3GZQA

Human sod1 a4v metal-free variant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
152
structure length
123
Chain Sequence
TKVVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural and biophysical properties of metal-free pathogenic SOD1 mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 123
sequence length 152
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gzqA00
1IBDA 1E9OB 2ZKXA 5KBKA 1XTLA 5KBMA 1KMGA 2R27A 1E9QA 3RE0A 3QQDA 1SOSA 2AQRA 4OJAA 2Z7UA 3GTTA 3QQDB 1Q0EA 1E9PB 3HOGA 3H2QA 3ECUA 2AEOA 1TO5A 4BD4A 2WKOF 1YAZA 1B4TA 1RK7A 1OZUA 3MNDA 3GZQA 2JCWA 4A7SA 2Z7YA 2ZOWA 2GBVA 2E46A 1OZTG 1N18A 1AZVA 2K4WA 4A7TA 2VR7A 3PU7A 1QUPA 2AQNA 2AQQA 1PZSA 2LU5A 4B3EA 3MKGA 2WZ0A 1SDAB 2AF2A 1B4LA 1JK9A 1YSOA 1YAIA 3KM2A 1DO5A 1OAJA 3KBFA 3LTVA 4BCZA 1SXBA 1E9QB 4FF9A 3S0PA 4L05A 3CQQA 4A7GF 2V0AA 3CQPA 3GZOA 1FUNA 2GBTA 3KH3A 2AQPA 2VR8A 1PTZA 4MCMA 3F7LA 1UXMA 2Q2LA 1JCVA 1SDYA 2XJLA 1S4IA 1OALA 3GTVA 2JLPA 4N3TA 2C9UA 1BZOA 2C9SA 4N3UA 1SXSA 1F1GA 1U3NA 2C9VA 3F7KA 1SPDA 1XTMA 2SODB 4BCYA 1XSOA 1IBHA 4U4IA 1SXAA 1JK9B 2Z7ZA 2ZKYA 1SXNA 1P1VA 1Z9PA 3SODB 3L9YA 1CBJA 1ESOA 1IBBA 2WZ5A 2WYTA 2APSA 2ZKWA 1N19A 1F1DA 1DSWA 4OH2A 1TO4A 3CE1A 1BA9A 3H2PA 1F18A 2Z7WA 3GQFA 2XJKA 5KBLA 1COBA 3KH4A 2E47A 3T5WA 3GZPA 3K91A 3KBEA 4A7UA 1EQWA 4A7VA 2NNXA 1EJ8A 4MCNA 1E9PA 1MFMA 3KM1A 1SXCA 3ECWA 2WZ6A 1CB4A 1IBFA 3L9EA 1L3NA 5CU9A 1PU0A 2AQSA 1HL5A 2AQTA 2GBUA 2WWOA 2VR6A 1SRDA 3HW7A 4A7GA 2WYZA 1OEZW 1Z9NA 4A7QA 1E9OA 1HL4A 1IB5A 3ECVA 2WKOA 3HFFA 1UXLA 1F1AA 2WWNA 1SXZA
chains in the Genus database with same CATH superfamily
4O4YH 4ENED 1KB9K 2IFGA 2X4PA 5HPMA 3CGTA 4FQ1H 2ED8A 3QK0A 4IRZA 3QQDA 1S6NA 4LCUB 4WU7B 4FC3E 4LLYB 4YHZH 5FIEA 5I1EL 4APQD 3BRFA 1BQ5A 2DQEH 2B20A 4BCXA 2PWFA 5TTRA 2WIMA 4ZW7A 2R1WB 1IX2A 4R5TA 3EYUL 2ZOLA 3CHXA 1AR1C 5ICZB 1AZRA 1BOYA 4PJXF 4BWTA 2EH7L 1OD7A 1R1CA 5I1JL 2P8MB 3FU9A 3DVIA 1S7VA 3FCTB 3O11A 1NCAH 2B1AH 3TBBA 3U1SH 4DEUA 1A02N 4EN3C 2ZYHA 2AQNA 4HCRH 1R33A 1JWUB 2FX8L 4ORGB 5FWRA 3RL2A 2DQFB 5IKCA 1JK9A 4QXGL 4WW2B 2EECA 4GBXC 3S3DB 1GOHA 1U0QA 5DJ6A 4RVBA 3QCTL 5GRXG 1PZ5A 4MRCA 3FO2B 1XCXA 1RP9A 3N85H 1JYWA 4PW9A 5IOPA 2EAEA 4R90H 4UQDA 3C8DA 3MRKA 1G1KA 2IFFH 4AZ8A 2B59A 5J11C 1I7UA 3L3DA 4UTBH 2W59A 3BWAA 2CQVA 4RMUA 2I9TA 1F45A 3FRPG 4F27A 1T2QH 3BKMH 4NZFA 1CCZA 1I1AD 3NBNA 1UEYA 5DLML 2YN5A 5A2JH 3ECBB 4KOBA 2FEDC 3TM6A 4AQAA 2M83A 3NK3A 4K7FB 4U1MA 3DXAD 3TFKD 2FB4H 1CG9A 3IF1A 3MJ7A 2HH0H 2R1XB 4JG9A 3MUY1 3N50A 4QEGA 1NLBH 1CBJA 2ZUVA 2GEEA 3R7QA 12E8H 1H8NA 4DGYH 2GK2A 6FABL 4MFHA 5DSCB 4P2RB 2SEBA 1MHCA 1W80A 4Y16A 3ULUL 2NXYC 3BQVA 5JQ6L 3D39E 1ZK9A 2XDHA 1JXGA 1YHPA 4FD0A 3SD2A 1JSYA 3ETTA 4PP1D 4AYSA 2BVEA 4JQVC 4J3WA 1BX2B 1Y18B 2VDNH 1KV3A 3S6CA 2J2ZB 4JM0A 4LE8A 4X4ZA 4Z3TA 4ZMVA 5E56A 4NC2B 5I73C 1MXGA 1QSED 3BCFA 1A64A 4CVUA 2NY6B 3AY4A 3N55A 4QHNA 1A5FH 3KPSE 5C0FB 5SX5K 1T04B 3EGDB 5IJDC 1J05B 1P2CB 1ZDQA 2W0PA 1EFXA 4BDVB 4CBPA 5KYUB 3B2UC 1YN6A 1KUMA 4NCDA 3RDTD 2PP8A 3WENA 2P28B 3BZEB 1L0PA 1OF2A 1VRSA 1DQLH 1GYVA 1TR7A 4HLJA 5GGUA 4GIAA 3MRBA 1DBJH 4IRSB 4K5OA 4U1HB 5K5YA 3VSQA 3IDNA 2F74B 4UQ2A 4XPBL 3D6GA 4HJ0D 4XNBA 5EPMA 3RTLA 1LO0H 2GIXA 2VDKH 1L5GB 1XDTT 2XZQH 2R0LL 1HQ4A 3BIKA 4JFHE 4OM0L 1HOEA 4LCIL 4UQBA 3WXWH 3C6EA 4M6OL 5EIIA 3FPXA 2VT0A 3EO1A 5IG7B 1NAMA 2K7QA 3MRJA 4G6JL 2CGZA 4MMXB 3PXLA 1UH4A 5I28A 4M5SA 2WZ0A 4OIBA 2XXCB 3VXPA 5KVEE 4NM4H 5HHOD 4XGZA 3LV3A 2DQGH 3VDAA 3EJZC 4OZHF 4OGZA 5HY9A 3AJ7A 3GMOB 2VXQH 3M88A 4B5EA 4MMYA 3SKNB 3M7OA 4UNVA 1SJHB 3FB7B 3HG0A 1A3QA 5H94B 15C8H 3B9KC 3K2UH 2AQPA 2J12B 4NO0D 1SVCP 5DTFB 5E8EB 5E6ZA 2JIXA 5KYNA 3NZHL 2R0ZL 4X6FA 4UAHA 5C0BA 3NESA 4JRWA 5D72L 1IGML 1WFNA 3FUKA 3VI4B 2EXSA 5L6YL 2F19L 3TNMB 2PUQT 3CJJA 5LKNA 1I9IH 1MI5E 2YAHA 4CMHC 1JHKL 5BJTB 1RAMA 5FB8A 2J8HA 1JPGB 1MJUL 4F7CA 1EBAA 2IOIA 4HWZB 3ZL4H 2R0WH 2VLJE 1JFQL 4HIPA 5AOJA 5BOJA 2VLRB 2BY0A 1E50A 2BSEA 2RBLA 1N19A 1JN6A 3L8QA 3PV7A 2IAMA 1AO7D 1ZJAA 1IKNC 1Q1JH 3QC6X 2D8KA 1OCWL 5LGHH 2YD1A 3FS9A 4ZMXA 3R18A 3QIWA 3I6KB 5EU7E 2D2CC 3E8UH 4YHMH 1MCHA 4PEEA 2RMNA 5E5UB 4E0RB 2XI9A 4MXWL 4YHNA 1IC0A 5GIRA 1ITBB 3VWJA 4NUGH 3LJ3A 3LRGA 4FTDA 5D1XD 4XC1L 5AW6B 5IB3B 3BZDA 2MEJB 2DQJL 1X9LA 3HI6H 1ETZB 1JK8B 1OQXA 5I17B 2NX5A 2WB7A 2WWMD 1NCDH 4QYOA 5E23A 1Q9KB 3H9ZA 3EH4B 4QTIL 1L9RA 3CHPA 1AQ8A 1B9ZA 5JDSA 4U1LA 1CD9B 1HIML 1JGLL 1E8ZA 2Z3FA 4UQ3B 2X5PA 3ASNB 1CGWA 3W39A 1QNIA 1KCRH 2Y72A 3CHSA 3VI3B 2Q3AA 2BIQA 1J5CA 1IQDA 3ALXA 4U6VH 5D7LB 3DHPA 3CSGA 3GBNH 4ZX5A 4CADB 4RGOH 3KLHC 1G7JA 1H8LA 3KLQA 4H8VA 3AG4B 1MREL 4G9FA 4WV1B 3G5VA 5E00B 2ZUSA 5D7IE 2Z7YA 4DVBA 4UOZA 3PCYA 1YEEL 1HL8A 2XTJE 1FG2B 5DA4A 2VO8A 2EC8A 1XGUA 1T3FA 1RD6A 4FFYL 4PB0L 4MJ6B 4UB0L 4M4RA 4N2NA 4WZ9A 1AHKA 5FO2A 4Q58C 5E8OB 1OWWA 4KWUA 2WUBL 4LAQL 4NAJA 4HHGA 5T33H 4WUUB 4XO3A 4LPWA 4WW1A 5I6OA 1H15A 1UJ3A 5D2LB 2I07B 1QSFB 2EO1A 2IDUA 43CAB 1GCYA 3MX0B 4Y4KA 5ILTH 2BIHA 1HNGA 3NIDE 2D7OA 4XH2A 5A2AA 2GCYB 1CJYA 1GRWA 2WXFA 1JCVA 4N8VB 