2BW4A

Atomic resolution structure of resting state of the achromobacter cycloclastes cu nitrite reductase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
334
structure length
334
Chain Sequence
VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Resting-State, Substrate- and Product-Complexed Cu-Nitrite Reductase Provide Insight Into Catalytic Mechanism
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 89
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bw4A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bw4A02
2IDQA 3JT2A 5I6PA 3WG7B 3FSVA 2UX7A 2CAKA 4GY4A 1AZUA 2CCWA 4YSRA 1L9SA 3FYEB 1X9UA 1XMEB 3QPKA 1MG3C 1PNCA 3NT0A 1J9TA 2P80A 4FA7B 2CJ3A 2VM4A 2VW4A 3AG1B 2WO2B 2IWEA 5I5IA 2AZUA 2BWDA 1KCWA 4KOCA 2ZONA 4GYBA 4F2FA 3SBPA 2BW4A 2PP8A 1PLAA 1JXDA 4DP6X 1NIDA 3S3BB 2JXMA 4DPBX 5I6OA 2BW5A 4CSPA 6PAZA 2HRHA 4BDVB 9PCYA 2IDUA 4DP0X 2PCFA 1OOWA 4TXVB 1WS8A 2HZHA 1UATA 4G72B 3H56A 1OCOB 3EH3B 5A7EA 5PCYA 1AS7A 2CBPA 1CUOA 1ZPUA 3X1NA 3DTUB 3FPYA 1AG6A 1W8EA 3ZIYA 1NIFA 2DY2A 2IDFA 2P80D 2TSAA 3S3DB 2XXFA 3TA4D 4YSSA 1IC0A 4ZK8A 4NERA 1W6LA 1A4BA 1M56B 2BO0A 5FC9A 3ZX1A 5D4HA 1J5CA 2BP8B 2IDTA 2BP0B 1AS6A 2EIKB 2VMJA 1IKOP 1HAUA 2Q5BA 1EHKB 1CC3A 1ETJA 1RKRA 2X87A 1W6WA 2PLTA 4YSCA 1OF0A 1OCCB 1ET5A 4AKOA 1QHQA 1VLXA 2VSMB 3ASNB 1E5ZA 1OV8A 1AZNA 4JHVA 5B7FA 3CDZA 2YXVA 1PCSA 2OV0A 2UXTA 5B3SB 5B7MA 1WA1X 4KO7A 2XUWA 2XV2A 3QJRB 3S8GB 2YAFA 4F2EA 1TKWA 1FFTB 4BWTA 2XX1A 1BYPA 1NTDA 5F7BA 4AX3A 2YAPA 3AZUA 2I7SA 3OMAB 4DPCX 1X9RA 1KCBA 4E9YA 3ERXA 4GXFA 3X1GA 1NZRA 1JZGA 1WA2X 3ABKB 5D4IA 4BWWA 2B08A 2XXGA 1AIZA 4AI7A 4E9WA 3EF4A 2Y69B 1JZJA 3NJKA 2DV6A 2IAAC 2ZWNA 2X88A 1J9RA 2IH9A 3GYRA 1L9QA 4BK5C 3NJNA 1IUZA 2DYRB 3X2QB 2PPFA 2XX0A 1RZPA 1JZIA 2QPEB 2JKWA 3HEIB 4HCGA 2J5WA 4G7QB 3WNIA 3FSAA 2VSKB 1JVOA 3NYKA 5TK2A 3X1BA 2J55A 2YARA 3PCYA 2MTAA 3ASOB 3FU9A 3V9CA 4YSEA 1A4AA 2PP9A 3EHBB 4HHWA 4A66A 1NIEA 2HRGA 4A2FA 2PPEA 4AKPA 3PAVA 4HHGA 1JXFA 1MDAA 2OCCB 2YQBA 3WNJA 5I26A 3UAAA 4PAZA 2FTAA 3QJTB 3KW8A 2VW7A 5B1JA 3UABA 3T6VA 3NP3A 3D12B 2VW6A 1KDIA 1R1CA 1HAWA 3TASA 2GIMA 2GC4C 3S3CB 5AZUA 3NSCA 4E9SA 4CSZA 4EF3A 4DP7X 2BWIA 5AFAA 1ZDSA 1NPJA 1ZV2A 2QPDB 1A3ZA 3FU7B 3PXLA 1NWPA 4ENZA 1E65A 1GS8A 2FJSA 4P5SA 1ET8A 3FU8A 3QJQB 4GP8B 1M9WA 1AANA 4DP9X 3FT0A 1V55B 3NJGA 2IWFA 1ADWA 4BWUA 4KOBA 1FWXA 1FA4A 2XWZA 1T5KA 3L45A 3WI9A 3ABMB 3TBCA 3CVBA 4G71B 4RH4A 3OMIB 2YAQA 2OJ1A 3WKQA 4YSQA 4W9ZA 2FT7A 4Q8BA 4HALA 3QJUB 1L9OA 4G7RB 1JZFA 2GSMB 3AG3B 3GXUB 1WS7A 1J9SA 2UXFA 1E30A 1OE2A 3EH5B 4A67A 4YSAA 1IBZA 4HCFA 2FT8A 3FQ2A 1ZIAA 2UXVA 1PAZA 3H4FA 2PPAA 3FYIB 4KNUA 1KV7A 3FQ1A 4NAJA 4W1TA 3ZBMA 2YAOA 5I6MA 2ZOOA 1WAEA 1E5YA 4X4KA 2IH8A 1F56A 4YVNA 3CZUB 3GDCA 5E9NA 2AZAA 2BP8A 4YSOA 1BXUA 1JZEA 1ET7A 1L9PA 2EIJB 1NPNA 3MX0B 1ID2A 1NINA 1I53A 4YL4A 3QQXA 5B1JC 5TK4A 1PY0A 5EHFA 2HX7A 1NICA 2WSDA 4GP5B 1CYWA 4YSPA 1BYOA 3CVCA 4N8UA 3N2JA 2EINB 2I85A 3UACA 1PZCA 2HX8A 3NJMA 2MRYA 2IDSA 1V10A 2R7EA 2W8CA 3IN0A 1IBYA 2CALA 2WO3B 3CDZB 1NDTA 2EILB 2RACA 1BAWA 7PCYA 1NIBA 4QKTA 4WTQA 2QDWA 3T6XA 3T9WA 1JZHA 1ASQA 3N55A 4DP1X 3T71A 1AQ8A 1TEGA 5LDUA 1E67A 1GS6X 1KBVA 2XU9A 1AOZA 3X1EA 3PLYA 2XYBA 1SFDA 1RZQA 4KO5A 4E9VA 4G70B 4A2DA 3FSZA 1NIAA 1KGYE 1ASPA 1SDDB 4NB7A 1KYAA 1PMYA 5B1AB 2H47C 1PLCA 2UXGA 4DP2X 1B3IA 3CG8A 3IEAA 4E9XA 1ASOA 3NJJA 1XB3A 3BVDB 3FSWA 4PCYA 8PAZA 3IBOA 4YSUA 3DIVA 1SNRA 3NJFA 2GHZA 2CUAA 1GSKA 4A2EA 2XV3A 3FQYA 2DYSB 1DYZA 1V54B 1PNDA 4E9QA 6PCYA 1RCYA 2YXWA 4A2GA 1GY1A 3PAUA 4YSTA 4BXSV 3SQRA 4M3HA 1YLBB 2XVBA 2TSBA 4M4RB 2HLEB 1JOIA 2B3IA 3NSDA 2DWSA 4A68A 5B1BB 2JFCA 1L9TA 3SBQA 1AZRA 1JVLA 3NJHA 3TU6A 3H4HA 1MZYA 4E9RA 4GP4B 3BQVA 4BDVA 3X1FA 4UANA 1TEFA 2LLNA 3KW7A 1A4CA 3C75A 3TBBA 1J9QA 2AVFA 3NJLA 1ZIBA 2N0MA 1GS7A 2BZ7A 2PP7A 1GYCA 1GW0A 3NJIA 3MBWB 1NWOA 2QDVA 1EZLA 2H5UA 2PPCA 1A8ZA 1OCRB 4KO9A 1OCZB 4JHUA 4KNSA 5B7EA 4HCIA 3WIAA 3ABLB 1SF5A 1GR7A 4E9TA 3V9EA 1JERA 2FQEA 3UAEA 4MFHA 3QJVB 4BXVA 5I5MA 1AR1B 2GBAA 1CURA 1QLEB 2AANA 2BP0A 2H3XC 1JXGA 1MZZA 2IWKA 1KDJA 3IN2A 1HFUA 1MG2C 2YAHA 4JKNA 4AKQA 5IY5B 3OM3B 3PAZA 2HX9A 3DKHA 4FAAB 3OMNB 1BXVA 2BHFA 5I6KA 4N4YB 1PZBA 3ZDWA 2FQFA 4HIPA 2PCYA 5AKRA 2J57A 1ILUA 1OE3A 3NSYA 4HAKA 5I6LA 7PAZA 2W88A 3AY2A 4UF7C 1SF3A 4P5RA 2VM3A 2FQGA 3FPXA 1SHWA 4KNTA 1CYXA 1WA0X 2AFNA 1BQRA 1SJMA 2E86A 3RYMA 3EH4B 3QJSB 1AG0A 1XB8A 4WKXA 4YVUA 3NSFA 4L0PB 2UX6A 3T6ZA 5I6NA 4A2HA 2DWTA 2R7EB 1BQKA 2FT6A 4DPAX 1PF3A 4G7SB 4DP8X 2A3TA 2QT6A 4AZUA 1BQ5A 3ABGA 1N68A 4HZ1A 1M57B 2GI0A 1AAJA 2EIMB 4YSDA 4DP4X 3PPSA 3HB3B 1GY2A 2GB2A 5I5JA 3JTBA 2NRDA 1QNIA 1PZAA 4KO6A 1SDDA 2Q9OA 4F7KA 3OD3A 4QLWA 1AS8A 1DZ0A 3OQRA 5PAZA 1L9RA 5B1KA 1XB6A 1J5DA 3IE9A 2HXAA 1ILSA 1KBWA 2FQDA 3AW5A 1URIA 4UAHA 3SBRA 4DP5X 2BZCA 3UADA 3AG4B 2PPDA 2J56A 2YAEA 1ZDQA 2GC7C 5F7AA 1BEXA 1AZBA 3AG2B 2Y1AA 2ZXWB 5I28A 3UGEA 3T6WA 2FNWA 1N70A 1A65A 1TU2A 1SFHA 5D4JA 2YAMA 1SHXA 2I7OA 2XV0A 3NP4A 3FS9A 1BXAA 2VN3A 3FU7A 4K9JA 5ANHA 4Q89A 3WKPA 1PLBA 2FWLB 1OE1A 1AACA 1AZCA 3G5WA 3CVDA 3U25A 2XLLA 3S8FB
