1NCWH

Cationic cyclization antibody 4c6 in complex with benzoic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
RVQLQQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN IGG2A
publication title Structural Basis for Antibody Catalysis of a Cationic Cyclization Reaction
pubmed doi rcsb
total genus 45
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncwH01
4ZFFA 3PGFL 3IJHB 1F5WA 2A1WL 5D7SH 4RGND 5GS1B 5DJ6A 4D0DB 4UINH 3H6JA 4G8EA 1T04B 1MHPH 2GFBA 1K4CA 3ILPB 3GIZL 1HNGA 4LLUA 2J8UF 3VXTA 5C08B 4XCYB 1LWRA 4JFPB 1I7UB 2I5YH 2Y6SC 3DTXA 3SKOA 1PX4A 4LQFH 3GSNA 3HG1A 1INEL 3QQ3A 4RAUA 1IEHA 3EYVB 4MNGA 4F80A 3JV5A 4MA7H 3OXRA 3B5TA 5ID0A 3P0GB 3ULSB 1I3GH 2J88H 2AXFA 4U6YA 1NBZA 4OD1L 4DZBB 1OSPL 4H0IA 3CLFL 4UMGA 2UZYB 5DJ6B 5E9DA 3FJTA 2ICCA 1J8HA 3QPXL 4G8EB 3HC4L 2GFBB 1K4CB 2YA0A 3CUPA 4NCDA 4X7CC 4JGJA 2XXCB 3GSWA 3R1GL 4LLUB 3VXTB 1GGTA 2EE3A 3BN9C 1F45A 4KZEH 4X9HA 1OLZA 1T7VA 1I8IB 3QNXA 3P11H 5A16A 2DIBA 4DTGH 4MDIA 3GSNB 3SKJH 3HG1B 2JJSA 3QQ3B 4MNGB 4FN0A 5ID0B 3VXNA 1JHKL 2HRPL 4LSVL 1N0XH 1OAQL 5GJSH 5SWSD 1NCAH 1FAIH 2DQGH 2AXFB 3VD3A 1NBZB 5MP6L 2XKNA 5GGTH 1RJCA 4KROD 2ZUUA 1QBAA 4HIJA 4JDZA 5E9DB 1A21A 3LRSA 3VG9C 3LHPH 4A2LA 5D5MA 4JRYA 2A6IA 3CUPB 3D48R 4N68A 3ZLQC 3GSWB 5CWSA 5J3HC 3B8YA 4Q9CA 3MRPA 2BVTA 4KU1A 4O58H 2ED8A 1EJOH 3QNXB 1DP0A 2D0FA 5A16B 3WFEL 1KG0A 3JV0A 4MDIB 3VGDA 2BJMH 1GGYA 4XX1E 3VRLF 2DQUH 3OR6B 4OZGE 3TM6A 4J4PA 4YHLH 4QRTA 5C0NC 4LSDA 5HI4D 2FJHB 2XKNB 3LKSA 3RVTC 4HIJB 4JDZB 1FGNH 1XIWA 1RI8A 3LRSB 2Q86B 1MFCH 1JZ2A 3S37L 5D5MB 3PF2A 3VFRA 1KJMA 3DIFA 2A6IB 4JRYB 4KZDH 2O5YH 3HKFA 5CWSB 4FFVD 4IDJL 4D9RD 3MRPB 1KC5H 5J1TC 3H9SA 1UB5B 4JZJC 5C08E 3INUH 1KG0B 3QI9C 4XP6H 1AI1L 1EVTC 2R0ZL 4C56D 5CEXA 3GIVB 1VFUA 1P7QB 2OTWA 2X40A 4HCRA 1D5XA 2RQ8A 2YR3A 2OMNA 3T3MF 4PRIA 1UH3A 1E4WH 5DYOB 3LN9A 1G6RH 3LKSB 3NOIA 2COQA 4KMTL 1PG7L 3UPRB 5DWUH 4HUMB 4O00A 3MOBH 3VFRB 1OGAD 3DIFB 4WI8A 3B9AA 4HH9A 3VFNA 3F58L 1Y18A 5IBUG 4PY8I 4RDQG 2WBJA 3DOSA 3H9SB 3GMQA 2WLZA 3ULVE 4M8QA 5CEXB 1GGCL 1LE5A 1MCNA 1U8LA 1YMHA 4MAUL 2GT9A 3ZL4H 3L5WA 3HG1E 1D5XB 5M94B 4MNGE 4PRIB 3TYFA 3S96A 4KPHH 3FO0L 2AS5M 3ARQA 1F6FB 5FGSA 3G6JF 1KT2A 2FSEA 4IRZL 5LXGL 4FXKB 1CFSA 1J8KA 5F1OB 1M7XA 4UT9H 3FN0H 1D9KC 5E9DE 4Q9QL 4OLWH 3VFNB 1UWEH 1J8HE 1L7TH 1Y18B 3NCFB 4UNVA 3DMMC 2WBJB 2DD8H 3LKPA 1EVUA 2WQ8A 3GMQB 3EOTL 4JEGB 4JFQA 1B6UA 2ARWA 4D3CH 5DD1L 5L88L 3MBEC 4M8QB 2QADB 1LE5B 4TSBH 1YMHB 2GT9B 3L5WB 3Q6FA 1U6AH 1K4DA 5JDSA 3S96B 5GRJL 4FXGA 2FSEB 1H5BA 5CEZE 3QBTB 4PB0H 1CFSB 2AK4D 2XZCH 1XCTB 2J5LC 2JJUA 2IG2H 2VN7A 5D5ME 5KBNC 2BCKA 1FG9C 4JRYE 1VFAA 4NZDA 3LKPB 3MODH 5TE7H 5DQDH 4JFQB 5EULV 5T5FH 3UTPE 1H9VA 1N2RA 4RMUA 2XKUA 1FAKT 4OLYL 3GK8H 1CVRA 1SBSH 4HPYL 2ADFL 4QEGA 1YEIL 2YN5A 3VRIB 4J3WA 3UBXA 2VXSH 3QQNA 1K4DB 1FNFA 5DRXA 5JDSB 3BJLA 4TRPL 4ODVH 4ONGH 4FXGB 5A3ID 3KYKL 1ZT4A 2G2RA 1H5BB 1FGVL 1E28A 4OLZL 2OZ4L 2QV2A 4PGJA 5TPWL 4FABL 2BCKB 3MUHL 4BQBA 4JFHE 4AJ0A 2R29H 1T0NA 3DX7A 3S88H 3H9SE 4RWHA 2JB6B 4ETQA 1JCKA 2QHLA 1HHIA 1BWMA 3MOAL 4LLWA 4PJDF 1B88A 1N26A 3O2DL 4FHBD 3UBXB 1K8DA 3G5XB 2NY3B 4OGXL 3L3IA 3MLRH 5GRZA 5DRXB 1YY9D 5JR1L 2YK1L 5T1LA 3C6SA 1MFBL 2WWKO 4DFIA 1CWVA 1ZT4B 2G2RB 4KTYA 4PRIE 5GJTL 1FFPB 2A0LC 3RWJA 3NIGF 1RQ5A 1E28B 1WT5C 4EDWH 1HZHL 1P9MA 3QHTC 2NR6C 4M62H 3RDTD 3QG6A 2HFGL 3AUVA 4FQ2L 1T0NB 3DX7B 3CU7A 1DFBH 1A7NH 1GGIL 5AZEH 3GMRA 4ETQB 5L8KB 4PGDA 3NAAH 1G0DA 1HHIB 1V7NH 4LLWB 3TO4A 1KLUA 4K3JH 1K8DB 2VQUA 1F8TL 4H20L 3L3IB 1EFXD 3HZKA 2NZIA 5T1LB 3C6SB 3RWJB 3K2MC 3PJSB 4G7VL 2FJFA 4ERSH 1T6WA 1FRGH 1XMWA 1H3UA 5C0BA 3OJDA 1OP3H 2CQVA 4H88H 3RL1A 5MENA 1QO3A 3W5MA 3BKML 2DQCL 4PGDB 1QYGL 4BSWA 4F7TA 2E9BA 1EH9A 1IQWL 4TTGA 3QCUL 4LDEB 3TO4B 1KLUB 4LNVA 3S4SG 4MAYC 3HZKB 2HT2D 5KVDL 4XMLH 3C8DA 3WIFA 4MS8D 1IC5L 2IBBA 3OAYH 2FJFB 2R0WH 2OR7A 2IEPA 5C08D 4YHOL 3SQBA 4S0SD 3QUYC 1JMZA 5I71B 3MLPA 3RL1B 5MENB 1QO3B 4UT7L 1BFOA 2R0KH 4XCCL 1MFDH 4BSWB 3RZCA 4F7TB 3U7YL 1DVFB 5HGBB 4JO1H 2ZJSH 3TO2A 1DQDL 2CLRA 2VTFA 4JAMA 2Z92A 3WIFB 1B4JL 3QIUA 4JFFB 4ISVA 4NO3A 4CW1A 1UG9A 5E2VH 5F6IC 4EIGB 4OSUH 3P4OA 5KS9A 1M1SA 2DBLH 4PLKD 3ULVD 4LSRH 1MJ8H 2XACC 1REIA 1U8HB 1MCKA 5B8CC 1BFOB 5ECJE 3RZCB 3HG1D 3ZO0A 3QXDA 5FM4A 2Y1VA 3BPLC 1KEMH 1I3VA 5BO1L 4JDTL 1MPAH 3TO2B 2CLRB 1GHFL 4JAMB 4S1QL 1UWGH 3HHRB 5E9DD 1IRAY 2FJGA 3IU4L 4ISVB 4NKIH 4NO3B 1NLBL 4OLVH 3AS3A 4X80H 3P4OB 5KS9B 2IMNA 3G6JA 1E6JL 3UPAA 1B0GB 3VCLB 1ROWA 5IEHA 4HT1H 3RKDD 5D6DC 4R3SA 4UQ2A 1V3LA 3QXDB 3O4LA 2GHWB 5FM8A 2PXYC 1RHHA 1Z9MA 5CEZD 3RI5F 5ADOL 3OPZL 1C08B 5CJXC 4F37F 4GMTH 4N5EC 3CDCA 2FJGB 5IB4A 4JRYD 1BQLH 5ACMA 1JZ3A 3UTPD 2F8XC 3QEGH 4JO2H 1Z9OA 5I8CA 3V8CA 3OKOA 1J0YA 5IEHB 1MH5A 1DBKH 1FORH 2HLFD 1YEHL 4R3SB 3QIWA 2FHFA 4J4PD 3O4LB 5MENE 4IEFB 1P7QD 4JFZH 4QRQA 2Y9RT 1RHHB 1FL3A 5EU4A 4HXAH 4NKMA 3X3GH 4QTIH 2ZUVA 3GNMH 3VG0H 4DEPB 4J8RA 1BZ7A 4JFHD 4WI4A 2EDHA 1I1AA 2FX8H 4TNWK 4ZXBC 4G8IA 4F7MB 1GIGH 2FBJH 3H9SD 3DX8A 3RQ3A 3ZHLA 5I8CB 4PP1C 1TJIH 