1JZDC

Dsbc-dsbdalpha complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
RSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQLPQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGAADAGFCYPPETKTVPLSEVVAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Disulfide Bond Isomerase DsbC is Activated by an Immunoglobulin-fold Thiol Oxidoreductase: Crystal structure of the DsbC-DsbDalpha complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords thiol:disulfide interchange protein dsbc
total genus 24
structure length 118
sequence length 118
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2001-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11412 DsbC Disulphide bond corrector protein DsbC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1250 Mainly Beta Sandwich Immunoglobulin-like Thiol:disulfide interchange protein DsbD, N-terminal domain 1jzdC00
1L6PA 1JZDC 2K0RA 3PFUA 1JPEA 1Z5YD 2K9FB 1VRSA
chains in the Genus database with same CATH superfamily
2VB5A 1UD3A 4ADGA 4BFIB 3CVBA 1MQ8A 5EULV 5HY9B 3OR7A 3QJQB 3C5ZD 4H2CA 4J3UA 3KPLB 4GH7B 3NP3A 1BZOA 5C0AE 5BRZE 5IVNA 4PJFA 2OULB 4GJTB 4QHUA 1TEGA 5KVDL 1M71B 4PJFE 1KBPA 5I8KL 3U7WL 5DXWA 3E9UA 4ZS7L 3QRBA 2N7BA 2AERT 2FX8H 1DJHA 2X4TB 4ZS7H 1V5JA 1J0HA 3AXLA 4KK9D 3G04B 3JWNC 3LXUX 1SFHA 1HILB 1CE1L 1IBZA 1BMZA 2YC1A 4XGZB 3CSBA 3IS0X 3HG4A 5KOMC 4YEFA 2OTUA 1KCLA 3AREB 1I8KB 4KVNH 4MNGB 1X5FA 1UXSA 2MQCA 1XF4A 3QJRB 1NDGB 5PCYA 4HC1A 3TO2B 3HTLX 3O6FD 3IEAA 3ZKQD 3EJCA 2IPKA 2JKTM 3A5VA 4FG4A 3BUPA 2A6DB 1URLA 2HFEB 3BMWA 1AXIB 1ETZA 4OLUL 3P2DA 4BH7A 4I3SH 4ZW8A 4XP4L 1R5VB 4KKCD 5F8QC 4OM1L 2YMXH 2X4PA 2YLHA 1KLGA 3F12B 2ZUSA 1IVLA 1ES0A 1P5UB 2FEEI 4JQIL 5JHDD 4L3EB 4LPXA 3MN8A 1GS8A 4P48A 5CAYB 3QULA 5I1EL 1AC0A 2SEBB 3H2QA 1IC5L 2W94A 3VYOA 5B7EA 2MHAA 2OYKA 1DBMH 3SIKA 5IG7A 1DCLA 2IQAA 4EN3C 2UZPA 2YBRA 5SWZE 5C0GA 1VLXA 2GFBB 3AS1A 3LQZA 5CIPH 4GINA 4JGUA 1EO8H 5AW7B 4FFZH 4PPTA 1XCXA 2AJUH 2B1AL 3OVUB 3L3GB 3WAJA 2LGNA 3F7VB 1MFNA 4PI2A 3WHXA 1NEZG 4LIQE 1E7UA 1N8ZB 4YMPA 4TSBH 4WO4D 1XT5A 2CRMA 1WFMA 5H37G 4HYTB 4DN4H 2AJ3A 4Y9GA 2ORBL 1VPOH 2XSKA 4AKOA 5L6YH 4H13C 1J0YA 1FNEB 1LO3L 2G2PA 2Y1ZA 5G5DA 1FAIL 3RWCB 3A47A 4UDUA 5F7FA 3ZW3A 3MTXA 5AENA 1BPVA 4FLOA 2AMUA 2DBLL 4QRPD 4M1GL 4ZXBB 2X4QA 5LAXA 1RCYA 1TZHA 3QUXA 1ZWIB 3QXDA 2WTRB 4LPWA 4QCIA 4MS6A 1RIHH 3V0EA 2D31B 3UAJD 5E1IA 3QVAA 5HXMA 2L4OA 3ARBB 3MDJA 3GYRA 1W0VB 1FORH 3D07A 4ZFOA 3BXNB 1DQJB 3MZTA 1TTCA 3CIQA 4L5FH 3MREA 4H25B 1GKOA 4MHHI 5LCVA 2YSSA 3G7TA 3TX4A 1DUYB 1OAJA 4PRPA 4AT6A 5B8CC 5LGKA 4FFVC 1OTSD 2QQLL 4MMXC 4HXAH 1OAXL 5TE7L 2ERJB 3IRPX 3GLDA 4BHUI 3CC1A 1K8IA 4B5EA 4K3JL 1XF5A 4O02L 3VGDA 5B3JF 1GMIA 3QZLA 5KVDE 2EKSB 4LP4A 1T20B 2VM9A 3VXOB 4YS4A 1SXNA 2QZQA 3UTSE 4JAMB 3DXAD 1XF1A 1CFVL 1G7JB 2K6ZA 2P5EE 3MNVA 4FFZA 4NC1C 2YAFA 2QVKA 4P4KA 2D3NA 3DVGA 2GSMB 2H47C 3U7YH 1ETB1 1N6UA 2ITEA 3MI6A 5LG1A 4AW7A 4PY8I 1OWWA 2XA8L 4OCWL 4X4XA 2AQTA 4BKLA 5J7CC 3MODH 5CJ8A 2BSRB 3H6AA 1EAJA 1KBGL 1IL1A 1WBXA 2IXQB 2V3FA 3EDJA 1NCWL 5FUCE 3TGXA 5E6UB 3RKDC 3DPBB 2YXWA 3TH4T 2WQXA 5BO0D 1CFMA 4YDKH 4OVVA 4LLQA 4N1HB 4UQDA 4BSJA 5I5MA 1FIEA 3MRFA 3F8UB 1JXJA 1EAPB 1TOXA 3WAKA 1A6WH 1EZSA 2IH1B 4WTXA 3EO1B 5E08L 3K91A 4YHLL 4Z23A 4D8PA 5E00B 1TTUA 5I18L 2GTZB 3ABMB 1GR7A 5JW4Q 1BLNB 5C7ZA 3MGOB 2EILB 1X5XA 4O2FB 2JJWA 4LLVB 5DD0L 2L7UA 5DJZA 1JPGB 4LIQL 5BVPL 1BAWA 4NC0B 5DHVB 4XO9A 4TKWA 3D5OF 4MGXA 1A7NH 2NUTB 4DHLA 5GS0C 4XP4H 1SBSL 3QC5X 1GAFH 4PJAA 4PGZA 1OF2A 2ENQA 1ROCA 1WFUA 3FXIC 4PJCA 1NDMA 4NQEE 2IQ9H 4KX8A 4HX1B 4HD9A 4LK4A 1M1XA 2AEIT 4E9QA 3FT1A 1VHPA 1T04A 3LCYA 1QFWH 3BZFA 1AZBA 2FWLB 4WU7B 1MRDL 1KJ2L 3N43B 1RZFH 3DBXA 4DW2H 3ZYJA 4PV1C 1C5CL 2MEJB 1XXFC 4NWTH 4B0MB 4Z77A 4IRJC 4J3BA 3SE4C 1EHNA 4NO0A 1U33A 1X5ZA 2FYYB 3C08H 4WENB 5DMJB 1R24A 2VH5H 4N68A 3S34H 2WWKT 2R2HB 5TDPB 3GXNA 5EB9A 4FHKA 1J11A 5D1XD 2J88H 4M8QB 3QDMD 1RZJC 3CQFA 3OKMB 2I25N 5C86A 3LQAL 3BO8A 4DQAA 1GZQB 4H20L 3BZ5A 4NN6B 3K3QA 4NSKB 3P30H 5ANHA 4PEEA 3Q2LA 5HDBB 4G8EA 3SDAC 4PS8A 1SMAA 4P07A 3QDJB 4FQCL 4R4FL 4YJZL 2O26U 3VXTA 3GSRA 1Q38A 3VWKC 3DV6B 4OSUL 3TIDA 1URIA 3I02B 4FXGB 2V2TB 2NLJA 2QKIB 1J1OH 1HCFX 1IFHH 4TNGA 4ZUVA 1ACYH 3OJDA 3EGXB 2HJKA 2YEQA 3TYFB 5K9JH 3PXJA 1IILE 5EA0L 5DVMA 2EXWC 3C6LA 4JHZA 3HLAA 1GYVA 2X9ZA 3TA3A 4AQAA 1QWHA 3KPRE 1LTXA 4PJXB 3SQRA 3V95A 3LKNA 4FG0A 1EEQA 1YSOA 4L4TB 2BK8A 2N7AA 1MIEL 1XAUA 5D5ME 5IT2H 2I60H 2CNYA 1AGFB 5LGHH 3F3HA 1TSHA 4AM0B 4NQXA 1YUHB 5HYSA 2F0CA 2NNAB 4NQUA 4YPGA 2XTJD 4XB7A 4BJLA 3WE6A 3V55A 3EYOB 2CO3A 2CUIA 3HZ3A 1RIVL 2A83A 4ANKA 1YEHH 2QKSA 4YWGL 1L9NA 4RVBA 1CQYA 4C55A 4UQIM 1NCJA 4JUSA 1A3LL 4M6NH 4KKAD 1U8CB 2J88L 5CGBA 3ULSA 2FD6L 5I1HH 5E4EB 2ADFH 3R4DA 4CW1B 2IADB 4C58B 1HSAB 2ZAGA 2H8PB 2XWRA 2ZP9A 3UZEA 3ZT6A 2X5PA 4XNMB 2WUBL 4PJ8A 5DD5L 3OB0H 3LDBC 4LLWA 3UBXI 2CDFA 4Z7UB 2NY5L 1XB8A 3MLVL 4DP2X 1H6UA 1E8XA 1I9IH 1JZHA 5GHWH 4AQ1B 1RIHL 2KERA 1QVOA 5AOMA 4KUZH 4JFVA 5E99L 3T9WA 3L5XL 1PJ9A 4GT0A 1RKRA 3OZ9H 1VZGA 1T0NA 1E27B 4PAZA 1Q0YL 3BUTA 3MA9H 5CEYA 