2BW4A

Atomic resolution structure of resting state of the achromobacter cycloclastes cu nitrite reductase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
334
structure length
334
Chain Sequence
VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Resting-State, Substrate- and Product-Complexed Cu-Nitrite Reductase Provide Insight Into Catalytic Mechanism
pubmed doi rcsb
total genus 89
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bw4A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bw4A02
2YXWA 3NJIA 1NIDA 4KO7A 1MDAA 1QLEB 4KO9A 4NAJA 1ET8A 1OE3A 3L45A 3ZDWA 2VW6A 1KDJA 1NTDA 1JZEA 4JHUA 4NERA 4A66A 4YSRA 3TU6A 1ASQA 3S3DB 4DPAX 1NINA 3ZIYA 3N55A 3V9EA 5AFAA 1IUZA 4MFHA 5A7EA 2XXFA 2QPDB 4JHVA 1OOWA 2AVFA 3ABKB 4CSPA 2FT6A 2PPCA 5ANHA 1SHXA 5IY5B 3N2JA 1BXVA 2AZUA 1WS8A 4NB7A 2YAOA 4HAKA 1JZGA 3X1BA 1M56B 2XXGA 1BQ5A 2IWEA 3WKPA 3PAZA 2XX0A 3NSCA 2JKWA 1BYPA 1A65A 1CYXA 3V9CA 4N4YB 3IN2A 1URIA 2GB2A 2QT6A 1KDIA 1BAWA 1ZPUA 4BWWA 1IKOP 3T6XA 1JZHA 6PCYA 3QJRB 2MTAA 1ETJA 3HB3B 2IH9A 1PZBA 3T6ZA 3TBCA 2N0MA 3FQYA 2FQDA 1AS8A 4JKNA 4E9WA 4YSCA 1RCYA 1QNIA 1MZZA 2YAPA 2BP8B 4KNUA 2ZXWB 4E9YA 1QHQA 2B08A 2HLEB 3FSZA 1AAJA 1ET7A 2Q9OA 1NWPA 2HRGA 2YAEA 4E9SA 1SDDB 2W88A 3CVBA 4YVNA 5B7FA 1AZCA 1GY2A 3UAAA 1JXDA 2YAHA 1YLBB 2W8CA 3ABGA 1PCSA 4DP4X 1NICA 1L9OA 1WA0X 2LLNA 3PAVA 3OD3A 3WG7B 1KCBA 3SQRA 2AFNA 4TXVB 2CALA 3UACA 1CC3A 2YAMA 5I28A 3HEIB 3ZBMA 2YQBA 4F7KA 4GY4A 3NJHA 3SBRA 1A4BA 3PXLA 4YL4A 1VLXA 3S8FB 2MRYA 2UX7A 3D12B 2XV0A 1W6WA 1F56A 2EINB 2PPDA 2XLLA 3EF4A 3IN0A 4F2FA 1UATA 3QQXA 4HHWA 1NIEA 1A3ZA 2X87A 2BW5A 3AG2B 4GP4B 4E9RA 3C75A 1JOIA 1MG3C 2BWDA 4BDVA 1ET5A 2R7EB 1X9UA 1OCZB 2GBAA 4YSUA 1M57B 4QKTA 3T6WA 4AKQA 2WSDA 2FJSA 4DP2X 4W9ZA 3CZUB 1AZBA 1J5CA 2UXGA 2GC4C 3FYIB 3TA4D 5I5IA 1JXFA 5B7MA 1OCOB 2YXVA 2FQFA 2XX1A 2FNWA 3OMNB 4PAZA 1AZRA 1WAEA 1PNDA 4E9TA 2I85A 6PAZA 1GS8A 3S8GB 1L9RA 3FYEB 4BWUA 1CUOA 3KW8A 4AI7A 4YSQA 1ADWA 4GP5B 1KGYE 1M9WA 2PCYA 2BP0A 2WO2B 2VN3A 1CYWA 5AZUA 2J55A 4YSAA 1R1CA 2QPEB 4W1TA 1GS6X 1AR1B 4UANA 2BHFA 5B1JA 3DTUB 3CDZB 1A8ZA 3KW7A 1WA1X 3RYMA 5TK2A 4YSEA 3JT2A 4CSZA 4YSOA 1NIAA 5I6MA 1PZCA 4A2HA 1AANA 1ID2A 1HAWA 3AG3B 3NT0A 3OMAB 3OMIB 5B1AB 4AKOA 3T9WA 2IDSA 2GIMA 2XYBA 1WA2X 4YVUA 1IBYA 1N68A 1PY0A 1EZLA 1OV8A 3H56A 4KNSA 4GYBA 1XB3A 1KCWA 2BWIA 1FFTB 2XV3A 3NJNA 1E30A 4HCGA 5I6PA 4QLWA 2AZAA 3IE9A 1OCRB 3OQRA 3NSFA 2FWLB 4AKPA 2H47C 3NJKA 1ZDSA 4HCFA 2VW4A 5B7EA 1RKRA 1PF3A 2PPAA 2VSMB 3QJQB 5PCYA 1KV7A 1SHWA 1L9QA 3G5WA 4E9VA 1J5DA 1E67A 4A2FA 2XV2A 1ILSA 1PLBA 1BYOA 2BO0A 1E5ZA 5PAZA 1B3IA 4BDVB 3PPSA 1J9SA 1OCCB 1PLCA 4FA7B 1AS7A 3FT0A 4WTQA 1NDTA 1AIZA 5I6OA 2YARA 4HIPA 2P80A 4K9JA 7PAZA 1SFHA 2IH8A 3T6VA 1ASOA 2EIMB 4M3HA 1ASPA 1BXAA 1N70A 3X1EA 2XU9A 2Y69B 5I26A 4YSTA 2E86A 4G7RB 4G7SB 4BWTA 3UAEA 3FU9A 5I6NA 1L9PA 2HX9A 5B3SB 1JVOA 4DP9X 1NPNA 2QDVA 1W6LA 3NSYA 1OE1A 1JERA 1KBVA 2UXVA 4HCIA 3QJSB 3WIAA 1XB6A 2FTAA 2IWKA 2EIKB 2EIJB 1PNCA 5B1BB 2TSBA 2BP0B 2H3XC 4E9QA 2XVBA 2OV0A 3ABMB 3NP4A 1JZIA 3AG1B 1V10A 4P5SA 2DYRB 1KBWA 4KO6A 3DIVA 1NIFA 4Q89A 3GXUB 3NP3A 3UGEA 3CVDA 4PCYA 2VW7A 3SBPA 1E65A 7PCYA 3NYKA 3QPKA 4FAAB 2DWTA 2IDQA 2VSKB 1SNRA 2PCFA 3QJTB 2BP8A 1L9SA 2J56A 2OCCB 3QJUB 3MX0B 4ZK8A 4DP0X 5B1JC 3GYRA 4YSSA 4EF3A 1J9QA 2PPEA 5EHFA 2J5WA 4M4RB 4X4KA 3ERXA 1BXUA 3EHBB 1AG6A 1SF5A 2P80D 1DZ0A 1AS6A 1EHKB 1RZQA 3ABLB 2X88A 2A3TA 1NZRA 3NJGA 3S3BB 4G70B 3MBWB 4A2EA 4DP8X 4GXFA 3UADA 3WKQA 2QDWA 5FC9A 4A67A 1OF0A 1WS7A 4A2GA 2BW4A 4G7QB 1ZIAA 1IBZA 2VM4A 3PCYA 2EILB 4KO5A 3PLYA 3TBBA 3X1FA 4DPBX 3BQVA 5LDUA 2RACA 1HAUA 1SJMA 2IDTA 1DYZA 1TEFA 1JZJA 5TK4A 1GR7A 3ZX1A 1TU2A 4KNTA 3CG8A 3ASOB 1L9TA 2CAKA 1MZYA 3AY2A 3NJMA 3U25A 1AZUA 2CCWA 2HX8A 4A68A 2FT8A 1TKWA 3AW5A 4BXSV 4KOCA 1JZFA 4HZ1A 1PLAA 5I5MA 1I53A 5B1KA 2JXMA 1SF3A 5D4HA 2ZONA 2I7OA 3IEAA 2PP8A 3FU8A 3FU7A 4ENZA 2PPFA 3OM3B 2CBPA 1J9RA 2GI0A 1ZIBA 2FQEA 2PP9A 3X1NA 5D4JA 1ZDQA 1E5YA 1KYAA 5I6LA 1NIBA 1IC0A 1GYCA 2YAFA 1FWXA 3FPYA 5F7BA 4BK5C 3EH4B 1CURA 3AG4B 5F7AA 2FT7A 3PAUA 2DWSA 1GW0A 3NJJA 2UXFA 3S3CB 1AG0A 1BEXA 3CDZA 3NJLA 4DPCX 1ILUA 1W8EA 4UAHA 2IDUA 2TSAA 4DP5X 4HALA 2DY2A 1V54B 3FSVA 3FSAA 3H4HA 3TASA 2GSMB 3WNJA 1AOZA 4F2EA 4N8UA 3IBOA 2J57A 1HFUA 3BVDB 3FPXA 1NPJA 2UXTA 4G72B 1SFDA 1BQRA 3AZUA 2WO3B 1ZV2A 1GY1A 4AZUA 1PMYA 2HX7A 5I5JA 3NSDA 2Y1AA 3FQ2A 2I7SA 3GDCA 4Q8BA 1OE2A 9PCYA 3H4FA 4KOBA 1XB8A 2BZ7A 2NRDA 1A4CA 3EH5B 2IDFA 2ZOOA 4RH4A 1JXGA 2DYSB 2DV6A 4YSDA 2YAQA 3NJFA 4WKXA 5E9NA 1V55B 2H5UA 3JTBA 2HZHA 2XUWA 4GP8B 2CJ3A 5AKRA 3FS9A 3UABA 1AZNA 3ASNB 3CVCA 2HRHA 2XWZA 2ZWNA 1GS7A 1XMEB 4L0PB 2PP7A 2FQGA 3FQ1A 1SDDA 2IWFA 1AACA 2Q5BA 1PZAA 1PAZA 1J9TA 5D4IA 4AX3A 2JFCA 4YSPA 8PAZA 2B3IA 3WNIA 1FA4A 2IAAC 2VM3A 3T71A 1GSKA 2CUAA 2HXAA 3FSWA 4E9XA 4UF7C 3DKHA 1MG2C 4HHGA 2AANA 3EH3B 3SBQA 4DP7X 1TEGA 3X1GA 4A2DA 3WI9A 1BQKA 3X2QB 1A4AA 5I6KA 4G71B 2OJ1A 3FU7B 2VMJA 4P5RA 1JVLA 3QJVB 2UX6A 2BZCA 4DP6X 2GHZA 1RZPA 4DP1X 2GC7C 1NWOA 1X9RA 1T5KA 2R7EA 4BXVA 2PLTA 1AQ8A