chains in the Genus database with same CATH superfamily
4WWKD 2DQGH 4UQEA 3FSVA 3T0EE 4MBOA 3QUYC 4E41A 2JWYA 3HRZA 3O3EA 1DBBL 2KZBA 4ODXA 3VXTA 5DHYB 4BA0A 2A9CA 1YEGL 2XFGB 4QF1B 5FW6A 1IL1A 1N64L 4KKLD 1GJUA 1KCUL 5GRWA 1B6DA 1IBGH 2DQDH 1BG9A 4G7YH 4UQ3B 3VUAA 1NGPH 2Q6WA 4ZMOA 1OOAA 1VDGA 5CCGE 3AG1B 3H7BB 1OLLA 1WAAA 1C8QA 4FQHA 5E99L 5ACZB 4XNUL 1ZXQA 3F01A 5F70A 1PLAA 5J11C 3GUTA 3FT9A 4EIZC 1ITCA 3MNWA 2C4FU 4GBXD 1ZHBA 5EU3A 5EV7A 4ZAKD 2D03L 4HUXA 5MENE 2CR3A 2CJUL 2QZQA 4BSWA 4F33A 1KNOB 2B1AL 5C2BL 4OD1H 5E9DE 1U92B 5IR1A 3T4YA 4OW6A 2BCKA 1RY7B 3LKPB 1DANU 1OKEA 3DVGB 1EUTA 4ZW8A 1CUOA 2DBLH 2YD3A 4YDMA 5AG8A 1QTPA 3HS8A 5FM5O 3ZIYA 4GNKB 5EN2A 3T3PE 3CC1A 5ABDE 5E70A 3V4VH 3RFZC 4JDTH 4PCKA 3LKSB 1IVTA 3KVQA 4Q6KA 5AZEL 3IFPA 3SQOL 4NRZA 4Q9RL 3L2LA 2VXVH 4MDIA 4MMXB 3EYSL 3QA3A 4WWPA 3ILQC 3GXFA 5EBGA 5FFOA 3ULAB 5C0BA 2VR8A 2IQAA 2I9LA 1QTSA 1KY7A 4OCXH 4PJXF 3REWA 2VLMD 4AKOA 3FFDB 5BQDA 2VZUA 5JQ6L 5LWYH 5JLZB 5FYLE 2CGRH 1AZNA 2DF3A 1ADQL 4G8EB 3TFKD 1CLZH 3Q8BA 4P23B 3DJTA 1NCDH 2J3SA 3UC0L 3SKMB 3E3QC 3EG9A 1WE5A 5JUEL 4JDZB 3L5WB 4OJFH 1VGEH 2Q0ZX 1BGXH 2WLJA 2P24B 1BM7A 4IBWA 3L3DA 4WKZA 2BSDA 2QSCH 3LZLA 1JGEA 3X1GA 2EIDA 2A4EA 1GZHA 1MJUL 1QSEE 3HS0C 5C8JA 1SVZA 4XCEB 1LILA 2Y07L 1YEIH 4O02A 1JGLL 1JSYA 3DTDA 4FMVA 4LIQL 4OLYL 4JM2C 1TEYA 3QWNA 2XICA 3LSOB 4R96A 5LQBL 4F2ME 2WUBH 5KSUB 4XBEL 4HCGA 5LCVA 5HHQA 1A5FL 4Z7VE 3QUKA 4U6VL 5HI4D 6FABH 4E9LA 3HMWH 3FRPB 3NIGE 4HUVA 4Q4IA 5D1ZC 4GAGL 1UT9A 1JNNH 2D7PA 1HDMB 5L2KE 4U6HB 4H25B 5FM5M 1L7IH 1XSJA 4A66A 1A6WL 5DWUH 5FPIA 3RB7A 1RUPL 2Z31B 2ZTBA 4Y4KD 2CK0L 1KIQB 4XMLH 4YXLH 4NZRL 2QBWA 4RFNC 2DL9A 2YQBA 1KTCA 4XVUC 5I26A 1TO4A 2J1ZA 4UT9A 1S5IH 2VXUL 1URLA 3PQYD 2APSA 1VKXA 2FZ3B 2NR6A 1VADB 2EDJA 1F4WL 5D7IF 4LEOB 3ESNA 3N9GL 3EDFA 2YMXH 4BSVB 2P8PA 2GC4C 2VM9A 5FAAA 2BOCB 4OCMC 1S3KL 4MA7L 3HB3D 4ZAKB 4BE6A 4RBPK 2K9UA 2XQYK 2DYPA 5EBMB 1OSZA 2DIAA 2BM3A 3ATFA 4RAUA 4B0MM 5FO8A 2M83A 1A1NA 3BWZA 4U6TA 5E8NA 3ZTNH 2PWEA 4AITA 1V7NL 1LO0H 4O2FA 4PG9A 3FO9B 3Q05A 2VQUA 3PWJA 3CFUA 4I18B 1K6QH 3L5JA 4QRPA 4MNQD 5TE7H 2X4SA 3NJGA 3QG6B 3H0TA 3MYZA 2JQMA 3UAJC 3NCYP 5H2BA 3ZO9A 1P4BH 2UZYB 1I3UA 3QPXL 5DLLA 1FNSL 2QKSA 5GRVK 3KWUA 3HUJE 3FCGA 4L8SC 3HNSH 5EEVA 3V4PA 1D6EA 4P3WA 1GGCH 4PJ9A 5MEOB 1C5BL 3QJUB 4H88L 2DQEH 4MRBA 5EO1A 4G8GD 1QR1A 1JZFA 3EH5B 5D1QC 1E30A 3EFFB 3D85B 1KPRA 4PLJD 4WNQA 4U0RC 3FQ2A 1QPXA 5F7YC 3AXLA 2WB7A 3MO1B 4UV4L 4P9HC 2WCSA 3UL4A 2XTJD 1YQ2A 5FLVA 3VQMA 4FG6D 2G4EA 3MLYL 2GSGA 4RGNC 2VLJD 5HYSG 4W6WB 1NJ9B 3BGMA 2GUYA 2HAZA 3F62A 3O8XD 1EA9C 4OQTA 3S98A 2AJSH 1R3JA 2A6DB 2IO5A 3BHBA 5DUML 3PS6A 3DX1A 3EO1B 3RWDB 3V4UH 1RIHL 2Z35A 5H37G 2PYFA 3GXTA 3N2JA 4DEUA 2UWEB 1NCUA 1P2CB 3OAYH 4Q0XL 1KCRH 5KJRL 4GLRH 4L9LA 4NBYB 4AYFB 4WVRA 2IFFH 1NLDH 3NIFF 5DQ9B 1X5MA 1QR4A 5GJTL 5I1HL 5ITBL 2NYZA 4DGYH 1F2QA 1CFTA 1JDCA 3O6KL 3DSFH 3JZYA 3EDEA 3PV6A 4Y1AB 3KYAA 4BQ6A 5J11B 1WFUA 2V3EA 4YHYB 1JTOA 3K8KA 1YEHL 4GQQA 5DFWH 5J0BA 4YHOH 2A9AA 1ORSA 4DP1X 1BQLH 2DTMH 3MV7A 4FNSA 3D18A 1FF5A 4X5XA 5HVFB 2MSPA 3MRNA 4HQQH 4N2CA 1ZLVK 3TZVD 2IV8A 3MLSH 5KVFH 1AFVH 1GC1H 3H9SE 1BZOA 4KVNL 5I1CH 2R8SH 4TSAH 4N2GA 4QNPF 2F7QA 3WS6C 4JKKA 4EMZA 1WQVT 4MAYA 1CE6A 3C5XA 4B53A 4FE9A 1KGUA 1XMWA 3TN0D 3D69B 4YE4L 1Y0LB 1JXJA 1ZY9A 3DMMA 5T33H 2J6EL 4APQD 4BH7A 2B1OA 3TIDB 4L1HA 2A9NL 2AJUL 1NBZB 4P3DB 2PKDA 3OKLB 3S5ZA 4TYUA 4YDIL 4IGBA 3V4VA 3PJLA 1JFQH 2X6BA 2TRYA 1BF8A 3EAKA 4MNQB 4YHNB 4ZSOE 1JZ3A 1SY6L 4E5XB 2WVVB 1P4IL 2BDNH 2G2NA 2LW3A 4OF8A 1T22B 2Y7QB 5IVXB 5T3ZD 3CN1A 2IH1B 5AYTA 4OJAA 4NKDA 3W9DB 4U1JA 1Q9LB 3QG7L 3ARBA 4Z5RB 5F9AC 4IOFC 5F8QC 4M4PA 5GGTL 3U7WH 2ICWA 5CIPH 2FX8H 4MJIE 2HLEB 3NSDA 1OSEA 1S7WA 4X8JA 3HS0B 4A68A 1MH5B 5T1LD 2DQIL 3HG1D 2IPTH 4NDMA 1CDGA 3SBQA 1H6FA 2X4OA 2XPGB 4OCRH 4OZFG 1MZYA 4PS3A 3MLWH 4OZHF 4Y19D 2WGXA 4G6AC 5KS9F 2WN2A 2GHWB 3E8UL 3SE4A 2FJUB 3QNZA 1N59B 3WAJA 2W07B 1QATA 5SWZE 3RTLA 4PJFB 2LHAA 5D1ZB 3TYGH 5J06A 2C7UA 5JO5B 4WI0B 5IBTH 2NY4C 2QDVA 5CUSH 3VTMA 1LEIA 5D1XA 1T66C 4W6YB 4QHLB 1T1WA 1O7SA 2YSSA 4WEBH 1K5NB 2XY1A 3PIQA 5DVMA 1XD0A 1PKQE 4RFNB 4BZ1H 4QT5B 4K7FB 4D8PB 3ARWA 4F8TA 1CTOA 2AANA 3FMGH 3UROR 1N6QH 1MZZA 3CC5A 2J2ZB 3RWHA 3R1GH 4YDNA 5D2LB 5IY5B 2UZIH 1UJ3A 1I7TA 4S1QH 5AZ2L 3GXPA 4NJ9L 3LRGA 1P9MC 2BFVL 2ITCA 3EH1A 2DN7A 5LHDA 4X6CA 4GIOA 1FYTA 3E7JA 1AY1L 1JJUA 2I5YH 2VABA 3T1FB 2VYRE 2H32B 4HIXL 7TAAA 1NCAH 5E5MB 4AW7A 3QJFB 1YC8A 4OT1L 2F6AA 3WXVH 2QMJA 3T3MB 2R1XA 3DGGA 4XNZC 1DQML 1X5HA 3HFFA 5IHHA 1BQRA 3P3UA 5AYQA 3QNFA 2X4TA 4EI6B 2XZQL 4OV5B 4PB0L 4QRRB 3FQXA 4JO2L 3OMZA 1Q0EA 1KYOK 3BXNB 5D72H 2BPBA 2G3MA 1IAOB 3LN9A 4WHYG 2Q8BH 4NYLA 3TN0B 2FEDC 1XGQB 1W8NA 1NEZG 4L8SB 4UQAA 3C12A 4ZOBA 1WIUA 3DPDA 3KYMA 3K80A 3VFNA 1BSIA 4KK9D 2XWJA 1I3RA 5JHLL 3UEQA 1RZKC 3QULA 5GRXG 4D94A 1N12A 4HIIB 1JWSB 1YVLA 5D1QB 4KJYB 2KYIA 4GG6B 1EJ6A 3GZOA 4U0RB 5K9KA 5C0BD 2XN9A 5E56A 4KO6A 1SDDA 5EU6D 1DJWA 5HHOB 4I3RH 5JIPA 1QUPA 4RGNB 2EICA 2PPDA 4TLSA 2FYVA 