1NCWH

Cationic cyclization antibody 4c6 in complex with benzoic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
b'RVQLQQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN IGG2A
publication title Structural Basis for Antibody Catalysis of a Cationic Cyclization Reaction
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncwH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncwH01
2R0WL 1BFOB 4Y2OA 4YR6A 4MQTB 3S5LB 3RTQC 3M07A 5J12B 3W11D 5KW9L 4M9OA 3KYAA 3KPTA 3TPKA 5D5MF 4HIJA 5HXMA 4HJJL 4Z7UB 4M93C 4LDOB 4YHPA 1MJJB 5C0IA 5KVGH 3F7YA 3SGDH 3JWOC 1JGUL 1U95A 5SWSA 3O41A 3UAJD 4BH7B 1PW3A 4AENB 3O4LE 2W60B 1MWAA 1CDYA 4UT7L 3PWNB 1H5BA 2IALA 4L4TA 1MLCB 5JW4R 4YHOH 2BNQD 3WFDH 4H5SA 5LWYL 1MHPL 2VLJD 5FGBA 2JJTC 5DD0L 3MV8D 4YHNA 1RHFA 5D5ME 4XP1L 2XRAH 3S98A 3CH1B 4G9FB 3TYGH 1JCKA 4U0QB 2GFBA 1JE6A 2B2XH 1NGPL 4WWKB 1VEMA 1NBZA 3CVHA 4POZC 3Q1SH 4Z8FL 5IHZB 3TVMB 2FL5A 4ONOA 4XI5C 5DHYA 1S7WA 1GIGL 1P5VA 5DMGD 4JRYB 5DLMH 2BMKB 4EI5A 4IJ3C 4PLKC 2MHAB 4Y5VA 1CR9H 2H2SD 1TTFA 2UY7A 4F7PB 5IMKA 3BKCH 4LRIC 4APQB 5DUML 1HHJA 2ENYA 2WBJD 4JFEB 3BH8A 1QEWA 1YJDL 1MI5D 4W81A 1P84J 3V7MA 4LRNH 1F11B 3MXVL 3T8XA 4GQ9H 5CJXA 3EYVB 1NL0L 3RWFA 4X99A 3ZDYF 1Q9WB 4I77H 5JZ7C 2Z9TA 4R4FH 1Z3GL 3MRFA 5IMLA 5E2TL 5INCB 3SE4C 4DVBB 2E9JA 5GSVA 3OXSA 4KJQC 4PJCB 1RMFH 1OF2A 4RISH 5C0JA 2NY4C 4NT6A 2BCKB 1GC1C 3D39D 4PLKD 3U7YH 4FNLH 5B39G 5KJRH 3RDTC 2VABB 1A4JB 4PGCA 3GJFK 2QSVA 4LASH 4DOHB 4PGEA 4NYLA 4QHUA 4I8DA 5DDHA 4NP4L 3M8OL 4I0CC 4ZXBA 1A6VL 5BJTB 3C5SB 2CDGB 3MRJB 3OKMB 1UCTA 2F5BL 4U1KB 3AXLB 1IE5A 3VXRD 1VACB 4OLZH 1R5VA 3W39A 1FIEA 3MCKB 5E8OA 1PEWA 4OLVH 4WU5B 3MO1A 4QRPE 1S78D 3GEWB 1TJIL 2W1NA 5D1ZD 3IETB 1UEMA 4OZIE 5EU6D 4BELD 4TVPL 4K3GA 3MUJA 2XKNB 4FOMA 3E8UL 3DROA 2R2CA 1I7RA 2XWTA 3QA3A 5IBUB 2BSRA 1YEJH 4JG0H 4OM1L 3RDTD 1E0OB 2FWOB 2DRUA 4AEEA 1T89C 3MV7E 3D25B 4PY8J 2A9ML 5H2BB 3QDMD 3MNVA 5C09D 3RWCB 4BQ6A 3BH9B 3DARA 1PG7X 3EGSB 2ZUTA 3WLBB 3RY6A 1F6AA 3BOVA 5EZJB 5C6TH 5TE7H 4YXHH 2VDKL 1AO7A 2FCBA 3ZSTA 1Q9KB 3IJSB 1SEQH 3S36L 2JF1A 5GS1B 4XVSH 4OCWH 1OW0C 3X12B 4FFYH 2P42B 4HH9B 1YEIL 5E7FA 5HHVL 2VLMD 1BWMA 2J8UA 5BW7A 1ZV5A 3MRIA 4EKXA 2P5WE 3BIKB 4DAGL 5DJYA 2JB5L 4JZOA 2YSSB 3MROA 4FTVD 1YEHL 4UBDC 3AREA 1E4WH 4CJ0A 4G8GD 2LVCA 1N8ZB 3C6SA 5FM5O 3DTXA 1DTUA 3ARGC 4HIHA 2IGFH 2EDEA 4JPWL 3O0RH 4CDGC 3QHZL 3HAEA 4OM0H 3QAZC 1TVHA 1GZPB 2B5IB 3GBNL 3QBTB 1MIMH 3V5DB 5TQ0L 4NRYB 3UJIH 2FNBA 5IEHA 3WDHA 2VXVL 5CIPA 3P4NA 5L8LB 4DN4H 2X4PB 3KXFD 3BPLC 1IAOA 4POYA 3MFGB 1IGML 3AGVA 1R0AL 5IM7A 2NW3B 3L1OL 1RZ7L 2JJSC 1T1ZB 5BV7L 2W0LA 5E2UH 4OJFH 3MNWB 2HWZH 1BOGB 3L3HA 4S1QH 4LHUG 1MWAH 1N5YH 2A9NH 1EEQA 1SYSA 4HPOH 4F7CA 5JIPA 1FO0L 1D9KD 4HMEA 1BWWA 1L9NA 1BIIA 5IJVA 5HHMB 3ULVD 2P4AB 3AU1A 1PSKL 4H25B 1NKRA 4NJAH 1MIEH 3SBWC 3SE8H 1FFOA 3CVHH 4PJBF 5TE6H 2DQEH 4K9EL 3IDYB 3VGHA 5C3LD 2V2TB 1NUFA 2X1OA 4QOKE 3HE7B 2HG5B 5KN5B 5AG8A 4HWUA 1M71B 2AJSH 3QSKB 3D69B 2AI0H 1CDHA 1FNGA 1OP5K 4OZFG 2JIXB 4P3DB 5DMKB 4PG2C 4ODSL 1MFEL 3WUWG 2VDQH 3HS0B 4GAJH 3TA3B 4XC3H 5I1IL 3S97C 5GGRY 3WJLC 1QSEE 1KENL 4HZLB 5I75B 1IGTA 2YHGA 2L7UA 2ZUXA 3O3BB 3TZVC 3GSNL 1AKJA 5D7KD 5MEOA 4HKBA 5F7DB 4PJBE 1LE5A 5FUCC 3ZKMC 5AD0B 2NXZC 4JFDE 4K7PH 1XGRB 4MQ7A 5HDQL 3FCTB 1R3IL 2HVJA 2N7BA 5DK0B 4OV5B 3U0WL 1GOHA 1OGTB 2E7BA 2WZPD 2VDNL 4CADB 4FQXC 4U3CA 3GMPA 5HYSB 2J5LB 1K9TA 5IFJB 5SWQA 5EORH 2HTLC 5EIIB 4U6HB 4FQHA 4RFOL 5IROC 5MHSE 2J8HA 4Y19E 3QH3A 5MP6L 3T2OA 2MTPA 1W2KT 1XGUB 1NGWA 3C09C 2DQGL 4GRWH 3H7LA 4ISVA 3A6CL 1XCTA 1CI5A 4A6YH 5DD5H 5GQBA 3WN5B 2X4QB 3DUHA 1NMCC 4B0MM 2H32B 1IC4H 2VO5A 2B4CL 3E6HB 4Q9BA 5FYLL 4KK6C 4L4VE 5I1EH 2E8ZA 3FB5A 3OR7A 2G75A 5D96B 3ZKMD 2CDFB 2NXZD 3GK8H 2DIAA 5CEZH 4UUJB 1I8IA 5LXGH 4OZHB 5C07B 1SJEA 1HDMB 1X5XA 5CMAA 3BMWA 5T3XE 1U93A 1J5OH 4PFEA 2IPTL 5F9WC 3WFCH 1RK1A 4H20H 4JHZA 1KN4L 1KPUB 3KAAA 4KAQH 3Q5TA 2FJHA 1A7QH 3DRTA 4RFEB 4MD5A 1T7WA 2FYYB 2WUBL 3N1QC 1EEUA 3FO0L 3IXTA 3OBAA 3VWJC 3FFDB 4Y4FA 5TDPA 2VB5A 3OHXA 1FAIL 4TOYL 1XR8A 3SCMB 3I3DA 5EOCH 1CXLA 3X11A 2R1WA 1JWSA 1F6LL 1A7BA 2IAMC 5C08D 1CXKA 5T1LD 2FSEA 3N0PB 3WNMA 2FJFA 3QNYA 2FRGP 2VXSL 1KCRH 3R1GH 2DQJH 5HJ3A 2VLJE 1VADB 1LO3L 4HHAA 4P2QE 1J0KA 1INDL 2EDHA 5FA4B 3T09A 4KU1A 3GHEL 3I75A 4GKZB 5E5UB 3SGDI 3ZLQC 2AQ3A 2VQ1B 1R3LB 1CDJA 1MF2L 2GJJA 3DVNB 5C9JB 5DK2B 4TPRL 3W9DB 5GGVL 3T4YA 2CH8A 4MLSA 1OAXL 1RIVL 1IZJA 5FB8B 3LKSA 1FNSH 2XTJD 2LTQB 1JV5B 4Q6IA 3MV9D 1Q9OB 4BYHA 3VWJD 1C5BL 5L88H 3IFNL 3BPNC 4PJEE 4KKCC 4QHLA 3GMLA 4HAFA 1LQSR 2Z31A 4ZPVA 1IVLA 1QSEA 3I02B 1BX2A 5FDWB 2IAMD 1AC0A 3EFFA 1UZ6F 3GSXA 3DX7B 2B1AH 5HYSG 3HAEH 3DO7A 5F88B 1VFAA 2J6EA 1KIQB 3VFVA 4F15C 3I6LD 2AJUL 2N56A 5IW1A 1SMAA 2ZWLT 5J1AB 3JV5A 4JFHD 1MI5E 3KYNB 4Y5YA 1PVHA 4LBEB 3KS0H 1PYWA 3GSVB 1ZSDA 2AJYH 4FQIL 4J6RH 2GAZB 3HNVH 3TYFA 1U3JA 2D7NA 3N9GH 1INQB 2X42A 4DFIA 5J11B 1NGQL 4OF3A 2BSED 2J2ZA 2QEJA 3DSFH 2G60L 3VXPA 1U8NA 4CW1B 1F3JB 3RVXC 3TO4B 1YMHA 4HK0B 4Q0XH 4ZUWA 5FUZL 1I1FB 1F2XK 4GMSH 