1JZDC

Dsbc-dsbdalpha complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
RSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQLPQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGAADAGFCYPPETKTVPLSEVVAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thiol:disulfide interchange protein dsbc
publication title The Disulfide Bond Isomerase DsbC is Activated by an Immunoglobulin-fold Thiol Oxidoreductase: Crystal structure of the DsbC-DsbDalpha complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 24
structure length 118
sequence length 118
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2001-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11412 DsbC Disulphide bond corrector protein DsbC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1250 Mainly Beta Sandwich Immunoglobulin-like Thiol:disulfide interchange protein DsbD, N-terminal domain 1jzdC00
1Z5YD 1VRSA 1L6PA 3PFUA 1JZDC 2K0RA 1JPEA 2K9FB
chains in the Genus database with same CATH superfamily
4RCAA 4R7DA 1EPFA 3AWEA 1GYVA 1QFUL 5A16B 1ZMYA 3D06A 2ZAIA 2R27A 1PJWA 2WVSA 2UVFA 5DHYB 1F0LA 4E0RA 3X13B 1W16A 3O41A 3MCG1 2OFQA 3MHZA 5C2BL 1LLAA 3S35L 2P43B 5D7IA 3V0DA 5JHMA 4YDJB 2V17L 2OMTA 4WLCA 3AY4C 3PV6A 3KWUA 5BUPA 4FQIH 3B7TA 1HJCA 4UV4L 2O4EA 2BNRB 1WYJA 1CC3A 1OSZA 1W8EA 4XMKH 4TQPA 4RBPH 1MHPL 1XF3B 1NMCB 2DQFB 1CFMA 1BIIB 4LMQE 2OYMA 5IVXB 2AJXH 5IB2A 3OHMB 2PWGA 4J3OG 3IJHA 4OIIH 5AL8A 3D39E 4KQ3L 4ODVL 4C83A 1UOVA 3T4AB 3O3AA 5I6OA 3MRIB 5IBLD 3B2VL 1F41A 2WSDA 1YVLA 5I0YA 2J56A 4HK0A 5CINL 2ZUTA 1HZLA 1CLYL 1EHAA 4Y2OB 2PR4L 2F54E 1JGEB 2COVD 9CGTA 4XE0A 4WDIA 3RZCA 2WZ0A 2FZ3A 3RNQA 1XCXA 1ZY9A 2V2WA 5HGAB 4AQAA 5I75B 1MLBB 4XBPA 3SDCA 1HWHB 4BGLA 4FQQA 2F8VA 3UTOA 1U8QA 1G84A 1ZT7A 1C16A 1NEUA 2FQGA 4MQTB 1EBAA 5AYUL 4HAFA 2Q10A 3MCLL 4WCYH 1XGPB 3UJTH 3VFUA 1YY8A 1BZDA 4YGVB 4KROD 1A7OL 2FH8A 4LVOC 1FH5L 1WZKA 2UY7B 4M6NL 5DJ2A 3V0EA 2MRYA 4NIKB 5SWZA 2ADJA 2P4AB 3LIUA 3UO1H 3N04A 4RMBA 5J8OA 3O8XB 4FFYH 3MUHL 3ZR5A 2EDHA 2H26A 1C8PA 4QYOB 3QQ4A 4FQXC 1KMGA 1FYHB 1RV6X 2AXWA 1EBPA 2FB4H 2G75A 2Z0UA 4FRWA 3H42H 4OQTH 3F2LA 2EDKA 2TSBA 3LNDA 4RMRA 3L2LA 4L9LC 3D39B 3QIWC 4ZUVA 3SE3C 4CSPA 3EADA 4Q9QH 5MENE 2I9TA 1GZHA 3BT2H 4CUCA 4LCVA 4S2SB 5CJQH 1B90A 4ZNCD 2Q20A 4MRBA 3OSVA 1W8OA 4XP1L 5K9JL 1R5WA 3OMZA 5C92A 3ZRCC 1NC4B 4FTVA 4MBRA 2CHXA 3GDBA 5CJXA 3HC0B 5IK3A 2DAVA 3LEYL 5IR1B 1CE6A 2WP3O 3GM8A 1P5VA 2BY1A 4BV1A 1CDYA 3G5XA 3OWRA 2NY4D 3H9SE 4G9FE 5D1ZC 4YS4A 3TJEH 1BP3B 4F9LA 3S5LA 1FZKB 3IE9A 2CLRA 4ATWA 2XFGB 3NEOA 4FXKC 4NNXA 3CZGA 3IDIA 1D7BA 7FABH 2EZ0D 3ZYIA 4OLVH 2MTPA 2EDTA 1HL8A 4Y89A 1YCSA 3CVBA 4GO9A 3NIGE 2WO3B 3FL7A 1J0ZA 4PR5A 3GWJA 5IGXL 3FZUC 2I69A 4KNUA 5DURD 3WFCH 2YJLA 4UINL 4B9YA 1V10A 5E4OA 3VX1A 3ZY7A 1KCRH 3OGCA 2KQNA 4LP5A 4B9CA 5T1KA 1PD0A 1J8SA 1A21A 5FYLE 1L5GB 2GIXA 2VDRL 1QLFA 1JXGA 1FO0L 1NCWL 1R5VB 1UWXK 2GW5A 1DZBA 4JRYD 1DVFC 3CAFA 3MUJA 4KPHH 1QA9A 4M3KB 1MWAL 4CC0A 1RJLB 1BZ8A 3WO4C 1T7XA 4APQC 3BVVA 3F7YA 3TP4A 1E5UI 2VQUA 1KPVA 3L7FA 2AP2A 3D18B 