1FL5A 4P2QA 3S97C 4D0CA 2PYEA 3ORJA 4OZFB 2NW2A 4LBEA 5BO0D 1WE5A 1UCBH 3QWNA 4Z7WE 4FHKA 1YRKA 3QH3A 1BIIB 2JLLA 5EO0B 4N2LA 5AL8A 4MJJA 1W0VB 2JTDA 4IGBC 5EULV 2Y3NA 3HCVB 5DZPA 2MOVA 1UA3A 5J5EA 3GLAA 4H25B 4AEEA 4BUHA 4G5ZH 1MCFA 4OGAD 1QYGL 1J9RA 1KDIA 3NPZB 3NIGE 3HNSL 1FVDB 1QEWA 1SUJA 2IPUG 3BZFA 3CCHA 5CZVH 3BCDA 2YQ2A 3LH2L 3OLGA 2F5AL 2X3BA 3AAZB 5BMFH 1UUNA 1COBA 2K0RA 4UDTB 3NSXA 4OT1H 4D9RD 1JDDA 3KPRE 3DVNB 3TV8A 1W72A 3U6RB 4PRHD 1AGEB 4KDTC 5I6KA 3H9YA 1JNLL 3MRRB 4HSAC 1KCSL 2Z1PA 1SXCA 5JUEL 3DMMD 3OKEA 4LLDA 1INDH 1PY0A 1FFOB 2Z8SA 3CH1A 2Y5QA 3JT0A 5KSUA 4KXAA 2Z4TA 5AFAA 2DQUH 5F3FA 2NY2D 3HI5H 3IFLL 2DYPA 1QNZH 3ARTA 3LNDA 3UTPE 1J1PH 2OKMA 3O2DA 3TYFB 1RHFA 2CU9A 4FQXA 4XO8A 4X9YA 3GHBH 1WP6A 1RERA 1RLWA 4DGIH 4DKFL 3WTTA 4MXQC 3H3PH 2HFGH 1CU4L 1XR9A 3EJSA 1TO5A 4F33A 5F93C 3GO1H 4NQUA 1J11A 3E6HB 2BFVH 1JMZA 1NCGA 2LHAA 3JWOC 5EA0L 3DHJA 4QHPA 4F8LA 4Y8AA 4XNMA 1V7ML 3H0TB 2X44D 2Z91B 4EUPH 4WIQA 4JNXA 3V0HA 3D69B 3VYNA 3G5ZA 3T1FA 2LT9A 3DJ9A 3OSKA 4OLYH 2X1OA 1O7DE 5LAPA 5B1BB 3ARRA 1O6SB 3LPFA 2XX1A 1KWKA 4I1RA 4OLWL 1I8MB 4OCRH 1VFAA 2EEAA 4YBLB 3CQQA 3ME0B 1YNKH 3NRQA 3UYOD 1CFSA 4J3TA 5ID0A 5BZWA 1U2CA 3O4LB 2EUZA 1CE6B 2GHWB 1Y6MR 1ETB1 1E8XA 3CG8A 3IN2A 1C16B 4L1BA 3INUL 3BGMB 1N9PA 2BHFA 5TF1L 2MNUA 4IU3B 4L8DB 2NYZA 2WIIB 2V2TB 3RA7H 2IH9A 1UXSA 2Z31A 4MAYC 3MNWA 1GPOH 1U8LA 3CQFA 3ES6B 2NLJB 3L5XH 5I8EB 4B60A 4L5FE 1R3JB 3QDME 1N8OE 5I6XB 2BZCA 1SPDA 3GRWA 3HPLB 3IMSA 3OXSA 4HK0A 4P5SA 5DQDL 4GUOA 4M61A 3TO4B 5EF0A 4DW2H 2O5YH 2WNXA 2NYYC 2CRMA 4HK3J 2XPGA 2HLAA 1UEMA 2FHCA 3QJQB 4QAWA 2IADB 1A1MA 5K9JL 2CWRA 4ZAKB 4KQ4H 2YSSA 3FT2B 1J8HB 3DV4A 3RX8A 4LMQE 4OCWH 3WNLA 3CFUA 3SGKA 1T20A 5EH1A 1MRDL 4YQXL 3H9SD 2AGJL 4KK6D 3WS6A 2AXHA 4H1LH 3WIHH 3B8SA 3KJ4C 9PCYA 3CLEL 5C0EB 1P7KA 2LU4A 4OIIL 4MQ7A 3TN0C 3HB3D 4I9XA 4AH2A 3LNFA 1YMMD 2W0LA 2ZOOA 4ZD3L 3T1WA 1YZZA 5SX4I 6CGTA 4I0KA 2R83A 1S7SA 4GMSL 2KI6A 5I30H 1A6ZA 3BLBA 3IKCA 2ADFH 4L0PB 3UBGA 2H4EA 5KN5B 1HH6B 1IAIH 2F8XC 5AYTA 4OCMC 3GD1C 4JFFB 2O4EA 2NY7H 3QPXL 3DX9B 2E9IA 4IJTA 4G11A 4JFED 3V6FB 3OHXB 3A6CH 2PW1B 3F7VB 2OTUB 5EZIH 1AD0B 2O61B 2V8LA 5BQ7B 5BS0B 1W0YT 3WKNA 1SHSA 4ZUTB 2CG9X 3CPLB 3VU2A 1P4BH 1X44A 2VDLH 1QBLL 1LEIA 1E7UA 3W0WB 4DAGH 1BOGB 3C09B 3QG7L 4GOSA 3IB4A 3QFJA 1TU2A 1UA6H 5CN1A 2WINA 3QQ3B 3QJFB 3VQ1C 4G1EB 2VZ3A 3UAJA 1T22A 5SWSA 2XWBA 4TL4A 3D2UD 4PV1C 1TETL 2ZYSA 3N5AA 1PLGH 5HI4C 4KBPA 2WANA 4PJ9C 4X0NA 3BAJA 1RIUL 1SHMA 5B3JF 1NCIA 3L3GB 3HZMA 4QF1A 4YHOH 3IDYC 4AM0A 4QUOA 4L3AA 3F12B 5L2JA 3OKDB 2VMCA 3D85B 2MH4A 3QUZB 5BRZA 2PPEA 1A3RH 1VCBC 1HT6A 2IANA 3OJMB 4ZMOA 5C0NC 2AQ3A 4FKHA 1G7MB 5CR1A 2UX7A 4ZMTA 4UV7L 4BZ2L 4P3DB 1ZEAH 2BNUA 4XMVA 1M7UA 1MIML 2EVJA 1WZ1L 3NYKA 3QFDB 3EHBC 5F9DC 3W11D 1U8MB 2QSTA 5IHBA 1LO2H 4PGCB 5D9SA 4JAMB 2FYYB 4AIOA 5IF0B 2KPWA 3WAKA 3FF7A 1U3YA 3T3PF 2OMBA 3RKDC 1UZ8B 1F1DA 5JW4M 2HVJB 2X1PA 3BUTA 4O51B 2VM4A 2J8UA 4P05A 3RUGA 5JNYA 3T3MB 3SY0B 4ZODA 4NRXB 3UC2A 3QB7C 3NACL 3APCA 3MZTA 2DWYA 2PO6B 3FFDB 4NHCL 3G7TA 3KYMA 1KJ2A 3OGOE 4KHXL 5HGBB 3TJEL 1GXEA 1JHLL 4NHUB 2DQCH 3U7YH 3GUTA 5A16A 1XX9C 3SCMD 4KGJA 1A9EB 4Y2OB 5I1KH 2CUAA 4M5YH 2J6EA 3T0EB 3FFCD 4QJ4B 1DJGA 2FIRT 4HG4J 2YGNA 3G6AB 1DUZB 4TQPA 2A73A 2B7DT 4M1DL 5DJAA 3HE7C 1MFDL 2WQUA 3G04B 5CGTA 2WQAA 4LQFL 4JZJB 3P11H 5I76B 5FA4B 4IU2A 5E99L 4U3XA 4PSRA 4NBZB 3O6LL 4X5PA 5EO1A 5CGYC 4K7PH 3GSVA 4Y5YB 1JIBA 5HHVL 3DSFL 2JJSA 5GRZA 1BHGA 2ADIB 3EFDL 2VXUL 1T2JA 2Y6SD 4HGMA 3JXAA 1JD9A 1QW9A 3FTGB 3MLWL 2QGEA 5CZXD 1W6LA 3ZO9A 4C55A 3DTDA 1CD1A 4JX0A 1Q94A 1XH2A 3B9AA 3HC4H 3BP4B 2QPFA 4YXLH 2QR0B 2VISA 3HLAA 1AS7A 4IJ3B 4TVPD 3SDCD 3QW9A 4NWUH 5E0QA 1X5AA 4EPSA 2VIRB 2O93L 4NN5C 5E2JA 2BY3A 4OFVA 4TQ8A 4WSKA 2EVGA 3WY3A 3UTTB 1TJGL 3FMGH 3L3HB 3X12A 4HC1L 4AIEA 1UD2A 1AFVH 3V0AC 5FYLH 4ZFOB 1TNNA 3IJSB 3L4WA 3P3RA 3RQ3A 4L0ZA 4WWID 3HS9A 4OR1A 4E9VA 4OIAA 3U2IA 4HS6B 1ECZA 1JRHL 3IJ7A 3QZWB 5FDYA 4YXHL 4F7TB 2G2NA 3IDMA 3QBTB 4ZXBC 5HYQA 3QHTC 3JWOH 5I74B 5CCKH 3D08A 1QFWH 1ODUA 4D0DA 1JZ6A 1G7QB 4YEEA 1R5IA 3BGFC 4L8CB 2IG2L 4L9LA 5J12B 5CEXB 4G8FB 2GI0A 3O6KH 4JDEA 4ZZFA 2K4AA 4DO4A 4DWHA 4W6XB 3QDJE 3KGUA 4KY1H 3LD8C 2A74A 2YKLL 5JW3H 2HKFH 2ICWA 1H19A 2CXKA 3L2NA 4E42B 2BNRE 3RZCC 3S98A 2Y7QB 2XZCH 4YS4A 2P46B 5FGCB 4CA4A 1MCWW 2X4UB 3FXIC 1KXHA 2Z92A 4AMXA 5KUKA 2YARA 1BREA 3LXBA 3GSUB 2EE9A 1FIEA 1S3RA 1YJDL 3UACA 3UEQA 3MRPB 3NIFE 3RNKA 4MMZB 2FK9A 1OP5K 2GUOA 4BKLB 3KBEA 1EQWA 1IGFH 1SNRA 1L9SA 2DQDH 4OD2A 1E9PA 3L3IB 4FI8A 5J6HB 1MCOH 2EXYD 5A3ID 4LL9A 4Y9CA 1UT2A 2F15A 3ZYZA 2AANA 2P5EB 1CFBA 1QLEL 5CD5D 5JO5A 2QSVA 4DQOH 1BFTA 3PWVB 1KCBA 1DHKA 1FLTX 5DRXA 4Q7DA 4U0QB 2JCCA 5AVWB 5INDB 5BNXD 5DFTA 1SN2A 1IGJA 3O9WC 5HHPB 2CGYA 3V95A 4M48H 1A7PH 3RVXD 4YSCA 5B8CB 2XG4B 2ZCLH 4ODXA 4HIHA 1ZHLA 4L0YA 2QV4A 4QKXB 2P5WB 4N8CH 3EAKA 2XETA 4KRPD 1T1YA 4FYTA 3MNVB 2DQHH 5GZNA 1C8QA 4YZFF 5MEQB 2G2RB 5GGVL 4PLKD 4KOCA 1Z9SA 3EF4A 3JVFC 1H0DA 1B4TA 1V8HA 2OP4H 2F53B 1WD8A 3LN4A 4N5ED 2Y07L 5SWZA 