4HXAL 1W0VB 2AV7B 1IC7H 1ZXQA 1NLDH 4JFQB 3UTZB 4AH2A 4PJXF 3ULUL 1XF3A 3WXVH 1IEBB 2YPLE 3U4EB 1EEYB 3MRGA 4QXWA 3OKOA 2YC1B 1GGBL 4CVZA 1QACA 5TQ2H 2M26A 3VXRE 2P24B 4KDTA 3WS3A 3O8XB 4PTUB 4LU5L 3VCLB 1RU9L 4JFFB 4WW2F 2EYTB 4JB9H 4R8WH 1Y6KR 4MA1B 1P7HL 4XBPA 1E4KC 1KJMB 3MLVL 1UACL 3UX9B 4P4KB 5K93A 1KXTB 3JWNC 5JPMB 4LMQE 1DBML 1DFBH 1BD2D 3P9LA 3RVXD 3BP6B 4PJXE 3KNBA 1JGDA 4OFPA 4X5WA 5GS2H 2NTSP 2RBLA 4K7FB 4M61A 4P2RB 2OR9L 5J8OA 1PY4A 4OD3H 3PWLB 1AD9A 1CFVH 4QF1B 3QQ4A 5D7JC 4Y4KA 1FG2A 3QDME 3U7AA 3L3OA 5C09E 1FZOA 2OTUA 1RK0A 3HE6C 3UEZA 4GG6B 3H9YA 2FD6L 4XPBH 1VFMA 2BNQA 3NZHL 2PETA 1DEEB 2FR4A 1YY9D 5HYQB 1FC1A 3SQBA 3QG7H 4M6MH 1AC6A 3MV8A 3GMQA 5FGCB 4LDEB 1BQSA 4WW1B 2F53D 1KELH 3MZTA 2X6MA 3TBWA 6FABL 4LOUC 5ACLA 5ICXB 4XGZA 2VLME 3FB6A 4AZ8A 1TVBB 4JY5H 1T3FB 3ZTNL 3DVGB 2H8PB 5ESAA 4YFLI 4DCQB 2NY2B 3H9HA 2H9GA 4H0IA 5LCVH 5CINL 2R2BB 4JPVH 4IIQB 1KLGA 5L2KB 4FTVE 4NKMB 2W9LA 5JIKA 3RGVC 3O9WA 5D93C 4NQXB 3IU3A 5FAAA 1LE9B 4G8GE 1KIUA 3HE6D 4K94H 5DRNB 1F3DJ 3QFJE 1D5ZB 3GMRB 4MNQB 4G6AD 2VDOL 1NDGB 2BNRA 2WBJA 5DXWA 3HTLX 1LO5B 2EDFA 4U1JB 3GJFB 4HWZB 1MI5A 4Y2DC 4JVPA 4O00A 3VXSB 3G5VA 2XA8L 3QUKB 3OX8A 3G04B 3S35L 2W0PA 1I1CA 3RWDB 4ETQB 3NFNA 3BJLA 4QWWC 3KXFE 1KJ2B 3RI5K 4MA8H 5A16B 3ULVF 3OB0H 2OJZL 4X6EB 1DCLA 1DQDL 3CDFA 2ZOKA 3EDEA 1VB9A 4GW4A 5HHOB 3GO1H 2UZIL 2EXYD 2A1WH 4NKOA 2NY5H 4IMLB 1IMHC 5I0DA 4ZQKA 3D39A 4JZNA 4XB7A 3BQUA 1JL8A 1IC1A 1Q38A 4XHQA 4K3EH 5KSVA 4RFNB 1X4YA 1GYAA 5J3HC 4S1SL 3AY4A 3ZT6A 4R2GC 2ZCHH 4Y2DD 1YYLL 3P77A 1J1OH 2AK1L 4NM8L 2N4IA 5CCKH 3VXRA 3V79C 5A1AA 3LCYA 2DQDH 4GMTL 3WFBH 1N64L 1IBGH 1U2CA 2A74A 1N4XH 5D1ZA 5C0BD 4RBPH 5EU6A 3SE4A 5E00B 4TUJA 3BRFA 5EO9B 5ADOL 1QFPA 2X5PA 2BC4A 2YRZA 2Y9RT 2DL9A 1BLNB 1HOCB 3C8KB 2P5ED 4RGMC 2J6EH 3SO5A 5I8CB 5C09A 2AJZA 5EN2B 2R0LL 3BD4A 1DN0B 4P5MB 1S7QB 5D7KE 5C0ND 1OAQL 5A3IC 2FB4H 4UQ3A 2EEDA 4WW2A 1FH5L 5JOEA 3MJ7A 1L0QA 3KPPA 5JLZA 4W6XB 4ESKA 1K4DA 1QLRA 3PHOB 5ID1B 3L3DB 1ZGLP 4MNHB 2PO6B 4DGIL 3KPOB 4WUUD 2BOCB 3FT3B 2C9AA 4OV6F 1G7JB 4NO3A 1ONQA 3CC5A 4LPCA 3MJ8B 1T5XB 5EB9A 1RJYB 4LKCB 3TVMC 4OZGF 1NCBL 1UZ8A 4J1UA 5ADPH 1RD6A 4KQ4H 2Q7YA 1UXSB 4U1NB 1CL7L 5EC1A 4PG9A 4FTVA 5I16B 4WJ5A 4YGAB 2Z8SA 4G8GA 3O6FC 5CJQL 4U31A 5DVMA 1I1YB 2FO4B 3MLWL 5L0QC 1T4KA 4N8VA 1LDSA 3PUCA 4KROB 5CJOH 1P9MC 4FQ1H 5FUCE 5JDSA 1A1MB 1GSMA 1HHKB 5DJ2A 2AXGA 5JHDB 2XACC 2ZUWA 3RAJL 2WM0A 1A7PH 3ULSA 3K8MA 5DS8B 1ZT4A 4OZGE 3KXFA 1RUAH 2MKLC 5I1JH 2JCCB 2FGZA 3ZE0F 1R24B 1S9VB 1GXEA 2PTUA 3WJJA 3QEUB 1EFXD 1HXYA 5IW6A 1NAMB 1VPOH 2ICWJ 1C5CH 4Q2ZA 1CGTA 4NUGH 4NQED 3O6FD 3TBTA 5E7BA 1UA6H 5C08E 4LLMB 4ZS6D 1WZLA 1NC2B 1D9KA 3VXTB 1MFBL 5KVGL 3IF1B 5E24E 1B90A 1P53A 1DBBH 3SGKC 4JKWA 3M17B 1IGJB 5IOPB 3S9DB 2VLKD 4YO0A 2E7HA 1IL1A 5AG9A 1CFBA 2P8PA 2X4NB 5EU4A 1G7HA 2YA1A 4YHOL 5D1QB 4F3FA 3WFDL 3MRMA 2VDPH 5JUEH 4YDJA 3UBXG 5D1XB 4Z18A 5IR1B 3HN3A 3T1WA 2XRAL 3WFZA 3TO2B 3IT8D 5HGBA 3CGTA 4HX1A 3BUTA 1L6XA 3TYGL 5BV7B 3FT2B 2B2XL 5DHVA 4FFVC 3NA9H 4JJ5A 4GKSB 4JDVA 1NBVH 4AIOA 5I71B 3Q1SL 3WIFA 2EDQA 1AGEA 2UWEA 1A9BB 1QKZH 4KRPB 1J0YA 1FO0B 1W8NA 5LJYH 2ZUQB 4BJLA 4F57H 4M3JA 4JFHE 3ARFD 3JTTA 1AGDB 5DLML 1FL6A 4N5EC 5ACZA 1CR9L 1DQMH 2UUDH 1OPGH 2D0HA 2YWZA 4DN3H 3BKCL 4M6OH 1MAMH 5D6CA 3EO1B 1Z5LA 3ZYZA 1HXMB 2W0KA 2VQUA 4QRRB 3G5ZA 3ZYIA 3ROOB 3S3JA 1UG9A 5GRWA 4LRNL 4CDHA 1CT8A 2Y5EA 1EBPA 4JN1H 5J13B 4GQ9L 4FFVD 4G6FD 2EECA 5DUPH 4U1HA 4JGJA 3WUZA 4D3CH 5JMOC 4I77L 4MA3A 1AGFB 4R4FL 5CGYD 5I8KH 3U0TB 1U92B 4B50A 3QO1B 4N9GB 2PW1A 3QWOB 2DWEA 2DD8H 4PJ5B 5GS0D 3BVNB 3CFKB 5KVEH 3GSNB 1B6UA 1RMFL 4OIBA 4RISL 1KG0A 1OTSC 4N5ED 4PJHA 1KIPB 3TIEA 5I30H 3U7YL 4FNLL 4MZ3A 5KJRL 3H8NA 4U6YA 4LCWD 4LASL 1PKQB 3CUPB 4OZGA 5EO0B 4ZG1A 1ZHKA 5C0CB 2QADB 1I1AC 1JF5A 1E6OL 1S3KH 1FNFA 3DHMA 4BSVA 1FN4A 4X6CE 5C0GA 4ZAKC 2EKSB 4D9QD 1UKTA 3K3QA 4GXUN 4W4NA 4OLZL 2FBOJ 2VTFA 5J9PA 2VIRB 1Z9MA 3PV7A 3Q3GB 5FO9B 4OLVL 4R26H 3BWAA 2CRYA 5B4MC 1MHCA 2ERJB 4QXUL 5C08A 5T1LA 1Q94A 1B88A 3DNKA 1U8MB 3WDIA 5BVJB 4P3CH 1EO5A 3ARDA 5L2JB 3OTTA 3QZWB 3C60A 5GGUA 1DANU 3H9ZA 5B22A 3S37X 1YEJL 4JG0L 4PJGF 1AQKH 4PJ8D 3O4OC 5GRVL 3ZHLA 2ATPA 3IDYC 5IT2H 3KLDA 3W0WD 1I1AD 2V2WA 3HE7C 1ERNA 1IZKA 3VXQA 4HIXH 5C6TL 4ZAKD 5TE7L 3EYQC 4YXHL 5JNYB 2G5BB 2HJLB 3MV9A 4M03A 1SEQL 3MODH 2RR3A 4AQ1B 4EOWH 4XVSL 2R2HB 4OCWL 3LB6C 4FFYL 4WWID 5EC2A 4G6MH 2FBJH 1IGCH 4GQPH 2PYFB 4OCNC 5I75C 2ZG2A 3QEQB 1WTGT 4PJGE 3VI3F 3V4VH 3GSWA 4U1MA 1QOKA 3PWPD 5BXFB 1J11A 4ZYKB 1E4WL 1KTDA 4LLYB 1T5WA 2AXFB 3G9VA 3HZYA 4YXLH 5A2FA 1EEZB 5F7HA 4JHAH 2IGFL 1PQZB 3DXAD 3C08H 3O0RL 3EYQD 5CHNA 5FF6B 4OM0L 1OTUD 4LF3A 1B6DA 1XF4A 3E1F1 2R23A 5TH2B 1N3NB 1G1CA 1MIML 2EIEA 1VDGA 1TITA 3UJIL 1C7TA 4XX1G 1A1NA 1KACB 1BZ9A 4PRPD 4ZSOB 1PG7W 2GCYB 1F45A 2Q8AH 3UTSD 5MEND 3MJ9A 4DN4L 3WN5C 43CAB 1ZVYA 2LU7A 4O58H 5GZND 3GRWA 3G5YA 4D0CA 4XMPH 3Q6FB 1SVCP 3PQYD 1G6VK 3EJZC 4G3YH 5JOFB 5DSCA 5D96C 3UTOA 5E2UL 1A6TB 3ULVH 4OJFL 3OJ2C 5GRVK 2HWZL 1IEHA 4S1QL 5DJ8B 2W0FA 1MWAL 