3E2HC 1TFPA 3DUSA 2IAND 2CPCA 4N5EC 2FECL 4LKXB 3R4RA 4OFKA 3MRHA 3WBDA 1J8HB 4JZJB 5C0AD 3U2IA 2OTUA 3BDBA 4P4RA 2YAMA 1U93B 1ZGLP 2ADJA 4XNDA 4QRBA 2X53A 4Y19B 3PDOA 4LDCA 4PY8I 3MLXL 4U1NB 1I8UA 2DMBA 1CTMA 3RDTC 3GLEA 4GW5B 5SV3A 2FWLB 4UYPA 4HAFA 3BW9A 1NCOA 3INUH 3UAFA 2WNKA 1RK1A 4N8VA 3UMNA 4XX5A 5SWSB 2LAAA 2WQUA 1DQTA 3GGWB 2ZOWA 4XPHL 2B77A 1M7DA 4MD0A 5HDBE 3O3BB 4LLQA 3QI9A 3TFBA 4HPOL 2EDTA 3MV8E 4MXVE 5GRUH 3HN8A 4ZFZB 1ID5I 3BKYL 3SKOA 1E50A 3EGXA 3VRIA 4EZJA 4P2QA 3LNEA 1B3JA 2NDFA 1NAMH 2KERA 3DURA 4ZUWA 4DP6X 4OH2A 3S3BB 2ZUUA 4HYTB 2ZIDA 3AT8A 5IGXH 2VR5A 4OB5L 3QS3A 9PCYA 1B2YA 4WGKA 2L4OA 4GS7C 3V5KB 3ELAT 3M6DA 4QXTA 2NR6D 1XF2B 4GSQA 1Z2KA 4RFOH 5F3FA 3HZVA 1OGSA 4M5YL 1U3HC 1YY8A 4G72B 1I9IL 2J71A 3N1PC 3QISA 4ZPTA 5I1KL 1PGRB 4LRIA 1FNAA 1S7TA 1SQMA 4KY2A 3IVKB 1MFBH 4PV8B 1MFAL 4GEIA 1YMMA 1T7XA 3JYCA 5HHMB 1UWGH 2XXFA 5INCB 2HPOA 3HI5L 4KVCH 2EDBA 3PY9A 3EOAA 1RUAL 5DHVB 3KAAA 4HCRA 4AJWA 5TE6L 3V0FA 2D4DA 3KYNB 1IKOP 1G9MC 2WXQA 3MJ9L 3MUUA 1CXEA 3GUFA 4KRNA 5IVOA 3TL5A 3VWJC 5BZWB 4PRPA 3VI3E 1D5ZB 5B39A 2FWOB 3GEFA 5F6IC 5LAXB 4Q56A 2QGCA 4D0CB 4C56B 4KGJA 3BEVA 4R83A 5TD4A 1XTMA 2ROYA 1TFHA 4Z0XB 1RUKH 4FJZA 3MZGB 4NO2A 5B7MA 4PJ9D 3SO3C 2Y7OA 5CIPA 4S1DC 4LF3B 3QJRB 1LO3H 3BDXA 1JPGA 4JHAH 5EU6B 3DYPA 43CAB 3TT3H 1DN0A 3FN0L 4IKIA 4DCQB 1OAXH 2PW2B 3APFA 4JFDA 1E28B 2K6ZA 4D2NA 4E9YA 2R9HD 3QAQA 1A3QA 1IFHL 3RZCC 4LLUB 1XSOA 5GZNA 1DJIA 1U8PB 2B4CC 1DVUA 1AHMA 4PJGF 3TBWA 4S0TD 4WUUE 1N0LA 1ND0A 4BE5A 1FVDA 3GYRA 3RKDD 3VXQA 2IANB 4I88A 3TWYA 3X2QB 2WQRA 1RUML 2NY4B 3GSRA 1LDPL 2YD6A 2DQHH 2K3TA 5EORH 4EQ2A 3WNIA 2VDMB 5BVPL 1N5YL 3VDAA 1R47A 2VQ1B 3TBYA 3ZRSA 4FHKA 1IFGA 2OYMA 2PP9A 3UJTH 1CDCA 1R3IL 4D9RE 2ZCLH 5B4MD 4DO4A 2WQSA 3CFEA 5FYJH 4AKPA 1QFOA 2ZG1A 1LXMA 2A83B 4YHPA 2R4RH 1A9BA 1I8AA 3GIVA 3GNML 2WXKA 4IW4C 4KTEL 4LCVA 4DKFH 2WTPA 5KYXA 4F7MB 3QT2A 2NY7H 3OKYA 1OSYA 2YGQA 3T4AA 1P7KB 2COVD 3VWKD 1MVFA 3WAKA 2FB4H 3O2DA 3OAZH 5I2IA 3P4OA 2XNAA 2ZOLB 4POUB 4GUPB 3VFUA 2GQHA 5E2TL 3VXSB 2Q3AA 3LZNA 4LMQI 2Z0UA 1J5OH 4JZOB 4LLYA 1T0PB 1TMQA 3QAZC 5DS8B 1I8KB 3TH3T 5CD3A 4M4RA 3MGAA 1SDYA 1UM5H 1G9NL 3AACA 4NUGL 4B97A 1ZDSA 4IBSA 4WI9A 1A3ZA 1ETZA 4XMTA 3FU7B 2EKSA 2KBGA 2FJGB 3D08A 3S3PA 1OEZW 3JWOC 5BMFL 2VDPL 1DJHA 4NQCB 3OKDB 4YUEL 2BSSB 3WTXA 1T03L 4K5OA 3VFWA 4IU3A 3HHSB 2D7OA 1L6ZA 1MJ8L 3F7PC 1SLXA 3QWQB 3EYFA 3E6FB 3G08B 3AAZB 3B9EA 4FABH 1XF1A 1G7MA 1I3GH 3ZXAC 1UKTA 3DMMD 4AMKL 3CVBA 2AXWA 2HWZL 1MLBA 5D2NB 3S5YA 3HE6A 5HGAA 4L4TE 3OLDA 3ZTJG 4IGBD 5ECJE 1JRHL 1OAQL 2R2BA 2NYKA 4Q8BA 5E8OA 4HALA 1OT4A 2DWEB 4U31A 3V0GA 1OAUL 4JFXB 3UYRH 3WEMA 4QXWA 1FRGH 1KYOJ 3GBMH 5EO0B 3I6SA 3DX8B 1IGMH 2UXFA 4WI6A 5J12C 3UTSD 3UZVB 2I07B 4UTBL 3U83A 4RGOL 2X89A 4AQAB 1KJ2A 2QGDA 4XPBL 1IAIM 1UH3A 3N1FC 3UPRB 1CZ8L 1MJJA 5C09A 4XB3A 2B3RA 2FEJA 3SSGA 3FQRA 2Q87A 3RVTD 3TIDA 3NA4A 2DB8A 4JO3L 3ZLQC 1KF9B 2DKUA 4U6XB 1MELA 1SYVB 5J1AA 3ZE1F 1OGTA 3UH8A 5FHAH 2QFRA 3ZDYE 2KDGA 4OZGB 3BSZH 5DZ9A 1FORH 4AUUA 3O4OC 4MNHA 4QAWA 3SGJA 5ICZB 2OSLA 3RUGA 4G8IA 3G5YB 5DYFA 1KG0A 2I85A 5LNGA 1L6XA 4FDWA 4K3DH 5D6DC 3EJZC 4OD3H 4Q52A 1OPGH 3DBXA 2DM2A 3LQZA 4PRIE 5AVXB 4MGXA 1M71B 4JLRA 1FE8L 3IDXL 4DOHE 4K3EH 4G7VL 4LMQE 4MNGB 4IMLB 1NDTA 5D1XD 4DWHA 1AGEA 4PWFA 4NIKB 4Z3FA 1DE4B 4KQ4L 1AI1H 1MCBA 3B9DA 1QASA 3CQFA 4GT0A 4RIRB 3QYMA 3QXVA 4EAEA 3GJFH 4Q9QL 4MA3A 4N9GA 2MIZA 1KTJA 4K8RL 4LSTL 2FJFA 4L3EB 4WRLA 3L3GB 3P4MB 1MFEH 3VWKB 1AQ8A 5C6WH 2H8PA 2FEEL 1Q9WB 3KVPA 1AOZA 3PDGA 3JUZA 1IJNA 3O3DA 3B7RL 4ANWA 3BVTA 1J0YA 2ZUYA 3A67L 3FTYA 2IAMA 1MAKA 4YL9A 1I8MA 1FYTD 4MB5A 3CLFL 3KJ6H 5HGHA 4XN7A 1R24A 1HKLL 5B1AB 1ML0A 4CVZB 3FB7B 1UWEH 1ZTXH 3DA0A 5ISZD 3SE9H 2VTFA 3VXME 5DZOA 2Y7NA 4EUPB 3MODH 3NACH 1VFUA 3AJ7A 1U6AH 3GHBH 5D5MA 2CR6A 3L13A 3II2A 3GI8L 1CF8L 1N5AB 3Q2WA 4L5FE 4FQXC 4PI2A 2W9DL 4LSSH 3VWJB 3NIDE 1MUJB 1T21A 3GSNA 5FUOH 3ESVF 2XHNA 3LPGA 4C58B 3KPSA 1DYZA 2UZPA 2X42A 1CXLA 4GRWH 2SEBA 6PCYA 3AS3A 3IT8D 2OMYB 2F74A 1KEGL 3TCTA 3MA7B 4NLAA 5EU5A 2CCVA 4L8BA 2Z8WC 2O30A 1XCTB 1NCTA 2BY3A 1CJYA 5IUCA 3I6KB 3CHPA 3RZCB 4BYHA 2XN9D 1ZT4B 1M3IA 3QE5A 4X5WA 1VEOA 4GO8A 4DKEH 4YXHH 4JDVA 2G9HB 1RD6A 1CK0H 3WN6A 5DQJB 1MW2A 5FHBH 2Z91B 2A77H 4LO9A 1Y18A 4W68A 2X1QA 5L0QC 1FSKB 1NGXB 4P2RE 3HC3L 4XBPB 2NT0A 2YPVL 1J7VR 3CMOH 3DSNA 4M03A 2CLZB 2Z6FA 4DF9A 3R06A 1LE5B 5ID1B 3H2PA 4ZUUA 1U8KA 1VCAA 4KO9A 4LLMA 2LU7A 5T5FL 1KGJA 2GK0B 1CGTA 1D9KA 3CNKA 5EF0A 4FYSA 1G4MA 2JE8A 4FQQB 3UAEA 4D3CH 4JN1H 1A3LL 3VXNB 4DK5A 1QFWM 5I5MA 1BFVL 3QQ3B 3VG9B 5HYSA 4FMKA 4FQ2H 4TS6A 1QX1A 3ATBA 3CN2A 5FS5A 3C9NB 5KN5B 3FH8A 1NGYA 1DEEB 2OSXA 4JN2B 1FG2B 4K2UL 3DKHA 2OK0L 4CUCA 2EE6A 3FTZA 3OMNB 3WEXB 3QAZB 1A25A 5H37A 1GTFA 2K6WA 3G04A 4PBXA 5DK2A 5HJ3A 4S1SL 3IF1A 1CLOL 5D7SL 1X5GA 3HE7C 2R29H 2R2HA 2W9EH 4L3FA 3IJHB 1NM9A 1OE3A 1IGFH 4P2QD 4W9EC 2WIIA 4N8CH 2WXHA 3GMQB 3NCMA 4UF7C 3UPAA 2FH8A 3V7AE 4KJPD 3WNLA 1J0ZA 4DSYA 1HSAA 2IXQA 3OXRA 2CDFB 1H9DA 3VSQA 2AFNA 3DX6A 1KIRA 1SJMA 2D2CC 2FL5A 1DEDA 3CVIH 