4JPWH 3N43B 1JOIA 3S36X 3D25B 3FSAA 3SJVD 4FZEH 2PPAA 3GJFB 2W9EL 3MR9B 2H0PA 1HDMA 4CC4A 4TNFA 1JVOA 3ULVE 3HG1A 4B9YA 4P5TA 1MRFH 2EE0A 2OTWA 3HBZA 4FNLH 4M1GH 1CZ8H 4XBGB 2HP4A 4N85A 5EHFA 5H8DA 3BN3B 5HD8D 4AGQA 1ZANH 3P9LA 4HZAA 5JHMA 4NSKB 4IOIB 3L95A 4LVHC 3O2VL 4ES9A 3CK0H 4N2OA 5I2IA 1BF8A 2X6CA 4IIQA 3L6FA 3U7AA 1I8UA 3V7AE 2YPVH 1ONQA 4ZRGA 4GKZB 1NGXA 1U3HC 3H2WA 4TLUA 1S5IL 3CZFA 3ZT7A 1LE5A 4LIQL 2RFXA 4YDVA 5F70A 5TQ0L 1EEYA 4P4KB 5I26A 2BNQE 2DJSA 3FOLA 2EDMA 1DSFH 4IRJA 3NDYE 3NCJL 4XP5L 1DQIA 4WI0B 2VN3A 4KVNH 4Z7UF 4ZFQA 1NEZB 2FZ3B 4MXVE 1CQKA 1AIFA 5HDLA 2B39A 4JDTH 4MZRA 1M6OB 2BWDA 1A6VL 1U8JA 4W9IC 2ROXA 4RX4A 1GZHC 3VXNA 1TZ8A 2ZOTA 4P5MA 1FC2D 1KLFB 2NY0D 1FNSL 1ACYL 5HVFB 3BKCH 3U0WL 4HIXL 1MN4A 3IGAA 5L0QB 1AXSA 3ZKMC 1KBWA 3D87B 1RIHL 4X6DA 1X5JA 1ZT1B 5IHLB 3QUXC 2F58H 1ICTA 4FQLL 2F1BA 4NKMA 1MUJA 4PJHF 4Z18A 4DP1X 1MH5A 1BW8A 1KYFA 2KBGA 2VQ4A 3N1FC 3TBTA 4AE0A 2AERT 4YL4A 4EXKA 4NM8L 4HWUA 4J5VA 1KTDA 2D7TH 3QXTA 4UBDC 1KB5H 2IBZX 5D7SH 4F57L 1GOFA 1G6RB 4WY7H 4KRPC 4UT6L 5I8CB 1MCKA 3DXAE 1WA0X 1HZHL 5F7DB 4TOYH 3JV4B 4LCUA 4NLHA 5BZDA 4PLKC 1HK6A 3A47A 3WNJA 1T7XA 2MPAL 4JHWL 5TDOA 3BLKA 4QRAA 5DFVD 3F00A 2F5BH 5AYUH 1K6QH 3JZ7A 4WI8A 5D70L 1QA9A 1AP2A 3JSSA 4UYQA 1K85A 4R84A 2AJZA 4MYPA 1EV2E 4RAVB 4MQTB 5FFGA 2DQFA 2IJ0C 3PLYA 1OSPH 4YSPA 5ENWB 1QSEE 3GMMB 4PWFA 5K33A 3VJ6A 2GQHA 5DQJB 2WBWB 1FNLA 4EVNB 3IWVA 4YC2B 2CGRL 3KXFA 1S7WB 3Q6FA 5I1AB 3FO2A 5TD4A 3BJ91 3I6GA 5CFAA 1KTLA 1LDPH 4QHLB 4EQ3A 2R23A 3UOAB 2ZG3A 1X3DA 4BQ8A 3KMDA 4OZIB 3AC0A 5F96L 2RACA 3KLAB 4ELMF 4KUCD 1E27A 1KENH 3KHQA 2ZP9A 4GRWH 3X1BA 3QISA 1WLHA 1NSNL 1B9KA 3CFQA 5AL0A 2Z93A 1NCWL 2YJLA 4AYFA 3DJSA 3D30A 2BCKA 5LGJA 2BO0A 4K7FA 5ECJE 2JKWA 1AKJD 2R1XA 1OPOA 4JQIH 4XXCA 2MNWA 5KYYB 4ZBJA 4HKXB 2B16A 5E8NB 1EJFA 4G7SB 5HYSB 3K71B 1RURL 3GJEB 5LCVA 1P4IL 4QXWA 5C0AD 4EKJA 3NCBB 5KVGH 5DSCA 4ZUWB 1M71B 2OXHB 2OK0L 1EIBA 4G8GA 5HHOE 1D5IL 4PH8A 3BSZL 3MUGB 5AWNH 2JIXD 1AACA 2CKBB 4W9FC 4YR6B 2AVGA 1ILUA 1XGRB 3HC3L 1A1OB 5C0BD 4K5LA 1Y18A 1MCQA 4K94C 1G7LB 1E0OB 4AEIH 2WCSA 5E6IB 4HVBA 2X89A 3NA9L 4ZW5A 4CW1B 3KLKA 4Q9CA 2EC9T 2WO4A 3E7JA 4N26A 1SYSB 1QI5A 1IAIM 3NZ8B 4CSTA 1E4WH 2EDQA 4EBQL 5C0FA 4PVBA 5LDSA 4NUMA 4MCZB 1VA9A 1LO3H 3PHOB 1ZXQA 4WLCA 1YPZE 4BDVA 5AB2A 1DQMH 1IVLA 4XOEA 3X3FL 3BH8B 3A0OA 2A4EA 3AXHA 2PNDA 4Y16C 5HI3C 1CGUA 2AZUA 1FLRL 4JKWA 3BZEA 2GJZB 4UT7H 3DO3A 3UTQB 4JN1L 3F85A 1HHIA 3CAFA 9CGTA 1GGUA 4U1HA 2F1AA 3WE6B 2OV0A 1A6UH 2F74A 1RJLB 4Y5VA 5F2FA 3M45A 2XPYA 1WBZA 3S35H 2WQVA 4WWKD 2RCSL 1AO7E 2DTMH 3ECUA 5LG1A 1E5UI 2VLMD 2BIMA 3AY4C 3TBWA 1VGKB 4ZTPH 3S5YA 5DFWH 4KXDA 4A1RA 1PLBA 3OVUB 5I18H 2VKWA 4GG8A 5E2VL 1E6OH 1F8TH 2GEQA 2DIEA 3LPWA 4ODVH 1J0HA 4JO3L 5A2FA 1F4WL 3HBPA 2ZJSL 1BP3B 2L8AA 5D1XE 2YIHA 1XF4A 2VO5A 2VLKD 2AF2A 5CHNA 3DO7B 3LTVA 3SKNA 1CN4A 2R1YB 1SJHA 3FB7A 1R3LA 1XGPA 1SBSH 4JFXA 3B8YA 4A6YH 4KMLB 5JIQA 1UCTA 4X4XB 1FO0L 2R29A 3MMEA 4J3SA 2WLHA 1DBML 2ETWA 4LKXA 1W0WB 1E3FA 1Q9WB 2EEDA 2DEYX 1C12B 1OALA 1RL1A 3HE6B 5FCUL 3TNMA 1M9WA 2D0FA 4OZGB 1FA4A 4TLSA 5T1DL 4R3SA 3V4PB 1IIKA 3LXUX 4DGVL 5BJTA 4V33A 1JPGA 3JWNE 3S5LG 4HG4K 3G6JE 2Y0SA 2XT1B 4JANB 1ND0B 5FA3A 2H9GB 4TSCH 3H55A 3WFDH 4K23L 2VLRA 3MRDB 1PLAA 3ZPDA 5KVFL 2CLVB 4IS6B 4G7QB 2MWCA 1IBBA 2Q8AH 2PLTA 5J3HD 2VLJB 1RLBA 3V8CA 2C3XA 1JE6A 2D3VA 5JIPA 4LVNC 5K39B 2V9QA 1EAPA 3SDDD 3CE1A 5LBSA 1QBAA 4NXSA 5DURD 5E70A 2ISDA 1LP9A 2HN7A 1P6FA 4Y4KD 3H7BB 3JWDL 2CJTA 1ROCA 5GISL 3C75A 3W9DB 4P2QD 4E0RA 2D2OA 2VH5H 3CFJB 2KS0A 3K4ZA 3OLDA 5D71H 3ZDZF 2LGNA 4P59L 1EHLH 3DNKA 1L6PA 3WUWB 1BZ8A 1LGVA 1IGTA 3WL9A 1Q9KA 3II3A 1YG9A 2IAMC 4PS3A 5K93A 4Y1AE 4PJIF 3C60D 2PR9A 1ADQA 3WJLA 3PGFH 4K4KA 1G9NL 1A47A 3QIWC 3G5XB 4B9GA 1I3GL 4XNYH 3VNYA 3VI3A 2YPLA 1U8QB 3QO0A 5IMMB 3DUSA 1AZUA 4O00A 4BGLA 1EO7A 3BAEH 3FUMA 3OBAA 4L1SA 3VWJC 4L18A 1AOZA 2NUTA 5BVJB 1CR9L 3NJFA 1A9VA 2WZPA 3QC5X 1DVQA 3HUJB 1NBZB 4D9RE 1NGWA 4PRHE 5T5FH 2XN0A 4XMPL 2R69L 2W0KA 2IOMA 2X1WL 4MJ6A 3V4UH 5D7IB 4NCC1 3IDIB 1N0LB 5E8OA 1F4YL 3BZ5A 2VN6A 4ONGL 4PJ7E 5GJTL 1F6AA 2AEWA 1QFWM 1BG1A 2TAAA 4WUUA 3SDXB 2AXFA 4DEWA 3L3JB 4DO5A 3KBFA 4O9HL 5CJOL 4BFEA 1NC2B 1LEKA 3S0PA 1IQWL 5ABAA 2I07A 1IAMA 1A7QH 2Z9TA 3P4NB 43CAA 2XHNA 4FG6D 4H0LC 4TKWA 4Y2NA 2DMCA 2IQ9H 3MX0A 4MA3B 5E94B 3DETD 3VE0B 1A14H 2AVFA 2IH3B 4ODSH 4HA1A 1Q4NX 1IKFH 5EUOF 1X5YA 4GKLA 4OZFA 3DVFA 2FQDA 4NZRH 2Q5BA 3MV8D 5FGSA 4ZPVA 3VVVA 2HT4D 4PJAF 2AK1H 3MTRA 3AS0A 4IRZH 4YVUA 1NMBL 1SOKA 2JKTM 5TE6L 4HWBL 5C0RH 1BZOA 2M2DA 3HCVA 1FH2A 5JPNA 1KXQA 1JZ2A 4LCWB 1BAWA 1IC7H 4L37B 4GSRA 4DZ8B 5DFAA 1YEJH 5CEZH 1UJ3C 3QWRA 2KL6A 2J21A 5ADPH 2RA1A 2B0SH 4PJ5B 2WYTA 2XWJB 3OJDA 3GSWB 2HTKD 3E38A 2Y24A 3AAZA 1AY1L 4J4PD 4RFNC 4XP4H 3FQRA 4QRTB 1C5BL 3ETBF 1FRGL 1S9WB 4PUBL 4IK6A 3WFHA 3VB8A 1BA9A 2EDOA 1BYNA 3L4UA 2E47A 1FH5L 1AGEA 2WXQA 3QQ9D 4N90D 4XPAL 4BSWA 3PL6B 3MBED 2EH8H 2HLEB 4PRPB 4F8PA 4LEBA 3VRIB 3U7WH 1OLLA 1FCGA 1WO2A 2L0DA 1FFOA 1BQSA 1C5CH 2EIBA 3FO1B 1T6VN 