3FHQA 5AB1A 5B4MC 2NTSP 1GPOL 3EH1A 4X9BA 1NL0L 1NFDE 4DPRA 1ASOA 3H9ZA 2QR0B 3B5HA 4X99B 1M7DA 3P4MB 3LKSA 3VRIA 3UBXG 1MCIA 4JPQA 1VPOL 4OJDH 1A25A 2XZQL 4XVUC 5TE4H 3RB5A 5EN2B 4EIBA 1F4WL 3ESUF 1WFIA 4LK4A 3S2AA 1M6OB 2HFFB 2H8PB 4F5CA 4OD3L 2EE0A 5CEXB 1QX1A 2WWMC 5C08E 4BJLA 4WY7H 5E1IA 1QRNE 3RWDB 4G9FB 1P7HL 1AQKL 2GJ6E 1ZHKA 1NFIA 3UTQB 4PCYA 2IOMA 4JFSA 1NDTA 5LAXA 2ODIA 2KS0A 5CILL 1FZOA 1NIFA 4ZQKA 4N9OB 5CBEA 4JM4H 1BGXL 4MAUH 5CCKH 3RFRA 5DZ9A 2D0HA 2GC4C 4NQCD 4DAGL 4E42B 5GGSA 3TVMC 3ZO0A 5JIQA 1DQMH 1I8MA 1YECH 2VM3A 2Y7NA 1LO5B 1MY5A 4O9HH 1LO0L 1UATA 1IGYB 4P9ML 1WO2A 4Z76B 3AQXA 4LFHD 2ORBH 5DD3L 4U3SB 5F7EL 5C9JA 1DQQA 1MPAH 3TCLB 3SJVA 2BVYA 2G3MA 3A3YB 3KLAB 2Z34A 1OAKL 1E6OH 2WQWA 4HQQH 5EUOA 2APXA 4LF3A 1BYNA 4NJAL 2DQJL 1RZ7H 4X7FC 4BSJA 3E7JA 2MHAA 1OE2A 2X2IA 1HXYA 2VM4A 2A9DA 4RX4A 4YHKL 3UG3A 1N3NA 1INEH 3LZNA 4JN1L 1QOKA 1ZT4B 4LCUB 5E5UB 1A9BA 4BZ1L 3K2UL 3NTCL 2OULB 1S5HA 3I2CL 2F5BH 1RIVL 5E8PA 3QR2A 4MA3A 3H6AA 5C08B 4TL4A 1MRDH 1VEMA 4OZ4A 5PAZA 4JFUA 1P4BH 3ZMEA 3ZT5A 2VDNH 3ZDXB 3T8VA 5B8CC 5FO9A 3ARFA 1R0AH 1EZLA 1EJFA 5E2WL 4CADB 2YZ8A 1WFJA 2AZAA 4P4KA 3AG3B 4PUBH 4QJ4B 1H15B 5CNHA 2IO5A 3PAUA 3QQ3A 4QHLB 4HKBA 4KDWA 2E56A 1HHIB 2CDGA 4ZFGH 4LSDA 4XNAA 4TQIA 3OLIA 4IMLA 5CHNA 4ACPA 4DP9X 2PYEA 5F7LB 1JNNH 4M61A 1E42A 4YQXH 1H8NA 4E9SA 1FYTD 3HHRB 4AJWA 2GBVA 3FZUD 2XQYA 4A6YA 5DJ0A 5AZEH 2HMID 5T1MA 2H1LM 3UROR 4IOFC 3MLUL 4K5NA 4OT1H 4X5WB 5F0PB 4ZYKB 3U7YH 1L9PA 3CXDH 1TQCB 1URIA 1QFPA 5H94B 3GSVA 3CN0A 4MSWB 4BFFA 4I0PB 1B4JH 4OKVA 3DX7B 2DH2A 4LRNH 3GMPA 4N8VB 4N2MA 1RK1B 1CE1L 4APQD 2P8MB 4Z7WE 5B4MD 5DJDA 5IROD 3BKMH 5EG6C 2ITDB 5IJKC 1M57B 1NEPA 3F58L 3ESNA 3ULUD 2JKSA 1OK8A 3D12B 4GW1B 3W0WE 8CGTA 1OTTC 1CFNB 3GHEH 3JBG7 2CJSA 3HE6B 4WUUA 4AIZB 2VXUL 4NGHL 1I9RL 5DRXB 2X4TB 5FUCE 3RGVA 2MQGA 4DGYL 3S48A 4F9PC 4QRBA 1QSED 1T04B 1CTMA 1MQKH 3NJJA 4A7UA 4B7IA 4P3CL 4EXPX 1CDBA 4RMUA 3UDWA 1UQSB 2WWMD 1OGAB 2JB6B 4I3RH 2ENSA 5CU5A 3R19A 4LMQI 4M43L 3MFFB 4DK3A 1Q9OB 1QPXA 4YJZL 1V55B 3NACL 5I8EB 1ZT1A 1TYEB 4UTCA 4MD5B 2QVFB 2VZTA 3CVHB 3TIDA 2B39A 5IVNA 5BRPA 5I19H 1JFQL 1BPLB 3MROB 1U95A 1QYGH 1R4XA 3FT2B 1KG0B 1KT2B 4NBYB 2GG1A 5D72L 3MU3A 1W9XA 3L4VA 4GRWH 3E6FA 2DLIA 3T6ZA 1RZKC 5D7SL 5BS0D 1MJUL 3IK2A 2BM3A 1TENA 3K4AA 2C3VA 4HMCA 4D0DB 3MRCB 4GFTB 4CGTA 2C9QA 5LQBH 1O7DE 3GXFA 4IJ3B 4DO5A 4G3YH 1AGFB 3WG7B 3EDDA 3UX9B 4Z7WB 3PQYA 3QIBA 4LHUD 1RULL 1T21B 1RUAL 5E0QA 5F72S 5H37A 3VD5A 3QQ9C 4PJ9C 2H1PH 4D9QE 5IFAL 1B0GB 5EO1A 3RTQB 4F7PA 3D09A 1WV7T 3QWOA 4X6EA 3FT0A 3ZHDA 3O45A 4Y4HD 2FJGB 3MKGA 4KI5F 1KIPA 3TX4A 3KPTA 1UG9A 4FF9A 3WIIH 2ODHA 5JA8B 3GMLB 4B5EA 5D6CB 3GSUB 5KG9A 3N85L 4CRPA 1HYRC 3KJ6L 1X7QB 3MLSL 1E6JH 1YUHB 3ULSA 1EHXA 3RIFF 4I3GA 4XP4H 3WS6C 1ZGLP 1KXVC 4ZO9A 4NAQA 3TF4A 3LXAA 1QSFE 4JPWL 3UH8A 1DQDH 3V5HA 5I5RA 3BKYH 2GB2A 5HHME 4UDUA 1DE4B 1PIFA 4IRSA 3ZO9A 1RZ8B 1SXZA 3J7HA 4LSQH 1TTCA 2JQMA 1QW9A 2BS8A 4MXQD 1K2DA 2X1QA 1JOIA 4RGMB 4MNGA 1YZZA 1T1XB 3FFCB 2XZAL 3C5ZC 1ADWA 1S7WA 4OGQC 4TUJA 1A8ZA 5FYLL 4F1ZA 3LPFA 