3DETD 3ZE2F 1KV3A 2DLGA 5IB4A 5CEXB 3US1A 3CLEH 5IZ7A 2FJHA 1NFDF 1E8XA 4OF6A 1KBGH 4PJBE 3LZFH 3VXOB 5ISZB 2VIRA 4K9EL 4RBPH 3LN4B 4UNUA 5C9JB 4IK7A 4N2KA 1YMMD 2BP3A 1FPTH 3BN9D 3QEQA 4FG4A 4LDEB 2EEFA 4HJUA 4MS8C 4X0NA 4QHUA 3P4NA 1JTPA 4C8XA 3DO3A 1MRFL 4IRJC 4KXDA 4IS6B 2BVOB 3U30C 3SDAC 1M57B 4ZX5A 1OW0A 1RHFA 4TN9A 4N90E 3LQMA 1HZKA 2GB2A 3F65A 1YMHA 4PG2C 3KLDA 3EYVB 1CE1L 3O11A 3RFRA 4PJXB 4IBLT 3CLWA 3X12A 1Y07A 4AE0A 4F5CA 1AHWA 4XE5B 1IC1A 2WP3O 3F58H 3F7LA 4PGDA 3FO1A 5AOLA 4Q58C 1ZTMA 2NZ9D 4JR9H 1WAAF 1URIA 4PI0A 2P7TB 2XRAL 4TSCH 1BJ8A 2VWEC 1ZLUK 3B1UA 3PV7A 3TPUA 3GK8L 5HVHB 4AIXA 4PH8A 1I8LA 1CFSA 2ZUQB 4BKLA 5JPNC 2VDRH 3V9CA 3O4OB 3HC4H 1OM3H 5TDNB 4ZTOL 3KPLA 1SBSL 2EYRB 3QZOA 5FGCB 3VFOB 1U8CB 4UOQA 2XV0A 1FQ9C 1ZSDB 2YKLH 4WW1A 4WK0B 2WWKO 1BAGA 1U58B 5I6XC 1TVBB 2BOBB 4Q9CA 3U25A 2BERA 4HS6A 5HD8D 4QCIA 3LB6D 3L3HB 3LMJL 1UM4L 2MMXA 5IMLA 2EVHA 1IE4A 3QUMB 4GY4A 4PREA 4QGTA 4LLWA 1DVFC 1A0QL 4XWOC 4XHJD 1TXKA 1SGKA 2ZAIA 5IV2A 3ES6A 2W0LA 4OZFA 1KCKA 1DBJL 2KPWA 2F53D 1KLUA 5DYOA 3FTVA 1BEYL 4EDXA 2NY5C 1FNLA 3I6LE 4URKA 4U1LB 1HYSD 2VB5A 5C97A 4Y2DA 5I5IA 1JYXA 1KCWA 1XEDA 3AWFA 1ZWIA 2BW4A 3RWGA 2X1PA 1IGJA 4NN6C 2C9VA 5IW3A 4XI5C 2G5BA 1NCHA 3WY1A 1VA9A 1TF4A 1U36A 4Q7DA 5D9SA 6PAZA 4XBGB 4GUOA 1W2KT 3G6AB 3Q3GB 1M7IB 3QXUA 2VXSL 5D7IB 1NL0H 2B5IC 4JKWA 1ZA6B 4D9LH 4UIMB 5C07A 4MSWB 4TQHA 3OG6B 1GYAA 1BQSA 3V0WL 4I2XB 4Z8FH 4M1CD 1VZGA 1T1ZB 3FPYA 4R3SB 4QTHA 2Y5TB 1P6WA 2UUDH 4FTVA 2AJZB 5HY9A 5CGBA 1ZLVH 3VH8B 4AZ8A 2OXGA 5FECB 3ZOAA 5L8LB 4FFZL 3TA4D 3VA6A 3MROA 3NFPB 3VFGH 4YSSA 4L0YA 2P5EA 4JG0L 3BESR 2OPCA 4OU3A 4F7PB 2GW5A 3N40F 5D4HA 1S9WB 5IWLC 2HTKC 5E4EC 1TZIB 5J1SC 4O51A 3O6FC 5EB9A 4X6FA 2DTSA 2P43B 4PJ5B 1R75A 1OCCB 1J88A 4PWKA 2ZJSH 4Z7WA 1BBJA 1JZ4A 5GRJH 3EYOB 2EDWA 1EEUA 2CO7A 2ZXAA 2V9RA 1P4LA 3POCA 1FL5B 1YDPB 4XN4A 5F44A 2F58H 4WWID 2KZWA 2XXCB 4KO7A 4QYOB 1KELH 2NLJB 1A1OA 3CSYA 3PABA 1NEZA 3BRFA 4KHXH 5LGJB 1FFTB 3LKRB 4LCWD 4BWTA 1LP9F 1NTDA 1T1XA 3GEWB 2Q86B 1RZGA 2VDQH 3KXFB 1S7RB 1YEJH 1GHFL 3HI1A 3O2WH 2JQAA 1CICA 1DVZA 1EZVX 5IOPB 1D5BB 5IROA 4X7SH 4PGEA 5MI0C 1JZJA 2IH9A 3IJSB 3IPBA 5DVNA 3FF8A 2FHCA 1QSVA 5C09D 2F54D 4P5TD 1QFWH 4OCYH 2ZOTA 2A1WH 2J1YA 4IBUA 2OMZA 5EUKA 3JV6A 3N50A 3HNTL 5GGSY 1MFCL 4CJ0A 1Q1JH 5IB3A 3QEHA 1YJDL 4K23H 4LVNC 3WIFA 2UZXB 4B6ZA 2MTAA 3ULVF 5IEKA 1INEH 1KACB 4ORGA 3ROLB 5EEZA 1UZ6E 2WQ8A 3C60C 1GA2A 3V0EA 1BFOB 3C5ZC 1D2PA 3MRQB 5E4AA 5CZXC 4AENA 5IFHL 4YX2L 1O6VA 5F0MB 5F7EH 3NIFB 4JRLA 3UAAA 4PB9L 1NDGB 2F53B 5I8OH 3H6JA 2AXFB 2J1XA 5AAMA 4LEXL 1KIPB 3UIZA 2NY2C 5E8DH 3OJDA 1C1EH 1JHKL 5GGQH 4GI9A 1JPTL 2J5LC 2VDNH 2YZ8A 4O4YL 2P49B 1BVKB 3RRQA 1RU9H 4Y8AA 4FQIL 3AXIA 4ODBD 1T3FA 4DZ8A 1UFUA 2HKFL 3AU1B 1UACH 3GPEA 5F7DA 1R4XA 5D7JD 3WD5H 2O5YL 4ALAL 2IAMD 2VLRB 2EIEA 1F90L 1MPAL 5C0CA 4PRHD 3NSXA 5LNEA 2K6YA 4KRLB 5A3ID 4Y4FC 1TUPA 1L9NA 2VLME 5ILTL 4RWYH 2I60L 5HHVH 3VFPA 2GEEA 5CFAA 3U7YL 4JFOA 1M53A 5E6RB 5KYWB 4IRJB 4LCYA 4IRZH 3K6SA 1PL3A 3SDAB 3U30B 2CJTA 2JJVA 2OI9C 3MBEA 4WV1C 4NENB 4OIIH 4ZX6A 1KGIA 4B7IA 3VD5A 4F27A 3B9KC 2QJDA 4Y1SA 2DQTH 4QJ3B 5FO7A 1RIUH 2OM5A 4K15A 1PX3A 4K5NA 3D0VA 4OLUL 2CDGA 3P11H 3VG0H 2O61A 3MLRL 4HIEA 3T77B 3KPSD 2FYYA 1WS7A 5K1JA 2YUXA 4IHOB 4TUUA 1OE2A 4WDIB 1KTDA 5I0YA 5IQ9A 5I1JL 2PCFB 3ECQA 1BQHB 4JO8A 5DD3H 2XA8L 1T6WA 2PPAA 4LASH 1BJMA 2ZX7A 4HFWB 1HJCA 1M7XA 5I6MA 2C34A 2ADGB 5DZNA 2UWEE 2F1AA 2ESVB 2WQAA 4WCYH 4XXWA 3OZ9L 3V6ZA 5KYNA 5FYKH 3OV6A 5DJZA 1FZKB 3WLWC 2HRPH 2BIMA 4JY5H 4ZD3L 5F21B 4G9FD 1L9PA 3M8OH 5IW6A 5I6XB 4GAYA 1OGAD 2OZNA 4OZHB 3DPBB 4D0BB 4Y1AE 2K9FB 2AQ3A 4J1UB 1A7PH 4R0LC 5KS9B 1XH0A 2EO1A 4G6KL 1DVFB 3GSVA 3DYOA 3HCVA 5ACMA 5AB2A 1XIWA 2B2XL 1K4CB 2C26A 5E6IA 1W80A 3NA9L 4F8OA 2MRYA 5L88L 3PQYE 3PNWA 2R7EA 4D0DB 2YPLD 4KMQA 4KMTH 5DLMH 3AWGA 4AW4A 4ZO9A 1B4JH 4YR6A 3L8QA 4L8DA 3DV4B 2BMKA 1RK0B 2E9WA 5F7WC 4AQ1B 2RACA 1UADC 4W9GC 3W11C 4RA0C 2NZIA 2IALB 2P1YA 5B8CA 2OMNA 1KPUB 1U8OB 4NN6B 2J72A 2XIIA 4M9PA 5BO1H 2BIQA 3UTZA 2A73B 1U8IB 4U3CA 3T0BA 5FYJD 1TJHL 3X3FH 3ARDB 4MJJA 3T8XB 4KNQA 3EJJX 4W93A 1WSST 1XBDA 3FT3A 1E67A 2B5IB 2X0WA 4JFZH 2ZUWA 4U1MA 2YGPA 3MJ8A 5EOCL 3K91A 1RZQA 2QV4A 4I0PC 3C08H 4NZUH 2WWNA 4FCAA 4XWGL 4G70B 3DOSA 4JS7A 4MNQE 3ZE0B 4MXWL 1NA8A 5CJOL 2XWCA 2HFGH 2BNQA 4XN9A 2Y1ZA 1NAMB 5G55A 1JV5A 3O4LA 4LP5A 3QORD 5E0QA 2VXQL 1BD2D 35C8L 3SKJH 1TZ8A 3MGOA 5AD0A 5DUBB 3FO2A 5D7JB 8FABB 3T6QC 3NGBC 2A4CA 3TJPA 3VGDA 4XH2A 4JM4L 2ENYA 1GKOA 2R83A 5CU9A 1H8SA 2R69H 4ODUA 5CAYB 1Z5LA 5I1EL 1D6VH 1LQSR 3FONA 1UTDA 2ZCKL 1EHXA 3RI5K 3W5MA 1ZKAA 1DDHB 4HOWA 2QQLL 4GW4A 2AQQA 4XCFL 2WKOF 3L5IA 3D50A 2IH3A 3IJ7A 5AL0A 2ADIB 1A6UL 3DV6B 3QEQD 3BQUC 3I2CL 2Z8SA 1OHZA 4OFDA 4XOBA 4OLZH 2NQ3A 1JPFA 3QHZL 3UBXI 3V6OA 4TULL 4U7SA 1QABA 3ZYIA 3FUEA 5KBMA 2VLJE 4Z7UB 1OSPL 1JOIA 1Q94A 2J4WH 3W9EA 3HZKB 2EAEA 1E5AA 2AKRA 2B1HH 2XG5A 3QIWA 1RVFH 2FBRA 5MI0B 1OF2B 4FQCL 5CZVL 4NRYA 4XE0A 4LSQL 3V4LA 2EKJA 2DH3A 1M05B 1AO7D 4PJ8B 1M4KA 4N68A 1MREL 4NQDB 3GFUA 1F6AA 4HJGB 