chains in the Genus database with same CATH superfamily
4DCQB 1DCLA 5KJRH 3OV6A 5CD3B 3O45A 2BNQA 3HG1A 5IOPB 5AVZB 8CGTA 1D6VL 4W9CC 4JM2D 1KTDB 1NTDA 5FYLH 2APWA 2XRAH 4G8EA 1KWGA 5C7XL 2PYEA 5D2LF 3NIGE 3L95A 3PL6D 4K55A 3ZIYA 4EVNB 3M8OL 5A7EA 2KDGA 1M7DA 5FO2A 3PUCA 1TIUA 4KI5E 1IAIM 3H7LA 4GBXB 4J28A 4P07A 3UO8B 3SJVD 4Z3EA 5I9QC 4JL1A 2HKHL 4ONFL 1LO3L 1H5BC 4U1LA 3S98A 3DECA 4DESA 2VLLB 1GPOH 1YYLH 3IDNA 4GRWH 5IROC 5IK3A 1YEKH 3QZWB 3SPJA 3US1A 3ISRA 4Z7VF 4R96A 3JV4B 4IKKA 4MLIA 4N4YB 4APQC 4Z76B 5F7YC 1HQRB 1MFCL 1B90A 1AJ7H 3AT8A 3O3DA 1IGJA 5DUBA 5I82A 3C5JA 2X4NA 3G6JB 1L6ZA 3WSQL 1CXKA 1U58A 2MTAA 1BQHG 3HI5H 4G9FA 3QIUB 1YY9D 3F58H 5C1MB 3FQYA 3UTSE 3OPZL 1E5AA 3GMOB 5DD5L 4FS0A 2EXWD 5KBPA 2OS7A 3OMZA 4IIZA 3EJZC 2RBLA 3T2NL 3WTVA 4WO4C 4K3JH 4QD2E 2EVIA 3RVTD 4CVXB 2NY4B 5LO7A 5GSRB 2HPTA 1D5XB 3BAEL 1M1XB 5MEQB 5SX4H 4JZJC 1E5CA 2D2CC 2Y0SA 2ZKXA 4FNRA 2HSIA 1X5HA 2JELH 4TXVB 2DM2A 3UACA 1ZSDB 4LVHC 4PB9L 4L1SA 4QRSA 1ZTXL 3FU6A 3E3QC 3HPLB 1ACCA 4MBRA 3N3EA 3PGDA 4P4RA 4WWID 4PRPD 5JHDB 3ZDXB 2OR9H 1FYTB 5ICYA 3S5YA 2R9HC 3CHRA 1TXKA 5LGHL 5SWQB 3VD1A 3D50A 1W6WA 4D9LL 3RGVD 3NFSH 5DGQA 3EH2A 4IRJA 4PU2A 1DDHB 2ZICA 3QDMB 2OYPA 3REWB 1T7ZA 4UQ3B 2CK0L 5T5NF 1L0PA 5I30L 5CSZB 1X9UA 1QSFE 1OCZB 2XZZA 2P43B 2VN4A 5DZJA 4QEGA 4YSUA 1TETL 4HJJH 4FQHB 5E1GA 4DKEH 4W9ZA 3VFVB 4RWYH 2XWJA 2LU7A 3GMQA 2UXGA 4RRPM 3FO2A 2AJYL 5CIPA 2XZQH 4M48L 3RB7A 3HC0B 4MWFB 3BZ4B 5HHNB 2V8LA 5IUCA 4S1RL 2R8SH 3BT2H 3FO0H 3V52L 3FRPB 3PWPD 1SOKA 4JQXA 3HE7A 2J1YA 3I85A 6PAZA 4J3OD 3JWNH 4BWUA 4OGXH 5E8EB 2N7BA 3GS4A 5AW7B 1T5XB 3ELAT 1RJZA 5IG7A 4PY7A 5AAMC 4YSQA 3K1KC 1RK0B 1KGYE 1S3KL 1GGCH 2FEDD 2WW8A 5I8CB 2V2TB 1HU8A 2CA3A 4K8RC 3VWJC 4DO6A 1ITCA 2NUPA 1L5GA 5EIVA 4Y4HC 3DI2B 1C1EL 3V5DB 3QO0A 3QFDB 3CSBA 4JLRA 2XWBA 1JYWA 4AIXA 4D3CH 4QR7A 3MGTA 5AALA 3CC1A 2DQUL 1J87A 3UTZB 3DMMB 4M61A 5GS0L 1LMIA 3BWZA 4TUOB 3LEVL 3Q01A 4XE0A 5CZVH 1IEHA 5D96C 1TQCC 1G7MA 2WLYA 4FYRA 1MCLA 1HEHC 3II2A 1TSHA 3EDEA 5CJXC 1EHLL 3BHBB 5CFHA 4HFUH 5EA0H 3RFZB 4MAYA 1OAJA 2R1WA 3H42H 1HCFX 4H1LA 4QYOB 4JFYA 5E4AA 5F9JA 4E5XA 3SCMD 1FFTB 4N5ED 4FQ2L 1UXMA 1EJFA 2HB0A 5C6PB 1ZVNA 4JW3A 3P4NA 5I0DA 4QLWA 3B7RL 2RFXB 1K5WA 5FLUA 3GF8A 2P5WD 4RBPK 1BD2D 2DQTH 4HQQH 4I3RH 3IDJB 3M88A 2V6HA 3A4AA 5EOTB 1IAIH 1KB9K 2YPVH 2GSIB 2M8XA 1EDHA 3DVNB 4JUSA 4DETA 3JQOB 4QXTB 3CQQA 4WVRA 4JCMA 2Q10A 2FGZA 1NCGA 4G82A 2EDWA 3TEXA 1MCEA 2A0LC 4X7EC 1DJZA 4LLQB 1M6OA 4W9EC 3BZFB 5G5DA 1FFOB 1KIRA 4BZ2A 2OP4L 4NP4H 4WTQA 1M1SA 2DW5A 1GJWA 1TYEB 4ADIA 4RFNB 4AQEA 4EUPG 1I85C 1M7XA 3LNFA 4K5OA 3QPQC 4PJ9C 4W6XB 3TV3H 3DX3A 5IVXE 5GPRA 3T6VA 3BPLC 2V3DA 3FFDA 2XU9A 2J8UF 1WD9A 3ILDA 4FJ6A 5HHMB 3ZDYF 2R56H 2Y72A 1HNGA 1A25A 4Y5VB 1HXMA 1DL7L 2G3MA 2ROXA 1NMAL 5CN2A 1KEGH 5EIIA 1WBYB 3RTQA 4KI5D 1MWAA 1FDLH 3L4WA 3QQNA 3IB4A 3VB8A 3BGAA 3WN5B 2CE6A 3ZT7A 1F3JB 4JG1L 4LT7A 1MJJB 5FB8A 3OLEA 2VL5B 3EFDL 2NY6B 4UM9B 3EBHA 2OZNA 2J88H 2VDMB 3OGCA 4NM8L 1YN7B 2NLJA 5LGKA 3ABMB 2C4FT 4UT9L 3FOLB 2PYFA 4MAUL 4PJFB 2CGZA 4PD4K 4F15B 4NZTH 1NCNA 1T1ZA 1J05B 4JFOB 3HUJE 1NIFA 3WAKA 5IW6A 4Q89A 4O02H 4XCNB 5FYKL 1ZLWK 1T1WB 2DMKA 4XN7A 1NCAL 4PCYA 4AQ1A 1AY1L 5ESVB 3VWKB 5AD0B 3E3QE 4BUHA 3B2UD 2Q1EA 4MDIB 5CU5A 3UTSD 5IREA 3P4OA 2K1MA 4N28A 3QXVA 5IHBA 3U7YH 4EPSA 1V5JA 4XBEH 2W60A 2WJ7A 4P46A 3FQ4A 1FNSH 3L16A 4ZTOL 5C0RL 3ERXA 1KN2L 4K2UH 4U6HB 3I75A 1JHTB 4PJGF 2MQCA 3QI9B 4F5CA 1J1XL 3DV4A 4IBSA 1OCWL 5FV1L 3JXAA 3MBWB 4QYAA 2A77H 2KLRA 2WINA 3UMTA 2G5RA 1HH6B 2Q8AL 3NH7H 4K3GA 2QDWA 4H20L 4TVPL 5C0AE 4OI7A 1QBLH 1OW0A 3CLEL 4XMVA 5FEBA 2P48B 4M8QA 1T4WA 2RD0A 1MI5B 1JZ6A 5EWIL 1FI8C 4G1MB 1W72A 1N6QL 2JB5L 2MKLC 3QG6B 4PGBB 2VDRB 1S7SB 5BZWB 1SJMA 2YQGA 1DYZA 1U41A 3JV5A 3KWVA 3KL0A 2Z91A 5D7LE 2EE9A 1MZYA 1NBYB 3JWOH 5HI3D 5AZ2H 4P23C 5E8NA 3KNBB 4OLUL 2ZUYA 1QFWM 4ZSOB 1JV2A 3MLXL 3QR0A 5KZCB 3MUUA 5F3HB 3CPLA 4X7SL 2BSDA 2P8MB 1XIWB 1Z9SA 4KTDH 4AL8C 4QY8A 5J11C 3ZHDA 2L7JA 4TKWA 4LLYA 4KZDL 2BRQA 2VXQA 3N06B 3S3PA 1IAOA 4WI5A 4LHUG 5I16B 4GW5B 4WIQA 1ZDQA 1E5YA 2JKTM 4OF5A 4O5LL 3X1NA 2VSDA 4OD1L 3HS0B 4FJZA 4UINL 1CFBA 4UUJA 5AOZA 4R2GD 4BCYA 2NY5H 2DF3A 5T3ZH 4N8PA 1KYOK 3MZTA 2IQ9L 3G6JF 1KC5H 3ZMEA 2A2QT 3V6ZA 4QJ4B 3QHTC 4P2OB 1R5IA 5TH2A 3IGKA 1GGBH 3FSVA 3NEXA 1JGEA 3OXRA 1KLFA 2P8LB 1XFPA 2WLZA 4PJEE 1XXDC 1ZA6A 5GSVA 1N4XH 2WTOA 3CK0H 1MAJA 4X5WB 5GRJH 3QNZA 2WGNB 4AIZA 4XHJD 5MP6H 5JIHA 4ELMA 3WJJA 3P40A 1JHKH 3A67L 3QQ9C 3UCRA 1TYRA 5CILL 2DQIL 4QTFA 5T1MA 4M7LT 5IBTL 4KJQD 3IDIB 3FT4B 3S34H 1GW6A 2WXGA 4K9EL 3VH8A 5BRQA 2OJEA 2CD0A 4XP6L 3ZYJA 4KQ3L 3WIIL 1TCRB 3GJFB 2IDFA 4H8PA 5CD5D 4KUZH 4UDUA 2FL5A 3FQTA 3GMNA 2P5EB 4PJDE 1BREA 4NYLB 2OMBA 1MJUL 3K5SA 4DUXA 2Q20A 2QQLL 4OD2A 4LKCB 2EIBA 2QQNH 5IJKA 2RMNA 1MH5B 1SVZA 3GTTA 2NQDA 1MJ8L 4H5SA 2NW2A 2Z35B 1SY6H 4MA1C 2QSVA 2X40A 1R3LA 3L6FA 4U1GC 2HRHA 2HKFH 4M4PA 4W93A 4FXGB 1RJLA 4V2BA 3TWCH 2E4FA 2WSKA 4NFCA 3WO4C 5T1KA 2IC2A 1UASA 3HPJA 3KPRA 3O6LH 1J9TA 2ZTBA 5F7EH 3TH2T 4U3SB 4LAQH 4Y16A 4X5XA 