2ZUQB 4DGIH 2AK4E 5HVWA 1QSFB 1J1PH 1N18A 5FAAA 3RY4A 3UYPA 2PTUA 2W9LA 1BZ9A 2XNAB 3KPQB 1T03H 2HT4D 3ULUF 2X4SB 2FBOJ 5IB2B 2DWYA 4YE4H 4KO9A 2XCMC 2DBJA 2JIXB 1FNAA 4WDIA 3UC2A 4F58L 4BKSC 3UEQA 1LWRA 5B8CB 4MNGE 1WC7A 1CVSC 3E1ZA 3L3HB 5HGAA 2OMTB 1CICC 2VMJA 4JDTH 4AQEA 3FF7A 3V4VB 2E4FA 4YHZL 5AVYB 2WKOF 4K7PH 3VFPA 3Q6FB 3MOBL 1QR1A 4AZ8A 1OAQH 2HJLA 4K4KA 3SGJA 4FEMA 2QQKL 4G82A 4FAAB 1NFIB 3HI1B 2R69H 4WJKB 1MCWM 2WBJC 4P2OD 3Q43A 3MR9B 3LRHA 4OCNC 4NRXB 5D4JA 5T5FA 3TT3L 2Z65C 1VEMA 1QR4A 2EC9T 5HDWA 1EXHA 1N4XH 1RK7A 1MFAL 4NYLA 3N06B 1QFWM 3V4PB 2H5UA 1W8EA 3TONA 1EFXD 1DBBL 4UT9L 2J7LA 4K7PX 5EBMA 3HHSB 4JANB 1P4BL 5GRWA 1XGTB 1ZT7A 1IM3D 1D5BB 1I8IB 3PUCA 2WNGA 4FQIH 2DRUA 4MS8C 4OFPA 3V0VA 2FJGB 4O02B 5AVQB 1MFMA 3VWJA 3T5WA 5M94B 1JL8A 4PJDB 5GSVB 1Y6KR 3RIAF 2E9BA 1FF5A 5ACLA 1XGTA 5D7HA 1ORSA 4NN5C 3QZWA 1A65A 1JP5A 3T0EE 5F1SA 3SKJH 3QIWD 4YHYC 1CFSA 4PIRF 3ULVE 1IAIL 4NYLB 5DQDH 1S7VA 2V8LA 4KJQD 3T3PB 5JW5B 1SNRA 1FZMA 1QFOA 4EI5D 5GQBA 3QXTA 5IHLB 3IBOA 4NQDA 1PSKL 1N64H 2QDWA 1WQVT 4NRXA 1IU1A 1YA5A 4U1NB 2HTKD 1DSYA 3IJ7A 1I3VA 4PRAB 1I9JL 3N0AA 1SEQH 1WTLA 3RWDB 3EO0A 4XXCA 1R1CA 4HEPA 3MRPA 3O45B 1J9RA 3B8YA 1NJ9A 2CR3A 4LEXH 3QQXA 3R1GH 4NJAH 1XTLA 3Q6FA 1HL4A 5DZAA 1S7XB 2ZXQA 3QQ9C 4I48B 5E8NA 5D1QB 2A7BA 3HI6L 2V8MA 4R96B 4WO0A 3L95A 2W38A 3D7PA 1H15B 2YPLB 4LFHD 2Y23A 3FQ4A 4XX5A 2JIXA 4D2NA 3S9DB 1MLCA 1Y1UA 5DJDA 1Y0LB 3TYGH 3VGGA 2WQ8A 2XNAA 2ITFA 3TCTA 3X13B 5C0EB 1R5IA 3C8KB 5LBSH 4Q9QH 3RZCC 2DY2A 5CILH 4BFJA 5CJOH 4XMPH 2UUDK 2AVFA 4PP1D 5F89A 4NQCB 2DQJH 4F2ME 3BSZL 1OB1A 4WFHE 2P5PA 5GS0L 4QRQA 4RSYA 3BSZH 2NSMA 3H56A 3O9WA 4HLZG 3DV4B 3H8NA 4OCSL 4OZ4B 4WUKL 1BDYA 5EIVA 4HLEA 5EN2A 4UUJA 2HH0L 1UACH 4XTRD 4GRMA 1QSFD 3HN5A 4MD5A 2ZSVA 4PJ8B 2R51A 4UAOB 4XMVA 4YFLI 4JLRA 3THML 3RZCD 2DQIL 1WWBX 4PP1C 2BNQB 4N2AA 1OZTG 4XXCC 3RWGB 4B9ZA 4TOYL 4WWKA 1S7WB 3L7EA 4L05A 5IMKA 1NANH 4FEIA 5LBVA 1KNOB 4RGOL 1KJ2B 3DHMA 3NIDB 4ODSL 5F3HB 4ALAL 4UTAL 3KS0J 4L8SA 5IMMB 2FGWH 2ZG3A 5DU7A 3S96A 1NBCA 4WGKA 2XYBA 4M7ZB 1OL0A 3I85A 3EBAA 3BEWA 2CNZA 4OI8A 1PD6A 5JW3L 2YEVB 2VAAB 4PN6A 4JPKL 5FYLL 1UEYA 3VFMA 1AC6A 3CDCA 4ONFL 2BVYA 5HDQL 2Y06L 1HINL 5B38G 5I1CH 4JS7A 5KSBE 1AGFA 1MNUL 5EWIL 5GZOD 2JVUA 2CIIA 3WS6C 1FFNB 2MOVA 4JY4B 5KBMA 4F37F 4L4TA 3BIKA 2XIDA 2NW2A 2YKLL 4TLTA 1E3FA 3NZ8B 5D70L 3P11L 1P7QD 4RRPA 1WZKA 4DP9X 5FOBB 5F6IC 4ELKB 5CFHA 4YHNB 3QZMA 1P1VA 1RPKA 5FYKE 2DIAA 3T2OA 4ERSL 1TJHH 3TYFA 3VB8A 5DJ2A 3GSUA 4RFEA 4POZC 5HTSA 4Q9QL 2R0LL 3G6DL 1TTRA 1BFVH 3U9PH 4PTTB 1FLTX 3HNVH 2GJPA 4NJ9L 3VXQB 3X1NA 3EHBB 5E6IC 4XVOA 1JAEA 5DEGB 1VFBB 3L5IA 1ET7A 3RVWD 3WNJA 4GAJH 1DBBH 2UVEA 1XGZA 2EEXA 1T1XB 2HPOA 2FSEB 1ONQA 1A6UH 3VXRE 4JM0A 2DLFH 5SV4A 3HCVA 2F5BH 1AGCA 4AOFA 3VDAA 3V0IA 3WFDH 3MOAL 5FHBH 3HBZA 5LQBL 3MKKA 3HPJB 4LAJH 4BRVA 1AR2A 2EINB 3N1MC 2EDWA 4U3SA 2A9CA 1OCZB 2FYYA 3O8XC 3OJMB 1KEGL 3V6OC 3KJ6H 1RZJL 1A66A 3I6SA 5T1KA 5D4HA 2TAAA 1A6ZA 1BECA 1P7KA 2QPSA 3RBSA 4L29B 4JDZB 2LTQC 3W0WA 2F8IA 5IWLA 1AZVA 4XP5H 5D2LF 1WAAA 4MFHA 4JGMA 3TWYA 5DMKB 2X9YA 5GGRB 1BAFL 1R75A 1TVBB 5C71A 3AC0A 1IC0A 4TNVK 1OP9A 2GC7C 1MAML 3V9FA 1ASQA 3CFDA 4K73A 1DLFL 2R56L 3RKPA 5C0CD 4Z0BL 3DTXB 5E56A 2BWIA 4UANA 4ZX6A 3AFLA 3EJQA 3OXRA 4A6YL 2G4EA 4AYBA 4KQ3L 5HYEA 4LAQH 4CKVX 3QFJA 3MLYL 4MAZA 4QXGH 4XB3A 5AZEL 4O2FA 3MLXH 2P43B 3FB8B 3GMOA 5D71H 4R84A 2WZ5A 3MRRA 4I3RH 4YFLF 4HCRA 5E00A 2FJHB 3QQDA 4GKLA 4K8RH 2PLTA 4Y1AA 3RUGB 3TEUA 1BYOA 2F74A 1ZJAA 4ENED 3P0YL 4KJPC 3MRFB 3RPIB 3BPOB 4RMUA 2HLFD 5I71B 1NSNL 1H3TA 2C8NA 3GS7A 4I89A 1ZVYA 5TK2A 2HMID 3VQ1C 3VI3B 2HKFL 1WAEA 5CR1A 3UTQA 2XPGB 2E3VA 4BHUA 1MFBL 1KB9K 3OSKA 5CHNB 3CFJA 5CEZE 4DZBB 1IL1B 3H9SB 4LKXA 5JOPE 2WWMC 4X8GA 2H3NA 1Y6NR 5ICXB 2YQ2A 4P59L 4DO4A 4PRBB 1A8ZA 4IIQB 3B9DA 4IRZL 5E6SB 4NKDB 4X6DF 4PBDA 3SOBH 1RH8A 3V4PL 4HSQA 2C9SA 3B4NA 3IDYB 1SJEB 5I74B 1ZLEA 1GYUA 3F7QA 5ANME 3BP4A 3OMAB 2PCFA 1T22A 4P9MH 2PUQT 1QBLL 3LRGA 3QCTH 4Z3FA 3BRFA 4WNQA 1PZ3A 2IPTH 4I13B 4TLUA 3DO7B 3QISA 4OZIE 4YXLH 3CFKB 3T8MA 1BJ8A 1IX2A 2VDOL 3EYFA 2DTML 3Q1EA 1QNZL 2XN9B 5SWSE 1WAAF 2O6DA 3GSNH 5C92A 5KJRH 5DRWA 2JIXD 1FL6B 1PZUB 1U8MB 3WEBA 1BBJA 4XE5B 2VSDA 4IMKC 3NJNA 4P9HL 2Q2LA 3BW9B 3BXNA 1EHLH 2CXKA 2NR6A 1NUFA 3RA7H 3DHUA 3NJXA 3TVMD 3SBWC 1U41A 4X4KA 2E76C 2GUOA 2GTWB 4JFHE 4MA8H 2Y6SD 4LDOB 2XKUA 3KPRB 1CTMA 3WXVL 4TL4A 4XH2B 1J0IA 1JZ7A 4DKEH 1FVEA 3BE1H 3BVXA 4JL2A 5EC2A 2AJ3B 1UWGH 1RUML 3TA3D 4M3HA 1SMOA 1RZFL 3ZTDC 5DS1A 3D50A 5KJ4A 4JHUA 5FYJH 3PWPB 3H4HA 3F7VA 1DBKH 1FBIH 3DUUA 2ZUWA 1CB4A 2H32H 2QVIA 5JR1H 4QEGA 3BUQA 4GG6F 4XXDB 3R8BB 3QJTB 5E2WL 4FFWC 4LQFH 5T1LD 2GFBA 3VFTA 1RVFH 3SDDA 4GBXC 5BJTB 3A6OA 3CWGA 4I7ZC 1O9ZA 3B34A 1FFOA 4RNRB 1LDSA 2YKKA 4P5TC 4LVNB 1XF2A 1UUSA 1NLDL 5D9SA 4JRFA 4MSWB 3VXSA 4P4RA 3PFQA 4YXKH 2NY0D 4CKQA 1PY4A 2P8MA 2R15A 4PCTA 1IEHA 3CZLA 3OAZK 4KK9C 3U9UA 7FABL 2DQIH 1R5VA 2BH0A 1XSIA 5TF1H 4FA6A 3GJFA 3LKQB 3S3PA 2B59B 3IN2A 2JK5B 2X6CA 3CPLB 1SBSH 2IOOA 3F7YA 4AUJA 1RZQA 3RRQA 3FT2A 3OHXC 5HHXH 3QG7H 4I2XE 1G87A 5IVXE 3CXDL 4G6KL 