5HY9B 2A9NL 1N5YL 4MB4A 1BM3H 1HZHH 4BKLA 3KR3H 4HPOL 2XFXB 4ZODA 5A2IH 4TNWF 4ZO6A 1N6VA 4IRSB 4DZ8A 3OAUH 1KT2B 3QQ9D 2CDEB 5I6XB 2W65B 1T7YA 1A9EB 1HQRB 5C0BE 4NQDB 3QNXB 3PP3H 2DI8A 5ISZD 2XXMB 4LSTH 3QZWG 4OI8A 1BD2A 1HH6A 4OCYH 4RX4A 1RURH 1MIEL 4PV9B 5DHVH 3SE8L 3SCMC 3CVHL 2AJ3A 4RSVA 2O61B 5TE6L 2DQEL 1U42A 2MCPH 4NNYA 4L29B 3CFEB 4FXKB 1AP2B 1CDUA 2AJSL 2MNUA 3MPCA 4KK8C 3DETC 3TT1H 1S5IH 2AI0L 3EJZD 3IJHB 5T1KB 2VDQL 2VJXA 4GAJL 4XC3L 3T1FA 1YMMB 5C0FB 1C8PA 1OSZB 2F53A 5F44A 1Q9LA 4KVCH 5DT1H 4ZUTA 2CMRH 3EYUH 5T1MB 3DBXB 5FFLA 4XP9H 4WUUE 4X80H 5HHNB 3IDUA 2D9QB 2IPKB 5IQ7H 5FM5M 2PUQT 5HGHB 2Y06H 4K7PL 4ZUVB 2QQNH 5ANMA 1NGXB 1WT5A 4CMHB 2X09A 1FBIH 2XN9B 2C4FU 4U1SB 1EERB 1P1ZB 5GIRA 1TETH 2NMSA 3ARVA 2X41A 2WBKA 3OL2A 1PZ5A 2WIMA 32C2A 2VISB 3ZKQD 2R0ZH 1KCKA 4NQCB 2NNAA 3DETD 3EOBA 4PJGA 5EORL 2Q86B 3FO2A 4GRMB 1U8HA 3OG4B 1DP0A 4NBXB 4ZPTB 3SY0A 3PWVB 4AIXA 1HYSD 4GBXD 3AS1A 5DD5L 3B9KC 4A6YL 1OL0A 4JGUA 1TNNA 1T0NB 3RZCC 4C59B 1A47A 3IS1X 3VXOB 1IC4L 5E2VH 1KYOK 1IAKA 4KKNA 1CLOH 5J11C 4MGXA 2V5RA 4XXCA 1EHXA 5I1EL 1SBBA 2E27H 3GK8L 4GLRH 1XT5A 1CFTA 5CEZL 5LXGL 3GMNA 3DUUA 3O6KH 4NQEE 4AJ0A 3QRGH 2ARWA 3WL9B 1J5OL 5DJXA 2XQYG 5F96H 2FATL 4G8EA 3WFCL 3KYMA 2GT9B 4H20L 4WENB 1AHWC 3TJHD 1G7IA 4KAQL 3HB3C 1JNJA 1A7QL 3CSBA 3EYOA 3QDGD 4GUPB 4JFEE 1SHMA 3Q48A 4Y2DA 4ZFFA 1J12A 2HAZA 5EOCL 3WFHA 2VLKE 3B9KD 3RWGA 1JP5A 1HHGB 3O8XC 5KZCB 4EUPA 4UAOC 1FL5B 4TQEH 3R1GL 1KCRL 1NFIB 1QTYT 2DQJL 5I8EA 5C0BA 4BUGA 4OLUH 5F7KC 4Z0XB 1U8IB 3ZL4H 4PJCE 1J0ZA 3N1MC 2A6DB 1M05A 5ITFB 1ZS8B 4FN0A 1V3LA 4HGWA 1P69B 4E0RA 2P5EA 3GSOA 1FNSL 4P2OD 4XXDA 4KKBD 3V0VB 5L88L 1OWRM 1JJUA 3L5WA 3JTSA 3GHBH 3O6LH 4LLDA 4N0FA 4ZNEA 1TTGA 4MDJA 1A21A 1J0HA 3OKEB 2H2PC 3VH8B 5BS0B 1F02I 4LLWA 1YA5A 2OL3A 5D2LB 2NY2C 4R7NB 3LQAC 3QFDB 4AIZA 4NSKB 3V5KA 2Z91B 3VXME 3P0YH 4FMKA 1L0XA 1L7IH 5HVHC 2ZUVA 4IIQC 5EDXA 1UQSB 1CD1A 2AJYL 3N06B 2VOTA 5F9OH 4J6RL 1WUNT 3MJ9H 1JZ4A 4R6UA 3BN3B 3HNVL 4MB3A 3VJ6A 4HULB 3N9GL 1L6ZA 1X6LA 4X9HA 3S4SA 1M4KA 1M7IA 1FYTB 3DSFL 1KPRB 4OUOA 3JUZA 4YUEH 4P23C 3K8LA 4TN9A 4HKJA 5CD5D 3STLB 4Q0XL 1JK8A 5CJ5A 3NIGF 3H0TA 4D0DB 3BYTA 4GMSL 4KPHH 4Z7OF 3MUGB 1XGPA 3FOLB 1IC7L 4RGND 4LCWE 3UTQB 1NLDL 2CIIA 5FA3A 1J9CT 4I13B 5SWZB 2OBGA 4NDMA 4RWYH 3WXVL 4ELMF 1EJOH 1BVKB 4X8JA 4D9QE 5CGMA 2VL5A 3QDJA 2EEBA 3P4MA 3ZTJH 1LEGA 4QY8A 1QVOA 5TQ2L 1AIFB 2ORBH 3EDFA 4ORGB 1EFXA 2NY0C 1CFQB 1QFUH 2XPGB 3QQ3B 4PJDA 3QUYB 2IAND 3O6FA 2BHZA 4I3SH 4JB9L 2RHEA 4NQEA 1RHHB 4R8WL 2WNGA 3V6OE 4D2NA 3MR9A 1F4XH 4UOW0 2XKUA 3BD5A 2VKWA 1K6QH 3NIGE 4BQ9A 4O2CA 5ELIA 4Z7OE 4EEEA 1DFBL 4P23D 4M7ZB 3VRIA 3BJ91 3P4OB 4ZO7A 1IKNA 1NUNB 3MBED 2E6PA 4XHJC 4ELME 4OD3L 1REIA 2CR3A 3G5XB 3OGOE 1YJDC 2W9EH 2MQ0A 3G6JB 1CFVL 5DQDH 4XNZC 3VXUE 1FIGH 4M62H 3OKLB 2J12B 2HFEB 4UQ2B 3T04D 4XPBL 5E95B 3P73A 2LVEA 2YD5A 5J1TC 5ICZB 2BVOB 1VFBA 2FX8H 3FHAA 3GMOB 5DEFA 3TPUA 4EQ3A 1KSRA 4BM7A 1KELL 4E41E 2H1PH 2NY0D 2OMBA 3QEHA 5CP3A 3TN0C 3U1SH 2JB6B 4JY5L 4U1GC 4U6XA 4NRXA 5GRUH 4LKXA 2NY7H 1XZ0B 2DQUH 5LCVL 1K5NB 4NOFA 2NLJA 4JPVL 5IV2A 3ARFA 1C1EH 1WCBB 1K8IA 1OARH 5ENWA 5C0DA 4PRHB 5KSBA 4IM8A 5AZ2H 4JFXA 4R4BB 3HZKB 43C9B 4K94L 2PO6C 4GJTB 1FZKB 3DXAE 3NMEA 4N0CC 4N90E 1ZT7B 2EO9A 1A6ZA 3BP7B 3RVUD 1I8KA 4Z5RA 1ZMYA 3V4UH 4QRQB 1NFDF 2YKLH 3IRZA 3WO4B 2NW2A 3CU1A 4F7EB 4PRPE 2WWMD 4KI1A 5KANI 3UTSE 3NIDF 3CSYA 4MA8L 2ED9A 3FQRA 4Z7VA 1YEEH 1NGYB 4BA8A 5DMIH 3GO1L 3PQYE 4KMQA 2R4RH 2A1WL 1X5AA 2A6JB 2VL4A 2NY5L 1J0IA 4LSQH 3BP5B 3ZKXB 4HEPG 3QPXH 4EUPH 1RZ8A 4HJ0C 4LCWA 4QRSB 4PD4J 2R29H 4HKZA 4DEPC 5ISZE 1U8OB 2DKMA 5I2IB 2BFVH 2ZCHL 1BREA 4JY6A 2XWJA 1J1OL 3DV4A 4GKNA 4HMDA 5CCKL 2I9TA 2O5XH 1FDLH 1B4JH 2VE6B 2HLFC 4IHOB 5CEYB 3WFBL 1X5GA 1IBGL 5F3BA 4N0UB 3WE6B 3O81A 4AM0A 1HSBA 1N4XL 3V6OA 3T65B 3IFPA 3OJDB 1ZWIA 1P4LA 3E6FA 2ADGA 2WINA 5F70A 3V6BR 4C58B 3VXNB 2UZXB 1YN6A 1ZGLA 2PTVA 35C8H 1KGCE 2R1XA 2YD2A 4OBSA 4WHTA 4ELMA 5C07E 4PJ8A 3L3IA 3KPNB 2J6EL 8FABA 3QIBB 2IEPA 1MY7A 3W0WA 1YC8A 4JY4A 1LD9B 3BDXA 4XCYB 1TENA 2FB4L 5CSGA 1WGOA 3D18B 1NDMA 5D1XC 1GAFH 4KJYB 4WV1B 1QBLH 3K46A 3BEVB 1CE1L 1JI1A 1VGKB 4YNYA 4Z78A 4ENED 5BV7C 1JGVH 1QSFD 2NY1B 3BZEB 4NCC1 3IKCB 2VAAB 4I0PB 4GXVH 3KDMA 1ZVSB 3RIFF 3TBVA 4ODUB 5ADPL 3HUJA 2OI9B 4KQ4L 1QG3A 5DYOB 3PWPA 5DRXA 1A4KB 2DTSA 1EHLH 3MRBB 3H2WA 3O2DA 1GH7A 4X8XA 4NN6B 5J7CC 4HIEB 5BRZD 4U6TA 4DKFH 3MRQB 5GSRB 2D2OA 3V6ZB 3RY5A 1NJ9A 1CXEA 3DXAA 1VGEH 4WDIB 3RNQA 1WBZA 3H9SB 4HUUB 4PGZA 1N2RA 1QPXA 1NFKA 2EYRA 4FP8L 5CJOL 3WLWD 1UB6A 4FQ1L 1TJHH 3VFOA 4XZUA 1K4CA 4ZOCA 5J13C 1A7PL 4PRPA 4RBPK 4LIQE 2VXUH 4NHUB 4OF7A 1X5FA 3DIFA 2GYSA 5D2NC 5MENA 4KK5D 1RUAL 5DGQA 4ZTOH 3SN6N 5I1JL 3BUYA 3LKPA 3K1DA 2Y5TB 3QDGE 1GGUA 3D2UD 2E9IA 5EOQH 3LEXB 3VDBA 1C5CL 5DJCB 5LGJB 4NUGL 1ZA3B 1H15A 4Z76A 4NC0B 1ORSA 4JN2B 1UA6L 4QTIH 2OTPA 2ARJB 1NFDA 5HYJB 2CSPA 4UDUB 3FRUA 4XNYH 4P46C 4BH8B 1DBBL 3GSRB 2V2XB 4J3UA 2APTA 3ILPB 2QBWA 1IGIH 5CP3H 2PYED 4YR6B 1MUJA 1UWGH 1EX0A 2Z0BA 3P0VH 1LP9F 4XBEH 1D5XA 