1RUAH 3OKOB 1ZGLA 5GRWA 1MH5B 5L8JB 3KJ4C 3LKRB 4P59L 4LSUH 3QIWB 1P4BL 2XZQH 1JNHA 1ULVA 4QRQB 3BX7C 2R56L 1DDHA 4PRID 1FL3B 5EU4B 3UAJC 1FZMA 4NKMB 1NGPH 4QHNA 3RA7L 5J7CC 3SO3B 3F62A 5GXBB 3UO1L 2QHRL 1BZ7B 2NYYD 4KDTC 3EZ8A 5KW9H 1I1AB 4R26H 3OV6A 5E8DH 4G8IB 3DPBA 2WBJD 1KIPA 1KF9B 2ZG1A 3VFPB 3G5YA 1I1CA 4JRXA 5KS9E 3L5IA 3CLEL 1IM9A 1CD8A 4OCLC 3I6LD 5KJRL 2OJZL 2QADD 2VZTA 3KLHD 1JNHB 2FEDC 4YDLC 1U3YA 3AB0C 5ICZB 1LK2B 3S7GA 2K7PA 4PLJC 3T0AA 5BVJA 1FZMB 1TTGA 1NGWA 1KEGH 4UDTA 1F3DH 4QHNB 4IOIB 1EUTA 3LEVH 3NH7L 3MRJA 5D71L 3KNBB 1PLGL 5ADPH 2H32H 4UTBH 1LDPL 2CRZA 1KIPB 3WXWL 3ZYJA 1JNLL 1IM9B 4LAQL 5BV7B 1UZ8A 3C5ZA 4I48A 3MYJA 4JPWL 1KCUL 3SKMA 3MUZ1 1A3RH 4X5WA 1EO8L 5DUPH 4N1EA 1N3NA 2DRUA 2Y07L 3MBXH 3O4LE 1Q9KA 5CUSH 1HWGB 1NGWB 4X9FA 4XTRD 4HC1H 5IBTH 4UDTB 3GI9L 4NGHH 3QO1A 4DUVA 5DC4B 3L3GB 3QH3B 3TV3H 3UPCA 2VZUA 4KXZI 2PTVA 4KK9D 4JB9H 1YA5A 4CVXA 4R97B 1CE6A 3DARA 4ELKA 4MZ3A 3H3KA 3OR7A 3P30L 3D87B 1BECA 5GISL 1FFNA 2VERN 3C5ZB 5JHLH 4I48B 3MYJB 1UZ6F 4GXVL 4NZUL 1ZV5A 3UC0H 3SKMB 5IKCA 4X5WB 3HNVL 2BRQA 2YMXH 4IJ3C 2NY3D 1TITA 35C8H 3UJIL 1B6DA 3QJHA 1N3NB 2V7HA 1Q9KB 1XZ0A 5IW1A 1CGSH 3PV6A 1EAJA 2X9XA 3QO1B 3BRGC 4MB3A 3HCVB 1JBJA 1KELH 2R2BB 3HS0B 5CP3A 1OPGL 4B7IA 4CVXB 4OZFH 1CE6B 1G6RB 4Y2DC 1V8HA 4ELKB 3HE6B 3BSZH 5CINH 1OT1A 3OR7B 4EI6A 4YXHH 2DLHA 4YEFA 3AROA 1F4AA 1JI2A 4YGAB 5IKCB 4XB7A 2X4PB 1H3GA 2H8PA 3QJHB 2V7HB 3FMGH 5GZND 1XZ0B 1YECL 4P2CG 4QCIA 5T1LD 5IW1B 3PV6B 1MCHA 1OAYH 4D94A 4KKAD 3HRPA 3CU1A 1JUFB 1WCBA 1D5ZA 4X6DF 1YEGH 4YHKH 1CL7I 2Y5TA 1R3LB 2H2PC 2X4RA 1TZHA 4HS3A 2DLIA 4EI6B 1UM6H 3WD5H 2NY0D 4JRXE 4PUBL 3HMXH 1UC6A 5HHPA 5E03A 3TO4D 3WIIH 2ATKA 2H8PB 1S7RA 5DD3L 3NPZB 3T2NH 3WNNA 2C5DC 1SJEA 4QCIB 1N6VA 4FTVB 1UJ3C 1QVOA 1X5XA 4HUWA 4NOBA 5IGXL 1UT9A 1WCBB 3RNKA 2E27H 1D5ZB 1D5IL 1KGCE 1MHEA 4TUOA 1MAJA 3K1KC 1RHFA 4ZFZA 1V7ML 2VDLH 3RPKA 4MA8L 2X4RB 4LNRA 5DRWA 4POZC 1TZHB 4HS3B 5MEND 4WRLA 3ULUF 3OKEA 5FHBL 1DVFD 5HGHA 5F9OH 5HHPB 1E4XI 3ZE1E 3ZTJH 5C0IA 2Q8AH 5I30L 1A5FH 1SJEB 1L6XA 1IAMA 3MFFA 3MLZH 4HLZG 4JFFD 3ZE2E 1QVOB 4HUWB 2FZ3A 3LRGA 3TLRA 3RNKB 4GKZA 3FZUD 1MHEB 3ARBC 1CR9H 4TUOB 1QBML 2XRAL 1ORSA 2VISA 5DC0A 4ZFZB 3MJ9H 3GSUA 5DRWB 2A77L 2CH8A 3H9ZA 3RZCD 3OKEB 4QGYA 1EMTL 4L1DA 4AEHH 5HGHB 1TVHA 3MZGB 1J18A 1CDIA 1CE1L 2IF7A 3TIEB 5C0IB 5HHXL 5ITBH 4B5EA 3D18A 3DX9A 5DJ2B 5F1NB 2D7TL 3MFFB 3S35L 4QXGH 4NQCA 1KJ2A 3BOVA 4F9LA 1IGCL 2FZ3B 3HUJF 4PV8B 4Z18A 5TQ2H 4NQEA 2NY2B 4GKZB 3WLWC 1G9NL 5CKGA 1CGTA 1ORSB 3KS0J 1DQMH 3A67H 4XPHH 2I26N 2AJXH 4E41A 4M7JL 5C0JB 3QQ4A 1WFTA 1F4XL 1CD9B 1DCLA 1IAKB 1T7YA 1TVHB 3DJ9A 4F58L 2C26A 4FFYH 2ZCLH 3PHSA 3ZHKA 3AGVA 3NVQA 3ZSTA 5KANI 2Q7YB 4X6EA 4OZHF 1EPFA 5JUEL 3NZHH 3N85H 4KDWA 5F8QC 1CD1A 1KJ2B 1FDLH 1I8LC 4HUUB 2ZOKA 4LARL 4NQEB 3OB0H 4ZUWB 3EBAA 3UEZA 4HWUA 1UWXH 3MLYH 3GMMA 3BP4A 5JPNA 5I66A 4E41B 1EHLH 4OFIA 1QSVA 4YFDB 3QQ4B 4YDKL 1JWUA 3O4LD 3NABH 3FO1A 1YMMA 4OAWA 3WFDL 1BQUA 2APBA 3BGFB 3PQYA 4HPOL 4L8CB 5HGAA 4X6EB 1CL7H 3LH2H 1SJVA 4OJFL 1TCMA 3QXAA 1CD1B 1I4FA 1PYWA 1Z3GH 4PPTA 4TVPE 1JGLL 3IDXH 5CZXD 2ZOKB 3T8XA 5IHBA 2WAHA 3EAKA 5GZOD 4NKDB 4LVHC 3ARYA 3GMMB 2E6PA 3QUXA 3BP4B 5JPNB 1N7ML 2HTLC 3LEYH 1W0VB 3QIWD 4M1GL 1JWUB 1ZLUH 5AG9A 3FO1B 1YMMB 4OAWB 3RY5A 2XA8H 3PQYB 5HGAB 4FNLH 2OP4H 2UZIL 5D4QA 1A47A 1OVZA 1IGIL 3KJ6L 4X9GA 1I4FB 1A1OA 1PYWB 2C7UB 3MOQA 3GHBH 4JRWA 3T8XB 3LDBC 1I1AD 1JGUH 5IWLC 1E4XH 1OLLA 2YC1A 3R8QA 4ZTOL 4DGIH 3CCHA 1RD6A 5INCA 4G3YL 1BEYH 1BAFL 4MQTB 3HFMH 1R5WA 2LTQC 4OT1L 5DEFA 4HK0B 1TVDA 3RWFB 1KB9J 2CJUH 3BDBA 3ZHDA 1ZVSA 4Z7WF 5C07A 3TNMA 4DQOL 1F6AA 1QQDB 5EU7C 25C8H 1IAIM 1OW0A 1BOYA 3O2WL 3OKMA 4FP8L 4HGMA 4LCIH 4NWUL 4RFOL 4NQCE 5DFWH 1MIEH 1PG7W 2YC1B 2BY2A 1S7TA 3LVEA 1CU4L 1MCDA 2R1YA 3CCHB 3HC0A 5INCB 4NQEE 4XXCC 1IM9D 5FYLL 2CK2A 2G5BA 5ESQA 4I3SL 5DEFB 4AYFA 3GI8H 3DXAB 4E41E 2K3TA 5EC1A 3DI3B 5CCKH 2BZDA 1ZVSB 5DDHA 5C07B 3TNMB 4BSJA 1RZJL 2VDMH 1HOCA 1F6AB 1G9MH 2YOCA 1OD9A 5TF1L 4BA8A 1KGCD 1K2DA 2VUOA 2YUVA 5T1DH 3F7VA 3U46A 3VXSA 5E5RB 4Y89A 1TNMA 4CAGA 2R1YB 3FQTA 2CR3A 3HC0B 3MREA 4OUUA 3D9AH 1JK8B 1QRNB 2OM5A 3IXTB 1C16A 4I13B 3C5ZD 1DBAH 2G5BB 5ESQB 5BOZG 4X99A 5KSAC 5FUZL 4NWTL 2DQHH 4X5XA 3MX0A 4CKVX 5EC1B 2WW8A 1R0AH 4HZAA 2IH1A 1T1ZA 1VFMA 1RVFH 3WFZA 5HSFA 2NTFA 5DDHB 1JRHL 5IVXF 1YMME 1HOCB 1BP3B 5JW3H 2E8ZA 3PQYE 2FX7H 3IT8D 2ITCA 1K2DB 4U0RB 4G80A 3GSNL 5GS0D 3F7VB 3U46B 3CFDB 5BRZA 2ADGA 1RURH 2NW2A 3MREB 1A22B 1Q9WA 1MCCA 3AAZB 3EDKA 4HKJA 1R3KA 3HE6D 3RWDA 1ITCA 4PJAA 1VKXA 1C16B 3O8XC 4X5XB 2O61A 1UYWH 3ZT7A 1DZBA 2IH1B 3CXDH 1T1ZB 1VSCA 4YE4H 2NTFB 5B3JE 2DAVA 2W0FB 1SYVA 4CADA 2ITCB 1IJ9A 4X6FA 1KPRA 4OM0H 4LSSL 3RGVA 1G1YA 1U3ZA 2ADGB 1Z5LA 2QQKL 2ZCHL 4UI2A 4YZFE 5BRZB 4LIQE 2NW2B 4KQ3H 1Q9WB 3BT2H 4NHCL 4HKJB 4QY8A 1R3KB 3O6FC 3RWDB 4KJQD 1RULL 5CEZL 3L5XL 1XF5A 2AJYH 4PJAB 3BPOC 3T3PF 1HXMA 5KTEL 3DHJA 5E24E 4K94L 3LMJH 3A0OA 1N0LA 4UB0H 1CQYA 1RFDL 5IM7A 3EYSH 1V3JA 4FTVD 1L6ZA 5E2UH 1KBGL 4CVZB 5C07E 4CADB 5I1LA 