL 4N8PA 1VZIA 2V33A 4YDVA 3ZKMC 5DI8A 1LMIA 2A9BA 4HK0A 5D1XA 4DPAX 3ZL2A 5G5DB 5D7IB 4AK2A 4GEJA 2WXGA 3B2XA 3QUKB 5KSVB 1Q9LB 4GKZA 3PGFH 5IFJB 2DJSA 3UO1L 2G0KA 3KH4A 3N04A 4MB5A 1EERB 5J6SA 3UPAA 4A2GA 4PUBH 4PGDB 5A2LH 3EAKA 2XIBA 3O3UN 1MRFH 4LQFH 3SPVA 4BDVA 4XMUA 1J8HD 4AEEA 3CLFL 4TYUA 4M7KH 3U7AA 1D6VL 3VH8A 3ZPDA 2Q7NA 3T0AA 3VXMA 2HSIA 2ZXAA 4QRPD 1VA9A 1PX4A 3NJJA 4DUVA 2XN9A 1LK2A 5DK2A 1ACXA 2QPFA 1AIZA 4HK3N 1WFUA 3VE0A 1SLUA 2NDFA 4YPJA 4ZX5A 3GMPB 4QYOB 4LNRA 1HKFA 4GAGH 2JLPA 4PRIA 4X98A 5I6KA 5KBNC 1EXHA 1DVFB 1D5MA 2QZ5A 3GZKA 4PJGF 1OY3B 1WPCA 4APQB 4KNUA 3DJTA 1ND0B 3IWUA 4ETQB 1CD8A 5ID0B 1T0MB 4NKMA 2CKBB 3SIKA 2VRQA 4D0CA 4X99A 5GISH 5INCA 3WIIL 2OSLA 4F2EA 4OQ1A 4AKQA 4L3EB 3BN9C 1N3NB 2NX5D 1YEKH 2HVKA 3EJJX 5JOFB 1R5VB 3NRPA 3K4AA 3GS7A 3E2HC 2EYRA 2PCFA 5EO0A 3DDFA 5EBLA 5FGCE 1DJXA 5HDBB 3WXVH 3QAZB 4PJCF 2Q76B 2EKJA 3OHXC 2OK0L 3ZHKA 3O3AB 4IRSA 4PRPA 4JPKL 2V8LA 1KTDA 3JWDC 1JUFB 4MFHA 4OZGA 4XHJC 1OP3H 2CO6B 3W0WE 3STBA 4QHLA 3PHOA 4V1DB 4A7GF 5B38B 4HUVB 3APDA 4LVHB 1KG0A 1MVFA 3ULSA 4BQBA 4FRWA 3Q7JA 2NTSP 1A6UH 2J6EA 1MN4A 3L9RB 3HNTL 4OLWL 2NY5L 4E0RA 3ZQ9A 1FYTB 3MV9B 5AOLA 4PY8J 3Q9PA 4DPBX 2WVUA 3E9TA 4HOMA 4FFZL 1R5IB 5K9QI 2ZXDA 5T5NF 4UB0H 1TENA 4LSRH 3I50H 4Z78B 2YAMA 3SCMB 4NWTL 2BW4A 4MMYA 1E4KC 5FCUL 2LLLA 2X41A 3GKZA 3ARGA 3IAQA 4LHUA 3QUMH 2RMNA 3MNDA 4LOUC 1YPZA 3RY5A 3CH8A 3V0DA 4RWYH 1KY6A 2CGZA 3LH2L 4E42B 2I7SA 4YPGA 4PJDB 5J6HB 3INOA 4NOFA 3ZDXE 3PIQA 3NRFA 3JSSA 4I3GA 1NBYA 3EYSH 2OMUA 5J13C 3PWPD 4UNIA 1I8IB 1MHHB 2NY4B 1GC1L 1K4CB 4NQXA 1A3LL 5KN5A 1NDMA 2QKIC 4PLKC 5HYJE 3QPQD 5ISZD 3O4OC 1NC4A 1XXFC 1DVSA 1KEML 2MTPA 1FO0L 4G3YL 5GPRA 2G4EA 5DUBA 4ONOA 1UZ6F 1ZDSA 4QY8B 3OMAB 1MIML 5HGDB 1OXYA 4NNPL 4K15A 3SDCD 3MV11 2ZIDA 1KPVA 1YMMD 1RZJC 3CVHB 3WN6A 1N59A 2HLFD 4FZEH 3E6HB 3FU9A 5AW1B 2C1PB 2OJZH 5DFVC 3T3PB 3AACA 4W9HC 4NRXA 1BECA 3BPOC 3PGCA 4NENB 2X28A 3SKOA 4CMHC 3VD9A 1DO6A 1MRCL 2WKGA 4ODXB 2A9DA 4UT6L 3KPMA 3TWYA 2GK2A 2GSIA 1T5XB 4QT5A 4X6CF 3NFPA 3RNQA 1IM9B 1JNNL 2R29H 5KVMC 3ABZA 1TUPA 1PCXA 3SBRA 4J8RA 4GY4A 1NFIB 3QI9B 1BF5A 1IL1B 5IVXF 4QCIB 5I19L 4H25A 1W6WA 4YLQT 3CX5K 3IJ9A 1AXTH 4S2SA 2N56A 4OZIA 1I1YA 3CN3A 4W9GC 3OLGA 4G82A 4OCSH 4ZMQA 1TCMA 1HNGA 3DX6A 3SDDC 1I7TB 1CBVL 3LMJL 5E2VH 1FVCA 2YA1A 3WL9B 5D1XE 1SYSB 3PABB 4JAMB 4K3JH 4Y5XC 5L6YH 4WTZA 1CDGA 4JO5A 3E3QE 3V0FA 4U1GC 5GRJH 3SO3B 1MXDA 3WFCL 4JZJC 4RBPK 3O4LB 4PJEF 5C0DB 2UZYB 2I9TA 12E8H 2XUWA 3VXME 3KZ8A 4LK4A 4HUKB 4W4NA 3NH7L 3TNNA 1G43A 3OKLB 4M1CC 1EHKB 2XN9E 4RGMB 5GSVB 4JK0D 3ECBA 5F89A 1WGVA 4QHKI 3B1TA 5HHNB 5I0XA 4JB9H 2OYPA 5C0IA 1A8ZA 1ZIAA 2J1XA 3PWLB 5FXCH 1NICA 3JV4A 1NCAH 4HIIA 5C6TH 2JI3A 4JN2A 4PRIE 2E6QA 3I9GL 4EJ1C 1FJ1B 1OZTG 1SYVB 2BSRB 4K94H 1CE6A 2ITDB 3UAAA 1RHHA 1NH6A 2CGYA 2W65B 1RUQL 1MWAL 5IQ7L 4KBPA 1JPFB 3LVEA 1HEZB 2Y07L 4JHUA 1KJ2H 4K3HA 4YO0B 1ZLVH 3P2TA 5FUZH 2VMFA 2GC7C 2BVPB 4HIPA 1J9QA 3NN8B 1H0DB 5SX4I 4Y5XA 3STLB 4MJHA 3O6FB 4PJ9A 1GH7A 2OAAA 2HJFA 3VCLA 5HP5A 2CPUA 5F6IC 2I26N 1JNJA 2UXFA 3D07A 4OQTH 4QIRA 3M1CA 2FT8A 4PRPE 2A9NL 5MEND 3QO0A 3VFSA 5SX5H 3N85L 4XNMB 4EVNA 1MG2C 2YQ2A 3MKGA 4KRMB 4OZGE 5F3HA 2IQAB 1N68A 1J0KA 2BWDA 2PO6D 4WWKB 4NN6C 2OMZA 2GG1A 2YD0A 5E9NA 2V2TA 4AEHH 4AQ1C 3I9PA 2VZSA 1J8SA 3MR9A 1EMTH 3REWA 5JW4N 3JTBA 5DO2D 5GGRY 4PBDA 3U1PA 2WLIA 1SN2A 1VRSA 1AGCB 1AJ7L 1REIA 2QLVB 2Z8SA 1HTYA 1B4LA 4MMXC 1PL3A 1N5AB 4IRZH 2UX6A 1N6VA 3KR3H 5L7XL 4QEGA 3AC0A 4L5FE 5DJDA 1YG9A 5F9WB 5A2AA 5HDBF 4GRLC 4G83A 4K3DH 1Q0XL 1YPZE 2NPLX 3EIFA 4NHUB 1WVZA 2Z3FA 3NCXA 4BZ1H 5JDSA 1BBDL 2OMXB 2DN7A 1KTCA 3IN0A 4ODSL 1JSYA 3FCSB 3MZGB 3S96A 2H2SC 5CIPH 5KTEH 2JV6A 3MJ7A 2H3NB 3O81A 4X80L 3CJJA 1U33A 1JE6A 2V17L 5CZXC 2C9UA 2A73B 5FYKH 4NBZB 1E8YA 3V6FB 1JZEA 1YEWA 4ZO9A 4RGNC 1CR9L 2H47C 4D9QE 