2BW4A

Atomic resolution structure of resting state of the achromobacter cycloclastes cu nitrite reductase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
334
structure length
334
Chain Sequence
VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of Resting-State, Substrate- and Product-Complexed Cu-Nitrite Reductase Provide Insight Into Catalytic Mechanism
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 89
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bw4A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bw4A02
3T6VA 4YVNA 2YAHA 5I6LA 3ABLB 4BXVA 3OMIB 3MBWB 5B1JA 2IDTA 3WG7B 3NJIA 3UADA 3ABGA 1SF5A 4YSRA 2MRYA 2DWSA 3SBQA 3X1FA 1ADWA 3UGEA 1AACA 4Q89A 1SDDB 2H5UA 1A8ZA 4E9QA 2AANA 2DYSB 1BQRA 3AG4B 3SBPA 1L9OA 5D4IA 3QQXA 1NPNA 4DP6X 2YARA 3QJSB 2FQDA 2DWTA 2XXFA 5AKRA 1KDIA 5B1AB 4KNUA 3GYRA 4YSDA 2PPFA 3H56A 2OJ1A 3D12B 3FSWA 5I6NA 1V10A 1JZEA 4KO9A 3EH5B 3AW5A 4RH4A 3ASOB 1XB3A 1EHKB 4BWTA 3GDCA 2YQBA 3NP4A 3OMAB 4DP8X 2J55A 3DIVA 1GY2A 1HFUA 3FQ1A 2N0MA 3TBBA 3HEIB 4G71B 1NIDA 2VSKB 2ZXWB 1SNRA 3CVDA 1NIBA 2XUWA 4HZ1A 4AI7A 1OCOB 2IH8A 2HX8A 3TASA 1FWXA 2E86A 2BP0B 2WO3B 1ETJA 2A3TA 2P80A 1OV8A 2XXGA 1T5KA 2I7SA 4E9WA 5E9NA 1OE2A 1JZJA 1W6LA 5D4JA 2VW4A 7PAZA 3WI9A 2BZCA 3FU7B 1PLCA 2IDUA 5I5MA 2GC7C 2HRHA 3MX0B 1R1CA 4GP8B 5I5IA 1GS7A 2PP7A 3C75A 1J9TA 1KCBA 2OV0A 4AZUA 5I28A 4DP9X 2YAEA 4ZK8A 2PPEA 2VW6A 3PAUA 3SBRA 1W6WA 3IEAA 3IBOA 2J57A 3ZDWA 3QPKA 4YSUA 2VMJA 5B1JC 4M3HA 2H47C 3NSCA 1UATA 4YL4A 2H3XC 4DPAX 1GYCA 1NTDA 1E5YA 4K9JA 2CCWA 2XV2A 4GP4B 3QJRB 2PP8A 1NDTA 4E9XA 1AG0A 4ENZA 3SQRA 4BDVB 2UXTA 1NINA 2FJSA 3FQ2A 1ASOA 3QJTB 1KCWA 1JVOA 4QLWA 2EILB 4DP5X 6PCYA 2WSDA 1AZCA 2FWLB 2P80D 2R7EB 2HX7A 4HALA 4UAHA 5I6PA 7PCYA 1RZPA 2VN3A 2IWKA 1SHXA 2YXWA 3X1EA 2XLLA 2XU9A 3WNJA 2BWDA 1JZIA 3OD3A 3S3DB 1BYPA 1A4CA 2IDFA 1M57B 3X1BA 2HLEB 4F2EA 2BP8B 4A2FA 4A2EA 2Q5BA 4HAKA 2DV6A 2AFNA 2PCYA 3EH3B 4A66A 2FQGA 4HIPA 4DP1X 2XV0A 4GYBA 2BO0A 1OF0A 1KYAA 1JXDA 3OM3B 1L9PA 2IH9A 3V9EA 2XVBA 1TEGA 1E65A 2YXVA 2QPEB 1PZCA 5I26A 4N8UA 4CSZA 2CAKA 2UXFA 2CUAA 1JZHA 4UANA 1CURA 3OMNB 1ZV2A 1SJMA 3N2JA 1GS8A 4HHGA 2W8CA 2QDVA 4G7QB 2PLTA 4KOBA 2YAQA 4L0PB 1ET8A 1ZIAA 4P5SA 1GY1A 3NP3A 4G70B 1JOIA 3L45A 2PPDA 3NYKA 4HCFA 1FFTB 1EZLA 2VM3A 5B7MA 1OE3A 2UX7A 5B1KA 1NIFA 1V55B 3FPYA 5TK4A 2IDSA 1J9RA 3PAVA 4YSSA 1AR1B 1E5ZA 4G7SB 1AZBA 1ASPA 1WA0X 1AAJA 2AZAA 3NT0A 1NPJA 4BK5C 2IDQA 1AOZA 4CSPA 2I85A 1XMEB 5B7FA 1M56B 4GXFA 1BQ5A 4FA7B 5I6MA 2GB2A 1AIZA 3NSYA 3PAZA 3QJUB 4E9SA 1M9WA 5F7AA 1J9SA 2FT6A 2UXVA 2IWEA 3HB3B 3ERXA 4JHVA 4DP2X 3BVDB 1QLEB 3FQYA 2XWZA 1AS6A 1SFDA 2FNWA 1NWPA 1SHWA 4BWUA 1BYOA 4QKTA 4PAZA 3FYEB 3WKQA 4AKQA 3NJFA 1F56A 2PP9A 4AX3A 4E9YA 1N70A 1JERA 3DTUB 1PNCA 1RKRA 1L9SA 2BHFA 2CALA 4KO6A 3IE9A 5AZUA 1TKWA 2HX9A 1AZRA 4YVUA 4A67A 5TK2A 4G7RB 5A7EA 4KNTA 1FA4A 3FYIB 4E9TA 3ZBMA 3NJLA 2VSMB 1DYZA 5I5JA 4GP5B 4FAAB 2B3IA 3PCYA 1QHQA 2VW7A 3ABMB 4DP7X 2RACA 1PNDA 2FT7A 2TSAA 1ZIBA 1AANA 4F2FA 1HAWA 4YSOA 2PPAA 4X4KA 3NSDA 3AG3B 3CDZA 2Y69B 5B1BB 5F7BA 1BEXA 2GC4C 3ZX1A 3N55A 2YAMA 2PCFA 1JZGA 1YLBB 3QJVB 2W88A 1KBVA 3RYMA 1ET7A 2UXGA 6PAZA 1IC0A 4A2GA 1ILSA 4BDVA 2XX0A 3IN2A 3ZIYA 3V9CA 1PLBA 3CZUB 3H4FA 3FSAA 2ZWNA 1WS8A 4HCIA 3H4HA 1IUZA 1J5CA 3UAEA 2AZUA 2CBPA 2FTAA 3G5WA 1GSKA 3WKPA 1OE1A 3S8GB 1JXGA 1NIEA 1KDJA 4KOCA 1NWOA 2ZOOA 1CYWA 5PCYA 4Q8BA 3T9WA 1ZDSA 3ASNB 3WNIA 9PCYA 1PZAA 1AZNA 1JZFA 1J9QA 1BAWA 1A4BA 5B3SB 1X9RA 1XB6A 2Y1AA 3OQRA 5LDUA 3FU9A 1AQ8A 2BWIA 1IKOP 1WA1X 3S3CB 4F7KA 4YSQA 2JXMA 3EH4B 3FSVA 1ZDQA 2IAAC 1NZRA 5I6KA 4G72B 2TSBA 3PXLA 1CYXA 3CVBA 5FC9A 2QT6A 2MTAA 1XB8A 3NJJA 4M4RB 3EHBB 4YSCA 3AY2A 3PPSA 1L9RA 1MDAA 2DY2A 4E9VA 4W1TA 3FU8A 1RZQA 4YSAA 3NJNA 1AS7A 1WA2X 1ID2A 4KO5A 4TXVB 1OCRB 2X87A 5D4HA 2NRDA 2J5WA 1IBZA 1L9QA 1MG2C 2PPCA 3DKHA 1L9TA 1TEFA 2XYBA 4DP0X 1E67A 1ILUA 3NJGA 1BQKA 1MZZA 2EIMB 1KV7A 2QDWA 1AZUA 2BZ7A 2BW5A 2R7EA 3CVCA 1JXFA 2XV3A 1NIAA 2GI0A 1JVLA 4HHWA 4E9RA 1TU2A 3AZUA 3TU6A 1KGYE 1BXAA 5IY5B 4NERA 1AG6A 1PCSA 4NB7A 4DPBX 4UF7C 3X1NA 1PMYA 3U25A 2BP8A 1DZ0A 1MZYA 2J56A 5ANHA 2JKWA 2GBAA 1PLAA 1X9UA 1RCYA 2BW4A 3FS9A 3UAAA 2ZONA 4PCYA 2HXAA 3T6ZA 3CDZB 1QNIA 3JTBA 1A3ZA 4A2HA 1SF3A 2UX6A 4YSPA 3NJKA 3TA4D 3UACA 4KO7A 2CJ3A 3S3BB 3EF4A 1OCCB 2FQEA 1A65A 1J5DA 3T71A 5EHFA 3GXUB 3X1GA 4DP4X 5I6OA 2HZHA 3AG1B 8PAZA 3S8FB 1PY0A 2EINB 3JT2A 1VLXA 1OOWA 1B3IA 1WS7A 4N4YB 1OCZB 1W8EA 3X2QB 3ABKB 1E30A 3TBCA 2YAPA 2YAFA 2DYRB 5B7EA 3FU7A 3WIAA 5AFAA 4GY4A 2Q9OA 2B08A 2EIKB 2XX1A 3AG2B 3FT0A 1ZPUA 4WKXA 3PLYA 1I53A 4MFHA 4AKPA 3BQVA 1WAEA 1IBYA 2IWFA 1SFHA 4A68A 1PAZA 2HRGA 2YAOA 3CG8A 3FSZA 2X88A 1ET5A 4P5RA 2GIMA 1CC3A 1PF3A 1HAUA 4BWWA 2AVFA 4HCGA 1AS8A 4YSTA 1GW0A 2EIJB 1BXUA 3KW7A 1NICA 1GR7A 4WTQA 2I7OA 3NJHA 4JKNA 4KNSA 4A2DA 4NAJA 1SDDA 1CUOA 2QPDB 1A4AA 3FPXA 2FT8A 4W9ZA 2WO2B 4BXSV 3NSFA 2GHZA 1GS6X 3IN0A 4YSEA 1PZBA 5PAZA 1KBWA 4EF3A 2JFCA 1BXVA 2OCCB 1ASQA 2GSMB 3T6XA 1V54B 3T6WA 2VM4A 4DPCX 1MG3C 3NJMA 2BP0A 3UABA 1URIA 4AKOA 3QJQB 2FQFA 4JHUA 1N68A 3KW8A 2LLNA