2KZBA 1Z9OA 2B3IA 3L08A 3WNIA 4FADA 4RFEA 2EJ1A 4X9YA 4N2CA 3L3JB 1EO7A 1NMCB 2G2NA 1Y6KR 2X9YA 2BY0A 3GXTA 2X41A 1GJIA 2GI7A 5IROD 1S9YA 2QHLA 1IVTA 1BQLH 4QF1B 4HHGA 4LLDB 3SQOH 1T3FA 4PMEA 4APQD 4IBUA 4NJ9H 5FHBL 2EDOA 4MMYB 1IBGL 3HI1B 1DJHA 1WZ1H 4QRFA 2VISB 4M7LL 1CFQB 5LCVL 1E6OL 3SPCA 3LH9A 5ILTL 2BFVL 3L5JA 3OB0K 2XZAH 3TS8A 3QT2A 4L9LA 4FQCL 4YX2H 1X5AA 3DGCR 2VDMH 4HIEB 2XA8H 3GRWL 4U1NB 4XOAA 5SWSE 4KMQA 1EEZB 4JPWH 3KPSE 5C9JB 5I6XC 3EJZD 4P2QD 2WWKT 1HC1A 2VR6A 5IMLA 3DSFL 4WO4D 4FD0A 5T5FA 5F3BB 2DOCA 4XTRC 2WNWA 4DFHA 2A74A 1UOKA 1MIEH 3ECWA 1P4BL 2FJFA 3NABL 3SDCC 2XKSA 3TJEL 3KVDD 1RUAL 1IUZA 4CVUA 3MRLB 4Q9QH 3O4OB 1UA6H 1KENH 1DQLL 1TPXC 2BIOA 4U4IA 3DNKA 3IK2A 5I73B 3B83A 2R9HD 4N2DA 3ZRFC 3N2JA 4XC1L 4H0LC 5HGHB 1JD9A 2IWEA 4UMSA 4KZEL 2WMPB 1QFUH 4IRZL 4PV9B 1CYXA 2E8ZA 2FNBA 1ZGLB 1GHFL 1FLTX 3V0VA 4HGWB 2GB2A 5BQ7B 1PYWB 4H13C 3U1QA 1MVFA 2GJPA 2JKNA 3IFPA 3ULVE 1URZA 3RFRA 2E7HA 1X9LA 1JZHA 3QJRB 4WKZA 2ZAHA 2OULB 3FO1B 3DVGB 4LCWA 4JCLA 4FFYL 4NQUA 1AS8A 1ZT1B 4XMXA 1BGXL 3MREB 4L8SB 4UT6H 3KLHC 4RSVA 4QRRA 4BZ1H 1OP5K 2WB1A 4JO5A 2YAEA 4IOSD 5BZDB 4IJ3C 5E2JA 3EYUH 5D55A 1M71B 1HK6A 2CMRL 1X7QA 4MSWA 1C7SA 1MHPL 1U3YA 4X8JB 3GSVA 5E4EB 1MUJA 3FQWB 4Z78A 5IB1A 4U1JA 1B0WA 4RAVB 4HKXA 1IIIA 3N91A 4JFEE 4LOUC 5E2VL 1WYJA 1Y18A 2F1EA 3DO4A 1DQKA 4K8RD 3UZQB 5ITFA 3QIBA 1Q72H 5CCGE 4JN2A 3QQ3B 3I6LE 2DQFB 4G1EB 1YC8A 3R1GH 5DMIH 4FQQB 5CWSA 1AHWB 2NY3C 2VZSA 2X4UB 2ZT9C 3WFEH 1TZIB 1TUPA 2JMRA 4FTVE 1CR9L 4IMKA 1LDSA 3LRSA 4HUNB 5FGCB 1MCWW 1C08B 1X7TA 3L4CA 3R8QA 1MCRA 5ANME 2VRQA 4PJFF 1RUML 5E4OA 2IANB 4PVMA 5I17B 4JDEB 4BDVA 2APXA 2Q86B 2VSCA 4DKFL 3CD4A 3H55A 4C83B 1OHZA 5AOJA 3HG1B 5C07E 2HRPH 5CINL 5EB9A 5MEOA 2F54E 5F1NA 2WVVA 4TUJA 5C0BB 3DHJA 1U8HB 2GJJA 3VJ6A 4G8EB 3VTTA 1ZRUA 1MHCB 4JEGB 3ESUF 1LO0L 1UWFA 2BSSA 3D06A 3UDWA 3MROA 4J3TA 1RUQH 1VFUA 3PFQA 4XB3A 3LQAC 3WU1A 2ZWZA 2FJGB 3WHXA 1D6EA 1JRHH 2BJMH 3CVHL 5DEZA 2W92A 2EDQA 4U1LB 3EYFA 7TAAA 3MUZ1 1FRGL 3IDNB 4JANA 3MJ9L 4TSCL 2ORBL 4C58B 3MJ8A 5CGYC 2FBOJ 5JW5B 2XNAA 5E6RB 4ISVB 4D0CA 5BRZE 3QEQE 4MS8C 1KJ2H 2OL3H 4R7XA 3GSNL 4X6CE 3KH3A 4GKLA 4ZPVA 2B16A 4UYPA 4KK6C 2YRBA 4YZFF 4WWKD 1IGJB 3X14A 3VD0A 3RHWK 4AQ8A 4GAGL 1QSEA 3B3IB 3C5JB 5IB5A 3ILPA 3QPQD 1U58B 3GLDA 2EEFA 4YK4B 1CE1H 1T2QL 2AQQA 2HJLB 4IDJL 1KCKA 2FATL 3E6FA 5B1AB 1RSYA 4D9QE 1ECYA 4EMZA 1BBDL 1IGMH 5FA3B 2R0LH 1EZLA 3BKJH 5JXAL 3GTVA 3DJSA 5D1XB 5D5MF 3U9PH 1PY4A 3H1ZA 3HFFA 2ITCA 5C6TL 2XV3A 3QDGD 2FIRT 5MENE 2F5AL 5IM7A 1KF9B 1OAQH 3SE3A 2DQDH 3OQRA 4R84A 5E00A 4EXKA 5ITBH 4WI2A 3G04B 4Q2ZA 2H0PA 3WXVH 3PGDB 3U0WL 4UOZA 4P4RB 4HWBL 4TTDD 5CJQH 1GZPA 4LDLB 1XCQB 3EDDA 2ADJA 5B1CA 4C56B 4M03A 5ICYB 1WFJA 3TNMA 2PR4H 3RJOA 2NYZA 1VEOA 2VN5A 4K23L 4RAUB 3MOBL 1SHWA 2YD0A 1PDKA 2MQ3A 1QWHA 3ML9A 5E51A 4WFFD 4IRJB 3OBAA 1LO5A 3HN8A 4PJBA 3SDXA 2G3ZA 3DOIA 2BO0A 2MH4A 2E0PA 4Y4FC 2QJDA 3UYRL 2ZWYA 1AGCB 1J9SA 3VXNA 1EEUA 4B6ZA 5HHOB 2MPVA 4AENA 2XWJB 3FAWA 3TYGH 1FNEA 2YARA 3GMQB 1KCSL 4MNQE 1P4IL 3O3UN 1DUYA 4BD4A 3FO2B 4FC3E 5BXFB 5ISZB 1ROWA 2Y07H 3Q6FA 1M05B 4B3VA 3BEVA 2AERT 4NZJA 4R4BA 1IKNA 5HHVL 5I26A 4HDIB 4ZX5A 4AQAA 5HVFB 1XL4A 3DX7B 3FT3A 2F68X 2DI9A 3MA9L 4KWUA 2KL6A 2RIKA 1BJMA 4HCRH 4Z7AA 4HJGA 4NKMA 5AAPA 1RJZB 5IG7B 3LPPA 3CFDB 4B5ZA 1F90H 2IADB 1PNCA 1NLDH 1XV8A 3KR3H 4JFSA 2AI0H 1TDQA 5IV2A 2R1YA 3R06A 3WV0A 5KVFE 4MD5A 1Z5LA 2HA1A 3UL4A 1S7UA 1B4TA 4B27A 3F5WB 5IMMA 1G6RH 1MFDL 4KO6A 3VXTA 2FECL 2OZ4L 3NA9H 3GXUB 3APNA 4MJJA 2NX5E 1GYVA 1LGVA 4ICXA 5EORH 3DHPA 3NYKA 1G7MB 4P23D 5GRWA 1KGCD 3FU0A 1JGUH 2VSKB 3VG9B 4JHAH 3QJTB 4Z7QE 4P57B 1M6UA 3HJ0A 3QJUB 4L0ZA 5CP7A 1KJ3L 1UCTA 2JIXD 3MMEA 2R1WB 3B7YA 5B38B 3BWAB 5F9JB 2ZCLL 1Y0LB 4ODSL 2X9ZA 1HHHB 4X4KA 5BV7B 5T33L 4DGVL 4K3EL 2E56A 1JYXA 3O4LB 3HFML 1LDPL 3H9HA 3OKKB 1I1AC 1EHAA 2J6WA 2FWOA 1WWCA 2B0SL 3CMGA 4P48A 2FZ3A 1NEUA 4NQDA 2AJZA 4DP8X 1XH3A 4FNSA 2L7QA 1UCBL 4XO4A 3PGFL 4AUJA 1UG9A 1BEYH 1DBBH 4HIIA 3ZDZE 3SPVA 3RB5A 1BLIA 1MREH 2OMVA 2WBKA 3INOA 4JO2L 3WIFB 4XODA 4N0YH 5D70L 1KIPB 3ULUH 4JRLA 1CF1A 5LLIC 5G5DB 1KELL 1KIRB 5EPMA 4GQQA 3SD2A 5CKAA 2Y2WA 3CH1A 5ABAA 3SGJA 4LK4A 3QRBA 1S5HB 2DM4A 4NQQA 3HA0A 3HIZA 1OSPL 5FKAA 5JHBA 2F54D 9CGTA 5DD1H 2DPKA 3FFDB 1KB5L 5FO8A 2C3GA 1ACYL 2L4OA 1OGAE 1BM7A 5CEZL 1HYSD 2WCPA 2DWXA 2ESVB 1HXMB 1RLBA 4AV5A 2RQ8A 2WLHA 1PKQA 4KXDA 2FEJA 5GZOA 4EE2A 1REIA 2DQJH 2PPFA 4X2UA 4ZFZA 2GEQA 3CE1A 1QAWA 4OZFA 3HC4H 3QUML 4K5LA 4K5PA 2PP9A 5K1NA 3FB8A 1QI5A 1YUKB 2YAFA 1NAML 2QELA 1CDBA 5AB2A 2QFPA 1BOYA 3AG4B 3BD4A 2FT7A 4U6YA 4B0MM 2PYFB 1GW0A 2GY5A 2NXYB 5EU4A 5IGXL 2GQHA 1T1ZB 4JG5A 5BRZD 3LJ3A 3NACL 4FOMA 2WWNA 4ICWA 1O6TA 4LPWA 5IW6B 1QLEH 2HMIC 1NFDA 3VD9A 3SE6A 4AQ1B 2GSMB 2QADC 5JQ6L 1WFUA 3U79A 3QEGL 3U6XA 1NPJA 3DBSA 5L7XH 4CBZA 2Y3NA 3RZCC 3PQYA 1H6UA 4X4MA 5HXMA 2WO3B 4AGOA 5FFGA 2N01B 4FQLH 3VM7A 3BE1L 3B4NA 3R19A 4P46B 3G5ZB 5IFHL 1WZLA 1V7NH 3CN4A 1L3WA 3GKWL 3D9AL 4XMTA 3I84A 5JPNA 1P6WA 2J72A 4JE0A 1D5IH 2X12A 2DICA 1WIPA 2Z93B 4G42A 1SXZA 