5C0RH 1MFCL 1A7BA 5I6XB 3G6JA 4LO9A 4MD5B 2QVIA 3CK0L 3BT2L 3BMWA 3MTRA 4AQ1A 2R69H 4I7ZC 4QYAA 4MXQC 1KB3A 3WKNA 1HEJC 5E70A 4FNLH 3IPFA 1EAPB 2CQVA 2FEEI 4OCYH 3BAIA 4OZFG 2CMRL 3V7MA 4D3CH 1L0XA 2VXSH 3BHBB 4DFIA 1DFBL 2Y36H 4ZS7H 5T1MA 3KLAB 5I0YA 5B3JE 4LFHD 4I9XA 4KHTH 4YSTA 4YGVB 3BGMB 2NCEA 1KTBA 4M62H 1I9IH 1P6AB 1AY1L 4GINA 5EEUA 2OMNA 2CJUH 4PJDF 3N1QC 1H8LA 2V8MA 3WCYA 1BZ9A 4XPAL 1XQ4A 3JWOL 1DYZA 2G2RA 1U4EA 2ZP0T 3AFLA 1RZGA 4L8CB 3G5VA 1LO5A 3B8YA 4HJEA 3FB6B 2MMXA 4KQ3L 4I0PC 5JHLH 1GAFH 4AUUA 1K8DB 5CILH 3GMMB 7FABL 4G7QB 5PAZA 3RZCD 3DVGB 4M7ZB 3O0RH 2HX9A 4GXUM 1UM6H 1F11B 4JZOA 1K3IA 1KWKA 4M1GH 5TE4L 4OZIE 1W80A 3RAJL 1WIOA 1T1WB 3V52H 3X12A 2RALA 5JO5A 5GGVL 4H88L 1MJ8L 3V4VL 2GEQA 3FC8A 1RJYA 3Q8EA 2Y6SC 2DLHA 3CPUA 4OLUH 3IDNB 2CO2A 1IVLA 1E28A 4JANA 3MU3A 5IBLC 4LBEB 3UZQA 3TWCL 3ZKXB 1MNNA 1EANA 2EDJA 1KBKA 2WUBH 5DZVA 1R47A 3B7YA 4OTXH 4OCWL 5BOPA 4URKA 2YPVH 4P2YA 4RRPA 4APXA 1CYWA 1XR8A 2VDNH 2J1ZA 4LLQB 5EU5A 4JKPL 2WLJA 5DK3A 2ZF8A 4UINH 4XI5C 1AKJB 3CHOA 1T6WA 3VFNB 5C9KA 5HGBB 1TQVA 2XQYK 1NGYA 3IJSB 5SWQA 1YEHH 5HYQB 2N1TE 4KKQA 1OCWH 5MEQA 3HPJB 2XA8H 4PJ8C 4Z7OE 1NIEA 3D08A 1U8MB 2BVYA 4LCWD 1ASQA 3OKEB 4HVBA 3CFBB 4DSYA 3INUH 2HUEA 2XWCA 1ZLSL 4L23A 5CUSH 2DWEB 2IALA 1UKTA 4MNHA 2DQDL 3BUTA 4TL4A 5F96L 4ZFZB 1QA9A 5HJDA 4CN6A 2V9UA 3LDBC 1HSAA 3P1VA 4NQCB 4NEHB 5A3ID 1P4LB 2YAPA 4LOEA 3ARPA 4GOSA 4ZUUB 2EVGA 1FPTH 1I1AD 2B2XL 2Y7NA 3TV8A 3T1FA 4NO0D 3V0VA 3L3JA 3QZWG 1OV8A 4XP6L 2WTRA 3UTZB 1WBYB 3RDTB 4AENA 1RIUH 4KXBA 3QFDA 1E2ZA 4A7SA 3HHMA 3II3A 3D6GA 1AFVL 3MCLL 1KPUA 4R4BA 2E0PA 4JN1L 2Q86B 4YSEA 1JDCA 3D18B 1FYHB 4M7LT 4G5AA 3ARDD 3EF7A 1R5WA 5F8QC 2N01B 2E7BA 3GRGA 5ADPH 4UQDA 1IM3B 1VFAA 4UDUB 4M43L 3Q6FB 3AXLA 1FNGA 4X6DB 3BVTA 4WWNA 2C9QA 3WEAA 3P9LA 5T5NG 3I2CL 4UOW0 2GCYB 2G60H 2XWTA 4JFQA 4O2FA 2HRLA 4NRYB 2L7JA 3X3FL 4Z76A 5JW3H 1GJUA 3QUGA 4KO5A 3KYNB 3UTTB 2VXTL 1TJGL 1CDHA 4UNVA 1B9KA 3PXJA 5T1LA 3TVMB 4D8PB 4R3SB 2PXYD 1OAXH 4PRAB 2Z4QB 5EOQH 4F8TA 1OAKH 1KIUB 1EO8H 1RU9L 2J4WL 1HSBA 2ICWJ 3DK2A 5F88B 3H4HA 3KPRD 4OF7A 1VF5C 5JHMA 4LHQB 1Q1JH 3UBXI 3SYAA 1MIEL 1TFPA 1QOKA 3TV3H 1KJ3L 5BRZB 1L9SA 2LE9A 4XP4H 3ULUC 5GGQL 1E5BA 4U1JA 4A7VA 1IGTB 4GKNA 3FK3A 3RURA 1BXVA 2EIDA 4QDGA 3GD1C 3G6JE 1CT8A 1RZFL 2AQSA 4E9VA 5KS9B 2XWRA 2DIBA 3QDAA 4JREC 4KHXH 1HAUA 3KBPA 2FQGA 5KSAA 4FA6A 3US0A 4PS4H 3QO1A 1DBKH 2X87A 5BUGA 2JKWA 3MRKA 2OYLA 1MCNA 3SJVA 1PZCA 3Q06A 1AO7A 1PZBA 3WE6B 3MRFA 2XVKA 3ZE2E 3QULA 5M95B 3UO8B 2LU7A 1NC2A 4XGZB 1MJ7L 1KGCE 3ESUF 4AV0A 2ZUTA 3GBEA 1C1EH 1DJHA 3PWUB 2NY3B 4PBWD 1FZJA 2PW1A 1ZHBA 4RZCA 2WW8A 2W0PA 2FR4A 1W16A 1NSNH 5FOBB 4XMPH 4XVSH 3O3DA 4ENEC 2ARWA 4QRRA 1KLUB 3C8KB 4S0SD 4TRPL 5FYLH 3ZHLA 2BNRA 4UUJA 3HRPA 3CFTA 1B6DA 3MLZH 1JYWA 3EH2A 3MCKB 2IH3A 2CHDA 3SGEH 1DBAL 2ZXBA 2JI2A 3AM8C 1MCLA 4MDIB 3GM0A 4X5QA 3CIQA 2X0UA 2XQYA 4P4RB 4RGNE 1BJMA 4OAWB 1QUNA 1TR7A 1ZWIB 2EO7A 1CCZA 5AUMA 4K4KA 1PLCA 1ID5I 4BGDA 5EC1B 1CTOA 1RIHH 1A6TB 1UUSA 3BZ4B 4MYPA 3ECQA 3P9MB 2V5RA 2XFXB 2I69A 2ZUUA 2IQ9L 5EEZA 4WO4D 4NS0A 4FLQA 2HCZX 2F74A 1I75A 1T7VA 4OF6A 3MGTA 4OD2A 3BEWA 5IEKB 4HZ1A 5LDUA 5CEZH 4C56D 3STZB 3VMPA 3MJ9H 1T0OA 2IV9A 2BRQA 5DS2A 2W0FB 5EIIG 4H8VA 3S3BB 25C8L 1I3VA 4HIEB 4XNQB 2O5YH 2Z7ZA 3TN0D 4GKOA 4Z3HA 4KVPA 2LU3A 4UZGA 3WDIA 5IEHA 1DVQA 5C0GB 1DJIA 1M9WA 5K1VA 6PAZA 4HLZG 3NSYA 4KY1H 2CBMA 4I3SH 4HAGA 3ZR5A 1LO4H 2F7IA 4PCSA 4WW1B 3AM8A 4YHML 1KMGA 4LHJB 2H6UA 2R2EA 4WTWA 4IDJL 2C3VB 3PNWB 2F1EA 4YSPA 4PRNB 3V6ZA 1ZT1A 4EZJA 5E0FA 4CJ1A 3WGVB 3BI9X 2CJ3A 4YNYA 4OIIH 1S7QB 1NANI 1XGTB 2EDOA 1YZZA 4YBQD 5AAWC 4ZG1A 1X7QB 2FLMA 3U1SH 1M4KA 3MZTA 2ZP8A 4NZFA 4Z5RA 2JKTM 1JRHI 3WO4B 2ZX8A 1LD9A 4IGBB 2XY2A 3GBNH 4PUBL 4JDZA 4BUGA 4OI8A 4OUUB 1N8OE 1XF5A 5DZNA 4M7KL 1QSZA 5LCVH 1S7XB 5G4OA 4TSCH 