chains in the Genus database with same CATH superfamily
4PS8A 2PTVA 1JGLL 1G43A 4Z7NB 4A63A 3TPUA 2EH8H 4ATWA 3ZSSA 5KVEH 5ESAA 2BNRE 3H9SE 4I3SH 3TEXA 3TXAA 4ALAH 1MFDL 5LGJA 4NFBA 2C1PB 2ID5A 1JUFB 2B3RA 1DSFH 2BXYA 2GHWB 2B0SL 5CZKA 4YHPA 5F7YC 1KT2B 5FOJA 1JRHI 4LGSB 4YHKL 4XVTH 3OB0H 3RUGA 4Q7DA 5IB5A 3WNNA 4ZSOA 3T4AA 1EAJA 4KNUA 4F37F 3H1ZA 1IKNC 2DZEA 3BGFB 3QEUB 3EH5B 3O2VH 4W6XB 1QYGH 3QNXA 1MFAL 1KN2L 1EHKB 1UXSA 3D48R 2QADC 5D93B 1XCTA 2IVFC 5ADOL 2ZKMX 3BPCB 4MMZC 1XCXA 1SNRA 1F3DH 2G9KA 3BUQA 1RI8A 1OCOB 3DHPA 1CT8B 2CA4A 3TASA 3PWLB 4N2KA 5C0ND 2Y06L 3AREB 5HDQL 3DO4A 4W70A 1G6RH 4I1RA 2XXGA 2H2SD 2CE6A 2PWFA 2FJHA 1G5GA 3B9DA 3I6KA 3UMNA 1TVBB 3LIZA 5HHQA 3WI9A 1LO0H 1T21B 1YMMA 4KROB 4N0UB 1YEKH 4JDZB 3N40P 1BZQK 3GSVA 1R1CA 1NAMB 1PEZA 2JJSC 3GF8A 2ENQA 4N5ED 1DO5A 1ZKAA 3MOBL 4PRPE 1SYVB 1T2QH 3ALXA 3ULVC 4GW1B 4G6JL 4QRAA 2OV0A 4TUKH 15C8L 4TNEA 2X4NB 3JV5A 2AKRA 4PRIA 1CXFA 1HEJC 5C0EB 4C47A 3V8OA 4EZKA 5TDPA 1I7TB 1DUYB 3KYNA 1H5BB 2YMOA 3K1DA 4TUJA 5F9JA 1MW2A 3IBOA 3CHPA 1FZJB 2W81C 3SGKA 2CHDA 2D03H 1RPQA 3MA7B 5TH2A 5B3JE 1UT1A 1KNOB 3PHOB 5ADPL 2EDOA 1UFGA 5E9DB 2NY4D 1Z5HA 3FO2B 2IAND 3T4YA 4ZUVA 5TPWL 3GBNL 2Y7QB 2HFEB 4X6CE 4XBGA 4X4YA 1MW0A 4UIMA 4FXGB 4BZ1H 3SBWC 1U8OA 4KJYB 2UXTA 4RISL 3F7RA 1IZKA 2ICCA 4O02H 3GHPA 3H9HB 5FF6A 5EEVA 4EO5A 2WP3O 3L54A 1A4KA 4G6FD 1EJ6A 1QKZH 4L4VA 2F15A 3KPSB 4WSJA 5FB8B 3QIBD 2PETA 3DJRA 3V4VA 1QFOA 3BVNB 4MX7A 4TS6A 1NCCH 5IOKA 4NJAH 2V8LA 3FFCB 2HLEB 4FP8H 2JB5H 3EOTL 1IC5H 1OGTA 4PJ7E 3KHQA 2AQTA 2K7PA 5CCJA 1IGJA 2FQGA 2TRHA 5CINL 4DP1X 4XPHH 2EDBA 1NL0H 2F5AL 3G08B 5KVGL 4R7NB 4KFZC 1JCVA 4M1CC 4ZX5A 3L5HA 2BC4A 4KMQA 5GS1C 1MREH 4TLSA 1QSFD 2APXA 5D70H 3MGOA 4P5MB 5AVYB 3VXTB 3D4YA 2UYLA 4OJEH 5LXVA 3NUKA 3VG0H 1NCBL 4EN3C 3CLFL 4YWGH 1U8MA 3L5JA 1DN0A 4GO6B 2FUQA 1OP5K 2HFEA 3IJEB 5AG8A 1LEIB 4KY1H 2V7NB 3PL6C 3PDDA 3SOBH 3CXHK 5KBKA 2FO4B 2OTWB 3ESVF 3GLDA 4HQQH 4LIQH 4L8SA 1F90L 1K5NA 1R3JB 2F1EA 5FW7A 4KRPD 4N0CC 1JGUL 5HYJE 5I5RA 3QQ3A 4WW1A 1YO4A 3UTTA 4Z7VA 8CGTA 1A66A 1PZ5B 3DETC 2OP4H 4ODSH 2X2IA 5EF1A 3OKDB 4HIXL 2AJ3A 4NDMB 2A6DB 4NQDB 4NRZA 4UMGA 3BIKA 2E6JA 1EFXD 1NMCB 1KT2A 1E5ZA 3PWPB 4NCC1 3QIUD 1ZLVH 5ACZA 2UZYB 5GJSL 4UQBA 1AAJA 5ICYA 1WTLA 3A47A 1R0AL 1D5RA 3HR6A 2V33A 3QAZB 1FQ9C 1JNHA 4H2AA 5CILH 3VGDA 3R4DA 3K81A 1P5VB 1GSMA 3QORC 1INDH 1BQ5A 5EG6C 3ZDZF 2YBGA 4Y4FB 4U05A 4YOKA 1RFDH 2Z7UA 2AEOA 2UXVA 4PD4K 2EDQA 4JHVA 5HYSG 1ITCA 5CP7A 1FE8H 3V6BR 3ARBD 5AAWA 3KXFA 4FRWA 2A74A 4PRAA 5AW2B 5CJBA 2YEZB 4OD1H 4FQQA 3ZR5A 2CKNA 3DX7A 3HG5A 4JVWA 4WKZB 2EIEA 5ITFB 1L9SA 1J12A 2VMCA 1MHEB 4EDXA 4KVNL 1YPZA 3LHAA 4YVUA 5A6MA 3X3GH 5LG1A 2EE0A 1JG9A 3C60C 3SDYL 5I18H 2C26A 1OT4A 1B3JA 2V9UA 3RX9A 2XY2A 3UTPD 3FB6A 4XI5D 1BJ8A 3PCYA 1LK2A 3KPSA 5DO8A 2NY2C 3O3EA 4WNJA 5C0CA 1HN1A 1Z0NA 1OSZA 2N59A 1PD6A 4M3KB 4R8WL 1TYJA 4R26H 3KLAA 4X6EB 4AE1A 4S10A 2CO7B 5GXBB 5BZWB 5C3LD 1SBSL 5EBWA 3QHTC 1KGXA 2Y7QA 4OFVA 5C0BD 2CKBH 5I16A 2VLJE 5D6DC 4FLQA 1XR9A 4E9LA 4P9ML 4PD4J 2VXQH 3EHBC 5GRVL 1KYOJ 3B9EA 3IN2A 3C9NB 4I8DA 4LPTA 4BUGA 2NCEA 4PP2A 2J1XA 1RK0B 4HCIA 1M7XA 3SYQA 4JQIH 4I48A 5CJQH 3WLWC 4XMXA 3RVUC 2YRZA 3NESA 4FHKA 3FMGH 4PRBB 2IGFL 2VGLM 1S46A 4PJHB 3RVTD 3CIQA 4P05A 3ZTNH 1OE1A 1IO4C 5H4ZA 1HH6B 1A47A 4IBZA 3I9IA 1D6EA 4JJ5B 2A1WH 5DZ9A 5F88A 1HOEA 2GBVA 3GBNH 5AZ2L 2DW5A 4Q8BA 3B8YA 3OQ3B 1S3KL 1JGUH 3BVUA 1FIGH 4R96A 1J5HA 3QK0A 3UDWA 3KPSD 1BVKA 1NCWL 3ARBB 2WLHA 4U6VL 4ODSL 2GJJA 3SPHA 3CFBA 3T3PE 3VFGL 3V0HA 3MCLL 3N1PC 2ZF8A 3BWZA 2EUZA 5EUOE 4UNVA 4JZJA 2Q8AH 1U6AL 3X17A 5EWIL 1WFIA 2C1OB 2E59A 4YSQA 5J9PB 1BZDA 3GZOA 3QJXA 4KU1A 3U6XS 4ZX6A 3MACH 4QI3A 5DRXB 1J8SA 2XA8L 1H5BA 2EIBA 1MQKH 1E9PB 4RAHA 4XNZB 4BQBA 3JSSA 1L0PA 1S7WA 2DTSA 3RWCA 4POYA 4OTXL 4ZPTB 1OF2A 2WN3A 3PP3H 4AEHL 2DY2A 1B4LA 4NQDD 1NFDA 1MFCL 1TZHB 4KO5A 4MJ5B 2Z31B 4JO3H 1KC5L 1G7MB 3EOBB 1N59A 4L1HA 3TLRA 5C70A 4YDIL 3QWNA 3SKNB 3ARXA 4ODTL 1L9QA 3H9SB 2QR0A 3MZTA 2L04A 5DJYB 1IAII 1A8JH 3BDBA 3AJ7A 2NXZD 3K4DA 3HLKA 4HIQA 5D1XE 3CUPA 3HHSB 4GUOA 3HZMB 4UTBA 1HHHA 1BIIA 2X05A 3QFGA 4PJGE 3T0EC 4OGXH 2IPKB 1U30A 2R0ZH 2TAAA 5T3ZD 4ORGB 3FUHA 3TIDA 3OKKA 4NM8H 1S7SB 2MIZA 1GKEA 5AW0B 2X53A 3CSPA 4JY4A 1DQJB 5DD5L 1RCYA 4PI2A 1PSKL 3QAQA 2OL3H 3KCPA 2Z34A 1WGOA 2C8NA 1QKZL 4HMDA 4K3JL 2A74B 2FH8A 4X5PA 2X6VA 5IB5B 4XOEA 4PVMA 4ADJA 4FZEL 3TVMB 3ZE2E 2VITA 5JOPD 3S35X 1NLDL 2XXCB 3UBXB 2O61A 1VADA 4KMTL 1F0LA 3GI9L 2HG5B 3DRQA 3MRRA 2J4WL 1BBDH 3CFEB 3S8FB 2XDHA 5EBWB 3EZ8A 1VGEL 4O5LL 5DHXB 4YHOL 3ABKB 2MFNA 5IHZB 4JGNA 2BHYA 4GG6F 3CHSA 4M93C 4YPGA 1Z9PA 5I8KL 4WWOA 3Q44A 3V0IA 3PHSA 1RZJL 2X5PA 1NAKL 1U3HD 4NQCE 4R0LC 4OI7A 5JXEC 5ALBH 2QPSA 1I3GL 4NSKA 4OCSL 4Y2DB 5F0PB 3W56A 1NGPH 1LE5B 2FO1A 4AZ8A 5C0GA 3TCTA 1SFHA 2ADJA 5DJXB 1VDGA 4DOHE 2Y1VA 3FSZA 3CZSA 5E9DE 3V55A 1KV3A 4QHUB 1WEJH 2GIMA 2Z7YA 3QEQE 1CC3A 3RIKA 1I8IB 3GXFA 1WZMA 1AS8A 3BE1H 1GW0A 2FL5A 2L8AA 2WN2A 3HE7D 4FX5A 5C71A 4MVBD 1YEIH 5HGDB 4ZD3L 5L6YH 4OLVL 5DQDL 