2FX7L 5F7DB 5IMKA 2E6JA 2VABA 3DV4B 25C8H 5C0FA 5IIEB 2YC1A 4WJ5B 4AC4A 1N9PA 3RNKA 4Z7VE 1JZ7A 4G8GA 4Y5YA 3DO7B 3ZZQA 3HZ3A 3O6MH 4F8PA 3BUQA 5DK0B 1EXUB 1PZ3A 4M8QB 1NCUA 4MMZC 3CHQA 4XTRD 1W72B 1LYQA 3SDCD 1IKFH 1HINL 3OAYH 1AO7E 1UT9A 3RIFF 1PAZA 2I5YH 1QPKA 2F53B 4NWUL 4FJYA 4M93B 4XMKL 5EN2A 2ZD0A 3WFBH 2YUZA 3C5ZA 4AX3A 4GRMA 2P24A 2NTSP 4XZ4A 3TEUA 2MCG1 4RMVA 2B39A 3K2UL 5B8CA 4GOSA 4YUEH 1F86A 5FGBC 4YDMA 3GZQA 2FJUB 3NEOA 3KWTA 1JV2B 3ZE1E 3TJHD 5D7SL 3WXWL 4JQVA 2MFNA 3FH8A 1Z9SB 3X1GA 3W0WA 2WWMC 2WO4A 2D9CA 3EUUA 3HZYA 3BP5B 3O2WL 3MUHL 3QWQB 3W5MA 3QP3A 1MSPA 1YN6A 3NFNA 1IL1A 4WV1A 1XAUA 3H7BB 2UUDH 1U3HB 3UGXA 2AJVL 3VYOA 3PS6A 2IH1A 1X9RA 3KLHD 3JBG7 4TL4A 4BXVA 2H2SC 3MV8E 4W6YB 2E6PA 3LPWA 1HCVA 4LCCB 1K8IB 3V0JA 3WDJA 5I0ZA 3MLTB 4LGPB 4CN1A 5F71A 3ZE2B 2VW6A 3MLUH 3FQUB 3KPOA 3GBEA 1JGEB 3DRTA 3OXRB 5F1OB 5CLWA 5EF2A 4NQCE 3ARGA 2X0UA 4GXUM 1LILA 3T1WA 3ZTCC 2ZPKL 3PFUA 4DPAX 4LOUD 3VA2C 4ES9A 3P69A 2WXKA 4KKCC 4MFHA 2E76C 1DFBH 4RGOL 3UBXA 5H2BA 2QPDB 3OGOE 4JHVA 2A9MH 2C3XA 2NY3D 4N2KA 5DSCA 3JSSA 4WUUE 1OM3L 4IMLB 1OKEA 1RZJL 2PPCA 3B6SA 1U4FA 5TE7H 2VDKB 1FYHB 1A7OH 2OJEB 2ODHA 5SX5K 3SO3B 3OXSA 1JZGA 1YPZA 2XXGA 3GXPA 1BQUA 4F57L 4A7GA 4GIAA 2ZOUA 3TVMA 1BYPA 1WC7A 2WD0A 3IS0X 3MODH 1FZJA 2FL5B 3FQTB 4UDUB 4ZPTA 3SY6A 1VA9A 3GMNB 2Z4QA 3VB9A 2OK0L 1BMWA 1T89C 4PIRF 3Q2NA 1L6XA 1N0XH 1TF4A 4G8FA 2LE9A 5F1SA 4AEIL 4OF8A 4OD2B 5ESQB 1BQHB 1PCXA 4G7YH 4KRPB 5K5YA 1N3NA 4RMWA 4H5SB 2AKRA 1U6AL 5TE4L 1A4JA 2GUOA 4JPIB 1R3LB 3ARDA 3L6FB 3M7OA 3PJNA 2XQBL 2YIHA 1I3GH 3P3UA 4MCMA 1RJLB 2VQ4A 3WMPA 3CN0A 1QMUA 3P9MA 5T1KB 1KFGA 1MFAL 2YGQA 1VKXA 1J8HA 1YLBB 5L9DL 4QRTA 5DMGC 5E8OA 2YWYA 2IFGA 2H3NB 1DVFD 5KYYA 2ATAA 1JZ3A 2CCVA 1QA9A 1SJXA 3QIUC 4GKZB 3DDFA 1I1FA 5AVYB 3E8UL 4XVSL 3TO2A 4BHUA 3F85A 4MTMA 3AREB 3VVWA 1OGAD 4LQFH 2YQBA 4X9HA 3TO4B 4XP4L 3STLA 4MS8D 3RWCB 1WFNA 3TT3L 2FSEA 4MQXC 5FWQA 2ZWLT 4KK6D 2G5BA 4YHNA 4QRPE 5EUKA 3MRHA 3SE8L 3T3PB 2KZWA 2W07A 2NY4C 3WEBA 2DIAA 4UM8B 5K93A 2OX5A 5T3XD 4L9LB 2W0PA 2HJKA 4KZCA 5L6YL 2KBGA 1SXAA 1A7NL 3A6CH 4PJ5A 1DTUA 4I0PA 4IYKA 5K39A 5EUOB 1AR2A 1JXFA 3HHSA 4TL5A 4PJ7E 2R0KL 2AJSL 3D18B 2A74B 2X89D 3CBKB 3JWNE 3DSNB 3ECVA 2HKAA 3ZDYE 1TG8A 4FFYA 5TPWH 4JFDE 4DN4H 1YZZA 1NC2D 1IB5A 3ELQA 3OHXA 3B9DA 3QORA 4JDVB 1CWVA 1TITA 2CJUL 35C8L 1SLXA 2BP0A 3UC2A 4M3KB 3RWEA 1AVAA 4H8WL 2EYSB 3L7FB 4KX9A 5J12B 6CGTA 3WFCL 2BHFA 2MHAA 2VMDA 4Y4FD 2Q87A 1F8TH 1U93A 5KSUA 1EVTC 1NBVL 3C6SA 3IFPB 3KBEA 2H32B 4ZS7H 3VI3E 1Q1PA 4KXZH 4YSOA 4N0UA 4WKZB 5JLZA 1KBGL 2AV1A 4WFHE 3O3BA 1IGCH 3CIAA 3EJPA 1E90A 1O7SA 4WEBL 5ELIA 4ZX4A 5J0BA 1I9JL 1BXXA 3VXUE 3EGSA 4YLCA 3UTTD 1G9MH 4L1HA 3KXFD 5GIRA 4OQTA 2ICWI 4W4NA 1NGZA 3V0IA 4GYBA 1TJMA 2WLLB 3DMMC 1MUJB 3RVUC 5IB1B 1CK0H 4U1JB 3F7YA 1JRHI 2OMYB 4HKXB 4QHMA 4BSVA 1Y18B 4AVJA 3EZ8A 2W5PA 4Y1SA 1USQA 5ITFB 3QIBB 1VACB 3S5LA 4XXCA 2B3RA 2Y1YA 3NGBB 5J3HC 4KXCA 3BD3A 4Y1AD 4Q9RH 5CWSB 4ONGL 1YEFL 2BSED 4QPEA 3GZOA 3WLBA 2AXHA 5L8JB 1JPGA 4QHUB 2Y1VA 1TVHA 5CKGA 5HDBF 1KV7A 1LTXA 3D85B 2DIJA 3QFJA 5DD6A 2XTSA 1Z3RA 2PTUA 4YIQA 1B0RA 3T08A 3MLYL 2IPTL 2YPLD 4BDVB 5H4ZA 2UY6A 3MJ9A 5EOCJ 3AT9A 1AS7A 5E99L 3MLRL 3MXVL 3RU8L 5FHAL 3HKZA 3V2AR 4FQ1H 4FNLL 2WLJA 3IJ9A 2FR4B 5DLMH 5L2JA 3GSNA 2F7PA 3RDTC 3BQUC 4NC1C 5H37G 3VJ6B 5DJCB 1GL4B 1JWMB 1ITBB 2YD2A 3QW9A 1CF8H 4NQCD 4WF7A 4G7RB 3F2LA 3L48A 1I1AD 4MXWH 4O58H 5JIQA 5IHZA 4OLXL 3I02B 2CPCA 3MROB 3ZZ1A 3KPMA 3HBZA 2ICWJ 1SVCP 3DARA 4N8VA 4RFNC 2CO6A 5I1KL 3D39D 4OFDA 3EYFB 2TSBA 3L17A 5F1IA 2VDKH 1TQBB 1PAMA 3NP4A 3MJ8B 5A16A 3AG1B 3SGEH 1RPUA 3BRFA 3MRGB 1H3PL 1ECZA 3X13B 1H3GA 4YQXH 3ARXA 1CFNA 2IDCA 4ZPVB 3UGUA 1YYMH 2A4ZA 4G5ZH 5DJ0A 2CGYA 1R33A 5GGVL 3X14B 2FBRA 3WN5C 5IB5B 2IV9A 4Q6IA 3PGCA 3P9WB 2EE2A 1PTZA 4ODHL 1WEJH 2NY1B 4IBTA 5DGRA 4CSTA 2WN2A 2NY6C 4FAAB 2QHRL 5DT1H 5KSAA 4DERA 1GYUA 1OP9A 4N2EA 3VM5A 3IMBA 3HAEG 4OBRA 1LE5B 1BLNB 4TMPA 2KZ1B 1BF5A 3S4SG 1MCNA 1FO0H 5LDSA 3WEXA 3S88L 1JK9A 3P0YH 2H1XA 1MQKH 2WXMA 4IS6A 3EHBB 5HDWA 1SF5A 3QUZA 4X83A 5IM7B 3QUXA 3R0NA 4QWWC 4XWGH 2DJ4A 1K4CA 4NQEB 4MNGA 4NT6A 2B15A 3SE4C 4HT1H 3UJJH 2YOAA 5LUMA 5E00B 5I1EL 3NDYE 4RZKA 3X3FH 4HPYL 4Q2ZB 1LEIA 2FH8A 2X6AA 5JHDE 2B14A 4I5BB 4HIXL 3ZDXE 1ZLVH 1FCGA 1RZ8B 1FYTE 4GAJH 5CXPA 3TNMB 1F1AA 1JNLH 1YCSA 1F3DH 4KDTA 2ZXBA 2HMID 4A2GA 1DVQA 4QRPD 2ZCZA 1PDKB 2A9NL 1RZGA 1MRDL 1VFAA 2QADD 3SDXB 4KO5A 2EO7A 3TBBA 4KTEL 3HRZB 3OPUA 3QI9C 1DLHB 1R0AH 4GKNB 2EUXA 4G9DA 1FFPB 3RZCD 2E46A 3CN3A 1TEFA 2ED9A 3P3YA 2WVUA 3ZE2F 1TU2A 3QJHB 4DGUA 3RL1A 1FNEB 1NAKL 4GG6A 3GHEL 1DUYB 3BZ5A 2JF1A 4YBQD 4XP5L 4JUTA 3US0A 2APBA 2A6KB 4Q52A 3ZMRA 2LAAA 3QNFA 2OZ4A 4AQAB 4ELMF 1OAZH 5GGSY 1SZNA 2H41A 5FFOA 3FT3B 3KM2A 2QSCL 2XPGA 3ARTA 4JAMA 3MRKB 1WFOA 1KYUA 1OF2B 4XXDA 4Z7WB 3ZQWA 1RFDH 2H26A 2J7LA 1SMDA 4F24A 2K6WA 4PRHD 4YAQA 4LHUB 4HJGB 4JFDD 2PXYD 4U1KA 3RX8A 2CBPA 3NA4A 1J9RA 3EYVA 3FN0L 4UQIM 5F7MC 5BPPA 3MLPA 3FO9B 1BX2A 1QNZH 1IC0A 3MOAH 5IV2B 3TH4T 4WI8A 1KGUA 1E3FA 1N8ZB 5D7KD 1Z5LB 3MGOB 