3K1DA 5JHBA 3QA3A 4XP9L 5DVKA 4K2UL 43C9B 4LEOB 5A40E 5KSAA 2K9UA 3LB6D 4BINA 3QHFL 2JWYA 1HL4A 3T0XA 4FA7B 2NDFA 3U6XS 1GSMA 1CICB 3TT1H 2NY5C 1A0QH 3Q0HA 1TZOA 1NICA 3L2MA 4HDIB 2HJFB 5I15H 3OR6A 1SDDB 2GB2A 4AMKL 4J6RH 1FBIH 5AZ2H 5TQ2H 1HAUA 4PRDB 2YXWA 3FO0L 3D9AL 5D4QA 3TCTA 4EKXA 5I0YA 3GSNL 2ZUTA 4NQQA 3BRGC 1FN4B 1T7WA 2Z91A 3TNNA 3VDCA 1YY8B 4HIIA 3H9SE 4V2BA 4XPGL 4XMLH 1NCCL 2EINB 4FQXC 3AXIA 4F7MB 1DDTA 1MCLA 1P4LB 1Q90A 4U6XB 5LBVA 4F8NA 1BPVA 3PU7A 1F3DH 4TUKL 2Q8BL 4C56A 1C08B 1L7TL 2YK1L 3MA9H 4FJYA 5D4HA 5MEPB 5DYFA 1FF5A 1J0KA 1D5MA 1NL0L 4O02L 3SQOL 2CD0A 4MNQB 4UF7C 4AXWA 1Z5LA 2PCXA 5B1CA 3MPCA 1N70A 3O0RL 3O4LA 1CE6A 4WDIB 1J0JA 3H3KA 4P99A 2WN2A 4LESA 1T6WA 5IM7A 2UWEA 4PFEA 2XWXA 1NWPA 2Q86A 3A21A 4UU9B 3VNZA 4JFEE 3IAPA 4QRRA 4YLQT 2NLJA 2OL3A 5AZEH 3ZTNL 3F5WB 3NCYS 1B0WA 4HEME 5J1AB 3KWUA 5BV7B 3L3KA 3U79A 2MCPH 3HPLA 4OCSL 3I3DA 5DZAA 1YC7A 5EZOL 5FKPB 2QFRA 4KMTL 1LTXA 5EIVA 3UAJD 1E2WA 3PWPE 2APBA 4ONOA 2PTVA 4ZX3A 2I7OA 3ZYJA 1AXTH 3HNTL 3C6LD 4CBZA 5FM5M 3O8XD 4Y4HB 4PCYA 3OPZL 4QRPB 3IBEA 5IHUL 2DF3A 4IDJH 1NAMH 3PJSA 1MHEA 5DO2D 1FAIH 3TJPA 4H8WL 5CBEA 2BHZA 3SO3C 5ANMA 3O3AB 5KS9F 2Z31C 4UV4L 2OYMA 4PS7A 3WFCH 1JHTA 3OWEA 3I2CH 2DQIL 2IAND 1A8ZA 5C0EA 3UBFA 3MNMA 3CN4A 3BUDA 1CDGA 4H8QA 1FZOA 1KIUB 2ZG1A 4NAMA 2BHYA 4FTVE 1TIUA 3WKMH 1RVFL 5IEKB 4ADJA 5IB2B 3GXPA 4NC1C 3AMLA 4F93B 1W16A 3VXRA 3PUCA 5KN5A 1WPCA 1L3WA 2UX6A 2YHGA 2K6WA 4JFFA 4YVNA 1JGDB 3IJYB 3IU3A 4YSSA 5IR1B 1BMGA 4RISL 3QORB 5F0LB 2I5YL 2Z1KA 1U8PB 2PF6A 4OCLC 1OGAB 4J2XA 1BYPA 2X2IA 3FT0A 3HNVH 2BXYA 3LKPB 4MWFA 2O61A 4JFDB 1ZS8B 2PKDA 2X1QA 2VJXA 3CPLA 1JI1A 2X53A 3VGHA 3W0WA 1QBML 4HHAB 5IVXA 1N4XL 2QSCL 3O3UN 4AM0Q 3CFCL 4NZUL 4WW2F 3BHBB 1XSKA 3P4OA 5I71C 4X0KB 1ML0A 4Z8FL 2FH8A 4PMEA 1LMKA 3B5GA 5KYWB 4AYBA 1QLFB 3NJMA 2BSSA 3LIZL 2CRZA 1QUPA 3DPDA 5F9JB 3FFCE 1IAKB 1OCZB 1YEDA 4NOFA 2CRIA 5DJCA 1DBKL 4FFWC 5DUMH 3AREB 3FQ1A 1CTNA 2W94A 5KBNC 4L3EA 2IDSA 2PXYD 4JRXB 1KDJA 4O4YL 3QEHA 3UO1H 4WTZA 2EIKB 3AWGA 3C5SA 5D7JC 4FNQA 3WEBA 2KZ1B 4FQ1L 4JM2B 3VGFA 5DJ8B 1PG7H 4LLWB 4YHZL 5FECB 4N24A 4HF5H 3VW3H 1G7MA 2E9GA 5GGSB 3TZVB 2E7HA 4A2EA 1HOCA 3GLZA 3VCLA 3GIVA 2F6AA 3KDPB 1DSYA 2D3JA 3QFDA 2OCFD 2YUZA 4LSVL 1YNTB 3V6OA 4TVPE 1K72A 4JAMA 2FYYA 3PXHA 3TBCA 2QGBA 4MVBC 1KACB 1S2EA 4Z3GA 1UUSA 3W57A 2B1AL 3U1SL 2IIJA 3BUPA 4CVXA 3CWGA 4HCRL 1IFGA 4H26A 3OX8B 1DBAH 1SVZA 1AD9B 4POZC 1T0NB 2WWKT 3SY0A 2YKKA 4NRXA 2YR3A 2QJDA 1DQKA 2QTVA 3U82B 3O0LA 1E4KC 1FWXA 1KBVA 5C07D 5F6HJ 1CVRA 3D5OF 2OMVB 4EI5D 4BA8A 5MEOB 5EV7A 4MA1B 2KZWA 2XN9D 1W91A 3V0IA 2EDKA 3N85L 4AL8H 1A9EA 4Y2OA 5GRVL 2V8MA 3T0EA 2HJLA 4OJEH 2H2PC 3FAXA 2IFFL 1DUZA 4UTBL 1KZYA 3FULA 5I75B 4WI4A 2W60B 3BKML 3EYSH 4BWWA 1JGIA 3TIDB 4BZYA 1SRDA 5CN3A 1XVSA 2YN3A 4ZDHA 5AVUB 1I3RA 4LOEA 3KAAA 4X9BA 4Y5YA 5FO8B 1AGDB 3IFPA 2OMYB 2HH0L 1ZD6A 5CXPA 2ADIA 1WEJH 3FQNB 4P46A 4DP8X 4H13C 5F7NC 3MFFA 4Q14A 1DTUA 5FYJD 5JHAA 3B6SA 1MRCH 2W65B 1NH6A 12E8L 4FOMA 1OVZA 1PZ3A 2AQRA 5J13B 2ATKA 3UYPA 4KKAC 4DGYL 4HUMB 1HVXA 1VDGA 1EHNA 4CVZA 1E8YA 4RLDA 1KEMH 1ZVNA 2CLRA 4JPIB 3CDCA 3FU3A 4GNKB 4MD4B 1MCSA 3IJ9A 4U3SB 3QWOB 4GXUN 2YC1B 1VADA 5MHSD 4QGYA 3ULSB 2YO3A 2VDNL 2NY5H 3ARBD 1W72H 2JJSC 2B8OT 4WHYG 4X7EC 3KPQA 4HOZA 4XVUD 1A5FL 5E4IA 3VFSA 2GK0A 3FT4B 4F7TA 1XBRA 3S34H 4LEXH 5F7EH 3PHQB 1X7QB 3NSCA 5DD6B 5JIMA 5L8KB 3GYRA 5HHNB 3UTSA 2APVA 1FL6B 4IOFC 3VI4F 4L8CA 3KE0A 2A6KB 3BKJH 5GZND 3MV7D 3O2DH 1Z2KA 5IBLC 1DQLL 3DX3A 1DBJL 5I23A 1KFGA 2N01B 4KO6A 2DYSB 2XFGB 4FI6A 3MGOA 2X6AA 3SDAD 1LO0L 2EE3A 4G6MH 1CFTA 4RGMC 3WTXA 5F1IA 4JY6A 2XZQL 2X40A 4BRJA 5EU6D 3WXWL 2VDMH 3IAQA 3ARPA 2X4UA 4XNQB 2C3VB 4AQEA 5F0PB 3TPUB 4D8PB 4E5XB 1MCNA 3CC1A 3SKJH 3WOVA 3MUJA 4XNUH 2D31B 2AV1B 2VWEE 2Z4QB 1CGSH 4L9LC 3ZHFA 2FBOJ 5F7BA 1TJIH 1OB1B 4OSUL 2DQGL 4H8PA 1XGTA 4NQCE 2VXQL 5JYLA 4MMZA 2C7FA 3KZ8A 4M62H 2A74C 3KBPA 4AQ1A 3CFBB 1RUQH 2P26A 4O58L 1YEFH 4FKKA 1QPXA 3K2UL 1F3DJ 3QCVH 3BVXA 3QXAB 4BSVB 3BYTA 4OJFL 5JXED 2BVTA 4ZMAT 4NQSA 1I9RH 1SJMA 2ZSWA 3QEQB 4JGNA 4AZUA 2HT3C 2P5EA 3MO1B 4X99A 1IM3A 1AYOA 4G42A 5IW3A 4JPQA 1DZBA 1EEZB 3NQKA 5INDA 1IBZA 2BDNH 3NVQA 4PGDB 4JFZH 3ZHKA 2XQBH 5HHPA 3EF7A 4E41D 3HMWL 5EZLA 1Q0YH 2XG4A 4GAFB 3QRGH 3PAUA 3IGLA 1JWSB 4ICWA 3ARUA 1KYDA 3FSVA 2YZ1A 3HA0A 4EAEA 3FUDA 2R0WL 3GRWH 1BFSA 3OZLA 2EDFA 4FXKB 3MRHA 2NY3B 5F7YC 3KR3H 3FO9B 3JV6B 3MNVA 4WEBL 5D93B 5MEQA 2G3MA 2Z7UA 3FTXA 4LCCC 3UTZB 3N1QC 3VGEA 1BZ7A 1Q1JL 4S1RH 5LGHL 1E5BA 3LDBC 4CGUB 3LS5H 4CN1A 5C09B 3PWLB 4K8RC 4UUJB 1CLZH 1YMHB 4YHML 1P84J 3QZPA 3T4AB 3U83A 4NQDB 5B3JE 2E46A 4KXZI 4RSVA 5DUJA 3EH5B 1MFCH 1NC4B 5D2LF 3TEXA 4NUGL 1TF4A 4XMZA 3X14A 2AQQA 5B4MC 4RFOL 3HC0B 2B1OA 3FQTB 3HI6L 3MCKB 3OKNA 3EFFA 1NCDL 3KDMB 2ZUUA 4FF9A 4DERA 5J9PB 1OIOA 1KIPA 1OT4A 2YAEA 2X2JA 3UDWA 2RD0A 4GKZA 4AE1A 1FORH 1BQHB 4OW6A 4FADA 1H8SA 4AC4A 2FX9H 1KCRL 1N6VA 3F7LA 4U6HA 4X83A 4CC4C 4U6VL 5C7XL 3GBNL 3ESNA 3T3PE 4P5TC 4RGOL 3L3OA 3Q2LA 4YDNA 3KCPA 5JW5A 4OFIA 2D9QB 5FM8A 2FZ3A 