4PS4H 1WUNT 4IOFD 1QKZL 4OI8A 2A9AA 5JDSA 2APBA 2RQ8A 3OD3A 1WBXA 5IF0B 4WI8A 1XGUA 3CPUA 1YEDA 1B0RB 2HVJB 2CWRA 1XH3A 1NLBL 2R2EA 3QZBA 4JFDE 4MMXC 6PAZA 3V2AR 4PJDA 4XP6L 3VH8G 2F7IA 2IFGA 4LNRA 4WNSA 3NK4A 4YDKH 1NBYB 1P9MC 4YN3A 3O6ML 2HLAB 1FL5A 3ELQA 4ZW6A 3V4PB 1MH5B 2EC9U 2F9BT 5HY9B 5KSUA 1H3VA 4QPEA 5H4ZA 2YRLA 1W2KT 2AJUL 2IFFL 1S3RA 2YKKA 4KXZH 5H2BA 3RX9A 1KACB 4U7MA 4RMTA 2W38A 1ORQB 3L3DB 3GGWA 4R5TA 4L4TE 1KTKE 3NJKA 4NEHB 2NY0C 3FU8A 3TWYA 4EUPA 4ZOAA 4OTXL 5C86A 4JPVL 5HHMB 4JY4A 4OZFB 4Z3GA 4LBAA 4ANWA 4KKNA 2KDGA 3HS0A 4W4OC 1A7PH 4JB9H 4PGCA 3DI2B 4LVNC 2VXTH 1XBRA 4EZLA 4XPBL 1RUKL 4I7ZC 1MIMH 5HYSG 4M7JL 3GSNB 4XNZB 3DOSA 5T33L 5TE7H 5TDPB 1JVOA 1MAML 3POCA 4UAHA 5D7IE 1O9WA 5E2UH 3S6CA 4PJBA 3PFUA 2JFCA 4NQTA 4O4YH 3Q5TA 3BPCB 1DHKA 2XOTA 4CDGC 3QYMA 5CN3A 1JN6A 2AEPH 4I4WB 5J6HB 1BQLH 4JFTA 3ZT7A 4M8UA 3QDJD 4AQ8C 4OD2A 4PJ5A 4YHIB 4JFDB 4M7KL 5HHVH 2BCMA 5E70A 1ETA1 1KIUB 3DJTA 4MS8C 3D2TA 5KSVB 3QQ9D 4PJ9D 4RRPG 5CEYA 1UWYA 2HWZL 1TZOA 2G5BA 2R1XA 2AJYH 5T1DL 4X4XA 3O6KL 3QO1B 4AV5A 1OK0A 3QUKB 2F8IA 4O58H 1M53A 1BMZA 5GGTL 3KMDA 5CXPA 4FQCH 1SY6H 3UGEA 5SX4H 4RQQB 3TTYA 2A0LD 1AC0A 4HJJH 1XQ4A 1PAZA 3WIFA 1A7RH 1KGCD 1RH8A 1XD1A 4R7DB 3AREA 4EN3C 4BZ2H 4A38A 2V8MA 2CK0H 3MRNA 5L2KB 1NJ9B 2KLRA 1L3NA 3EYOB 5CD5D 4V11A 3BW9B 4UT6A 3HC4H 4DQAA 4JMNA 3QXAA 3O41B 2DN7A 5EU7C 1QO3A 2CO3A 1RMFL 3NFPA 2R2HA 4RISH 1SBBA 1UH3A 4KO7A 4JJOA 3OKKA 3Q9QA 3NZ8B 5TF1H 1ZS2A 3CN3A 1CJYA 5SWZE 1F3DJ 1L0QA 2OMTB 2F1AA 4KBPA 1HE8A 1W0VB 2FATL 2GSIB 3T0EB 1H0DA 3MJ9A 5L2JA 3Q8FA 1GHFL 4U1LB 2JKWA 4YDNA 4WFGD 3LRKA 4OAWB 1NUNB 2KUTA 1CL7H 3QNZA 2Z65C 3UAAA 3ZE2F 3MLVH 2W1NA 1PZ5A 3SBWC 4A68A 2IH1A 4XN4A 2J43A 4IIQC 2VDOB 3KBEA 3V6OC 3DX9A 3FTGB 4LP8A 1ETZB 1NGWA 5E8DH 4N0CD 2FJFB 5DLMH 3QDMB 5FC9A 4RA3A 4ODWB 1S5IH 1FPTH 3O3AB 4E9LA 5TQ0L 1CDUA 2WINB 3HS8A 4X98A 4DEUA 4Z77A 2RCSH 4HK0B 3N43B 1BLNA 4KHTL 5CUSH 3NABH 3X11A 2YMTA 3BI9X 3BH9B 4YL9A 2V5SA 4D2NA 5DMKA 5FGBA 3D52A 4G7VL 5AW0B 1E7UA 5DRWB 4FTVE 2WVTA 5I18H 5KJRH 4HS6A 3O9WA 4GQPH 3BDYL 3CFNA 1BAWA 4KVNL 2FZ3B 3PGCA 2BVEA 3ARDC 4O2FB 2CGRL 1RIUH 3PNWA 4HEPA 3VGAB 3SDCB 1L9RA 1T0MA 1HOCA 4FQQB 4R8WL 1BQKA 1G9NL 4I3SH 3N2JA 4XC1H 5FF6B 1KBWA 4FDWA 1IAIH 1LO3L 2ARJQ 1ZT7B 2C9RA 1LWHA 4XP5H 5LGJB 2NY0D 1FVCA 3CHRA 4PB0L 3VFUB 1ZV2A 2OR7A 1KB9K 3T0BA 1NGPH 2A6JB 3CC1A 3AACA 3NP4A 4NUMA 1Z9NA 4FXTA 1A47A 4RMQA 2EVIA 1JMZA 1IUZA 2C9XA 3F7KA 4I9WD 4G11A 2UWEB 2DD8L 1BMGA 2XXCB 1EUUA 3FTYA 5F89A 2FNWA 4M5ZL 2G75B 1EXUA 3UZEC 1FL6B 1S7VB 4HK3N 4BH7B 2EE6A 2IWKA 3L4ZA 5FUZL 3DI3B 2X28A 5HHNB 4XVJL 1I3RA 2XA8H 4Z5RB 2GTQA 1U8LB 5HDBE 1IM3A 1F90L 3MLWH 3SE4C 3MV01 2NUTB 3W11C 2Z0BA 5T3XH 1R5WB 4LASH 2D03L 4UQAA 3O3BB 4NUGH 4FTVB 3BOVA 3CSYA 3OR7A 2GVYA 3SYPA 3V4UH 2ZUQC 4AQ1C 4F5CE 3VMPA 4MKTA 5EU5A 5HDQL 2WWNA 3G5XB 2HA1A 1T80A 3PNRB 1YEIH 2J21A 4GP8B 3VW3L 4WI2A 5ABDE 2JCCF 2CLRB 1W72L 4UNIA 2ZOLA 3QUMA 3BPLB 4NNXB 3CZUB 4Y4FC 3LQAH 1F4AA 4JQIH 1E9OA 1GTFA 2VIRB 4D9LH 4KOCA 3QPXH 2NY1B 2VLME 5IEKB 3IJ9A 2JB5H 4NZUH 1HH6A 3GKZA 3CCHB 4PJEF 