2RHEA 4HKZA 4L8CB 1AYOA 5JNYB 1UVQA 2UYLB 1GS7A 1ZE3C 5IKCA 3QC6X 1NCGA 5HHXH 4G9FB 5CLWA 3V5DB 5D2LE 1OGAB 1H3VA 3V9FA 1RZIB 2VR6A 2YGOA 1LO2L 2H5UA 3B83A 4X7EC 3C5ZB 5JHDD 2GIYA 4PS7A 3CZGA 2HB0A 2BIPA 5DVKA 2FX7H 3MV9A 1SF5A 2Y72A 4KROC 4BCZA 1YG9A 5I15H 1BDYA 2L0DA 3U9UB 5I8CA 3PNRB 4JQIH 4M7KL 4M8VA 5FUCC 3FUKA 1Y1DA 1JGVL 2PNDA 2NY2B 2LAGB 2CXKA 4KX7A 2DD8H 5FOJA 3P9MB 5DI8A 4ZUSA 1EAQA 2HVKA 1QSFA 3LN5B 2H4EA 5DU7A 2FAUA 3SODB 1ZHNB 2J5LB 4QRRE 1JIBA 3ZDWA 4P9HL 2FQFA 1ZLWK 1RPUA 2F5BL 3L3JA 3KPRD 2QADD 1I8IA 1SEQL 2UVEA 5AKRA 5KSAC 4AUJA 4HAKA 3QZNA 3TGXA 1RIVL 5BOPA 4RMQA 1I7RB 3T2NH 1J1OH 3LHPH 1KIUB 4U1SB 3DNKA 1D7DA 3FQTA 4YBQC 4PLJC 2D3NA 4LOFA 4FLQA 5G2NA 3BSHA 2EDDA 5CGMA 2O1AA 3QCUH 2QQQA 1KCSL 4GPVA 3Q6GH 4Y4FB 4FP8L 4AYDC 5H35B 4XRCB 2XTJC 3LEVL 4NO0B 2ZT9C 3NBNA 4ZS6D 1C12B 1HXKA 1PBYA 5T3ZE 1BD2B 4HF5H 3BYTA 4ISVB 4YHIA 1UCBH 3D8MA 3GSXA 3QDGB 4OGYL 4WO4C 4F7TA 4FFWD 4FTVD 5EBLA 3B9KB 3WIIH 1XSIA 4X4YA 5JW4M 3FO0H 4IRZA 3O8XC 4PJEF 4QR7A 4FNLH 3TO4A 2P5ED 4R4NC 5JHMA 3J07A 4H7VA 2EIZA 2IPKA 2V5SA 1UUNA 1V27A 2ATKB 2DQUL 3S35H 4TL4A 3BEWB 2NNRA 4FERA 5BNXD 1WITA 1WBYA 3B2DC 1PZAA 4JPIA 3OD3A 1DZ0A 1H8NA 1TJGL 3N1GC 3HLKA 4Y4HC 1DQVA 4Y19E 2ZXCA 2IVFC 3L9RA 5GS0H 2WLYA 3WN5A 1IQWH 5EEYA 2JCCF 3KL0A 5CN3A 5KVGL 3KHOA 3TYFA 4AYMC 5F88A 2JIXA 2R56L 3U4BL 2D7NA 3QIBC 3B6SB 1AGBB 2C9AA 1ZAGA 3B7YA 4BFGA 2FX9L 4N2BA 2VUKA 5EO9B 2PETA 4R0LB 3SBWA 1SMDA 1A7NL 3ZT5A 4L1SA 2FGWH 2DW5A 3B3BA 3ET9F 1AO7B 3L5HA 5DS1A 4Z7OF 1KXQA 3S37L 1AZCA 4GXVL 4ANXA 5AVWB 3KDMA 4UTAL 1V3LA 1UXWA 3LNIA 4ZO6A 4BQ8A 4GW1A 1TZOA 2IDQA 2WZPA 3JWNH 5LB1A 3KWWB 2O5ZL 3FYEB 1CWVA 5J3HD 2C9SA 1MHCA 3P73A 3FT4A 5KSVA 2XWRA 3Q5YA 2QKIA 5JHDB 3H85A 3LZOA 3IXTA 4EDWH 4B9ZA 4NNYB 1YPZF 4XVOA 4I1NB 4KOCA 2XN2A 3D87B 1NANI 4OI9A 4FZEL 1DQLL 1DBKH 5EIIG 5FIEA 5FR3A 1WIPA 2JXMA 4JE0A 3ULUL 1T20A 4MJ5A 1QPKA 3M45A 3ZDXE 3N04A 4FZ8L 5F71A 1FV1A 1EGJL 4UUJB 3GTVA 1IC7L 3H3PH 1JYWA 2X6VA 3F12A 4E42B 1X5FA 2FHFA 4IK6A 3N85L 4FFYL 4XO5A 2VDLB 3TO2A 5M95B 3KPRB 1U91B 4LT7A 3HLAB 4NI3A 2E5EA 4PGZA 2OMWA 1EXUB 2Q7YB 2A74C 4L05A 2W0KA 3KJ4C 3NGBB 3ZGHA 2EDLA 3P30L 3R18A 1DUYB 2BY1A 1W0WB 3IE4A 2QHLA 3ZKMC 1MF2L 4KRPD 5LGKA 4OGXL 3C6SB 2VDML 1NUGA 3JVGC 2J1WA 3VFSB 3S6CA 4PLOB 1XXFC 5D7HA 4EBQH 1Z9NA 3ZL4H 5C08D 5C0BE 4NGHH 3CSFA 4XN5A 5EU6E 4KTDL 2WOYA 4L1DA 3BQUB 4CU6A 1E6OL 3GT6A 3NZ8A 1TQBB 1ET5A 5EOTB 4NQSA 4XXDB 4EXKA 1MAMH 2XTLA 3MBED 4W9IC 2DQFA 1JZ6A 3KGUA 1QW8A 2P5WA 3ZGIA 1U2CA 1GJWA 5I0DA 1PCSA 4WFFD 4Y2OB 2IANE 4FNRA 4ONHA 5FKAB 5C0AE 5BJTA 1JPSH 3MPCA 4IBZA 4PRNB 1CQYA 5DJXB 2YC1A 5ANMB 1MIMH 4K7PX 4LHQB 2OP4H 5LGYA 1AIZA 3EF4A 1YNKH 2DV6A 5F7KC 5CGYD 2X88A 5FM4A 1CD9B 3BP5B 4M61A 4DO6A 4FI8A 1IUZA 4FI7A 1XQ4A 2PPFA 3COOA 3L2MA 4HKXA 3MRBA 2J5WA 2EE2A 2VLKD 3MRGB 4WZ9A 1YUHB 2FHBA 1XH1A 3FQWA 2DIJA 3WIHA 1NKRA 3X1BA 5EA0H 4KROB 3RL2A 1UM6H 3KL5A 1EHAA 3SZKC 1RZKL 1C08B 3HZYB 3DXAD 4TUOA 1PZ5A 2WLKA 2GJZA 3FT1A 5E2UH 2ZUVA 4OJYA 1UXLA 3BP6A 1YEGH 3HNVL 4ZMXA 5E6ID 2ZKYA 1N64H 3D25B 4O2EA 2D3JA 3G5VB 4OCNC 1G6RH 1MFNA 2C4XA 4AV5A 5E99H 3BPCA 2QVIA 3GXIA 4OCWH 3TXAA 4XNUH 5IQMA 5L2JA 3FUHA 1R1CA 4FXTA 4KK9C 4XC3L 3STZB 5GHWL 3S3CB 2WLLA 1BAFL 2D03H 2XY2A 5T1MB 3N44F 4RMUA 4CKQA 1XBRA 2CJUH 3RWCB 4HD5A 2I69A 1UQSB 1G7PA 5I75C 3FN3A 2B1AH 4WI7A 4ZXBC 4UT6H 3QJHA 4M7JL 3FB6B 4PY7A 1EO8L 1XVSA 1S9XA 1T5XB 3PXLA 1ORQA 4ZTPL 1YEKH 3VXUA 2DMCA 4WI4A 4JMNA 5IMMB 3MUY1 1EVTC 2FJSA 4GP8B 5DJ6B 2FSEA 1X5AA 2EXYD 2VN6A 2BNQD 2NY6D 2IWFA 1OHQA 2GITA 4Z7IA 1LWHA 1OZTG 4MVBD 4OF0A 5E2WL 3U7AA 1T5KA 3GBNH 3LRSA 4A7SA 1T7ZA 2WLIA 2YAQA 3TCLA 5AZEH 2Y3AA 1JXKA 3SQOH 5G4OA 1OVZA 4L48A 4XBMA 4Z6AT 1HCFX 3EYSH 1UZ8A 5A2IH 1PD1A 2NUTB 5C08B 5IFAL 2ZZUT 3OPUA 4KKNA 5JR1L 1A7OL 2VDOB 2Z92B 3RWFA 4ZUVB 5JQ6H 3ZKNC 3HAEH 5KYUA 3GXUB 3RJDA 3PWLA 4AQEA 5I16B 2DEXX 5IB1B 1BMWA 3VRLF 4Z0BL 3IDIB 4L9DA 2JF1A 1PX8A 2VAJA 3D52A 3MJGX 4PLKD 4OZGE 5FW8A 5C2UB 4RVBA 1X6LA 3GKWH 5JUEH 3QIBB 1WWBX 3MRDB 4HHAB 2CNZA 1WAEA 4B9GA 1E5YA 5FB8A 2DQDL 5DD6A 1BHGA 2J20A 4X0KA 1UB6B 2Z7ZA 4LPTA 2CIIA 2K4WA 2ICWI 3D0AA 1MJUH 3F6JA 3QIWD 2BC4A 3VSUA 4OLYH 1JGLH 3MX0B 3FCTB 4LIQH 4PJCA 4YGAB 2F9BT 2YLKA 1PY0A 1A8JH 2NR6C 4MB4A 5LQBH 2C1PB 1S7UA 4N8UA 1KLGB 1A5FH 3FF7A 4YO0B 1S9VA 4LE8A 4OD1L 4JRXB 1G9ML 2VLKB 3KYOA 5K59F 3SE3C 4WW2A 1X5LA 2DJSA 4YPGB 2IGFH 5F96H 5FM8A 1A6WH 4R7XA 1OP5H 4P05A 5JIMA 2ITFA 2Y2WA 3B5TA 4PJDA 3ZK0A 1RK7A 4UQCA 3LIZH 2CK0H 1J0HA 4NZRH 3FOMB 1DQJB 3ULVC 2D8KA 3MV9D 3FJTA 5JA8B 3A24A 2FBJH 3G9AB 3R8BB 4YEEA 3BIKB 2OX5A 2VXUH 5DD0L 3S4SG 1JZHA 3UTTA 3FUJA 3ZSTA 4Z7AA 1TEGA 1QO3A 5FA4A 5JW5B 5HYQB 1FNGB 5I24A 1A7QH 1GS6X 3N9GH 3E0GA 4OZIA 5FX3A 4HPYL 4KQ0A 4OCXL 3QXDA 2AK4B 1CXKA 1BVLA 2A74B 5LWYL 1S3KH 4PWJA 1P0SE 4MA7H 4RETB 3QCTH 4WGVB 3ZQ9A 2VR9A 3OGOE 1T0MB 5F3BA 1HH9B 3QDMA 1PLCA 4YDLC 3VGBA 2A99A 3IJ9A 1GYUA 3KPMA 1VGEL 3BVDB 5IEHB 3EH2A 5EZLA 1I4FA 3GM0A 3ZE2B 2ZNXA 2WY3B 3L4WA 2QSCL 1HVXA 3DIVA 3EUDA 1GH7A 4EEEA 1OB1A 3GMNA 1XGPB 1GSKA 2EIBA 2ERJC 2E3VA 3QPXH 1FNSH 