3CCHB 5LBSA 4AYID 2UXFA 3I50H 1INQA 1BEXA 1XIWC 1YUHA 2YRPA 4JRXD 4DPCX 4UV7H 2CUHA 4LNRA 1BA9A 1L6PA 3HR5A 5J1SC 4OZ4A 4R7VA 4Y8DC 5FW7A 4OR1A 5I0VA 3KPNA 1PFOA 4WFHD 3T09A 1KN4L 1BAFL 3RWDA 3C5SA 1BFVL 2BSTA 3HC2A 1CD9B 5GHWH 1KBKA 3VCLA 4DTGH 3TPKA 1JV5A 4IGBA 2V2XA 3CWGA 3NIDB 4URTB 1GC1C 3F7QA 5IJVB 4P2OC 2BS8A 1G1KA 4OF0A 1XR8A 1U95A 3LPFA 4YZWA 1R5WA 5E8DL 1JWUA 2X9XA 3HG2A 3H9SD 3W39B 3VSTA 1RP8A 4NQDB 1ZT4A 4LLMA 3T3PF 1XH3B 3TBVB 2H5UA 3QCUH 4IOFC 1WAAE 3K46A 4ANUA 1ZT7B 3QYNA 2J6EL 3VFRA 3SKNA 2CJ3A 4WUKL 4KJWC 3WKNA 7CGTA 5FW6A 2QGBA 2OXHA 3GMPA 4FYQA 3AY4A 2AQPA 2Z8VC 4KKCD 2HLFC 2HKHH 1SDDA 3U9WA 3E9TA 4GB9A 4KC3B 2O4EA 1OEZW 5DO8A 3EO9L 3KPPA 2AEIT 3CH1B 4EUPH 4TSBH 2R23B 2JJSA 1NFIB 3PNRB 2ZSVA 4UZSA 1CICB 1NKOA 5FKAB 1GSKA 2WKLA 3RUGA 5KBLA 2E75C 5FO8B 3RJDA 1J0JA 5HHME 1H0DB 3AQXA 4AE1A 4X5QA 3LZFL 1QEXA 4DKAA 1JGLH 4QOKA 4Z95L 3WSQH 2NDFA 3MSPA 5JXEC 1L9MA 4GUCA 4TVSa 5EBGA 1HWWA 1RURL 4ZFGL 3CFJB 1NMCC 1X9QA 5CAYB 1RZPA 1TTBA 3ARFA 1MRCL 1TJHL 2RCSL 3T2NH 2EADA 1RH8A 3ZHKA 4G8IB 5L88H 5DD3H 4U6YB 3L2MA 5CM1A 2XPZA 3HHRB 4PJFE 5CMAA 4UQCA 1VEPA 1ZE3H 2ZSWB 1E2VA 4N0RA 3SDDA 3WY4A 2EYTB 3P4LA 1FUNA 4JGNA 5J13B 2Y5QA 4J3WA 4XCFH 5EU6D 4PB9H 1N67A 1ZTXH 5BVPH 1CL7I 3UIZA 1UWXK 4XN2A 3QIUD 4RNRB 2CRZA 2MOQA 1MKFA 4NRXA 4HBCL 2ZOTA 2F1AA 2WBWB 1E28A 1TNNA 2TAAA 4QHKI 1RUPH 3ABKB 3AWEA 4MQXD 3VMPA 5J9PA 3FUIA 4DEWA 1F58L 1BXVA 5BZXA 5KAQG 5K9QG 5TGBA 3X1BA 2NY4D 3SGKA 3WMSA 4HXBL 1BDYA 4YHYB 3BKYL 1XSIA 3HBQA 1EMTL 1AFVL 2ICEC 4PW4A 2WWKO 2YRLA 2AJYH 1PG7H 1SEQL 2YC1B 5JO5B 3O4OC 1WPCA 3E7JA 5F7LB 1KFAL 4S1RH 1UA3A 1VZIA 4JO8A 4ELDA 4OGYL 2UWEE 4Q7DA 1NEZA 3BAYA 4ZJ9A 3V52H 1Z0NA 3GK8H 4YZFE 3FDWA 3TA3C 2IH9A 3PREA 4UB0L 3TH3T 2R2HA 3ESOA 3PG2A 1MI5E 2VLRB 3BWUF 3QUGA 1MZZA 1E9QB 2LQRA 4HEME 4WTZG 3H0TA 3QDMD 3WEMA 3G5XB 1YNLL 3F7LA 1AAJA 4XNYL 3RPKA 2GABA 4I13B 5EZOL 5E0QA 3WS6C 5D1ZA 1UFUA 5EN2B 3MYJA 3VFNB 4JFQA 1T04A 5CF3A 1T0NA 1C1EH 3WG7B 2MOGA 1DEDA 5FCSH 2G2RA 4Z7NB 5JHAA 4ZSOE 4M43L 3B2XA 5DJ2B 3UJIL 1G84A 2NSQA 4L37A 4RDQG 3BJLA 3HEIB 3ZBMA 2XACC 3VXRB 5GS0H 4GY4A 3LEVH 3W0WB 3S8FB 4QHKJ 3HZYB 4I1RA 2XV0A 2ZKHL 1UADC 2LU4A 1IAMA 3TCLB 1JPEA 1EHLH 4U6VH 3AMKA 5ALBL 5E4EC 1YN6B 3NFNB 1IL1B 4WV1B 4GSDL 1HKFA 1QUNB 2ZOLA 2X87A 5HGAA 2H8PA 1VEMA 3G5VB 3C6EA 1E4WH 3B5GA 4MJ2A 2IH1B 1A3QA 1YEGL 1JGIA 1QSFA 3QPXL 3C60A 3WBDA 1IC5L 4J4PA 4FQ2H 3D2UA 4K15A 4OJFL 4QKXB 4XNBA 3FYIB 4JCWA 1SXSA 2DJSA 2PCXA 1X5LA 5B7MA 3KGTA 2W0FA 3KPOB 1OAUH 3RVUD 1GAFL 4Z6AT 4UNIA 3F05A 4JR9L 5HVGB 5EO1A 4E9TA 1XZ0A 2ED8A 3KL5A 1AGEA 1ADQH 2VZOA 2YD9A 3P3RA 4TUKL 3BVNB 3GI8H 2BOLA 1VCAA 5J3HD 3KW8A 4YWGH 5DR5L 4F8TA 1E6JL 4FXLA 2HLAA 2PABA 3B6SB 4NO2A 1I8LA 4YHOH 4QHLA 1YY8A 5GRUL 1KTRL 4FFWC 1WBXA 3OXSB 1WRFA 5ACLA 4N2MA 5HGDB 3VX0A 2VXUL 5ABZA 4L4VA 4ZPTB 1X5YA 4TSAL 3GXMA 4L5FH 3DTUB 4ZTPL 2P5EE 2K4AA 3V0GA 3CBJB 4LSDA 4L3FA 4X50A 4PW9A 5F7FA 3P3TA 2K3TA 4KKPA 4PJBF 3SDXF 2HUHA 4LFHG 4HWEH 4HKJA 1A4JB 3BQUD 3RDTD 1QLRB 1EGJL 1DSFL 3P9MB 4JG1H 2FRGP 4OKVA 3GM0A 1VKXB 3QG7L 4NM8H 4QRTB 5KS9E 5DQDH 5BW7A 4Y19D 1GOGA 3UPRA 2XSKA 4UT9H 1MIML 4PJXE 5KYYB 1FORL 3S3JA 4MAUH 1DVYA 1OSEA 3D4YA 4YK4C 3TO2B 1U8IA 1EA9C 3IE9A 4K94L 3CHPA 4JVUA 4KV5F 1FC1A 3FUEA 3WOVA 5FYKH 1NCIA 1A5FL 3NJKA 1I9IH 1NCAH 4V33A 5C2BL 3STLB 3WTWA 4HCFA 1KNOA 5D1XC 2G5BB 4WFED 5EUKB 1G9EA 1ZHKA 3MRHB 4U2ZA 3WELA 3ZKMC 1HH9A 4PG9A 3ZXAC 4RQQB 3O9WD 5I8EA 2YXFA 3EOAA 3VG0H 1BF2A 2C9AA 2IG2H 1GOHA 1R34A 5DRWB 2NY6D 4D0DA 5DJAA 2HJKB 1MCOL 1O9VA 3CGTA 1PPIA 1DBKH 2B1OA 3L4VA 4ZTOH 1OCCB 3WUWG 1T1XA 4BFIB 4ZMZA 1D9KD 2Z1KA 1AGFB 1KN2H 1NDTA 1YA5A 4BH8A 4J6RH 4Z7UE 4JPKL 4PLOB 3P02A 3RWFA 5B39A 1P9MA 5IVXA 3VXMB 4MDJA 4XBMA 2AABL 2WC7A 2BVTA 2DM3A 1OCWH 4NWTL 5DHDA 4IRJC 5FA4B 4QWWD 4DPRA 5IB4A 3DRQB 2E86A 1RHHA 1RULL 3GMLA 3U30B 2YRZA 4LLVA 1HL8A 1G7HA 3KHOA 4H20H 4NGHL 4ALAL 2QDVA 3NIDF 3N0PB 4OCMC 5I1HL 2WJ5A 3W81A 4EQ3A 4OGZA 3QORB 5I5RA 1U33A 1YMMB 2EIJB 1S9WB 3DYPA 2BP0B 3UXFA 1DLFL 1I3VA 3OLGA 1A21A 1S46A 3RWEB 3RX7A 2OV0A 4BM7A 1A8JH 5K59E 3WIHL 2FYYA 3QI9D 3J7HA 3K8LA 3HE7C 2MHAB 3LIUA 4XO3A 4I77H 4AK1A 5GXBB 3A21A 4P5SA 3IF1A 3ARUA 4IJTA 3K5RA 3HUJA 3IMWA 5KSUB 2NY7L 4BQBA 2DAVA 2P45B 3C6SB 4NKDA 5BOZG 2PW1A 2N3JA 4S0SD 2VLJA 4L18A 1UVQA 4MZRA 3MLXH 4PH8A 2AV1B 3O3BB 1CU4L 43CAA 2Y22A 5G4OA 1LQBC 5C0IB 3MJ7B 1A7QH 3EGSB 5AVWB 3IAGC 1F4WH 1Z0MA 2J56A 4CMMB 4KZDH 4MJIA 5KVDE 4XNZB 3C5XA 1HX0A 4PTTA 1IJ9A 1P7BA 5EHFA 1A6WL 4O5LH 4Z77B 2EIZB 4XVTL 1F42A 1CDUA 3LEYL 1ZHNA 4R0LA 2ZYIA 1UKQA 3GB7B 1OHQA 4TRPL 2JCCB 1PFCA 4M6AA 4BSVB 5E2TL 3K6OA 2IQ9H 1NUGA 4TNVF 5AVSB 1TVDA 3VG9C 4ZZFA 5IJBC 2NY2B 4LLUB 2MPAL 5LNDA 5KZCD 1ZVSA 4FFVC 3OKDA 4CAGA 5C0EA 5HGBA 3WFZA 4X0KB 1FE8L 3DIFB 3WLBB 3PDOA 5KUKA 1FVCB 2HH0L 1JPGB 2A1WL 4HC1A 3H9ZA 1OF0A 2R29A 5C0AA 2EKSA 5BV7C 3FFCD 2BW4A 5FGCE 2J43A 2BNRD 2YD8A 3QGVA 5DD6B 1D5BA 3R7QA 3A67H 4GQ9H 3TX4A 4YIQB 43C9B 1B0RB 3CVHB 2DQIH 2IANE 5CILH 5EFIA 1E9PA 5GGQL 3ABZA 3QAZB 5IBTH 4ACPA 5KN5A 3OZKA 5LDUA 3VDBA 4O9HL 1HHJA 2UY6B 