2IPKB 1NFDF 4XHJD 3NACH 2BSCA 4AQ8C 3MV9D 2HSIA 3WSQL 2IH8A 1XZWA 3TO2A 4ZTOH 3HR6A 4Z3GA 3EKCA 1NDGA 2SODB 4JRWA 3AU1A 4MNGA 1I31A 2IWGA 5KS9F 5IT2L 4LL1A 2VZSA 4MWFB 4PW4A 1P69B 4PRHE 4XP9L 3HN8A 1NGZA 4MRBA 4XBGB 2R4RH 1J7VR 4G8IB 3RQ3A 4YSOA 3RGBA 3TBTA 4PUBL 3K1DA 3BUDA 1MJ7L 3Q8FA 4ZMQA 1KTDB 1BEXA 1FIGH 3N41B 1VRSA 1F8TH 2BSSB 4OKVA 4PB9L 2QT6A 1M71A 1SHSA 4WNSA 3SGKC 3KJ4B 2UZIH 3WUWB 1YPZB 1PU0A 1Q9KB 3FPYA 4OCYL 3UGXA 1BZEA 4ZOCA 1ZHKA 1XCTA 3TZVD 5KEZA 4G42A 2CR0A 1MCFA 3O8XB 5I0YA 4XP5L 2DQEH 2WXQA 2XQYA 4BFIA 5EIQA 5GGVL 1TO5A 3VAEA 4BA0A 2ROXA 2D4DA 1HOEA 3T4YB 2NTFA 4NRYB 4MJIB 3PLYA 3BFWA 4N4YB 4UQ3A 3U4EB 1BQLH 1WHOA 3QIWC 4JK0D 1S9VA 1HQ4B 1YEGL 2FBJL 1YPZE 5FO2A 3MJ8A 2A99A 3PIQB 2YD3A 2COQA 5C08A 1BQ5A 1MW3A 3SQBB 3DROA 1RK1B 1A7QL 2IAMC 4W9EC 1WD9A 1QLRB 2BVPA 3MLRL 4FE9A 2DV6A 3A6BL 3SGJC 3H4FA 4NT6A 3S37H 3NSFA 1DBAL 4G1MA 1KOAA 3J07A 1BD2B 1DQQB 1QRNA 4P99A 3M7OA 3V6FB 4KKLC 4Y9FA 1P6FA 2GW5A 2D7OA 4HXAL 1FN4B 5IJVA 4EKXA 1XR9B 3SD2A 4ENEC 4JMXA 4QKXB 1KB5A 4NFBA 5IF0B 3UO1L 1T7ZA 5I2IB 2ZWLT 3PJSA 2XZCL 2VQUA 5EU6A 1KGUA 3IKCA 3RKDD 4RSVA 2PP7A 3QHZH 3KLHC 2BIOA 4RFOL 1OAQL 1T4WA 3QB7C 4LMQI 3UTTE 1GOFA 1BIIB 1IGIL 1AZNA 3X2QB 4QHKI 4U1SB 4QXWA 3ZDYE 1KYDA 4H26B 5E0FA 5IK3A 5E2VH 3LH9A 2F18A 4NUGH 1I1FA 3ZT7A 5H2BB 4IU3A 4KC3B 1MPAL 4MVBC 1BFVL 5KBNC 3G6JE 3PGDB 5K9QG 1JWMB 2FNWA 1MPAH 3ZSSA 4DGVH 3ZYOA 1EWHA 3EJSA 4JO8A 2X2UA 4UYQA 3LDBB 5KOVC 2NY6C 3LS5H 4PHZA 3IFPB 1SJXA 3T71A 4E9TA 4UINL 3VXRB 5D72H 3A4DA 4KQ4H 5D1ZA 4B3VA 4UU9B 2AXJA 4Z76B 2XWBB 3IDJA 1R3HA 1ZKAA 3BHBA 1ADQL 5A40E 3LZPA 2R9HD 3ZO0A 4G1EA 2C5DC 5I1JH 5EPMA 1NEPA 2VLKA 2JCCE 5IB1A 5B7MA 3JXAA 4QOKA 4X9YA 5DTFA 2F1AA 4R7NA 5I1JL 2BY2A 4JPSA 3O6FB 1N9PA 4G6ML 1VFUA 3C87A 4UMGA 4W4NA 1A7PL 4XC3L 5ITBH 4X4ME 3JTTA 2R27A 1A7RH 4PRDB 1QSFE 1HC1A 4FQLH 5IQ7L 2IBBA 2EE2A 3HAEH 2EYTB 3TEXA 4UDTA 3I84A 1UM4H 2BIMA 3KWWB 1AQMA 1YYCA 4DKEL 3B9EA 4HK3J 2VL5A 4D9RD 5MERB 5I30L 1OGAB 1IV8A 2XXCB 3HE6B 4XMUA 3SOBL 2I26N 1YN7B 4FZEL 4LDLB 5D1ZI 1GH7A 2ITDA 4XB8A 4IEFA 3RVWC 4N26A 3VD2A 2QPUA 4MJ5B 2BP8B 3IFLL 2NY0B 2XDHA 5D7IF 2VDOB 1YEDA 2G9KA 2BWQA 2F7PA 4ACTA 3SCMD 4F7MA 2XI9A 5A6MA 5FO8A 1ZCRA 1U8HB 2NT1A 1PAZA 4ODUB 3PDOB 4XP6H 5IQOA 2MKLC 5TGBB 5EF1A 2D9QB 2B1HL 3OSVA 2A6JB 3SKNB 1FNHA 5F70A 3I3BA 4OZIA 2EDJA 4PJIB 3BAYA 5DI8A 1YMMB 3K1KC 4PVNA 4DK3A 2X6BA 2ED6A 1MJ8H 5LJYH 2KLTA 1MHCA 4ANWA 2QV4A 3V79C 3P2TA 2YD5A 4GUPB 2IBZY 5TQ2H 2A4ZA 2Y24A 5AW5B 3IFNH 4QO1B 3DOSB 4KO6A 1BXVA 2HP4A 4NQTA 2R2CA 2VWEC 2AEPL 1MUJB 3VUAA 2R69A 3M1BB 3SDAD 3H9SE 4ZQTA 3QPKA 1CFVH 4WI2A 4QRPB 3MRBB 3GHBH 3VJ6A 3TIEB 4LCWB 5JORB 1PSKH 2MOGA 2PP8A 1ZIAA 3D52A 5AVSB 3SE3C 2GIXA 3D69B 4PRNB 4YGAB 4PR5B 4HIHA 2KBGA 2NR6D 3L3KB 3WKNA 4P57B 5C8JA 3CZNA 5AYUH 3WHE1 1HL8A 3B2PA 1LO0H 4KITB 3LIZL 2YGNA 5AW2B 3HPLB 4CBPA 1NBZA 1R3KA 1A3QA 2ZPKH 2NOYA 4NXKA 2VLJE 4RAVB 3T0XA 4PRIA 5IHHA 4H4NA 5CLWA 2K3TA 3KYOA 4CSTA 5K39B 4Z5RA 1HHKB 4K23H 1PY9A 2ZNWA 1C16A 5EUOE 4EZKA 2GKIA 3PXHA 4WHYG 1ZEAH 4POYA 1F8TL 4K8RC 5MEQB 1TLKA 1J8SA 4PTUA 1J8HD 3EAKA 5LCVH 5K9OA 5K93A 2Y2WA 3TT1L 2R69L 2FJFA 4U6YA 1CU4L 2DMHA 4GRLD 3WU1A 1MLBA 1MQKL 3NCEB 3QQ4B 3IXTB 3KYKH 5IEHA 4JM2B 4AV0A 3KL5A 4NZRH 3ESUF 3L5HA 3UYRL 2PW1B 1USZA 3FQXA 4TNWK 5DRZA 4WJ5A 1E28B 4YHOL 3ARQA 4N90D 1OE3A 3LS5L 3DOHA 4IBZA 3HC0A 3CUPB 1OD9A 4FQPA 1BMGA 4E9XA 5AB9A 3EG9B 3LEVH 3UADA 4YDVB 2K8MA 1J8RA 2D2OA 4L9LC 1F4XH 4QRRA 1DFBL 3RTLA 2E46A 3Q6GH 5BV7C 3LRSA 4EBQL 1XWVA 3MA9L 2AXHA 1PNCA 5T3XD 5A2AA 1T03L 1HEZB 4A2LA 4LEOA 3CQPA 3BGFB 5E2JA 2FECL 3EOTH 5E9DA 3BT2L 1HJBC 1ECYA 3GTNA 3SY0B 2YBGA 1GGYA 1HINH 1KGCD 4F33B 3POHA 4XCYB 3UJIH 4HKBA 2DDQH 3ILQC 3MLTA 3PE9A 2F53A 3O11A 1CYGA 1JCVA 2IV8A 4PBXA 4U1LB 1OAUL 1GOHA 1W16A 3PXLA 2FEDC 5F7WC 3S48A 4HIJB 5F93C 4JFDE 3FRPA 3ZU8A 2CO7A 4GSUA 1Q9LB 5IW1B 5IW6A 4TUOA 4WV1A 1HE7A 3SYOA 5GZNA 3US9A 3ZTJH 5K9KB 1SHXA 3U1PA 3BAIA 2R0LH 1G6VK 3BQUB 5DK2B 2CO7B 3O6MH 3FU5A 4X7TB 4CVZA 3FB5B 4AE0A 3AY2A 3K2MC 4RBPH 4U1LA 4E42A 3NSJA 4W70A 2F53B 3O11B 5CEXB 3BZEB 2GBVA 3A6BH 4FLRA 3QS2A 4YN3A 1QW8A 3PNWA 5KBLA 4KXCA 1HZLA 2CKBL 3BPNB 5LO7A 3S4SA 3MLWH 3C09B 5C6TL 4ZYKB 4WCYL 4Q8BA 3ZE0F 43C9A 4HMCA 2BP3A 1GGTA 4U6XA 1I9RL 3UZVB 3PHQA 4KI5D 4QHLB 4GAGH 4IK7A 1QYGH 3P0YH 3NIDE 4ZX5A 3S35H 3GBML 2WXGA 3C5ZA 1M7DA 4P3CH 1ETJA 2UZYA 4GRLA 4YDVA 4DO6A 3TA4D 4NBZB 3L45A 3SGDH 2K0RA 3NCWA 3CXHJ 5I8CA 3HC0B 4N25A 4CN1A 3OAYK 4YHKL 5E1HB 3QZNA 5GZOA 4WJ5B 3Q9PA 4BFEA 2PW1A 3WEXA 3T4AA 1HCVA 1TPXB 1EERB 2MQ0A 3S7GA 3ZZLA 5IEHB 4RESB 4J3OH 2OXHB 2FLBT 2H45A 4H20H 2EAEA 3S3DB 1YDPB 3QE5A 4WWID 2QQKH 3GRWL 3RTQD 4JHAH 4PRHB 2Q86B 1NUGA 5I19H 5K9OB 5LNDA 2D9CA 3KYNA 4JFEA 4AL8L 5F71A 1AP2A 4XZ4A 3FSWA 2GSGA 4HIEB 1YNTB 5I0ZA 3L3DA 4Y4HD 1PFCA 2HG0A 4Q4IA 1DZ0A 4H88H 1B6DA 1HAWA 5GRZA 1OSPL 4NZUH 5K39A 5SWQB 4FQHB 2WXJA 2N0KA 4Z3TA 2XXFA 4KI5E 5EOTB 3RBGA 3DOIA 1AQKL 2BVQA 2LAGB 4HGWB 2N7SA 5GJSH 4GAFB 5FXCH 3CXHK 2NY3C 4LO9A 3QNYA 3BDYL 1JXKA 3ME0B 1MZZA 4TVPH 3VRIB 1I7RA 1NTDA 3F7PC 3K8LA 3UMTA 4BXVA 1U58B 4BFGA 4JCLA 1N6QL 3JUYA 1G6RL 3FL7A 