4LKXA 4LRNL 4QOKD 1W15A 4WWNA 1AJ7H 3FPXA 3FOMB 3CLEH 1CICD 1JFQL 3KXFB 5F9OH 1AHWA 3GSXB 4WU7A 2OJZL 3HB3C 4KZEL 5EC2A 1N59B 3NEXA 4H8PA 4CU7A 1A9EA 4P2OA 3MV9E 2Z4QA 3Q2CA 2CLRB 3P3TA 4I0PC 5FCUH 3TO4B 4NQSA 4B9KC 5HPMA 3DVIA 3CU1A 2X2UA 2VN6A 3P0YL 1NCNA 1N0XL 3IMRA 3RP1A 4FKEA 5HHXH 2YK1H 1ZHLA 3E0GA 4F7TA 1RU9L 1YNTF 4IOSA 4JDVB 4HWUA 4M7JH 3IE4A 3PRZA 1BEYH 4HKXB 2CK0L 4XMKH 5B1JA 2P47B 4O2FB 4ZOAA 1I4FA 3JZYA 4ZS6C 3HE7A 2GBTA 2MRYA 3L3DA 4X6DF 4YIQA 2XPGB 3O6FD 3UTZB 1D9KB 5D7IB 1BA9A 3FUJA 2X44D 4OD3L 3LKPB 5CLXA 1EX0A 1DCEA 1A6PA 2YMTA 1N3NB 1SXAA 3GS0A 4XMVA 4ONHA 3FB8A 3QI9C 2WXRA 4HFWA 2YBRB 1EEYA 3RU8H 1OOAA 3VTMA 1X5JA 1SEQL 2MQ0A 4YHIB 3E9TA 4HZLB 2VO8A 3AW5A 1FYHB 1OQXA 3BH9B 2RTTA 1PDKA 5FGCE 3N0PB 1G7IA 1YYCA 1KTCA 3B2MA 4MA8H 3QB7C 3FBQA 3HEIB 3WGUB 4JN2A 1MJUH 1HEZB 1O7DE 2IADA 2Y7OA 3LRLA 4NQEE 5BMFH 5CP3H 2WTRB 3T1FA 3B2UC 3TBWB 1T0NA 4DO4A 5EO1B 3TWYA 2Z8SA 4JDTH 3GKWL 3DETD 3LRGA 4JDZA 4XC3L 5CCKL 2C9XA 4CDGC 1EO8H 1MCHA 1QBBA 3L5XL 2Z9TA 2YPVA 4J3OG 2G3XA 4E9WA 1AQKL 2AV7B 3QUKB 1KTKE 4Y16B 4XNQA 1MH5B 2KT6A 7PAZA 4F8TA 4NRZB 2BZCA 5EO9A 3O2VL 4OQTL 4Z9KB 3KVPA 3AREA 1L6ZA 1WITA 1VESA 3N3EA 1RJYB 5ACZB 4GKSB 3PWPE 4L4VB 4BGDA 3RURA 1EAOA 3INOA 4RGMB 1LO3L 4YXKH 3E38A 4MNGA 1AGEB 1U3JA 1KCSL 1I1AA 4CVXB 1GYWA 4Z7IA 3LRKA 4L1BA 2PO6A 5E2TL 4DF9A 3GLEA 3MCKB 5I1IH 4NQXB 3P73B 2F54D 3V4LA 4ODWA 3UZQB 4ZUVB 4O51B 1DL7H 3V5KB 4WI6A 1IC4H 1CE6B 4QRPD 4U3XA 1ORQA 4QRBA 2BINA 2VMJA 3MXVL 2HRPH 5F93C 4AITA 1DBAH 4HJ0C 5MI0B 3LPWA 2VABA 4DPAX 1MCCA 3LB6C 4NPKA 3LD8B 1Y7VA 1G87A 4Z7UF 3L08A 3DUUA 1KLFB 2ESVA 4AIZA 4WKZA 3CBKB 2ZOLB 2XA8H 1EZUA 4PRID 3QQ4A 4BDVB 1CMOA 4EBQH 2VLJA 1C12A 3FQ2A 4BZ2H 5AOZA 3H2PA 1JSYA 3C5JB 3FT2A 4CA4A 3O8XC 3P77B 3SCMC 4UIMB 2Z0BA 1RZPA 3EYUH 1NL0L 2F5AH 2M2DA 3UYPA 3N0AA 5SWZB 4YBQD 2YLKA 1OGTB 15C8H 2WBJA 2ZKHL 5EMYA 1CZ8H 4L23A 3G5XA 2VL5A 4R90L 1H3WM 4E41B 2MPAL 4M5ZL 1MPAL 2FEEL 3NQKA 3S5YA 4A2FA 2CD0A 5E7BA 1CN4A 5GGRB 4YK4B 3H3BC 2FWSA 5E6IC 2A6JA 4RDQG 2MNUA 4OGQC 1QSFE 4DUWA 3MUZ1 2DKMA 2ZUQB 2RFXB 3NCJL 4RETB 3V52H 4RFNC 4ZSOE 1DP0A 5EIIA 1J48A 3P54A 2ESVD 4NI6A 2YEQA 4L9LB 4XN9A 5JHDA 4LSUH 2Y6TE 4MD0B 5JR1H 3GK8L 2Z31D 1YZZA 3QHZH 1XBRA 1I1RA 4YS4A 4U6TA 3RTQA 2QDVA 1SLXA 4QPEA 2EH7H 4EIUA 5I30L 3HVNA 4R96B 4LSTH 4PWHA 3L5WA 2ZXGA 5AVRB 4GG6B 4W9DC 1YMMD 1AKJB 4KKCC 4B7IA 4Y2OA 3U48A 4UV4H 4HK0A 3BHBA 2A83A 3VH8B 2BVUA 4ZUWA 5DJAA 4Y5XB 4PVLA 3VXPA 1QD0A 4JPKL 5ADPH 2Z6FA 4PEEA 5EIVA 3QULB 4GW4A 5E6ZA 1XMEB 1S7XB 3BWAA 3G5ZA 3U36B 3C2SA 1HOCA 2XJLA 1G7PB 5AWNH 1J18A 3PFQA 3HUJA 2IAMB 3D0VB 4OI9A 2XG5B 3TS8A 3BZEA 1SHWA 4PV9B 4N26A 1OAKH 4NLHA 1LEKB 4P46A 4BELD 2VDOL 2XA3A 3I50L 2ZOTA 4Z76A 1JK8B 1MY7A 1SJHA 3MV11 3WL9B 3TL5A 1LTXA 1EO7A 1IJ9A 3FCTA 4WV1A 2X4OB 1TQTA 1MAMH 5AZUA 3WFDH 5IJCC 2AK4D 4GQZA 3T09A 4PYGA 1ZWIA 1UENA 1FA4A 3J07A 4C56E 4GINA 2NW2B 5DI8B 3SDDC 5T1MB 3VXSD 4TTDD 2F6AA 3ZHLA 5JORB 1FUNA 2VZSA 4MJHA 3L5XH 3NCXA 4M48H 2VXUL 3AXIA 5ISZA 1I82A 3KLKA 5I8OL 1NBYA 4JFTA 4OM0H 5IJKA 3ILQC 1X5LA 4L8DA 12E8H 3DDGA 4IRJC 4P59L 2VDNB 4IM8A 1M2VA 5CJQL 1NCGA 1RH8A 2R2HA 2WYIA 2Y69B 3WS6C 3FU0A 4A7UA 3DBXB 4DGWC 5E8DL 3KWWA 4L48A 4H8VA 4N8CL 3DRTB 4EDWH 1DBBL 2A77L 4YMPA 4P2QD 5IIEA 3Q13A 4N0FB 1IAOA 1A3LL 2AXFB 4KKLD 4DTGL 3R0MA 2IG2H 4TSCL 3QIWC 2ITDA 4DW2H 3ARDC 4GFXA 4KKNA 1OM3L 1SZNA 4K07A 2YFOA 5EIIB 5FV1L 5HJ3B 1WS8A 2BNRD 4AMXA 1G1CA 2XSKA 2E47A 4KUZL 4ERSH 1KCVH 2E56A 4OD2B 4PJEB 3IPFA 4X6BB 1KTDB 1UT2A 1Y1UA 3QUYC 5L2KB 5DD1H 3S8GB 1TZAA 1WC7A 1KDJA 4G5ZH 1N2RA 1Y0LA 2Y7LA 1CBJA 1DBMH 2UUDK 4XCFL 1BWWA 2KZBA 5D1ZC 1K72A 1U8LA 2HT4C 4J2QA 1JE6A 3KPPA 4NPJA 3WNIA 2RCSH 5TE6L 3CHOA 3EF7A 2GJ6A 1JF1A 1J9QA 1RAMA 2WQXA 1HX0A 1A7QH 1JWUB 1UACH 1KUMA 1FG9C 2UVEA 3OQRA 4X9BA 4ZUWB 5FWRA 3E2HC 1IM3A 2VDNL 2W65B 3VXUD 4XVUD 4JZOB 4PG9A 3RWHA 2DL2A 3MRNB 5ESAB 2X4TB 2QQLH 3VM7A 3ZMRA 3RUGF 4IEFB 1VZIA 3BO8B 2HPOA 5ID1B 4AQOA 1K4DA 1UOLA 1KIPB 4Y0GA 1PG7X 2A74C 2JXMB 5BCAA 3HB3D 4AYFB 3FU8A 3ENEA 1RZQA 4R7DB 3ECQA 1IAIM 2IGFH 1A7NH 2QVTA 2Z92B 4KH9A 4G2AA 1BYNA 3GSWA 1GH7A 5B39G 3QEGH 4XN5A 1IBFA 4J3OD 4KRPC 4N0CD 2WVVB 3I50H 4G1MB 3IDGB 4ZMVA 5B38B 2XG5A 3VD9A 2BSBA 2F7RA 3BZFA 4BQ8A 4P46B 1XZWA 5GGTL 1C5DB 1NEZA 1YEDA 2YXMA 5T5NG 2HJLB 3PWJB 3RWDA 3LPFA 4LVNB 4MD4B 1ZLSL 3GEWB 2UV3A 1GZPB 1Q8MA 2VQTA 4E9RA 4FL4C 1TQCC 1KGYE 4TNGA 2BK8A 3NOIA 5DJZA 4UF7C 1XO8A 3U7AA 3X1NA 4BIKA 3IFOA 3RILA 4JLRB 3MQIA 2NUTB 3NA4A 3FS9A 4KTDL 4LAQH 5HI5C 4YDKH 1M1SA 2A4ZA 3EYUL 1J10A 4XXDA 1E4KC 2EEBA 4LLYA 3KPQB 3HZ3A 1S8DA 2PTTA 2UX6A 4KJPC 1IKFH 4XPAL 3GSUA 1ZANH 3BXNA 1DDHB 2NYZA 5JIKA 4RDQF 4M4PA 1G7JA 3AUWB 1OCCB 3IGUA 2GITA 3O3UN 3QXAA 4KI1A 1BQUA 1U3NA 1PX3A 1XXDC 4OCSH 2J25A 4TNWF 3AG1B 4XAKD 1FIGL 3WTVA 3HBPA 1OOWA 3PV6A 3DX9B 3VFOB 1IJNA 2YSTA 3LS4H 4Z3HA 5JO5B 4FEIA 1XH3B 3R06B 1TYEB 4WHDA 5L9DH 4ERSL 1E7UA 1TSHA 4Y19D 5F7MC 1L0QA 5MERA 5AFAA 4GAYB 4RCAA 2P8PB 2Q9OA 1USQA 4JZJC 3BIBX 1V7NL 4PJ9B 3D2UB 1UZ8B 2ARJA 2CXGA 4S1RL 5DD0H 3IAGC 1F8TH 2OCJA 4ZAKC 2KZKA 3OXSA 