5ADOL 4MMZB 1GGBH 4C56D 1GSMA 3OZ9H 2BK8A 1ZA3A 5GZNA 1XL6A 1PNDA 1TPXC 4NNPH 3NIDE 4HUXA 1QA9B 2Y5TB 3SJVE 5BV7B 3F7YB 2I9LB 2E59A 3U82B 1KPVB 3L7FB 3Q13A 4HIXL 3UL4A 4JE0A 5EUOE 1EDQA 1D5ZA 1KNOB 4B9IA 2EXYC 1M7DB 3WMSA 3OKMA 4BDVA 1EFXA 1PLGH 5D7HA 3B83A 3M8OL 5AYQA 3RIAK 2ED6A 1EAJA 2GBUA 2JKXA 4JRXA 2VJ0A 2I5YH 1D5IL 4NHUA 2WOYA 1A1NB 5CSGA 2WB7A 2CKBA 3UAFA 1CQKA 4A7SA 3CFIC 1H3UA 1NSNH 1D5MB 4K3JL 3VXUB 5D71H 4LCWD 4NC1C 1VFBA 1FZOB 3IU4H 3V0HA 3ZTJH 4DETA 5IQOA 1ZD6A 1Q72L 3H7BA 4GMTH 4U6YB 4XXDA 3O11B 3ARDD 1TTBA 5SV3A 3L95A 1DLFH 4NQEA 2OK0L 1PDKA 3Q6GL 2ICWI 1EHLL 1OPOA 4Q4IA 4V2BA 2Y6SC 5DVOA 1YEKH 3SBPA 4E9QA 1NMCC 2IWEA 2ADGB 3VGDA 2PYEE 2AERT 3BLBA 3QDGA 4JVWA 4S1QL 1H3TA 4LPCA 3HC3H 4EN2A 4HUVA 4PJ8D 2YZ1A 3PWUB 4DGWC 3RY5A 5J6GA 4ZFQA 3B9KB 3T4AC 5I5MA 5C9JB 3SDXF 4JJHA 1UHVA 1PVHA 5BRZD 5C0RL 3BMVA 4PGEB 1AD9A 3OR6B 5KYXA 4PG9A 1MCPH 5C0CD 4KH9A 3G04B 3NGBB 5EUOB 1PKOA 1HCVA 4AM0Q 1C1EH 4UM9A 2GBAA 2CO2A 4BIKA 5T5NF 5DUMH 3QJUB 4F7KA 3NZUA 4JGNA 1XV8A 3KLLA 1DZ0A 4CAGA 1G4RA 3FOMB 1JNLH 1I7TA 1O6SA 1A9BB 2AQ3A 3KPRD 4IRJC 4X80H 5I75C 1B3JA 1QFOA 1S5HB 3Q2VA 3SDYH 1AHWA 3ISWA 1CGTA 4LPVA 2HLFC 4WUUE 4XMLH 4AGOA 2AANA 3DX8A 5AD0B 3TNMA 1YMHB 2RJMA 2XVBA 4ENEC 3ARPA 4YXLL 1RPKA 2DB8A 4AE0A 4I0CC 4TPRH 3APDA 4AJ0A 3IDXH 5FO9B 1I9JL 5DSCA 1ZVHA 2JTDA 2X4RA 5ALBH 2KZWA 4Q6KA 3O8XC 4XE5B 5EC2A 5GSVA 4P23A 4X7CC 4N2HA 4HKBB 3SKNA 5K9OB 4Y4FD 3L4WA 3A24A 2PN5A 2V5TA 4ZAKB 5C07A 1SEBA 3QVAA 4U1SA 4XNBA 4UUJA 4M61B 1YAZA 3FSZA 4OFVA 4TSAH 3JTTA 1IGML 2C1OA 5KUKA 4A6YB 3DXAD 1P1ZB 3MAWA 3OKEB 2EQDA 1GAFL 2VH5L 2A9NH 4B0MM 4ZMWA 1Q90A 1AFVH 1TU2B 5GJTL 4LSPL 4Y9BA 1UA3A 1SDYA 1CG9A 3QXTA 3MXVL 2VITA 1KXTB 4TUUA 2IALB 3MBEB 2M2DA 3JV5A 4HYTB 5DO2D 1A6WL 4XPAL 5HGBB 1NDGB 1IKFH 2RFXA 2WBJA 2F53B 5KWYC 1BD2B 1CFQA 3PQYE 2V0AA 4ZW7A 2X5PA 3T0DA 4WKZB 3QAZB 3L6FB 1QNZH 1UACL 2HJKA 2ZKHL 2EXYD 1AGDB 4Y2LA 5EU6A 3ULVD 3LKOA 3UJIL 2COQA 3MC0A 5E0FA 5BPPA 4M56A 2N1KA 5CWSB 5C09A 1WT5A 1JGUL 3OB0K 5BZWA 1QR1A 4ZT1A 5B22A 4JM2D 3NPZB 4R4FH 4ZI8A 3T3MB 3I75A 3LZFL 4HD5A 3EJSA 4AJYV 3KCPA 2R0KL 4GRLA 5I0DA 3MRLA 3FB6A 3J8F7 4TOYL 3VI3F 4RWYL 3ZUNC 5JNYA 3NSXA 3UTZA 3H3PH 3UG5A 1HXKA 5DJAA 1GGUA 1ZT1B 1VADB 1Z32X 5J12B 2YUXA 4YXKL 1CXFA 1J9CT 3QI9A 3SGEI 3W1ZA 1KGWA 4HKXB 4JKNA 4O02A 1ZHNB 2A38A 2DWTA 3BP6A 3NG5A 2G2RB 4DP0X 3ES6A 2BNRD 2NY5C 1NUFA 4ZFOA 1CD9B 1KPUA 2Y6SD 1X5AA 4FMVA 1MCSA 2GSGA 3E6FB 3Q06A 5T3ZH 2B15A 4MNGE 1VCBC 4JCWA 1DVUA 1JK9B 5KVGE 4AMKH 3HG5A 2C1PB 3KS0J 5JZ7C 2D73A 3OMIB 5DHMC 2I85A 4UDTB 3HRZA 4XWGH 3PYCA 1AS7A 3NJFA 1NC2A 1U3HB 3R0NA 4HJUA 3ALXA 3NCJL 5E5RB 2RQEA 3S8GB 3BAEL 2G3XA 1ZK9A 1ZPUA 3D4YA 1ZCRA 3GJFH 4DHLA 4FKKA 2R8SL 2YMOA 4KJQD 2VDPB 2YUVA 3EYSL 3CUPA 1U9KA 3QWOB 1K3IA 2LFEA 3QFJA 4PJDE 2FGWH 4XVTH 5AB9A 1SBSH 4NWTL 2DWSA 3HBQA 3LZQA 3TA3C 1KIPB 4AZ8B 3GNMH 2GTZB 4IRJD 3IS0X 2ICWJ 4X4MA 3RDTB 2XPGB 4UBDC 2XG5B 3KD4A 3RWEA 1L9TA 5I73B 3BYYA 4HFUL 5IHHA 2FAUA 2XN1A 2X0WA 3DTXB 1UWGL 5K9QI 3LH2L 1X5XA 2FO4B 1KIQA 4JFZL 2DQGL 3V5HB 2B9AA 2FLRT 4OB5H 4XP9L 2WNXA 