2VT0A 3HE6B 4OVVA 3BAWA 4Z3IA 2OR8A 1GR7A 1WWWX 4XP6H 2V0AA 1F4YH 5D7LA 5IHHA 4KQ3H 3WIIH 1L9TA 1FC2D 4LEOB 1PGRB 2A73B 4GO8A 1PIGA 5L2JB 3A6BL 3GSNB 2JI2A 5C0BE 2BSRA 4A37A 4KY1H 1TLKA 5KYWB 1S7RA 4OLEA 4Y4HA 1MJUH 3RJQB 4PIBA 1E42A 1PD6A 2QQLH 4YHIB 3CX5J 2OW7A 4GSQA 2DDQH 1ZLUK 1NCWH 1MJ8H 2ZONA 4R7DB 5BZZA 3KPMB 3IPFA 1A6AA 1RZKH 3ZGHA 1TTFA 5LNEA 2X9WA 4IOFD 5JIDA 1QLFB 1YEIH 2CBOA 4Z23A 4TNEA 4WLCA 5F1IB 4OKDA 3IJYB 5A16B 4E41D 3EH4B 3QXAB 4A2MA 1FAIL 5F7AA 2DLFL 5AENA 3OF6A 3PAUA 2XZCH 4FL4B 3GSRB 4LRNL 4ETQB 1CFNB 3AM8A 4QRQB 4ZNEE 5DJ0B 2PUQT 3MUY1 2L7UA 3IXTA 4DP5X 3GBNL 4Q6IB 1F0LA 1LP9A 3H4HA 5E9AA 3B2VL 4ERSH 4Z7IA 2HYMA 1AOZA 4PJEA 2MNUA 3UG4A 4JRYB 5CEYA 3EOBA 1G0YR 5KSAB 1XCXA 2HJFA 2ZOKA 3FPXA 3KJ6L 5E1AB 2HG5A 2OMWA 5LCVH 2HT4C 4ZMAT 1XEDA 1P7QD 3CXDH 5ILTH 4X6EA 4ANWA 1ZGLM 2R1XB 2Y9RT 5D1XE 3WEXB 1JK9B 2X2YA 3Q9QA 4PCSA 5KJRL 4GPVA 4Z7NF 4F7EB 4AQ1C 3GRWH 3IBEA 5HD8D 2HAZA 3QUXB 3UTOA 5JOPE 4PRNA 1CXIA 2VJ0A 1JPTH 5EV7A 5DTFB 4HZLA 5FYLL 4W9FC 3DGGB 1LEIB 4N8CL 4PJDA 1E2ZA 3LRKA 1HL5A 3NJFA 1Z9LA 3M46A 3N1PC 4BSWB 4C56E 3OKNB 4MHHG 4PJ9A 4LNVA 4P46C 2LR4A 4AQOA 2XFXA 2XUWA 4ZUTA 1RZGB 2MCPL 4F8OA 5SWZA 1DEEA 4EEEA 1NM4A 4JFHE 2GTWB 4L29B 5I66B 2Q5BA 4G9DB 1AACA 4MAZA 4F7CA 4XC1H 2VO5A 5HHOE 1G9NH 3EO0A 4U7SA 1DO5A 2CDFA 5DRNA 1TTAA 2EABA 3RL1B 3G08A 4FG0A 4KZEH 4XBGB 5ISZE 3AU1A 4AYGA 4ZODA 1AJ7L 3M1CA 1XF4B 1OANA 3NPZB 3VSUA 2YEZA 3HI5L 3SBQA 4IIQA 2BSCA 2DWYA 3NZ8A 4U7KA 2H26B 3TL5A 4AYBA 1ACZA 4ZQKA 1QR1B 4U1KB 2XBTA 3IDMB 4RBPH 2BIIA 4H40A 3EYVB 5KSVA 1I9RL 4A7GF 5ERWA 3FF7A 4OCNC 4F9PC 3TA3D 4K3JL 2CSPA 3LS5H 4WJG3 4RLDA 1T5KA 4I48A 4Q6KA 3OHMB 3LKNB 4GFXA 1UD3A 2PF6A 1DBML 5D7IB 5SWSA 1FGNH 4JGUA 1YUHB 4V1DD 3KPSA 3B56A 2JELL 3BAJA 3IU4H 3RWIA 3NQKA 4OQ1A 4WHTA 5E2VH 1FVEA 1QRNB 4TOYL 5HJ3A 2ZWKA 4PYHA 1OE3A 1SLWA 3N44F 1KDJA 5DS8A 3KYMA 3O41A 1I31A 1SXNA 3C5SB 3LQMA 2X1PA 5L4JA 4L4TD 1GGIL 3HMXA 3TBYB 1FP5A 2I25N 3MRRA 1LJMA 3TCTA 2APFA 4ORZC 4R90H 1U21A 2ZKMX 2N4IA 3U7WH 4FTDA 3DETC 1RUMH 2YUXA 4OUOA 4DKEL 3BUPA 3O4LE 4OJYA 2EDJA 4NB7A 3DYOA 4IKJA 4MJ5B 4ZMNA 4RVBA 1XR8B 1U95B 4IRSB 1EFXA 1R5WB 1A65A 1JWUB 1EBPA 5CINH 3WJJC 1UD5A 3PHOA 1AXSA 2R8SL 2WCGA 3BT2L 1ZT4B 3FO0L 4LLMB 4ZXBB 4DHLA 1KDIA 3IJEA 2IALA 1IKOP 4BWWA 3EJYC 4OGXL 5DRXB 5I74B 1LO0H 3VFRB 1YQVL 5DF0A 5BVJA 3AS1A 3J8F7 3K8KA 1G7LA 3GD1C 2OXHB 2YEQA 1CGYA 4Y2NA 1MCBA 3B2MA 2BP8B 1ZLWH 4YGAB 4LQ1A 4ADJA 2HRGA 5C08A 4E9SA 1S7TA 1SDDB 1T66D 1U8NA 3CVHH 3KJ4B 3MRJA 5LG6A 3T0EB 2E9WA 4PP1C 3VFGH 2YAHA 2BNQD 2ORBH 3DIDA 3HG1D 5IJKC 4KRPC 4XVJH 1A4KA 3NCCB 2BS71 4JFEA 4D3CL 3FTYA 5JA9A 4FFWD 4M6NL 1NGPH 2WY3B 1UOVA 2E9IA 5ADOH 3O2DA 1FNGA 2PYED 2ESVE 1KTCA 3ESNA 4X6FA 1JDAA 2ZX6A 5F93C 2V5YA 2QLYA 2XKNA 4J8RA 3VFOA 4FTVA 2CZNA 4Y16C 3NG5A 4PHZA 4UU9A 3IN0A 5EA0L 1M7IA 5DJXA 4MQ7A 1KT2A 4AZ8B 1BBDH 1A3ZA 2RTTA 4OCRH 5ANMA 1IQDB 2CHWA 3OJDA 5IKCA 5JW3L 5JXAH 5LGJA 1INDH 3AREC 1Y07A 2BP3A 3NCBB 1Q9WA 5JHLH 4IHOB 3BSHA 1ZHBA 4GXVL 3DV6A 5DYFA 3DUSB 4PV8A 5C09A 5C6TH 3TO4C 4DP2X 5J06A 2AK4B 2F5AH 5ESAA 3UCQA 5C07A 4E0RA 1IAIL 3TA4D 1CO1A 1E50A 1K8DA 4XPTH 3UBFA 2YPVL 1DSWA 1T83C 5DUPH 2NZ9C 5JDSB 3U0WH 1R24A 2NMSA 4G9FD 3WS3A 4EN3B 1WAEA 1HHKB 4L9LC 3VGEA 1CI5A 3FTGB 4NRXB 1JHLH 3FCBA 3RWGB 1BMZA 3LH8A 1XL6A 1PZUB 3IFLL 1E28B 4F37K 2PR9A 1NQBA 1N2RA 3DK0A 2FB4L 3MGAA 3WNOA 1YNTB 4MXVF 1NUDA 4MB4A 5DZNA 3ME0B 4NP4L 4H0GA 3ZKMD 3MNDA 2AJ3A 3HN3A 4APXA 4YH6A 2YD3A 3TV3L 1R1CA 3W37A 3D33A 2A74C 1UM6L 5AVUB 1AR1B 4UANA 1KCSH 2D0GA 1CXLA 1P4IH 3LEXA 3QEQA 1NBCA 4X6CA 3TWYA 4A55A 3GSQB 3RYMA 5TK2A 4XMWA 4YSEA 5HHVH 4LPCA 1NEZB 2DQCL 4B41A 5KVGL 2VH5L 1KEGL 1JBJA 2R2HB 4X80H 3ZTJH 3LXCA 1UJ3A 2Y7LA 1Q9KA 2RGSA 3E6HB 4IRJD 5E9DB 4AKOA 1UWEL 1P0SE 3H0TB 5J12C 1C12A 4YVUA 4M7KH 2A7BA 3MV9B 3T9WA 3W2DH 5M95B 2J88L 4YC2B 2EECA 5D1ZB 1X44A 3Q2LA 2F53E 2F08A 4JFQB 1T04B 1AXTH 4NZTL 3MRBA 3QXTA 2C9VA 1A6TA 3NJNA 2C3VB 5MENA 5HY9A 5I6PA 2G2RB 4N0CC 4Q4EA 4B9PA 3CSTA 4WWOA 3HE7D 1R3HA 4F8NA 1ZDSA 2DIEA 2NT1A 3EG9B 1BFTA 4OTXH 1NUNB 1UGNA 3U7YL 4NX0A 4XBEL 1FNSL 5H8DA 4TTGA 3NCMA 2ZCLH 4RISH 3QIBC 1B3IA 2OI9B 4K2UL 4ODSH 2EXYC 1QSFB 3LNGA 4DGVH 1ETZB 2D7MA 3U9UA 3ECQA 5F2FA 1GIGH 2BY2A 3HFMH 4O51A 4P2RB 2E3VA 4MNQA 3VD2A 2Z92A 4IMKC 4R9HA 3KD4A 3ZE2E 4KRNA 4YE4L 1ASPA 2B0SH 1CD1A 3L4XA 4B60A 3NH7L 4UTCA 1WQVT 1DQTA 5EU5B 2HP4A 4M5TA 1QBLL 2YJQA 3A4FA 3FU9A 1BZ7B 5K69A 1UCBH 3NIFB 3PGFH 5IW1A 2X4RA 5GGSA 3K4ZA 3BWUC 4U3HA 3WJMB 4FFVD 1U8QB 5I1AA 4MAYD 4EJ1C 2IWKA 5HYQA 4QHLB 1AHMA 4NRZA 4KZ0A 4NJAL 4CVWA 5B1BB 1KXQE 3ES6A 3Q9PA 3C09C 4PWFA 2H3XC 2LLLA 1EUUA 5CNHA 3JWOL 2AXFB 4P59H 3CZLA 1OPOA 4S2SA 3VGHA 4L4VB 4Z0BL 4PLKC 1SRDA 3MV7A 4UZGA 3C9NA 3UDWC 3OB0H 1QFOA 1IFGA 3L5XH 4QT5B 3KYAA 4ILDA 1CD8A 4LL1A 3UO1H 3EYQC 1NCBH 1KB5H 1S8DA 4G6AC 5D9SB 4KTDL 2NX5A 5KW9H 1MFVA 4B96A 3C87A 5FUCC 3UG3A 2B9AA 2AXGB 1PVHA 5F0MB 2HTKC 3ILQD 2KQMA 3WJLA 4E9LA 3B5TA 1TQBC 1OXYA 5CSBA 4QJ3B 3S4SB 5I1JH 3EYSL 3QUMH 1R46A 4NNXA 2AVGA 5GRYA 4ZOEA 4EF3A 2XETA 2NY5L 5HJBA 3VVVA 