5ECGA 1T6BX 5DRWB 5EO9B 1ZVNA 1F45A 2WKOF 4OI8A 1USZA 1QLFA 3EXLA 1CLZL 2NNRA 4ZPVB 1NBZA 2YWYA 3OWEA 1A7QL 3SHSA 5GZOA 4XC1L 3FUEA 5D1QC 3ULAB 3BN9D 3QARA 2QMKA 2ZOKB 4YIQB 2VLKD 2XTJB 2IQAA 5SWSD 4AOFA 2KUTA 2XKSA 5ALCH 5FM5M 1VF5C 4A7SA 5GRUL 1QABA 4X50A 4N6RA 1QNZH 3F64A 4Z7OF 4O2CB 5IUSA 2FGWH 4QXTB 2YPKB 1DUZA 1XD0A 1KGCD 3RIFK 2OMVB 1E6OL 4HMEA 1DBJL 3MGOB 4MQSB 4P5MA 4EF3A 5LG6A 2A6KB 4TSAH 2JFCA 2BIIA 2F61A 2HKHL 3LPOA 2L3BA 4IRZH 2GSMB 3L7EA 5E1HB 2YD5A 4U4BA 4WTWA 4I77H 3QG7H 1JHKL 3V0DA 3O3DB 4X9YA 4PJCF 2DDQH 3VFSB 3TT3L 2K4AA 5DK2A 4DKEH 5F7HA 1Q0EA 2DM2A 2ICWB 4I89A 3MLUH 4JDVA 2ZSWB 5EDXA 4KI5F 1G6RA 25C8L 5D1QE 4ODUA 1LXMA 3NACH 2H5UA 3HNVH 4FZ8L 4HKXA 4Q89A 5LCVH 1P53A 2OMTB 2AANA 1BQRA 3CLEL 1G1OA 2GCYA 5FM4A 3MDJA 1OP4A 4LGPB 4WWPA 1INQB 5D2NC 5DRZA 1QHOA 1NA8A 4HWBA 1HSAB 4QRRB 2H6PA 2WIMA 3P73A 5KVGH 1Q94B 5AOJA 4XX5A 1HKFA 1UD3A 4JDTL 2FSEB 3CZJA 1K5WA 1B4JL 4CVXA 3BZDA 4B3EA 5HBBA 1OB1A 2VLRE 4NKOB 3RHWF 3HZVA 1MRFH 2ZUUA 2RBLA 2YPVH 3IBEA 4TM9A 5I8OH 3O6FA 1HJBC 1IRAY 4ONGL 4Z78B 4Z95H 1NIBA 4HKBB 3GD1C 4WIQA 1HINL 2IMNA 3CFJB 1U3YA 4Y1AE 3QUYB 2Y6SC 1XL4A 3RVXD 3GJFH 1LO3H 4JFEB 4L3CA 3MFFB 3LEVL 4PREB 4EVNB 2Y7MA 2ICEC 4M7LT 5ALBL 5A16A 2EXSA 5IK3A 1OTTC 2BSEA 4DVBA 4DUXA 1S7UB 5IMKA 5HDWA 4JFUA 1OE2A 1G1YA 1RIHL 5D4JA 1JIBA 1FLTX 4GW1A 4PJGF 1T0NB 1CLCA 4L8CA 4UT6H 3GQFA 4GAYA 4OD3H 2ZNWA 5IW1A 3RPIB 3AM8C 5AZEH 1X44A 3LKOB 1N3NA 1QQDA 1ZXKA 4MA8L 5BVPL 3DO7A 2B77A 2PF6A 3S48A 3DI3B 4MJIE 5IV2B 2ZXEB 2DMBA 1NFKA 5C7XH 4PJ8B 2UWEA 3LNFA 4I0CC 1FCCA 4BHUA 3U2SB 3ME0A 2JCCF 4Y4HB 4ZG1A 4U0RC 1TJGH 2ZE0A 3WS3A 1PX8A 4APQB 2VW6A 4NJAL 4L4TE 2DQHH 2FBRA 1WFJA 1ZS2A 4C4KO 1RVFL 3QPKA 3WEXA 3WN5A 2NXYC 1TZHA 3MRGA 1SXNA 3PJSB 2H3NA 2MTPA 2XN9A 1UATA 4ZZKA 4QRQA 4AY0A 4GRMB 1NTDA 1MHPL 4G9DB 4J3OC 3VMPA 4XPFH 1GCYA 5ESQA 2P49B 2VDML 4CVZB 3P0YH 3L3GA 4X4XB 1I9IH 4JO2L 3VE0B 4FQCL 2J8UE 3QDGB 5H2BB 1C5DA 1NEZB 1DJGA 2V3DA 4QLWA 1O5PA 1U58A 3PU7A 4WI3A 2FWLB 2OX5A 3E3QE 2DWEA 1HH9A 3FFOA 5E51A 3NCJH 1S7QA 3BP6A 5IWLA 4PB0H 5L9DL 2AJVL 4O4YH 3UH8A 5D6DA 3PWNA 3L3HB 1WWCA 5C9JB 3Q8EA 5D1QB 7FABL 3TIDB 1EDHA 3BWSA 1RLWA 4X8CA 1WGVA 9CGTA 5DS8A 3GK8H 5AB1A 3VUAA 3KE0A 4YHZH 2BP8B 5BV7L 5DK2B 1B2WL 5GGTA 2IALA 4DT2A 5IQOA 5F8QC 2P8LB 5IMMA 3QG6B 3RU8L 5GJSH 3QIUC 4JQIA 4Y5XC 1GAFL 3V0EA 4YL9A 4MA3B 1KCLA 4WSKA 5HYIA 3VI4A 4XAWH 4WUUA 2YXVA 5T3XD 1NFDF 3QXAB 3W38A 3IETB 5C0CD 3I6LD 5A2AA 1U8PB 2H9GA 3CFEA 1EANA 3K46A 1P6FA 3MBXH 4CVUA 3IU4H 4IHBA 4YR6A 1CFNB 4G9FB 2JJWA 4XPHL 2ZG2A 5INCB 5E8EA 2BMKB 1ET8A 4P57A 4GKZB 3TVMC 1WC7B 4XPAH 3BIKB 1U3HC 5IQ9A 2XIDA 2JJSA 1FFNA 3VD4A 4Z7AA 2WWNA 1U8LB 4PJCE 4Z18A 3DHJA 3WFEL 5EA0H 3MJ8B 1KG0B 3L4VA 5GRVK 3ES6B 3OKNA 3WHXA 2VM3A 5HPMB 2OMUA 3VXME 2J3SA 3CFQA 2D2CC 2FAUA 4JFPA 4OB5H 1WE5A 1J9RA 3IM1A 4POZC 5G5DA 1A9BA 3C8KA 5GS0L 1NBZB 2Y3AA 2X9XA 3SYOA 2EE3A 1U8HA 3I3EA 4DFHA 3L1FA 5EUOB 1T5WB 2IPKA 1S7WB 3A6OA 1DBAL 2BFGA 3T0EB 4JW3A 1EEZA 3SPVB 5JOFA 4W4NA 1AOZA 3VMOA 3ZTCC 1T04B 4FMFA 4GXUM 2ESVE 4NP4L 2J8HA 2D0GA 1CWVA 5ICUA 4DEPB 3IRPX 2H8PB 5DRNA 5CZVH 2QPFA 1F58H 3QULA 4GW4B 3MV7B 5DTFA 4WEEA 1PBYA 5DJYA 4R8WH 2HKFL 2MHAB 5J6GB 3NCBB 4OIBA 1GTFA 3QUXC 1BAFH 1CFTB 1TQWA 4AQ8C 4NZUL 1YPZB 1F11A 2R0WH 4Q6YA 2HJKA 5D72L 3SGDH 2X09A 3LNEA 4FQIH 1UYWL 3CFTA 4YDLB 3KPNA 4DZBA 4FYQA 4H25B 4GG6A 3LPGA 1WCBB 1L9NA 3V0GA 4DERA 2HVKA 2WYZA 4QXGH 3J27A 4OFDA 3ECUA 2E9JA 1T1WB 2CDEA 1RK7A 3RPBA 3ZE2B 4NC1E 1SJHB 2CCLA 4C59B 4X9FA 1II4E 4LIQE 3IFLL 2IPUG 1A3RL 5C0CB 4PRIE 2AJ3B 3CDGA 3WIIL 5FDWB 2O6CA 4YZFE 4JG0L 5DJDA 5IW6A 3A67L 4MX7B 3ARFC 3LRSB 1VGKB 4LVHB 1N64H 1QHQA 2GSIB 2VW7A 3GLZA 5DLML 2H1PH 4KVNH 4L1DA 1ND0A 2RACA 4HDIA 5IEKA 5EDSA 1T7ZA 1QVOA 1ZIBA 1B2WH 4KUZH 4U3SA 1H8NA 4GEJA 5B1BB 1ADQA 4XN8A 3PUCA 5BVPH 1J88A 1JCKA 3BPOB 3FQUB 3W9DB 2DPKA 2GUYA 2QGDA 1BJMA 3BFOA 4MLIA 4WCYH 3N55A 4U1NB 2YAMA 4P3WA 1XF5A 3P9MA 5DRXA 1S9WB 3IF1B 2WBJC 1MLBA 1Y18A 2WXGA 3S9DB 3IS1X 2A7BA 4M62H 5HGAB 3VU1A 5CJ5A 1QO3A 2I5YL 2Z64C 1BBDL 5DHYA 3C5XA 3GJEA 2UY7B 4H26A 3CFUA 3NTCL 4HUVA 3N42B 4DSYA 5EORL 3IJEA 2VE6B 3SO3B 3U83A 3QYMA 5DA0B 3T1FB 4G8GA 1EFXA 4GO9A 4EDXB 3FHAA 3UCRA 3UC0H 2DAVA 2R29A 5L8KB 2XTJD 4W68A 3MROB 2CPCA 4UNIA 2XTJE 3HRPA 2KMWA 4HKJB 3ASNB 3QDMB 2CJUH 5EU4B 4HEMA 1H0DB 1AIFB 1U8NA 4Z7QF 4UIKL 1TENA 2A9CA 5IB4A 3HS0B 3W2DH 4PGEA 3FB6B 3G6AA 5B3SB 4PG2A 1ZT7B 5BV7C 2GJPA 3ARZA 3RX5A 5BVJA 3G6JA 4FL4B 4JE0A 3ZHDA 5C0JA 3LZFH 3ZRFC 1X5YA 3ARWA 1JF1B 1XGQB 2R0ZL 1V3JA 4HDIB 4IRJA 4G72B 4KDTC 4N22A 2D7TH 3MA9L 3IJYB 3TJHC 5K9OA 4OFIA 4WZ9A 3KPRA 4QIRA 4WUKH 5D7LA 4YSCA 1OP9A 1KJVA 2EO7A 4Z7OB 4OD2A 4X6BA 3BRFA 2VAAB 3Q1SH 3H7BB 4EI5D 4OT1H 1JYXA 1TJIL 3M6DA 1DEDA 5TFSL 4X7FC 2QV4A 1X5IA 5FUCE 1J1PH 1OTSD 1R5WA 2QSTA 4I7ZC 1BQLH 4OV5B 2ED7A 4ACTA 5BS0E 3WCYA 2WQ8A 4ZO9A 4P2RD 2Q2LA 2OTUB 4WFGD 5KVFL 2OSXA 3BUBA 2Y25A 3Q3GB 3QXTA 2JKIS 3TJEH 5FWQA 4YHYC 2VMFA 3GHEL 2WTRA 5FFOA 5CJXA 2B8OT 3FB7B 2WV3A 5CMAA 3ULSB 2XV3A 5CLTA 2AV1A 3OPZH 2J8UB 3IMUA 1HYRC 3O0LA 1G0YR 3T65B 5FUZL 