4LCUB 4NQVA 2I07B 3GUTA 2VZTA 2VDPL 4U7MA 4HIJB 4QYOB 1X5ZA 4UNUA 3EHBC 5JUEL 4NKDA 4BQ8A 4F7MA 3IRPX 5C0IB 3KWWB 1G7QB 4X98A 2DQCH 5SWSB 4KZEL 1G7LA 2B4CC 3NZ8B 2UYLB 3ZO0A 1DQJA 1NCNA 3G6AA 3DLQR 3C6LA 3NA9L 1MWAB 1NBVL 1Q0YH 4I48B 2M2DA 4V2CB 4LLQB 5D9SB 5IB2A 2IALB 1FJ1B 2VZOA 1QKZL 2YXMA 4FMFA 4P46D 4F57L 1XF2A 2X4SB 1LP9E 4MQXD 5GS3A 4Z0BH 2EDBA 4GW5A 1X7QB 3P9MB 1DQML 1OPGL 1TCMA 2GFBB 1G9MH 4AL8H 2CXGA 4DN3L 5EU5A 4M6OL 2WW8A 1ZLUH 1ES0B 1UWEH 1MRFH 5GS0H 2GSGB 4OLEA 2FL5B 2I5YH 1S7WB 1S8DA 3V4PH 4RWHA 1BVLA 4JN1L 1FP5A 3QUZD 5CP7A 4ZOAA 5DUPL 1U91B 4EVNA 4EI5B 4GBXA 4D3CL 4OKVA 4OLWH 4J3XA 2X2YA 4Y5VB 5I8KL 5IB1A 3KPRD 5HI4C 1V7MH 3VFUA 2DD8L 1HWHB 3SE3A 5KVEL 2FIRT 5EUOF 4LK4A 1DQQA 3BH8B 3QI9C 1QEWB 3N85H 5I30L 2YA2A 4MD4A 2VERN 3ZHDA 2F54D 2GJZB 1X5IA 4KUZH 3D1MC 3ZZ1A 4D9RE 1VFUA 4TUKL 2HLAB 4HUXA 5T3ZD 5T5FH 3FQWA 1G9NH 1S3KL 4WU7B 2APFA 3C9NB 3MRFB 4FQLH 5IMLB 1CICC 4YIQA 5JW4Q 1NCAH 1T83C 5GSVB 5ETUB 3BDYH 3TLRA 3X13B 1BP3B 2YWYA 4F2MB 3VXSE 3UYOD 3LVEA 4Y7MA 4X7EC 5HYFA 1IM3B 3WNLA 2B1HL 4ACPA 1WITA 4R26L 4XPHH 5EUOE 2XICA 5B8CA 4PGCB 1GVIA 2EDNA 4A6YB 4JO2H 5IVXF 3UPRA 3BRDA 4NYLB 5BZWA 5K9QI 4R7DB 4P3CL 1UENA 3PL6D 5EUKB 5F1OB 5GHWH 4Y1AA 3QI9D 4XNQB 1P7QD 4UU9B 1GGCH 2AEIT 2WAHA 3AM8A 1AQKL 1ZHNA 3CZFA 3ZHKA 4YX2H 2UY6A 1R5VB 3W39B 1DVFC 4CGTA 4H0GA 5IT2L 1NUGA 3FN9A 3VMOA 5D7SH 4HIXL 5JQ6H 4P2OA 3U82B 3LN9A 1KCSH 2BSSB 2Y72A 2H26A 4J2XA 4JRXD 3MODL 3ULUC 4EOWL 3O2DH 5IVXE 4KQ3H 5M95B 4JQVC 1MJ8H 5E0QA 4G6ML 2FBJL 1IGCL 1SQ2N 4RAVA 4WVRA 1I8MB 5GXBB 3O4LB 3LEYH 4RZCA 1CDCA 2Z35B 4C56E 2HT4C 1UKQA 3V4VL 2HRLA 1F6AB 3CZJA 1A14H 3MJGX 4ZFZA 3MBXH 2FX7H 4JPKH 1NCWH 1J8HD 3D85B 3U6RA 1WCQA 4HKXA 4B5EA 5D5MB 3VFTA 2HFFA 4CMHC 1CQYA 1DVFD 2B39A 2VZ3A 4YXLL 1UH4A 4JHAL 3C08L 5KOVC 3MGOA 3RL1A 3QCTL 5EULV 1MCOL 1ED3B 3BXNA 5GGSB 4WTXA 5EFIA 5IHBA 3WO3B 2NY3B 3AROA 3ET9F 2CGRH 5FHBH 4JDTH 4WTZG 1X44A 3NCFB 3AREB 5JOPD 3C6SB 3DECA 4O58L 4NOBA 1ZOXA 1WV7T 4I9WD 4HIHB 3PWUA 4XMPL 1T22B 5LGKA 4G3YL 5HPMA 2HTKD 3HAEB 3ULVL 2LQRA 5CLTA 1TVHB 3SPVB 3C5ZB 4JAMA 2EH8H 3ZDZF 5EBGA 4TVPE 5INDA 1TIUA 2ED7A 4CVXB 1BM3L 1HZHL 3L5HA 3KR3L 4J3OC 1TLKA 4PJFA 4EN3C 5IEHB 3UTPE 3OAUL 1ODAA 2IANA 5LGHH 1JGEA 3MOBL 3HMXL 4G43A 2EE2A 4L1DA 4LSTL 2Y25A 4L3AA 5LAXA 4OCYL 5DQJB 1RUQH 3CXHK 1RURL 4E9LA 2J88H 3MBEA 4PJ9C 3JZ7A 5GJSH 2MCPL 3L9RB 1TQBC 1YEDB 1SYSB 5EUOA 3VWKC 4F7CB 1AGBA 5JDJA 3ZDZE 2KZWA 4RIRB 4X6DF 1F3RB 3P40A 3R0NA 3TT1L 1S5IL 1YUHA 3OG6B 1I1RA 1BEYH 2SEBB 1BIIB 5IJVB 1FV1A 1JMXA 2NR6D 1WFNA 4KVCL 1C12B 2NQCA 4EN3D 5E2WL 2X9WA 5DT1L 1FVDA 2CMRL 1XAUA 5IKCA 3EYUL 1QSFE 3BD3A 3P2TA 4QRPB 4XP9L 5GGRA 1ZLWK 4X80L 1UYWH 4GSDH 4YGVA 1VHPA 4IS6B 5IQ7L 3RKPA 2Y06L 4PREB 2QQNL 4NN5B 4X6DE 1FBIL 5FK9A 3B5GA 1TETL 4QT5A 3OPZH 1IM9D 3VWKD 4LNRB 4NCC2 3MV7B 4U49A 1YY8A 5IUSA 1GCFA 4OLXH 2DLHA 4LLAA 3MREA 3ORJA 2C3VB 5MEOB 1SJXA 2VN4A 2XIDA 4MAYA 2ADJA 1MJUH 2EH7H 3HC3H 3R8QA 4HLJA 5IJKC 4X4ZA 3HG1D 4MQ7B 4MVBC 4MHHI 4LIQH 4YHIA 2HVJB 3PP3K 3WMSA 4I18A 5E2VL 4JFZH 1CLOL 4G42B 2BSTA 2DBLH 4NPYA 2E27L 4XB8A 1I3UA 4TUOA 4FQHB 1DEDA 4QEGA 3QH3B 3ARBB 1NGWB 4XNMB 3O6KL 4ISVB 3QRGL 1XCTB 5F96L 4MJ5B 3FQNB 3SDDC 1LK2B 3TBSA 2PN5A 3RGHA 4MXQC 5EOTA 3LKQA 5H94A 4NQUA 1B0GA 1HILA 4LARH 3FB5B 2DLTA 2G75B 3OR7B 3A67H 2D4DA 4LHUD 1RFDH 2PYEE 3EKCA 4CMMB 3Q5OA 2JE8A 4OFKA 3WS6A 2BOBB 1SJEB 5D2NE 1SEBA 5GGTA 3TF7C 2YPKB 3PV6A 4TQEL 3LS4H 5C92A 4RMTA 4ZUSB 4OLUL 2C26A 5FCUL 3MUZ1 2YZ1A 2HT3C 3GKWH 3PP4H 3ES6A 3DRTB 5ECJE 4KY1H 3ZL4L 1IQDA 4LGSB 3SDCB 1LO4H 3O3EB 1VEOA 1EUTA 2C1PA 3X11B 3ROLA 3SDDD 2OLDA 3FO1A 2R1WB 5DI8A 5I76A 1X5YA 2FSEB 5C0CE 2OJEA 2FJFB 4WI4A 1BQHG 5E9DD 1MCBA 1VERA 2XWBA 5HJ3B 5F7YC 4HHAB 4LCIH 4AQOA 4WNQA 1H0DA 3GHBL 2H45A 3O6LL 3I2CH 1S7SA 2GIYA 3LV3A 5JXEC 1J05A 1FSKB 3GMMA 5IB5A 4IRJB 4P9HH 3D0LA 1TFHA 1TZHA 3VD3A 4PP1D 4QOKB 4P5TC 4Z7NF 3F58H 3LKSB 1ORQA 5HHQA 1YN7B 3P0YL 5IB3A 1L7IL 5F1IA 3FOMA 5F1KC 4QHLB 5F9OL 1NBYA 2HJKA 4JKPH 5H35A 4LGPB 4S10A 4K71C 2VRAA 3HI6H 1JZ6A 1QSEB 4O51A 3GSQA 1BX2B 4MJ6A 3ABZA 1RJLB 3D48R 4ZTPH 5BRZA 3EFFB 1CFSB 1ZLSH 4OGYH 3KPRE 3B4NA 3BZ4B 3CX2A 4YUEL 3VFVB 4L8SA 4PJBB 5IW1B 1T2JA 5I18H 1AXSA 4UIKH 1AR1C 4Y5YB 2HKHH 4JFDB 5KBNC 4KPHL 4Z7NE 5JXED 4V1DD 5CZXC 3L3JA 4YC2B 2GTZA 5F7NC 4UB0L 1BGXH 4UTBH 4ZO9A 5FV2A 5T5NG 5T3ZE 4RWYL 1UT9A 3EW3B 4P5TD 3LKRA 3ECBB 5I1DA 1EJOL 2E7CA 4BSWA 4JZJC 5IBLD 1U3HD 4MJID 1F5WA 5CWSB 2ORBL 2CLVB 3C5JB 5FUOH 1LHZA 1EA9C 4Y19B 3D2UA 1S7TB 1UC6A 1QFUL 1YMHB 2IFFH 3ZKXC 4IRZH 4P59H 4MWFA 4HS8H 4I3SL 1OAYH 1XR9A 4HW6A 1F4XL 1MNUH 1K6QL 4J3SA 4MX7A 1XF3B 3DMMA 5KSAD 3GGWB 2IADA 3BYYA 1VKXA 3HCVB 3F7VB 4L4VB 1AR1D 3EJJX 3OKOB 3WBDA 4BZ2H 2PCPA 4OD2A 4HIIB 4Y8DC 5DQDL 3WS3B 3SDXA 3SDYH 1FIGL 2PW2A 4M62L 1ND0B 4Y16C 1T0PB 2QL1A 1NSNH 4KJPC 4UV7H 2FX8L 3MOQA 4NC1C 3QG6A 1HI6A 3WNKA 4FQQA 5ICYA 1C08B 2EC8A 1TJGH 2F5AH 5EU3B 2V17H 3P9LB 3TA3D 2H1PL 3QUMA 1SY6A 2RFXA 2VXTH 4X5WB 4PUBH 4ODXB 4M61B 3U1SL 1CK0H 4X6BA 3KPQA 1AD9B 2X40A 1OM3H 1UEYA 4MXVE 3QQ4B 