4XCEB 4KDTA 2ZT9C 4HP5A 2BNQD 4RMBA 5EULV 3DURA 5ICZB 1WEJH 2WXOA 1D5IH 2J88H 4AGPA 5M7QA 3F12A 2Y5QA 4GAGL 3ZT6A 1MZZA 2EYTB 1J5IA 4PJBA 3ZO0A 3HFFA 4HPYH 1VFOA 4A6YA 2APXA 1AVAA 2D9QB 5FK9B 5J4MA 1CFVL 1VESA 1OGAA 2DQJH 5F97E 1S7WA 1DQTA 2COVD 4X5XA 3S3DB 5GISL 3S8WA 3K80A 2DMCA 2FTAA 1Q0YH 4L3AA 3BD3A 1FV1A 5HI3D 4K5NA 5F6HI 3C60D 1YEKL 2VSKB 3K72B 1ZXQA 3KD4A 1XV8A 1DBML 4GRMB 1CDJA 4G1MB 3EBHA 3WXVL 5D2LA 1J8HA 4OSUH 4NQED 1QBLH 3TA3D 3DIFB 3TH2T 3PCYA 3WNLA 3DYOA 4QNPE 1HL5A 4QRPA 3VFUB 5I1DA 5IW6A 3QJZA 4U1NB 5J12C 1YDPB 5EBGA 2NY2D 3MRLA 4XP9H 4ZFOB 4HCGA 4ODWA 2Q2LA 2GTWA 1OOAA 2TAAA 1U92A 1G5AA 4X6DF 4ZO8A 4WJG3 4A2FA 1WGOA 2OA9A 4U4BA 3NZHH 3T2QA 2TRHA 3CTTA 1A6UL 2P5WB 2Y1VA 3PQYD 5FW8A 4R4FL 3SD2A 1IKFH 3LPOA 3BSZA 4KTEH 3T2OA 1HK6A 5BJTA 4KRPD 4JGJA 3PXLA 2I9LB 5LAXA 3SJVE 5B7EA 3GMOB 5IB2A 2VZOA 2P26A 1AO7E 4UB0L 2JIXD 3N43B 2J44A 3I50L 4LSRL 1XB8A 3VG0H 1T3FB 1IT9H 2Y23A 2NX5A 3ATFA 3A5VA 3IKKA 3UTSA 5M94B 4BQ8A 1PJ9A 2MKWA 2OL3B 1DJGA 3QUML 3OAUH 1TZ8A 3GSOB 2AQ2A 4HK3J 4RWYL 5I75C 4JHVA 5IHZB 3IDJA 3MUHL 1X9QA 1OSEA 3OB0K 4P46B 3MA7A 1EFQA 3DVNB 4HKBA 2AEPH 4JMXA 1AQDA 3CZEA 4I13B 3BWZA 4QRRE 1OW0A 3EYSL 2EDYA 1MI5D 2BNRE 2QMJA 4EI5A 2P42B 1IGCH 1QWNA 4UTBH 1KB9J 4HDIB 4Y5YA 3SDDB 5KS9F 1QQDA 4PJ7A 3KNBA 4JE4B 4PH8A 2PW2B 3Q2NA 2EIZA 3ULUE 4ALAH 4NO3B 1FN4A 1FQ9C 3SDCC 1SMDA 3ESVF 4POYA 1P5UA 4N2OA 4YDJB 1H3UA 5FA3B 3VD5A 2HLFC 2R7EB 2WQSA 3JUZA 2HB0A 4F37K 5C07D 3BLKA 3H55A 4WI5A 4L2YA 1JGIA 4Z7NB 2FO1A 2ADGA 4FZEL 2OJZL 4J3OF 1NAMH 1B4RA 5CP7B 1Q9WA 1E9QA 3H3KA 3E0GA 4YFEA 4P05A 1RULL 4HUCA 4F15C 1I53A 4MHHG 1YUHB 1KYAA 2H3KA 3ULVH 2BIPA 1EX0A 3GSXA 5FKPB 1PPIA 3RY6C 5LGYA 5CKGA 2R29L 3WIAA 3T3ME 2KYIA 4Z7QF 5EU4B 3PWPA 1KCLA 2XN1A 3JBG7 2BSTA 2F54D 1TQBB 3BCFA 5IVZA 1HHKA 1U2YA 2J2ZA 1NAKH 1CQYA 4EKXA 3BUPA 1EZLA 1AXTL 1BD2D 4YHLH 1DBJH 5ISZA 3NZ8B 1LTXA 2E8YA 4CVZA 1HCZA 4UM9D 4MS8D 1GW0A 1H3PH 2G75B 3IE4A 4OJCA 3CVIH 3VD2A 4RA3A 1ZA6A 1M1SA 2MIZA 3FU6A 5GGSA 2NZ9D 4XE0A 5E2VL 4ZUTA 1FFOB 4U3SA 5L6YL 3LRSB 4K3JL 2UXVA 3IGAA 3HZMA 2AQPA 2KI6A 4ODHH 1SQMA 1X7SA 1A4KB 2NW3A 2DM3A 5IROD 1QSFB 1DJYA 3L13A 4HIHB 3C2AH 1RZKH 3BFWA 5AW8B 5C0ND 5TGBA 3PP4L 3RBGA 3Q5OA 1IEAA 4H5SA 12E8L 4XMLH 3HG1A 5HGAA 4DJMA 5CD3A 1MHCB 3JYBA 4PJ5A 2OJ1A 1JD7A 1I7ZA 4C4BA 5IMLA 2KC0A 2WLZA 3K4DA 5EZLA 4I4WA 2YD9A 4P3DA 1KGWA 4PGEB 3SBQA 1AGFB 4JB9L 3RY6A 5DZOA 3DNKA 3GBDA 3F00A 1F6AA 2WYZA 3KGTA 4JFXA 5FYJH 1NCAL 5C2BH 3LSOB 5C6TL 1FWXA 4Y89A 3FFDB 4TM9A 4PJBE 1AQ8A 1NKGA 4K94L 8CGTA 1QO3B 2XZAL 4QRSA 2CA4A 4Y4FA 4YN3A 2KLRA 5C0FA 5DHYA 3O8XB 1AAJA 3PP3K 5CEXB 1G87A 3QZLA 3CFCL 4P06A 1OGAE 3VYOA 4FNRA 5IR1A 1KJ2L 4ZMTA 1MVUB 3HZKA 1UENA 3PL6B 5FUZL 4YC2C 2VABB 2YN3A 4DAGL 4H8QA 3VX0A 5B39B 5EU6B 1SLWA 2VN7A 1BIHA 2JTDA 4IU3A 4RMVA 4QHUB 3SGKC 3IK2A 3VXTB 1GRWA 4FYQA 3SQRA 2FEJA 2ED9A 4NPYA 4NZRH 3LIZH 4Y4KB 5D2LE 1J8HE 4OFQA 5DDHB 1E5ZA 5DEFA 4OQTL 3F6LA 4QRPE 1G6RB 3ROLB 5LB1A 6PCYA 2PO6C 1WC7B 3GK8L 2GB2A 2ZCLH 1NCJA 1KGJA 2VTFA 1A1MB 2CRZA 1J9TA 2VE6A 4XCNA 1H5BC 3CPLB 1MKFA 2VAAB 4FJZA 4QRBA 5DO2C 2W81C 3GMQB 1O5DT 2FVNA 1NKOA 2EEFA 1F00I 4P5MA 2BWQA 1T7YA 1J0HA 1EMTL 2VDOL 2ZYSA 5AW2B 3U7YH 5FX3A 1ZT4B 1N0LA 1URLA 3PV6A 3C5ZA 4PWKA 1UJ3A 3GMRB 3GUFA 1FO0A 1T22A 1WO2A 4N2LA 4BUQA 1U8CB 2ZX5A 1FC2D 2O4EA 3MREB 4LMQI 3KR3L 2PYEB 4DF9A 4HKJB 1RPUA 1KYUA 3IKCB 2NX5E 2OTWB 3KCPB 3UTSE 1AG0A 4NKOA 3KYOB 2R1XB 1U8QA 2X9WA 4LASH 1AQHA 5F1IB 3Q3GB 4BZ1L 3KWXA 1TLMA 3ABMB 4OZFH 4OI7A 3OJDB 3ELQA 3KAAA 4NKDB 5AZEH 5KTEL 1E6JL 2JKXA 3H9SA 1INEH 1Q94B 1EFXD 4G5ZH 1JMZA 4U3CA 2BVUA 2HN7A 4GEIA 4KI5D 4L4TB 3VFPA 4PWFA 1OGSA 5DD3H 5FYKL 3OL2A 3Q6GH 4PJ7E 1WG3A 1OF2B 1JDAA 2DWDA 2N3JA 3MO1B 4D0DA 3GXNA 2FGWH 5C0CD 3TT1H 3V7AG 4BFOA 1XF4A 2R69L 3ZR6A 3QDJD 4FNLL 4X6EB 4XNAA 1UZ8B 1NFAA 1XGUB 4YVNA 4Z0XA 