4GS7B 1BXAA 5HHOA 4ZMXA 4E0RA 1KELH 4NERA 1PCSA 3S3SA 3INUL 1M1XA 1DZ0A 1XEUA 5ANHA 4RFEB 2WNWA 4FA6A 1MEXH 4EIZC 3RE0A 2F0CA 1JJUA 5C09A 1LQBC 2JKTM 4ABWA 4RX4A 2I27N 4UI2A 2WXLA 4P5KB 3QI9D 3PWUB 2BVPB 3QUZC 3ZDYF 2JLLA 3KPRB 1X7SA 5D7LB 1QLEH 1QFWM 1U8CB 3DECA 4MBRA 4FTVE 2JH2A 1MLBB 1Y18B 4Y2DC 1V7MH 5FLUA 4NUJA 3W11C 3PHAA 3D30A 5E9DD 5FUCC 1DE4A 3RWGB 1B3IA 3K71B 2HJLA 2PR9A 2QGEA 1B88A 4U3CA 2WQSA 5TH2B 4EKXA 5E8EB 3SPIA 3MMEB 3D85D 3HFMH 5H37G 3APFA 5HJDA 3HPLB 3VXMB 1KULA 1E0OB 1IAMA 5JPMB 4J39A 1XF3A 5HDBE 2PXYB 4NQCD 3O11A 3MJ8A 1A2YA 3O0RL 3B5TA 4M43H 5KBMA 1T21A 4N0UA 1MCWM 1QUPA 4AKPA 1WAEA 2AV1B 3ARVA 5T33H 4DPRA 4AWJC 2DBJA 4I5BA 4MDIA 2E9GA 1GOHA 4PMFA 1UM4L 4OZGB 4RZCB 2I9TB 1IGMH 2DQ6A 1E90A 4U1JB 2AHIA 1N4XH 3OGOE 1ACCA 1E3XA 1P7QA 4V2CB 3ASWA 2A9BA 4AVIA 3I6LE 4BWWA 1B0IA 1DQJA 2XQ0A 2ZCKH 3VGEA 1JPGB 2LV4A 4H5SA 3ALWA 4U6YA 1FN4B 1O6SB 1GR7A 3ARED 1VZHA 3WDIA 2OMXA 2CHZA 5C1MB 1U95A 2F74B 5E2VH 3GMNB 4FXGC 4PJBA 4RISH 4X99B 1W80A 4Z7WE 5IW3A 2PMZA 3AS1A 2FLBT 1MWAH 2AJYH 1H15A 3K1KC 2YD0A 5T1LA 3IN0A 3CQFA 3B9KC 3QUMA 4FGMA 4HIJB 1IC1A 2QZ5A 2YKLH 4YSEA 3SCMA 1R0AH 4R0LA 2F8OA 3VSTA 3AT0A 3QZPA 4HWNA 3QIBC 4X4YB 1R5WB 1TFHA 4DO6A 1HQ4B 5C86A 4Y19B 2NW3B 3EFDH 5I1EL 2IIJA 1LVEA 3NACL 1BVZA 4O2FA 4ORZC 3ZSTA 2HTKD 4GQQA 4LRNH 5JHBA 4B0MB 2NYYC 1CLZH 5CSZA 4U1LB 4CGTA 2NQDA 3KW8A 4I18A 1AVAA 3FTWA 5IESL 3L3JA 3U79A 1JV5B 3UADA 2CO6B 2IOMA 5AOKA 5D8JL 3GSVB 3CPLA 4U6XB 1EO8L 1I8KA 4U1HA 3N85L 4Y8AA 3O3AB 3NBNA 5ISZE 1WWAX 4E41E 2MPAH 3K6DA 2B20A 4M5ZH 2VTFA 1F1DA 2RR3A 2XI9A 1DQQB 1WPCA 1TPXC 1CL7H 2GT9A 3AT8A 4N90E 1PCXA 4LCWD 5DJAB 1J0JA 2YRLA 1CLYH 1MFEH 3EYOB 4G1EB 5B1AB 4LKXB 2ZXCA 4NZTH 5HGDA 2VMDA 3FSWA 4NX0A 4U0RB 5JUEH 1A3QA 4LIQL 4XOCA 3QDMD 5CIPA 1TZGL 2QPUA 3BUDA 4ZNCD 2V5SA 4XO9A 4EKJA 1UTDA 1ETZA 1IARB 3LX9A 1IILE 2AEWA 1WWBX 4H0HB 2WZ6A 2CHXA 3DSFL 1M3IA 4HZ1A 1OAQH 4L9LC 3H2QA 4OLZL 1TJHH 1JF5A 4OJAA 2HX8A 5FUOH 5IEHB 3GGWB 4NFCA 4NM4H 4X6CA 5DHMC 3V4PH 4Z7WB 1LD9A 4E2OA 5CUSH 3EGXB 4L8BB 3PP4H 5E9NA 1NJ9B 3S5LB 2NNAB 5EO0B 2D7OA 3AGVA 3O4OB 4WI4A 3P4NB 4HHAB 4EBQL 3QHFL 4OQTA 4L2LA 3V95A 1HH9B 3S98A 3IKKA 3U4BL 5EZPA 1YY9C 2Y5TA 4UINH 4N5EC 3U46B 3WKYA 4F9LC 3RGVD 1CGSL 2ZP8A 4K5NA 3VFNB 5TE7H 4AEEA 4MXVE 2JCWA 5C0BE 2ZYHA 4D8OA 3HNSH 1HKLL 2XZQH 2Y5EA 3HZVB 4JK0D 3PAUA 1TMQA 3JWOC 1FG2A 1A6ZB 3MBEA 2ZSVA 4QRTA 1LE9B 2MHAA 3EFOB 2PCPB 3E2HB 4XP6H 1H15B 4DJMA 3B56A 2VO5A 3DJ9A 1FNHA 1G7IB 2G5RA 1J7VR 3RIAF 1C8PA 1EMTH 1X5MA 3KPNB 4DZBB 2PP8A 1S9VA 3SO5A 4E9XA 4PJEF 3L8QA 5BRZE 2X4PA 4WY7L 2GFBA 4WEMB 5F3BB 2Y72A 1P7BA 1J8HB 1JTPA 2R7EB 1AZCA 1N7ML 5I6PA 3QZNA 3QUHA 3L7FB 3RFRA 4LSVL 2C9QA 3UTQB 4KDWA 2C9PA 2K6YA 5LWYL 1HXYB 2K70A 3OAUL 3WNJA 1H8SA 3HZKA 3LVEA 5ENWA 4WUUE 1PFOA 4GQPH 1NBVL 3ZHNA 3OB8A 2L4OA 5I15L 1T5WA 3BP7A 1DJSA 3ARUA 4A2EA 5MEOB 5HI5D 4LLMA 1FYTD 4V1DE 3OGCA 4YGVB 4OLUL 4CBPA 2FSDA 2X89D 1BP3B 1D5XA 1NBCA 1KYAA 1MWAB 4K4KA 3TEZA 2PW1B 1CLYL 5HXMA 4XVTL 1OGAA 2VDLH 5L8LB 3P11L 5E2WH 1N26A 4WQOA 3SDAB 4QHKI 2QPEB 1JV2A 3DYMA 1I9IL 4JO2H 1A7OH 1JGVL 2IH3A 4HK3N 1A6WH 4ELME 2BNUA 4L29B 3EJUA 4FFYA 3VH8G 3KYOA 4G9FD 5DD5H 2YAQA 1XH3A 3R06A 4A6YA 3ZKXB 1COBA 3D25A 3OJVC 4YHML 2XKUA 4K23L 4MXWL 3I85A 5FK9B 1GPOH 3C5SA 4M5YL 4NP4H 1NEZG 4EN3B 2QQKL 2VDRB 1BOGA 1EZLA 1T1XB 4NHCH 2X6UA 5KW9H 4YO0B 5JYMA 3WGVB 1IL1B 2H32A 4XB3A 4TF4A 4PB9L 4LNRB 4S1SH 5FO8B 4ZMTA 2R1WB 2DKUA 3M7OA 1IVLA 3QORA 2NY5C 5B8CC 3KGSA 4MCYA 1SM3H 3UJIH 2HT4D 4RSVA 3BLPX 3KLAB 3SOTA 4FA7B 3W39A 2EXYD 1NGXA 4YHNB 3UZEC 5IMOA 2Q3XA 4QDGA 2BOBB 2D3VA 4UV4L 1NOFA 3L9EA 5GSVB 1QLEB 3ZL2A 3CK0H 5B8CB 4PHZA 1BZ9B 1UFUA 4O2CA 4BWUA 2SODB 3GJFB 3KHOA 4XCYA 2AQ1A 3U6RB 5FOBB 3QO1A 3STZB 2P24B 1N70A 3FB5A 3HBZA 4YXLL 1P1ZB 1A3LH 4DTGH 2MCPL 2EXWD 3HI1B 1A7BA 1I8LC 2BHFA 4LPYA 2YPLD 3EJYC 1CL7I 2X3CA 1UVQA 5FHBH 1XIWD 3OLIA 1UM5L 2X10A 4PFEA 1AKPA 1BPLB 1H3XA 4JGMA 5DDHB 5C0RH 3P77A 3VFSA 4Z7VF 4JFEE 4B96A 5JO5A 2R23A 4S1QH 3TTYA 2EO9A 1NCIA 5CFHA 5F3BA 2CUMA 1UXWA 1K2DA 3O2DL 5LHDA 1GGIH 3NH7L 5D72H 5LUMA 2IANE 3OMZA 4F27A 4J8QA 5HDOA 1VIWA 4N9OB 3B9KB 3WMPA 2EH8L 4OU3A 1RIVL 2TSAA 4Q2ZB 1R5VB 3FQNB 4G82A 1JPFB 3BKJL 3MSPA 1Q9WB 3DBSA 4IRSC 1TETH 2ZOUA 5F7BA 4RFOH 4OCYL 3UJTH 1JGEB 1RULL 3V7AE 3MKGA 5EBLA 4HF5L 2DMGA 4TTDC 1KBVA 1NLBL 1OHQA 4NKOA 5EN2A 5FGSA 3SE8H 5BO0D 1ZGLM 4RRPA 4A2GA 1E7VA 1FVEB 1JK9A 2BP3A 3KBFA 4OF6A 3D50A 3KYMB 3UG3A 3SKNA 5D5ME 5CD5D 3A67H 3H53A 2NUPB 1XF5B 3P9MB 5FO9B 2P5ED 2DYPB 4Z78A 2V7HA 2D03L 3HG3A 1FGVH 2VAAA 1ZEAH 1A3RH 1LP9F 5EC1B 3I75A 4W9HC 4J3OH 4DKFH 3LZRA 2Z91A 2EE6A 4JG0H 2VXSH 2CIKB 1LEIA 4IBVA 5D1XA 1VGKA 4A37A 3W37A 2XG4B 4JQXC 2XCMC 1FNEA 3UPRB 3G9VA 3REVA 3CH1B 1N19A 3K2IA 1X6NA 4OV6F 2KLRA 5E1IA 5HHPA 3RWDB 2AQNA 4CW1A 3WAJA 1LO4H 1IKOP 1X5ZA 5F9WC 3S3CB 2IFFH 2JXMA 4PJXE 5IB4B 3RJQB 4P46D 4E5XA 1IGCH 5D2NE 1G9MC 3JUZA 2CKBB 3TN0C 3QGVA 4NUQA 3OG4B 4M1DL 5FO2A 1D2OA 2BIOA 2WIIA 1LDPL 1MDAA 3BZ4B 2FJGA 1BZ7A 1E40A 4HCRH 4KKRA 3K6SB 3KYOB 3MLSL 4N0YL 5JLZA 4DGYL 4FQXD 1WAAA 