2UVFA 5GRUL 3QIBC 1RV6X 2OTUB 1E27A 2DI9A 2NY7L 3BPOC 5HI5C 1RAMA 2DQUL 4EDXA 2VLJB 2JJVA 5EZLB 4YEEA 4GRLC 1C1EL 3T0EA 1OARL 3KLAB 1J8HE 3GMQB 4Y89A 1D5BA 5AZ2L 3S3PA 3TBWB 4JQXA 3KHQA 4XC1H 4WHCA 3MLPA 4L5FL 1MJ7H 5JIHA 4Y16D 1I3RA 2G9HA 5I1HH 2NY1C 1KLFA 3RWHB 3WFEH 4KJPD 3BP4A 2IQ9H 5ESAB 3RI5F 2A73B 3V4UL 2EDRA 2H9GB 4NZDA 3ULUE 5ILTH 2D7QA 2YKLL 4WEMB 3DV6B 3HRZB 3QUZA 4FQCH 3REVA 1RSFA 3ZKNC 3JXAA 5L9DH 3MRNA 3DOSA 4H26B 4I9WE 3H3PH 4XPTH 1YEEL 1I4FB 5DMIL 1LNUA 3NAAH 4X7TA 2R4RL 2ICCA 4GRLD 2WBJB 1HHHB 4JDZA 4LSQL 5KS9F 1KB5A 4OQTA 5TGBB 1JZ7A 1MI5B 4I4WA 2APWA 3G5VB 3QPXL 5GGTH 2F54A 5E99H 3BGMB 3OX8B 5FM4A 5JW4N 1WZKA 3KLSA 3EOTH 2Q87A 3NFNB 4ZFOA 2R29L 3RPKA 1MHEA 2AEQH 2BFVL 2ZOKB 1CYGA 5JW5B 2ATKA 4GW4B 1CIDA 2O5XL 4NKOB 1FDLL 1B4JL 2QKIA 2PNDA 1OAUH 4IJ3B 4ZQKB 4FZ8H 4JZNB 1YPZF 1RZJH 5KS9E 2AGJH 2QSTA 4M3KB 4YHKH 4O02H 5KOMC 5KSVB 2F58H 2DOCA 3RU8H 5E56A 3V2AR 3A0OA 3PL6A 2YPLB 2OR7A 3LPGA 4J7RA 5E6ID 5J6HA 35C8L 2FDBP 3P77B 4R96A 1UJ3A 5DRZB 4GT7A 3MRHA 3VXRB 4PP2B 2HH0H 1WVZA 4HBQA 1RZIB 1YNLH 2A74B 2HN7A 3BISA 4NO2B 4XNUH 3V6FA 4PLNC 3TC9A 1MCWM 5D7IF 5EU6B 1YPZE 2YD7A 1GAFL 4MS8C 4WHYH 4JRXA 3LPFA 4TUJB 4YZFF 2WP3O 1QBLL 2CUHA 3LY6A 5IIEA 1ZTXH 2NY4B 3H3BC 4PJXB 5DEGB 7FABH 3QEGH 1JGVL 2QQLH 5D8JH 3RDTB 1TCRA 4C4KO 2F8OA 1DUYA 3T2NH 1H5BC 3NN8B 3QDMB 4GXVL 5FOBA 5C09B 2AJZB 2WUCH 4XRCA 1XGQA 5C2BH 1KCVH 1HH9A 1IILE 5FGBC 4MCYB 1PY9A 5HGDB 1XGTA 2YD9A 5DTFA 1EHLL 3BKMH 5JLZB 3REWA 3HG1E 2M1KA 2NTFA 4X4YB 1JNHA 3KPLA 1K4DB 5D7IE 1WWWX 4L8DA 5K9OA 4Y8AA 2VKXA 4DKFL 1IGFH 2ZG1A 4HGMA 2ICWB 4MA7H 4NFCA 5H37H 1NMAH 1WF5A 3T3PF 3VRJA 1VGEL 4JRWA 5HHXH 4X7CC 1ONQB 2EC9T 3MUHL 3W9EA 4PGBA 4KC3B 4LVNB 5GJTH 3CFDA 5GZOD 5JMRA 5EC1B 4FTVB 1GL4B 4EI5C 4G8GB 1UM4H 3HR5B 4Y5VC 4L4TD 2IMNA 3QFJB 4OGXH 3L6FA 3QHFH 4N8VB 2VZ1A 1S5HA 5JDSB 1BAFH 3N1FC 5EOQL 3S5LA 3T3PE 5DJ2B 2AXGB 4QTIL 2H3NA 1I7ZA 3IJYB 5B39A 5CJXC 1OQOA 4UMGA 2BY2A 4XNYL 3KXFB 4TULH 2PKDA 5KG9A 5K33A 4M7LT 3QUMH 1SY6H 1IGIL 3HZVA 1RULL 3IFOB 1UWGL 4AENA 1HXYB 3VFMA 3P0VL 4Q2ZB 4XBEL 3PWNA 4OUUB 1MLCA 4HFWB 4YAQB 1EO7A 2V9TA 1KUMA 3QCUH 4ZXBC 5A43C 4H1LH 5CD3B 3CH1A 4G9FA 2V6HA 4YO0B 3AAZB 1Q0YL 3FJTA 4WWKA 3CH8A 1DLHA 3CLEH 4LCYB 3OGCA 1WBYB 3BPLB 3AUVA 3MRMB 4BFEA 5IHZA 2N7AA 1EV2E 4UOJA 5ALBH 4YDJB 4M4RA 2KPNA 5J0BA 3CNKA 1FFPB 5L2KD 4P99A 4JFYB 2BMKA 4Z0BL 1EIBA 4DWHA 5HGBB 1OP9A 4HX1B 4TTDD 3CD4A 5EBMA 1G9ML 1IM9A 4AL8L 5DHVB 3MV11 3VWKA 2XV6B 1NEUA 4G5ZH 3NCBB 4F7PA 1UWEL 1OWWA 2AQ1A 4APQA 1MRFL 5GS0L 5AAMA 1KB5H 2I5YL 2Q1EA 4OQTH 3WNPA 2ZNXA 3V4PL 1FCCA 4J3TA 4OI7A 3JTTB 1F11A 1FL6B 4V1DE 4OLWL 4M5ZH 5TF0A 5ACZB 1JVKA 4RAHA 1Q9WA 2CR6A 1FNHA 3V0WH 5BW7C 1V7ML 5I66A 2DMKA 5EH1A 4DVBA 1AI1H 4K7PY 2YPVH 1UM6H 4MJIE 4F9LA 3N85L 4P5KB 2NY3C 3G5ZB 4FRWA 2BCKA 4PLJD 2ZPKH 3V8CA 3D3VD 4HT1H 3JSSA 4KUZL 2VABA 4KH2A 3AREC 4YJZL 5T5FL 1G9NL 2N1KA 4BFGA 3CCHA 3PGCA 1D6VH 1HNFA 1TVDA 4BZYA 4FQLL 2DI7A 3C5SA 1NCAL 2CDGA 3MRJA 2PW1B 5J4MA 2DWEB 4JCMA 1AO7D 3BDYL 4U1KA 5DZOA 2PR4H 4F9PA 3AXLA 4QKXB 1N5AA 2NXZB 1KG0B 2F74B 2IC2A 5IJKA 2A83A 4PY7A 3TIEB 2VDLH 4HBCH 3MRKB 4LHUA 4PTTB 3DGGA 2WLYA 2VSDA 4JO2L 1CG9B 2X89A 3IETA 4OZGB 1JZ2A 5HYIA 1I8LA 2OTWB 2CK2A 5GHWL 2AABH 4J3VA 2XKNA 4FXLA 5C0GB 1U8QB 3JUYA 2QLVB 4YX2L 3WNOA 4WGVB 1XF5A 1BVZA 1UVQA 5J9PB 2GITB 1ZLUK 5DO2C 3D25A 1KBGH 2JELL 3UCRA 3P9WB 1C16A 3RWCA 5D7SL 3S36X 3BH9A 1NMCB 5C08B 1FNEA 3EGSA 1Q94B 3OAYH 5T1LB 5JQ6L 3WLBA 4ZO8A 3TGXA 1KCSL 5EZJA 2APXA 5E9DA 3AC0A 4CNIB 1Z2KA 2COQA 2X1PA 2X4UB 3O2DL 3SGJA 1MJ8L 1KIRB 3WUWA 5GGUB 3H7BA 1DLFH 1RUKH 2B0SH 3X12A 2NX5E 4HH9A 2KZ1B 3LEYL 3MCLH 2ATPB 2GK2A 5K9KB 5F9WB 4UINH 4C4KT 5DVKA 3T0XA 3VXQB 1DE4A 2AEPH 1A14L 1HWGB 4XPFH 4HF5H 3MBXL 2FX7L 4JPKL 4EI6B 2YSSA 3TBYA 1NCWL 3VFPA 1IKFH 3VWJB 5ESVB 4MNGE 5DVOA 2ZNWA 3CFBA 4LFHG 3C2SA 1BJ1H 5EC2B 3VI4F 1N8ZA 2QSCH 2VR9A 2RIKA 2IAMB 5GGSY 1MHHA 1RZFH 3OZ9H 1TTUA 1NMBH 4KROD 3KHOA 1GZPA 4U1MB 2CGRL 5FHBL 4NRYA 4JDTL 2FHCA 3SGEH 4B53A 4XP5H 4JLRB 4V1DA 5GRYA 5JPNB 2NY6D 4L8CB 1EUUA 3B5HA 3TIDA 4PJ7F 4HDIA 4P5TA 1NC4D 3VI4E 2IQAA 4LF3B 4FABH 1XF4B 1U3HA 2EH8L 2R23B 4MJIA 5D7LD 4KRLB 4HS3B 1EPFA 3MNWA 3OJVC 1BOGA 2AK4D 3NBNA 1D7FA 2IPUG 1A1NB 1XF1A 5DURD 1BZ9B 1I9RH 5LGHL 1S7VA 1S7XA 4FQPA 1MLBB 3LQZB 3QIWD 3RA7H 3FB8A 4QCIB 1AKJD 3B9VA 3WHE1 3H9SE 5KSAA 4K94C 2ITCB 5E8EA 1T6VN 4F15B 4NFBA 1RUQL 2J88L 4H25A 4O2FB 3HFMH 2W0FB 5GJSL 1U58A 1DDHB 4BKLB 3TNNB 2V2TA 2K7QA 4OFDA 4UILH 5D1QD 4DZ8B 2HG5A 5KN5A 3PGDB 1BEYL 3D69A 4U2YA 5DMKA 2LU4A 3CVIH 5DJZA 1MVUB 1BD2B 1HH6B 3TA3A 3V0AC 4Y4FC 2HT2D 3J7HA 5D4QA 2AJ3B 3U9UA 4RCAA 4DFHA 4MSWB 4NNYB 5D6DA 3MC0A 1UYWL 5HYJE 1SBSH 2GEEA 4GSDL 5F7DA 3QO0A 1NCTA 2AVGA 5AD0A 1GZQB 3B6SB 3EYFA 1MREH 2X4RB 3ARUA 3OPZL 1QA9A 1Q9LB 1FSKC 5DK0A 4OV5A 4KJWC 3M1BA 2OR8A 5DD6A 2XQBH 2DQTH 4Y16A 5HYSA 4OLXL 3VD4A 5FGRA 4PGJA 4O5LH 5EIIA 4QRRD 1MJUL 2EH7L 4MDIB 2XG5A 4Q6IC 3HC3L 4NWUH 4U3HA 1XGUA 1WISA 1B9ZA 4Z7QF 3ZYOA 3QNZB 4LIQL 3JWDH 2XTLA 3CDYA 2BJMH 2Z31C 3BKYH 1RZGB 4WFFD 