4ESKA 3MCKA 4X6FB 1KPRB 1MREL 4M4RA 4OZHA 4PBVC 4W4OA 1CXEA 4JM2A 1NMBH 4QY8B 2BOBA 2VL5A 4FMKA 5KZCB 1XF5B 3I9GH 5ESAB 1P6AB 1HXMB 5K9KA 1J1PL 1HSBA 2IAMA 3HZVB 2H32B 5I1JL 3DV4A 5T3XE 4UT6H 2XG4A 4MJ6A 4UILH 4TVPD 2AJVH 3TBSB 2CDGA 4Y5XC 5I8KL 5FV1L 2DBJA 1CLOL 3H0TA 3NCCB 5I1LB 1S9XA 3MCKB 2Y23A 2A38A 4BJLA 5B38G 4PREB 4OCWH 1KCLA 4HQQL 2A83A 3JUZA 1EERB 4JM2B 5DJZA 5IROA 3QXVA 4HCRL 3KPPA 3QUKA 5TQ0L 2BOBB 4HDIB 1OWRM 2PW1A 2FO1A 3FOMA 4DKAA 1AGDA 2EXWD 3T65A 1OCWH 1HSBB 1PVHA 2IAMB 5I1HH 1U0QA 3WKMH 3DV4B 1DQLH 1YEEH 1CF8H 4FRWA 3HI6L 5EIIA 1T5WA 4HBCH 3ARFC 2X6MA 4MJ6B 5I1KH 4ZD3L 1YC7A 2CDGB 3H0TB 1VFOA 3GJEA 3QRGL 3QIBA 3S3JA 2NY2D 1J7VR 3H42H 3SDXA 5H37G 2L0DA 2A83B 5DJZB 3W0WA 5BRZE 3BKYL 2PW1B 3MSPA 3Q2CA 2YHGA 4KHTL 3T65B 1JPTL 4PJAE 1AXIB 2EH8H 4AEIH 3P4MA 4EZMA 1HCVA 3GBML 3TVMA 5IOPA 3QDJA 2Y06H 1YJDC 2J3SA 1EAPA 1KACB 1A3LH 3CSPA 4P9HH 4I0KA 3GJEB 3QIBB 4NQED 3SDXB 4XP1L 4R4BA 3NBNA 5KSBF 4ZG1A 3SGKC 3W0WB 4Z7QF 2IBGA 1IMHC 2KUTA 4CJ0A 4E41D 1U9KA 3IAPA 5J6HA 5TE6L 4ZAKB 3OAZK 3DETC 3CVHA 4HULB 1RIUH 4FFZL 2PW2A 1YQVL 4Z5RA 5TF0A 3P4MB 3GSQA 1HYRC 2R2CA 4AEEA 5EWIL 3TVMB 3WFHA 2CGRH 4N0RA 5IOPB 3QDJB 4OGAC 2BSSB 4S1SL 1IKFH 4I3RH 2APVA 5D93C 3I2CH 5DJCB 1INQA 5L9DL 5HVHB 4R4BB 5F1IA 2O5XH 5FK9A 1HQ4B 5DHXB 3GKWL 3GRWH 3SDCA 4LASL 5J6HB 4EQ3A 2YD6A 3OGCA 5JQ6H 2PW2B 5L2KB 4Z5RB 4K7FA 1IFHH 1YMMD 4NO5A 4X6CA 3PQYD 1MCPL 3VGEA 1EHNA 2CMRL 3QZWG 1MCIA 4JQVC 2D03L 4JPVL 1DJSA 1BM3H 1YEDA 1INQB 2DQJH 2YD4A 4KRMB 4KKBD 1RU9H 4NP4H 1MQ8A 5FK9B 4NUJA 1F02I 2V9TA 3SDCB 1FHGA 3FRUA 1V3KA 4FA8A 2X7LB 3OSKA 2BP3A 32C2A 5DVNA 4K7FB 4MZ2A 4OI8A 1JF1A 4NO5B 4KJPD 1TETH 3IDNA 3M45A 4PJ9A 4X6CB 1JVKA 1RZKL 3ARWA 3MGOA 3GMOA 5CJ8A 2W59A 2X1PA 4GAYA 2NZ9D 3GDBA 4N8VG 4RX4D 1F3JA 1OF2A 1C12B 4XVUC 1YEDB 3B9VA 5I1CH 2UUDH 1MRDH 4BQ6A 1HHHA 3C2AH 2BDNL 4NUJB 4HAFA 3T0VA 2QSQA 2B39A 15C8L 4XP4L 3SDXE 5H35A 4J3SA 3FRUB 1MRFH 3LPWA 4J12A 3W0WE 4HMEA 3DVFA 1MIML 32C2B 3DXAD 1J9CT 2DQDL 4R8WL 1JF1B 1U8OA 1NC2A 2VXUL 4PJ9B 3RFZC 4QXUL 4X7SL 2D9QB 1OM3L 3MRQA 5C07D 3MGOB 5KOMC 3GMOB 4GAYB 2DMCA 1GXEA 3QDJE 1F3JB 4ZTPH 1OF2B 4FQJH 1FZJA 1P53A 5CIPA 4XX1G 3FQWA 4KI5E 4TSAH 2HKHL 1WEJH 3Q5TA 4N0CC 2J7LA 5TE4L 1QRND 4LMQE 5D7JA 5H35B 1C5DA 1MCWW 4Y5VC 4U6VL 4UUJA 1OAKL 4HKBA 5T3XD 4MXWH 1NC2B 2OQJA 3C60C 4J3TA 5IMKB 4ONOA 3MRQB 5EZIL 1SEQH 3BQUA 4LCWA 3HR5A 2BFVL 2VH5L 3T2QA 5EH1A 2NY1B 2ZUXA 4N9OB 4M1DH 5I74B 5JO5A 4K94C 1CGVA 3FQWB 3PL6A 3W9EA 3R4DA 1MOEA 1LEIA 1C5DB 5ALCH 4UUJB 3RVVD 4ZFOL 1ZOXA 4HFWB 4HKBB 3GSXA 4WCYL 2VE6A 5E2WH 2PYEA 2OQJB 1N64H 2VYRE 4M7ZB 4WY7L 3BQUB 2WWMC 4LCWB 4OM1L 4X6CE 2Z4QA 2JCCF 2R8SL 3HR5B 3MFGB 4WO4C 1XIWC 4WTWA 5DMIH 5IBLC 1B9ZA 1K3ZA 2CUMA 3DGGA 3OAUH 5JO5B 5BRZD 4NKQB 4OCNC 4IS6B 3PL6B 3W9EB 1LEIB 4OI9A 5I6XB 5JW4R 5HBBA 1AJ7H 3GSXB 1JYWA 2VE6B 3REWA 3GIZH 4Y4KB 1ERNA 1H15A 2PYEB 5CHNA 1CS6A 3ARGB 4PJBF 1II4E 4PTTA 5HYSA 1DANT 2WUBH 4XBEL 2XTLA 3QCTL 3BEWB 2UWEA 4PJEA 1WLHA 4APQA 1HYSC 1INEH 2R69H 3DGGB 2X4QA 4R9HA 4YC2B 2ATPA 4E5XB 3DO7A 4OD1H 1OSPH 2I24N 3ABZA 5I75B 2WIIA 3PABA 5KZCD 2XWJB 1XH3A 5CD3A 3HC4H 4O9HH 3REWB 4DN3H 1RZFL 3KPNA 2IFFH 4PTTB 5HYSB 5BMFH 3QDMA 3VWJB 1FCCA 5BXFA 1E4KC 4XC1L 2YPLB 4XPBL 4LEXL 5KG9A 3Q1SL 5I1GL 5F7MC 4PJEB 2F74A 43CAA 4APQB 2VOTA 1JZ7A 1X5IA 1ZVYA 3GFUA 1OAQH 2ATPB 3O9WB 5JW4M 5J1SC 4GKNA 1FLRH 4JM2D 1IGTA 3DO7B 5H94B 2WIIB 3PABB 4ELMF 2DL2A 3S36L 5CD3B 2EC9T 5DSCA 4U6XA 1QFHA 4DN4L 4IRJA 2IAMD 3KPNB 5IF0B 4NQUA 3ARUA 4UV4L 4AIZB 5KG9B 3BIBX 4P5TA 2F74B 1NMCC 43CAB 4LCWE 3HMWH 2MPAL 2G75A 4EUPG 4XP5H 5E8NB 4GKNB 5IMLA 1X5AA 1IGTB 2BERA 5HHVL 2OMBA 4WW1A 1ZT7A 3BPCB 2K9UA 1S7XA 3T0DA 5LBSH 3TN0A 5DSCB 4U6XB 3E2HC 2DI7A 1J87A 1GAFL 3O0RH 1AR1C 4PY8J 2PYEE 5DGRA 4NZTL 4BZ2L 3QDHA 1OD7A 2W0KA 1IEAB 4P5TB 1I7TA 4OF0A 1AI1H 3X11A 1WZLA 2ZUQB 3QIBD 2R0ZH 2G75B 2EYSA 3B6SB 5DUML 5IMLB 1RPQA 3SE4A 3W0WD 1HHGB 1Z0NA 3AY4C 5KVFH 5C0DA 2DLEA 4KMTH 3F7PC 1E27A 4ZAKD 1ZT7B 3RP1A 5FYKE 1S9WA 1W72B 3TN0B 3CH1A 2EDQA 3MLSL 3F58H 4JQIH 3ZDZF 3M8OL 1IGFL 2EDEA 4CNIB 4KH2A 4M7LH 3TVMD 2BVUA 2AJUL 3W11C 4LRNL 5BS0A 3QDJD 4JREC 4NJ9L 4TVSa 3VFMA 5DHYB 2ID5A 4L4VB 4BFGA 3D25B 4XI5C 1I7TB 4Y5YA 3EJJX 5CS7A 4GRWB 4YHML 2BK8A 5EZJA 1U8JB 4PJEE 2UWEE 1BZQK 3NCYP 4FG6C 3FO0H 2XY1A 3I6KA 2P5EA 5C0DB 1SBBA 4Z95H 3KPQA 1E27B 1QACA 1BREA 2APWA 4TPRL 5J12B 3KXFB 3JTTA 3CH1B 5L2KD 4RGMC 1KTRL 3DYPA 3TCLA 3BD4A 1QLEL 3UTSA 2DTML 4EVNA 4RA3A 1KOAA 5E2TH 2OYPA 3TJEH 3QDME 4Y5YB 1D5BB 5EZJB 4JDVA 5E4IA 1KN4L 2JKXA 2P8LA 1UCBL 1DBML 3OZ9L 2B0SL 5GRJH 3SDCD 3I6KB 1MVUA 2P5EB 3KPQB 2AKRA 4NRXA 4M9OA 1RZ7H 3UBXG 3JTTB 2X42A 4LSTH 3EFDH 1GOHA 1U3HC 4ODUB 3PWJA 3TCLB 3PHOA 3UTSB 4M02A 3LB6C 3FONA 3X12A 4MD0A 1H3VA 1DSFL 2ADFH 1M6OB 43C9A 1G7PA 4JDVB 5GQBA 4YHNB 3VE0A 4F15C 4LHQB 2P8LB 4OCRH 3MCG1 2ZUWA 1LE9A 3QJFA 4TRPH 1MVUB 2G5RA 3ZKXC 2AKRB 3ELAT 1NEZA 1UA6H 4NRXB 1BQHA 2QSCL 1ZHLA 2OZ4H 4PJ9D 3PWJB 2JB5L 5EN2A 3PHOB 4DGVH 3L1OH 1ZLSL 1IC7L 1P4IL 1IAIH 3D69A 5D2LA 3MRDA 3O41A 3QIUC 