3DUSA 1GGUA 1QRNA 2W0FB 2EP6A 2CMRL 1IBZA 2ITCB 2I9LB 2NZ9D 2PPCA 5DMYA 5IQ7L 3FB5B 5DEFB 5HYQB 1LP9E 5C6TH 1JYNA 2JKNA 5KAQG 3SD5A 1GTNA 1JI1A 1ILUA 5FF6B 3GI8H 4NN5B 2ATAA 2DWYA 4AQZA 5AUMA 2P5WD 2BZ7A 2QFRA 2BW5A 1UM5H 5IQNA 5ETUB 3Q9PA 4UUJB 3DHMA 4HQQL 4RBPH 4JLRA 4UM9B 4ZXBA 1JVLA 4NO5B 1CGVA 4WCYL 2VN5A 1ETA1 4U31A 1IFHH 1LNUB 2W9LA 3IJYA 3KPLB 4LMQI 2Z7WA 1I1CA 4PHXA 2RD0A 3RWIB 4QJ4B 4HJJH 1KENH 3BPLC 1UT9A 5CS7A 2B16A 4HIXH 3FXIC 5KYXA 2R1YB 1CI5A 1CXKA 5HYSA 3LSOB 4PB9H 1TJIH 1XGZA 5SX5K 4OCYH 2MCMA 1K4DB 4DGIH 3VU2A 1Z66A 1R24B 1VFUA 1U2HA 1J5DA 2AJUL 3X1GA 2AXFA 1B4JH 3R18A 1QSEB 1JWMA 5F71A 1U8QB 4ZFFB 1J86A 1RZKC 1QX1A 4DP4X 3I2CL 4OD1L 1RFDL 1HIML 1LYQA 3N06B 1U9KA 4L4VE 4N4YB 5JDSB 4XHJD 2JCCE 3QWOB 3D08A 4N28A 3PWVA 5E6UB 3R7RA 4ZXBD 3AB0B 3FU7A 1JWSA 5FX3A 2XFGB 3WLWD 3BP5B 3Q0HA 4L4TB 2BSSB 3ZDXF 2NDGA 3IGLA 4P4KD 3Q7JA 2XKNA 2R9HD 2X70A 3LH9A 4Y9BA 5AVWB 1FIEA 4NCDA 3HG4A 5C07A 3FO1B 1JGVH 4MNHA 4UIKH 2DLEA 2Q7AA 1RXLA 3HE6B 2DTMH 4LSUL 2Y2WA 4LLQA 3CMOL 5E2VL 1HWHB 1M6OA 2C9RA 3FTVA 1DTUA 2UZYA 4AYID 3NAAH 3F7LA 1YEGL 2IPUK 2OYKA 1M6UA 3V7MA 2Y9RT 4YH6A 5EZJA 1P2CB 3T2LA 1DLFL 4O9HL 1AGFA 1F8TL 1NGZA 4YHPB 3O2WH 1J1PL 2KYIA 3D3VB 5J1AA 3K2KA 5C8JB 3VI4F 3E6HB 4G9DA 4P9MH 4IU2B 1TVHB 2GHZA 3P4OB 2F7IA 5DZVA 5D7IE 4PJDE 2H1XA 3KNBA 5T1KA 2W5PA 3FT2B 1XF4A 5PAZA 3OSVA 2WIIB 1S7TB 3PQYD 3Q1EA 4K5MA 2ZJSH 2ZKHH 5FYKU 5KVFH 1WCBA 1RZJC 2LAAA 3FN0L 2F7OA 4G3YH 4QEGA 3RGHA 2NXYB 5E4AA 2VM4A 3V4PB 1MG3C 4MNQB 1MPAH 4OAWA 3K2UL 4CC4A 1T0MB 4ONGH 1ZVYA 1DFBH 5E7FA 3GBML 3UYPB 1AGBA 3SQOH 2LLNA 3X13B 1HS6A 4CN1A 2AABH 3DMMC 1G7LB 3QNYB 4UTAL 1ZEAL 4U6VH 1AMYA 4M93B 3A6BL 1JDAA 4QRPB 2QKIA 1SF5A 3ATBA 1WRFA 4F7PB 2JB6A 3C2AH 2FJHB 1RZIA 1ZE3H 4AYDC 1W9XA 4WHYH 5K9QG 4CU6A 4JKPH 2VDRH 4JJOA 1TF4A 3O4OC 4UT6L 1DFXA 4CJ0A 2AQ3A 3QO0A 2X4RB 3NZ8A 3GNMH 3QFDA 5D4IA 1S5HA 2W9DL 3IU3A 2F8XC 5AKRA 3LB6D 2J6EA 2ODHA 4GRLD 2PPFA 1UM6H 2B9BA 2OJ1A 3RVWD 4A2MA 5C0FB 3FH8A 5HPOA 3H9YA 5LGYA 4B9YA 4RH4A 1BLNA 1FVDB 2XWBA 4DEWA 3ELAT 3U36A 4PJHF 5HYQA 2YQBA 4WSGA 2ICWJ 1LM8V 5HHNB 3GGWA 4X6CB 4Z7WA 4OW6A 2WQUA 2E4FA 3CSYB 1FZKA 3CVDA 5F89B 1CICC 2XVLA 4JN1L 5ETUA 3PJSA 4TMPA 5KN5B 5T1DH 2ENYA 2A3TA 1MHPH 4UZGA 5E4EC 1T7XA 1WFTA 3FC8A 3MJWA 3MJ9H 1U8KB 3QDMA 1WWWX 1Z32X 2X70B 2WCSA 5BJTB 1F1AA 2DN7A 1TVDA 4QRPA 1CL7L 3ILDA 1NGPL 2ICWA 1XMWA 4RMTA 1WBYA 4G6MH 2W0PA 2ZPKL 2VERA 4JL2A 4FLRA 3FOLA 3L1GA 4UTBH 3TV3L 3BKML 5CIPH 1U36A 5DRNB 4Y9CA 4Z7OE 4N87A 4OLZH 4ENEC 1UA7A 3VXRB 2YAEA 3K74B 3RVWC 5AVVB 4FQPA 3ULUH 1CDYA 1R3KB 4P2OC 5DJ6B 4BD4A 4XNBA 3MNDA 3KLHD 2BRRH 3TZVD 3WO4C 2Q76A 3DJSA 4EUPB 3BZEB 3U2IA 4K8RD 2R59A 4Y4KA 2WJ7A 4JGUA 4LSVH 4DCQA 4OTXH 5DVOA 2BERA 1KY6A 2XHNA 1VGEH 4PSPA 1CIUA 3T2PA 3ULUF 3U4BH 3RGVA 1FAKT 2OR7A 3WXVL 5AVZB 5LGKA 3O3BA 3ARGA 3CU7A 5I8KH 3JV4B 3HI1A 3SQRA 3ZKMD 4FNLL 3FO2A 3CVHH 3CDGB 3QIBA 2WQAA 3HTLX 2DLIA 1TQCB 3RZCC 3OR6B 3MRPB 3Q05A 4RZKA 1SMDA 3F6LA 1M7UA 4F80A 2CGYA 3KM1A 5E6RB 5T5FH 1XFPA 3JTTA 4ZAKA 3T0DA 1K8DB 3QUZD 4TPRH 4NZJA 4LL9A 1CD8A 2IANB 5KVMC 4FDWA 4XVSL 3C2AL 3TZVA 4HS3A 2HUHA 4B9IA 1MCKA 1P9MC 4R3SA 2V2XA 4CDHA 3B2DC 1F6AB 1N7MH 1GW6A 5GGRY 1L9PA 3K4ZA 2DM3A 4AV4A 1ECZA 1XXFC 2BNUB 2WCPA 3G5YB 5FUOL 3AU1A 1U8IB 4PJFB 1I8MB 1DCLA 1G4MA 4UDTB 5E5LA 5L2JB 2BVTA 1UC6A 2J7LA 3U0WL 1M71B 3ARFD 3CFCH 3OKMB 5BOPA 4B97A 1XCQA 2OFQA 3OMNB 1ZV2A 1W8NA 1FPTL 4AH2B 4ZMOA 2H7WA 4YDZA 2YD8A 5IFJA 1R33A 2GK0B 3LXBA 4X7TA 4JN1H 5A6LA 1OARL 2NY0D 4LCUB 1RUQH 2ZCHL 1OQOA 5LBVA 4B27A 4PV8B 2RALA 3MN8A 4PJCB 4XXCA 1JHTB 1CF1A 4NSKB 1QATA 3IDIA 1RJLB 1S3RA 2W07A 1F97A 1NIFA 1S9XA 3WFHB 4YSSA 1THCA 4NT6B 4UINL 3WHE1 4PTUB 1D5XB 3GTTA 1V05A 1E50A 4D9LH 4HG4J 5FR3A 1U2CA 4PJ7F 2EDXA 2CK0H 3VXTA 1E5AA 4OLWH 5JOPE 1NMAH 5E4OA 3ME0B 4HEME 4Y4HA 4LLWA 3WIHA 1TQSA 3D33A 4K23H 4MXWH 5EU7E 4OKVB 3I6GB 3JWDC 5IVXB 3MREB 5EBLB 4L05A 5D2NB 3CMOH 3BVDB 4OB5L 2XQBH 2Q3AA 5JIPA 1P84K 1AS6A 1CGTA 1KBGH 1Q9WA 3FQTB 4HCRA 5C0IB 3AY4C 4GW5B 1KEML 5J4MA 3Q3GA 3DK2A 4XOBA 3TBVB 3IDXL 4XO8A 1VKXB 1TMCB 2PN5A 4P3DA 5MEND 2R0KH 3TBYA 1CG9A 1M2OA 1RKRA 3BEWA 3OAUH 3ZU8A 3K6FA 3IJHB 2GEEA 1YMHA 2VABB 1GKOA 2WLIA 4OLVH 5DQDH 5JYLA 1TU2B 3QS2A 3RAJL 1CFQA 2VZOA 3D07A 2ISDA 4Y89A 4UB0H 4R4NC 2K9UA 3MLTB 3QVAA 4J4PA 3MLXH 4LBEA 1SMAA 4OLUH 4YDKL 1BQHB 3C8HA 5EIQA 1L7IL 1ORSA 2UWEE 1UVQB 1KACB 5KVDE 2K3HA 1QTPA 5DYOB 1AYRA 2E7HA 3MRIA 1MREL 3BSGA 5AQ0A 5I5JA 3MJ9L 3OKLA 4QRUA 5J1TC 1CF8H 4QYAA 3A5VA 5KG9B 1PNDA 3KWTA 1UH4A 3TNNB 3KPMB 3KBEA 2BNQD 3IMWA 1AANA 4RESB 3G6AB 2EACA 3AG3B 4FHJA 3L3KB 3CCHB 1YAZA 2P48B 3D39E 4FA8A 1M7DB 1AYOA 2WMPA 3HUJF 2KERA 3WMSA 3Q8FA 3VVVA 1Z3GL 5FO7B 4B9JA 1U41A 1FLRH 1WHOA 3MV8D 1PKQA 3IT8D 4JQXA 3BC9A 4XB8A 3VFWA 4Y16C 5L2JA 1UKQA 1FFOB 5JXAL 4K3DH 2CNZA 5F88B 1MJ7H 1PD1A 1XVSA 1RZFL 4QHLA 1IUZA 3EOAA 3VTAA 5C97A 1MAJA 4OZIF 3MXVH 5F7FA 1T22B 3ZTEA 2HRLA 2IXQA 2GSGA 5IF0A 1NIEA 3MRKA 4U33A 4M5YH 4U0QB 2UY6B 1GGIL 1K6QL 4G8IA 5I30H 3AWEA 3FQRB 4ONOA 1OCWH 1J05A 3O4LE 2RH0A 1XGRB 3L2LA 1PZAA 5C0BB 1RIVH 