3VMOA 3F05A 1DEEB 3ROLB 4PR5A 2WIIB 3RGVB 3ZIMA 3B2VL 2WW8A 2YIHA 3G9VA 2FEEL 4WSKA 4Y5XB 5DSCA 5CCKH 1BBDL 3NABH 3RE0A 3FQ1A 4NUJA 3RZCA 4KZEH 3STZA 2BNQD 2W95A 2LU7A 2QPFA 2A73B 2EIJB 4ETYA 4Y2DB 1BWMA 4DNLA 4YSUA 1JNJA 4N0FB 3SE3A 1H3UA 4B96A 1GGCH 3ARXA 2ICWI 2KH2B 4YE0A 5DWPA 4F2FA 2Y72A 4BQ9A 4CN4A 1ZA3B 4GUPA 3UGEA 1G1OA 4J7RA 2WB1A 4RA0C 5FWQA 5KVDH 1A6TB 1NBQA 1SYVA 5T3ZD 2JB5L 3QWQB 3ESOA 1N7MH 3HC3H 2Y0SA 4XAKE 1OGTA 1YYLL 3L1GA 1NC2A 3KPMA 2EKJA 4XRCA 4E9YA 2WTOA 5HVGB 1OSZA 2O61B 1HEHC 1OARH 3PDOA 2PN5A 2IH3A 2QTVA 1PKQB 3D30A 1L0PA 2FHBA 1D5XB 4TN9A 1UH2A 4XVTH 2F53D 4O51A 4JFSA 1CGTA 4DGIL 1N5YL 2HVKA 1INQB 3RP1A 2A9BA 3VFWB 2BIIA 5J3HC 7PAZA 5FW7A 3DVIA 4JDVB 1OGAA 1UB6A 2XKSA 5F6HJ 3KWWA 3NJKA 1JPSH 1V3MA 3LN4A 2EYTA 4PJBE 1GAFL 4GLRI 5JA9A 3NTCL 4O02H 4B9YA 5IHWA 1L9PA 4OZGE 5D7JA 3IMTA 5J1TC 2F8VA 3PABA 4PY7B 1BQHG 1FC2D 1XH2A 1WUZA 3Q2NA 5LVEA 3LZOA 4G1EB 5EO1B 3O2WH 5FYJD 3LN4B 1AY1H 2YD1A 2KPWA 1INDL 3BHBB 1RUQL 4ZS6D 1Z9LA 2XWBA 1M7IA 1LP9B 3IDJB 1UG9A 3IU4L 4UU9A 5D1XA 3LPFA 2X70B 1L7TL 1QFHA 2LLNA 5HD8C 4HV8A 3TJEL 4JQIA 1CLOH 3REWA 2CGYA 1HE8A 1RZ8A 2W65B 3DTUB 5CWSA 3DVNB 1G1CA 4ZO9A 1ZLSL 2K7PA 4CGTA 2X28A 2YMTA 1D5XA 3T09A 5I6OA 1J8HA 1NGXB 1DDHA 2J8UF 5ANMA 1QI5A 3TJHD 1KPVB 1M6OB 1RD6A 3F64A 5ILTH 3PGDA 2ZE0A 3FO2B 3KPMB 2AI0L 4N9GA 4DN4L 3EYSH 3NJFA 1CGYA 5KTEL 2DH3A 3VYNA 3B7YA 2EUWA 1ND0B 2WOBA 1MFCH 4JDEA 1KTCA 1A6TA 2WNWA 4X83A 1OOWA 4LRNH 1U2HA 2OSYA 1P7BA 1F11A 3LSOA 1LMIA 4IJ3C 4XO5A 2ED7A 3MLRH 1KIQA 4M1DH 1CF1A 2BCKB 2BMKA 5FM5M 3NGBC 2BRQA 5D6CB 1A7QH 2VZ3A 3FB7B 4XNZC 1QRKA 3HI5L 3KDPB 1YVLA 1QP1A 1Q4NX 2R23A 4PS4L 1W0YT 2FJUB 2J1KA 3DDGA 5D7KD 5TE4H 1PJWA 1R4XA 1XVSA 2O5XL 4LHUG 2YFOA 3OB0K 3O3DA 4IKJA 2ZX9A 1NC4B 3E3QE 4ZTOL 1U3ZA 1XH0A 1EZLA 3L8QA 4M61B 1RK0B 1CI5A 2X3BA 2XZAH 4NT6B 1UADC 3VSQA 5J57B 1I8MA 3HUJE 2NXYD 3NJLA 4UZSA 1QKZL 4CMMB 5DVNA 1LP9E 4B0MM 1OLZA 2V9QA 3G08B 4BINA 3ZDYB 1DJXA 5JIIA 1OTUC 1KEGH 1ZEAL 3TC9A 1EGJL 5EUKA 3O8XD 1XH1A 1FIGL 4CU8A 4YHKH 2D73A 4UQ3B 1KT2B 3T4YA 5AFAA 3QDGD 3SE4A 1G5GA 3VYPA 1WAAE 4EXPX 2OSLA 4NBYB 4ZW3A 4N2GA 2ZKHH 5D96B 1MCQA 2NDFA 4IKLA 4NJ9H 4Z9KB 2XIIA 3DYMA 1L9OA 1TU2B 3ZL4H 2GK0A 4N8UA 1L5GA 3WUWA 4GAJL 5CD5C 1LE5B 1N70A 2B4CL 3FKUS 1GJIA 3FQWB 5IJDC 1CXIA 2F8OA 5CJQH 3KGSA 2OXHA 1EHXA 2DI8A 4XAWL 4FDWA 3MLWL 5JYMA 4HALA 3IGFA 5CJQL 1ZLDA 2IGLA 3ZSTA 4J4PA 2ICWA 4X6DB 1XMWA 3QI9D 3QIUA 4H40A 1W72A 4XN7A 4ABQA 3RB5A 5AG9A 3FT9A 1JHTA 2EIZB 2P5WD 3AT0A 1OCWL 1JMXA 25C8L 3DSNB 3KW8A 3RIFK 3UJJH 4X5LA 1JGLH 4AX3A 3AU1B 2E7DA 4UM9A 4LCUB 2E0PA 1UM6H 2Z7ZA 4UNVA 3B3IB 3SO5A 4PJHE 1G84A 4XVSH 3OL2A 5IROD 1QO3A 5JIHA 1YEEL 3DX9B 5AVVB 4FLSA 5AB1A 3MV11 5ESAA 3QJFB 5MENE 3P0GB 43C9B 4IIQC 4G9FE 2WXIA 3UIYA 3FOLA 3TBCA 5HGHB 2K6WA 2QVFB 3LHAA 4KKCC 1EEZA 3WBDA 2YGOA 4UIMA 3T4AC 3QWRD 3KLAA 4R2GD 3BZEA 2E56A 2F58H 5C7XH 2ITCB 1QFWL 5ISZD 2M2DA 3PV6B 4KXDA 2GVYA 3NIDF 4RZCB 5AW4B 3TNMA 5DLLA 2AEQH 1XF2B 1YYMH 3KXFE 4HT1H 1NCAL 4CNIA 4UTBA 5I66B 1NL0L 2XZZA 5T1LB 2Q76B 1LILA 1OSPH 4NZUL 1WFJA 4DPBX 4EUPH 2R2BB 1A0QH 4TUOB 4V1DE 3VFTB 1VGEL 4IKNA 4APXB 1JVLA 3AWEA 2WNXA 4L37B 4OVUA 1NCTA 5CILL 4OF0A 4HIJA 2XY2A 4H44C 3QIUD 4K15A 5AOIA 1E43A 4UV7L 2WCSA 3EH2A 4MJJA 4HKBB 3GXTA 3ZZSA 2W59A 2DWEB 4M9PA 1SQ2N 2A0LD 4YSTA 1UA7A 4YXKL 3WIHA 4J6RH 4AQ1C 5LB1A 3O3UN 2VIRB 3SJVE 2WVSA 4P9HH 3V4UL 3HZYB 1CDJA 1D9KC 3KBEA 2MNJB 3ZKXC 1FVEB 3EJYC 4QJ3B 2TSBA 1LEGA 3CG8A 2PXYA 5E8DL 4IOIB 1ACYL 5TE6L 4X7EC 3GJFK 3OLDA 1UD6A 2OMYB 2ICCA 4ZUWA 3RDTC 2VDML 3SCMB 3ARWA 3UOAB 1RU9H 5DWUH 1UATA 4F7TA 1QPKA 2H9GA 5HDLA 3RNQA 1ZV2A 3FQXB 4X9GA 1E6JH 3DGGA 3F5WA 2WXMA 1S7UA 5I76B 1MAMH 1F4AA 4CGUB 2FQEA 4BDVB 1CE1H 3IXTA 5DMIH 3X12B 3DK2A 1D6VH 2AV1A 4P4KD 4Z0BH 1HN1A 2E7LA 2AJZA 3RU8L 1T4KB 4WNQB 1FFRA 1KN2H 2CCLA 5FYLD 1HWHB 4IGBB 4TF4A 3DJRA 3P73B 4DGWC 3D25A 3BGAA 5DZNA 2MCG1 3IMWA 3G6JB 3QZWG 2FQFA 4R4BB 5LBSA 4WKXA 4Z8FH 1ZT4A 1HHKA 3WFBL 3MNWB 1W15A 2IIJA 4OQ1A 3CZSA 5GGTH 2ZX7A 3LXAA 5IUSA 1ZS2A 4IGBC 1A4AA 2PYEA 2XBDA 5F7YC 3SYCA 1TR7A 1JPSL 4ANVA 3VI4A 4X4ZA 3F83A 1GGUA 3M1OA 4LCWD 3NZSA 3TJPA 1H6TA 1D5ZA 3LB6D 3L4WA 1AD9A 3R18A 4ZMLA 4DZBA 3QRGH 2YGPA 5CN1A 1B2YA 3FQTB 5HHMD 3KGRA 4V2BA 3DXAB 1HDMB 3ZE1E 3L3KA 4EIUA 1HHIA 3MROA 4ORGB 5I1GH 1WZMA 3D69A 3MLUH 4UQ9A 3WFDL 4A68A 1X4YA 4NAQA 4M6MH 3SE9L 5CGMA 1YY9C 3L2MA 4QRPA 5B3SB 1N0LA 4QYOB 3GI8L 2AABH 3MRRB 1MCHA 2Q9OA 2WTPA 4AL8C 4J8QA 3FB8A 5D1XE 5EU4A 1N7ML 1BXAA 5JQHC 5FUZH 1CE6A 3JSSA 1C12A 4IRJB 2MCPH 5JPNC 4M4PA 5EWIH 4PJ5A 3ZHDA 1QLEL 5HDQH 3M6DA 2G60L 2E9IA 4X80L 5ESQA 1T3FB 5E08H 4A38A 1P7HL 1YMMA 5BV7H 3W57A 1IGIH 3RL1B 2A6JA 1E9OB 3S37X 2P5WE 2B15A 4H8UA 1JVKA 4XODA 4NKOB 3WFHB 3CFNA 2AEQL 3EJRA 1X7QA 1LLAA 4NZRL 1W8OA 2I5YL 4MZIA 1Q9OA 3KYKL 4F9PC 4E36A 3VWJC 3EFOA 1CN4A 5J12C 1A6ZB 5IQNA 4J8RB 4I9WE 3FQUB 4IEFB 3FFCB 4WI4A 4YDIL 3HA0A 4Y5YC 35C8H 2LTQB 1U93B 3CLWA 5AOLA 3BVVA 1X5MA 3NSCA 3RIKA 2HH0H 2EIEA 5F0LB 5DYFA 1TO4A 2VL5B 5HYJD 2BHUA 1O7DC 3DECA 4AMXA 1D7CA 4KV5E 4AIOA 1QFUL 1URZA 4DN3L 1U42A 1V3LA 2LT9A 2PW2B 1X9RA 4WWPA 2V9RA 