The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
118
|
structure length |
118
|
Chain Sequence |
RSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQLPQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGAADAGFCYPPETKTVPLSEVVAN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Disulfide Bond Isomerase DsbC is Activated by an
Immunoglobulin-fold Thiol Oxidoreductase: Crystal structure of the
DsbC-DsbDalpha complex.
pubmed doi rcsb |
| molecule tags |
Oxidoreductase
|
| source organism |
Escherichia coli
|
| molecule keywords |
thiol:disulfide interchange protein dsbc
|
| total genus |
24
|
| structure length |
118
|
| sequence length |
118
|
| ec nomenclature |
ec
1.8.1.8: Protein-disulfide reductase. |
| pdb deposition date | 2001-09-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| C | PF11412 | DsbC | Disulphide bond corrector protein DsbC |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Thiol:disulfide interchange protein DsbD, N-terminal domain |