3N43F 4OCYL 4D3CL 5DC4B 2OQJB 1N70A 35C8H 2VXSL 32C2B 4ZS7L 4M3HA 3GSRB 1GY2A 2DDQH 4A55A 5BVPH 1HHHA 3A24A 4KHTL 4Y1AA 1PAMA 3VX1A 1IGJA 4M62L 1S7RB 3FUJA 3ARBB 4GMTH 1C8PA 4R90L 1XGRB 1U95B 2C3XA 1Q8MA 2P3YA 4WK4B 3FTUA 1X5AA 2J21A 5KVEH 1EZUA 3CHRA 4A38A 1EZVY 3RZCC 2GI7A 5JHLL 4XRCB 3D7PA 3IEAA 4K9JA 4LLDA 1BPLB 3IETB 3PWPE 1G9EA 3AU1B 3R1GL 4N3TA 1OLZA 3K81A 3KL5A 3O0RL 4OT1H 4QHPA 3CSTA 3HS0C 3MGOA 1WFTA 4OM0H 1UM6L 2FWOB 4C83A 2UY7A 5BOZG 4M1GL 3NIFE 5ISZE 2NXZD 3PPEA 4UMGA 2V5TA 4MJ6B 1T03H 5AWNL 1A1OA 1RUKH 3JTSA 1XMWA 3S34H 3V52L 1VHPA 3EJYD 3DOSB 4ANVA 1A0QH 1E3ZA 3V4PH 3CWGA 4DZ8B 4F2MB 4H1LH 4KRLB 5IY5B 4JGUA 1FAIH 1MWAA 4LPYA 4OLUL 3TT3H 4UAOB 4F7MB 1WA2X 5CWSA 5MHSD 4BM7A 4BK4A 4E68A 2F8VA 4YSQA 4QUOA 4NC1C 2WUBL 2WSKA 4IBSA 4OTXL 3H6AA 4L4VA 2DKMA 2YPVL 3P4OA 1R19A 2A83B 2YMXH 1NWPA 1Q38A 1MLBA 4OCLC 5DUJA 4D0BA 1GHFH 4HW6A 3FS9A 2CR6A 3HG1E 4UINL 4CW1B 4XNZC 3L5HA 4N0YH 5IJVA 3OPUA 3VRIB 1T4KA 4KK8D 4PJ5E 1KOAA 1CICC 5E9DA 5BQDA 5HPMA 1DVTA 2Y7OA 3RZCA 1OCWL 3GSUB 1GZQA 2XA8L 4L3CA 4ETYA 4KC3B 3O11B 1GJIA 1ZRUA 2D03H 3VXSD 3VWJB 5FYKD 1QSED 3QXDA 3INUL 2A6JA 4FMVA 4AIOA 3HS0A 3QNXA 4RH4A 3GMNB 5CUSL 5FHAH 1A6ZA 3O2DH 1LHZA 3MOAH 3FUHA 3HI5H 4WSJA 4K3GA 1I1AC 3JVFC 4OIBA 3TM6A 1QI4A 4TNGA 4Z3IA 5J0BA 2O5ZH 4FQCH 4PY7A 2I60L 3THMH 1BZ7A 2V5MA 3QJXA 1E43A 4ZTPH 3S36X 2EUXA 3ZHDA 3E9UA 5I8KH 2ITEA 2R0ZH 4X4KA 5CLYA 3JWOC 3ZDZB 4X7TB 4YSCA 4JR9H 4WFED 2CBQA 3NJHA 5DZPA 3SYPA 3X14A 5KVDH 1IX2A 4WI3A 4FEMA 2N1KA 1FG2A 1V54B 2HLEB 3ARDC 4RZKA 2K3TA 1GGIH 5CJQH 2ZUXA 2XWBA 1LP9A 3KBFA 3GJEB 3FO9A 4N4YB 4LLUB 4JREB 1C5BH 1HCVA 2AV7A 1QR1A 5FDWA 1XCWA 2ODHA 3LEXB 3MPCA 4LDCA 4PRBA 5IHWA 4M9OA 4P8QA 4LCWA 5ADPL 2J8UA 5D1QD 2C7FA 1ECZA 3ZDWA 4JBSA 4BFBD 3BVWA 3H4FA 2R2BA 4FS0A 5D72H 4HZAA 4KXAA 3LNFA 2D31B 1IBBA 2H2PD 2G60L 3P4LA 3HLKA 4ZYKB 5C0AD 1PZ2A 2CO7B 2YLHA 1CPUA 3B5GA 5JW3L 4GQ9H 2PXYC 5F9DC 5A2FA 1JGLH 3FU7A 4NNXB 4I5BA 4ZPTB 4K73A 1DZ0A 2ZG1A 5EBMA 1UHVA 1OAXL 3MRCB 5EOQL 4LF3A 1EO8L 4Y5VC 3TIDB 3QQ4A 4D9RE 2BIOA 2RQ8A 5DMKB 3UGUA 1Q1JL 2WIIA 3H9SE 1DE4A 2OCJA 4G80B 2UWEA 5DMIH 1CGXA 3ZO9A 2M26A 4XP4L 4TVSa 4Y7MA 5IHUH 3FTWA 5C08D 3SEPA 4AVKA 5DJ0B 3CSGA 1WYJA 2C9VA 3M7OA 2BVOB 1TNMA 5CN2A 4YMPA 4KH2A 1AZNA 5DURD 5FECA 4LPXA 1NFDB 1OANA 3LD8B 3TBVB 1CO1A 4PS4L 1DBKL 5SWZD 3V4VA 4N2NA 4FULA 1TFHA 1E9PB 3U36B 3Q1EA 4HKXA 1HH9A 4GUQA 1S9YB 4Y1AE 2ZG2A 4HFUH 4XMTA 2R9HD 5B4MD 2QQLL 4I9WD 1C1EL 2WLYA 4HWEL 1I1FA 3CU1A 2CIKA 4KX7A 5DMYA 3MBWB 4AWJC 2J1KA 3ABKB 4WWID 4P49A 1NSNL 2H7WA 4N2GA 3NIDB 4EXPX 3NP3A 4XVSL 1D3CA 4Y5VA 1FNFA 3EJTA 2FO8A 3GQFA 5FYLL 4BIKA 2EE9A 4F1ZA 4DPRA 3AG1B 1UB6A 3TCLA 2O6DA 2JJTA 3NOIA 4UDTA 1E65A 4HWZB 3KGRA 4UWQB 4L8SC 5F1OB 3WEOA 4RIRA 1KLGA 4PV9A 3EYFB 5JHAA 3Q2CA 3BIKB 5I66A 3MI6A 4BH7A 1HXYA 3MV7B 4M48H 4XE5B 5HHOA 3UTQA 1RIHL 4WO4C 2E6JA 3DC0A 4MJ5B 1A65A 3DHMA 1WUZA 1U91A 3APMA 1T04A 4OZ4B 2GT9B 3HG0A 3W9EA 3VRJB 3RGVD 4Y2DD 3OAZH 1AR1D 4FI6A 2AJUH 4L4VE 2P7TA 1SVZA 4YLBA 5CEZL 2OV0A 4G11A 7TAAA 3II1A 3DXAD 3DJRA 3I3BA 3MJ9L 3O2VH 4IHBA 5D71H 4FQ2H 3TN0C 2HJKA 3RTLA 1I4FA 3HG3A 2JE8A 5GIRA 2PTTA 4XWOD 5E9DE 4Z3GA 1L0QA 1BVNP 2AMUA 2O5YL 4CMMA 5AB0A 2AERT 3MMEB 1FORH 1GSKA 1ZE3C 1RJZB 1R34A 3EYOB 2FHFA 4N0FA 5F1NA 3KDMA 4KY1L 4UMSA 3TO4B 1BQ5A 4I3SL 4P5RA 1W0WA 2FBJH 1LO4L 5DRZA 5TF1H 2KZBA 2P80D 3QH3A 3N1MC 4NQSB 1FFPB 3FO2B 3L2LA 5CBEB 4X7SL 3SOBH 4YBQC 5EEYA 1OQOA 1QBMH 4FDWA 4PGZA 5C3LD 4I2XA 4OIIL 3P40A 2CKBH 3A3YB 3BPNB 3T4YB 2MKLC 5AVRB 3U1SL 2Z93A 1KULA 1NCOA 5BZWB 3R06B 1TCRA 2YGOA 1AD9A 3GBNL 1HHIB 1RCYA 3BMVA 1BZEA 2BCMA 2DIEA 3T4AA 3G08B 4YHNA 1IARB 5E8EB 3FCTB 3NCFB 4Z7WA 4B7LA 2NXYD 5LCVL 4M56A 5DU7A 2B8OT 4TSCL 5H35B 3VXPB 3QJTB 4KJQD 3HRZB 4EN3A 1LP9E 1JHKH 4A2HA 1WEJL 5FYLD 1D5IL 3LHAA 5AEAA 5JYMA 1JYVA 1DLFH 5EIQA 1QHQA 