4L0PB 1B0GB 3FSOA 3ZXAC 5FYJL 5J6HA 4OV5B 4LKCA 3FFCD 5EZIH 5HDRA 3K80A 4TNWF 1WIOA 4N5ED 4OGZA 5D2LE 3QUKA 4PJIF 1PLCA 3KPOB 1BREA 4N6RB 4EXKA 4JQVC 5F7KC 2LHAA 2XPZA 1RZJH 4OLZL 4Z76A 1BJ1J 1JZEA 3NIFF 4RFOH 3QO0B 4GBXA 3UJTL 3DETC 3S5LG 5IB5B 1V3JA 1UTDA 3L9RB 4NHUB 4RFEB 1JV5A 2W0KA 5IMOA 4OFDA 3ZL4L 4R97B 3UGUA 4R26H 4OD3H 4WUUA 1E4XL 3T2QA 3RX9A 2C3GA 2BSEA 1H19A 1TQBC 1QFPA 1DE4A 3L4CA 4KHTH 1PZ2A 1ILSA 2YUXA 4OLYL 3K46A 3DYOA 4BBWA 1EZVY 4U0QB 4YVNA 1I1FB 2CHXA 4PP2B 5AYTA 4F93B 2BXYA 1WZAA 3ZKSD 1OAZL 3S8FB 2IAMD 4I18C 3ALPA 3QUZD 4ZAKB 3NIGE 4TUKH 4KK5C 5B39B 1X5IA 2Z0UA 1KXQA 2WOYA 3AY4A 3ZHLA 4FQXA 1UZGA 2L0DA 4IS6B 5E95B 4Y2NA 3VH8G 4QNPE 4NO5A 3D08A 3UTTD 2NY4C 4JB9H 4JZNB 3KYMA 4AYID 5F3HA 1Z0MA 2IVFC 4AEIL 2YPLD 4U1MB 3K2UL 4UQAA 1KNOA 1C8QA 5C0RH 3KPSA 3RWGA 2FWOB 4KVPA 3SGEI 1QRNB 2N1KA 3V6FA 3AXIA 2FWUA 3P3YA 4MD5B 3LNIA 3TFBA 1D2OA 3IDYC 1QLRA 2BVPB 2JMRA 1MRDH 2G4GA 1VIWA 1LEKA 1KCUL 4PRHD 2WD0A 3DROB 3FT3B 3MZGB 5G4OA 3M46A 4WJG3 4GSRA 1Q1JL 2B3IA 4RGNE 2C9AA 4U6TA 1ODUA 3FC8A 5F89B 1HQ4A 3QIBA 3B7TA 4NEHB 1KZYA 4LBAA 5JOFA 5JO5B 3EOTL 5B1JA 4U1HA 1R5IB 3CV5A 5CSBA 1BAFH 1WITA 2C34A 4PJ6A 2AV7B 2HKHH 4OZGB 2V5YA 1IB5A 4PIBA 1SVCP 1MH5B 1YPZA 3IBEA 1ZY9A 3G5WA 2YD6A 4DEPB 2E59A 3QNZB 1D3CA 2EDEA 2H1XA 5HD8D 4H2AA 1VFAA 2L7EA 2ZUYA 2NY6B 2OMUB 3H0TB 2ICEC 4K5MA 4WKZB 1U95A 4YBLB 4PRAA 5F9WC 3SYAA 1NGZB 1UA6H 2ZYRA 3BH8B 5GZND 1A4JB 2P8PA 3E6FA 4Q0XL 4G43B 5C3TA 3WO4C 4JQIH 4AVHA 2PXYD 3B7RL 1CF8H 1T80A 7CGTA 3DRQA 1CFSB 4Q2ZB 3TBYB 1AS8A 5J56B 2X4UA 3QUHA 5GJTH 4LVEA 3WD5L 4JFZH 1R19A 3Q2CA 2BZCA 3NCJL 2IG2H 5D7KE 1SRDA 3HFFA 5CP7A 1FCCA 4OJDH 5FA3A 3WMSA 1FBIL 3SKMA 3GBNL 4J1UA 1E5AA 5KSAC 2IAND 4O2EA 2VGLM 4JO4L 4M7KL 2IH9A 4S1RL 4XPGH 3U2SA 3TS8A 4OZFG 1RIVH 5E6ID 3OKNB 4JANA 5JW4R 8FABB 2ZG1A 4HJ1A 4MSWA 3VXSB 3TBYA 4WUUE 4JO2H 4NO2B 5EUOA 3LEXA 3AG1B 3L3IA 1ZXKA 3OXSA 3FH8A 4YGVB 4OIIH 4N86A 1SXZA 2P8PB 5KBPA 4FQ1H 2ZOTA 1D2PA 3SDDB 5E2UH 5F96H 3VXUB 3ULUE 2VXTH 3IFNL 4ZW6A 1F02I 3HG0A 3O4OB 4JFOB 3ULUH 4WKZA 3HI1A 4NWUH 5EU7E 1R3LB 3KL0A 3DUUB 2A9ML 1SF3A 2Y7NA 1JN6A 1L9RA 3MRLA 5IZ7A 3VFPB 3II3A 1GXEA 3HS0C 4AQEB 4NZJA 4OZHA 4QY8B 1WCBB 1B4TA 4K07A 1V3KA 5HDOA 1WC7B 3LNFA 4MMYB 3GMNA 5D2LB 3IWUA 3EYVA 4R7XA 4XCNB 5C0AA 3RVXD 3HMXH 1TZGH 1NAMA 2VDNB 4LEXL 5FB8B 1FE8L 3KPRA 3RWFA 1BYNA 1QSFA 2DKSA 1KXHA 1I9RH 2GUOB 4WFGD 5H35B 5EOQL 5CEYB 5L8LB 5J6SA 3BC9A 1E27A 5DZPA 2YO3A 2HRHA 3C8DA 1FO0A 4Q97A 5B3NA 5DMGC 6PAZA 2ZUQC 1QEWA 2AQ1A 4HS8H 3BW9A 2H1LM 3IU4H 1JK8A 4FFZL 5D70H 3BGMB 1N19A 2H1PH 4RWYH 3Q05A 4GG6B 1NIAA 5J1AB 4N2FA 4LLWB 1EJ6A 3ALXA 5AKVA 3GF8A 2HLAB 3QIUC 5DRWB 1NGPL 1T5WA 4OF8A 4S2SB 3KPSB 2B77A 5F21B 2IADA 3D85D 5LLIC 1YEKH 3HZMA 3WMQA 3DO7A 2KZBA 4U1MA 5HGGS 1T6BX 3ARDB 2AKRB 4WUKH 1J5OH 1M9SA 1T22B 1ZTXE 1WVZA 2MNWA 2VXQL 4LLDA 3KE0A 3S36H 3VRJB 2ZCLH 5GS3A 3GRWH 4FFWD 3MV8D 3CLFL 2YMXL 1TJGH 4N24A 2A83B 5DVOA 4RISH 2CALA 1E42A 5DQJA 4M3JA 1Q9WA 3ILQD 1ZHBB 3COOA 2H4EA 4IIQA 4UINH 4PLKC 4LSVL 5CBAA 1ADQH 2VDRB 1JZFA 3KAAA 4XNZB 5GS1C 1JWUB 2X2YA 3Q1SL 3WJLC 5CHNA 3BLPX 2WUCL 3LKNB 3VFGH 2VABA 4B9KC 4FTVB 2YUZA 5KYUA 4LSTL 4DETA 2KZ1B 4GQRA 1JDCA 4WUUB 1KV7A 3C6LB 5IBUG 2FR4B 4RRPM 3UZQA 3EGXA 3OJDB 3VRLE 3D85A 3VXPA 2F74B 3L9RA 5FX3A 1VAHA 4Y9CA 4LLYA 3FU9A 3STLA 1CG9B 4DKAA 1K5NB 2DIEA 3LIZA 3P11H 3OKEB 2QVMA 4EI5A 1ID5I 2VR3A 4KK5D 1E4JA 5C97A 3ENEA 2Z35B 1U8KA 3O4OC 4UV4L 1J9CT 1JWSB 4A2FA 5A2JH 4LASL 2ZKHL 4HJUA 4NQCE 5KJ7E 1GZQA 3D06A 3FZUD 4JFQB 3CFDB 1B0GA 3VMNA 2ZYHA 4PSPA 3TV3H 3TT3H 4JO4H 4M7KH 4S1RH 5L0QB 1KFAH 1MAKA 3M17B 2DH2A 1J88A 1DBJH 1FSKC 3Q0HA 3U2JA 4FABH 4GUOA 2NCMA 1Q90A 3I74A 3VXME 4RGNC 4OGXH 3GHEL 3VXNB 3VVVA 1ZLVH 3OGCA 2WWOA 1IM3A 2Y25A 4HUNB 2QEJA 3LRMA 1A6UL 4PJ9D 3WFEH 2IDTA 2NYZA 2D3JA 1MXDA 4KAQL 4P5MA 3QUYB 4NPKA 4OIIL 5FYKH 1OW0A 1P7KB 3GSNL 5AEAA 1C9SA 3D4CA 5C0JA 5C3IA 4WU7A 4KVCH 4P5MB 1OE1A 4WW2C 5F88A 4KZ0A 4TQHA 4X5XB 3O6LH 4HX1A 3UG3A 2A9MH 2ZF9A 5DD0H 4B9GA 2CSPA 4MAYD 4RMTA 1BM3H 4J3SA 4MNQE 4HLJA 5DJCA 1RERA 2BVOB 2XBZA 3BKJL 3MO1B 3PPEA 4KUCF 1E9OA 2E9JA 2VW7A 3LNGA 3WNMA 1RSFA 5KZCD 3GQFA 4K0OA 1QUPA 4P4KC 3L1OH 2EIDA 4P59H 2IANE 5ESQB 5IFAL 1HIMH 4M1CD 4D7PA 4OCRL 1A22B 3QP3A 2CZNA 2GJ6E 4OY9A 2AK4D 2DQCH 1OAKL 5JZ7C 3Q8EA 1VFBA 3MGOA 1SY6A 5MI0B 4YHMH 1J8HE 3B6SB 4M1GH 3CSTA 1BJMA 1PIFA 4D0BA 2C4FT 3ZDXE 2IH1A 3D85B 1JRHH 2BPBA 5AOKA 1L7TH 1EAPA 2XN9E 5SWSB 3HNSH 2J3SA 3T0EC 2P9RA 4BK8A 5BXFA 1ZLSH 4JN2B 1EJOH 2VABB 4NFDA 3NCFB 5E1GA 5MP6L 3DXAA 4KKLD 3CD4A 1FFNA 1ECZA 4DOHE 2EVJA 5AAMC 1D5ZB 3KL3A 1JWUA 3PQYA 1JDAA 3VA2C 5ABZA 1BVNP 5BZXA 2Y7LA 4HJTA 4JJHA 4HLZH 1X44A 1Q9WB 3MNWA 3RWEA 1A4BA 3NIFB 1YEWA 4P8QA 4PJBA 4R4BA 3MJ7A 3D2TA 3SPJA 4BZ1A 1B3IA 3O0RL 3AT9A 4JAMA 4PBWD 4UB0H 4UF7C 4EIGB 5AOZA 1BP3B 1UWXK 4H5SA 3P73A 1F5WA 1Z5HA 1F1DA 1MVFA 4G5AA 4YUEL 2C3HA 1JZDC 3HZMB 2KLSA 1A6PA 2E6PA 2IG2L 2NW3B 4UAHA 2ENSA 4I2XB 1PD0A 4NUQA 2WWKO 4OQTA 3VX1A 3ZTCC 4YXHH 5E23A 2DJUA 4L8BB 2HLAA 3MXVH 3OKYA 5JUEH 4ZX4A 2FYVA 2RCSL 4XOBA 4Y5VC 2IQ9L 5LG6A 1DDTA 5K9QI 1BPLB 4PRPB 2H9GB 2OMBA 