5I1DB 3MOAH 3WS6C 2OL3L 3KWWA 43C9B 4TN9A 1LE9B 4GRWE 2A73A 3QJFB 4K8RH 4G6JH 3IJSA 1OAXL 4RIRA 2VIRA 3BN3B 3E3QC 3G5VA 3VG9B 2MMXA 3JSSA 1NEZB 1BQHB 3N9GL 4LSPL 4KDVA 4CBPA 1NC2D 1NFKA 1OOAA 4HJ0C 4QF1B 5EN2B 3HI5H 3QWRA 4JZJA 3U9UA 2VQ1A 4FQ2H 1ADQH 2WNGA 4Y7MA 4E42A 3D69B 3MLVH 5D2LB 3MRDB 1JGDB 4H25A 3O41B 3QI9A 2NY1D 3SE8L 4PG9A 4FQ1L 5BS0E 1LO0L 4W6XB 2VXTH 2D7NA 3F5WA 1C7SA 4H20H 2A73B 3IJSB 2HKFL 4RIRB 3EIFA 3WJJC 3G5VB 1MY7A 2YKLH 2P5EE 4FFWD 3U9PH 1UKQA 3BEVA 1NDGA 4UTAH 5E6IC 3BQUD 3RVXD 4LCWD 4JZJB 3U9UB 2VQ1B 5HDBF 4E42B 1FO0H 4Z7NE 1MQKL 3UTSE 5F7YC 3B83A 2LQRA 2VXQL 3BKMH 3QI9B 1QYGH 1Q0YL 4PG9B 2D31A 5LCVH 4HIEB 4E0RA 2CR6A 5I73C 1IQWH 4HLZH 1K8IA 3NIDE 4KK5C 4HGKC 4P4RA 3F5WB 4HEME 1JZ4A 3PL6D 3BXNA 1BMGA 2Q6WA 5DD5H 3MRNA 4HXBH 1H8OA 4LPYA 1ZANL 1LO4L 1KJ2L 3ZKNC 3WSQH 4Y4KD 3A6BL 1D9KA 1IGMH 2PYED 1FN4A 3BEVB 3ARGD 2EXYD 1NDGB 2J8OA 4EJ1C 1MEXL 4FXLA 1KCRH 3SQOH 3BAEH 3JUYA 4PLOB 3VI4E 1AE6L 2FNBA 3SE9L 2FH6A 1QP1A 3MBEA 2X10A 4E0RB 2FX9L 3QPQD 2AJ3B 1K8IB 4P4RB 2EDRA 5EO0B 4M7LT 1YNKL 5FYKD 2FWOA 4U05A 2Q6WB 1F58L 1NBVH 1IZJA 3MRNB 4R7DB 3BPNC 4NQDA 3MGAA 3E1F1 2VR4A 1D9KB 4P5MB 2D7QA 1JHTB 3OF6D 5IT2L 4RISL 4X6BA 4R6UA 5GS3A 1FNSL 1NAMH 4LLMA 2F5BL 4POUB 2ZZUT 3DMMB 3IDJA 4ENED 4Q9RL 3VFSB 3VWJD 3BDYH 2PF6A 1BF8A 2YPLD 1MNUL 4APQD 5F1KC 3MBEB 5I18L 1UVQA 5D2LE 3VXRB 3WNKA 3O9WD 1X5FA 3ARDC 4KKCC 2E7BA 2OXHA 4AZ8A 5D1QC 4L9LC 5E1HB 3G9AB 3DUHA 4K7PH 2FWOB 1CFNA 4DUXA 3T09A 2YD3A 4B7LA 3O6LL 2FGWL 4NQDB 3HAEG 1C1EH 3MLWL 4GKOA 2VN4A 4KVNH 4S10A 4WU5A 2N7BA 4HUKB 2FD6L 3G08A 5J06A 1CT8A 2CLVA 5MERA 2V9RA 5GSRA 3QHZL 3BW9B 3H2WA 3BMVA 1J0IA 2F53A 1CFNB 4XWOC 3KPRA 1QFWL 1ZSDA 5FECB 1A14H 5K59F 3O6MH 4K7PX 4WU7A 1NGYB 2BRRH 1JPSH 1WT5A 3JWDL 4NT6A 1OTSC 4WU5B 3VA6A 1L7IL 3WKNA 4WV1C 4DGYL 1TQBC 4HWEL 2H9GA 4P5TD 3G08B 1YEHH 3EJYD 3VA2C 5MERB 3RJQB 1WWWX 5LAXA 4OB5H 4XHJD 2F53B 3NPSC 4BZYA 3KPRB 1ZSDB 2FEEL 2AJZA 1DEDA 3TN0D 3E6FB 4GQ9L 4PJCA 4NT6B 1YEJL 4MCYA 1O7VA 1XGUA 3MLUL 5INDA 1MI5A 3GBLA 4KRPC 4U1IA 4B53A 4PJIF 4L4VD 3STLA 2H9GB 5HYJA 2NY4C 4WFFE 2AP2A 2P49B 2XTJC 4UBDC 4PGZA 1P4BH 5L6YL 2YRLA 3BIKA 1H3WM 3VXQA 3JV6A 5GPRA 2YPVL 5LAXB 1A1MA 3VXRE 4OBSA 2DM7A 4M48H 4MAYA 3U4BH 1OAZL 2AXGA 1AO7A 3F6IA 1A7BA 4GMSL 3BIAX 4MDJB 3KXFD 4QTHA 3Q5OA 4PJCB 4OF7A 1RIHH 3LS4H 2GTZB 4RZCA 4WFHE 4NQDE 4MCYB 1MF2L 5D96C 2M1KA 3QUYA 1XGUB 5EBMA 3TZVC 1MI5B 4MXVF 3TH4T 1RJYB 3STLB 1PGRB 5HYJB 2A6JA 2HVKA 2OJZH 2XIDA 3DVGA 5JOPE 3V5HA 4OFYA 1W8NA 1JPFA 2O5ZL 5CBEA 1B0RA 3VXQB 2OR9H 3JV6B 4HEPG 1NEUA 2W1NA 2XQBH 1A1MB 4TUKH 1HIMH 3GBNL 4MAYB 4BQ9A 2P5ED 5CZVH 4WWKC 3ET9F 3FN9A 1ZLVH 1CLYL 4QTHB 3NH7H 5D71H 4OTXH 4RZCB 1LDPH 4DVRL 3UTSD 2Z93A 2R4SL 5EBMB 3WXWH 1QHOA 2Y6SD 2VLLA 4PJGF 4NM4L 4R4ND 5B8CA 5HXMA 2HVKB 3DVGB 3V5HB 2CSPA 1JPFB 5CBEB 1B0RB 3NFSH 2OI9C 4M5ZH 4JHAL 1JGEA 4Z7UF 5FYJL 2VNCA 4NO0A 5ESVB 5EOCJ 4MXQC 1T21A 2F53E 5F6IB 2D3VA 3KPRE 4WGWB 2DKUA 3BN9D 5L0QC 2Z93B 4JFDA 3CFEA 3MPCA 3HB3C 4LRIC 3CX2A 4DW2L 3P30H 1QA9A 5B8CB 5F88A 4QRUA 4ODTL 4NZUH 4UZGA 3BPLB 3ZDYF 1OAUL 2VZOA 5EU5A 1C5CL 1JGEB 5AWNL 3NZ8A 1WC7A 5CJXA 4NO0B 3DX6A 4JKKA 4TQEH 1I9RL 1SEBA 1T21B 4DAGH 3VD5A 5M95B 5J3HD 2LABA 3HPJA 4DKFL 2W0PA 4JFDB 4PJCE 3CFEB 3ETBF 3KPSA 3IKCA 3BVNA 1I3RA 3BWAB 1QA9B 4XVSL 5IV2A 2YN3A 1MI5E 2GJZA 5C0EA 3VH8G 4OF5A 5BJTA 5HYJE 4GT7A 1P7HL 1JFQL 3QUML 3ZTNH 5DHVH 2FHBA 2PXYB 2NX5A 3OAZH 3K8MA 4ODHL 2XQYG 4OFDA 3RVTD 4OZ4A 1WC7B 1DLFL 3V0VA 3CFKA 5E8OA 5DT1H 4N8CH 1SEBB 1VACA 3KGRA 3OBAA 5GS2D 1INDL 4KROC 4ZXBA 1U91B 4GSDL 3L6FA 4H8WL 5FHAL 3KPSB 5F7DB 3IKCB 4Z0BL 3BVNB 1I3RB 3U2SA 1P4LA 3QI9D 5IV2B 4G6FB 5C0EB 2EDWA 1FV1A 5J0BA 1JPST 1N59A 3C09C 1NGQH 1OY3B 3WFBL 2NX5B 2I60L 4YDIH 3BESR 2IBZX 3V0VB 4OZ4B 2HTKC 1A6ZA 5E8OB 3ZMRA 8CGTA 1VACB 4FZEH 2VXVL 3QQ9C 4KDTA 4ZXBB 4E9LA 1DQJA 2BHYA 4HUXA 3L6FB 2A9NL 3OMZA 1J0HA 1V7MH 1CDGA 3LPFA 3U2SB 1FVDA 3KJ4B 4IMLA 1FV1B 2EECA 1P5UA 2PN5A 2PNDA 4PJ5A 5DK0A 1N59B 4JKMA 4LLAA 4YHZL 5CAYB 5IESL 4ZS6D 3JWOH 4K9EL 5I30H 4BFEA 4PIRF 1EBAA 3S5LA 5H37H 1B2WH 2CDFA 3V6BR 1D9KD 2X89D 1DQJB 1FZKA 3DMMD 1VGEH 4WFFD 4LLDB 3QEQB 2CRMA 4ZOAA 2XZAL 1FVDB 2A77H 2J4WH 1NUFA 4JFDE 1EMTH 3MBED 1J05A 3CK0H 1YNTA 3VXRD 3JWDC 3CVHL 5DK0B 4YDLB 1P69B 3PHQA 4PJIA 4HWNA 4BYHA 4LLVA 2NLJB 2E7MA 2WIMA 5FCUH 3S5LB 3SDYL 1A1NB 2FRGP 2VC2L 4WFHD 4NQDD 1IGCH 1CICC 1KJ3L 4JO4L 1YPZF 1PEZA 3NIFE 5I19L 3IAGC 1G9NH 2RCSL 1FZKB 5B39A 4K07A 2EDTA 4NUGL 5FA4B 5JOPD 2UY7A 2APFA 4WHTA 1S78C 4Y0GA 1AFVL 4M7JH 3MV8A 4QRPA 2N4IA 3KPSE 4LL9A 1OW0C 1J05B 1F4XH 4X4ZA 1NJ9A 2GJJA 3N06B 2JELL 4GLRI 1BGXL 2ARJQ 3PHQB 1R5VB 2W9DL 3L5JA 2CIIA 4LLVB 4XNQA 4QNPF 3S9DB 3RI5K 2NX5E 5TGBB 4HWBL 1KB5H 1JP5A 3IFPA 3ZYIA 3VGFA 2N56A 1GGBL 2GSGA 3HNTL 5B39B 1MCRA 3A6CL 4Y2DA 3LAFA 4MLSA 1IC4H 5DI8B 2E7LC 3MV8B 1KPUA 4QRPB 2KQMA 2ARJA 1NJ9B 1QSEA 2SEBA 3RU8H 2MQ3A 3V5DA 4EI5C 3SDDC 4IJ3B 2CIIB 2CLZA 2V9QA 4YGVA 4XNQB 2F53D 3KPRD 4Y1AA 1A6AA 3BKJL 4OLXH 1A4KA 2A0LD 4LGRB 2CK0H 3LKNA 1T89C 2VDNL 1F97A 3IFPB 4N0UB 