2WXNA 1TZHB 4X2UA 1QP1A 2V6HA 1DN0B 3GZPA 1KTDB 2X4PA 2ZUVA 3GK8H 5KAQF 2B1OA 3C75A 3EJQA 1N68A 4M1GL 4MNGB 1SHMA 3TS8A 4X6DA 4XGZA 1D9KB 2NY2B 2FX8L 2NDFA 3E6HB 3OAWA 4Z7QF 3IGKA 4TUJB 1FAIH 1BZEA 2AK1L 1T83C 2P44B 4CSZA 5ABZA 4PJBE 4YZWA 5JDSB 1BX2B 1ZVSA 1E2ZA 5GS0C 2F54D 5DXWA 3FU9A 1YUKB 2PPCA 1SVZA 4PJ5E 3V8OA 4MTMA 2QEJA 2DOCA 1A6TB 3QXWA 4XBEL 3U4BL 4KJWC 4FYSA 2J25A 1IQDA 4NZJA 1B2WL 3BUDA 4X50A 3E8UH 3PIQB 4D9RE 5JW4R 2HG5A 1UJ3A 3JUZA 3KPNA 2O26U 5I17A 1I3UA 4F7EA 1MVYA 4MZRA 5KSUB 1SXBA 3FBKA 3WN5A 3P2BA 2ZE0A 2G5UA 4GNKB 4RFNB 2AEOA 4GIOA 3MYZA 1KBGH 5CN1A 4N5EC 4QJ3B 3P11L 3C9NA 1IGCL 1P2CA 1QW8A 1E4WL 1YA5A 3L45A 3NFNA 4WEBL 4OLWL 3MRKB 3FONB 4JL1A 1IBFA 4AYGA 2E86A 1TQCC 3SGJC 1P5UB 3GSRA 5DO8A 4ONHB 4XNDA 4Z3FA 5FECB 2J8UB 2HH0L 3C6LA 4I0PC 4XRCB 4YX2H 1KC5L 1ML0A 5ID1A 3WTWA 3ZU8A 1X9UA 4HOZA 3I74A 5BW7C 3TO4A 5DS8A 2EDLA 1HNFA 2W0FA 3IFNL 4WWKB 1WAPA 5MEND 1M2VA 4PW3A 1F8TH 4JQXC 3ZN6A 1EMTH 4IW4C 3LYRA 5F96L 5GISH 3UXFA 2ZXQA 4LL9A 5I0ZA 3N1QC 3F62A 3HE6C 3I6LD 1EJ8A 4JFVA 3AQYA 2BJML 1MRCL 3FU0A 4UQ2A 4Z7VA 1RJZA 2AGJH 5DVLA 3IFLH 3I50L 1NANI 4TLSA 4MJ4A 3ECQA 1IKNA 3X1FA 1K4CA 1YY9C 2GAZB 2XWEA 4Z7NE 2VW4A 2FHBA 3H9SD 2XICA 4G9FD 5CEYB 5JW3H 3EZ8A 4HT1H 1C5DA 4ZTPH 3D0VA 4M7LT 2G5BB 3VRJB 1AZBA 1CD1A 4QDGA 5HI3C 1F1DA 1IARB 1DQLH 2A3TA 3EJJX 3PWJA 4M6OH 3WHE1 2WZPD 3TA3D 1WQVT 5JW4N 2EC8A 2JLPA 3M1BA 1FFOB 2WKLA 3LRHA 3PWNA 1BFVH 3MRFB 4XX1E 2P45B 3X1NA 3AT8A 1OM3L 5ID0A 3W9EB 2DS4A 4XPHH 4QXUH 3ATBA 4PRNA 1JZ3A 4YLBA 5KSAA 3DO4A 1R1CA 4GSDL 3ZMNA 5FYLD 2WAQA 5DD6A 3CZEA 2BWIA 3O3EA 3UTSB 3WUZA 1I8KB 4LDEB 5L8JB 3QEHA 4IJ3C 1TSRA 4I85A 1TJXA 5F7UA 3SZKC 3QJOA 4CN6A 1NLDH 2JK5A 5HGGS 5K9KB 2V9QA 1U8PA 1RZGA 5ICUA 2CNYA 2WXOA 4TF4A 1PG7W 3M17A 5GGUA 3RTQC 4OKDA 4JN2B 1NCCH 2FYVA 3D9AL 2BH0A 4IBZA 2BVQB 5LG1A 1PKQA 1W8NA 1FAKT 2VNCA 4RMSA 4HLJA 4ZS6D 2C5DC 1XGQA 4HXBH 4L8BA 5C2UB 3DX9B 4TRPH 2MOVA 1NGWB 1R3KA 1UA6L 1QBLL 4N85A 2C3XA 1QRND 1ZTXE 5GRXG 4ZRGA 2GJ6D 2DTMH 4U6XB 3A6CL 4MD4A 4UT9H 4AEHL 5J13B 5DRNA 5HHXH 1JMXA 2LU5A 2MTAA 3EW3B 3B2PA 5DMKB 3N41B 7CGTA 2DJ4A 1BM3H 1FDLH 2AKRA 1H5BA 2FWUA 3OJVC 4NPYA 1P4UA 2LE9A 5EEYA 4KX7A 4ODSL 1AKJB 5HVHB 3VXSB 5LBSL 2B1HL 4BQ6A 3DVNA 3TBWA 2ADFL 3SQBA 1YEGL 3LKNA 5INDA 1GKEA 3SDDC 2KERA 2ZX9A 1T0MB 1Y0LB 1DJHA 4ZO8A 3TBVB 1AZCA 3LNGA 5FDWA 1SMAA 1PL3A 2GK0A 4K7PH 2QDVA 1U93A 4KTDL 2WXKA 1O7DC 4DGUA 5KSBB 2JXMA 1TVBA 3QJFB 4WO4C 2XFXA 2G2NA 1AP2A 2UZXB 5AOIA 4M5YH 3JTSA 2X6MA 2E0PA 3APMA 4HAKA 3LRLA 1E28B 1KLGB 4K9EL 4K3EH 2ICEB 3ZE1B 1LDPH 5EIIG 1TNNA 4I0PD 1DBAL 2VC2L 2VN3A 4KKAC 2R7EB 3FUNA 4DEPB 5F7DA 5IB5B 2IWGA 2RD0A 2WXHA 5A2LH 1CO1A 4WWNA 1KLFA 3F84A 2H45A 3IDYB 4QRSB 3V4VL 2DBLH 3PXJA 4QXVA 2XHNA 3MV9A 2W9EL 4G7YH 2ZCHH 3L2NA 4N2LA 2P7TA 1OOAA 5I1JL 1EEZA 1ORSB 2VERA 3VXOB 3S4SG 4POZC 2J6WA 2WXMA 2WUBH 3AW5A 3BGFB 2X6BA 4R2GD 3WMQA 5D9SB 3RI5F 3G5YA 1L3WA 4NRZB 2EO9A 5DWUH 1A9EA 4P5KB 4L1LA 2J6EH 3IU3A 4NP9A 1I1FA 2E9BA 2VDRB 3DBXA 1HAUA 3CSYB 4JRXE 2BW4A 4BK4A 4HJ0C 1UD3A 3WDHA 3TFBA 2NPLX 3OJ2C 5JR1H 3PWLB 3GD1C 