4AQ8C 1NAMH 4J1UA 2D4FA 1V7ML 3MUGB 5CHNB 2NY1C 2V9TA 3X12A 1PU0A 1U8IB 1M7UA 1ZSHA 2DYPB 4FG2A 1GGBL 2V7HA 3UPAA 5E94B 3NACH 1VJSA 1A9BB 1INEL 2P42B 1JK8A 4WNJA 1MW2A 1RVFH 1NZRA 2A3TA 3CK0L 5GRJL 3MRIB 4LSVH 2EDTA 5JQ6H 5MP6L 3QEGH 1JHKL 4AMKH 4A67A 1KTLA 2X6UA 3RTQD 1HH9B 4PG9B 3T3PE 5C6WH 2XBDA 4GAYB 4HP5A 2SEBB 5I8EB 1UH3A 3EHBC 2XWTA 4WEUD 3FW6A 4R7NA 1PSKH 4D0DB 3QWOA 4ES8A 32C2A 3BE1H 5DJAB 3SE3C 4F58L 1YJDH 3AWGA 1TCMA 4XGZA 5IFHH 5JW4M 3GKWH 1T1XB 3MLSH 1H6FA 1N12A 4H1LH 4QCIA 4B9KC 4FI8A 1NCJA 4FXKB 4AGNA 5EUOE 2FX7H 5DHVH 1OP5H 1TVBA 4PRAA 3WUZA 1A66A 3HMWH 4KUCD 5A6IA 2QQNL 4KOCA 1X5JA 5IB4B 1ED3A 1RHHB 1NJ9B 1UACL 3GMLB 4Q14A 1U8PB 3FCTB 1SY6L 4LLVB 4ZFOL 4JK0D 3F65A 3LNHA 5TDNB 2XN2A 2HKFL 1P6FA 3FQRA 2WYZA 2BS9A 1WP6A 5GS2D 3TWCL 4D8PA 1IGTB 4P06A 1ZKAA 4P46D 1HTYA 2WIMA 1LWHA 5KANG 3O6FA 5F7EL 2Q7YA 2EH8H 2VDQL 4LAQL 1NIBA 4QHPA 3BVUA 5H94A 1IKNC 5GISL 1CGUA 5A2KH 2LTQB 3SKJL 3BGMB 1OM9A 5JZ7C 4PYGA 5F1KC 4LF3A 4QTHA 1BQLL 3TBTA 4QXUH 2C1PB 1LQSR 1W8EA 4Y9CA 2PW1B 4NBXB 2VLJB 1UVQB 2X09A 1ZHLA 3TEZA 1T03L 3BH9B 1I3RB 4WI3A 3WXWH 1RXLA 4M5ZH 1WZ1L 3Q8FA 3ZT5A 5ABDE 3V79C 3G6DH 3O2WH 5EDSA 3L5IA 4MJIB 3DA0A 3Q5YA 3OG4B 2O6EA 4PTTB 3OTTA 4RRPG 3RUGF 1U8LB 1U42A 4CA4A 3KGSA 1MWAH 4JPWL 9PCYA 5IMOA 4LOVA 5JDJA 1F18A 2GAZA 1XF2A 3AT0A 5DWUL 1IVLA 2NRDA 3U46A 4X9FA 4H26B 5A7BA 2WV3A 3B7TA 3TNNA 2JKLA 2DYSB 5ACMA 5JHMA 4LVNB 3PV7A 1OAXH 2PWEA 3GDBA 4LBEB 5C0EB 2I07B 4LOFA 5F7NC 3RPBA 2XCMC 1XGYH 4WDIA 3PDOB 3OR6A 4PP2A 2LAGB 2ZPKH 4PRIB 4DK6A 5DQJA 4Q9QL 1C8PA 1UA6L 4B9GA 2OQJA 1BFSA 3G9VA 3UABA 1CTOA 3ASNB 1YEHH 3WYRA 1I9EA 4P2AA 5KN5B 1E9PB 1G1YA 3KYKL 2PP7A 1QFWL 1XMWA 3JV0A 1AO7A 3X17A 4PJ8A 3MRQA 3SGDI 3HKFA 3PE9A 5D7LB 2E6QA 2Y5TA 5E2UH 3ATEA 3DETD 2IBBA 5I76A 1N7MH 1TZOA 1G0DA 3NIGF 1R3JA 4K5NA 4PGCB 2YHGA 4PJIB 2OK0H 3TP4A 5KEZA 4RGNB 1KIUA 2AJUH 3JVFC 4K7PH 4DP7X 5FXCH 1BPVA 2W9EH 4L3EA 4UT6L 3V0WL 3VRJA 5TE4H 4BZ1L 2JV6A 1W8NA 3SGJC 2K3HA 2XQBH 1CICC 4KH9A 3QJVB 5FUCE 2EYRA 3N1QC 4JGMA 4GW1A 5D4QA 3B34A 2O61A 1MFAH 3Q1EA 2OMTB 1MY7A 1F00I 5HYJE 1Q9OA 3MV8A 5C71A 5L9DH 1UWYA 3GIVB 1CYGA 3LKSA 2ZJSL 2OR7A 1ZTXE 4PP1D 4XVSH 2WIIA 1LP9B 1FG2B 2O5ZH 3OAYK 4CW1B 4N1HB 3WFHA 4KRPD 4YN3A 1AKJA 1SVBA 4IM8A 1KXTA 5CEYB 3EOBB 4Z1PA 3DO3A 2HJFB 2ZOKB 5BS0A 1QQDB 3HAEH 5DJDB 1RZIB 3E1ZA 1IARB 5FOBB 2NQCA 4LKXB 3KPTA 3NCEB 4OZGA 1UGKA 3RVWC 3UBGA 4AUUA 1XH2A 1VFBB 3GMMA 4WUUA 1CLYH 3KPRD 3T65A 3FB5A 5ANHA 4WI0A 4Y16D 5J13C 3SE9H 1WS8A 2JTYA 4HAKA 1JUFB 1EANA 2ZXCA 5L6YH 2K45A 3T0DA 4NQEE 3GHBL 4PRNB 1A7NH 4KDWA 2DLHA 5D6DA 1NDMA 3AADB 4HZLB 1KMGA 1SOXA 4FN0A 4XOEA 2UUDK 3U4BH 4AJYV 4GRLB 4Y5XB 5D7JB 3T8XA 2H1PH 3S36L 4HETA 5DVOA 3RHWF 1TJXA 2J8HA 2XFXB 3LX9A 1RUQL 4ZUTB 1EHXA 5JPNC 2JQAA 4HFWA 3RWJA 1KIQA 2NZ9D 3IRPX 3SDXE 1SN2A 4WI9A 5SWZB 4KKLC 1BFOA 3VE0A 4YHYC 1X5FA 1C5DB 1DEEB 3QH3A 4B97A 4PM1A 2CLVB 3FSZA 3CZGA 1A3LL 2CJUH 3L9YA 4UAOC 2C3WA 4YMPA 4YGVA 2DMCA 3EO0B 4JO4H 3W3BA 1MNNA 4H8WH 4Y5YC 1AGBA 4ZMYA 3PAVA 3VRIA 3MCKA 4OF3A 1PG7W 5FIEA 3LNIA 3NIFF 4BRVA 2APVA 3MRPB 1NBVH 4XE5B 2YEZB 1EBAA 4IIQB 2BVOA 3BP4A 4C47A 3UAFA 1OTUC 1L7IL 4KV5E 1U4EA 4Z7WE 2NUTA 3RKPA 5IHLB 1KBGH 1J0HA 4ZQKB 4I85A 1GYWA 5IVZB 1P2CA 2XLLA 3C5ZC 1BIIA 2VKWA 4U3CA 3KDPB 5KSVB 3BKJL 1YHPA 2FHBA 5ERWB 3WL9B 3U9PL 4E9RA 2N56A 2NDGA 1JOIA 4NIYE 4I48B 2ATKB 3BKCH 1G5AA 2R4RL 2ZWSA 2GBAA 3VTAA 1A2YB 1NBZA 4P9ML 4OFYA 3OC8A 4WHTB 3B9KB 2X6MA 5HJ3B 3QIWB 5CJQL 3VSVA 4OFQA 1QFPA 5DS8B 3KYMB 3BW9B 3L9RB 3O41B 4PJ7A 4WV1C 2FNWA 3DX6A 2RJMA 2PR4L 4PAZA 1YEFH 3O6KH 4LCWD 1MDTA 3SDAA 3RZWA 4K9EC 3CXHJ 3FYEB 4QAMB 2XQYK 4QRRD 3P30L 3P2TA 3MRRB 4PRBB 3BXNA 3D0LA 1VADA 1BOGA 1HESA 2VN3A 5F97E 1FPTH 5I24A 3TYGL 3I6KB 1LK2A 3MLRH 1EFXB 2VTFA 2DEWX 1XGTA 3RU8H 5FHAH 4CC1A 3QIBD 5B1JA 1MFBL 2EXYD 2XBZA 1AXSB 4FYSA 1WA1X 1CQKA 1CQYA 4KROB 3JVGA 4HS8H 3VI3A 4CSSA 2K9UA 3ISYA 4KVPA 2BHUA 3M17A 5I75B 3U0PB 1ID2A 2QGCA 4HF5H 5FGBA 5BVJB 4Z3HA 3HZKB 1CCZA 3VXUA 4JKPL 1JZ2A 1NLDL 1WHOA 5AQ0A 3KR3L 5C0DA 5T1DL 2AI0L 5I1KH 1N68A 5C08B 4N3UA 1S7TB 4OJAA 2OXGB 5CJBA 5IVXF 2ZX5A 4KNSA 1CT8A 4WW2B 4NC2B 3RI5K 2MNWA 1G6RL 3QEUB 4XRCB 3JWDC 4M6OH 4AVHA 5FYKE 3PP4H 1WCBA 5I1GL 3ARDC 2XY2A 5D8JH 4PBXA 5KSBA 1FNGB 4PLKD 5AYUL 4X6FB 4ODHH 3MO1A 1JGUL 1MQ8A 4JHAL 2XKNB 4F3FA 1U3ZA 2QHRH 4HUCA 3EYQD 4G6AD 1M7IB 2WQ8A 5DJXB 4GIPD 3U82B 3SQBB 1KT2B 1WIOA 2CWRA 5ANMB 2ZAGA 5IKCB 2I24N 1E5ZA 2HTKD 5LGJB 1UZ8A 1DO6A 4JPSA 3HUJF 3PPSA 3CZFA 4DCQA 5LAPA 3ZYOA 4RIRA 4PV8B 5C09B 2CO4A 4NRYB 5ESAB 3TZVB 3ZQXA 4EN2A 1PX8A 1KTDA 1K8DB 2D7PA 2L7EA 2HVKB 1QSED 4QUOA 5BUGA 1OT2A 1I7ZB 1KLGA 2GFBA 2Y69B 2NY1D 3EZJB 4TVPE 2BIPA 3O11A 1QATA 1BEYL 1DBBL 4Y0GA 4EVNA 1L9PA 4ZT1A 2EDRA 1CDHA 4X4ME 4N0YL 2FECI 3ARZA 4U0QB 4AYEC 2XN9E 3ULUL 4GBXA 1MW0A 1MRDH 3C12A 2YGVA 4NO5B 3WIAA 4F8QA 2VR4A 5CO1A 3WFDL 4I0PC 5KOVC 4KTEH 4M7JH 1G43A 2CK2A 2VLLA 3M7FB 4S1QH 3EHBD 2WGXA 3QJXA 4OBSA 3U30C 3BDXA 1S5IL 1V10A 2VLKB 1NAKH 3NCYS 4FDWA 4BA0A 1KCRH 2RAMA 2ITFA 1HQRA 4O02A 1VESA 2IOIA 2I27N 1VHPA 2R0WL 3QORC 