4ZO6A 3MCLH 2NR6D 1ND0A 1LDSA 4MX7B 5I1IL 2V2WA 3ULUC 1JYNA 4Y2DB 3R8BB 2OTUB 4R2GC 1X7QB 4S1RH 2BVQA 4HF5H 3V6OC 4NC1C 2ARJB 5SV4A 4M1GH 4WNQA 3QEQE 2VDRL 1QSEB 2SEBB 3VFGL 2ADIA 3V5DB 2QQNH 3UJJL 4OUOA 2CLZB 4YO0A 4PJ5E 4YGVB 1WFOA 4Y1AB 1A6AB 1A6WH 3EOBA 2D4FA 2QQLL 1A4KB 1UJ3A 2I9LA 2KZWA 4U1JB 4F3FA 1NUNB 3LKNB 3TBTA 4ZPTA 1U93A 1MJ7L 3KYMB 4ONFL 1G7MA 3MA9L 3E8UH 4R96A 1MI5D 2V2WB 3UTZB 1AQDA 2CDEA 5D7IF 5DJ0A 5HYJD 2BVQB 4XXDB 4OCYL 3P2TA 1MWAH 2FYYA 2HVJA 2VZ3A 3OHXB 4XGZA 4YO0B 5E6YA 3EDDA 4MAYD 2QKIA 5JXAL 3EOBB 3UZVB 1UJ3B 3TT1H 4F3FB 4K2UH 3TBTB 4FP8H 4NWUH 3WDHA 4ZPTB 4U49A 3DNKA 2YA1A 4JY5L 3P0YL 3ARBA 3ME0A 3R0NA 1G7MB 3TF7C 1BBDL 3MO1B 1AQDB 2CDEB 1T03L 5DJ0B 3M1BA 3FHAA 3DSNA 3THML 4KY1L 3HE7C 4OFYD 3ZT5A 1UM4L 1BFVL 2F58H 3JVGC 3MV8E 4MB4A 1UB6A 1PSKL 4QRPE 4PJFA 2DQEL 4EQ2A 3V6ZA 4XGZB 4AQOA 1RZJH 2QKIB 2JJWA 3MJ9A 3ES6A 4HH8A 3EDEA 2DQIL 3ESUF 3HRZA 4GLRH 5HHQA 4KMQA 4X4YA 3ARBB 2Y36H 1F00I 4JN1L 3V0WH 2QSTA 2X41A 4P48A 5DVLA 2UYLA 1EGJA 1QRKA 3LIZH 4UIKL 4XB8A 3LN4A 1NKRA 4NZRL 4NWTH 3VXPA 1QLRA 1RUKL 2K7QA 2R39A 1UB6B 4ORZC 4RGOH 3AC0A 3V6ZB 3WFCH 3AXLA 1QSEE 4NQVA 3L7EB 4NO0D 3ULVH 4UAOC 5A1AA 3ES6B 3SCMA 1I8LA 3GSNH 3WJLC 4Q2ZA 2O26U 4Y1AE 3HRZB 1JL8A 5HHQB 5SWQA 4JPKH 3I50L 4X4YB 5AZ2L 5T1MA 4YWGL 2BSED 2JIXA 4JFDD 4KQ4H 1JI1A 4XP9L 4YBLC 1GC1L 2BX5A 2UYLB 3FO9A 4TULL 5CJQH 3SKUD 3LN4B 3VXPB 1QLRB 5FOBA 1OT2A 2D4DA 2P48B 1NFIA 2Q8BL 2PXYD 5MEOB 3AXLB 1ZTXH 5DVKA 4NO2A 3SKNA 2JJTC 1ODAA 4NQVB 3IFNL 4N5ED 3QDAA 1FIEA 3NA9L 5CFHA 1L0YA 1M4KA 1BFSA 5KAQG 4Q2ZB 4LSSH 4JGUA 4RMTA 2ZCHH 4L3CA 4WFEE 5T1MB 5DLML 4XMPL 2Y5EA 1U3JA 3KPSD 3MXWH 1XGTA 1MY5A 5CEZH 4G6FD 4A6YA 3FO9B 1GGUA 3L95A 5KTEH 1JHLH 3L3HA 5FOBB 1CG9A 3STZA 1NFIB 1S7QA 1T2QH 2KBGA 5MI0C 3NACH 2NX5D 2ESVA 4NO2B 1RFDH 5J11C 4IOFC 1R6VA 4PRPA 4MA3A 4G9DA 3T2OA 2KPNA 4JZNA 5DQJA 1MREH 4Z7VF 1SQ2N 4ZXBD 3RAJH 5A2FA 5K9QG 3FB6A 4L3CB 3L3JA 4L3EA 4LVHB 4M6OL 2XICA 4PP1D 1CK0H 4HJJH 4OCXL 4AMKL 2G60H 1XGTB 2BY0A 4H26B 5GHWH 1KFAH 1LEGA 3W82A 4A6YB 4B0MM 5JIIA 1CDHA 3L95B 1NSNL 4G8GA 1CG9B 4G6ML 3STZB 5I1JH 2IWGA 1U95B 5IG7A 1BQSA 3QFJA 3NN8B 2ESVB 5C6TL 4RDQF 5C7XH 3UAJD 4PJFE 1D3CA 4XNUL 3O6KL 4KKLC 5D70L 4PRPB 5T33L 2UVFA 4G9DB 4MA3B 3SBWC 1CLOH 4XNXL 4JZNB 4OZFG 5DQJB 4KHXH 5ILTH 3LDBB 3R06A 2EZ0C 1OHQA 3L3JB 4L3EB 5I17A 1XGYL 1BZ9A 2HYMA 3QEQD 4XXCA 2OK0L 4PS4H 4F7EA 4PGEA 1LEGB 3MYZA 2LTQB 4G8GB 3T77B 4U31A 5T3ZE 2FEDD 1KLGB 4KUCF 4OLUL 5IG7B 3QFJB 5IJVA 4NZJA 3WUWG 2EDJA 4PLJD 4X7EC 4ZD3H 3I84A 4LPUA 5LQBL 2BNQA 5CJ5A 1ITBB 4U7MA 1IILE 4GAFB 4ZNCD 1EXUA 4HWZA 4FQCH 1OTTC 3BRFA 4JO3L 3R06B 3LQMA 2DIAA 5I17B 3CFCL 1BZ9B 2V2TA 4F7EB 3WXVH 1JV5A 4PGEB 1BVKA 2ADJA 3OXSA 3BH8B 2H2SC 5KSAA 2NY5L 3WUZA 1UENA 1KENL 5IJVB 2VDQH 1A3QA 5E5MB 2IPUG 3SDAB 5CBAB 4K3DL 3T0EB 2BNQB 1XF1A 4GAGH 3CFBA 2HJKA 4HWZB 5D7SL 5E7FA 2X05A 5AYUH 2V2XA 4UINL 3DSFH 1AQKH 3MJ8B 4Y88A 1MHPL 2BMKA 1H8NA 2V2TB 3LS5H 1JV5B 3UTTA 1BVKB 1TZIA 3MV8D 2E5EA 2IBZY 4QRPD 3U1SH 3B2UC 2ADJB 3OXSB 3ZTJG 5KSAB 3O8XA 2I5YL 1S9KC 4L8BA 5SX5H 4XHQA 1YUHA 3K74B 4TNVF 5EWIH 4QT5A 5EDXA 4MA7L 5D7JC 2BSTA 3D85A 1I3GL 3VRJA 2ESVE 5HVWA 1S9VA 2HJKB 2UY6A 4PRPE 4G6AC 4XVJH 3QXWA 4JHWH 3MRRA 4Y2DD 1ETZA 1A6TB 2BMKB 4D9LL 2AEQH 3GKWH 3O6FA 3SGDI 5EBLA 4W81A 4L3EE 3UTTB 1TZIB 3EHBC 4KZEL 3IFOA 3O8XB 3FHQA 1QSED 4L8BB 3P11L 3U30C 2H41A 4DTGL 1A7PH 4NM8H 4NNXA 4G8GE 3SKJL 5I15H 2DM2A 4RMRA 4NQTA 3EKCA 4JLRA 2R0LH 3VGAC 5FO8A 4RFNC 1G6VK 1AGFA 4Y1AD 2BSTB 3QFJE 1N0XL 3D85B 4JHBA 1NCAL 1FAIL 1S9VB 2GW5A 5GGTL 4YIQA 2ZNWA 5EU7E 2NXZC 5GGRY 1N6QH 3LHPL 1A6VH 1YEFH 1T5XA 3MRRB 4V2CB 4L8SC 1ETZB 2H2PD 3O6FB 3GKZA 3BPOB 3H9HA 3QXUA 1EJOL 3IFOB 4WGVB 1J1XH 3QNYA 3RTQC 4Y4FC 2BJML 5CSBA 3S34L 1RZKH 1X3DA 4JLRB 2DQUL 5FO8B 3DECA 1AGFB 1XCQA 4YHLL 4C55A 2X1QA 4Y5XA 1ZS8A 4WFED 3QO0B 5C6WH 2J1KA 4YIQB 4Q7DA 2BNQE 5GRXG 1FGNL 4Z76A 5IFAH 1T5XB 4KZDL 3MUY1 2Z31C 3SOBH 3I02A 2O5YL 3CZFA 3DGCR 4JY6A 4POZD 1HCFX 3KHOA 1P7KB 2FLBT 1QNZH 3INUL 3L3KA 3P0VH 4CDHA 3QNYB 1FFQA 1QSZA 1EEZA 4X7SH 2NY0C 3ARFA 1GC1C 4L5FH 3D2UA 2AEWA 2GEEA 3BO8A 4M6NL 1VENA 3VXMA 4AT6A 5EIVA 4KI1A 3MGTA 5E00B 1E4WL 4ACPA 1PY4A 3ARBD 5CLTA 1FC2D 4Z6AT 1NCWL 1DLHA 3I02B 4HW6A 3CZFB 3TPKA 2GI7A 4KJWC 4XWGH 5HI3C 1RUQH 2W38A 1CFQA 3UTTE 1RK0A 3GHEL 4Z7OF 1KCKA 1EEZB 5JMOC 2C1PB 2MSPA 4RQQA 3ARFB 1CIUA 1T0MA 2EO1A 3BO8B 4KRNA 5D7LA 3ZL4L 3VXMB 1LGVA 4AT6B 5ANMA 1KN2H 4N9GA 3MGTB 4NCC1 4KPHL 1NKOA 1Y0LA 4IRJC 3CAFA 2VSCA 4IDLA 3UP1A 1AKJA 3WLWD 5GGVH 4OD3H 3BE1H 5C2BH 1T22A 2H1PH 3SGKA 4F57H 5FAAA 2ITDB 3FN0L 4OLWL 3WDIA 5T3ZD 1L7TL 2DD8L 4U6TA 3ESVF 4D3CL 1RK0B 3ZE0E 4ZMAT 4P2OC 4RQQB 3SGDH 4TSBL 3MUGA 4Q0XH 5ANMB 1U6AL 4N9GB 1Y0LB 5IBUB 3TA3C 1AKJB 1HNFA 5FO7A 5ELIA 2C4FU 4LFHD 4PB0L 1T22B 1WAAF 2XZCL 4OV6F 3WO4B 1FSKC 2IG2L 1YNLH 2ZKHH 4GW5A 4MWFA 3CPLA 2CXGA 5TE7L 4PB9H 3AS1A 5T5FL 1H0DA 4AEFA 4WTZG 3ZDXE 1RUPH 1FQ9C 3GK8L 4M6AA 1SBSL 4JQVA 4NRYA 4YXKH 3MUGB 1HILB 4XAWH 1JGVL 5KANG 2VXSL 5D93B 3UROR 4R0LC 1K5NA 3CMGA 4IRSC 4ODVL 