4MXVF 1M1XA 4MJ2A 1FORL 1DBJL 2P49B 4PIBA 4JDTL 1CLZH 1WSST 1NINA 3MACL 3QUMB 2BFVL 4X0KA 4XNZC 1EANA 4MQ7A 5LDUA 3IGFA 4OGXH 5DMGC 1T6VN 3RVWD 3GSWA 3IFOB 1KBKA 4LB8A 3A0OA 3G6DL 2HZHA 2DYSB 1XBDA 2R29H 4HCRA 4NQEE 4AKPA 1IGFH 4CKQA 3S34L 3SOTA 4K94C 3QZWG 4WZ9A 1JV2B 2A6IB 3QDGE 4RNRA 5LB1A 5I0WA 3QWNA 2VDLH 2XVGA 3FOLA 1KEMH 3EH3B 3UJJL 2MKWA 4HUXB 4YDIH 5H4YA 3KEHA 1HEHC 4OZHF 2SODB 1YG9A 4FP8L 5KJ7E 3SKJL 4G42A 4AYBA 3W0WD 4NN5B 3LJ3A 2CUMA 5IWLC 4DQOL 3I84A 3MUUA 2GSMB 2YC1A 4BSVB 4NERA 2HKFH 5J4MA 4Y4KB 5BZXA 4HWEL 4B60A 2BP0A 3ZYJA 3I6GA 2IDCA 4JRXB 3G7TA 2NTFB 3G08A 3GXDA 1RZJL 4NO3A 4BYHA 4QCIA 5I71B 4WAFA 5I1EH 3NAAH 1HHHB 4LEOA 1J8HA 3RA7H 3DHUA 3OAYH 1OB0A 3SE8H 2Q2EB 1AMYA 1TSHA 2B2XL 3P30L 2ATPA 5ESVB 4L4VA 1X5GA 3RBSA 1XZWA 2E4TA 1VRSA 4C4KT 3T0EC 1A4JB 1JK8A 4MAYA 3SDDD 4BSWB 4EKJA 1TIUA 4NQEB 2X70B 5KTEL 12E8L 4FEIA 4RAVB 4KXCA 2OTPA 1GC1C 5HPMB 5HYIA 5BMFH 2CPUA 4EZKA 4WO4D 2YPVL 2IBBA 2PYFA 3BUIA 2BHYA 3HI5H 3QDGB 3GTVA 2DEYX 3II3A 2BY3A 5HYEA 1E8ZA 4ODTH 3D5OF 3QEGL 5F9JB 5KW9H 4HS8H 2BXYA 3EFOA 4KXDA 4WUKL 4D9QD 2WIIB 4WO0A 4WHTA 3VFOB 1MHCA 5KVFH 1OW0A 4FFZH 5F2FA 1I7RB 3FDWA 3DPBA 2ARJA 4UTBH 1I3GL 2AF2A 4M62L 4QY8A 5HDOA 3RZCC 5JDJA 1SXNA 1OTUD 4JDVB 2FIKA 2Q86A 1TJIL 3P77B 1IEBA 1O6SB 2XKUA 3N40F 2J4WL 1OAXL 4XCNB 4ZXBA 1NMBL 3EHBD 4R5XA 3SDCC 1COBA 2RA1A 1UXWA 2Z91B 5EU6E 1AHWB 1QSFD 3H3BC 3IDUA 4QXTA 4FKEA 1AZZC 4J8RB 4MRCA 1TFPA 3VFVA 2ZXBA 5C09E 3HZKA 3TNMB 4BEIA 2MPAL 4GRWF 5HHMD 5EO0A 4QXWA 4HJ0D 4FAAB 1JDAA 1OSPH 2Z1PA 4IHOB 3QXUA 3GINA 1AD0A 1F00I 3C5XA 4QXGH 5F7KC 1KYUA 4QTIL 2IANB 4H0IA 5IY5B 2WCPA 4J12A 1BA9A 2DMBA 4LPUA 4AXWB 1X5ZA 3T77A 3SKNB 4IBWA 3KM1A 4I0KA 4NCDA 4NQDA 4QKXB 5CCJA 5JORB 3TF7C 4AX3A 3F7RA 4N20A 3N44B 3FT3A 4FN0A 1N4XH 2OBGA 2W0LA 4ONGL 1WHPA 4G6KL 4GMSL 1GZHC 2BWDA 1U8CA 3TXAA 2VLKA 4TNVF 4YGAB 1AHMA 5K1VA 3QHTC 4JFDD 2VITB 4OGAD 3EGXA 4FQ1L 3TV3L 2FIRT 3LHPH 1KJVB 5ABAA 4CVZB 2FJHB 5CJXC 4GAJL 1UM4L 2A9BA 3K81A 4OF7A 1CFQB 3C6EA 3LTVA 1MQ8A 4PBXA 3WKMH 3AABA 4L1DA 2WXQA 2HJKB 4F9LC 3HHSB 2APSA 3ZTDC 2BIQA 5J11B 1OQXA 2D7NA 4NOFA 1U3NA 3BPLC 2C7UB 3QFJE 4L4TD 4XX5A 3SKUD 4BUHA 5JXEA 4L29B 2XWZA 5GRUL 5J1AA 1QR1B 3N9GH 4FJYA 3T6WA 4XWOD 2NY1C 1E5ZA 1JPST 2FD6L 3CZFB 4HZAA 1UB5A 5E2TL 1I8IA 1NCGA 3IEAA 4G5ZH 4X4ME 3KCPB 2IAMB 3MOBH 5C0BB 2L7EA 3MRLB 2P52A 4ELMB 4XPTH 4MMZC 5E99L 4JLRA 3UTZB 3BVWA 3LSOA 3EOTH 4H13C 4FHBD 1JXDA 2AI0L 4DP5X 4X4YA 2ZKYA 5GRVL 2J2ZA 3ZKQD 3SE9L 5C0AA 1PG7X 4NKDA 5DK2A 5E00B 3BP6B 5AW9B 3OTTA 1ZLUK 5BV7C 3ATAA 5TQ2H 1P69B 4J6RL 3DDFA 2A83A 4NHCL 4Y16A 1T0NB 1EEQA 1M71A 2GSGB 4LSVH 4NRXA 3BP4B 3HG1A 5DYFA 2D31A 4X6DE 1CDGA 4GG6A 5I1LA 2H32H 3PU7A 1Y1DA 4WU7A 2WLMA 2WXFA 1XGTB 3MBWA 5MEPA 3HRZB 3S5LG 5F6IB 1NC2B 2KC0A 1CIDA 3NFSH 3CZJA 3EYVA 5I30L 3TYGH 1KFGA 4BINA 5BZDA 3HHMA 2VDMH 5AW4B 4R3SA 3CUPB 1ACCA 3BVNA 3RZCD 3U7AA 2YK1H 2CBPA 2CDEA 3MRQA 3RRQA 4PPTA 4PV8A 4DPCX 2SEBA 3GI8L 4PRAA 4L3EB 1Q8MA 5GJSH 3SDCD 1ROCA 1B88A 1H3PH 3FSVA 4GOSA 5FK9A 3MUGA 2ERJB 4AM0A 4NP4H 1OP9A 4J4PA 3RWEB 5EBWA 1G7IA 4JQIA 