5GIRB 1P4BH 2X4QA 3TCXA 1A02N 2CK0H 2H6PA 1PZ5B 4KKAD 4JFZL 3RWEB 1MCQA 3HE6B 2DBLL 4L4TE 3E6HA 5DUBA 2NNAB 4PJGB 2HMID 5DFTA 2CDFA 4UV4H 4YDKH 3ZMRA 1W72A 5CJ8A 4UUJA 1NUDA 1FZMA 2ZZUT 4Y5YC 3SY0B 4OZHA 1HDMA 3OAZH 4KJWD 1HIML 4PJAF 2BVPA 2QADD 2IBBA 3EFDH 3HZMA 3RL2B 3WKNA 3IXAA 4Z7QE 3PNWA 2CKBA 1KPUA 4AK1A 3GBLA 2D9CA 2BDNH 4RFEA 4OCXH 4LARL 1HSAB 2FYYA 5HVFB 3FFDA 3A67L 1RFDL 1CFTB 1O5DT 5GGQH 4PR5B 2Z31D 3GMNB 5D93B 5FHAL 3ARXA 3DUUB 5C70A 3LS4L 1FVEB 1RJZB 1CDGA 3PABA 1QP1A 4G8EB 3IDXH 3QDHA 4KHXH 3Q6GH 4OD1H 3S88H 1G7IB 4OZFH 3PP4L 3GKWL 4XP4H 4KY1L 3WEXA 3EYOB 4XP6H 5E6IA 4PJ7A 2VQ1A 1LO4L 4Y2DB 3ZKSD 3MSPA 3PG2A 3QB7C 1ZHBA 4ZFFB 4I5BA 3DVNA 5GISH 5DK2A 3RWGB 4KDTC 4CVUA 5J6GA 3S6CA 3W9DA 3W11C 4ZUUB 4TTGA 4EUPB 2VZSA 5FB8A 1V3MA 1P5UA 4X5XA 1JV5A 2D7MA 5I8EB 5C0BB 3L7EA 3BHBA 5A2KH 1RZKH 4LCIL 2IWGA 1B2WH 2MQ3A 3BN9D 4OGAC 4BQCA 3I2CL 3UAJC 3QR2A 4G80B 2VLLB 3MMEA 4OIIH 3I02A 5FDWA 3EO0B 1Z6JT 4P9HL 4GRWE 1WIPA 3QEQD 5K59F 2DJUA 3DX7A 4HGWB 4O2EA 4Y4KC 4E0RB 3F58L 5F88A 1EHAA 3L5XH 1NANI 3PXHA 2P47B 4ODTH 5B3JF 4LBEA 5MEPB 2CXKA 3L5WB 4JKPL 1T1XB 1INEH 3HI6L 3BAEH 1J8KA 5CEZE 4ZTPL 4MDJB 4M7JH 1BHGA 1AD0A 2MMXA 2VR5A 1YEKH 1ZLSL 3U46B 4OGZA 4OGYL 3LQAL 4WUUB 3QXDA 1Q1JH 3F5WA 4AIZB 5K59E 5I18L 2D03H 5C0AD 2HKHL 4OGAD 2J8UF 4WIQA 4PBWD 3TO4A 3U4AA 4HK0A 5B38G 4LVHC 1CD1B 5DMGC 3RUGF 2IG2H 3IS0X 3O9WC 1BGXL 4UTBL 4JFQA 3UTZA 5B3JE 4Y4KD 4RGMB 1QRND 3WDJA 4Q74A 2H2SC 3U4EA 2YBRB 2HKFH 1EEYA 2YC1A 3BZFA 5FUOL 1AO7E 2WBJC 4D9LH 4HKJB 2D0FA 2XYCA 4GOSA 2DDQH 2IFFL 1JK8B 2P24A 2ZKHH 3HI1A 1R5IB 4IRZL 4IRSD 4HS8L 1OAYL 1XGPB 3VCLA 4JFFA 3F6IA 2EYTA 1MNUL 1KJMA 2CIIB 2GHWB 2APBA 2J8UE 4NQDD 1JPGA 1NKOA 4NDMB 4KI5D 4K3JH 1QFHA 5E1AA 5JPMA 4NBZB 3X17A 2VL5B 4BZ2L 3P4MB 2QV2A 4QY8B 4K7FA 4P2RA 1EFXB 3SKOB 3O9WD 3PWLA 5HHPB 3SDYL 2R1YB 4QF1A 4Z77A 3BQUC 4NQEB 1RPQA 3O6FB 4GG6A 1NSNL 4UV7L 1OCWH 2BRQA 4NZRH 4ORZC 3TV3H 4R4NC 5F71A 5L0QB 2B20A 2BNRD 5BVPH 5HYQA 4PJAA 2F5AL 12E8H 1AGCA 1TJGL 2DJSA 2V17L 4TSAH 3AY4C 2CUMA 3IYLW 1JN6B 4WW1A 2VXTL 4PUBL 1CDBA 2YK1H 1CK0L 2VLKB 3BX7C 1OM3L 1TVBA 1T3FA 5CBEB 1MFCH 3R4DA 4JVUA 1S78C 2G5RA 3P73B 1CIUA 5D1ZC 3I9GH 3DRQB 3IGAA 1QHOA 2LU3A 2XN9D 1KYOJ 1X5LA 5L2KA 4NKMA 3BKJH 3S5LG 2BZDA 1CGYA 4XC1L 3KG5A 1NQBA 3BQUD 1MJ7L 5I1HL 4UDTB 5DK3A 5TDNB 5DRNA 2IQ9L 1BQLH 4U6XB 3U4BH 3F12A 4MNQA 3FQXA 4LKXB 4R4ND 3UDWA 3NH7H 5EU7E 1NDGA 3S35X 5ILTL 1W72H 4U1JA 4HWZA 3EDKA 2NLJB 3ZDYE 2Q76B 5IV2B 4WW2C 4S2SB 1K8IB 2E9BA 4FQCL 3QUKA 5ENWB 3G04A 5C0DB 4JFXB 5E6YA 3RWDA 4ETQA 3EO9L 4PV8B 5L9DL 1H3PH 2CKBH 3S8WA 1KJ2A 5A16A 4PJIF 3H3PL 4XPTL 3RQ3A 1N26A 4X6EA 3NAAL 4B7IA 4HUVB 1A6ZB 5HHOA 5KAQG 1I8KB 4GAFB 3VGDA 3BW9A 4Z5RB 5HVGB 3VXMB 5D7LE 4IMLA 1MOEA 2VC2H 4LVNC 2AK4E 5GGTL 2YZ8A 2NW2B 1A5FH 3D3VA 3MACH 1G0YR 4L4JA 1F4HA 4LLUA 2GSIB 3SGEI 2R56H 4LSRH 2AEQL 3FQRB 2J3SA 4IOFD 3QISA 4MJ2A 1JFQH 4PJIE 3QXAB 1OAUL 2DIBA 1OLZA 2R39A 4FZ8L 4RRPG 5KZCD 1RZJL 1WZ1H 2AGJL 4D9RD 3LD8C 3FAWA 4LCWB 4YHKL 1BF8A 4O02L 2P1YA 2F58L 1U8PA 5FKAA 3RU8L 5IK3B 1IAMA 3RUGA 5FOJA 2ICEB 5E00A 3RPIB 3OR6A 2FIKB 3DX9B 5T1DH 1A64A 1CCZA 3VFRA 2P8LA 3QJHB 3GM0A 3DV4B 2I9TB 1F58H 3WJJC 1T7XA 3CFJB 2HH0L 1BLNA 1MEXH 3HMWH 3E2HC 4XNXH 1YNLL 3SOBL 1HSBB 4XNUL 5EN2A 1CFNA 1DN0A 3IFPB 1S7QA 5TE4H 4IOIB 1D9KC 3E6FB 3UBXA 3L3KB 4RGOH 2WINB 4OB5H 2I26N 4ODBD 3OQ3B 1ZTXL 2BVTA 1KN2H 7FABL 3QEGL 3PHOA 2QQLL 5HBBA 4ELMB 5ID1A 3JVGA 3ULVC 3L3DA 3LOWA 5D8JL 4PJ8B 5EOCJ 4YH6A 1FGVH 3GI9H 4OZ4A 5DVNA 3T2NL 3VXUB 3KPOA 3R06B 4DVRH 3FT3A 2WUCL 1B4RA 1I1AB 2HFTA 5C2BL 1KCVL 1T2QH 1T5XA 3M45A 4LKCA 2QJDA 4ZAKB 3ZSSA 1NDMB 1FNLA 3W5NA 4FQJH 3BKML 1LO0H 1XMWA 4E41B 2DAVA 5CZVH 1IGFL 3T3MF 4MA7L 4WFFE 5LQBH 2AQ2A 3O2WH 1NMAL 2LAGB 5DA4A 1Q72H 1KULA 2FO4A 5HHXL 3MQIA 1LK3L 1FYTD 2E5EA 4W6YB 2AJXH 1HHKA 3TBVB 5GJTL 4XX1E 5JHDA 1JBJA 4Y4HD 2VR4A 1X4ZA 5IBUG 4DKDC 3O4OB 1ZE3C 3RX5A 1S7UB 1JF1B 1UM4L 5SWZD 1ETZB 1EXUB 3I6GB 4ONHA 4NZJA 2IPUK 4OGXL 2BHYA 1LMKA 2ZCKH 3DXAB 1R24A 3QHFL 3RWJB 1NC4A 3TFKD 4HV8A 3T3ME 1WBZB 1G1YA 3CSGA 1N2RB 2CO7B 2OSLA 1BAFL 4U3XA 3F8UB 3QEUA 5D7LA 3UMTA 5DZNA 1NAMA 2AK4A 3KS0J 4HSQA 3QUYD 4PRPB 4LLMA 3DIFB 1IGYB 2X44D 3BGFC 3UTSB 1UCBH 4ZD3H 2DS4A 3QIWA 2X70A 3IF1A 1CLYH 1IT9H 3NCJH 2R69H 2ADIB 2V7HB 5F3HB 4UI2A 1FC2D 1SY6L 3QUML 3PQYB 1I3VA 3PHSA 1AH1A 4PJIA 4X9IA 1DBKH 1H15B 2X4NA 4OLYH 3VE0B 5D1QA 1T20A 5E5MA 1HKLH 3S3SA 4RDQF 4Z7WF 1DR9A 3QCUL 1JYVA 1XH3A 5DZLA 5J57B 5ISZB 5IR1A 1JZ3A 3VA2C 1XEDA 4U1LA 3TO2A 4NFDA 3LN5B 1WIOA 3FT2A 5GPRA 3NIFF 2GY5A 3CLEL 1D5XB 4NQVB 3GUTB 4PRID 5H8DA 3CX5K 4NKDB 5ALBL 1JTPA 3LHPH 2DM4A 2AAVA 1P2CB 4X98B 3ARDC 5IWLA 1AGDA 1KCUH 4Z7WE 3C60C 4YXKH 1QR1A 1KJ2H 2Q6WB 1URLA 4G5ZL 4P9MH 3B8SA 4XMKH 3RIAK 3VD5A 1SMOA 5IB2B 1L9MA 1HXMA 4HAGA 3B2UC 3STZB 1KB5L 4OQTL 4ZNCD 5I15H 4QRRA 3MLSH 1NEZB 2XTJC 1WFTA 1XF2B 2EDYA 5C0AE 5MI0C 2FGWH 2IH3A 1JTOA 4NZUH 4HS6B 4KI5F 4M5ZL 4GW5B 1DBAH 5T3ZL 1AGFA 3V0WL 1UJTA 5EU5B 5AAWA 4HD9A 1QRNE 1AI1L 1DZBA 4PJ5A 2BNQE 2YPVL 1UM6L 3BVNA 3CFKA 