3WN5C 1D6EB 3A6CH 4L3FA 3S3PA 1SDAB 2WP3T 1JTOA 5IVOA 1A4BA 2J72A 1QP1A 1X9RA 2WXMA 5CWSA 2VKXA 1NH6A 3U46A 2A5UA 5GZNA 2EYRB 4LLUB 3WIFB 5EZOH 1WAAE 3H55A 2CR3A 4RRPG 4Z3FA 3QORD 2NUTA 1VFBA 2EDKA 2L0DA 2X6BA 3H42L 3ILEA 4GSDH 1OZUA 2IAAC 1EPFA 3SGJA 1C5BL 3GFUA 2BP5M 2P4AB 1DBJH 5J1AB 1GVIA 3FHQA 5IJVB 2AJXH 4X6FB 3AY4A 4GMSH 2GAZA 2BSCA 5DEZA 3N43B 5JIDA 1FGVL 4PBVC 1WA2X 4DCQB 1INQA 4HLZH 1WUZA 1DL7L 4PWEA 3MJ7A 1D7CA 2X87A 3QA3B 3TEUA 1ZTMA 3MFGB 3HS9A 4QXWA 6CGTA 3RKDC 1YJDC 1F4WL 4QHMB 2VSDA 2LR4A 4HIIB 3SZKC 3F7PC 3BX7C 1VPOH 1L9TA 2HJFB 2Q0ZX 2XYBA 2KDYA 4PMEA 2MNJB 4DP0X 1KENL 3WELA 1V27A 1XIWA 4UT9H 1TUPA 1EHXA 3MV01 5LGHL 4J3OF 3MGTA 1CU4H 1YDPB 1ZD6A 2F7QA 3DXAD 3L7FA 4CSSA 3NK3A 4NJ9L 3LZOA 4DN4H 3QNYA 3NZHL 4GAAA 1N9PA 3MLSH 4N0YH 4FNPA 1CTNA 2GY5A 2YA1A 2ADFL 2IANA 3UGUA 3V6OA 1MZYA 4JPWH 4WO4A 4FNLH 4UZUA 3QZWB 1NKGA 2W65A 4HWZA 4X5WA 1V8HA 4IK6A 3RQ3A 4BZYA 3U1SL 1XCWA 4I3RL 2JTYA 2BH0A 2KDGA 5T5FA 1MVYA 4HP5A 4M4RA 2CGRH 3VGGA 3B2PA 1MRCL 3V52L 3ZUCA 4V1DD 3MVSA 1NSNH 4KTEL 3GXUB 4TNWK 3P3RA 1XSKA 2EXWC 3UAJA 5LQBL 1MCDA 5I6OA 5E8NB 1S3KH 3P2BA 1L6XA 2VJXA 3BJ91 1I9EA 4J12A 1O6TA 4ZFQA 2BVQA 1S6NA 4ELMA 2NOYA 3ZDXB 5CEXB 4PY7A 1ROCA 4OZIB 1QFWL 5I23A 5EEUA 1NC4A 4NUPA 4LBEB 3US1A 4ZUSB 1N5AA 2F2HA 3CC1A 1MCPH 3WTUA 3CVHB 4DEUA 1SRDA 4BEIA 3NCWA 3MTXA 5JW4Q 4LCCB 1HQ4A 2EXYC 1TCRB 3V6ZB 3MO1B 1R6VA 3FUFA 3AT9A 3Q6GL 3CIAA 2BSSA 4PW4A 3GS4A 4A68A 2DQHL 2WUBL 1GHFL 3LIZL 4TULH 1C1EH 3QW9A 4HJGB 2QQNH 1RUML 3L1OL 4KUCD 1HYSC 1HCZA 4MS8C 2WD0A 2ORBH 3U1PA 2R29L 4KX9A 3S8WA 1LO5A 3PAYA 1W0VB 4TVUA 3RZCB 1CGSH 2ZJSL 3BQUB 5D1QA 3WFBL 3RGVC 2X1PA 2Q8BL 3A4FA 3FH7A 3K91A 3LXAA 5GGVL 1T4KB 4UOW1 1XF4B 4Y4KC 5C08B 1DEEB 1NGWA 2ADGB 2ZCLL 2FT8A 4LXFA 1QYGL 1PG7L 1RLBA 4FXKA 3ZO9A 7TAAA 5IQLA 3IYLW 1SY6A 1CFMA 1TQBB 3C6LD 4P5TC 4M1CD 2EC8A 1PZBA 3O6FB 4K2UH 3M1BB 5E8DH 5AVXB 1IFGA 1FL3A 5D7HA 3VRJA 1A6VH 2NTFB 4JDEB 5TE4L 4L0ZA 4RWYL 1LMKA 4G8EB 4KKZA 2N01B 1O7SA 2W80C 2PXYD 5JPMA 2Q7YA 1VACB 5F0MB 4F1SA 3EKCA 1MIEL 2D4DA 4L5FE 5LGHH 3ZY7A 3VGBA 1OLLA 1A2YB 1PSKH 5I6LA 4FFZH 4NZDA 2GYSA 4HJEA 2XQYG 2JTDA 2ATKB 4GQRA 4N85A 4ZMYA 1GYVA 5BPPA 2DMKA 3EGXA 1T2QL 1IEBB 4Z7VB 2QSVA 3EW3B 3ZE1E 3X1FA 4QHKJ 4XNQB 4EIGB 1I85C 2EE9A 3FTZA 1HU8A 1IBGL 1SDDB 4QOKA 5GIRB 5HDBF 2WVUA 1F3JA 5GSRB 1CICA 3VFPB 2R2HB 1ZCRA 4X6DB 3UL4A 2UZXB 2CGZA 4CAGA 3CN3A 3ZO0A 2OMXB 2P28B 2YD2A 4BUQA 1PY9A 2IADB 4LCWE 4XB7A 4U6HB 4F8QA 5C0DB 2HMID 1ED3A 3IXTB 2BRQA 4N2LA 4APXB 5IHUL 4NENA 4YFLI 2BSTA 3UO1L 4R6UA 2X9ZA 1DBBH 1JN6A 5CJXC 4DP8X 1E8ZA 4E41D 1DUZB 1LL1A 1VZGA 2NSMA 3BDYH 4YHIA 4UWQB 4MDJB 3U30B 5DD3L 4H0IA 5D71L 1Q1PA 4ES9A 4IKLA 3BW9A 1FFRA 1KB9J 3LS5L 1KLUB 2BIPA 3DX6A 4ANXA 2NY1B 5F0LB 3ARSA 3PY9A 2Q7YB 1LWJA 3QYCA 4XMUA 2XNAB 3KPPB 1NGQL 3O11B 4QMEA 3F7QA 5DLLA 1BZOA 1BV8A 2BVYA 1DJZA 5IBTH 5SX4I 4PJAA 2DIEA 2XACC 3GIZH 3ULVH 1PLCA 2EKJA 3QIBB 4L3ED 2IV9A 5MENE 2ATKA 1OAUH 1S78D 4Q9BA 2FZ3B 5L6YL 3KLDA 4KX7A 5DJ8B 5HY9B 3HN5A 2PP7A 5DURB 3K8KA 1KCBA 3AQZA 4IK7A 2HT3D 4BH8A 3B3IB 2W95A 4BBWA 1KYFA 1EDQA 2CNYA 3F85A 4HEPA 3SE9H 3DUHA 2LW3A 4XI5C 4LF3A 3B7RL 3QJOA 2MKLC 5L88H 5IFHH 3BUPA 5MI0C 3QHFH 5ERWB 4ABUA 3WNLA 4NRYA 2VB5A 4RGNC 4XBEL 3FQTA 2E27L 4F93B 3CK0L 4K7PL 4GAJH 2BVEA 5C9KA 4M5SA 3FO0H 3VWKB 3V5HB 1C08A 3CZEA 4BFGA 4NBXB 2ZPKH 4JN2B 3FFCD 4K9JA 3F84A 1DEEA 1NGWB 3KBPA 1FL3B 4DESA 4XPGL 2BOLA 4N0UE 4ZNEE 1WFOA 3BW9B 3HHRB 2ATPB 4FG6D 2HKHH 2R0LL 2KQNA 2V9QA 3ZTJH 3U9WA 5HHME 2P80D 2X1XR 1JHKH 3DV6B 3CFNA 4G6FB 4K3EH 4WW2B 5EPMB 3L3IB 4NDMA 4NQDA 4XN1A 5TQ2L 2LVEA 1YMMB 3JYCA 4M29A 3FDWA 1FDLL 3RZCA 2XIIA 3AC0A 3FAWA 5DJZB 1AQDA 1FZOB 3WAKA 3CFCL 3GO1L 3LKSB 1JNHB 4HD5A 1E9OA 4LARH 5FDYA 4F2EA 4HAKA 3VI3B 4BH8B 3L3OC 4XVJL 1ZVSB 3UBXG 2UWEF 3QEHA 4G8FA 3POCA 4LEXH 3W1ZA 3K72A 5C0EA 4PRHD 3JUYA 2HKAA 1OK0A 3Q5OA 4KI5E 4AJYV 1P84J 3AB0C 4X5RA 4W9IC 3ETTA 1KB3A 1DJHA 3I3DA 5BO1H 1TDQA 1WAAF 2EEAA 2AQRA 2OJEA 1ROWA 1TSRA 2DLGA 4Y1SA 4AQEB 3KR3H 5TTRA 1QWNA 3TGXA 3BGMA 4MAZA 1TTUA 4N2DA 2CA3A 4G7QB 3S88L 2MSPA 2JI3A 4HG4K 5F7EH 4OH2A 4G6AD 1JPTL 1IBHA 4P5SA 4RMVA 1C8QA 1ZANL 3EGDA 1CYGA 4MTMA 1Z5LB 5BV7B 2AXGB 2N7BA 6FABL 1CE1L 3UZVB 4HKJA 1J0YA 1A7OL 4HCFA 5IB2B 2ZX8A 1U8JA 2Y7SA 1ZLUH 1IZJA 2HSIA 5FB8A 2P5PA 2UX7A 3FPYA 3PWNB 3VWKD 2WOBA 2PW2A 3IDMB 1NAMA 4WK2B 1OPGL 1ZWIB 2WXJA 4JFHD 1H3GA 4LSSL 4WRLA 2QHRL 4KXZI 1MVUA 1XWVA 3RIFF 3NCYP 3VVWA 1AD9B 2APSA 1ND0B 1DJWA 4P2RB 4I13B 2XWCA 5F7DA 2R0KL 3NIFF 5IVXE 2WKGA 4WEUD 1NGZB 2H4EA 3QZMA 4MQ7A 2AEQH 5FYLD 4YC2B 4AIEA 5SX5H 3TCLB 4TSBH 3RAJH 1MJJB 3QO1B 4DP2X 4OJFL 3FQYA 2YC1B 2XWZA 4O00A 4UMSA 1SFDA 1C9SA 5E03A 4UZSA 1A1OA 1RUAH 2W0LA 1QUNB 4IJ3B 3HAEA 4GUPA 4IGBC 2CIIA 4PBDA 4P4RB 3RGBA 1JNNL 4HIIA 3VD0A 1YEEL 1PNCA 3MNZB 3SE8L 3Q8AA 2WSPA 2D7PA 4F92B 1IMHC 4KO6A 4H2CA 4Y4HD 4U1GB 3D0LB 1BD2D 4GMTL 4UQ2B 4GRWH 2VIRA 3RTQC 4AGLA 1SJEA 4PJ9D 1SY6H 2FIKA 1HL9A 4OUUB 1DVZA 2FGWL 5I2IB 2B7DT 4L8DB 4B5EA 3KG5A 1UA6L 3BP5A 1Z3GH 1T3FB 3DPBB 4FD0A 1WP6A 3K5SA 3DTXA 1RZGA 3N5AA 1AXTH 