3I3BA 2APTA 3HG3A 2BNQB 4YFLF 1LL1A 4RGNB 4EDWL 1UGKA 3I02B 5FUZH 2L7JA 5DWUL 5AEAA 4AEFA 2JI1A 4PJFF 3DGCR 2VDRL 4W9DC 4Z7OB 3EADA 4MHHG 4Y0GA 4PIRF 1GGIH 3OKLA 1VFBA 1CXLA 5T33L 1I9JH 4N0FA 4BH8B 1JZIA 4IRJC 5KZCB 1DQQB 4EIUA 1PW3A 2ICES 3KGRA 3WI9A 3VGDA 3QG6B 4M5TA 2CBQA 2FJFB 1J1XL 2YAPA 3LZPA 1ORSB 5ILTL 3QUYB 3V5DB 3VD7A 1AHWB 3MLXL 3TO2B 4PJ8A 3ULUC 1R3KA 2J4WH 3LRSB 1SLVA 3FT3B 2OZNA 1UCBL 1Z9OA 2XIDA 3M17B 5DJXB 5ESQB 5DJ0B 3TJHD 2A2QT 5E5MB 5E4AA 4Y5XB 4QDGA 3S3SA 1DQDL 1Y1UA 2WO2B 3DRQB 3VX0A 1CXFA 4P2RD 4G43A 2V7HA 1E9OB 2H0JA 4G5ZL 2GAZA 4N6QA 4NI6A 4DPCX 2BP0A 2ERJB 4DF9A 4F20A 3G5YA 4KXBA 4X4KA 5C0AE 1R34A 3FUIA 5CZVL 4GQ9H 5KUMA 3MACH 4DETA 4RBPH 4KDVA 2NZ9D 4OGYH 7TAAA 5BMFL 4YSQA 3BSGA 1ZVYA 3REWA 4OT1L 3CN1A 5T3XD 3VXOA 4JFQB 2NY6D 3D4ZA 2DY2A 4FX5A 2NR6D 2CA3A 1PIGA 2K3TA 1KBPA 1BQUA 1EDYA 4OLZH 4PJGF 5AB9A 5DGRA 1KJ2H 4X4YB 1PJWA 3LH9A 2VR7A 4GUQA 2ZWYA 4UIMA 4N1HB 3AITA 3P77B 3S2AA 2F0CA 3TOPA 2DQUL 3RPIB 3HI5L 1FO0A 5CLZA 2J6EH 4PRIB 2NNAB 3WE1A 5EUKB 4O2EB 4PCKA 4IRSD 1NBYB 3GDCA 2G3XA 2X09A 4KTDH 4QHLA 2HT2D 1S5HA 4OZIA 3GHBL 4ZX6A 5GQBA 1ZAGA 4M93B 2GJ6B 1ITCA 3CDZA 4Y4FC 1MVUB 2DKUA 1XSIA 3FSWA 1AXIB 2RAMA 3Q8BA 1S9YB 3V7MA 3H3PL 5F3HA 2HFGL 5FXCH 1BZ9A 1B4RA 4K9EC 2EC9U 4F2ME 3W9EA 2QHRH 3GO1L 2VLME 1B3IA 4N3UA 5IEHA 1XIWA 5D1ZB 4XN7A 1KBKA 2WBJB 5KYYA 2X6MA 3GB7B 3OL2A 3UJTH 3U4BH 1ASPA 5AVQB 2VLLA 1SY6A 1EFQA 1SXNA 3GMRB 4M7LT 1O7SA 4F8QA 4FCHA 4DUWA 5KVDH 1M71A 3DVGB 4MD5B 5C3TA 1XH0A 1K4DA 3MROA 4QTHA 2VLKE 4OCRL 5IK3A 5TDNB 3PDOB 4A2FA 1U41A 1Y0LB 4YR6A 3ARYA 1YNKL 3IDJB 1F6LL 1CXKA 4GO8A 2X4SB 3KYOB 3M86A 4P2YA 4AW7A 1TCRB 4RA0C 5FGRA 3PIQB 1VZIA 1FPTH 2GSMB 1OWRM 1O7VA 2ATAA 4XXCC 4QOKB 4IIZA 3TBVB 2XWEA 3KW7A 3TJHC 3FUNA 3WEAA 5L2KE 4MCZA 1AANA 3PHOA 2PP7A 3RA7L 5JOFA 2VQUA 1F6FB 5GHWL 3WAJA 3PXJA 1GPOL 2BJML 3L5XL 3Q1EA 3BH8A 2GJJA 3KPSA 1EEUA 1YUHB 3WJMB 2VLRD 4AYID 2GJZA 1MCBA 1QZNA 4Y19B 1NGZB 4A2DA 3OB0K 1WBYB 2XV6B 4JR9H 5FYKD 2O5YL 4IBYA 3WE6A 2Q76B 4ZFFA 1RJLA 2NZ9C 3NAAH 3ZE2B 4GUPA 3ISRA 1RV6X 4P23A 3T4YB 4FL4C 3BC9A 4KQ4L 4YO0B 3VQ2C 1NIEA 5HTSA 5F8RC 4N9GB 5AW3B 4OCWL 3BQUC 2VDPH 1VGKA 4X6CE 2XNAB 1H5BB 5F1SA 4BH7B 1HKFA 1HXYA 3BW9B 1YAZA 3V0WH 2MJWA 3IETB 2Q20A 4FLRA 4PPTA 3P40A 3Q2VA 1Y7VA 4JL1A 1BJ1H 1T1XA 3L7FB 3C5ZA 4M6MH 4R6UA 5L4FA 3WIHL 1DVYA 3ESUF 1T5WB 3T6XA 4GAGH 4G8AC 1MJJA 4FQHB 2Q6WA 3RWGA 1A66A 4PY7B 1I1FA 2R1YA 4FFVD 5CJBA 4Y5VC 1Q8MA 3C2SA 4OFDA 5I30L 1TITA 4KPHH 3APDA 1LDSA 4H8UA 2ADFL 3LAFA 3TS8A 1A7RH 1P5UB 2QVKA 5KJ4A 4KK9D 4F7EB 1IAIL 5D7LD 1CL7H 3FYIB 3S8GB 2A6JA 4K8RH 1BQLL 4X8CA 4BFKA 2NY7L 2WAHA 1H6FA 3K2KA 4HWBA 3TU6A 1JGUH 1B0RB 3A6CL 4HJ1A 4JJ5B 1KGIA 3KNBB 1O9ZA 1E8WA 2WZPD 2W95A 3RTQA 3STLB 5EZIL 3S3PA 4QRQA 2NZIA 4LCYA 2JLPA 3ARGB 1N8ZB 2OTPA 1HZLA 2EH7H 4JO1H 1P4BL 2VDLL 4JANA 1U3NA 2H9GA 2Z6FA 1JXDA 1H3WM 4WI2A 3T3MF 3K5RA 1MI5A 5H35B 1NPJA 1UA6L 4WUUD 5E5RB 2BP5M 2FX8H 3L5WA 2VLJA 5GXBB 1JD7A 3PABA 1S7TA 4ZS6D 2FATH 4L9DA 4QXGH 5K39A 4PJHE 2FECL 1QSFD 1R4XA 2W9DH 1PLGL 4IDLA 5IT2H 4WJG3 4WENB 1LNUB 1CGYA 1P6WA 4PGEA 2W88A 4L2LA 1M7DA 1YQVH 1FFPB 3GZPA 3NJJA 1VZGA 4YHOL 3U4EB 1EAJA 3KYKH 3C5XA 1OP4A 3QQNA 4Z78B 1IL1B 1A3RL 3OPUA 2X4RB 4TV3A 5CF3A 3V7AG 2AJ3B 2J1XA 2WQRA 3MV8E 1ROWA 4NO2A 4DSYA 3M07A 3BUQA 1QRNE 3TIEB 3SKUD 1ZEAL 3ILQD 2KDGA 2GJPA 4U1GC 3QIUB 2YFOA 4CGTA 1V3JA 3MRCB 3G5XA 4N2CA 1LO2L 5BUPA 4XBMA 1RK0B 2ZAIA 4P3CH 3QIBC 4LP4A 4Y1AB 2JVUA 2AXWA 1VB9A 4EDXB 4PJXB 6FABH 5DEGB 5IJCC 3AQYA 1KTCA 2HTLD 3K6FA 4LHUG 3LEXA 4GSUA 4Z7QE 4NT6A 1HU8A 1J1OL 1WAEA 1T80A 3ZW3A 2CIIA 1TQSA 4H0GA 1KGXA 5D7IA 1AE6H 1ZWIA 3U7YL 3IDIA 4XHJC 4FFVC 2IH1B 3WJLC 3FT9A 1N18A 4WI9A 4J6IA 5I1KL 3BDYL 4M5YL 1FNFA 2AJVH 1OKEA 3BN9D 4GQRA 4Z7NF 4ELME 4AQ8A 3UJIH 1NWOA 3OKKA 3SY6A 1NC2A 1ZE3C 4LSRH 1ODAA 1PYWA 1PZAA 1WISA 3P11L 1PD1A 3P4NA 4A37A 1HTYA 2APXA 5DHYA 5E94A 5GGSY 4K7PL 1SJEA 5E2WH 1AVAA 3QUHA 3RURA 4M7ZB 1KFAH 2QELA 3KYNA 1CDHA 2FDBP 4B5ZA 1UQSB 2MPVA 1XF5B 1MWAA 1FE8H 3T2NH 2O6CA 2XBZA 3BVDB 3FTUA 3TVMA 1JZJA 4ANKA 1JNJA 1HAWA 3AMKA 4IKJA 1TYRA 5EBWA 1D6EB 2EACA 3EJRA 3VSUA 4JZNB 3RGVA 2D4FA 4H1LG 4Z7WA 4L37A 3FU8A 4YXLL 4M6OH 4NWUL 1KULA 1TTFA 4HPOH 4NBYB 1PD0A 2J55A 1AFVL 5FYLL 4U6TA 2A9DA 4F9PC 3GSWA 1UOVA 3K6DA 3O4LD 3S5LB 3BT2H 1J5IA 4E9LA 5JTWA 4LU5L 4K9EH 1EEQA 4PJEE 4S10A 3PL6A 1UG9A 4PRPA 1UXWA 2VOTA 5CCKL 3CX5J 3JWOL 3PF2A 4OV6F 4X2UA 4EI6B 3HZKB 4A7VA 4DO6A 5JPNC 4FNSA 3D2TA 4JMNA 5EFIB 3SOTA 3LXAA 3CDYA 1CYGA 3O6KL 3UPRB 3LN5A 3OGCA 1PKOA 3BPOC 2BVPB 1SLUA 2CALA 5LUMA 1UVQA 3VRJB 5L6YH 1NMCC 3TO4D 2F19H 4KY1L 5CP7B 2XTLA 2HKFL 1CDJA 2DD8L 2FBJH 3Q8FA 4GYBA 4HPHA 1HINH 3RFZC 4U7SA 5IMLA 3CZKA 5HYJB 4ZAKD 3FQUA 1UOLA 5M95B 1HCVA 3SE8H 2XZCL 1J8HD 4XXWA 2WVVA 4LNRB 4HDIA 4RNRB 5E0FA 3NCYP 1XTLA 4Y2DB 2BK8A 2R56H 3N43F 7PCYA 1AOHA 2FO4A 3ARFA 3GMLB 3PAVA 3FONA 4JY4A 1MEXH 3F04A 4JRYB 1V27A 4FULA 1PCSA 5LCVH 1ERNA 4ISVA 1FN4A 4R4ND 4C58B 2K6ZA 4AKPA 3O41B 2QVIA 3SOBH 5KSAC 5ALBL 1T1WB 4NQVB 3T2PA 4F7MA 5EBMB 4KI1A 2DQDL 4MXWH 