3QUXD 2AXHA 3ARDD 5CSBA 3LAFA 3KJ4C 1KIPA 3C60D 2ZPKL 3MV8E 4HT1L 3DVFA 5L8JB 4EVNB 4GBXB 1MCFA 4OKVB 1PKQA 3CUPA 4PIRF 1D6VL 5FM8A 2A6IA 5IB1B 3B2UD 5KVMC 4KI5E 3VFUB 2D7PA 5I1CH 4JM2D 4U2ZA 2PR4L 1TDQA 4HBCL 2J7LA 4JREC 2VIRA 1ZT1A 4NKQB 1E6JH 2VZVA 3QXVA 4IOSD 5TF1H 3U0PB 1AXTL 3B83A 3FQWB 1U8MA 2AABL 3QCVH 1XIWC 1D6EB 4YIQB 2BNRE 1QZ1A 2FX9H 3QZWA 3QDGB 4JKMA 3TWCH 3MLTA 5FYJD 1KXQE 1OGAD 4Q9RH 2EDKA 5CIPH 3B9KB 1KBGL 1UH2A 3RZCB 3CMOH 5FECA 5DQ9B 2AP2A 2D4FA 1A8JH 4P3WA 1IQWH 1IARB 2R2HA 3IB4A 1UZ6E 1DLFL 1RUKL 2B0SL 2LE9A 3L95B 3LN4A 5FYKD 4PRNA 1Z9OA 5E94A 5I1KH 3MCLL 2Z93B 2V7NA 3D39E 2MFNA 3LH2H 2ITDB 3AVEA 3QEQA 3UZEA 1FHGA 4UINL 5EBLA 5CUSH 5C86A 2AEPL 1AHWB 2DJ4A 1XIWD 2YD3A 4LEOA 4XPFL 1NEZG 4HF5L 3PF2A 3GNMH 1IKFL 5BXFA 1ZHLB 3AB0C 2ZCLH 2C3HA 1MFDH 1YY9C 4XCFH 4M8VA 4ZYKA 3S36H 4UIMA 3QPQD 4Z7WA 4LLYA 2QSCL 4RAVB 5J06A 4JEGB 4KKLD 1QLFB 1RZFL 1PQZA 4JANA 4UAOB 3OZ9L 4F8QA 3IFLH 5FF6A 3NABH 5EU6E 1WC7B 5L8KB 4YBQD 1CD9B 4R3SA 1KV3A 1LP9B 1NAMH 2DLFH 4ZFZB 2MWCA 5C0AA 4RX4D 3U6RB 4HKXB 3RKDD 1WT5C 4ZSOA 3L7FB 2GCYA 2HFFB 4XP5L 1YEHH 2BVQB 2JK5A 1EGJA 2BY1A 4FZEH 4TSCH 43CAA 4L3ED 1AE6H 4IDJH 1QRNA 3QULB 4HUMB 2P7TA 4FABL 5JOFA 1A6TA 4G6AC 5DJ8A 4M8QA 3DSNA 1FPTH 1I9RL 3QJFA 4N1CA 4N68A 3OAYK 4IRSA 1KT2A 1QO3A 2CDEA 3DYMA 2Y07H 2A6KB 3RA7L 1A9EA 1W0WB 4NQDA 3QNXA 4HC1A 3IVKB 2XG4A 1CU4H 5T33H 3SDAD 4XXCC 1EMTH 1ZA6B 1HNGA 4HMCA 4JAMB 3HFML 5HVHB 2Q7NA 5INDB 2EXYC 2O61A 1OHQA 3VFWB 1ZAGA 4UILL 3U79A 2OQJA 2WQRA 8CGTA 3CFEA 4FXKA 5MEQA 1BMGA 1AP2A 4XVJH 3MUY1 3NGBB 3L3GA 1A6WH 4P23B 4X7DC 2C1OB 1QBBA 3IDIB 5C0FA 1OSZA 3MBEB 4U7KA 1BBJB 3T4AA 3KPMB 5JHLH 2O93L 1M7DB 4ZS7H 2E7LA 5E8PA 5EUOB 4K9EH 4K7PX 5T1MA 1AGBB 1SBSL 3DBXA 1KTLB 5HHNA 1J88A 1E28B 5DJ6A 1YUHB 4AEHH 5HGHA 1E4XH 1NGXA 1MREL 3O3DB 2XN9A 4U1SA 1P1ZA 1P7KB 2NY0B 3EOAA 2XQBL 2DQTL 3VGAB 5IKCB 3QIUC 3K74B 4NQCA 5GGRB 1LO2H 2AKRB 5L7XH 2Q86A 3T0BA 3JV4B 4O5LL 3FT4A 4YGVB 4NWUL 4S0SD 5C0NC 2BP3A 5JW3H 4W4OA 5CBAB 3I6KA 5IVXB 3ULVE 2BJML 3JWDL 3BKYL 3MOAL 2UWEF 4ZMAT 1P4BL 3KLHD 2CK0L 2HFGH 4XNZB 1LVEA 2GUOA 4LQFH 4C56B 1YY8B 1KFAH 4ZFGH 1NGZB 1D3CA 4NO0D 2DIJA 4KMTH 4NRZB 4YDKL 4UV4L 1UB5A 2ADJB 4Z9KB 1QD0A 1EBAA 4QXTA 2PXYD 3D0VB 1ITCA 3JV0A 3TN0B 4IMKA 4YPGA 3EFDL 3QIUD 3WIIH 4ETYA 3HPJA 4U1GB 3R8BB 1CBVH 3GBMH 3GIZH 2BDNL 3EDDA 3LQMA 2UWEE 4OCXL 1MCHA 1T21A 4TUOB 1QFOA 1PFCA 5GGQL 3B3IB 3RX7A 4WI5A 2RJMA 1LDPH 4UNTA 3UXFA 5C9KA 5F97E 1FL5A 2PTTB 3IDXL 4KHXL 4OD1L 3Q6GL 3SJVD 1NFIA 3TBSB 1PLGH 3S88L 4PJHF 4I3RH 4GS7C 5EOTB 3LKQB 4K07A 4XP4L 4LSVH 4Z0XA 5H94B 1DUZB 4XP6L 1J1PH 4DGYH 2A6DA 5GISL 1ZS8A 2NYYD 1SEBB 2A77H 1CTOA 5DRWA 1T1WB 4ZS6C 4LSPL 3V0VA 2VZUA 2EKJA 1RZKL 3I3BA 1NAKH 2JJUA 4QHKI 3RVTC 3FO9B 1B2WL 5F1SA 3ES6B 5FO8A 5FKPA 1IKNC 4PJHE 4XTRD 2ZSVA 4DJMA 4NNXB 3ETBF 4OIIL 5IVOA 2I60H 3NTCH 3O4LD 3OKEA 4G8IB 4WRLA 5BS0A 2C1PB 4M6NH 5ITBH 1I9IH 5I76B 3FQTB 1A7OH 1CZ8H 2VDMH 5D2LA 2OJEB 3FN0H 3L5XL 3RZWA 5KVDH 2ZSWB 4QNPF 4ODTL 4WFHD 3QFDA 4NSKA 4DEPB 2Z91A 3RWIA 3OAZK 4YE4H 3D85D 3QDJD 2P46B 1UQSA 4WNQB 1INEL 3BPCB 1EGJH 1JWMA 4OQ1A 4WO4D 3BAEL 25C8H 3MJ6A 1S9KC 1S7SB 3LV3B 4I2XA 4M7JL 1MFNA 4JM2F 4V2BA 5IB5B 1YEKL 3D0LB 1QSFB 5LKNA 2DKUA 2MJWA 5C1MB 1OY3B 1Q1JL 1FYTA 3RVTD 1KPRA 1JHLH 1ORQB 2D03L 4HJGB 5HHQB 2UVEA 1N7MH 2CO6B 1IRAY 5IB3B 3STLA 1M6OA 2J8OA 3ARFC 2G2RB 3FAXA 4X6DB 2IG2L 2GK0B 3MUGA 3FOLA 4Y4HA 1NBYB 4QNPE 5H35B 3W5MA 3ZE0E 2F9BT 1QBAA 3CXHJ 3GSQB 4MJ6B 1S9XB 1HN1A 1MH5B 5SWZA 4HC1H 1S9YA 4OBRA 5JXAH 2HKFL 4JFPB 2RQ8A 1X5KA 5JW4M 4J8RA 2XTJE 3C5ZD 4D9LL 4L8SB 3MV9E 4XVTH 1AIFA 4N1HB 2DDQL 5DD1H 4HFUH 4ORGA 2ZKHL 4YLQT 1CFQA 3QQ3A 1YDPB 4L3CB 3BMVA 3QUYA 3HPLA 3L3JB 1RHHA 3KPSD 3SHSA 4AEFA 2DWDB 3RVWC 1EO8H 4K3JL 5HTSA 1G9MC 5EBWB 1DN2A 3EJYC 3LKRB 4L9LA 5CGYC 3CPLA 5I1DB 4CRPA 1V7NH 2QQKH 4LDLB 4XBGA 3I6LE 5GS0C 1H8OA 3D2UB 3G5XA 1DQLH 1I7UB 1O0VA 1OGAE 4LPTA 6CGTA 2Y4SA 1T1YA 3G08B 3OKLA 4UQ2A 2HFEA 4YDIH 4X4XB 1OCWL 4NZRL 1T0MA 5ICZA 3TV3L 1N0XH 1YQ2A 2ZP0T 4LSUH 5E70A 5A2LH 5BVPL 12E8L 1EK3A 3UBXI 4U1IB 4OD2B 1QQDA 2YK1L 1HINH 5FYKE 2PYEB 1JPFA 2ZUYA 2JB6A 2J1KA 2PW2B 1MFCL 5D2NB 1HYRC 3RVWD 3EJYD 3V6OC 4OI9A 4O4YH 4PRIA 3I9GL 3DPBA 4MMZC 3MLZH 1K5NA 1G9NC 3QG6B 3DX6B 1HI6B 4FQQB 5ICYB 1WCBA 3BKJL 5DJ0B 4R4BA 3MV7D 4PJ8C 3IDJB 3KPQB 4S1RH 1BQLL 5F8RC 1F97A 2X4OA 1YNTB 4Q97A 3NH7L 4X0KA 1E27B 3BP7A 5ID0A 1W72L 4P46B 4QRQA 1UXWB 1RUPH 3OXRA 3UP1A 1BD2E 4F7EA 4H1LB 1MQKH 2AV1B 3CIQA 2DQFA 1T66C 3UJJH 5ERWA 2CKBL 1H3XA 3CK0H 2G9HB 1BFSA 3A6OA 5DR5H 1OVZA 3BP4B 3VMNA 2P5WD 3QUXA 2A6JA 3BSZH 5C0EB 4RMUA 3ARBD 5KSUA 3SO3B 2VC2L 3BP5A 1N0LA 1A5FL 1WFUA 2VITB 3MACL 2F53E 2R56L 5IVZB 1CS6A 4LSRL 4J3WA 2P44B 2EO1A 3UYRH 1II4E 1U8OA 1EZVX 3KPRB 4W6WB 1LNUB 2E8YA 4D0BA 1T04B 2P8MA 4JM2A 1JFQL 1OTUC 4JDZB 1LILA 4XVUD 1KB5B 3BO8A 2WIIA 5ANME 5HVWA 1WZ1L 2VH5H 4IHOA 5CEYA 3VG9B 1T66D 4URTB 4N0UA 1BZQK 3WE6A 4WFED 4KGJA 3T65A 3OJDA 5DJAA 3ELAT 5ESQB 3ESVF 5GZNC 1PD6A 5F72S 4Y5XA 3QDAA 2X05A 5T1DL 1RQ5A 1YQVH 1EAJA 4XT1C 2ATKB 3NFPB 