3DV4A 5HHME 4NJAL 1G9MH 1QEWB 3FAXA 3VFNA 5HDBE 4EKJA 2EXSA 4N90E 3L5WA 1AZZC 5CS7A 2EC9U 3IGLA 5IBTL 2JELL 3ET9F 5FB8A 1LEGB 5LAXB 4J2QA 3CVIH 1T83C 1KB3A 2P1YA 4G7RB 4KMLB 3SSGA 5B39G 4UDUB 2A6KA 1GSKA 2W0FB 4LSPH 3RWCA 1FNEA 1WO2A 5F7LB 3KPTA 2R59A 1GJWA 4NM8L 2YPLA 4WWKC 5TE7H 3II1A 4A2EA 3HC4L 3H85A 2DQEL 1V7NL 1IAMA 2XWJB 1DVXA 1NGQL 3EHBC 4YHOH 4ZSOA 1S6NA 2WZPD 3ECBA 1G5AA 5CZXD 3U9PL 4FFYH 5TQ2L 4ZFGL 2FHFA 4JMNA 3AB0B 1T1YB 1HU8A 2YR3A 4JZOB 4CMHB 1VKXA 3E38A 3VG9C 5K9JL 4HAKA 3ZTNL 2VLKE 1DUZB 1PFOA 4FXKB 4JFOA 4IBUA 2V2WA 2BOCB 2Q8BH 4WTQA 5GJTL 4ODSH 4JO3L 2J1XA 2PO6D 1BA9A 4M5YL 3BWUF 2XWEA 5T1LA 1S7VB 1F41A 5I66A 4DW2L 3MCYA 2O6FA 2RH0A 3LH2L 4O5LH 3S3JA 3TNMB 5HSFA 1QYGL 4OCMC 2WBJD 4LPCA 3T0BA 2O93L 3N3EA 3BD3A 4XN2A 5EZIL 3MXVL 4EN3A 4JG9A 5F3FA 3A3YB 4Y5YB 4FG6D 3ZZQA 2VDMB 3UPAA 5EG6C 1NOAA 1NGPH 1OVZA 5TDOA 3VWJB 3OTTA 3V0VB 3FOLB 2HFEA 1I8IA 4AW4A 3FB6A 1WT5C 4YDMA 3ZDZE 2YD9A 1KC5L 4PBVC 4WTWA 5EBMB 1MCCA 4M02A 5CCHE 5I19L 4Q2ZA 1F45A 2YJQA 1KYUA 4LCUA 3L1FA 5BZZA 3FRPG 3BJ91 4G43A 1BVOA 1UWEH 4FMKA 5FPIA 3DSNA 4XBPA 1JHTB 2EIZA 4GG8A 4XGZA 3GSXB 4XBMA 4OLYH 1MQKH 3FQYA 4LMQE 3IAPA 4KQ3H 4K7FA 5HYJA 2ICWB 4X6DA 4X0NA 4I3SL 2PPFA 2WLLA 4ZFZA 3V6OE 4FS0A 1IO4C 4P2RD 1PX3A 2KMWA 7PCYA 3FQWA 1I9IL 3QNZA 5GHWL 4BE5A 4XWOD 2Z64C 5I6XC 2W9DH 3VFSB 3L3HA 3H3PH 3P2BA 2N3JA 5EN3A 3TFKC 1CGSL 1TU2A 4TPRL 3CX5K 4Y4KC 1QLFB 2ZXWB 4OZGA 1BFTA 1NWOA 2XZCH 4JZJC 3UH8A 3OR7B 4NQEB 3BT0A 3MRNB 1RIUH 3TM6A 3U2IA 5B7FA 1UH4A 2NY7H 3DK0A 4R7DB 3LIUA 3NSXA 3B9KA 3OG6B 1AKPA 2Y7QA 5ADOH 5DRNB 1WV7T 2CLVB 3QUML 4JO1L 3TCXA 4GRWB 4L2LA 4OZFH 2VJXA 1EMTL 3BMVA 2NX5B 1TVHB 4D3CL 4F9LA 5HPMB 4KO7A 4GKOA 1BYPA 5EUKB 1I7ZB 4N0UE 3TU6A 3ZKMD 4RCAA 4OFYD 3MLUL 3L1OL 1SM3L 5EZOL 2MSPA 3HB3C 1G9EA 1XGYL 3ZYIA 1LEKB 4WW2F 1X4XA 2AXGA 1Z6JT 4RIRA 1RHFA 5FIEA 2J6EL 1I8MB 4Z0XA 1KFAL 3K6IA 1RK0A 2ODHA 1UWYA 1I75A 4OGAC 2B9BA 4TULH 1AR1C 2FWOA 3QJOA 5FW8A 2Z4QA 4XMLL 4DOHB 4XN9A 3EFFA 2IAMB 4HCFA 1WS8A 1P4BH 5KN5A 2NNXA 2P7TB 1TQVA 3ULSB 5J11B 5FS5A 2BSED 5IJKA 3TBVB 4KNUA 3ARRA 1QD0A 3QQ3A 1MFAH 2VLJD 2VDOH 4L4VD 2BCKA 5AZEH 4IS6A 4LEBA 1BQKA 3UTTB 4OFYA 4XVTL 3C75A 4MX7B 3WE6B 3GHPA 4K3HA 2X1QA 3H55A 1O6SA 4FQQA 1G0YR 3ZE0B 2DQTL 5JHDE 4F57H 4GMSH 2CAKA 5EEUA 3E3QC 1L9TA 2UV3A 1FAKT 3MGAA 1MF2H 3QZPA 5DUPH 3K6OA 4JB9L 3MNDA 4N9GB 3HZKA 1FHGA 1UA6L 2B0SL 2YQBA 3TA3B 1SYSA 3EF4A 3HLAB 3CBJB 4AKQA 1IQDB 3V10A 4Z7NF 4QHKJ 1KIRA 3QZOA 4HWZB 2XVLA 4MAUL 4Y5XC 2UY6B 2OR8A 1MFBH 3HG1D 3CH8A 4JHWL 4I4WB 5IB5A 1RJLA 3GWJA 4TSAH 3K7UA 4F1ZA 4LVOC 3QO0A 5TFSL 2V2TA 3GZQA 3LOWA 2JKXA 1BZDA 2HN7A 2X70A 1I1AA 5DLML 1CICB 2GJ6A 4LSSL 5LN4A 5GS2H 1I7TB 3OPZH 4K5PA 4XI5D 1GRWA 3QJXA 3VNYA 1ZE3H 2Z1PA 2CDGB 3FBQA 2NY0C 3FOMA 2PWEA 2QPEB 2PNDA 3QUKB 5JW3H 2XG5A 1H8OA 3KG5A 1NDTA 2OLDA 3SGEH 5EEXA 4NSKA 4HEME 3BWZA 1ZVNA 2MWCA 4MXQD 4GO6B 5J6HB 2Y06H 2X41A 3GB7A 5DS8A 4LSUH 2EIMB 3SN6N 2Y6TE 3JBG7 1E2VA 2I9TA 4DIXA 3L5XH 4M8QA 2WM0A 4FYRA 4G3YH 1VACB 4FJZA 3BPLC 5CKGA 1VB9A 4GFXA 3GM0A 5AWNH 2D3VA 3FT4A 4HS6A 2IOMA 3H3KA 1NPJA 4MQTB 3AMLA 5BVPH 1XIWA 4JPWH 3VFWA 1AKJA 4CAGA 2BDNL 3N41F 2DYPB 1FZJA 3ARVA 3TO4A 3MVSA 1SOSA 3NZHL 4KI5F 2BDNH 3BZFB 3BX7C 2K6YA 1OAYH 4HUXA 2V2XA 2J4WH 5DYOB 1X7QB 4DUWA 1M1XB 1TTGA 3T8XB 3W82A 1OSZB 3N5AA 4GAYA 6CGTA 2QLVB 3F00A 2BFVH 3A4AA 3VSVA 4CA4A 1NC2B 1QLEB 3KPSE 4DP5X 3H3PL 3A21A 3MYZA 1FO0L 4S1SH 1JPFB 2EYSA 1P9MA 3UZEC 1EDHA 1SYVB 3IKKA 3PGCB 1KB5H 2B8OT 1AMYA 4UBDD 5LDSA 1KGIA 3HS8A 4JRYE 4L4VA 5DHYA 1YY8B 5DJZB 5DEFB 1H3PL 1C12B 2JFCA 4IRJA 5GRVL 3LN5B 4O4YH 5DJAA 2JH2A 1CGXA 3LVTA 1HHHA 2HJFA 4WHTA 4JE0A 2CE6A 1ADWA 1WUNT 1N0LB 4OFIA 3X3FL 1R5WA 4WRLA 3FCTA 4MJID 5BZDA 1O7VA 4FNTA 5KVMC 4OV6F 2F1BA 5DSCB 3VRLF 2G60H 2YJLA 3Q01A 4R4ND 3HJ0A 4X80H 2DIBA 1YLBB 3P30L 4X42A 2X1WL 2B7DT 2VDPH 3ROLA 1WHPA 3DPBA 4ZFGH 1U58A 4XHQA 4PJBF 5D8JL 5DURD 3TZVB 3ULUL 2IXQA 5TF1L 1AD9B 2M26A 3O9WD 1EX0A 4OH2A 5CJBA 1ZS8B 3MGTB 1UGNA 2GPZA 3WG7B 4J4PD 4BWUA 1C5BH 2CO1A 5KJRL 4FHBD 4TSCL 3BIAX 5KAQG 1ZT4B 4YDIH 2DKMA 2QGEA 2GSGB 4K3GA 1K4CB 4ADIA 1HKLH 3RAJL 4TVPD 2WV3A 3NEEA 3D25B 3QDGE 4P05A 4DVBB 1G9NH 2LVCA 4OZIF 1ZV5A 1JFQH 1F97A 1PVHA 1T4KA 4AGLA 3QPXL 3WTSA 4HSAC 4HOMA 4B7IA 3VDCA 4F3FA 2AV1B 1X5YA 3CAFA 1K8IB 2PTTB 1JNNL 2CBQA 3UJIL 3C5JB 5GS0D 3RFZA 4Y4HB 3NDZE 4XP9H 2C1PB 2E5EA 4P2OC 1XR8B 4X5WB 2R1XB 4K7PL 1X9QA 5I76A 4QXUL 3F5WB 1T1ZB 1M42A 2YSSB 3LJ3A 5A43C 5HP5A 1IC7H 3KJ4C 1A14H 1PX8A 1B9ZA 5I8CB 3CC5B 1JSYA 1SM3H 4GOSA 3GPSA 1M7DB 4LGSB 4TVPE 1S3KL 4FA7B 1M05A 4Q9CA 3QUXB 3QXDB 4PCKA 1UC6A 2QR0A 3K72A 1A5FH 1AJ7H 2NYKA 4QCIB 4ZXBA 4F92B 5GS0H 1A0QL 1CBVL 4JFUA 1XL6A 2V7NA 2W88A 3SY6A 4MMZB 1A5FL 1AJ7L 1O7DE 1EEYA 2EJ1A 5DVLA 5AVUB 2XV6B 2QADB 3U0WL 1QSEE 5A2IH 3CFCH 1U8LB 1RURH 2ZUTA 5T1MB 4W93A 2VYRE 4WNJA 1RXLA 2NY5H 2WKOA 4MMZC 1HXMA 4EUPA 1R46A 4XWGL 2EO7A 1S7QB 1BQHA 4TTGA 1DBAH 1QRNE 5EEYA 2QVTA 4PG9B 4QHNB 3HUJF 1QACA 4JO5A 1AGDA 1FPTL 1KF9B 1PG7W 3GBMH 2JLLA 3V4UH 4DPAX 4APXA 2CXGA 3ARPA 1DVYA 4KXZI 1MW2A 3UEZA 2VC2B 4XCFL 1E2ZA 2WZ0A 1XO8A 1JFQL 5IROA 2Q76A 