4ONGL 5DVMA 5FO7B 3MMEA 4OZIA 4X7TB 5KVMC 2R4RH 5GRUH 4IIQC 1C5BH 4ODSL 2PYFB 3JZ7A 3GJFK 3IDYC 4GW5B 2HTLD 2EE2A 4L1HA 5HHOA 1MJUL 3VXOB 4MWFB 3CPLB 2UVEA 1YEKH 1RZFH 1NC4A 3VGGA 1H0DB 5DK3A 2GK0A 2ESVD 4XCFL 2CUIA 3IFLH 3UYRH 1AIFA 2PR4H 4XPBH 4ZQKA 4LEXH 4NRYB 4PRPD 4GRLA 5J4MA 2NY5C 1LO2H 5ISZA 3MLRL 1K5NB 3VXME 3MMEB 4OZIB 4L3ED 5MEQA 4PJXF 3PP3H 3TBVA 4EDWL 4KV5F 1Q38A 5HHOB 3S36H 4G8GD 1KTKE 5TDNA 1Q8MA 4I2XA 1QSFA 4U6HA 1NC4B 2PCPA 4WHYH 1DFBL 1A7NL 3QFJD 3NAAL 4ZFFB 2Y72A 3K4AA 1AIFB 4X5LA 4ZOEA 1H3PH 4K3JL 4AL8H 1RIVH 5ISZB 1JTOA 2IGFH 4J3VA 3FQNA 5ANME 1FBIL 5MEQB 4O5LL 5L8LB 3CMOH 5HHVH 3TBVB 3DTXB 5ENWA 3LZFH 3SKOB 3PGDA 4Y5VA 1S8DA 1MSPA 5EBWA 4LOUC 4S2SA 5DD0L 4RAUB 2YUZA 1QSFB 4KRLB 4U6HB 2PCPB 4ZUTA 2EO9A 3OXRB 4H88L 3MXVH 2GK2A 3C60A 3S36X 4U6YB 4BZ2H 3VFWA 3SDAD 3T0ED 4JFEA 2BNQD 2I9TA 2EEDA 2HA1A 1BF2A 2VDOH 1J8HB 5BV7H 2X1XR 5DUMH 3FQNB 4Q58C 5EG6C 5ENWB 3ARVA 3PGDB 4Y5VB 3Q6GL 4J2XA 5IEKA 5KSAD 3DWTA 5EBWB 4S2SB 1IT9H 2FATH 3OB8A 3S4SA 4ZFGH 2F9BT 5JIKA 3VXNB 1EA9C 2R0KL 3C60B 1MFDL 5C9KA 1G7IA 2D7OA 1OQXA 2YD8A 2P7TA 4JG1H 3VFWB 2KKQA 4JO1L 2ZJSL 5FUOL 4WO4A 2I9TB 4LPXA 5FYLE 1OQOA 3RWIA 4MCZA 2VKWA 3CIQA 2IQ9L 5E2VL 1MCOH 1RSFA 1Z2KA 5ALBH 4OSUL 4OZIE 3UTTD 3IAQA 2DBLL 5IEKB 4R97C 1CFBA 3O8XD 1BIIA 1MJ8L 4LSRL 4MMZC 3IDMA 5KVEH 4XZUA 5HHOE 3LCYA 3S4SB 5IHUH 5FDWA 5GS0H 1T80A 4QRTB 1KCSH 1G7IB 5KN5A 2P7TB 3B2VL 2Z8RA 3D85D 3I3DA 1MPAL 4WO4B 1XIWB 2B20A 3HZMA 3PV7A 5IW3A 1SM3H 1KJMB 1UWGL 3RWIB 4MCZB 1FPTH 5ISZE 4NKIL 1HH6A 1TJGH 1EK3A 4OLVL 1A6PA 3O6FD 5E8EA 1VGKA 5LGHL 3OG6B 4K3GA 4XZUB 1CGWA 3BMWA 4HT1L 5GGQH 5FDWB 1F90H 2OTWB 5CP3H 1QSFE 3FKUS 5KN5B 1MFAH 1BQHG 2VABA 1E4KA 5EA0H 1URLA 1HXYA 5C92A 4QLRA 3HZMB 2I25N 1J1OH 1B90A 2DYPA 4GMTL 4HH9B 1BQLL 1CXIA 1DUZA 1NGZA 1PQZA 3ZT6A 5E8EB 1VGKB 4H0HB 3P4LA 5EUOA 3SY0A 4XC3H 1T4KA 1DBKL 1FORL 1U8LB 4UU9A 4XVTH 2ENSA 5TFSL 3TYFB 1P4IH 4P46C 5HD8C 4I18C 2VABB 4BM7A 4JFZL 1KT2B 3RJDA 1HXYB 3BRDA 4JG0H 4DUWA 4HXAL 1I9IH 4XNYH 4JFYA 3GNML 5DZLA 3VG0L 4P0DA 3VI3E 1DUZB 1NGZB 1HHKA 4PP2A 1UEMA 2FX8L 4NN7C 4EBQH 1GIGL 3T0XA 4TVPH 3MJ7A 4H1LA 2DLGA 4XPAH 5EUOB 5DXWA 1TJIL 1T4KB 2YS4A 4GXUM 3SE3C 4RWYH 3Q6FB 4LSUL 3O3BA 3B3IA 3ARFD 3LY6A 4X9BA 3OQ3B 1QFWI 2BY3A 3VXMD 3RVWC 3UTQA 4YHYC 3HTLX 2WANA 3Q5YA 2P1YA 3DYMA 1WBYA 1J5OH 2ICWA 2MKWA 2EEBA 4JFYB 1HHJA 5CD5C 1VFAB 4WW2F 4PP2B 3AY4A 2HKFH 4R26L 5E8DL 1EEYA 1N2RB 2J8UA 1OP5H 3REVA 3RUGF 4H1LB 4PJXA 4JKPH 3E2HB 4MB5A 1KYOJ 3WMSA 1NH6A 3O3BB 3AMLA 3AFLA 3P3YA 3B3IB 1WIUA 5HVGB 1NDMA 5LJYH 4UOJA 5F72S 3UTQB 2FEEI 2H6PA 3PNWA 2B7DT 1AKJD 2LAAA 1KEGL 1WBYB 3NCEB 2ICWB 1NCCH 2WP3T 1NBYA 3LEVL 4G43A 2AAVA 2GY7B 3C5SA 1EEYB 4MGXA 3T08A 5F7EH 3B8SA 2J8UB 1AGBA 3REVB 1KJ2H 5JHDA 1K6QL 2V17H 5FEBA 1NAKH 3BUYA 1FNAA 5F96H 1NUGA 1MEXH 4JREB 1NDMB 3MV11 4OGAD 2AXJA 5L7XL 2J2ZA 3MBXL 4WTXA 2H6PB 2PO6C 3PNWB 2MCPL 4PRAA 5CUSL 4HC1L 2VDKL 4NGHL 3WCYA 1NBYB 4TOYL 2ZUYA 3QG6B 3B9KC 4G43B 1FH5H 1KIRA 1VPOH 3TV3L 3TJHC 1PW3A 3C5SB 4NDMA 4FQLL 4JB9L 3GMRB 1AGBB 1TTUA 5JHDB 1MUJA 4U7KA 4RGMB 4U1MA 4X98A 1GCFA 3BUYB 1U3HA 5EUOE 5JHLL 2EDYA 4P4KC 1AGCA 1Z0MA 5FYLD 4OKVA 3UC0L 4EN3C 4YEEA 1MNUH 1T66C 2MNUA 2YMXL 5GRVL 1HKFA 1EX0A 3EYQC 4PRAB 1CGSL 3OWEA 4LBEA 2M2DA 5C0BB 4GS7C 1WV7T 1KIRB 3RX7A 3OJDB 3B43A 2X1WL 4NDMB 5HHOD 1LO3H 4BKLA 4I0PC 3VWKC 3VGHA 3U82B 1NC4D 1MUJB 3BSZL 4X98B 4U1MB 3CFIC 1U3HB 4WEBH 4UV7L 1AGCB 1JN6A 3WV0A 1TXKA 4PJ7F 4OKVB 3TWCH 1XF2A 4ZFOA 2FD6H 4W68A 3T4YA 4ZUSA 5ISZD 3TC9A 5C2UB 5D7KE 4OCSH 3WS6A 3Q3GA 4XVUD 3FMGL 5DRZA 2HN7A 3VU2A 1E4JA 3GB7A 4F15B 1OAYL 4LBEB 1NLDH 2GITA 5BZDA 2AEPH 5DFTA 5F9AC 4I77H 5C1MB 4YHPA 3ZKXB 5E08H 1KUMA 1MLCA 1YEGL 2GAZA 3K2UH 4YHKL 4BKLB 5DC9B 2DWEA 1QSFD 1N5YL 4LIQH 4EXPX 2DN7A 2J8UE 1E0OB 5HYQA 3LQZA 2Z92B 4KV5E 1XF2B 4ZFOB 3QIUB 3T4YB 3WIIL 3ZYZA 2AQ3A 3T2NL 1J8HD 1S3KL 1T2JA 4CW1B 3V52H 2CO6B 3PWNA 3HLAA 3Q3GB 4QOKA 3IXAA 4WJ5A 5DRZB 4LAJH 2HN7B 1WJ3A 2NZ9C 1G0XA 3TYGH 3OJVC 2RGSA 5BZDB 2GITB 4N0CD 1WZ1H 3WJJA 4YHPB 2AGJH 4Q6YA 1I3UA 1MLCB 2GAZB 2VDLL 2DWEB 2WK2A 3I85A 4QHMA 1YEJH 1PKQA 3C60D 5ETUA 3MLXH 5DJDA 1QKZH 5JHDE 3FB5A 5E6IA 4C59B 5F3BA 3LQZB 5K9QI 4LCCC 1BLNA 4NRZA 2Q8AL 2XQYK 1A5FL 2LE9A 3HLAB 4QOKB 3IXAB 4WJ5B 1KJVA 3MLZL 4N0YH 5T3XH 2GKIA 5EFIA 3G6JB 5C0CA 2VB5A 3RX8A 2P43B 5C0BE 4HK3J 3MJ9L 4UQ2B 2P5WA 5DZNA 4QHMB 1PKQB 4TUJA 5ETUB 1MF2H 1QFOA 5DJDB 3FB5B 3M17A 4UIMA 5E6IB 4AEHL 2WWMD 4BFIA 5SX4I 4K23H 2YD7A 4O2FA 4WO4D 1XIWD 2WZPD 5IBLD 4U1KA 3VMNA 5ITBL 2ZCKL 5T3ZL 3VRLE 1EGJL 5IB4B 5EBGA 5GIRA 4HIXH 1KJVB 5I73B 2DB8A 1WTGT 4QXGL 3HC3H 4MQ7A 5C0CB 3U7WH 2EE6A 4S0TD 3GBNH 4GOSA 1HQRA 5TQ2L 2DJUA 5J57B 2GTWA 1DQML 2Q3ZA 3A67L 1OB1A 3ILQC 4M6ML 2UV3A 3NFPA 3MTRA 4NHUA 4XPHL 2P5WB 2AJXL 4GG6F 4TUJB 1WWBX 2R4SH 4UIMB 4BFIB 4KTEH 2EKJA 4FFYL 1JWMA 2ZCLL 4O2FB 4PJDA 1ZWIA 4U1KB 2BXZA 3K80A 1I75A 1HYSD 2B1HL 4J8RB 1KXVC 3ROLA 2GJ6A 5IFHH 4KTDH 1R3JA 3LKOA 4M7KL 3U6RA 3N85L 3ARDA 4JHAH 1BVZA 1KXQE 3DX8B 4L9LA 4LMQI 1QLFA 5CGYC 5D1QA 3T3ME 4NJAH 