1NAMH 2AITA 4UQIM 2Y24A 3H1ZA 3FYEB 1KGUA 3O2DL 4PJXF 3VACA 3VRLF 4YDLB 2QQNH 2HTLD 4TSBH 5K9QG 1BXXA 4PN6A 4WKXA 5SWZD 5TFSL 3RL2A 3T8XA 1LEGA 1N59A 3AUVA 1YN7B 3SGDH 2V37A 4BZYA 5F8RC 5CU9A 4LKXB 5C0DA 2X4PB 1USZA 5I1HH 3VNYA 3IRZA 5CEZH 4JKLA 1R3IL 5HHQA 3HZVA 2K3HA 3WIHH 4GLRH 5LCVA 2IADA 3ARBD 3QUXB 3RZWA 43CAA 3ATDA 4MA8H 4EI5B 4YEFA 4KY1H 5FDYA 3FFDB 3R1GL 5BNXD 4K07A 1XXFC 4HXAL 3Q1EA 1AC6A 4LLUA 1U3YA 3RWFB 1GL4B 4AIXA 4WSKA 1FWXA 1N64L 2V33A 3T1FB 3REWA 1QFWH 3EGSA 1XMEB 2CGYA 3DVFA 2OZ4L 4BXVA 4Z7VE 3IVKA 4YXHL 3FRPA 5F3BA 2AXJA 1F18A 1R6VA 3QCVH 4B96A 5E5MB 1AY1H 2VR5A 3V0JA 5ICXB 4QOKA 3EOBA 1KENL 2W9DH 4P4KC 2HG5B 3JWOC 4E9WA 5I17B 1ED3A 4HUWA 5CZKA 1SHSA 1MCJA 4FNRA 3DHPA 5HI4D 4ZAKC 2WWKT 2A6KB 1OB1B 3C08H 3L7EB 4FERA 4HHGA 1MFBH 2B0SH 2NDGA 3ETBF 4U1IA 1LM8V 2FUTA 4FNQA 3QJHA 1T22A 3WSQH 4XXWC 5IMLA 3W9DB 5IB3B 1BZ7A 1RUQL 3QS2A 4WWOA 5TE6L 1VFAB 3VCLA 2F1BA 1P2CB 1WIUA 3MLTA 1DJIA 2X7LA 4NPJA 4BFOA 1OSEA 1P7KA 4P2YA 5T1KD 4OV5B 1PY9A 2P5WA 3MBEC 2MFNA 2JI1A 3C6LB 2WQRA 1GCYA 4Z7UF 5ID1B 1LK2A 5F6HI 3AXHA 3WDIA 2KHAA 4Q56A 3N50A 1AO7A 2W0FB 4F7MA 3JZ7A 3OL2A 5GRWA 1EO5A 2O5YH 2ZG2A 4PWHA 3QAZC 4FQIL 4PJHA 3D0AA 4JHWH 2FX9H 2ENJA 2YD1A 1UYWH 2X3AA 4P46A 3IMWA 3LV3A 4XMKL 4WI7A 5GGSY 2LVEA 3ESPA 2MOQA 2Z9TA 5IW6A 5KS9A 4KUZH 2AJXL 1PKQE 2HX7A 1OOWA 5HI5C 4UQ2B 4OIIL 4MDRA 3APCA 4QF1A 4AEIH 4L8DA 5K33A 3MZTA 3S35X 4Y0GA 4O51A 2QFRA 3OX8A 4LDCA 3AS0A 3AAZA 2CDFB 5FEBA 2HX9A 1ES0B 1C5DB 4CW1A 5D8JH 5DMIH 1P6WA 1PLBA 3HG4A 1R3HA 3VWKA 5ISZB 5J12C 5AVVB 5J9PA 2WANA 2VAAB 2YPLB 2XQYG 3H9YA 1FUNA 5DC9B 3TIEA 3V6ZB 2VLMD 4PD4J 4I18A 4AGLA 2UZIH 1MCWW 2E3VA 1OIOA 5E1QA 4KZDH 5KN5B 4WNQB 4PRNB 3X3GH 3MLZH 3VU1A 1JD9A 1A3QA 2EE3A 1SMDA 2O6DA 3EOAA 3E80A 2W9LA 3CMGA 5DD6B 3NDYE 4WCYL 3UJTL 4C58B 1UURA 2P5EB 2XWCA 4JFXB 1O7SA 1D7CA 5FM8A 3SJVD 1TO4A 2G4GA 6CGTA 3BJLA 2XG4A 3OPUA 4JKPH 1U3HC 2Y5QA 1XF5A 5EIIB 4YDVA 2W95A 2G3ZA 4DZ8A 1TEFA 3UO1L 2D0GA 4FFYL 2N3JA 1T2QH 1ZSHA 2Y22A 3WJMB 3WXVH 4ZFOL 4EQ3A 1MAJA 1A6UH 4OQTL 2FB4L 3W2DL 4BM7A 2Y5EA 3H42L 4RX4D 4UV4H 1CDHA 1PKQB 3ZTCC 1MCRA 3KYAA 4JPIA 2QL1A 2KLSA 1GJIA 4Q9QL 3MV9E 1XGQB 3IDMB 4L8BB 1Z3GH 4ZUWB 5A3IC 3BT2L 4BFEA 2E5EA 2CUIA 4H25A 5CJQL 5FYKH 1ZGLB 4C8XA 5I73C 4MD4B 3V5DA 2HVBA 5DRNB 3IDGB 2BNQA 2Y7SA 3N40P 3ARFD 3QJXA 3L3OA 5DTFA 2IEPA 2AKRB 2CJUL 1H5BB 5AW2B 1W6LA 5LGKA 2H3NA 4P4KD 2QPFA 4HGWB 1U3JA 3QG7H 3NN8B 3TBWB 1H6UA 3HMWH 2ZTBA 3DGCR 3TJEL 1IC4H 1D2PA 3FH7A 2X4UA 5BJTA 1MSPA 4LIQH 4ADGA 2PYED 5BOJA 5I1KH 2YD5A 1MCKA 2XCMC 1CXKA 7FABL 2GHWB 1D9KC 2NY2C 4OLVL 3F5WA 1H6FA 3QPKA 5HHPA 4HD9A 4ES8A 1C5BH 2XFXB 3MV8A 1AP2B 3LRGA 1XHHA 1HZHH 3DK0A 3FTUA 1HXMB 3WFCL 3G6AA 3MOQA 3QZWB 4PVBA 4P05A 1C5CL 1P7QA 5DZOA 1KCRL 3VXMA 3BN3B 4M6NH 1OF2A 5FKAB 1DSFH 1SF5A 3B6SA 1TZGH 3P69A 5E6UB 1MCWM 4KPHL 1KLFB 1W72B 3ZW3A 2OL3A 4B3EA 3ARUA 1T5KA 3QHFH 5DZNA 2QPDB 2P7TB 2R39A 5ITBH 2JJSA 3A4EA 4WUUD 4TUKH 4HG4K 3VWJA 3LXBA 4JKWA 5HI5D 2VZOA 4RFNC 3RGVD 1XR8B 5TE4L 3GMOA 3K3QA 1S46A 1ZDSA 3M7OA 1R5IA 2WOBA 2IQAA 3DDGA 1BF8A 2UX7A 3QUZB 3APFA 