1NM4A 2DM4A 3M1BB 4X6DB 3UTSE 3S5LG 1O0VA 1FCCA 4ZDHA 5KEZA 1E5BA 1Q9OB 1P6FA 2WINA 2WUBL 3JTSB 5TFSH 2HH0L 2Q20A 4AL8C 1QA9A 3QIUA 3TO4D 3FB5A 4H88H 6FABL 3TEXA 1EEYA 3HMWL 2X40A 3C6LB 2J8HA 1FFOB 2AQPA 2IOOA 2JELH 4R4FH 4TTDD 3C87A 3HVNA 4BZ2A 1JNNL 3A3YB 4E41B 5B4MC 3U6RA 3B2MA 1L7IL 3VXTB 3VDCA 4KI5D 4M62L 5E1AB 2AQTA 2VITB 3VMOA 4L9LC 4WEUD 3BAIA 3U0TA 5HDLA 3T0EA 1P53A 2OYLA 2EE3A 4XMLL 2Q6WB 2IOMA 3TU6A 2J7LA 3KEHA 4HZLB 4FQHB 1PPIA 1S5IL 1KCLA 2LLNA 3CIAA 3MLYH 1UC6A 2P4AB 3SGKA 3C75A 5GS3A 3ETSA 3F83A 4AH2A 4TTGA 3QEUB 1PYWB 3GUTB 3ZHDA 3MNWB 1A7BA 5L9DL 4X8XA 5BW7A 2HT3C 5DUPL 1EV2E 1DFXA 5FYKD 2YMXL 1C7SA 2Z93A 3WL9A 3MRFA 5D1XE 3RBGA 2VDQB 1NWOA 2FIKA 3HMXA 1RIHH 5DWPA 3RPBA 5MENA 2PPCA 5IR1B 1WF5A 1J1PH 4EZMA 5B7EA 5KJRH 3ZHNA 4JMXA 4LRNL 3ENEA 3WIAA 2FATH 5E9DA 4NPJA 5IFJA 1Y6MR 5TH2A 5K1NA 5GJTH 4XPAH 5I1HH 1CQKA 1S9YB 4AVJA 5HHPB 1IC4H 4MAYC 2WZPD 5I76A 5TE7L 3CFJA 4U1IB 3P1VA 4M8QB 5DC2A 1VACB 4X6CE 1FYTE 1H5BA 1UOWA 1YEHH 5IQOA 2HYMA 2FWUA 3LKNB 3T2OA 1H6TA 2V5RA 4M5SA 1SLVA 3SKNA 3HNSL 5I75B 3BPNC 3ZZLA 4ZXBB 1AJ7H 3C8KA 3SPCA 5ISZE 4AQZA 1GGCL 1SF3A 3FUIA 4FXLA 2QPFA 4KVNH 5F9OL 2DIBA 1BX2A 3ARBC 4P2YA 5D71H 4TNFA 3VO0A 1HESA 4TV3A 2LABA 4YE4H 2UX6A 3ZVVA 3Q2LA 5IW1B 5FFLA 2J6EH 3O3AA 1KYUA 1MVUA 4LPCA 1AIFA 1IT9L 1QLRB 1JGEB 2A9NH 2APVA 2CH8A 3MAWA 3J2PA 4P8QA 5F1KC 5IF0A 1N2RB 4YDIH 3QUML 3WKNA 2WB1A 1BLNB 1WRFA 3DOIA 9CGTA 3SCMD 3DIFA 5EZIH 5ICXA 3SPVB 1E3FA 2XWTA 1TTRA 2ZYRA 1SY6H 1KB5A 4F1SA 4EIGB 1P4IH 2J43A 4KI1A 4YSDA 4P5MA 3FHEA 3P3YA 2BVQA 5IG7B 4HUUA 2XN9E 1EDHA 2XWBA 6TAAA 4LSPL 4F2MA 3QG7H 3GSQB 3TBTA 5T1KA 1KCRL 1ADQA 1AE6L 4Z7VA 5LBSA 1ODAA 5GGTH 2IFFL 1NLDL 1QBBA 3G6DH 1CGVA 2P5WD 4HS3A 4DGYL 2BZCA 5SWQB 1ZDQA 3DSFL 3RI5F 2VZ1A 4FQJH 1LP9B 2ICEA 3O9WC 4QDGA 5EU4B 3GXDA 3N1MC 4X2UA 5T3XL 3KWTA 3SYPA 1UJ3C 1BQLL 2DTML 3QH3B 3VM5A 3AUVA 5ANHA 1NDMA 3QPQC 4HQQL 1TVDA 1FH5L 2GIXA 3PP3H 5CKGA 3G5WA 4JM0A 5CJQL 2YPKA 3DUUB 4FQLH 3QQDA 1Q38A 1AZUA 2NNAA 1MHHB 5FO8B 2XPZA 4RAUB 1EBAA 4ODTL 1K4DA 3UZEA 4NM8L 1OP3K 4O2FB 2ZX9A 4FA7B 5T33L 1J8SA 2X6UA 4KK5C 4QRPB 4JB9L 2EDQA 1L0XA 1PSKH 4HS8H 2GI7A 3R0MA 2KQMA 4X6BA 1RXLA 4J4PC 5K69A 1EAPA 1F1GA 2ZE0A 4NJ9H 2MFNA 2YK1H 5JDSA 2BW5A 2VJ8A 3T1WA 2CRYA 2BFVH 4JJOA 3L4VA 4UINL 2E4FA 2BDNL 4NP9A 2EXSA 3MXVH 4Z7WF 1AY1H 2OTWB 4GAAA 4KKBC 4FLRA 5KVFE 4TXVB 5T8IA 2XN1A 4Y7OC 3HUJA 1WS8A 3QQ9C 4NZJA 1IC5H 1B4RA 3IKKA 1X7SA 5KBKA 4GRMB 4Y5YA 2NNXA 4YDLB 3EHBC 4N28A 4N2NA 3ZIMA 4AMWA 2DLEA 3WKML 4V1DB 2I9TA 4TL5A 3WXWH 1JE6A 1YMME 1KPRB 7FABH 1AG6A 1AHKA 3P77A 1P7HL 2YGVA 2J8OA 4PB0H 3AXLB 5I73C 3QQ4A 2VZSA 3BIBX 5BS0D 5DO8A 4JO2H 2ERJB 4AIZB 3U0WH 4GQPH 3BAEH 3VXUD 5ESAA 5EDXA 2FLMA 3ARGD 1FZMB 4X98B 2ADFL 5F9WC 1L5GB 4XNBA 3DHUA 5MEPA 2VMJA 2ICES 4NAMA 3H7LA 1MCHA 2EDRA 3SDCC 4GI8A 4IIQB 5CJXA 1W6WA 2GUOA 4XP4H 4FRWA 5DHMC 5JHLH 5EU7C 3NPSC 1MCNA 3SCMB 5GSVB 2FLRT 3H9HA 2Z35B 2PWDA 1OALA 4QD2E 4KUCD 4JFPA 2OKMA 5IBTL 5LDSA 5K5YA 5BRZB 3LOWA 5KSBF 5ERWA 1E4KA 2BSCA 1WA1X 1MCQA 4AQ8A 1T5WB 1HI6B 1R5WB 2V7NA 3NZHL 3QZWG 2OR8A 1FVEB 1XEUA 1G7IA 2XX1A 4DNLA 3WFHA 2I7SA 1JZ2A 3OMAB 3GSOB 3ARFC 2BK8A 3PV6B 3LV3B 1N6QL 1W9XA 3V7AG 1T1YB 3QI9C 4N22A 3FTSA 1XGYH 1BPLB 2B08A 2CDEB 4AEFA 4MQXC 5GS0D 2Y69B 3KPPA 3KBPA 3GMRB 4WHTB 1RZPA 3D18B 1IM9B 1ONQB 2JKWA 2I5YL 1OAKH 1S8DA 3WEOA 5F2FA 5B21A 2F53E 4ZYKA 2RR3A 3MLXH 3BH9B 1KFAL 2DDQL 2GY5A 4JZNB 1EEQA 3NPZB 4UZSA 4XNQA 3I3BA 2X4NB 4FXKC 1RJZA 3GBEA 2X5PA 4N2AA 1E6JH 2MCG1 3DETC 3LQAC 4NWUH 1CE6B 3B3IB 4PIBA 2JNZA 1TZAA 1E2ZA 3EFOA 3PAVA 4Z1PA 4ZMAT 5FWRA 1AR2A 4C83B 4HPOH 4LRIC 1IKFL 1IEAA 1X5YA 4NOFA 4M48L 2Q8BL 1F02I 1M1XB 1EFQA 1WD9A 2ED7A 2GJ6D 3J7HA 3GZPA 3QFDA 5C0GA 2HKAA 1HSBB 2VISB 3OKOB 1LE9B 4GSXA 3QSKB 2V2WA 4N25A 1JZ7A 4DQOH 4OB5H 1H0DA 4NBZB 3DHPA 1E2WA 3UTTD 1XAKA 4LCUA 5ITFA 5FDWA 2MPVA 2Z0BA 1VGKA 4M5YH 2R2EA 2EADA 4NXKA 1I9IH 3W0WA 4I3RL 3CFMA 3SY0B 3FT2A 4LLVA 1CF1A 1MCJA 4NXSA 1MFAH 4O5LH 5EIIA 3OVUB 4ZUTB 4H1LH 4YAQA 5ICYA 4KKCD 4KV5F 1U4EA 3HI5H 5BS0B 4P9ML 1RUAH 3DVIA 4QAMB 3MBWA 4RAVB 1YYMH 3ATDA 4HJJH 5DXWA 2NY5L 2LVCA 4J3OH 5TE6H 3ARGB 2ENQA 5GZNC 3QNZB 4GQ9H 2Y25A 1SY6A 3MJ9H 2GJPA 4R7VA 3H9ZA 2BHUA 1ETA1 4HOXA 5GGVY 5IB2B 4QRSA 4LCWE 1QI4A 1U4FA 3LB6C 1NCCL 4RFEA 3AG3B 1LEIB 1OQXA 1NFIB 2WVTA 5DURB 3WFCL 2BY0A 2P8MB 1FNHA 3U9WA 3QIUD 2IBGA 3KPTA 1OK0A 2D3VA 3OJVC 2F54E 1RV6X 3O9WB 3FN0H 1PKQA 1VFAA 1U3YA 3I02A 4P46A 4R4BA 4F91B 3CX2A 1UJ3B 1I7TB 3UJIL 1JFHA 1WBZB 4ESKA 1JZEA 1QEWA 1G4RA 2Q2EB 5DHEA 2ITCB 5HYJA 3T4AC 1UB5B 4WNJA 2V7HA 2YD7A 3RUGE 2BP5M 2X9ZA 5IGXL 4LHUD 5FW7A 1P7QA 2WYIA 5K9OA 1RUMH 1CTNA 2ZP0T 2CUHA 2G0KA 2ATPB 3LH9A 2FR4A 5BVPH 3BKML 1TITA 4A1RA 1SMOA 1HEZB 2IMMA 3PHAA 5FGBA 1S6NA 1T0NB 1R5VB 5E0FA 3WLBA 1R3IH 4DGIH 3CZJA 3APMA 4H44C 1MFBL 2F19H 4PJIA 5K9QI 3W2DL 4MLIA 4PTUB 1WCBA 1K2DB 1KPVA 3GNMH 4WEMB 3V0IA 3ZE0E 1UWGL 4KTEH 4NYLB 2ENSA 4NO5A 3CUPB 1VFOA 1TQVA 2WKLA 3AUWB 2IF7A 3RURA 2CIKA 4X5LA 4MZ3A 4K3HA 3I6GA 4JBSA 3UTQA 1QUNA 5ADOL 5J6HA 2HMID 1WFJA 4P5KB 1HC1A 1ROWA 3NN8A 