1MFUA 3UC0H 3WY3A 4PJCB 2QSCH 1H8SA 2OPCA 1UJ3B 1WGVA 2AW2A 2VLRE 4OCYL 1B0GB 3GMOA 1KYOJ 2D3JA 2OCCB 2ZXAA 2KLTA 1MLCB 5BRPA 3S97C 1RQ5A 3BN3B 4XAKD 5I0WA 4QDGA 5A2FA 2DQEH 2O5NA 3D0VB 3MRBB 3KS0H 5EU3B 5GSRA 4XZUB 5IT2H 1D5XA 2WYIA 1M1XA 2GT9A 1DZ0A 3DJ9A 5HY9B 1JFHA 5MEQA 3ROOB 1QLEL 3QCVL 2JKIS 4Z7NE 5J4MA 2IVFC 1RZQA 2J1ZA 3O3EB 3LOWA 3HPLA 5K1VA 3CVIH 1SJEB 5JHDA 1IO4C 3WENA 3VXRE 4XNZC 1R3HB 5SX5H 4G70B 1FYTA 4RMRA 3TCXA 4L1LA 1FL3B 1FCCA 1JDCA 1NCOA 2KT6A 1N6VA 3UADA 2YA2A 3P0VL 4X6DB 1KN4H 5HYEA 1WFMA 1BFVH 1RLWA 4J39A 3GKZA 1ZIAA 1IBZA 3N50A 1DDHA 4HV8A 3PCYA 3REWA 4HIQA 1V7NL 3Q7JA 1BJ1J 1KPUA 2D2OA 2K0RA 1ZLEA 2GY7B 4U31A 2NY2C 1D5IL 2GTZA 3U9UB 1JE6A 1WO2A 4FQHA 5K9OA 3ZX1A 3VFVA 1LP9F 3FSOA 4PJEF 25C8L 2LVEA 1S7XB 3DXAB 2DI7A 4FG6C 3HC0A 3TLRA 1N26A 3BZ4A 5HHNA 2DQGL 3IMSA 3O6ML 3LZLA 3CNKA 3FRPA 3QAZC 5IW1B 2X4RB 5GGSB 1JXJA 1FL5A 3HE6C 1Q1JL 4GG8A 3IEAA 4RGMB 4I0CC 1E27B 4OIIL 4WUKH 1T5XA 1ID5I 4N6QA 1NFAA 1RK0A 2GI0A 5HYQB 3O2VH 3ES6B 2V2TA 4C59B 5FLVA 1UC6A 1E3ZA 4TQIA 5DFVC 1PG7X 4GSXA 4U1SA 3N04A 2BPBA 3EO9H 3V5DA 2NNCA 3V7AG 3MV7B 4YUEL 2K70A 1M2OA 1ILUA 1CFMA 2G3NA 3KLQA 2DKMA 3P77B 4B9JA 4NQDD 2G75B 2TSAA 3UTZA 3GSXB 3DMMA 2N59A 1MFNA 1T0MB 2Y06L 1KGWA 2Y1ZA 2IOOA 3GI9H 3FU5A 3BHBA 3FMGH 1UZGA 4XPHL 1NGYB 1UKTA 1BQRA 1RURH 3RFZA 2YPKA 3EBIA 1ZOXA 3CFEB 5CEXA 2R15A 1B9KA 4WU5A 2AMGA 4NNXB 4FL4C 3WNMA 1JGDA 1R17A 3LRLA 1MRCH 3CQFA 1Y6NR 4Q6IC 4AIOA 2X38A 4R3SA 5KUMA 4RA3A 3HB3C 3X12B 3LB6C 2RFXA 3OAWA 5FYJH 4DT2A 5KSAC 5E5LA 1UH2A 2YJLA 4XN9A 1F6AA 3IDJA 4HVBA 1G1CA 3BCFA 4N90D 4OJDH 3D5OF 2IBZX 1BBJB 3DVNA 3CFKB 3I74A 4QXTA 3ZRSA 4KBPA 1KTLB 5GZOD 1WAAA 1DFBL 3LNDA 4OIFA 3L3DA 4GP8B 4Y8AA 1C5BL 3QUZC 2P44B 3QUXC 3EOTL 1JYVA 4M1DL 2WVTA 4LLQA 32C2B 5TE7L 3BZFA 3ZKXB 1FFOA 4XGZB 4L0PB 4F9LA 3T0BA 4KMLB 3QNYB 4QGTA 4U1HB 3IS1X 3RVWD 4NM4H 3MODL 1A9EB 6FABH 4HXBH 4KU1A 1HSAB 2GW5A 4KDTC 3VXME 2KS0A 4A6YH 4DEPB 1EMTH 1G9HA 5D1ZI 1AFVH 1TVBB 5J6HB 3K8MA 4G7YL 2X4QB 1SEQH 3QO1A 3UTQB 1UA7A 3QISA 1ED3B 5KYXB 1ZLDA 1MHHB 4TVPD 1KFAH 4Y5VA 4D0BB 2JTDA 3W11C 5IW3A 3UMNA 2CIKA 2E4TA 5CFAA 4GUOA 3PQYD 2J5LC 4RWHA 4UB0H 2Z1PA 5EC1A 4D8PB 1YMME 1KGJA 1OP4A 5FM5O 2VL5A 4UM9A 4TQEH 4G6KL 1DUZB 2DBLH 3QZLA 1YN7A 5DZOA 2JH2A 2CKBH 5EZOH 5H94B 5E70A 2VLMD 3MKGA 4KKLD 4PJFA 1DCEA 3ULVF 1NIDA 1MDAA 1NCDL 1Z3GH 4MZ2A 3A0OA 4LF3B 2R27A 4XH2B 4QXGH 4HIJA 4K5MA 1ZXQA 2CKNA 2ZP0T 4XCNA 1BG1A 1EERB 1T1WA 3S3SA 1IE4A 4G8GD 4PJAB 1IE5A 5ESVA 2WZ6A 2WXLA 3VWKA 3T4YB 1I82A 3FBKA 2XIDA 4HGKC 4MDIA 4LXFA 3KWXA 3BDBA 3IRZA 4WI4A 3QWRA 2TRHA 3OR7B 2XWEA 4NUJA 5ALBH 1OOWA 1CXFA 1D7FA 2AEOA 2O6CA 3QFGA 5EZJA 4WEEA 2R69H 4UTAL 1CFSB 3C5ZD 4U6HA 5IMOB 1YEGH 2YAOA 2GAZB 3NJVA 3PWVB 3X11B 2JCCE 4KKNA 4YDLB 1H15B 1O7DC 1IC5H 2OSXA 1BM3H 3GTNA 3HG0A 3MV01 2XX0A 4OJFH 3TNNB 3OKLB 3V9CA 5MHSE 1OTTC 4HWNA 2X2HA 4OGAC 2PO6A 3FOMB 3IETB 3MBWA 5C2UB 5BQDA 4YDNA 1GAFH 1HH6A 1M2VB 1YEJH 2Y6SD 3BH4A 3OR6B 3FUMA 4PP2B 2UWEA 3W0WD 1G87A 5DQJB 4O4YH 4DN4L 2NOYA 3IGLA 4KMTH 1KY6A 2N0MA 4BZ1A 5DVMA 1MI5A 2AAAA 4G1MA 4FRWA 4HEMA 4OH2A 4DO5A 3KPQA 4IRSC 3QG6A 5DR5H 1E6JH 2O6FA 5JQIB 3I9AA 3PY9A 3FUDA 1OARL 2GJ6B 1RZ7H 3CVBA 2BVPA 1J12A 4PJ8B 2OMZA 2ZUWA 3AFLA 4FQXB 4ZXBC 1E4XH 3VYPA 1MFEH 3U2IA 1WA0X 2LLNA 2BHYA 3DJRA 5I74C 1OVZA 4JFVA 4TSAH 4RMSA 5I76B 2WXPA 2NYYC 3LQAL 5GZNA 3ARBA 2B77A 3ARGD 4HH9B 1CGWA 3AY4C 3IJHA 3L7EB 4HBQA 2P8MA 3BESR 1PLGH 1XIWA 3QNXB 3NJHA 3VFUB 3VXSB 2VITB 4YL4A 3ZU8A 4L3EB 3EGDA 4P4KB 3T0EC 1G9ML 4F91B 2PMZA 5D93B 3Q8CA 1XCTB 4A04A 2R2CA 2JJSC 4XNUH 5I16A 4XI5C 4GW5A 3PHQA 3IYLW 3WMQA 4CMHB 2Q76B 5FV2A 1NIEA 1IMHC 2J8OA 3HS0A 2O61B 4MCZB 2K4WA 3NESA 4X6CF 4UQAA 2YWZA 1Q9OB 1LWJA 2EH7L 3B3BA 3TVMD 5T3XL 5F9WC 3GO1H 2VZ1A 1K2DB 4AKQA 4MKTA 4F1ZA 2EDBA 3VI4E 4P2OA 4PJCF 1BECA 3NCYP 4OLYH 2YK1H 3CH8A 4JY5H 3HCVA 4OCXL 4X99A 2P8LA 2QFRA 4JRYE 1A5FH 1S9KC 5J1AA 5JIPA 1TEYA 4X5WA 5BS0B 3MLVH 3ARDD 2Z7UA 2XG4A 4OZGB 4HKBA 4AVKA 1XXFC 3P73A 5EF1A 3TPUA 1DN2A 3IDIA 3FT4A 1CFTA 3FB5B 4GRWB 4NEHB 1J8HD 5B21A 4IU2A 4WK4B 4BRJA 5JMRA 1Q4NX 3LZQA 1CYWA 2VDLH 4FQ1L 1VF5C 1A14H 2K9FB 2NXZD 3GJFA 1KJ2A 2OL3A 1RJYB 1IEBA 4LSRL 5DLML 4JQIH 5J7CC 1JP5A 1TTGA 2P5EA 1GH7A 3IPBA 1CF8L 4BK4A 4MXWL 1MXDA 4O58L 4NWTH 2XT1B 4KVCL 3T8XB 4LKCA 2JKXA 1MH5A 1PZCA 1RULH 1AANA 5HHPA 3TBSB 5B3JF 2X42A 2D3NA 1KIQB 3GRGA 4PS7A 3SGKC 3FCGA 4HK0A 2JK5A 5I1HH 2BDNL 4FXGA 2XDHA 3MX0A 5AB9A 1ERNA 1AR1C 4Y1TA 5INDB 3ALXA 5FFLA 3FT2B 4UTBH 5JXEA 3H56A 3WTUA 2A6DA 3QZBA 5DFWH 4PJ5D 5KS9A 2X3BA 4DVBA 1KCWA 4PLJC 3WIHH 4I0PD 3L3JA 4PJXA 2XQYG 4N9GB 2MJWA 1YYML 5IR1A 4BA8A 2AZAA 1GOFA 1YSOA 4XX5A 1WEJL 3DVIA 3T2QA 5C0GB 2NUTB 4JM2B 4YC2C 3V4VL 2BWQA 4KHXL 1XF5B 5D1ZC 2CDEB 1CU4H 4YXKL 3HNSL 4UT7L 1CFQA 5CS7A 2I9TA 3BGFB 3QORD 4G43B 1FO0L 3EXJA 1YO4A 4E9VA 3VGFA 2XC8A 3PL6B 4U33A 3K3QA 4YXHL 2XV2A 3P0YL 1XT5A 3D05A 1A6WH 3IMVA 4U1NA 5EZPA 2JWYA 4XVTH 4XWGL 5D7IE 4DQOL 1EEZA 1NBZB 3T4AA 5MI0B 4HT1L 4TRPH 4Z7UA 3DGDA 1QRNE 2P80A 1KCUL 3EYOA 4KJYA 5E2TH 4PS4H 5F3BA 5M94B 5E8PB 4PJ7B 5