2HX8A 1A3QA 1F56A 3MFFB 4LCWE 1BEYH 2J8UE 2VDPB 3F58H 3D09A 4X9FA 4HPYL 1BAFH 2NLJB 4A2MA 1F5WA 2W07B 4WU7B 1WQVT 3ILQD 2EIJB 2ROXA 1S46A 2IPKB 3PDOA 4K9EC 5JIKA 3ZVVA 4TMPA 1D9KD 5HI3C 2DQJL 1P53A 2B4CH 3C60C 4MJIA 3MRQB 4QHNA 1EZVX 4U7SA 1OTSD 4JM4L 1Q0YL 2ATKA 3MLYH 3ZDZF 3OX8A 4LCYB 2BC4B 5GHWH 1YY9D 4MRCA 3G5YB 2R23B 4ZTEA 3ZQWA 2AKRA 3QNFA 1QLEB 4X4ZA 3BSHA 3TA3C 4PV8B 2TSBA 3VFVA 4IU2A 5E1AB 5CEZD 1DJSA 1KBPA 1ZHKA 1QBLL 2NY2C 1T1ZB 4OSUL 4UQ3B 1D7CA 5F7UA 3K3QA 3EJPA 5J3HD 1CF8H 2HG5B 2E3VA 3ZGIA 5CD5D 4QKXB 2UWEE 4O58H 1ZHNA 4XP9L 4FQHA 4NX0A 2B1HL 3NEEA 5DS8B 1J11A 4JJHA 2DQFB 1DBBH 5K59F 1Z1WA 43C9B 1M7IA 1RKRA 5CCHE 1TETH 2L7EA 4F7CB 1HILA 5KVGL 5HDOA 3NZHL 4HCRH 1ULVA 2X4OA 3DECA 4KRPC 3GJFK 4ZMLA 5DJXB 3CDGA 1IKFL 1IAII 4KTEL 3L5WA 3EKCA 1R75A 1B3IA 4BCYA 5EF2A 3AITA 3ELAT 1IAKB 3FQRA 4BH8B 3EDJA 4PRHD 1IT9L 2IWGA 3C60A 3CVHH 6FABH 1NGWB 3IFNH 3W2DH 4PJIA 1JJUA 4MCYB 3OAUL 3S36H 3T0ED 1W8EA 2ZSWB 4MAYD 5EV7A 2VN4A 3TA3A 2QADD 2XWJB 1IGMH 1UEMA 2AEPL 4PB9H 3B9KB 1T1YB 1ZIBA 4Z77B 3IAGC 1WF5A 4WI7A 5I1CH 3QNYA 1X5MA 4WRLA 2A6KB 2BH0A 5IMKA 5C0BD 5AG9A 2NY6D 2H0PA 1CU4L 1ILUA 2DWSA 5F6HJ 1CWVA 1NANH 2O61B 4JX0A 4KTGA 3ARXA 3HEIB 4PRDB 2B08A 2D7TH 3ARTA 4YFDB 4ALAL 4H8HA 3BWAA 3H9HB 3IMWA 1JRHH 3PQYA 4R84A 2RCSH 2P8LB 5HHOE 1UCTA 2DS4A 3QQ3B 4EDWH 1XGQB 1CFQB 1Z9OA 2JIXA 5AOIA 5LN8A 3C9NB 3IU3B 4ZXBB 2DJMA 1NAML 2ZOKB 1L4IA 3KS0J 2A4ZA 5GGUB 2V2WA 2E7CA 3WFBH 1ZGLB 4NYLA 1NGZB 3DPDA 3FFCD 4JGNA 4PS3A 3NIDF 4RDQG 1KNOB 2B5IB 4P4KD 1PDKB 5D7JD 3BAEH 3US1A 2OPCA 2COQA 3ULVL 1CFTB 3U46A 4NFCA 2IFGA 3HBZA 3R4DA 4RAVA 3V55A 3HAEB 3VFGH 1MI5A 3H56A 3WNPA 4A2EA 3ETTA 2FJHB 1NAKL 2JCCB 1TTUA 1ZD6A 1E3FA 4MS8C 4OD3H 2YS4A 5KWYC 3A47A 1IBHA 1DBJL 4IEFA 2XG5A 5E5MA 2YXMA 4CADA 1H3PL 2NZ9C 1YMHB 2XCMC 3ILEA 4NO5A 5GZOD 3CVIL 1OLLA 4JRXA 4HJ0D 5C07A 1YEDA 5L4IA 3C8DA 4X4MA 4I2XE 3ZXAC 3G7TA 1YUKB 3L3IB 5J1TC 5IROC 5C71A 4FFTA 4IBQA 3WAJA 3OMIB 4FAAB 2XI9A 3M07A 5ANHA 4IHOB 4WCYH 2GUYA 5C0NC 4P07A 3KS0H 3ZK0A 4AC2A 2FQEA 3EFFA 3LNHA 3OJ2C 1U8OB 1U41A 5I2IB 1TZIA 4BKSC 1FL5A 3C2AL 4P2RA 2VQ4A 1NEPA 1RZKL 1H5BB 4GXFA 4XMLL 2ARJB 4Z7WE 1TVDA 1RUMH 4UQAA 2EQDA 1QX1A 3L3KA 4G59C 3TPUA 4NQQA 2VDLB 1NOFA 3QWOB 4YZFE 1ORSA 4R7DB 1AC0A 3BZEB 2QJDA 3OF6A 4UQ9A 4EIBA 2QGBA 3U2SA 1OB0A 5FYJL 3BFQG 2JQZA 3W9DA 5C2BL 4FTVD 5K93A 5IHHA 4MSWB 2X4QB 3AU0A 5AOZA 5IMOA 3W9EB 1JK8B 2X9YA 4XVJH 1AE6H 2BOLA 1PY0A 3O45A 4GSXA 3MVSA 4TUOB 3KPLA 5F70A 4CNIB 5CZKA 8PAZA 4E41B 1R9FA 2ZJSH 3WJJC 4MJIE 3KLHD 1TZHA 2DV6A 3UJIH 4QRUB 3NIGE 5LJYH 1NM9A 4OZHA 4GBXD 3OXSB 2XRAH 4Q0XH 3S4SG 4IS6B 4U6TA 1A6VH 1T2XA 1JWSA 3B8SA 5FGRA 3L7EA 5IROA 2JKJA 3BJ91 4XX5A 4GG8A 3KGUA 4NZRL 1E5UI 3LIZL 5DJ6A 5IB5A 1J8KA 5I23A 1S7TA 1YYCA 2YQGA 2OXHB 1BAGA 1XR9B 3ULVD 3GUTA 2ZCLL 5IW1B 2C34A 3VVWA 3GIVA 3L48A 3HLAA 2C3HA 1SPDA 1F3DH 1PAZA 3QUYD 5GRUH 2VERN 5IJDC 1A6AB 2VITA 4EZKA 3AUWB 3JWNG 3U7YL 5EA0H 1FRGH 5EFIA 4QWWD 4JRYB 3LKPA 4OGYH 3CFJA 3VVVA 3WNKA 4DP6X 4ZZKA 3U0PB 4MZ3A 2PTUA 1EDHA 1PZ5B 2QHLA 1THCA 2YFOA 3MAWA 5E7FA 4X4YB 3DMMB 3POCA 4PG2C 1GJWA 1JV2B 4G6FD 4DGYH 1UD8A 3KLKA 4AQAA 5FV1L 2DL2A 4LASL 4PJIE 4F8NA 4GW5B 1MCHA 1J10A 4GB9A 1CUOA 3RPIB 1JF6A 2NNAB 3QWNA 3JUYA 4XT1C 3MBXL 3NJNA 5C86A 1ZTXH 4ZRGA 5I1AA 1V7NH 2O30A 4Y9GA 1P5VB 4D9LL 1EXUA 1OPGH 5AZEL 4KI5C 3S2AA 1INEL 1NJ9A 2OYMA 3ARFA 4G5ZL 1PBYA 4HG4J 3LN9A 3GMLB 1TKWB 4JHBA 2E56A 2YQBA 4ZNEA 4K94C 1F1GA 4LQ1A 2DLEA 5FYJD 3TT1L 1XCQA 1BXXA 4X5PA 1A9BB 2QFPA 3JTTA 5TE6H 1OTTD 3WIHH 3PQYE 3BJLA 4JM2A 2XV6B 3B6SB 1FH5H 5IB1B 3HI1A 35C8L 3BZFA 3HHRB 3OD3A 2XWZA 4OIAA 4WHYG 2Q3XA 2BHFA 5BVPL 5CFAA 5KYYB 3WTTA 4O02B 2VM4A 4Y4HC 3W57A 4BSWA 5BZDB 2B59B 3UAJA 3SQOH 3O41A 4PTTB 2X4UA 4PG2A 4WFHD 1MJJA 3MSPA 3LZOA 1CICB 2NUTB 4GMTL 3OKDB 4XPTH 1M7XA 4JFFD 3FUFA 5KVEL 4FI8A 