3V4UH 5EO1A 3MRBA 5BVPH 1NANI 2GTWB 4XNZC 1ZGLB 3TFKC 5GGUA 3BPNB 3BZFA 3IGAA 3RGHA 2J8HA 1OB1B 4JJ5A 1BBJA 4L29A 4WHCA 1WBZA 3E3QE 3NFPB 1IZKA 1CLZH 3MLYL 4K3EH 4GJTB 4NHUB 3V4PH 4LPCA 4X4MA 2LU7A 1L0QA 1DDHB 1LQSR 4CVUA 4DW2H 1JWMB 2BVPA 4NNYA 4PJDB 1ZWIB 4A6YL 3LH2L 3Q48A 3QP3A 3ROLB 1D6EA 2GJ6B 2EDXA 3STBA 1R3JB 3LKOB 3U6RB 1OAUH 3ARDB 5J56B 1FZOA 1Z3GL 4QOKE 5D1QB 3C87A 1XR8A 1QLFB 4L9LB 4Y8DC 3IDXL 5EO1B 3MRBB 3G5YB 4KK8C 1X5LA 1OP3K 4YXLH 1X4ZA 4JRXB 2BC4A 3G6JE 1MFEH 5GGUB 2WV3A 3KDMA 1A0QL 3BZFB 1H3XA 3IGAB 4JJ5B 1BBJB 4L29B 1DL7L 3O45A 3DROA 3LEYL 1F2XK 4XPTH 1LILA 4F8QA 4WV1A 1PKQE 5E94A 3DUUA 4XVSH 5BVJB 2BVPB 3ZYOA 3OAYK 4FNLL 2OP4L 5JOEA 2R15A 2VAAA 3MRJB 1JFQH 1FYTA 1I9JH 1WUNT 4WVRA 3ZSSA 4QRSA 5HPOA 1FZOB 1R3IH 2D7MA 1XR8B 4HG4J 2HWZL 3RIFK 4PYGA 1JGUL 1E4XL 2BC4B 2DM4A 3ARPA 5C0CE 3F7YA 4JR9L 4DGIL 3KDMB 4OFVA 1Q1JH 5CMAA 1UZ8B 3IDGA 4N90E 4YNYA 3O45B 1INDH 5I1AA 3HFML 2I27N 5IHZA 5FHAH 1AR1D 1T83C 3DLQR 5HPMA 1AR2A 2P5WE 5D7KD 1QD0A 2CJUL 4WV1B 5E94B 2VLKA 3DUUB 1RJZA 1TQBB 3O3EA 4K55A 3QR2A 5ID1A 3OJMB 1WISA 2WQRA 5MEPA 2RR3A 4F7PA 25C8L 2AI0H 4QRSB 3WFBH 5HTSA 3UDWC 2E9JA 5SX4H 2P45B 2W9EH 3NPSB 2ZSVA 3QEHA 3F7YB 4F9PC 5CMAB 5KVGL 1FFNB 3IDGB 1CZ8L 2YBRA 3F65A 3CDYA 4YNYB 1YY8A 2ILLA 4GO6B 5I1AB 1XGQA 3LQAH 1U8KA 5HPMB 3W11D 3TZVA 2D9CA 1RJZB 5CCKL 5ID1B 4XI5D 2NY4B 3ROOA 4HIHA 4PJHF 2XTJB 2X70A 2F19L 2VDML 1G9ML 1G0YR 2ZPKH 4PJDE 4YHZH 5IESH 5F8RC 1AH1A 4K9EH 1S5IL 2EDLA 4FG6D 3SEPA 1YYLH 2GJ6E 5T1DL 3W9DA 1NFDF 5CJOH 2ZSVB 3QEHB 4DKEH 3F7RA 3TPUA 4WWKA 2OL3A 3NIGE 4WI9A 2YBRB 5JHDD 3D9AL 3N1QC 1XGQB 4ZAKC 4ALAH 1DBAL 1U8KB 3AREA 5D96B 1VEMA 1LVEA 1MRCH 3TZVB 2DQHL 1NANH 1T7XA 2EDKA 1ZLWH 1R0AL 1TPXC 1LP9F 1VA9A 2B4CH 1X5ZA 2XYCA 5FUCC 3ROOB 5FA3A 2HFFA 3IRZA 4LF3A 5B39G 5BZWA 3TH2T 2X70B 2RIKA 5JW3L 2FX7L 2NY6C 5C0BD 3WIHA 2Y5TB 4I3GA 4CU6A 4G9FA 1QEWA 5F7UA 2YPKA 3KLSA 3TPUB 1RURL 4WWKB 1KJ3H 2OL3B 2HAZA 4PD4J 5I19H 1U3HD 2HJFA 3UJTL 2MOVA 1T3FA 5ITFA 3G6DL 2ATKB 1S7RB 4FQIH 4LRIA 5EORL 3LB6D 1FP5A 1LK3L 4YE4L 1HEZA 4LEOA 2HFFB 1UXSA 2OI9B 5HDQH 2V5TA 1XFPA 2CKBA 4QKXB 1AY1H 1FYTE 3VD4A 4OM0L 4G9FB 1QEWB 3LKQA 4LNRB 2YPKB 1U58A 4KQ3L 3BT2L 2DLFL 3GUTA 5IIEA 2HJFB 2AJYL 4WWID 4KXZH 4LVEA 4U2YA 3BP7A 3HNTH 5ITFB 3PP4H 5L0QB 1H8SA 3NFNA 2AVGA 4D9QE 2APXA 3QIUD 1HEZB 4UB0L 2JF1A 4LEOB 4GQPH 2MQ0A 3EUUA 2GCYA 3EYSL 4GW1A 5E2UL 3QHFH 3RHWF 1UXSB 4NSKA 1HDMA 2XTJE 2VISB 1U2HA 2CKBB 5F97E 4KAQH 3GSUB 2HMID 2EDBA 3BKJH 3W2DH 1O7SA 1SJXA 5EOCH 1JNNL 1U58B 1NMBL 1A64A 3GUTB 1S7SA 2CXKA 5IIEB 2HLAA 2C3VA 3EFFA 3I9GL 1UKSA 3MRKA 5AEAA 3BP7B 4HJ0D 1RZ8A 4RNRA 5F21B 2F54A 1AHWA 3IDIA 4U0QB 4OZGF 5DHVA 3D18B 3DX9B 3NFNB 5I8EA 2IPTL 1ACZA 2FH8A 2AEIT 4NQCB 4YFEA 2LV4A 4YHIA 3RVUC 3SCMC 2VDRH 4QOKD 4UILL 4GW1B 2AJVL 4NSKB 2W60A 4NN5C 4OCWL 5K9JH 2V5YA 1UACH 1CXFA 4OIIH 5JIPA 1S7SB 2HLAB 2C3VB 3EFFB 3MRKB 3NCBB 1U8QA 1RZ8B 5TDOA 4RNRB 5E6ID 2F54B 3IDIB 1C8PA 4NOFA 1L9NA 1R5IA 1OCWL 2Z35A 3ALPA 4PBXA 4N5UA 5I1HL 5I8EB 3DVNA 1YYMH 3WKML 1DQLL 1YEEL 4LVNC 2XFXA 3OJ2C 1YN6A 4OCYH 3RY6A 4X8XA 4YHIB 1P5VA 4ONHA 3BYYA 5B38A 5I1KL 1FC1A 1EUUA 3C09B 1RZGA 4KK5D 4HMCA 1WZKA 5C0CD 4U1GC 5I74C 4N90D 2W60B 4DZ8A 5JXAH 5SV3A 3H42L 5D1XC 3MRCA 4QHKJ 2HT3C 5I66B 5GGRA 2RBLA 1YJDL 3ZKND 4G9FE 2P5WD 4JY5H 3P0YH 3ULVF 2D0GA 4BQCA 5GRVK 3TT3H 3H3PL 5D8JL 5TDOB 1FL6A 2HT4C 3F8UB 1R5IB 2Z35B 1U8NA 4OQTA 3U0WH 3DVNB 3QXAB 3CXHK 3KPMA 2DDQH 1YN6B 5JNYA 4ONHB 5B38B 1A2YA 1BFVH 5BW7C 4RAHA 2Y06L 5DFVC 5C0RH 5F3HA 4F7CA 1A3LL 1UM5L 2RFXA 4DZ8B 1A7QL 3B5GA 3QUXB 3WE6A 5GGRB 1CICA 2FCBA 4IOSD 5IJKC 1WQVT 1AD0A 4ETYA 2Z8VC 2DWDA 2PTUA 3WEXA 1AXTH 4JJHA 1RIUL 1U8NB 3W5NA 3ARGC 5FYKH 3N0PB 1GOGA 3KPMB 4AK1A 4CL7A 1A1OB 2CGRL 4JN2A 5JNYB 2GJ6D 4LFHG 3ZKMC 3ARDD 5F3HB 1MJJA 4KKCD 4LU5H 4I3RL 4UNUA 5EZLA 5AAWA 3FAXA 1ORQA 1IBGL 2RFXB 3OL2A 1FL5A 4JRXD 4KC3B 3KPLA 4O2EA 5D5MF 1UH4A 5HI5C 1R5WB 2CRIA 2YA2A 2O5XL 1CICB 2MTPA 4X6DA 5IMOA 5LVEA 3GRWL 4M43H 5DO2C 3I50H 4LSQL 2DWDB 4YWGH 3CJJA 3QCVH 4N0FA 3C8KA 4YBHA 1Q72L 2E7LA 2F54E 4WDIA 4ENEC 3QAZC 4JN2B 3VWJC 3OKMB 4X7DC 4AENA 1MJJB 2R1XA 3SDDA 3VFVA 1S7TB 4EI5A 5EZLB 3SN6N 3IFNH 1ORQB 4Y4HC 4XWOD 1FL5B 1KTLA 3KPLB 1VEPA 3O9WC 4O2EB 4P3WA 2DQJL 3BZEA 1JMXA 1RU9L 4NP4L 1T89A 3KR3H 4X6DB 1G9MC 1I8KA 5IMOB 1MHCA 4PFEA 3GO1H 1OTSD 4JQXA 1I1YA 3QZWA 2I07A 1Z9SA 2ICWJ 4N0FB 3U7AA 4C83A 3C8KB 4CVWA 2W91A 4GBXC 4XBGA 4DK6A 1J0JA 1NCDH 4CN4A 2F5AH 1TETL 5DJAA 3V6OA 4WDIB 1BPVA 3J8F7 5HJ3A 5HHMB 3X3FH 3VXSB 2R1XB 3SDDB 4QGTA 4EI5B 5F1SA 3CNKA 3FQTB 4OUUB 3EYUL 4O02H 3OKLA 1U92A 1KTLB 4R90H 5AG8A 5I1CL 1OTUC 3NMEA 1MRDL 1U8MA 3C2AL 4X99B 1I8KB 1PJ9A 3FT2A 1MHCB 4LPWA 5B4MD 1MRFL 4D9QD 5ICYA 3QZWB 4PG2C 2I07B 4W6WB 3WYRA 4C83B 2EE9A 4XBGB 2E7HA 4GH7B 4N8VA 2RAMA 1TMCB 4R2GB 1QPPA 4Z78A 2NY4D 3MUJA 5DJAB 2XTJD 3BGAA 4G80B 1UZ6E 4UBDD 4L4JA 4LP4A 3V7AG 4ZPVA 1W72H 4G6MH 4F8TA 2B1AH 4ZTPL 2HH0L 4CN1A 3OKLB 4FQJL 4NNPH 1KYOK 4AG4L 1U92B 3HUJA 3VD9A 5T33H 1W0YT 3BKCH 1VKXB 4TSAL 1WEJL 3FT2B 2O61B 3MV7A 