4BFIA 1F58L 1RVFH 3UYPA 3FKUS 1MEXL 1PG7H 3HMWL 1OGAA 3KPNA 4NNPH 4XNXL 2C7UA 4F33A 5TE4L 3QQ9C 4TNVF 2ESVD 4RGOL 2EIZB 4OB5L 5EO1A 4DTGH 4KJYA 4WV1A 3QI9B 1ZLWH 1UWXH 1KN2L 1P7QB 3BEVA 1EAPB 4R96B 1VGKA 1UJ3B 5K9JH 5ACMA 4IRJD 3VI3E 2Y23A 3IDMB 1FGVL 3GI9L 4DVRL 2FH6A 3BZEA 4QOKD 3UO1H 2HA1A 4I0PA 1T2QL 3W82A 4J4PD 2Z4QB 4U0RB 1S9WB 1XIWA 5HD8C 3FRPG 1CICB 1KTKE 4FQJL 4IDLA 4AMKH 3VG0H 4HZAA 4JRXB 2OXHA 5DYOA 4JO1H 3MRBA 4CKVX 1JZ5A 4H1LG 1E4XI 4KTDH 4DUVA 5IIEB 2VLRD 5CZVL 2VSCA 5LQBL 3TNMB 3O2WL 3CLFH 3C6LC 4YDVB 1I9JH 3T2PA 1K85A 5GSRA 3V6ZA 1Q72L 3VFNB 1T03H 1TCRB 3ALWA 5IMMA 3RBSA 1I75A 3V95A 2AJXL 4ZOEA 4XRCB 5IF0B 5EZIH 2YOCA 1XGTB 5F7UA 1J8HB 1CL7H 4NJAL 4X9GA 5HI3C 3REWB 1KNOA 4CUCA 1JNHB 1ZLVH 1DVFB 4L8DB 1K8DB 4F37F 1RI8A 5AEAA 5K9OB 4GFTB 3D9AH 3GFUA 3OKNB 3WHXB 4L3EA 2P5EE 5I1AB 3V5HB 2ZCKL 3WNNA 4HLZG 3VRJB 2DQHH 5HD8D 2Y5TA 2A0LC 1WBXB 5MHSD 5HGAB 2EEAA 3W9EB 4PGBB 4PBVC 5F6HI 2X1QA 3CFDB 5DJCA 5LGJA 1ZA3A 4X7SH 1HYSC 3C6LD 3PDOB 4ZNEE 3GSUA 3IAPA 4N0YH 4OFVA 4GBXC 3MNZB 1UCBL 4UDUA 4ZD3L 1A22B 1CLYL 2NZIA 5BCAA 3NCJL 2R69L 4L4VD 3GSRA 3N1PC 3SDAA 4HG4K 3SE3C 1S5HB 5HI3D 3ARSA 1DBKL 2H3NB 1I7ZB 4OLYL 5B39B 5T3XD 4LCUA 2I07A 2VXQH 3O3AB 1HKLL 5DJDB 3HI5H 4QYOA 1FQ9C 4NQSA 3HLAA 1TZGH 3P11H 2A0LD 1MFBH 5I8OH 3KWWA 5KG9B 1G7QA 2OZ4A 3TJHC 3NCEB 2W07A 4PJDF 3U2SB 2IBZX 2KQMA 3NZ8A 2UYLA 3HZVB 1T7ZA 3DURB 1WQVT 2WWKO 3VFMB 3WIHA 4I48A 4LLQA 5D9SA 1AQDA 5B8CC 5KS9B 1FJ1A 5AYQA 3LRSB 4MZ2A 4WFHE 3LHPL 2X4SA 3O11B 1G84A 4P2QD 3QDJE 1KCUL 1IEAB 1NCCH 4YXKL 3RTQD 1MELA 2DICA 1YC7A 1I7TA 1X7QA 2CIKA 3AM8C 3P9MA 4C83B 4L8BB 5IMOB 1KJ2L 4GW1A 4EN3B 4P9ML 4PJDE 4XMKL 1JTTA 3GB7A 5DC0A 1DLHB 1KC5H 1ES0A 3OGCB 2GSGA 5I15L 4P2OC 3MLSL 5C0RH 3VDCA 4KKBC 2NXYC 1YPZB 2FGWL 1ZEAH 3WXWH 4NZUL 2V5SA 3TP4A 5CLWA 4PJ9B 1U91A 4MMXC 1G9EA 1DBAL 1KLUA 1R3KB 2JKXA 3PDGA 5EA0H 1TQBB 5EBMB 1IM9B 4WGWB 3VWKB 2OX5A 3OV6A 4EJ1C 3FONB 3CXDH 4MLIA 1KPVB 1K3ZA 2GJ6D 2I9LB 4NO0A 1FCGA 5KSBF 4Y1AD 4QRTB 1UADC 3MRPA 4OT1H 5F7FA 2Z8WC 4PPTA 1FL3A 2PXYA 4ERSH 4D8PB 2GJZA 4WTZA 3HG1B 4HEME 3MRLA 2GW5A 4FXGB 2HLAA 5D7IB 4HUNB 4POZD 3HNSH 3KPSE 3QIUA 4WU7A 5DGRA 4R97C 3C9NA 1D5IH 3NOIA 4P9HC 5I66B 4M1DH 1EHNA 5I1CL 4XI5D 2NXYD 2EXWC 5ETUA 3RP1A 4BFBD 3X13A 4LPUA 4F2MA 5FYJH 4FG6C 4OZIF 5CD5C 1IM3A 3MA9H 4P2YA 3VGEA 3LKOB 5KSBE 2D31B 4Z7VF 1E6JL 2D7TH 1MAKA 1WAAF 5TF1L 1YECH 4A6YA 4RGNC 2B1AL 5IW3A 1BJ8A 1JGLH 3CCHB 3PGCB 4R7DA 3SJVA 3QCVL 1E6OH 5EUKA 2YPLD 4KVNH 2IH1B 4XNQA 3MYZA 2FX9L 4UU9A 2E6QA 3TWCL 5FYKH 4LGRB 4GAGH 1N5AB 3DYOA 2A83B 4PY7B 4Q9RL 2FHBA 4LHUB 4F7TA 3DGGB 5JZ7D 3CMOL 1U8JB 3STBA 3PJSB 3GRWH 4QXUH 1C5DB 4JCLA 4DZBA 3K2UH 2AS5M 2BSSA 3NGBC 4Z7VE 2EXWD 1IQWL 1WAAE 4KJQD 4FG6D 2NY4D 3OB8A 1XF5B 5I1KL 3MBEC 1I8MA 1UVQB 3LH2L 3O4LA 1TZIA 2Z35A 4NO5A 4X9FA 1V05A 3SDDB 5D70H 1C16B 4TSBH 5CUSL 1FNEB 3SKMB 4QTHB 2EDDA 2OMNA 5E9DB 5CFHA 2L7JA 3GNML 1MCDA 2ZCLL 3DI2B 1MFDL 3D85A 4OZFB 5T5NF 4XCFL 5DC9B 5D5MA 3QP3A 3H42H 1ACZA 3WUWB 5I0ZA 3H7BB 4WO4A 5I73B 1HQ4B 1ZVHA 3CDCA 3AMKA 2J4WH 3VGAC 2CLZB 2BY0A 15C8H 3IFLL 3QXUA 3NABL 2OYPA 2E7MA 1ED3A 1DE4B 4G9DB 1EFQA 2BNUA 5GGSA 1NAML 2DLFL 3HNTH 1NH6A 3TBYB 3VFPB 1JHTB 4RQQB 1R5WA 1G7MB 3CFBB 4XCNB 5BOPA 1MCLA 4FZEL 4TSCL 3T0VA 2BVYA 1AE6L 2EC9U 4IDJL 4DGVH 1TPXC 3QFJD 2HP4A 3HUJF 3DX8A 5DA0B 3W0WE 1MHHB 1T22A 2R0KH 5LBSH 2XT1B 1I85A 3U36B 4MAYC 3SPVA 3C5ZA 3RVUC 2OP4H 2GQHA 4KHTH 2X4TB 3QG7L 4M6ML 3S7GA 1FPTL 4CVXA 4NN7C 1GGTA 5D72H 3LIZH 4CU7A 2R2EB 3MLXH 3EIFA 2RCSH 4V1DB 3VH8G 3LKNB 2Y07L 3LRHA 4WFEE 2WWMC 4M7KH 3TIDB 3KPSA 4I18C 4PRBB 4HDIB 1BZ7A 1CU4L 2OZ4H 5T33L 5AZEH 3MFFA 2Y7QA 4P5TB 4NKIH 3CSPA 3ZT7A 2IQAB 4HUKB 1EMTL 5DQJA 1G0XA 1U3HB 4MJIB 4LCCA 3HUJE 3IDNA 3PWPE 4UBDD 3WIHH 3L9RA 4E42B 1YEDA 4K71B 4L1HA 4XH2A 2Q3ZA 1CVSC 4J12A 4XVJL 3ARGD 3UTTD 4RIRA 3G9AB 3MA7B 4YHYC 1S7VB 4ODWB 1S7XB 4ONGH 3FB8B 2SEBA 2ESVE 5KSAB 4MAYD 1A6WL 1FVCB 5E8EB 2DM2A 1QHPA 4FFZH 3CAFA 1C12A 2X1WL 4I3GA 3HC0A 1X9QA 3MTRA 5JHLL 1U58B 4ZS7L 1QNZH 5C8JB 3WS6C 2WWKT 4QRPA 5MENE 1A2YB 1S7RB 3D87B 2EDTA 4WI6A 3H6JA 5F9JA 4IEFB 4OZIA 4IS6A 1BQHA 2DLEA 4AEHL 4NZTH 4PREA 1E4XL 1OT2A 4XAKD 4JZJB 1WAAA 4X4ME 4PRAB 5DJZB 5KTEH 3ZDXF 3U83A 4S0TD 2VLRE 4F8TA 3U9UB 4LNRA 3MV7A 1I9EA 1NFDE 1LO2L 4NM4H 5L7XL 5E4EC 4K3EL 1RZJC 2C3VA 1MRCH 3QO0B 2CLRA 3FTGA 5JW3L 4JPIA 3NIDE 3LZFH 3EYFB 4LFHD 5TFSH 1SYVA 3B8YA 4OAWB 1QA9B 2XY1A 1SJVA 2DQDL 2HFGL 2NX5B 3PIQB 3M1BB 2BVEA 5DD6B 4ENEC 1T80A 3D5OF 4LQFL 3U48A 1KFAL 3UJTH 4ZFGL 5LVEA 4Y16B 4G42A 3ZDXE 3ARWA 4KFZC 1CXHA 4KMTL 5JR1H 1N59A 4MCZA 4N1EA 2P5WA 5E6ZA 1J7VR 2YN5A 2Z92B 3O45B 3ARBA 2FO1A 4XNMA 4MNGB 5J89A 2MCG1 4JQIH 3Q0HA 4MJ5A 3FQNA 1CL7I 1LK2A 4QRUB 3WIIL 1QUNA 1CBVL 2H6PB 5E4IA 3GBML 3GIZL 2GTWA 3TZVD 2OL3H 5I17A 3BPOB 2OS7A 5DUBB 5BO1H 4B41A 3INUH 3FL7A 4L8SC 4GRLB 3WLWC 1W72B 3THMH 1JYNA 1FZMB 4CMMA 5F1NB 1LDPL 1CE6B 2BOBA 1JNNH 3SKUD 2YPKA 4LVOC 3PDDA 4FQXD 2BVPB 2IBGA 1PLGL 3F7QA 3HZMB 2FATH 1G7PA 1FFRA 4I3RL 3IXAB 4KK5C 3RRQA 3PNWB 5GRJH 4G8FB 4HWEH