1OK0A 4YDIH 4ZW6A 5EB9A 5FGCB 2E74C 4PFEA 2HFFB 1M7UA 1XZ0A 2D7NA 4QJ3B 2CNZA 5D8JH 2DBLH 1GS6X 3L3GA 1MI5E 1EFXA 5IVNA 5TDPA 1U3JA 4PB0L 3SD5A 2NXZC 4OT1L 5D7KD 3D25B 3RWCB 3PFQA 2AFNA 3SY6A 4OM0L 1I1AB 2GI0A 2FH8A 2NNXA 3EJYC 3MRNA 3QEUB 3EOBA 5C0CA 1T03L 2BINA 3FO1B 4B9CA 5D93C 5CAYB 4F2FA 5I30H 1RUKL 2C9RA 1K72A 1WUNT 3CDZA 4NOBA 3V5DB 3W82A 4JRXE 1CJYA 1A0QL 3MRHB 5C07E 3V4PL 4HG4K 3FHEA 4X4ME 4OKDA 3L4XA 5AB2A 1FAIL 4RRPM 1PY9A 4CC0A 4FGMA 1KJ2A 4HUXA 5EOCJ 4K5LA 4EI6A 2W91A 1P1ZB 4YE0A 4GO9A 1L6ZA 1I8LC 3BN3B 4NBXB 2YMXL 4RNRB 5E2UL 4P2RE 3CSPA 1GHFL 4KK8C 4X0NA 5JNYA 2DWTA 2X70B 2HPTA 2N7AA 4F7EA 4E9YA 4N0YL 4OQTA 1HHGB 4WHCA 3SBPA 2P5ED 2JCCF 5KJRH 3M1BB 1S9WA 3DGGB 3F7VB 2OI9C 5AYTA 5IKCB 1IIIA 1X6LA 1RJLA 1UA6H 3LZFH 2D03L 5KG9A 3QA3A 4GUCA 2VQTA 1BPVA 3QUZD 3P9WB 2N0KA 5FHAL 3JZYA 3O2DL 5E00B 3MOAL 5HYJB 1QFWI 3CVDA 4NNYA 2VZVA 3H7BB 3F3HA 5L8LB 1BM7A 1KELH 1UVQA 1M2VA 2F9BT 5AG8A 4GG6A 1H6TA 2YOCA 4WY7H 5FO9B 3BO8B 3WHE0 3CVCA 1BVKA 3G6AB 2XTSA 4MZIA 2I24N 3KJ4C 2WWOA 4IJTA 5BZZA 5EBWB 4OZHE 3WFDH 2MCPH 1KT2B 1I8MA 1BYNA 1DQJA 2DMGA 5DTFA 4ZTPL 2ICEC 3J8F7 3ARUA 3RHWK 3ZKND 3BPCA 1M7DB 2Y6TE 4U1LB 5I8KL 1G9ML 1VGKB 2D4DA 4EUPG 2JB6B 2R0ZL 2YD4A 2LU4A 3L3HA 4JR9L 4FADA 2LLNA 5DJCB 3NPZB 1YEFH 3P77A 4P57A 3K1KC 4KKLC 1JHLH 1I8LA 4BZ1A 3GZQA 2ZUYA 4N20A 1K2DB 3OXRB 1GGIL 4NUGH 2E86A 2FEEL 4P2QA 5CIPA 5EOTB 3T0XA 3B9EA 5CCGE 1PU0A 4JHWH 1JTTA 1C5BL 5D1QC 3L4YA 1INQA 2P9RA 4X5WA 4DCQA 1JCVA 3GRWH 4R0LC 2AAVA 3QDMD 2WZPA 5BS0D 3VXSA 1KJVB 1QSEA 2ZX6A 1SXNA 3VGFA 1G7JA 2H2PC 2QV4A 5D72L 1BVLA 3A0OA 5K33A 5IJBC 3MN8A 1DZBA 4MXVF 2R69A 4CGTA 2BX5A 2XJKA 1Z66A 3CSYA 4LSPH 4P23D 2BS9A 2EABA 3AVEA 2X4NA 5GRVL 1G6VK 3W56A 2IDFA 4GQ9L 1JGLL 5E2WH 1J5OH 4Q9BA 3V0WH 4PJHA 4MNQB 1RD6A 4C8XA 2EDTA 2P8MA 4LXFA 5TPWH 3WHXA 4J3OH 4KUCF 3L81A 4L8SB 3FYEB 4IOSD 4BDVB 1UXMA 3SPVB 1UXSA 2R0LH 3ME0B 4FQIH 5JHLA 3HE7D 3ATAA 2DQCL 4JVWA 5DMIL 5GS1C 3IE9A 3ALPA 3IJEB 3WKQA 5IHUL 2XN9B 4ZNEE 1FSKC 4C4KT 2NQCA 2EVFA 5D1QA 3VE0B 1MCWM 3FCGA 2Y3AA 4R0LA 1HXKA 3FB5A 3SDAD 3TBYB 5I0DA 5DC0A 1NPJA 4PRIB 5HGGS 5D96B 5IBUB 5E1HB 1D5MB 4IIQA 1IQDB 2R9HC 5F9AC 5B4MC 1QRNB 5HPOA 5JHDD 3B3IB 3LJ3A 5C0AA 1PYWB 2AQNA 4HD5A 4NKMB 1E30A 2O1AA 4GP4B 4D0CB 1MHPH 2QZQA 4HFUL 1DQIA 3UIYA 5JR1L 1QUPA 2Q7YA 3TBTB 1SBBA 4H44C 5ICYA 1NMCC 4F9LC 4BFRA 3D85D 4LCUA 3GHPA 3JT0A 2YPVA 5HJ3A 3TX4A 5I6OA 3DSFL 1H3GA 3QW9A 1WRFA 4M4PA 3RA7H 5EBLB 4JO4H 2WTPA 1MCJA 5I8CB 1HHJA 4NBYB 1HDMB 2AXFA 4OLEA 5AYUH 4M4RA 2UVEA 2V7HA 1ZVYA 4GIAA 4IRSB 2Q3ZA 4NN7C 4LNVA 5C7XH 2K8MA 4MD0B 1A2YA 2VUYA 5DJAA 1AS7A 1AMYA 2F15A 4OZGB 4UZUA 4WI2A 4BK5C 5C0CE 1KPRA 2XLLA 4PGBA 4PV1C 2JF1A 1KG0B 5CU5A 3ULSB 4BA8A 2ERJB 1UWGH 3RGVC 4Y2DC 4G71B 1AR1C 5IQ9A 2EXYD 1OT4A 4A1RA 2BP5M 2AJUL 4JJ5B 2WLMA 3C09B 4GW4A 4AYID 1BQKA 1P4IH 4KVCH 3BUIA 3ARGB 1HKLL 2HRHA 4XWOC 3O2VL 4LHUB 4WUKL 4FQ2L 3BYTA 5D71L 3GB7B 5BW7C 4TQEH 5TH2A 1QWUA 1YPZB 4NUJA 2ITCA 2YXWA 2D9CA 3RWDA 4JE0A 2QSQA 5BVJB 2XICA 3P2DA 1H6EA 3PJSA 1EWHA 2WWMD 2ZWKA 4M6MH 4M6NH 5J06A 2OMUB 2FYYA 3G9AB 3CN0A 1OP5K 3V5KA 1ZK5A 4JZNB 3VXNA 1F90H 2FBJL 3K6DA 4HS8H 5KN5B 1XVSA 2X10A 2YK1H 4DZBA 1DQMH 4BK5A 2CNYA 5AW6B 4A67A 3EG9B 4J3VA 3CQFA 1LQBC 1J5CA 3SOBL 4GG6E 1QBML 2WBJD 4NT6A 5FO2A 3LRKA 2GJJA 2PCPA 4N2DA 4W1TA 2XG4A 5TDOA 2CKBL 4LLMB 5CEYA 3CH1B 5AFAA 4XBGA 1N59B 3U9WA 1AACA 4FQXD 2Q9OA 3BPLC 3MCG1 4JFDB 3UYOD 3FTZA 3EGXA 3TZVD 3DK0A 2WB1A 2NXYC 3DIDA 3DXAA 3RKPA 4KJQC 2HFEB 2FWLB 4WI9A 3VYNA 4P2QE 5BW7A 1VIWA 3DO4A 2YZ8A 3AWGA 3DV6B 3KPMB 1JHKL 2AJ3B 2GSIB 4QT5B 4LRNL 3IDMA 3VXOA 4F20A 4OFYD 1FZOB 1DLFL 1N26A 2FCBA 3OAWA 4Q52A 3QJHA 3LY6A 3ILQC 3D2UD 3VXSE 5FYKE 3SDXB 1IBFA 3F58L 5JTWA 1QSEE 3PHAA 1UH3A 3C6LD 1E27B 1D9KC 1J88A 3P3SA 2P80A 2MPAH 4S2SB 3T04D 4G9DB 2Q6WA 4Y16B 3O2WH 1I1YB 2BNUA 5EZJA 