4GRWH 3GEWB 5DMJB 5ICYB 2C4XA 4OKDA 3TZVD 1JPGA 4U33A 4N8VB 1XGRA 1SYVB 3HE7A 4YDVA 1SEQL 2FO4A 3S98A 5CEYA 4D0CA 4ZPVB 3JVGA 3OB0K 4Z77A 3RGVB 1HI6A 1Z5LB 4LHJB 5JXEC 4M1DL 5KSVA 2JLLA 2OJEA 1KCVH 5E8PA 3HUJB 5DRNA 4WWKD 4CMHC 3QEUA 1A6UL 3QUMA 2D7PA 5GS1A 3DI2B 3MV7B 4D0DA 5ALCL 4EOWH 4X6DE 5T1KA 4RRPA 2DTSA 1JPGB 3ILPA 5E2WL 5IM7B 2ZP0T 1WWCA 1XGRB 2P8PA 4MA1C 1N64L 4JFPA 3HE7B 4YDVB 2FO4B 4M5YH 3KPTA 5CEYB 4D0CB 1WF5A 4Z77B 3NGBB 4OZHB 3FOLA 2NY7H 1HI6B 5HHME 5DMIL 4AY0A 5KSVB 4WHDA 5FXCH 3NTCL 4JANA 3VXSE 5FFLA 2OJEB 2Q7NA 3E6HA 4GG8A 5E8PB 4G9FD 2VWEC 4YUEH 3OAUL 2VL5B 3TGXA 3VW3H 5DRNB 3RY4A 5I8OH 4MXQD 4DZBA 5D2NC 3WJLA 1TQCC 4LQ1A 1ZLUK 3QEUB 1EZVX 1I9EA 3QUMB 5K9KB 3KYNA 1PEWA 4CUCA 5T1KB 1AJ7L 4GAJH 1CQKA 4G7YL 3HB3D 3AS0A 3UTOA 2P8PB 2IMMA 3ULUE 1R3HA 2WUBL 1I8IA 1S9XB 4R4NC 3V6OE 4NC1E 3FOLB 1J11A 4XMKH 1CXKA 2JJTA 4MJ5A 5B3NA 4JANB 1NMAH 2FBOJ 2DKSA 3E6HB 3KPPB 4GG8B 3QUKB 4UAOB 2R69L 1G7LA 5A2KH 3FOMB 1AGDB 2UZXB 3D5OF 2Q76A 1WIOA 3KYNB 5EIIB 4O9HL 4D9LH 1T5WB 4DN3L 4OFPA 4YBLB 2IFFL 4MD5A 4NQCD 5FYJE 2F8VA 4U7SA 4XCNA 5TJWK 5BMFL 1R3HB 3DHMA 4Z7WA 3UMTA 1JF5A 3OR6A 4MJ5B 1MHHA 4OQ1A 2FHCA 2AABH 3IKKA 1DQTA 3O4OC 1G7LB 3HZYA 4I8DA 1FLRL 1U41A 2FJHA 5EZOL 3HUJE 4ZUVA 2Q76B 1MAKA 4YQXL 4P9HC 5JA8B 2R1WA 2Q86A 1X4XA 4MVBC 2F54D 1MCWM 3MV7E 2WLYA 4M3KB 4MD5B 5E99H 4ZS7H 1UB5A 1EAPB 4XCNB 4Z7WB 4TTDC 4MJ4A 2AJSH 3H7BA 1TCRA 3S34H 2VDPL 5CGTA 5GS2H 1MCQA 5MI0B 1T7WA 3HMWL 3ALXA 5J11B 1MHHB 3FRPA 4OZHE 2HTKD 3GIVA 4YDJA 4XP5L 3HZYB 1P7QA 1Z9LA 1G7HA 3SBWA 6FABH 5DYOA 3CVHB 1RK1A 3MRFA 7FABH 3QQ9D 4ZUVB 3K0WA 1FNEA 3UPRA 2J6EA 4KK6C 2R1WB 2QEJA 3GSQB 4HFUH 5LBSL 2P47B 3WFHB 5AYQA 1HKLH 3EGSA 3BD5A 4HWBA 1QBLH 2V5MA 3O0RL 4FQXC 4EUPA 4Q6IC 2QL1A 2VO5A 4YPJA 3H7BB 3ARTA 1TCRB 5IVXA 4BK4A 5F1IB 5EU3A 2VR9A 2AK1H 1EHXA 2ERJC 4YDJB 4M6NH 3QUXD 3DVIA 1QOKA 4PBWD 4DVBA 1ZK9A 4LKXA 2RB8A 1G7HB 2ZSWA 2H3NA 3MRFB 1RK1B 3OGCB 4R4FH 4UQ3A 5I9QC 5KS9F 5KVFL 3K46A 1FNEB 1ZEAL 4FXKA 2C3GA 3KYOA 1NCWH 2IC2A 3CH8A 2E6QA 1BOGA 4DOHB 4JQIL 1FFOA 3WNPA 3EGSB 4GRLC 1Z6JT 4EUPB 1T20A 4M7LL 3EO9L 2EEAA 1OARL 3GHEH 5IVXB 1GZPA 3O2VL 5DMGC 5EU3B 2ORBH 4P3CH 1M71A 4KVCH 3C6LC 1YC8A 5DZOA 2DQTH 3EOAA 4DVBB 4ZS6C 1T7ZA 4BQ8A 1DN2A 1JTPA 2ZSWB 1CICD 4LKXB 2H3NB 4UQ3B 1S9YA 3MZTA 1F4WH 4Z95L 2Z8SA 3IDNB 4JM4H 4I4WA 3KYOB 1XCTA 3RIAF 4PGCA 1S78D 1BOGB 4J7RA 1FFOB 3PE9A 2Z8WC 1T20B 5IMMA 4FZ8H 4S1DC 5E2TL 1TIUA 4OGYH 5DJYA 1ACYH 1TZGH 1GZPB 3TJEL 4Z7WE 2A6KA 1HHHB 1X5HA 1Q0XL 1M71B 1QHPA 3VRIA 2A74A 3EOAB 4G5ZH 4OLEA 2A9MH 4ODXA 3GJFA 1DBBH 1S9YB 2WBKA 1A7RH 3C5JA 1U8OB 1QTYT 4I4WB 4RMSA 4TSCL 1RZ7L 4ZOBA 4LSTL 4PGCB 3EFDL 3H9YA 2B2XL 5HHMD 5IMMB 5LWYL 3VXSD 2LAGB 1FZJB 5CIPB 2JB6A 5DJYB 4EI5D 3SDDD 1XAUA 4FOMA 2A6KB 1F42A 4MQSB 5IFJA 5D7JB 3TEUA 2A74B 3NCYS 3EO1A 2EYRA 4OCRL 1JGVH 2X9WA 3G5XA 5JW5A 2EH7L 4ODXB 5GRYA 3GJFB 1MCLA 1ZVHA 3C5JB 1FFPA 1UA6L 1F4YH 1ED3A 1QG3A 3ULUD 4L8SA 2ICEA 4ODSH 5D9SA 1IC1A 4R2GD 1HINH 1MJUH 4DGVL 3L1OL 4HG4K 2ED7A 3V79C 4DOHE 3U30B 1IAIL 5F9WC 3RTQA 4Y4FA 5CKAA 4XCFH 4HD9A 4N1HB 3VGAB 3WHE1 3PGFH 4RMQA 4RFNB 5IFJB 5IVXE 1YQ2A 2A1WH 2BOCA 3EO1B 2EYRB 5JW5B 1P6FA 4K8RL 4G6JL 1TFHA 2CPCA 3V7MA 2NXZB 3PJSA 5FYJD 1ED3B 4L8SB 2ICEB 2Z31A 5D9SB 2Z4QB 3HI5L 1FIGL 2DICA 5AUMA 4M00A 2R2HA 4XRCA 1ADQL 2NXYC 3NCJL 3MLVL 3RGVD 3RTQB 4Y4FB 1U8PA 1NBQA 3CLFH 4P23C 3I6LE 2VXTL 2BOCB 1FVEA 1F6LL 2XOTA 4PJ8C 5JA9A 3QPXH 5KSBA 1T1WA 3MV7D 1H15B 1FBIH 3R1GH 5CHNB 3K1DA 2FR4A 1F13A 2YKLL 4O5LH 3OX8A 2Z31B 3U9PL 3ORJA 2YRPA 3ZE1F 2UWEB 3HE7D 1SY6A 3T3PE 4UTAL 5AUMB 2GSIA 5DD0H 2R2HB 2WINA 3EDFA 4MD4A 4XRCB 2JE8A 1FO0L 1JHKH 2HRPH 4LSVH 2X4QB 3ZE2F 4RBPK 1U8PB 3W81A 2NY0B 5LCVL 2WMPA 5MP6H 1DVFA 3FB7A 5HGBA 1FVEB 5J8OA 1L4IA 2ZOLA 1XH3B 3V2AR 5LGKA 5DD5L 5KSBB 1T1WB 2Y25A 4JFFA 4HXBL 1MCFA 5T1KD 2FR4B 3DRTA 5FV2A 1TJHL 3WSQL 3OX8B 1IGML 3QDMB 5CILL 5J13C 5BXFB 2IQAA 3WFEH 3QNZA 3Q6GH 4DKDC 2VZSA 2GSIB 1U8HA 2WINB 4MD4B 1KCRL 2D2OA 3SQOL 3BAEL 3VFOA 3WO3B 12E8L 3HNSL 5DVOA 2MHAA 4XPFL 4PD4K 2M26A 4P2OA 4BUGA 4TNVK 3FB7B 4K71C 5D1ZC 5FUOH 2ZOLB 5HHNA 3S37H 4U1NA 4IRJB 3TA3A 1NBVL 2IH3A 4IDJH 2FECL 4GXUN 2IQ9H 3DRTB 4QWWC 4O51A 2IQAB 2G9HA 3QNZB 1NAML 3P9MA 2DKMA 5DQ9A 1B0GA 3VCLA 3BDYL 2UUDK 3FB8A 6CGTA 3RRQA 3VFOB 4I0CC 3I3BA 5F6HJ 2MHAB 4P2OB 3B2VH 1KIUA 1PG7H 5HHNB 4WW1B 4XH2A 1C08A 1S7XB 4K7PL 4R0LA 4U1NB 4H0GA 5KOVC 3P9LA 5DA0B 3PXHA 4IRSA 3AS2A 3TA3B 2IH3B 4OBRA 3BFOA 3S37X 4IIQA 3RWCA 1C1EL 1DBJL 3IF1A 4KVNL 2O93L 1FSKB 4O51B 5DD6A 5HY9A 2G9HB 5LGHH 3P9MB 5DQ9B 4KI5D 3X11B 1GGCH 2EYSB 3FB8B 4MAUH 3WN5C 5FDYA 4MQXC 4IOFD 4JGMA 3AM8C 3HAEA 4QXWA 4IRZH 3FL7A 5LXGH 3GMNA 4XH2B 4C4KT 1S9WB 4R0LB 1GPOL 3P9LB 4Q9QH 1VDGA 4IRSB 1PG7X 2HG5A 3EYOA 3K4ZA 1A14L 1LO5A 5KSBE 3O6ML 4IIQB 3RWCB 2BRRL 1JPSL 3EOTH 4Z7QE 3IF1B 2EDOA 3IU3A 5BS0B 4P5KA 5DD6B 3VFMB 4F7MA 5HY9B 3IDYB 5DD1H 5FYJU 4POYA 5L88H 1G1CA 3MNWA 1EZVY 3LKRA 1I1FA 3G5ZA 4HHAA 5TFSH 4H1LG 4KKLD 3HAEB 1M7IA 4OB5L 3GMNB 1Q9LA 2EZ0D 2HG5B 3EYOB 1LO5B 2AQ2A 4JFFE 3IU3B