4OZHB 4XPHH 4A55A 2GBVA 1RMFH 1P4LA 2VRKA 2I85A 4MLIA 1MCOL 1FHGA 2XXFA 4JVPA 1ETJA 1IGIH 4NIYE 1C08A 5LN4A 5IFJA 4XN5A 3SBPA 5E51A 2VW7A 3RWEA 3ML8A 2VN7A 4JFFD 5T3XH 3ZKND 1LWHA 4QTIH 1OAJA 3VD5A 5CLTA 2FL5A 2UVEA 2FJGB 2FJSA 1LMIA 4M48L 1A7PL 2Y69B 1AZBA 2VKXA 2ZCLL 5DC4B 5BS0D 1MVFA 4LPVA 4DESA 3FBQA 4TTDD 3UZQA 2E3VA 3W0WD 2DQHL 3F5WA 1IZKA 2FUTA 2HKHH 1ADWA 3GTVA 1A65A 4JFEB 5I1GH 2OCJA 1MG3C 2ICWJ 2WXLA 1S9KC 5K1JA 4UAOB 2OP4L 2XQYG 3STZB 3KEHA 1H6EA 3S5ZA 1GYCA 3QDMA 3QARA 4WSJA 3RWJB 4MD0B 4JPWL 3S9DB 3ZVVA 4FZEL 4PB0H 3RVTD 1A2YA 3GNMH 4LOVA 3RHWF 2VL5B 5E5LA 3VD3A 3DHUA 5I5IA 1Z9PA 3PWPB 1MRFL 4F7PA 1Z5YD 1IEAB 2WUBH 1OAUH 4FNLL 4M1GL 5DQ9B 1CZ8L 1XEDA 4WVRA 3ZDZE 1PJ9A 4GXUM 3O3AA 1I8LC 4V1DB 1ZANL 4F92B 1BJ1J 3D85D 3QUZD 4NLAA 5HGHB 3V0VB 4JFYB 4PRAB 3CK0L 1KJVB 1ZLVK 1QWHA 3BPNB 4PJIE 5C0IA 2H26B 3VWKA 32C2B 5HYIA 1TZGH 2YPVL 4GG6B 1A8JH 4XTRC 5IB4B 4U31A 3U30B 5IB2A 7FABH 1OAKH 4ORZC 3SPIA 4PQXA 1EUUA 2DQTL 2ZKHH 1EDQA 4U05A 4DP7X 4FTVB 3QNYB 4KVNL 4JK0D 3ISWA 4MB1A 1JGDA 1XZ0A 2XWDA 4G83A 2C9XA 3QORA 4YHYB 1U8PA 4DN4H 5FHBH 1OGAA 1MZZA 2WYIA 1MCRA 3JWNG 1WZKA 1MAJA 4XB8A 4OVVA 5KTEH 1NINA 3LKPA 2PO6D 4KHTH 2R2BB 5EU5A 5F1OB 3MA7B 1YNLL 5E9DB 3VMPA 3DURB 5L88H 5A6IA 4HHAA 3BKCL 5FYKH 3RX5A 2I60L 2X2YA 4G8IB 3PQYB 5DMGD 4XCEA 5LBGA 1GS6X 1BXVA 2OQJB 3BHBA 1YEHH 4JPSA 3B2PA 3PWUB 5C07E 3E3QC 4M8QB 5ETUA 3BUIA 5LBSH 5I1HH 4I1NB 1QLFA 2XN9E 3HHMA 1NFDB 1RZKL 2F58L 4N28A 5F9JA 2EXWC 1IAKA 1ZIBA 1JNNL 2H6UA 3FQYA 2N1TE 4WGVB 4NNPH 1MFEH 2ZOUA 3DROB 1HHHA 3EJYD 3HPJB 2FQFA 4HQQH 2DMKA 3IFLH 2KYIA 1EK3A 2G75A 3WHXB 3SYPA 2A3TA 4PTUA 3VFWB 2W81C 4WI3A 5D7SL 1KB5L 4PWGA 3OAZH 1KGUA 4WY7L 5ESAB 4AMWA 2WXNA 4WQOA 1V7NH 1E4JA 4TOYL 4X7FC 4LLWA 4KJPC 4HU2A 3OXRB 1ADQH 5FYJE 3HR6A 2Q7NA 2MSPA 3UTTD 4YBQC 3WY4A 3RVTC 5BOZG 2F5BL 1K6QL 1ZE3H 1YNTA 2NYKA 1IGYB 3KWWA 3VAEA 1KLUB 2WLLB 4ELKB 1OB0A 5IVZB 4G1MB 3VFTA 2SODB 3OHMB 3OG6B 4HBQA 3RPBA 5MHSE 4FJZA 5F3BA 3SDCB 5J6GB 2LQRA 1OSPL 3AUWB 2JCCE 3IJHB 3LQAH 2DKSA 4U49A 2OMVA 5MERB 5MEOA 2NW3B 2PETA 1ZIAA 1UATA 3D09A 3OLIA 4TSAL 5GS0D 5HYFA 4QXUH 1WFJA 3MRQB 1KPVA 4DFHA 5IB1B 1LDPL 3V6OC 1ZY9A 4JFVA 3MV7E 3UXFA 1Z32X 5EOQH 1GJUA 4LEEA 1KENL 2HX7A 1BF5A 2CDFB 5H2BA 1NDGB 3FUHA 1CTMA 4TQEH 4LP5A 5FF6B 4OZFH 2VR6A 3HW7A 5DQDH 1AGDA 2CUHA 1OV8A 5DHVB 2VM9A 2CR6A 1V55B 1HXMB 3FQNA 3LZNA 4FG2A 4JQIL 4UNUA 5EU6E 5FM5O 1I7ZB 4U0RC 3JTTB 4KRMB 2W65A 2VXVH 4NN6C 2UZYA 1UA7A 3AQZA 4S2SA 1HSAB 3I9GH 3ILPA 4ZFGH 1ZLWK 3RE0A 2R59A 5KVGL 1MVYA 1RZIB 3ELQA 2EEBA 4KKLD 5FK9B 5FS5A 5AWNL 4JPIA 4ZO8A 3CLFH 1FCCA 2J8UF 4MD4A 2BMKA 1FFNA 4C47A 2P5ED 1BBDH 4ZQKB 4I2XB 4UM9A 1TZIB 3VG9B 5LGYA 1FC1A 1OZTG 4WTWA 4S0TD 4DK5A 2BRRH 4HJUA 2OXGA 3OR7A 4P46C 3ZKXC 1HILB 4PG9B 1HSBB 3S2CA 1E4WL 3FT4A 4LL1A 3FQWA 3L1EA 3BPLC 1LO3L 3PHQA 1X7QA 3IVKB 3NFNB 5AD0B 1KYUA 2ATPB 1DQML 1YVLA 5HHNA 3QJHB 1BVOA 2P5WD 2Y6TE 4E41E 2FO8A 4J27A 1NANH 4OZGF 3EJTA 2A6KA 2P8PB 3QPXH 4X9FA 4UT7L 1V3KA 5E6RB 3VFOB 1Y6NR 5ALCH 1RUAH 3HI1A 3Q6GH 2O6FA 1A6UL 1WCQA 2F53D 3FAWA 4RH4A 5DR5H 2EO9A 5FYJU 3S35L 2BVQA 2EKSA 3WDHA 4F7KA 1GZQA 2DTML 1OPGH 4O2FB 3QDJA 2JKJA 2CBOA 1WD9A 4WNJA 4ZTPL 1KCKA 1TSHA 1NOFA 5I18L 1W8OA 4FA8A 3AU1B 2C3VA 2UYLA 5M7QA 1E6OL 1F8TL 4XP1H 1NGPH 4D8PA 2J1KA 3V2AR 3I85A 5DI8B 4DVRH 5I9QB 2BNRA 5J4MA 1BBJB 3Q43A 4W70A 5E08L 2D31A 4ODVL 3VGAB 3LQMA 2BSTA 2A0LD 25C8L 1WIOA 3TBSB 3GPSA 3SE6A 3ZLQC 1I8AA 2Y5EA 4P2OA 3RB7A 2YA1A 3T2QA 4NQEB 1LD9B 2DBJA 3CH8A 1KIQA 1SHXA 1N2RB 1JNHB 5EF1A 1B6DA 3ATAA 2OZ4A 4XN9A 1SBSL 4A6YL 3J27A 5FO9B 3QXAA 4NQCB 4JFSA 4NUJA 4BFJA 4P4KD 1Q0XH 4JG5A 2WJ5A 4MCNA 4BBWA 2VGLM 3MO1A 1PKQB 3VFUB 1JGVH 1HHJB 5GRJH 5DDHB 3MBXH 3ROOB 3M1CA 5ACZB 1CDCA 4K3GA 4XN2A 4HAFA 3IDUA 1GS8A 1UGNA 2XCMC 3MJ9A 1P69B 4K07A 4ANWA 2J25A 2OL3H 4OF8A 1ZHNA 4DT2A 4P2AA 4ENZA 1F58H 3D12B 4CKQA 4AQ1C 2WLIB 3WFDL 2NTFB 2Q0ZX 4X5WB 1KCUL 1AQDA 2AV7B 2XZAH 4AKQA 1FVEA 2CO7B 3L1OH 5EBLB 2Q8AL 5ANHA 5JHLA 2BS9A 1XCWA 3WS3B 2GTQA 1DZ0A 35C8H 5AOZA 3ATFA 2L7QA 4UQCA 5KYXB 4K71C 2VXSH 4QXTA 5C09A 5HJ3A 3D33A 5EU3A 4KI5F 2ADYA 4AC2A 1O9WA 3SDXF 1JHLH 5BW7C 3P69A 4GIOA 4GB9A 3ZTEA 1ZS2A 2CKNA 2VH5L 4XVJH 3WO4B 1NC4A 5E95B 1XB3A 3TF7C 4CRPA 3LX9A 3FQXA 8CGTA 2W0FA 1I4FB 5D71L 5K59F 5IW6A 1EHLL 4KK5C 5DHDA 1N5YH 3CSBA 4PCSA 4W9LC 2X28A 2R4RH 1OANA 1X5IA 3DIFA 4J2QA 5E99H 4AT6B 1OOWA 6TAAA 5I24A 3PV6B 4R8WH 4JL2A 3SYQA 1E9QB 3UZVB 4KZEH 1OP3K 1LILA 4WJ5A 4WNSA 1NJ9B 3PGFL 1PQZA 5D1QB 4M7KH 3HR5B 3B34A 2VXUH 3EJCA 4P2RE 4XNYL 1ASQA 5HBBA 2DJ4A 4OQ1A 5GGVY 3WJJC 5T3ZD 1MHPH 1MLBB 3MAWA 4APQA 1TTGA 5IQ9B 2CO6B 2BNQA 3GXTA 1L9NA 5I8OH 1AGFB 3DOSA 2C9SA 1NIDA 3TH4T 1G9ML 3CDGB 5F71A 4LVOB 5T3XE 4N2GA 4KTYA 4IMLB 2Y7NA 5T5FL 2CA4A 3P4MB 3QJVB 2NSXA 3V4UL 4AUJA 3LKSA 3UDWC 1ORQB 4CNIA 3BP5B 2UZIL 5H37G 4PJDB 1LLAA 2DM2A 3QR1A 3IPFA 2PPCA 3EXLA 5FOJA 3D3VE 3FCSA 5DJYB 5IBTH 2HUEA 2WJ7A 3L3OC 2C3HA 1IC5H 1A7QL 2BRQA 3L5HA 1BM3H 1PGRB 4PWJA 2V17H 5LO7A 2IQ9L 3W82A 4AEHH 1ORSA 1A14L 1AHWA 3TO2A 4ODSL 5A43C 2BIPA 