3ZDXB 5E7FA 4N28A 2MHAB 1SJMA 4PSRA 4QXTB 4JKPL 5DVPA 5LGJB 2XZAL 3K2UH 2A6IB 1YUKB 2X1OA 3HS0B 2ITCA 5DDHA 3DKHA 5HYQB 1ACXA 4P5KA 3Q9QA 2X4OA 4C8XA 3QXUA 1WBZB 4X7CC 1OPGH 3SDYL 2Q2EB 2XZQL 2YD7A 3B2UC 5E9DB 5BRZD 2VM3A 3OKOA 4ORZC 5HGHA 5L8JB 1NCDH 1HEZA 1KCKA 4M5TA 4C56D 5FHAL 2A6DA 2W07A 1EIBA 2Z3FA 3KXFA 4K94H 1RUQH 3G5YB 3G6DH 2OZNA 2AXWA 3FU8A 2JJSA 5ISZA 3C5ZC 1AG6A 3MV7E 1U9KA 4N0YL 3ZR6A 5F9DC 4N6QA 5FECB 4WTZG 5C0CE 5DZ9A 1BQSA 3FTZA 5CJXA 1UXSB 3SO3C 4YL4A 5B1BB 2EIBA 4WK2B 2YPKB 1IAII 1MIML 4FQ2L 3TFKD 1ZLWH 1XSOA 1OARL 2Z4TA 1TQSA 3CFBB 1QNZH 3SZ6A 3SDDC 4J23A 4KZDL 3EGDA 4KRMB 3VGFA 4BSVB 5DA4A 1F4WH 1FFQA 5D7SH 4ELMA 3MPCA 4GAGL 4UBDC 4HWUA 1X5JA 2VZOA 1OGAE 2E8YA 3SGDI 1LE5A 2FZ3A 1FVDA 4JPWL 4PU2A 4BCZA 1JGLL 4KRNA 5KBKA 3RDTB 4F24A 3T08A 2DOCA 2V9UA 3I75B 1EDYA 3P0VL 4ALAH 5D2NA 1UM4L 1Y18A 2OSLB 1OE2A 4MXVE 1T83A 3CZUB 2WMPA 4KKAC 3SO3B 5IQ7H 4N8VA 1E9QB 1JHLL 2GT9B 4C83A 1BZ8A 1MCNA 2PABA 2JCCB 4RLDA 2NPLX 1REIA 2B2XH 3ZTEA 3D3VA 5I30H 5F72S 4MQ7B 1KY7A 3VQ2C 3T77A 4U4BA 1DJYA 4OM0H 1R3KB 4PLKD 1P4LA 4FERA 3G08A 4G71B 3VACA 3VD0A 3HPLA 4LQFL 4RQQB 3QIBD 2F58L 3RFRA 4ICXA 4WK0B 2KT6A 2J44A 3LH8A 1JZJA 4A2DA 4GUCA 3ZMNA 1YYML 5IQMA 4IMKA 3FCBA 2Y3AA 3TIEA 5AOJA 1AQKH 4KKBC 6TAAA 3O3DB 2A3TA 3OKLB 3IVKA 1EV2E 3ULUD 2ZTBA 3CVHA 4K9EL 2N56A 3L4TA 4IKKA 2OJZH 4AXWA 4Y2OB 4L0YA 1T66C 3NDYE 4CC1A 3SKOA 1D5IH 5HHNB 5HHOE 3J27A 3MLZH 1NBYA 2ARWA 4NDMA 4JQXA 5BS0D 1F2XK 2BINA 4QRUA 5E24E 4JZJA 1F11B 3GSQA 3LSOB 3S36L 3ZTNH 4B9JA 3N1FC 3GSNB 1AZRA 3BVWA 1MHCB 5E03A 3IYLW 2AGJL 4PJCF 1IFGA 1FNLA 2QSVA 4N2EA 4PJIA 3MUUA 2ADIA 1NMCC 1MG3C 3GHBL 3OJVC 5DUBA 3BH9A 1F3JB 1TVDA 4ODUA 1BM7A 3BFOA 4F15B 1U8HA 2WUCH 2APVA 1SVZA 1ANUA 1D9KA 5JIMA 1YEDB 4F7CA 3G5XA 2OJEB 2BP8A 3DJ9A 4GNKB 3AS0A 1KJMA 4JPKH 5D55A 2YMOA 2BHFA 4R9HA 1SHWA 1N10A 2E8ZA 5TJWK 5D1XB 4U6VH 2EEBA 1LP9A 1QKZH 1UZ8A 5MERA 1G9ML 1TQCB 4RDQG 3ZHFA 1HCYA 4JPIB 2AJVH 4HUUA 1HYSC 5ACZB 2OX5A 3TPKA 4YSRA 2Y5EA 3D1MC 2NRDA 2VN3A 1TT6A 1ED3B 3QIWB 4ATWA 2WO2B 4X6FB 5F7EH 3EOAB 5IHUH 1RUAL 5IFJA 2I7OA 1D6EA 5DTFB 3L7FA 5I8EA 1JXFA 3ATBA 1LM8V 2XT1B 3IB4A 4QF1B 4KV5F 2AQRA 5HJ3B 4M8VA 1T2XA 1FHNA 1FYTD 5B38A 3JVFC 1UB6B 1BSIA 1CT8A 2DQDL 3HI5H 3QUYD 1A6VH 3S3BB 3U30B 4HUKB 2CK0L 2HG5A 2CKBH 3G5ZB 5EZLB 4DSYA 5BQ7A 1KZQA 2YARA 5MP6H 4TUKL 1KJMB 2IC2A 1F4XL 3U48A 1Y1DA 4TM9A 5I1LB 3O4LD 5D71L 2EXYD 2QGBA 2WJ5A 2C1OB 2Y3NA 1E9PA 3N1GC 1QZNA 3LNHA 2R4RL 3BH9B 1XMEB 3FH5A 4X6CA 2IANA 2QFRA 2J8UE 1H3PH 2DPKA 3CHXA 1CDIA 1YNLL 4UIKL 1BXUA 1UXWA 2X3AA 4XCFH 4H8WH 3CDYA 1YQ2A 2F08A 1E7VA 4WW1A 1IARB 4FC3E 3HEIB 4M6AA 3GIZH 3HMWL 3WNLA 4AY0A 4DKDC 3QCUL 3IGAA 4LLUA 4AEHL 1OAUH 2YZ8A 4JZJB 2YAPA 3QJUB 1MDAA 1KCUH 5GXBB 4NZFA 3W0WE 3FYIB 1MCDA 4WEMB 5E2UL 5F96L 5J1SC 4IBYA 2JKWA 3FTYA 3PJSB 5GGQL 1U8NB 1A8JH 1YYLH 4MB3A 1RJYA 4NZTH 1IBGH 1XR9A 4AVKA 1U30A 1WH0A 3GBDA 1FN4A 4PD4K 1TJXA 3KR3L 2JXMA 4LNRB 1NKOA 2HT4C 2YUWA 3DMMC 4BCYA 2WIIA 4G1MB 4ODXB 4QNPF 4ZO7A 1OT4A 4IK6A 3VXMA 3IDXH 1KN4L 4PRPD 4ZMYA 3T0WA 4FQJL 1KCRH 4OD2B 4RQQA 4NUMA 2N01B 2OFQA 3ETBJ 3R0MA 1JZIA 4ZO8A 1WEJH 3PY9A 3KZ8A 1CDYA 3T77B 1OP5K 3MJ8B 1LO2L 1H8SA 1RZKC 5HGDA 3D3VB 5CZVL 4MJIA 3U4EA 3CGTA 5D4IA 5C07D 4NIKB 1YNTA 1L4IA 1Q1PA 1E67A 1TJMA 1Y18B 2ROYA 4AEIH 1XCTB 3I75A 2A9NH 3JTSA 4YLCA 2Q86A 2Q3ZA 4PRHA 3T6QC 4QRPE 5A2CA 4NQVB 5AAWC 5EO0A 4ZFFB 4WWOA 1HZHH 1ZT1B 5E6RB 3EBGA 3ZGIA 1HZHL 3FUKA 1N59B 2CGRL 2JF1A 4BSVA 3QI9C 4ZPTB 3LEYH 4XPFH 4PRID 3CMOL 1CJYA 1HCZA 3OD3A 3IJEB 2ZUVA 1RFDH 4XBGA 4S0TD 5K1NA 3UAEA 3AWGA 3WIFA 1J10A 3US1A 3X1GA 1N67A 2QKIC 4G9DB 4GW5A 4R5XA 5CD3B 3ZLQC 1F58L 2ZICA 1E6JL 1JGUL 1UQSA 2OBGA 5FYLH 4B95C 5L2KD 1E4XH 4LT7A 2VDQH 1T0MB 2DJ4A 3LQAH 5I6LA 3B5TA 2JNZA 3VSTA 12E8L 3AAZB 1MNUH 2NNFA 1SN2A 2VRKA 1C08B 4J3OF 2QL1A 4Y4FB 3UDWC 3UZVA 2WBXA 1Y7VA 4QGTA 2F61A 1WIPA 4R90H 1NH6A 1IIKA 1PLBA 4M7JH 2VXQA 3HRZB 1K9TA 2JK5A 3MCLL 2JLPA 1CXFA 1OAZH 2B59A 5LCVL 3PP4L 5GS1A 4HJSA 2K7QA 2D03L 1BF2A 2EVHA 3PNWB 2OJZL 4ZFOL 2YXVA 1TKWB 3FU7B 4R8WH 1WBZA 1EAOA 4RDBA 2F7RA 3KCWA 2J4WL 4R0LA 4JW3A 3LKPB 3IK2A 1PF3A 4Z7WB 5ESVB 2E47A 3RFZC 2WP3T 4PFEA 2V7HB 3ZX1A 3DIVA 4S1DD 2B4CC 2FIRT 3P02A 3BQUA 4M6OL 3RHWF 5AZUA 3Q5YA 3IPFA 1ZLVK 4CC4A 1KCVH 3O6FC 5D96C 2VN6A 3OHXA 5BJTA 3LIZH 2XC8A 4PJXF 2GUYA 3IE9A 3QZBA 5IW1A 2BFVL 2FIKA 1XZ0B 4MLIA 1I1AD 2XX1A 1AGDB 3DUHA 3QAZC 4XXDA 4RGOH 1YN6B 3ZRCC 3Q2VA 2CRZA 3TH3T 2VZVA 4JHWH 5J89A 1GS7A 1GPOL 3MJ9L 4YPJA 2OL3A 2C9UA 3FS9A 5CLZA 5T3XH 4ZMWA 3MNZB 4EE2A 4R2GB 2WXFA 4P2RB 2NY7L 1KJ2H 3BPCB 1CLYH 4K9EC 2UUDH 3PHSA 3TN0C 3VWJD 3NN8A 3NFPB 3NIGB 2AK1L 1CWVA 5D5MF 2AQSA 4OCYH 4HZAA 3DA0A 1YMHA 4CADB 1WGVA 5C9JA 3OBAA 1K85A 5K69A 4MRCA 5C0ND 3EJYD 4PCSA 3LRSB 3CH1A 3NH7L 4JFFE 3RVXC 2QZ5A 1WZ1L 1GY1A 1AS6A 5DJ8B 4P23C 4QRRB 1KPRA 2GTWA 4F5CE 1ZTXH 2CJSA 3EG9A 2CHDA 2F7QA 4LVNC 4NCDA 1EEUA 4MMXA 4JRXB 3CCHB 5C0FA 1QUNB 2AITA 3WTXA 2V5MA 1IFRA 4RMVA 1CXEA 4X4YB 3R06B 2C1PA 4MBRA 2FX9H 1HIML 4U6YB 2CJUL 3CFKA 5IY5B 1HXKA 2WB7A 2Z8RA 5FYJE 2WLMA 4QTFA 3K5RA 3NG5A 2XYCA 4QHMA 3RI5K 5DK0A 1KCVL 2X2IA 1GIGH 