1HQ4A 2VM9A 2B4CL 1DQDH 1YY9C 4TVUA 4BSVB 5IP4A 1NEUA 4GLRI 1K85A 4HUUB 3H7LA 1GZPB 1MFBH 3FT0A 3QHTC 1K8IA 2KQNA 1FVCB 1RV6X 2BRRH 5E95B 5GHWL 1CGVA 4P59H 3RWEA 3H6JA 2YN5A 4WAFA 3ARWA 1ITBB 1M1XA 5HYSA 4WFEE 2ADFH 4PJHE 2FD6H 3VACA 1UURA 2DTSA 4L9LB 2R83A 5J3HC 1R24B 1COBA 1G4RA 2OL3H 3HG4A 5CD5C 2GFBB 4YFLF 1N64H 1ZJAA 3PJLA 3KPQA 1CF8L 1YNTB 2B77A 4PWHA 5DQJB 2ICWA 5E4EB 5I74B 5JA8B 2EDQA 1NUDA 3MLWL 4P2AA 1JF1B 3M6DA 2X88A 2N59A 3DUUA 5K1NA 3L16A 1DBBL 4UNUA 5ITBL 5F89B 4RAUA 1SJMA 1TETL 5D1QE 1I3GH 3FNKA 4GO6B 5EZOH 5C0IB 4U2YA 2J20A 4ZOAA 1MDTA 4HCRL 3JV4B 1Q90A 3QG7H 1KCKA 4XXCA 3C6SA 1YCSA 1S7SA 5AVVB 5DRWB 1F4XH 3PWVA 1HJCA 1IVTA 4K8RH 1RHHB 1VJSA 5E8NA 1XEDA 4E5XA 1ZSDA 1DVFD 3TFKD 1A6WH 5C0AE 1L5GA 2IPUG 5DZAA 1UD3A 5IUCA 3CVHL 1V8HA 3LIUA 4B60A 3T0EC 2ADJA 3G3LA 3IFNL 5KSBA 4IJ3C 2Z7YA 4MAYC 1RFDL 2V4LA 4UM8A 4BFNA 1KGXA 2QADC 4L3ED 5D6CA 1KBGH 4N90E 1MY5A 4YQXH 3O9WD 1KTJA 5ACMA 4PJ9B 3B56A 1GKOA 2HKHL 4KKBC 3MJ9A 4UM9B 1IGML 1LEGB 4QHMB 3VCLB 2R0WH 4DQAA 2NY6C 3QGVA 3FL7A 2BXZA 2SODB 5D7EA 5I1CL 1NCIA 4JL2A 5DHDA 3WS6C 3QO0B 3B9VA 2CK0H 3K4ZA 2OZ4L 3VFSB 1XBRA 1A1NA 4HJTA 5DVNA 3LKSA 3QR0A 1A14H 3EXJA 4I1PA 2O6CA 5IIEA 1VKXA 2D7TL 2OMZB 2V2TB 4PG9A 1N7ML 2CHWA 1E50A 2BWIA 3T0VA 4G9FA 1JRHL 1WISA 3V8OA 2RCSL 3B2DC 4V1DD 3IXAA 5EWIL 5KBDA 2BIQA 3MR9B 4L1DA 3REWB 3WLWD 5EUOA 2WLIB 3BP5A 4XR8C 3WY2A 5C1MB 1Z9SB 3P4NB 3BKCH 4EDWL 5IOPA 2HLAA 1FYTD 3MV9D 3KJ6L 3FT3A 4GI8A 4I9WE 4NSKB 3WFBL 4P4KC 3SE8L 5D7JC 5DJDB 4FG2A 3HAEG 4QKTA 2CM6A 4YLCA 4QTHB 3SCMD 2WHVA 3FF7A 4MAYA 1EHLH 3BAEL 2PKDA 4HUWB 1OGTB 2PP9A 3PUCA 1F1AA 4U1IA 2A4CA 3NTCL 1ZAGA 3VFGL 3U6RA 3CFDA 2X4PB 3CBJB 5GGTL 4OZGF 3SBWA 5C0BA 1U8NA 1FFNB 3PJNA 3IDYB 4OD3L 5GZOC 3ATEA 1SDDA 2Q2EB 3IVKA 5BPPA 1VB9A 1RZQA 2WKOF 1OEZW 1H3XA 3KLQA 3UAEA 2FK9A 1ETJA 2NY4D 3WENA 5JW4R 1EEUA 1FFQA 2C5DC 2Z35B 4AXWB 1V3LA 4HETA 3WN5A 4MQTB 4A7QA 1MCCA 3RTQB 1G1YA 1T7ZA 2VLKA 4ZOCA 4BINA 5ITFA 3LXAA 4NQTA 4RSYA 1VPOL 4CKQA 4DKDC 1D5BA 2X44D 4J3TA 5TFSH 2YIHA 3EO1B 3BWUC 4WCYL 3FFCA 5I8OH 5JXED 4KFZC 1S8DB 4FL4B 1YPZF 2BS8A 2R1WA 4H2CA 3DXAE 1IRAY 4P4KA 5HJBA 2AQRA 1ED3B 1S9XA 4NUPA 5D7JA 5FGBA 4J27A 4EDXB 4RA0C 1BZ9B 3MV8B 1RUML 2O6FA 1VERA 5IT2H 3WDJA 1Q9OA 3BVNA 3S3SA 1IAIH 1XGZA 2MQ0A 4HXAH 1G6RH 5B7FA 2WBKA 3WKMH 3IGFA 4BSJA 2QKSA 1F4AA 3ECUA 1I8KB 9CGTA 5I1KH 1EXGA 4ALAC 1IM9D 1TEYA 4FI7A 4X6FA 2QGCA 3DYMA 5I15H 1P7QB 3QI9D 5BO1H 1B4TA 4JZOB 4XVJL 1CFSB 1MCIA 1AE6L 1LQSR 3WUWG 3KLHC 5AD0B 3ESNA 3DKHA 4Y1SA 3UCRA 1U9KA 2ZJSL 4S1QL 3X12B 4GBXC 5JO5B 3P3RA 2XPZA 3UJIL 1DEEA 5FF6A 1RJYB 3NFNA 4R96B 2Q5BA 4IYKA 4MB4A 1E28B 1JPGA 2XRAL 3UZQB 2CH8A 3BD4A 1A6VL 3WFEH 3LN5B 2HMID 3PXHA 2OMYA 3EJQA 4QRFA 2LQRA 3MKKA 1X9LA 4DGVH 3ULVC 4WSKA 4OVVA 2GKIA 3CUPA 4APXB 4DVRH 1XR8B 1XZWA 5EF0A 1PQZA 1CZ8H 3O4LD 3T5WA 4EE2A 1S7VA 3QUYC 1AXIB 5I1GH 3UTOA 4HS3A 2EP6A 4FKKA 4C55A 1NGYB 4YR6A 3UMTA 5SWQB 2YUXA 3DX4A 4LSTH 4QWWC 4QLWA 3BGFC 4PJAA 3C5JA 1KN2H 3NQIA 3HB3C 1FRGL 4Y4HB 5EA0L 4OZIF 1GTFA 2DQEH 4OGYL 4K23H 5FWQA 5E6UB 1PEWA 4KJWD 4WEMB 1EUTA 2Y3NA 5DCCA 3LAFA 1AYOA 1L9OA 3CFKB 1GYUA 2DQUH 4YFLI 3ZZ1A 4BRVA 1KLFA 3SGDI 4A68A 1IFGA 5KSBE 4OFVA 4YVUA 1NAMA 3UZVA 3ECWA 3MODH 5ADOH 3BVDB 1GL4B 4GKSB 1AGEB 1RZKC 4ZUVA 3T1FB 1KCWA 1ZLDA 5CEZE 1FC1A 3AG3B 5I17A 5EC2B 1YNTF 3V0VB 3L3JB 1ZTXL 3VXRA 2JH2A 1F8TH 4BZYA 1V7NL 2WTRB 3O6FD 3OR7A 1OPGL 4AENB 2UZXA 3NVQA 3MQIA 4JO3H 4B9PA 1KPUB 4R4BB 4HQQH 3T6XA 3AS0A 3II2A 3Q8BA 3L45A 4XBMA 3HBPA 1OTTC 3RGBA 3FONB 4JKMA 4MA3A 2C7UA 4YBLC 4CJ0A 1R5WB 4WFGE 1JGDA 4WWKD 3WIHL 1IAMA 4G9FE 4F92B 1XF3A 1QVOA 3BH9B 2CK2A 1V3JA 1G9NH 4MA1C 2Y7LA 2X4RB 1FH5L 5EUOE 3T77B 2ZPKH 1JZ6A 4MB1A 2Y7QA 1T0PB 2A77H 1TTCA 1BSIA 3D2TA 2KH2B 2H45A 3SQOL 1R3JB 3GBLA 3ZDYB 5FDYA 1CXFA 3LKRA 4GQQA 3S35X 4XPTL 3LB6D 1G5GA 2YKKA 