5C7ZA 3KL5A 3F84A 3VXUB 3FT3A 3BH9B 3MU3A 4NZRL 2YEQA 2YKLH 1S7UA 1T1ZA 4KVCH 2AK1L 4IRZL 1LXMA 4ZNCD 5ESQA 2EXTA 3Q7JA 5E5MA 2NMSA 2DL9A 2A83B 1XEUA 1I1AA 1M53A 2AK4E 2HFFB 3GS7A 4L4VB 3IPBA 1ZLUK 3RI5F 3HS0A 1E9OA 1IC7L 3EGXA 4BHUI 1TTBA 5DMJB 2DM3A 5CEZL 4K3EH 3RILA 5DRZA 4Y89A 4DQAA 4QRSB 3DXAA 5ADPL 4GAYB 1QTYT 4XXDA 2Q10A 2G5BA 3ULUF 3NZUA 4M9OA 1SOSA 2IO5A 4D7PA 1BYOA 5B1JC 4PJ8C 3SBRA 5E6ID 3ARXA 3NCCB 3HHRB 3EFOB 2EYRA 1L0QA 3M7FB 3SYAA 1E28B 1J10A 1DLFH 2EH8L 3CZNA 2VUKA 1GKEA 3DIDA 3VI4E 2ARJA 4FXTA 1C5CL 4I3RH 1MCJA 4MNHA 1HYSC 3RPIA 1RZJL 1MFBH 1T5XB 1QSEA 3OSVA 3EH2A 4LVEA 1T0OA 3ZUCA 4LSSH 5HHQA 2RQEA 3CFNA 1NFIA 2FWOB 4ZSOB 1SXBA 1Z1WA 4Z3HA 4ABQA 4OKVB 3ZE0F 2HWZH 5HDBF 1BV8A 2J5LB 4L23A 2V6HA 2G30A 2HFEA 4DHLA 3TT1L 1A0QL 2IBBA 4GI8A 1U3ZA 2HSIA 3CZGA 2K6YA 3O4OB 5I15L 5SX5H 1S9YA 4J6RL 5FHAH 5AZ2L 2OMTA 2P7TA 4F37K 3LNIA 4K0OA 2WTRB 3ASWA 1FHNA 2XX0A 1F42A 2WBJA 4LF3B 4O5LH 5FDWB 1RZFH 3FU7B 1QOKA 4BQCA 4HH9A 2W9EH 4C54A 3BAXA 4MBRA 1HEZB 1XH3A 3K4DA 4XMLL 1T4WA 4U1NB 3GMRA 4NIKB 2Z7ZA 1CFVH 1DJZA 2YEZB 2MTAA 3DVGA 4NKDA 5T5NG 3SPVB 5AW1B 5TDNA 3MA9L 4OF6A 3Q01A 3IDJA 3H4HA 4IBWA 5HHOA 4JE0A 4URKA 2X4SA 3GSRB 3KYOA 3WIFB 3VFVB 5D7LE 3HE6D 5DJDB 3PIQA 3FFOA 4QCIB 3B3IA 1EX0A 2BC4A 2YBGA 1SLWA 1FZJB 1XIWC 2NQ3A 3WLWC 1E4XI 3UL4A 1QHOA 2X87A 4NO0A 3TV3H 2V5YA 2YAQA 1SFHA 3LH8A 1S9XA 3TEYA 1GVIA 4HXAH 1S3KH 3QUKB 2NY1B 5CKAA 4F9LA 3NCJH 5AZEL 5KANI 3CZJA 4MDRA 3V0JA 3MKKA 1U4FA 3IM1A 2MCPL 5L2KB 3DBXB 1NGZA 5EOTB 1YPZA 2ZUWA 5I5MA 2VLJD 5D5MF 1FL3B 2Q76A 2WKOA 1JPSH 2UY6A 1UXLA 2VDKB 3DTXA 5E1HB 1A6VH 1THCA 1AXTL 2DN7A 3S4SG 1OF0A 4WUUE 3TP4A 2ZCKH 3T4YA 4YO0A 3L08A 1X6LA 2CCWA 4W1TA 5DD5H 3LZLA 3U4KA 4JE4B 4KV5E 4IDJL 4N9GA 5D2LE 1FNSH 2A9AA 2XNAA 1QSFE 1FAIL 4BH7A 3TGXA 3BW9A 4EQ2A 4OFPA 1BM7A 2HA1A 4R4BB 5I19H 2CUIA 1VACB 3L9RA 3WFCL 3GBLA 1KCVL 2TSAA 2EDEA 1XF3A 3ETSA 1U8KB 4QWWD 5DT1H 5JORB 1T5WA 3UG4A 3B4NA 4RMQA 4FQHA 4PTTB 3WKML 2QT6A 2EIEA 1U8IB 2CM6A 4FLSA 3UGEA 3IFOB 4DEPB 4P23C 4JM2F 4LLQA 4MA7H 5D1XA 4M4PA 1P5UA 4KGLA 4F7EA 1Z9LA 1DO5A 4PS8A 4ZMQA 5HGGS 1EVTC 4G8EB 1BXXA 1HZHH 1AAJA 1M7IA 3NGBC 1A6AA 1B0RA 4JJ5A 3TLRA 3NABL 5FYKU 4Z7UB 2GT9A 3C5ZC 1PTZA 2GJRA 1JV5A 3STLA 3MUUA 1XL4A 1ETA1 2NSQA 4WO0A 4AVJA 4NKOB 4LB8A 1DL7H 2EO7A 3FN0L 3ZY7A 3PP3K 4JMXA 2OYKA 4G7VL 4FQJH 5H35A 5AUMB 3QPQC 4KI5D 1L7IH 1U8OA 3K6IA 2E4FA 3G6JA 4B9CA 4M56A 1UM5H 1EO5A 1NC2D 4YZWA 2YGQA 2FNWA 4X8GA 3M46A 5K9OB 5EN2B 3WN5C 1N3NA 1EJOH 3FOMA 2VSCA 2K1MA 4RFEA 1LNUA 4HS3B 3RTQC 5DUML 3V5HA 1ES0A 1NBQA 2ZCHH 3NOIA 1ZSHA 5TE7L 3WIIL 3F8UB 1F2QA 1LWJA 3UO1L 1I7TB 1D9KC 5IJVA 3LZQA 2I27N 2X4RA 4YSOA 1MW0A 2YGOA 4HF5L 3VW3L 2V3FA 1CD8A 3EZJB 4LCWD 3UGUA 1LK2B 2R8SH 3QJTB 3CXFA 3RY6A 2H8PA 1B88A 4LAJH 4BUGA 5ACLA 4N0CD 4YHPA 2LVCA 4AKOA 3IGFA 1RULH 4HV8B 4A7GA 5DD1H 2JB5H 4PJ5D 1QRNB 5HDOA 4Y1AA 5A1AA 4OGXH 3I74A 1UWFA 5C9KA 4IMKC 2PN5A 4KJWC 1HJCA 3VFRB 5D7KD 1MSPA 5EEVA 5F1KC 1NA8A 4EDXA 1KG0A 5DEGA 2OSLB 5EU7C 4B41A 1DBAL 2N7AA 5CS7A 1TTUA 1ZTXE 4AIZB 3PL6D 4PRPD 3LNEA 3O4LE 4QHMA 4QRUA 1WG3A 5DMYA 4HKJB 2ROYA 2OULB 3CIQA 1E6JH 1J5OL 3SQRA 1LP9F 1WFOA 1LK3H 4AL8L 1DN0B 3LKNB 4KNSA 4QIRA 3RIAK 4PRHA 1AZVA 1AR1B 1WAAE 4KKPA 1QTPA 1UZ6F 3N3EA 2G3NA 3BVWA 1CICD 3EYSL 4PJ7A 3IMBA 1KPRB 3KPOB 5BO1H 4EN3B 4XN4A 1FLRH 1AC0A 1QFUL 4NRZB 3QEUB 3Q8AA 3QAQA 1GKOA 4AGLA 4X42A 1ZV9A 4AX3A 3WMSA 2ITEA 3RDJA 1L9QA 1WEJL 1J8HE 2XY1A 4GBXB 2YRBA 4Q4IA 5LAXB 3RYMA 1TQUA 3BEWB 4LP8A 1MRCL 1UQSA 2QVFB 2GC7C 1WS8A 3KPTA 3CZUB 3QAZC 4DPBX 2NOYA 2XTJC 2YWZA 1TVHA 1CLOH 3FN9A 3MRGB 1D6EA 4BFFA 4Z3JA 4JZNA 2C1PB 4AQ8C 4TN9A 1KEML 4LL4A 4OUOA 5J11B 3ILDA 4FI7A 5JXAH 1PAMA 2WCPA 4L8SA 3EYFA 5CMAA 2GFBB 4AUUA 1WUNT 4XCNA 5F1NB 4LRIA 2NNCA 4YLCA 4ZOCA 2TRYA 2NY5L 2B9BA 4GJTB 3VXSB 2A7BA 4MNQD 1W72L 3EG9B 4JN2B 1C5DB 2M26A 4P2CG 5JYMA 3P73A 4RDBA 4R26L 4OQTA 3GXFA 4YHIB 2XG5B 2DM4A 4XC3H 3S34L 4LEXL 5F7EL 3TVMC 3DHMA 4EI6A 4MA8H 1FO0H 1U3JA 3DX6B 4N2MA 3RGVC 3H53A 3F7QA 3BKJL 3V6ZA 3BIAX 3O2DL 2WSDA 2NXYB 5BS0E 1IARB 1YEKL 3U46B 2BVPA 3II1A 5GGQH 3B7UX 1G4MA 3L1GA 3VRJA 4H8WC 4NO5B 1JWMB 3W0WE 4D9LH 2J56A 5CP7A 3U2SA 1JZHA 3N44F 2H41A 4GO9A 4G6ML 5C08B 5EC1B 5JPMA 2AQTA 1OOAA 2QBWA 4Y4HD 5DVLA 3ASOB 5I73B 5JHDB 4QRPD 5HP5A 3F7RA 4W9CC 8FABB 3HMXL 2HPOA 4K23H 3FUEA 3JQOB 2ZX7A 4RNRA 4Y7MA 1BECA 4YGVB 1DANT 5CBAA 1G7IB 2ADGB 4DKAA 4PN6A 2FSDA 3SKJL 3C9NB 1CGSL 4EUPB 1WWBX 4JRYA 3SO5A 3KL3A 2AJYH 1TJIL 1N26A 1SY6H 4NRYB 2Y23A 1RPKA 2ZUQC 1XGQB 3LVEA 4MAZA 3O41A 3BUYB 2Y5TB 4TF4A 4M62L 2VITA 2BVOB 1RUQL 4FNUA 4HSCX 4D0BA 4UI2A 5F7MC 1YEFL 2NNRA 3QCVL 2I32A 1PS3A 3D18B 1RUPH 4Z7VB 1MFAH 5IFAH 4LHUB 3K46A 1I9RL 1PY4A 3H9SA 4OF5A 4QJ3B 5SV3A 4P59H 3V52H 1FFRA 3VXTB 5F89A 1JUFA 5FW7A 2CJUH 4GRLB 5BRQA 4H4NA 4XXWC 4NZTL 3H54A 1R6VA 1JF1A 4DFIA 3ARFC 3QORD 1MW3A 2HMID 3PWJB 4KO7A 1OGAD 2XKNA 2XQBL 4JFZL 1NGQH 4L1HA 3B7RL 1OARH 1QWNA 2AJSH 1EZVY 2YOCA 3RBGA 2ZWZA 1XF1A 3QRGL 1PMYA 4JFDD 1UH3A 1K2DA 2EADA 1OCRB 3GRWL 4H88L 3T3ME 1A1NB 2X4TB 3KR3L 2F54B 