4KY2A 1DVFB 2E7MA 2EE0A 4UZUA 5AW9B 3RGVD 1SUHA 5HYSG 2Q6WA 1SJEA 1RULH 3F84A 1UB5A 3O2WL 4Z5RB 5FO9A 2P4AB 3OM3B 4O5LL 5DF0A 4WZ9A 3LKOB 4AC4A 4PRBA 1U6AL 2NSQA 3QUZB 2NDGA 2OZ4A 1HWGB 5FLVA 3VU2A 4H8QA 3KJ6L 2QQNH 1CLZL 4WI6A 2DICA 4ES9A 2YLKA 3UBGA 1AZCA 5E2WH 4W9IC 4IBWA 2ESVA 4Z95H 2VSCA 4M43H 3VI3A 1U4EA 1QFWI 5BOJA 4LPVA 5C2BH 4YZFF 1OTTC 2VZTA 1CLCA 1MELA 3RPIA 5E8EB 3NT0A 2ZOKB 5JORA 3D4YA 3QUMB 2HFGL 2E27H 1UCBL 5L7XL 4FFYL 1J9QA 4CC0A 5BZDB 4WAFA 4Y1AB 1TMQA 1LO3H 1R5WB 3IGUA 4OGAD 5ENWB 1DJZA 3GRWA 3HE7C 1DR9A 3WDIA 3CX2A 4IOSD 2Q8AH 1R3IL 2CCVA 2GEEA 1ZK5A 1FYTE 3DOSA 1A4KA 4QO1A 3GI9L 5DJ6B 3LN5A 2DM3A 3GXPA 3ROOB 2DWSA 4IMLA 2NZIA 3CDZA 5IOKA 1YY8A 4WLCA 1O5PA 4XNAA 4POZD 1DANT 3V4VL 3FBKA 3QG7L 2EYSB 2R29L 4HJGA 3LZRA 1F13A 1G7IA 3N55A 4L1LA 5CZRA 2GABA 2R7EA 4MCZB 3A67L 3I50H 4J2XA 4F58H 4G8GE 3OX8A 2X42A 2WLZA 3DX8A 5DMKA 2QQQA 3T8XA 4PWIA 3QPXH 5E8OA 5EO9A 5CEZH 1BV8A 4HD5A 1QSVA 4HUVA 3AITA 5DYOA 1DP0A 4AGMA 1HHJA 2W91A 3VDBA 2WO3B 1L9QA 1LQSR 3PWPD 4AUUA 1PKOA 3NVQA 4NO3A 1DO6A 2C9RA 4WFGE 3B9VA 3EHBD 3ECQA 1YN7A 5JA8B 1XBDA 3FT4B 3MCG1 3HE6A 5DK3A 4PWEA 3V5DA 2DAVA 4YHIA 3VH8B 2I27N 1QX1A 4ADJA 5L2JB 2EUVA 3GXDA 1G7LA 1KLUA 3F85A 3RILA 1U8OB 4HEPG 2I9TB 3A0OA 4HDIA 2A4EA 4Z7NB 4Y16C 5HHVL 3UTZB 4FFYA 2RTTA 4BUGA 1R0AL 4TNEA 3I6GA 5EF3A 4H0IA 3MV9A 4AL8H 2DEWX 4ODHH 1RQ5A 4JRXD 1KELH 1KEML 4J6IA 4HWBH 3ZDYF 5MHSD 1AO7A 1SPDA 2CDGA 3IJHA 1D5RA 3JUZA 2OMZB 4X99B 5EIIA 1R3HB 3BWAA 3JV6A 3HHRB 2MPVA 4BQ6A 2VDPL 1I1AB 1B2WH 2X89A 1ZSDA 5D1ZB 3MCLH 3VU1A 2GHWB 5L88H 5FDYA 4BZ2H 1UD4A 1MCLA 3GRGA 1MFCL 3ISYA 4G8GB 4QOKD 3S2CA 3OKKB 4HWZA 3CVDA 4U7KA 3MBWB 3RLSA 4GQQA 2Y9RT 4LBEB 1JPEA 4LCYA 4YHNA 4GI6A 4NC2B 4OLXH 3GLAA 3ILPA 3TJHC 1SXSA 2BNUB 3U4BH 2HXAA 2VOTA 2XU9A 3NZ8A 3HZKB 3MRMA 3Q5TA 3ZR5A 3L6FB 4JY4A 3ULVL 1U0QA 2ZIDA 1Q8MA 2FLMA 4IU3B 4KKPA 2CIIB 4QAWA 5JIKA 3H2PA 5EN2B 3U25A 4L8CB 1I8UA 5EA0H 5IK3B 3RX8A 1JZ2A 4U7SA 3VI4F 2FO4B 4KXBA 3KLQA 4XOCA 4ZNCD 3D0LA 4C4BA 3SDXA 1I8AA 5FUCC 4E5XB 1MN4A 5HVFB 5KVFE 5T3ZL 5FM5O 1EHAA 5J6GB 3GIVB 2GK2A 4XP6L 2YRZA 4FADA 2YAEA 4I5BB 4YBQC 2OP4L 2P7TA 3ARZA 2K78A 3BAKA 3LRLA 3NPSC 1NL0H 5A6LA 5I2IA 4P04A 3ZE1F 3GGWB 4N5UA 2FATL 3TF7C 1OALA 4WSJA 1FA4A 2BNQA 4CDHA 1BD2A 1DQQA 2GBTA 4JFFA 2UY7B 4YFEA 1N68A 4Z6AT 1HH9B 5IEKB 2P49B 1AGEB 1PZ5A 1WE5A 2XWXA 1HX0A 3NZUA 3MRCB 2AXGB 4TYUA 1RLWA 4Q6IC 1A7BA 2BOBB 15C8H 2UZXA 4PS3A 3VD1A 1P1ZB 4J3TA 3W2DH 1GKEA 4MD4B 2NUPB 5CSGA 3ZKND 3CFEB 2H32A 3RPBA 3U1SH 4HPOH 2PCPA 2OCJA 3VSUA 2NX5A 1PYWB 4PJGA 2NTFB 4BFFA 2FX7H 4K71C 3X13A 1TZIB 2DI7A 3SGKA 5DJDB 4X8JA 4TSAL 4G42B 1J1XL 2WXRA 2IF7A 2EEFA 3OWEA 2CHZA 1LJMA 3UIZA 2FJSA 3NACL 4LSSH 3DARA 2AANA 3ZDWA 4HIQA 5D1QA 4FA8A 1KGJA 1HK6A 3AGWA 4I48A 3JYBA 1UEMA 2NY3B 2VDLL 4Y2DC 1BFSA 1I1RA 3CE1A 5I17B 3O45A 2IBZX 4EMZA 2AZAA 4YO0A 4FJYA 1IM9A 4RETB 4XO8A 2WVVB 5C6WH 2OTWA 3RWDA 2WZAA 3VXUE 4O9HL 4JDTL 5AL8A 2KYIA 2OMXA 2P48B 4GG8B 3OZLA 1T5KA 3TYGL 1KG0A 1FZMB 4N2BA 4GB9A 3OLIA 5KANI 3EOBB 4HS3A 4JREB 2UYLB 2P8LB 4IBLT 2NNRA 3HBPA 1KB9J 2IMMA 2PXYC 4XN4A 5FGRA 5C9KA 1EJOL 5C0CA 3FU0A 2FATH 4JFFD 4KFZC 2UXVA 1ZA6A 1YECL 4LRNL 5JPMC 3QZWB 2EE3A 4PI0A 3DUSA 5C2BL 5BW7A 3AWFA 4KGJA 1Y07A 2RALA 3CPLA 3F7YB 4UNTA 3MQIA 2IWKA 3GJFB 2JKJA 4PM1A 1TCRB 3DSFL 3MAWA 4NX0A 5I16B 4FP8H 2EVFA 5BUPA 2P8MB 3PREA 3L9YA 1Z9SA 4WCYH 4UOW1 4HBCH 3OZKA 1X7TA 3C2AL 2F5BL 4G8GD 5D1QC 4P4RB 4PV8A 4HOZA 3SKUD 4UV7H 3L3OB 3HUJB 3WNKA 4DTGH 1OY3B 2VZUA 1HFUA 3RUGF 5D7JD 1BQUA 3V9CA 2NQDA 4A37A 2K4WA 2QHRL 4HJ0D 1BVZA 5ADOL 3UAJA 3ZDZF 3TTYA 2JJSC 5BRQA 1LO0L 3WELA 1NAMH 1NFIA 4FXKA 3WFCH 4OT1H 3FN9A 1W91A 4N2LA 3BP6A 3KEHA 3VXSD 1SLXA 1ET5A 2AXFB 5IJBC 3T0AA 4CVUA 1QR1B 1MW1A 5LN8A 5E6IB 2QMJA 3ULVH 3FU3A 4OUOA 5F44A 3LHPL 1U8PB 5JHMA 4MA3B 4KQ0A 4ZOEA 4KJWC 2X89D 4OB5H 3ULAB 5EFIA 4HGKC 5DD6B 2P28B 1TJIH 2YXMA 3SDAB 4BWTA 3OAUL 2I9LA 3VM5A 1HOCB 4IHBA 4FKKA 4XH2A 4JFTA 4C56B 4F7PA 5ICYB 2B39A 1UWEL 3AG4B 3IRCA 4N22A 3L17A 2CO4A 3TV3L 1J0KA 3ZJAA 5BNXD 4XMTA 1II4E 3ULVD 2WXPA 3L5WB 4I3GA 2Z0BA 3O4LB 1H8LA 2WK2A 4PREA 2VJ0A 1QVOB 3BDYH 1I1CA 3LN9A 3WJMB 4Z7UA 5GJSL 3WTVA 1WWWX 3QJHB 2XG4B 5GISH 1FL6A 1PY0A 3M86A 4XPAH 4YH6A 1BEYH 1U8IB 1SY6H 2NW3A 3JVGA 2HKFH 4BWWA 2CKBB 1F6AB 3QORC 2ID5A 3BOVA 1HQRB 1HS6A 4H5SB 3BP4B 1MFEL 1P7QA 3QNXA 4G9FA 1A7PH 4HFWB 3TTSA 1NMCB 4PJBB 1EO7A 4HXBL 2MCMA 4ABWA 4NKDA 3EJTA 4ZRGA 5FKPB 1ZPUA 4U6HA 4XZUB 3EH1A 2CQVA 3UYOD 5HYSB 3WS6A 5ILTL 3V0JA 3PQYB 2H3NB 1UOKA 4GMTL 4MXWL 4AGPA 3AQYA 3KPSD 5KSBA 2VISB 4DGVL 4E0RB 4P9ML 4MQXD 2X2JA 4N5EC 5E9AA 1OZUA 3UG4A 3K6SA 2XPGA 4TNFA 4ZBJA 3UTQB 4EI0A 4AQAB 1E8WA 1ADQA 1AFVL 4FN0A 1CDBA 2HZHA 4LGPB 2LLLA 1AACA 2CM5A 3FUFA 4KQ4L 1WWCA 2KDYA 1ORQA 4GW4B 2VDQL 4L48A 4FQXD 4YDLC 3CDGA 1GTNA 4J3VA 5I6MA 3CVIL 4NRZA 4WFHD 1KWGA 4Z7OF 2O5YL 3B56A 1CDGA 1WAPA 1K8DA 5T1JA 3GSRB 2ESVD 3QRLA 3OXRB 4YBLC 1B90A 1EO5A 5TF0A 1P9MC 3SDXF 5T1KD 1DVTA 2ZQKA 3EJZC 2J12B 4KZCA 1XL4A 4N2NA 4HU8A 4NGHL 3F6JA 5T33H 1BGXL 3S6CA 4LPYA 3CSYA 4G6AC 3OKMA 3W38A 2HA1A 3SD5A 3NEXA 4GAAA 1IBYA 4ZMPA 2BVOA 2QADD