5EDXA 3RUGA 2EEXA 4HGMA 4YDIL 5GXBB 3FRPA 3V2AR 3C08H 4JFEA 4MQSB 3O3BA 2MTAA 3I3DA 5D8JL 1JTPA 2DBLL 2QPSA 4X8JA 1HSBB 3EOYG 4HJGA 5C8JB 1VADA 5C0BE 2E9JA 2PMZA 4LLVA 1KN4H 1JFHA 5ICXA 2YHGA 4ZOEA 3M17B 5F7DA 3TA4D 1LWRA 4GKNB 2JLLA 5I30L 1KDIA 3UZEC 2YXVA 3NK3A 2APVA 1FHNA 3APCA 2DRUA 3QUHA 4JG0H 4MQ7B 3Q8AA 2LTQB 3BKMH 4LPCA 5DZ9A 1FDLH 2VLKE 4YHPA 3MUUA 5I6PA 4M02A 4BFEA 4Y2OA 1JZ5A 5DVLA 3MRKB 3P54A 3S4SA 1AQKH 1UD2A 2VDKB 5T8IA 1OTUD 1AO7B 3PHQB 1ET5A 3FBQA 3QULB 3IRCA 4KZEL 3FFCE 1JPEA 4H0HB 2EUWA 5B8CC 3RNKB 3M46A 1BZ8A 3GS4A 5BO0D 4TVPH 2Q8BH 4J1UA 5SWSB 3LIZA 3QDGB 1M56B 4RZCB 2W94A 2FR4B 4FQ1H 3UP6A 5KJRL 1C7SA 5E2TH 3BX7C 4PU2A 1JZDC 5J1AB 1ETZA 3NSXA 4QRRB 1K5NA 3QFJB 3QUZC 1UA6L 3EH4B 3LZFL 2H6PB 3RWGA 1HYRC 2YRBA 3ZL4H 4O2CA 4ECNA 2BP0A 1A25A 2DKSA 3DOHA 4HV8A 5KVGE 3DO7B 1BOGA 2AXWA 4LP5A 3U0TA 1FP5A 3BAXA 3VD1A 2C4FT 1YN6B 5E6IA 3FAXA 4F9PA 1QG3A 3BQVA 1KELL 4TL5A 2HX7A 4WY7L 3ZKNC 3SZ6A 5AUMB 5ESVA 3VG0L 3WFDL 3ZE2F 2MCPL 4QF1B 3AREA 1NOLA 3VXQB 5CO1A 5C9JB 5B21A 1CLVA 2IDSA 1R3KB 5EZIH 1MXGA 3OAYH 1T1XB 1WFMA 5JDJA 2F74B 3SSGA 5GS1B 5E08H 1QAWA 3LH8A 3NJMA 2X9XA 3RL2A 3O6MH 1JHLL 1MCQA 1YC7A 2GK0A 5KOMC 2MCMA 2IANB 4BEIA 1X3DA 4JHZA 2VWEC 1U93A 1FFTB 2OZNA 5SWZB 2EVJA 4JHWL 4Z7VB 1AKJD 1KXVC 5IB3A 1GZHC 1WWBX 3H9YA 5D7SH 3T3MB 1RK1A 3KLDA 5JYLA 1GYVA 1TITA 3RVVD 3V5HA 3D39A 4GAJH 2PWDA 1ZVSA 2QTEA 2XXCB 4P23C 3VI3A 2KS0A 2MEJB 4Q89A 3RRQA 4DERA 5I76A 1EAQA 3GEFA 4PCTA 3AB0C 4LSPL 2EECA 2YAHA 5CLXA 5EZPA 2L7QA 4RFNB 1S3RA 1XT5A 1NPNA 4ZT1A 5KJ7E 4YNYB 4NQCD 3HN5A 3FQTB 3VH8G 5E2WL 3QCUH 1J5OL 1MH5A 3V0WL 4Z5RB 1FNHA 3VMNA 5TPWL 2WWKO 3VXRE 1LD9B 5A16A 1QEWA 3HE7C 1U2CA 2QLYA 4JDZB 4QGYA 2PR4H 4X9GA 2NZIA 1XF5B 2BY0A 3FTYA 4FQIL 4XH2A 3RDTD 2CLVB 5TE7H 3VWKA 5BOJA 1LLAA 1QPXA 3BP4A 3QS3A 4RMWA 2V7NA 4BRJA 4JUSA 4FG0A 3QDMA 3SDAC 3DURB 4XMZA 4XN8A 3T2NH 2GAZB 1X9UA 3EYVA 1U58B 4GQZA 5I26A 1EJOH 3AXIA 3FQ1A 3CN1A 3X13A 4OLVH 5T3ZE 3H2QA 2EDEA 4KO9A 3BAJA 3ZLQC 1IM3D 2IFFH 3CNKA 3V4PA 4H1LA 2P47B 2NR6D 3M88A 1MHPL 5D2NB 1S7WB 4X5XB 4IOFD 3PWJB 4YEEA 4HKZB 4MCZB 2YD6A 1F97A 3HUJB 2CJSA 4LT7A 2OTUA 2AQ1A 3UTTD 3RUGE 1JI2A 1ACZA 3L7FB 3RA7L 4BWUA 3RYMA 4JO4L 2OCCB 4JFEE 2IMMA 2JJSC 3QJRB 4IOSA 1YLBB 5D2LB 3TVMD 2ATPA 1B2WH 1QFWH 2A74A 1ES0A 1BQHA 3RWFA 3VFWA 3CDCA 5I1DB 3F7LA 2VAJA 5C7XL 5IW6B 4UOW1 4AH2B 3MGAA 3MRLB 2VUKA 4LSQH 3O0LA 2K0RA 5FYJE 2X89D 2EEDA 5BRZD 1IIKA 3EZ8A 1V7MH 3MFGB 3NABH 2GTWB 3SE4A 4B41A 5JOEA 1U92B 1FNSH 3TCTA 2IWEA 3K2UH 1TQWA 3O2DA 1WJ3A 2EXYC 2OP4H 2VDMB 1UWGL 3ZQXA 5CSZB 2WQAA 1WHOA 4A7GA 3DI2B 3ZDYF 5JHDA 1FZMA 1MCRA 4ANUA 1MCPH 2IH1A 3E6FB 5BJTB 5LAXB 4LHUG 3RFRA 4NCC1 2P45B 1QP1A 4WTQA 1HESA 4Q7DA 2Z6FA 4WFHE 4MASA 2LR4A 1W0YT 1QLRB 4J6RL 1N67A 1QHOA 4MDJA 3QORB 6TAAA 3D4YA 3L6FB 5FW6A 4CSTA 1P4IL 3UTSB 4KVCL 2G30A 4JY6A 1UGKA 3SE3C 2X3AA 4D2NA 3I6SA 3ET9F 5HHVH 3UADA 4N8VA 4TQEL 1NEZA 3LNGA 1IJ9A 2WWMC 2FH6A 3DTXB 1IJNA 2GW5A 2NY3D 2ZUVA 4J3OD 3NAAH 2E7LC 2H1LM 3V0IA 3IMBA 3MA7B 3K8LA 1J9SA 4LEXL 4FKEA 3TJHD 2JJSA 1PGRB 1FH2A 4LKXA 4M6ML 5D7KE 2B9AA 1G7PA 3DETD 4M6NL 3TO2B 4G8FB 7CGTA 3FU0A 3NGBC 4AEIH 2VJ0A 2XWEA 1GR7A 4EI5B 3JWNE 1E8WA 4ZOBA 5ESAA 3VJ6A 2J5LB 1B0GA 3KCWA 1F90L 4JO8A 5D9SA 1U8IA 3KNBB 4PJ7B 2YK1L 2VDPH 1FGVH 1DQML 2EIZB 2WXLA 5ANMA 2WBJC 3N1PC 5EF3A 2NY7H 3ETBF 2Z91A 3WTSA 4X42A 3U4BH 1BFOA 1P5UB 3COOA 5HYFA 3VSTA 3EW3B 3HS9A 3LQMA 2DB8A 3SGJC 1N5YH 4FQXC 1SEBB 3RFZC 3GC3A 2CIIA 4Q8BA 5DHVH 2EKSB 1DSWA 3KBHE 4GSUA 4HPHA 5I6LA 2VQ1B 4PR5B 4U7MA 4PWGA 2VN5A 2WO3B 3FOMA 3NPSB 4BA0A 4RSVA 3QHFH 2FX9H 2IVFC 2VLLB 5TF0A 1VCBC 3QIUB 1Q9WB 1UOKA 3L1GA 1QLEH 2M83A 2XXFA 1H6FA 4YS4A 1H15B 2ZWLT 2YGVA 3SE3A 3S35H 5KANI 2ZAIA 3SPIA 1A4JB 1QFPA 5F9JA 3HC0B 3L5IA 1B90A 4L1HA 6CGTA 2BOBA 2HT4D 3SE9H 5F7YC 3RB5A 2E7LA 2ZSVB 4HBCH 3C6LC </