2QEJA 2WK2A 4HWNA 4LKCB 3B9KB 4R7NA 3HFML 1QP1A 4JFEA 1P5VB 1TVBB 1CR9H 4S1RL 3K7UA 1CK0L 1O7DC 2H45A 3RWJA 3MLTB 3IMVA 4HEMA 2PCFB 1T21B 3LS5L 5B39G 3CFKA 5D6CB 1CLZL 3MRNA 1DJYA 4EIGB 2JB6A 3GSXA 2AKRB 1NBCA 2J73A 4U4IA 4IBUA 2UY7B 3PWPA 2N3JA 4YDLC 1IEAA 2R0KH 1MFCL 3ARED 2IALB 4CMHB 4N2BA 5BUAA 4JRXD 4NZ8A 3UYRH 3D2UA 1IQWH 5HGHA 1ACXA 4YSEA 1A7OL 4JM2D 1CIDA 1KJVA 1OLZA 1YYMH 3U36B 4Q6YA 3ZDZB 5DA0B 5DJ2B 3BD5A 4OI8A 5KVEH 1MXDA 3TZVD 4PBWD 1XFPA 1FORL 3EJUA 1I8KA 4IKIA 2EYTA 2BLFA 2FX9L 5JW4Q 5F8QC 1TTRA 3N9GH 2H32A 3ARDC 2QADC 2UWEF 4YDJA 1GTFA 1N68A 1M42A 3H9HB 3QNYA 4FTVA 4HWBH 5TE6H 2ED9A 2OMZB 3T6VA 3UTTE 3CVHB 3WD5H 1QFWI 2BPBA 3H56A 1E4HA 2ZX8A 1Q38A 2H1PH 5FUZL 4P4RA 1AZZC 3ZUNC 4IKNA 4YPGB 2N59A 3GXNA 2VDLB 4F3FB 5MP6H 2NXZC 2R2BA 3H7LA 3VWKC 3MA7A 3OAYK 2UZXB 4KO9A 5IQOA 5IJKA 3DYPA 2X4OA 3JYBA 3DURA 3FTVA 2IGFL 1GGIL 5E4EB 5KJ7E 5AAWA 4MJIE 5IQMA 2X70A 2OQJA 5ICYB 4TSBH 1EXUA 2A9CA 4PRNB 3RIFF 3H42H 5FUCC 3NRPA 4XPTH 5IV2B 5GS1A 3BWUC 3KPLB 4UZUA 2DB8A 4OLEA 2X42A 2Y36H 3QDGB 4XMKH 4EI5B 2HMIC 5H37A 4UILH 3HPJA 5ABZA 3B37A 1DQJB 2NT1A 2J4WL 4WNQB 2HXAA 2LFEA 3FFCA 2XQ0A 1FZMB 1UB6A 3CC5B 5LNGA 1OTSD 4IBLT 4DGUA 4HOXA 4NNYB 3JYCA 5EUOB 5ESAA 4MS8C 2K3HA 4PJAB 4X9GA 2F2HA 2LVEA 3OXRA 4HCGA 1CDYA 3NJGA 3ESVF 1DJXA 3IKKA 3V4VA 1A4KB 5CO1A 5F6IC 4GQ9L 4S1DC 4ELKA 1KLUA 4OGYL 4AYEC 4KNQA 2C9UA 3GFUA 4IK7A 3HZVA 1S7RB 3HRPA 3VQMA 1NCCH 4PCTA 1WHOA 4JHUA 4TUOA 3SDCA 5J6GA 4B50A 4OLZL 2BOCB 5KANG 4DH2A 3ZDXF 4MB4A 1KJ2L 3HRZC 1U2YA 3NJXA 1RHHB 5EZJB 2V5RA 4NS0A 1ZLEA 4IGBB 3VH8B 4L8BB 4HKBA 5L4JA 2J88H 2J6EL 1WWWX 4QT5A 3R8QA 2ZX6A 4IOSD 4XMTA 2Z7WA 2P5WE 1W2KT 5IB1A 3MRQA 3U0PA 3EH1A 3SPCA 3NFSL 3W56A 5DZNA 3LKQB 3L4ZA 1UWXK 5F7AA 5CSZA 4XI5D 1WH0A 4PLJC 4JB9L 1JZGA 3IDGA 2F53E 1KC5H 3Q2WA 5E8PB 3G08A 4OAWB 2W38A 4JKKA 4I3SH 5EZOH 2HB0A 5EZPA 2QHRL 2AQSA 3ZE2F 2Y7OA 5DHVA 4B27A 5KSBB 1MWAH 2Y22A 3TC9A 3RWCB 2WYZA 5HHXH 3P3TA 3JTTA 1KBBA 2GSIA 3A5VA 2G3ZA 4YHLH 5LXGL 3U4BL 1HSAA 4KROC 3WNKA 4V2CB 1ACZA 3OPZH 3MLUH 1QO3A 4PG2A 5KVDL 1RZ7H 3GM0A 4QAMB 4H8WH 3ULAB 5I75C 5KG9A 2YMOA 3QEQD 4ESKA 4XX1E 1NDMA 2P9RA 1OAXH 4UIKH 1A6WH 1TZIA 5KWYC 1TLKA 2C8NA 5EOCH 4ZMPA 4A7SA 4Q6IB 5FX3A 3WLBA 4JG0H 1FPTL 2W9LA 1X6NA 1VKXA 4E68A 1YEIH 1HSBA 2E4TA 2Z8RA 4WHYH 2WWKO 4AGMA 1OP5H 3QJHA 3MV11 4KRLB 4NP4L 4U1SA 2NY3D 1S8DA 3QRFM 2NY4C 5IVOA 4RISH 3UTOA 2E56A 1DP0A 4JR9L 4AY0A 3PWNA 2XBDA 2PTTB 4FXGB 4YMPA 1U33A 1KT2B 3ATDA 1WHPA 4NFBA 3NAAL 4GRMA 3A6OA 5C09D 3B5TA 3FK3A 1I8IB 4OV5B 3FBKA 4NQDD 3W5MA 2WD0A 1QBMH 3GLEA 2VDPL 2QSCH 1QLRB 3CFCH 2A5UA 1BZDA 1L6XA 4NZUH 4UTCA 3V0WL 3WEMA 4NERA 5DI8A 5DC0A 4MAYB 3ULVD 4M6ML 3QP3A 3LIZH 3VMOA 1HH9A 1UB5B 2XVBA 1NCBH 5KS9B 3EOTL 3EH3B 4IHBA 3IE4A 2OFQA 1E3XA 1CURA 1LD9A 2OR8A 3DX0A 4I13B 2YBRB 1JNHA 2ZKWA 3GBMH 3O3BB 1YY9C 3ZQWA 1MLCA 4KPHL 1XCQB 2EABA 2JELH 3ALWA 4CJ1A 5F21B 3GWJA 1A7RL 4NQCA 3NZSA 3X1GA 1CL7L 1DVFC 2JJUA 1S78C 3T5WA 4K8RL 3SGEI 3ZT5A 1GAFH 4UOJA 4LRNL 3SSGA 3VFUA 4I48A 2ZSVA 1UWEH 1KGYE 2L7EA 4NDMA 1JGUL 2X2UA 4B9KC 5IHZA 4OFYA 2BNQD 5DDHA 4ZYKA 4RGND 5EO9B 3CX2A 5T3ZE 3AACA 1BLNA 4MNGB 1HCFX 3EBHA 5IUCA 1BZEA 2HLFD 3KJ4B 4P2OC 1XR8B 4LSVH 2WWOA 1QEXA 4PI0A 4JO1L 2FLRT 1CO1A 5BV7H 1PEZA 1D5ZA 4GSDH 5DK0B 2WLIA 3GXUB 2Y7SA 4NO3B 2KPNA 1JI2A 2OX5B 1MFMA 3KYAA 2WTOA 4L5FH 2KERA 2FIKA 3I84A 1ZDSA 5EBLA 5KZCD 2EYSA 2GIYA 3AG3B 1IGCH 3IT8D 2FATL 5CAYB 1BMZA 2W9DL 4KKBC 2FEEL 2FBRA 2QKIB 4I88A 4U1KB 5IT2L 1M1SA 2R2CA 3QUYD 1Q9OA 1BXUA 3NRFA 1I1YA 4IEFB 4K5MA 4R2GC 4OZIE 3DPBB 5AOIA 1IE4A 2PW2B 1YQVL 4P9MH 5AYQA 1G4RA 1U93A 3KYKL 5KJRH 3PNWB 4B9IA 1A21A 3QXUA 2ZT9C 3B7TA 2HYMA 3DI3B 1OM3H 1JYXA 3WO3B 4D2NA 4HIJA 4YIQB 4R7XA 4KJYA 3UZVA 3KM2A 4NAQA 5F9WC 5EORH 3CU1A 5D1QA 2A9ML 2E7BA 1JPFA 3MBWA 4J3XA 3VGBA 1E5ZA 3WYRA 4B9JA 1ZA6A 2GBTA 5AG9A 3AM8A 2VE6A 4P3CL 2IPKB 1OTUD 3MXWH 4PJ9B 4EZLA 3W2DL 1MELA 5AKSA 1BVLB 3NEXA 2C1OB 4I9WD 5E1GA 3TH3T 4AV4A 2DLHA 2NQDA 3KPMA 3UPAA 4JG1L 2CO6A 1WA1X 3IDYB 4YSTA 2E75C 1FGVH 1FYHB 4HEPA 4N0UE 3VFPA 5J0BA 1DVXA 1G7PB 3AWEA 1QR1B 4XBEH 2B5IC 1SN5A 4Z3FA 4WKZB 1P9MA 1SBBA 1AE6L 1TCMA 1TZHB 2E8YA 3LN9A 5IROA 4PRID 1YEWA 4ERSH 1CBVH 3BP5A 3AG2B 4WFGE 5I16B 2V9RA 2AJVL 4CILA 2ZYRA 2X88A 3EHBB 1XO8A 4XHQA 4ENEC 3UJIL 5LLIC 2K8MA 4GH7B 4CDHA 1U8NA 4LSRL 3VTTA 1UURA 2GJ6D 4J1UA 5HGAA 4BZ1A 3OMZA 4ZW6A 4APQC 1JTTA 3BESR 3H3BC 1J8KA 1C7TA 4PRBB 3D3VB 1U8CB 5GGTA 5E2WL 2CR0A 3KEDA 3ZTJH 2P8LA 2P80D 1KFAL 1KB5B 4GIPD 3VXQA 3BH9A 3FH8A 5JDJA 5A6MA 5D1ZD 3RP1A 1FE8L 2WBJD 3T2NL 1BDYA 2JE8A 3MREA 4OFQA 2V3DA 5HVGB 2HFFA 1BD2B 3T71A 1PDKB 4MQXD 2BCMA 2E86A 4J3UA 1MCIA 2R2HB 3ATEA 2MCG1 3PGCB 1CWVA 5AAPA 2HAZA 4HPOL 4EEEA 3HE7B 1AKJA 4GAYA 4ADIA 1F1AA 2GITB 3KL0A 1BFOB 2AK4B 1JZ4A 2OMXB 4EI0A 3GEWB 3DX7B 1AHWC 4OSUH 5CKGA 3BT2L 5C0AA 4IHOB 1M56B 2QZQA 4BFIB 1HYRC 3Q5YA 4K9EL 3GMNB 4QOKD 2EKJA 3DJZA 4O58H 4YFLI 5FR3A 1T7YA 5DK2B 4OJFH 1N12A 1MG2C 3QJRB 1I1AC 2DLGA 4DK6A 1FJ1B 4P04A 4OZGE 3HS0C 4LFHD 5K9QG 3SBWA 4QHUB 1GHFH 2B4CC 4Y19D 5FV2A 3TFKC