4Q2ZA 1EAJA 1KXHA 1XO8A 4NC2B 4N6RB 5AVQB 3FRPG 4PRHE 5SX4I 4DN3L 2L7JA 2DPKA 3HE6C 4E9VA 4KHTL 4ICXA 1EXHA 3D39D 2Z65C 1OGPA 4A2DA 4NUGH 5CCJA 2QTEA 5DJAA 1SDDB 4NB7A 1RUKL 4XHQA 2GTWB 2H47C 3TCXA 2A2QT 4S2SA 3IEAA 15C8H 5FGSA 1LO3L 4L4VB 4Y9CA 3UG4A 1IVLA 1HE7A 1KGWA 4YUEH 2ORBL 3TA3A 2E7HA 5D5ME 5F9WB 1OAXL 1IAKB 1UOLA 3N1QC 3SDCB 3DUSB 2ZSVA 4Z7UE 4AMXA 4AMKH 3L1EA 3KPSE 1F11A 2LFGA 3MRHB 5GIRA 3EADA 2HWZH 1G7JB 2V2XA 2DYSB 5J6SA 2OTUB 4P4RB 4UAOB 1MHPH 3EO0A 3MRKA 2ADJB 3DI3B 2Y4SA 1WBXB 2KLRA 2WNGA 2EECA 5JHLA 4OAWB 4KKZA 2YXWA 1TG8A 1JRHH 1OAQH 4PJEB 4UOZA 4IJ3C 2MQGA 2PMZA 1CO1A 2QHRH 3CFDB 2XXMB 2OMUA 3IDYB 2M26A 3KH3A 3SGJC 1SEBB 1S9KC 4F8QA 3DX9A 5AALA 3ARFB 5E24E 1I1AA 4MD0B 5ESQA 4G9FE 3BAKA 3SDXA 4UTBH 1A14H 2W9LA 4N6QA 4RGOH 1OGAE 5FYJL 5DC9B 5IQLA 1H3TA 4XPBH 2R4RL 1JUFA 3H4HA 4TLKA 1KJMA 4DKFL 5BRPA 3QO0A 3I85A 1VCBC 2NY7L 3AFLA 3PFUA 4RZCB 4R2GB 2LLGA 2JCCB 3EGXB 3Q13A 1EHNA 2P42B 5IP4A 5FUZH 3MV8A 3NJLA 4ZUWB 2WTRB 3MKKA 4JO3H 5GGRY 3L6FB 4ELMA 2YPLE 4ZOEA 4FXKB 3FQUA 5DRNB 3DJSA 2DJUA 5HGDB 1MHEA 5A6IA 1WPCA 5I71C 1UM5L 3BISA 4Z7OB 4YDJA 3MRCA 1IBHA 1YY8B 2NXYC 1OCZB 3WDIA 4HCIA 3UFIA 5J56B 1SJHA 1FAKT 1D5IL 5FYJE 3IK2A 3WJLC 1FE8H 1GOFA 4UDUA 3CE1A 3IDXH 3PHQA 1XCQB 1QLEB 3TWCL 4JFQB 4YH6A 5JMRA 4KQ4H 2H9GB 4I9XA 3FBQA 2YRBA 4HWBL 1YSOA 4NSKB 4MD5A 4NZ8A 5I6KA 1WFIA 4Q9QH 1I3GL 2B59B 5C1MB 1YPZB 3QGVA 4R7DA 2NXZC 2QR0B 3MRIB 3KNBA 1FL3B 4L2YA 1INQA 3GRGA 1BD2E 4PRPB 1N8OE 1D2OA 1UH4A 2DWDB 1ZOXA 2G0LA 2NY0C 2WWMC 3Q0HA 4G9DA 1G6RB 5CF3A 2W5PA 4L29A 3UYRL 2C1OA 3NAAH 1JHTA 5A1AA 1IGML 1EJFA 1XGUB 3D39B 1XDTT 3Q8EA 4YVUA 1S7XA 1HKLH 3MFFB 2D31B 1F6LL 5J89A 3S4SA 2G3ZA 4QXUL 4H2AA 4D9QD 4JFDB 5GSRA 1PG7X 2H2PD 3VYPA 1PF3A 3QEQE 3H3BC 4Z3GA 3MJ7A 2F0CA 4DT2A 4ZMPA 3ABGA 1D5MA 1N0LB 3QRLA 1FVDB 3RILA 4F80A 2W9DH 5A7BA 1ZHLA 1I9JL 2GI0A 2EYTB 5FDYA 1U8LB 1A1MB 2H26A 3TVMA 4WUUA 3BSZL 1FORL 2V4LA 3TJHC 2NTFB 2AI0L 5IMOA 4C54A 3DC0A 1IBFA 2NRDA 2X4UA 1S3RA 1IM3A 1IGYA 2CLVB 1KEGH 3KLAB 1VFBB 1A7RH 3W3BA 4LSUL 4OD3L 1OPGL 1PAMA 2BNUB 1AO7E 5H94B 5LVEA 1AXSB 2BSTB 3BZDA 1R19A 3SGEI 4K3EL 4NKIL 4QHNA 3ARED 3ZUNC 4B9CA 1WISA 1M42A 3HG2A 2MKWA 4LCCA 4MDRA 1D9KC 1XF5B 5DO2D 5I28A 1AI1L 1ACCA 2VDLL 2GFBB 2HT4D 3S5LA 3BCFA 3T4AB 2HRLA 3HAEB 1KB3A 4PUBL 4GMSL 4E5XG 3LH2L 4Y9FA 1CG9A 1SHXA 3AS2A 4RRPG 3RWEB 4XVJH 5JHDE 4KXZI 3VFUB 3F2LA 3FS9A 4OTXH 4YFLF 3RTQA 5EPMA 3PWUA 3IGAB 2Q10A 1ZVSA 3HC3H 3BP4A 2YPVH 3MNVB 4PLNC 4LVEA 4HT1L 4JCWA 2H3NA 3JT2A 5I6PA 4FFVD 1ZS8A 1Z3GL 3MLTB 2J21A 3OAWA 4A39A 3WS3A 3D09A 2EKSB 2A7BA 4MWFA 5KW9L 2ZKXA 2I27N 4XGZA 2P48B 5D7KD 4PVBA 4GAJH 2NY3D 1N67A 2YJQA 4N0FB 3RGBA 1A3LH 3IJYA 3U4AA 3KPRE 3PU7A 4LCIL 1YAZA 2HLFC 4N0YH 3LXAA 3VFWB 4UQ2B 1ZGLB 1U6AL 2YEQA 2ZONA 1E4XI 3ZPDA 2YWYA 3NCCB 2BS71 3BUYB 3K6DA 3WNPA 4Z7NF 4DPBX 4K2UH 4BUGA 2H0PA 4G80B 4LSSL 5A2KH 2OK0H 3EFDH 1MLBB 2JVUA 2EC9U 5FUOL 3HE6B 1KLFB 4HU2A 1PD6A 4FLHA 4S1SH 4OD2B 1CLOH 2JB6B 2Y6SD 4HK3J 5E5LA 2X7LA 3LY6A 4J3WA 2Y23A 3L3IB 4RQQA 4L4TA 1OW0C 2ZSWB 3QUZD 3CH1A 3VFVB 1FC2D 2CBPA 3N44B 1XZWA 5CEYA 4K5PA 2UY6A 4A6YH 4HH9B 4BKSC 1ZTXE 2IBZY 5DJ0B 3L3KA 1O6TA 1KJ2B 1AHWC 1LYQA 2G9KA 4K94C 2P5EE 4RZKA 1KGCD 3AMLA 3MCYA 5ESVB 3W0WD 4B41A 1U8HA 5IHZA 2MHAA 3U2SB 3NOIA 4PR5A 2WP3T 2KHAA 3OX8B 1CK0L 3VD7A 4P2OA 2Q5BA 1PZSA 1ZT7B 4XP9L 5FHBL 5IJKC 2R59A 4GRWE 2A77L 4IJ3B 3BZ4A 1B4TA 4UQDA 1EZSA 1N3NA 3VYNA 5ANME 4G8IB 1RURL 1KGXA 4GKSB 1KG0B 1CVSC 3CFBA 2IIJA 4EVNA 4X4XA 3B43A 3ZTEA 5DJCA 1CE1H 1OAZH 5IIEB 3DBXB 1T83A 3MRJA 1BZ7A 5A2JH 2R1WA 2XV2A 3VQ2C 1X7TA 5IB5A 4JFUA 1IAII 4X42A 1XZ0B 1DVTA 4UTBA 2YAPA 4PRIA 4YGVA 5DEGA 4UM9A 1AGEB 1PZDA 5F1IA 3IKCA 3U46B 3RPIB 2NYYD 4N85A 2V33A 1BF2A 3AREB 4MA3B 2GABA 4N9GB 3GK8H 1J9RA 3SIKA 4GFXA 3QXAA 4Y2DC 4YWGL 2XX0A 2QADC 4TMPA 4ZTOH 4P46D 4G8FB 4G7QB 4JPWL 4F93B 2NXYB 1IGFL 3UBXG 3FBKA 1G7LB 5HYJD 3PCYA 3TH4T 3ASOB 3VFTA 4P4KA 4XZUB 3LMJH 5TF1H 1P7QD 1A0QH 1CMOA 3T0VA 1R24B 1BVNT 1DBJH 2R4SL 1U8JA 4MX7B 1WLHA 1U8MA 3CLEL 3D05A 3PF2A 4JGJA 3SQBA 3MMEA 3V6FA 2VDOL 2FTAA 2P46B 4DGUA 5KZCB 1DBAL 3GXMA 4NQEB 4FFWC 2HFFB 1KBGL 5AVYB 2NXZB 1W16A 3D12B 3V0VA 4G83A 1EVUA 3LNGA 3BWAB 3L3OA 1SBBA 3O41B 1A6AA 1T21B 2NY0B 3WEBA 2D0HA 4WFED 4N0UB 3ZR6A 3TTSA 1O6SA 4XAWL 3WGVB 4HAGA 3IFLL 3K7UA 5E08H 1K8DB 1TU2B 4RRPM 5HJGA 1TZHB 1XR8A 5ACLA 3A6CL 1NWPA 3W82A 3MNZB 4QRUA 1T2QH 2Y9RT 5GRVL 4OKDA 5C08E 5C6TH 2YEVB 3F7RA 3V0WH 1MVYA 2EDHA 5E00B 1QBMH 4QY8B 3IS1X 5KOVC 2MNUA 5I8EB 4X7CC 4FFZH 4EE2A 1TTCA 4QUOA 4ONOA 2FO4A 4F37F 1MFUA 3OMIB 4JNXA 3MRRA 4UILL 3V2AR 5JW4Q 1CFVH 3O0RL 4WFFE 3PWNB 2EH8L 1CICC 2YMOA 3IFOB 1OM3L 3MVSA 5EBWA 5IROC 4A7GA 1HNFA 2YKLL 5L4FA 5GZOC 1QOKA 2IC2A 3SPGA 4MHHI 2WLNA 4M43H 1LM8V 3QHFH 4KTGA 1NBYB 4YSAA 3C5SA 1PAZA 4RMVA 2QSQA 1KJ3H 1D9KB 1U33A 5TGBB 4KPHH 4NLHA 3TC9A 4JRXE 2VLKE 1GHFH 1I1AD 1RZJC 2WO4A 2E76C 2IQ9L 4R7NA 1DO6A 1BIIA 4XMWA 2CO3A 4JG9A 4OZIF 1MCKA 4KAQH 1AZVA 4NPKA 2AXJA 4AYBA 3NZUA 4LHJB 1NSNH 1T4KB 5DK2B 3DXAE 3TNMA 3KZ8A 4WSJA 4CMMB 3GBLA 5F1OB 3EZJB 5AAMC 