3LV3A 2Q8AL 7FABH 3GSQB 2ZTBA 2FT7A 4KDTA 2R56H 4DN3L 4P9HH 5DC4B 4NN6B 2C3XA 3D69B 1JWMB 3KGTA 3ZQ9A 2CPUA 5I66A 4N2HA 4NUGL 1LO4L 4R5VA 1CGUA 4R4BB 5KSAA 3BJLA 3BKYL 4R26L 3WE6B 3QJVB 1OARH 1R34A 2AF2A 3RB5A 5JPNA 4PU2A 1RPKA 1AGFB 3ZL4L 3QG6A 2XX0A 2G5BA 1NUNB 2IXQB 4LVHC 2HMIC 4PJIA 5HVWA 3ARDB 2CH8A 3V8CA 4ODTH 1PS3A 2P52A 4KXBA 3VFTB 2X6MA 3FSAA 2D3JA 3I2CH 2EDHA 3IVKB 3CX5K 4ZDHA 1IIKA 4FABL 4I1PA 1J5CA 4AXWB 2CBPA 3G5WA 2FVNA 1L7IH 5F9WB 4JFXB 1EGJL 5FW6A 1P5UA 4KOCA 2B5IC 3W0WA 1BM3H 3RLSA 2ZIDA 4S2SA 2Q86A 1ZDSA 1X6LA 4QY8B 2AV7A 3QUKA 4HUUA 5EU6A 1GIGL 2VISA 1N6QL 3QYNA 1AZNA 1WZAA 3MLYL 1VFBB 8FABA 5IMMB 2OXGB 1RD6A 4IDLA 3HCVB 4RAUA 4AVJA 3EBAA 4F7KA 3DSNA 4XOAA 1GRWA 2YO3A 5I6KA 2PW2B 1MNUL 3T0BA 2CJTA 4ZMWA 5EWIH 3UX9B 4APQA 5IJKC 3F8UB 2CRZA 2AEPL 1LJMA 3SDXB 3NJJA 4N8VA 5JXAH 4P9HC 5C09E 3H6JA 3QDJE 3LN4B 1H3VA 4HZAA 5DEJA 3BP4A 3OXRA 5K39A 4J3XA 4QHNA 3LSOA 5SV4A 1T22A 3SDDA 2GPZA 3FQWB 4Z7WF 3IDXH 5DO2D 5CU5A 2H8PA 2NRDA 3QISA 1Z9MA 3N50A 2FR4A 1NCAH 3V5DB 4X4XA 2H26A 1FL5A 3VE0A 5AB0A 4HBCL 1VB9A 2AJUH 2GJ6D 5E0QA 2CSPA 3BT2H 5KZCD 4FFVD 1MZZA 2R8SH 2CO6A 2WJ5A 1MCIA 1C7TA 1GL4B 5ECJE 4J4PD 1BMZA 5FYJH 1T83A 5D1XB 5ILTL 2DQGL 1IC7H 4DK3A 1XR8A 1QEXA 4JFWA 1F6FB 3FCBA 4PWIA 2K78A 3NCFB 1CD9B 4NB7A 1P4UA 4PLKC 5CLZA 4R97C 3N1QC 3BPNB 2QSQA 1OAJA 3TYGL 5F1OB 5HGBB 1SQ2N 2GBAA 2V0AA 2CLVB 4YFLF 1QOKA 3KPRE 5D7LE 2P8LA 1GGBH 4IKJA 3D85A 3QNZB 4QRRD 4BK5A 3U9UA 1F6AA 2YA0A 3MAWA 4YSPA 3DDFA 4OM1H 1X9QA 4LVOB 1FDLH 3C5ZB 1NEPA 4IGBD 4GAFB 4IQHA 1U95B 3NIGF 4PJBB 5AOLA 4EPSA 2FQEA 3BFQG 3UGXA 3OKMA 3CVIL 3U2JA 1UHVA 4BQCA 4YHZL 4F20A 5F72S 4UAOC 5CCHE 4G7YH 4HIEB 4L9DA 1RSFA 4JM4L 1G1KA 4TYUA 2L7JA 5DGRA 2J8OA 3W9EA 1CFVL 1P7QD 3ZR6A 2Z1PA 1HZKA 5I2IA 3QDJB 3GSNB 5B7EA 3BPLB 1UCTA 3CUPB 3HHSA 2X4SA 4WDIB 1EBAA 2BM3A 5A7BA 2JLPA 2B08A 1U93B 2XX1A 3KWVA 3P69A 2CIKA 4HOZA 3Q2LA 3SGEH 1I53A 1RJLA 2M83A 5JHMA 1FH2A 3D8MA 4XE5B 2ZCLH 3GM8A 4MJ6A 4S0TD 5EA0L 1IV8A 3FZUD 5L0QC 3FTGA 1DFBL 2BHZA 4MRCA 4PTUA 1PYWA 3LKQB 4U1IB 1AD0A 4M8QA 5L4IA 3N40F 4Y2LA 1A7NL 4FJZA 1OO2A 4YSTA 1P4IH 1KJ2L 1TYRA 3WFEH 4GSRA 4QXTA 4WTQA 3IB4A 5D5MA 1V7NH 2OI9B 2I7OA 4A2DA 2YN3A 4BFRA 4YHLH 5J9PA 1Q94A 3RJDA 3TJPA 1UD8A 3JT0A 4HUCA 3M86A 4JG1L 2KI6A 1PJWA 3NSFA 2XN1A 4IKNA 3T08A 1AO7B 1YUHB 3GMQB 1MJ8L 1PD0A 2FCBA 4AGMA 2DIBA 1BLIA 1D9KD 3DX9A 4KKAC 5L7XL 4K9EH 1FJ1A 3VW3H 4MDJA 2PYED 1N6VA 3F7KA 5CINH 1D6VH 1BXVA 3BEWB 4FCHA 1EZVX 4Y5VA 2OCCB 3U82B 1H0DA 3UP1A 1AMXA 3QAZC 1IBGH 3BYTA 3MFFA 3RY6A 4FP8L 2H1LM 3T3MB 1HWGB 1GHFH 2FWUA 3LIZH 4TULL 2X2YA 5HDLA 3DX8B 3ULUE 3QJQB 3QR0A 4KAQH 1BIIB 1RUAL 1XAUA 1BAFL 5EULV 4UQ3A 4F7EB 4XH2A 3MBWB 1FE8L 2IDTA 2LE9A 3NJIA 4IIZA 2XYCA 2YGVA 1TTFA 1BEYL 1KOAA 4HS6A 3CE1A 2IQAB 1UWEH 4EI0A 1X4YA 4ODVH 2ZX6A 1UWGL 3M1OA 4HC1H 3VFNA 4KITB 1F02I 1W72H 3SBPA 1YVLA 3L3KA 1DBKH 3GMOB 1BW8A 3IDJB 2WQWA 4Y5YB 4K2UL 4NWTL 3SE3A 3H8NA 1F13A 4FQJH 4GKNA 4XE0A 2HRPL 1CFSB 2OK0L 1KPRB 5TE4H 3T8XA 4OCWL 1X5KA 3M17B 3FT1A 5JNYB 3ISYA 2NLJB 5DJ6A 3DMMB 4IS6B 2R4RH 2J55A 4MWFA 1GY2A 3SCMB 4BKSC 3P3UA 3SJVB 2V5MA 2RAMA 1INDL 5J12C 4AI7A 2FWOB 2XQYA 3KDMA 4KQ3L 3T0ED 4J3VA 5JW4M 4HOMA 1F5WA 5FYKL 2WO3B 1UM6L 1SXBA 3EBIA 4HIEA 1IEHA 2XWTB 2LU3A 5KOMC 5ANMB 1ZGLP 1QR4A 1UASA 1KPUB 2ZSWA 3CGTA 1IBDA 2WAQA 2NY1C 5LGJB 3BMWA 3Q6GH 3PNWA 4M56A 2MCG1 3VXSB 5I5MA 4UILL 1ZA6B 3WSQH 3S0PA 3EBGA 3G9AB 1KGCE 5IKCA 1IGML 4K7PX 2DEXX 1KSRA 2Y24A 2YQ2A 4AZUA 3MREA 2WBWB 1U21A 5I28A 2NX5D 1AC6A 1YYMH 3LNDA 1EGJA 1ERNA 3JBG7 1U42A 2JKLA 3SGEI 4IBWA 5JIHA 3LZFL 4FCAA 3II2A 2UVFA 3ZYOA 4PYHA 1UD5A 2EKSB 4XR8C 1KMGA 4JFVA 2VDOB 1MW3A 3B3IA 4LZKA 2EYTA 4IOFD 5IROD 1NDGA 2Y6SD 3MRLA 3H7BA 3RVXC 3HAEB 3DROB 2EDLA 1EXGA 3F5WA 4YL4A 3HG1E 4XTRC 1R19A 2AK1L 3WY1A 2YKLL 1T2XA 1IM3D 1ZT4B 2LLLA 2GY7B 4UDTA 1ZOXA 3BZFB 2V9TA 5KN5A 3M46A 5EC2B 4JQVA 3U9PL 2XWJA 3MOAL 1LD9B 1MIEH 2W1NA 25C8H 4XBPA 4JHWH 3OAZK 4JM4H 2GTWA 3SKJH 3K0YA 3DIFA 3MLWL 5L2KA 1BD2E 2DMCA 3S5LA 3X13A 3UYRL 5I0YA 4Y1AB 4TUOB 4YO0A 4XBEH 3QXWA 5A40E 4G9FE 4PR5B 3F3HA 3BHBB 3HMWL 4GRLA 4LEOA 1WT5A 5D7JA 5FXCH 4DETA 1X9LA 2C34A 3REWA 4Q0XH 2H3KA 1AXIB 3Q2VA 3VXNA 3WS6A 2A0LD 4XXWC 3T8MA 2MMXA 4J27A 2XY1A 1FO0B 2AMUA 3D85B 3LQAL 1JZ3A 4PY8I 2Z8WC 2VUKA 3BVWA 4QXVA 1YY9D 3KL3A 5AWNL 3H7LA 1SYSB 4HXBL 1I7ZB 5E5RB 3D09A 5E8OA 5GGSY 1JVKA 3MV7A 3U1QA 2PTUA 2ZCKL 3F01A 1O9VA 3LEYL 4TQEH 2CUAA 4B60A 1WFUA 4IIQC 5DMKA 2XV6B 4RQQA 2IOOA 4WVRA 3OJDB 3X11B 2A9MH 5IFAL 4HFUL 5IT2L 2ZUQC 5E08L 4ZOBA 5L2KD 4Z7QE 3IMVA 3MMEA 4HKZA 5TD4A 1NM4A 3S36H 3ML8A 2CLZA 1FHNA 4JRYB 1JV5A 2OCFD 4FKHA 1MXDA 1EUTA 4CMHC 2PPDA 2H2SC 3AS2A 1F2QA 4KC3B 4P46C 3MC0A 3O9WA 4OUUA 3IGKA 1KJMB 4ZT1A 2ZWZA 1IQWH 4WHTB 2CBOA 4AQAA 2AVGA 1K5NB 1R3JA 1XSJA 1UZGA 4PH8A 1IVTA 2UZIH 2OZNA 3ZTDC 3PWJA 1IE4A 3KR3L 2AZAA 4U49A 4EAEA 2M26A 4DGYH 3LY6A 5K69A 4AGPA 2I85A 2FJGB 4LSRH 1I8UA 1OXYA 1ZA6A 2FJFA 3W82A 4ZS7H 1FN4A 1OHZA 4XNAA 2H9GB 4ZTOH 5F1KC 4EJ1C 4GI8A 4NAQA 4M8RA 2K9FB 2F74A 2Q6WA 3O6KL 5D9SB 3WTYA 5LNEA 1RZ8B 2Y07H 4OZHA