3CVCA 2HLAB 3BGAA 3ZN6A 2WIIB 3Q1EA 3UACA 2HJFB 1NL0L 3F7QA 1EO5A 1J05B 3HNTH 3QZWA 4LP4A 1MFCH 3IDNB 4E68A 3KCWA 3S88H 1YJDH 3C5JB 3DVNB 4D9LL 1RHHA 4WJ5A 2DZEA 5CHNB 2LT9A 2WZAA 3ZKXB 2Y5QA 4L3CA 1WAPA 1QFWI 1E9QB 3CDZB 1JMXA 4Z8FL 3D0LA 1RJYB 4X99A 2XWDA 5T5FA 3CFCH 1A6ZA 4EPSA 1Z9MA 1I7UA 5C0DB 3BE1H 1SOKA 4TNVK 4UM8B 3N0PB 3FSOA 3QFJA 1TKWB 4PB9H 4NPYA 4QJ5B 5DMJB 2YLHA 4JFEB 4PJBA 5LDUA 4LEXH 4LOEA 1X9LA 1FN4A 2AQSA 1HHHA 2GEQA 1JHKH 3PLYA 3RZWA 3CCHA 3MBEC 3HC2A 5BVJB 3MKGA 1DJGA 4O4YH 2KUTA 3UBGA 4Q6YA 3ZKSD 1E9OA 1AC6A 3IJEB 4PP2A 4JAMA 2AQ1A 4OF5A 4PW3A 3O11B 3UTPD 4EN3A 1EPFA 3QNYB 4WI3A 1B0RB 1AD0B 2HKFH 4X6DE 1AHWB 1FFNB 2F58L 4QHPA 4LARL 3F64A 1KELL 3MRPA 1N10A 4U2YA 4KHXL 2PO6A 4PCYA 4JM2F 2VDQL 3BC9A 3O2WL 3CVHA 3NJFA 5I1DB 4HEME 5ILTH 3CX5K 1U95A 2HJKB 3WNOA 3EOBB 5E8EA 4DO5A 4GRLB 4X7SL 2W0FA 1BW8A 3SYOA 1A22B 3KPLB 5AAPA 4MCNA 3L1GA 5DHYA 4A7TA 5L6YL 3PGDA 4QF1A 3SQRA 5A16B 4UQ3A 3VI4B 3JYBA 3LD8C 1OZUA 1Q1JL 2JK5B 2XVBA 4HUMB 4J3OD 4OLUH 4Y5VB 1XXDC 3H7BA 4K23L 4M02A 3TVMD 4POZD 4WUUD 5HBBA 5I1JH 1XIWC 2X0VA 3ES6B 2VE6B 2DWSA 4OR1A 1IM3D 2XA8H 4Z3TA 3BUIA 4RDQG 3GKZA 5CBEB 2KMWA 2XJLA 3VFRA 5JPMA 2AGJL 3BZFB 4MMYB 3T3PF 3ISWA 3CDCA 2A6IB 1KNOA 5I8KL 3RWGB 1XV8A 2AVFA 1U92A 5B8CC 3TLRA 5FK9B 1TJIL 3Q8CA 3LKPA 5E8DL 1JI1A 2APXA 5A2AA 3DVGA 3BCDA 3S0PA 2H6PA 3RHWK 3DTXB 1SXAA 1ZRUA 1VRSA 4G6KH 4BJLA 3D07A 2KH2B 3MDJA 2F68X 5DRXB 2B2XH 3WY2A 2JV6A 3U6XA 3MV9E 3BT0A 3GWJA 4Z77B 2J8UB 3NA9H 4JQVA 3LKSA 5DTFB 3RNQB 1WT5A 5L88H 3D2UD 1SPDA 4TRPL 3WD5L 1AR1B 3WHXB 3D4GA 3BMVA 4P2CG 4BUQA 4MVBC 3MROB 5HHVL 3FFDA 1GOHA 4N5UA 2E8ZA 5JLZA 3P2BA 2X9XA 3IPEA 1TJHH 4G8EA 4P23A 3SE8H 2CBMA 4U33A 4OIIL 3KPNB 4ZFGL 3BOVA 3SKMA 2DQTL 5E1GA 4EI5B 5JXED 4XMVA 4Z7VF 2ZX8A 2P24A 1H3GA 1CYXA 4UT9L 4HLZH 4WAFA 2DAVA 3NIGF 4XWGH 1MXGA 2JLPA 4LZKA 3VGGA 4PLKC 4PJ7E 1HHIB 1BFSA 3OKMA 1S7QB 3V6OC 5DD3L 4DUWA 1G1OA 4LASL 2VXQH 2OL3H 35C8H 3LSOA 3FTWA 1QP1A 3WFBL 3KLQA 4X9IA 5I9QC 5FV2A 2WBJC 5KSUA 4X83A 4BH8B 4DW2L 3CJJA 1HINH 1AKJA 5JORA 4MA1B 2HRPL 3FRPA 4RMWA 5C0JB 4KQ3H 4WF7A 1HDMA 4U6HA 2WXJA 4H25A 4J3BA 2QQLH 4PHXA 3ULVL 2ZQKA 4KI5E 3VVVA 1J86A 2F8OA 4EOWH 4M9OA 2RB8A 3CU7A 2JKNA 1A7PL 2Z31A 2RBLA 3E6HA 5EUKB 4PGJA 4MKMA 1CLVA 4CJ1A 2OTPA 5JZ7C 3QHZH 3HR6A 4TULH 5B38G 3IDJB 2RFXB 1P5UB 3L08A 3U6XS 2ZCHL 4EUPG 2FZ3A 5KSBB 4KMTL 2R0LH 5BQ7B 1VADA 3IMTA 4TLUA 1OK8A 4LEOA 5FYKU 1LQBC 1R46A 2H32H 3EYQC 5F9DC 5FYKE 4OV6F 4BSVA 1GL4B 4NOBA 4ZRGA 5IESL 2DI8A 2X2HA 1O9WA 2BOCA 3T6WA 4JO5A 4GBXA 4ZAKA 3L4TA 1GZPB 5BO1L 5DD1H 4KX8A 4AGOA 4B5EA 4DTGH 1SFHA 4UM9D 4L3AA 1MREH 2EZ0D 4N2OA 3OJDB 4L23A 1I9RL 1WZMA 3HUJF 2P26A 3NP4A 4IBQA 3RIAF 4Y5XA 2SODB 4FS0A 1J11A 2KZKA 2PTUA 3MYJB 1KN2L 4F7CB 3S7GA 4IM8A 4NZUL 2UX7A 2CAKA 3C08L 3UEZA 4YSRA 1LO2H 1CFQB 3L95A 4H8HA 1WWCA 2HFGL 2UZYA 2WZ5A 4PY8J 5JIKA 4NHCL 4FA8A 1CU4H 5C0CB 4P4KD 3SKJL 4BK5A 3PWPB 5I82A 4M7KH 3FOLB 2YBRA 5MEOA 4JFOB 1UJTA 4LCYB 3ZTNL 4NQQA 4PV9B 4BRJA 5B3JE 5GXBB 3K6SB 2XN0A 3EJPA 3HBPA 4IBTA 3B4NA 2AABH 4P9HH 3VACA 4DP0X 2F5BH 4J8QA 5D8JH 2ZYSA 4Y9GA 3TO4C 1JYNA 2KDYA 3FDWA 3ZSSA 4BA8A 1Q8MA 1EH9A 1FFPB 3LXBA 1ZPUA 1KTDB 2J25A 2YIHA 2VO5A 4DKDC 2R23B 1NJ9A 4FP8H 2YEZA 5EC1B 3VGFA 1DUZB 3LEVH 4ZPVB 5BRZE 3MUZ1 2A6DA 3MLZH 2ZKWA 2VN5A 3L7EA 3QR0A 3KWVA 3REVA 1BG1A 3WN5C 3WTWA 1J5CA 4OGYH 1GW6A 1QEXA 1RFDL 1BZ9A 2EIKB 3IDGB 2UWEA 4I1RA 1FAIL 1JK8B 4IOIB 4Z7QB 4AYFA 4FLOA 4IRSC 1ECZA 5DQ9A 3LD8B 2CM5A 2AITA 1JK9B 2P5WE 5HHXL 3SBWC 4JHVA 1BOYA 4TSBH 3IGUA 3GSVB 4ZW6A 3HCVB 4TKWA 1XIWB 5GGSB 2CRIA 4Y1AA 4HJTA 1CD0A 2UXTA 1CL7I 3FTXA 4UZGA 4CU8A 2CK2A 1TJGH 5DFVC 4XPFL 3L4ZA 4IOSD 3S8GB 2FX7L 1JNJA 4BIKA 3CX5J 2B7DT 4L8DB 1KUMA 2FSDA 4BKTC 3PQYA 4JQIL 3IRPX 5DD5L 1OT1A 1JZGA 3FK3A 3GSWB 2OQJB 3O6ML 5KVGH 3L81A 3IAQA 2QKIC 3UERA 2DD8L 2R56H 3U4BH 2ZWNA 3UTZB 3SDDB 1CBVL 2VMEA 2IGTA 5CNHA 3BVNA 4F8NA 1M6UA 2FX9H 2AEWA 4GIAA 3ARYA 4CA4A 1A7NH 2EXWD 3OTTA 4Y16C 3GMLB 1Y0LA 1WHPA 4JHWH 5CJ5A 1JVOA 2CKBA 3S37H 1YNTF 2OJEB 5BV7C 3FU9A 1J1OL 2P8LB 2DICA 2CHZA 1A4AA 3LHPL 3OGCB 2O4EA 4P3DA 1NBZA 4HGWB 3OKLA 2BNRB 3BPOC 3HZMB 2O5ZH 3QCUL 3O4LB 1UD3A 4MNQA 4HHGA 1JDAA 3Q6GL 4YHNA 2K8MA 4HWUA 2BFGA 1I1YB 4E5XA 2WVVA 4DFIA 1F5WA 1T22A 1YY9D 1WTLA 2Y7QA 4RRPA 2IH1A 4ODUB 5L8KB 3W9DA 2WXMA 1Q9LA 2MQCA 3FONB 4EKJA 5AOZA 1XD1A 1DQLH 4Z5RA 3FO0L 3QFJD 4FNLL 5ELIA 4FZ8H 4Z3JA 3F05A 1EGJH 3KPQB 1IC7H 1L0YA 3IMVA 1WV7T 3APDA 3BJLA 5BS0E 2G2RB 3HS0A 4QOKB 3N85H 3AM8A 4FFYH 1JPFB 3B2VH 1FIEA 3MXWH 2C9RA 3VXUE 1BLIA 2UY7B 2XPGA 4NUMA 5HSFA 1CT8B 3FU8A 3QJQB 2WBJB 2W91A 3L17A 3BD3A 3P30H 1SM3L 4M7LH 4WTWA 4EN3D 2AKRB 1MF2H 1IQWL 2VLJA 1ADWA 1H3UA 2X4QB 1G5AA 1IGIH 4DGVH 2VDMH 4PJFA 5D1ZA 3L45A 5MHSD 4TQPA 4WI0A 1LEGB 1DBML 4RH4A 4QWWD 1QKZL 4G1EB 5JW4N 4G11A 3K81A 1G1CA 4QHLA 1IZKA 5CD5C 4KTDH 1K5NA 2AEPH 4CRPA 1QRKA 2BY2A 2ZKMX 4ZQTA 4QT5A 4K07A 4K7FA 4D8PA 5KBLA 1X5ZA 4ECNA 5I18L 1RZ8A 1TZGL 1RULH 3GRWH 4ZMYA 3PFQA 2J2ZA 4HCFA 2DJ4A 2YN5A 3TEUA 1OTTC 5D2LA 5IJVB 3N91A 4PYGA 4K5LA 3SB3A 3VH8G 3H4FA 1SDAB 1KV7A