2MNUA 2IDSA 3RWGA 2ESVB 2JCCA 1FV1B 1IBGH 4PLJD 4U33A 3WL9B 2OR9H 2V9TA 4WY7L 1P5UC 4H26B 4O5LH 4PP1C 3VA2C 3VX0A 4YZFF 4AUJA 1XCTA 1FVDA 4ONFH 2NXYB 1A7QH 1J8HE 3SKMA 5F6HJ 4LZKA 4RGNE 1NEZA 2CA3A 1A4CA 4Y2DA 4JM4L 4PJEA 3ILEA 3IF1A 3AG4B 4MAUL 3CPLB 4WWKC 4MQ7B 5CCKL 2ZUUA 1MFUA 4H1LH 4GT7A 4L4VE 3P3SA 2VL5B 4I2XA 2AXFA 5D96B 5EZPA 3VQ1C 1DQML 3MRMA 3O4OB 1YECL 3I85A 1FG2A 1S8DA 2BP8B 1CF8H 1OT4A 1T5XA 1ZOXA 2R1WA 3AVEA 4KUCD 4O9HL 3MXWH 4AIOA 2FT6A 3Q8EA 2UXVA 5D2NB 4YFLI 2N7SA 5IHUH 3BRFA 3QIUA 4RNRB 3OKLA 4BELD 4D7BA 1ZWIA 4CC4A 3PQYD 3B1UA 3QIBD 5ACLA 4J5VA 4KNSA 1MPAL 2QPEB 4LPTA 3PGDA 2EICA 1IAKB 2DV6A 4GAGH 5IMOA 3T09A 4AL8C 4BFIB 4Z23A 3GXNA 4XMXA 1E6OL 2C4FU 4HQQL 3KYKH 4G42B 3WFBH 3K6IA 4P49A 4PSPA 5ETUB 3DA0A 3BH4A 2CLZA 3MRBA 2FYYA 4EUPG 1RZ7L 5A6LA 1KJ2B 2GJJA 3PWPA 2Y69B 3VJ6A 1GYAA 1INEL 2G60H 2EDXA 1TFHA 3VA6A 3ECUA 5CJ5A 4OLXH 3NCYP 1F2QA 2F5BL 2D4DA 3T2PA 4ZW5A 3G08B 2ZYRA 3PL6A 4DCQA 2DQTH 1MRDL 2K6ZA 5D7JA 1RERA 4AYFB 5FM5M 4DOHE 1OE3A 4E9TA 4YLCA 1J8HB 1P4BL 2O5ZH 4B5ZA 4RGNB 2VDNL 1WAEA 4IRSD 3FUKA 2NX5A 4IU2B 2QHLA 3BP7A 1QTYT 4H0HB 2AXGA 4OD1H 4LL1A 4PFEA 1DO5A 4PUBL 5DEFA 3NPSB 1JK8B 4MAYB 2J73A 3RWIA 1OGTA 1BGXH 4YBLB 3ULVH 4ZFGL 3O2WH 4I87A 1XH0A 3SDXA 4J1UB 3WJLC 4NQDE 3VXNA 1JNNL 5BQDA 3FU6A 4YQXL 3IN2A 4OFDA 3TGXA 3LN5B 5AZEL 1F42A 3L17A 2NR6A 4OT1L 3U7YL 1RU9H 2XWBA 3V6BR 2VLKE 3EJTA 2FJSA 4LVEA 5J13C 5F7EH 1MHCB 2Y07H 4YL4A 5B3JF 2WJ5A 4E5XA 1B4JL 3QFDB 4LRNL 4HALA 3DPBB 2A6DA 2ARJB 3O3UN 3IKCA 1YNLH 1JUFB 1CYWA 4FZEH 4I48B 5HVHC 1WGVA 4QY8B 3BKML 1XEDA 4WI6A 4X9GA 2QQKL 2FIKB 4G80B 2ZXEB 4TV3A 4Y5VA 2G4EA 1GW0A 1UT9A 3CFBA 3PHQA 3TBYB 3GHEL 2WV3A 4AGNA 1UKTA 3MRPB 3WV0A 4DKTA 1ID5I 2J5LB 3QQNA 1OAQH 2X6UA 3OMAB 4JFYB 1K8IB 4RDQF 3GRGA 4Q58C 1IX2A 1MQKL 4N90E 3BWUF 3II1A 3G6JA 3QJZA 4KO6A 3CVCA 4DW2H 4ZUTA 4BUQA 2JQZA 2YSTA 1AQMA 4PP1D 1OE1A 4H2CA 2ICEC 1U30A 1XZ0A 2PPDA 1PX3A 3NT0A 2BSRA 1YN6A 2W0KA 5CIPH 5F1NB 5E2WH 4DEPC 2K6WA 4QIRA 4H88H 4AOFA 3T77B 4KRPB 1BQUA 5DC2A 5I19L 3IDYC 4XO8A 4NQDB 1KV7A 5F3HB 3ROLB 3KDMA 1QYGL 2W59A 4JFOA 1NCAH 5C0AE 1E5YA 1WE5A 1F58H 1HHGB 5KVMC 3RURA 2HPTA 1OY3B 3L4CA 1IFHH 4TQ8A 3FN0H 2WXIA 2WUCH 3AT9A 2HLEB 3BGFC 4GJTB 2MCPL 1R47A 1PQZB 3GXUB 4XHQA 4L0YA 4PJ5D 3HG1E 1QVOA 2A99A 4F37K 3VSQA 5FO8A 5LQBL 2CUHA 4PV1C 3ZIYA 4GG6E 3S96B 4HIEB 2NZ9D 3LRSB 4G3YL 3OG4B 1U8IA 4JFEA 4D9RD 4HEPG 3OM3B 3CHPA 4M00A 3ULAB 2WVUA 2AJVH 4AMXA 1IT9H 4BH8B 2H1PL 3O3DA 3HOGA 5LAPA 1AZRA 1VSCA 5CGYC 4F8PA 1GGIH 1I7ZB 2I32A 4M8QA 1IM9B 1TYRA 4OJEH 5GRZA 2OSLB 3LRMA 4JGJA 1WBYA 3WIIL 5CP7A 4NZDA 3UP6A 4HDIA 3ZQXA 4YSDA 1WZ1L 2EIDA 3ARED 2B1AL 1E6JL 4S0TD 1UB5B 2ZWNA 5D5MA 4GKNA 3RVXC 1VB9A 1TG8A 1HEJC 4PRBB 4XHJC 3ZKND 4JLRB 3CZLA 4XBGA 3FTVA 1X5LA 4PJCF 3P4OA 1DQDL 4I77H 4N2CA 4PJAA 4RIRB 3ZLQC 2Z7ZA 4DEWA 3BKYL 3KWWA 3F7QA 4P5RA 4X4YB 3WKYA 1ZGLM 1TITA 5CD3A 4JVPA 4OLEA 5ESAA 2P3YA 1ZIAA 1OD9A 4LSQL 5DK2B 4XMUA 3B4NA 4J2QA 3RP1A 2B77A 3P2DA 4M4RA 4WI0A 4Y16B 3QC6X 1NPUA 3QJTB 1J9RA 3MA7B 1F3DH 2JV6A 4MJ5B 2QZQA 2C9AA 3VFMA 5K59F 4JO1H 4Y4KC 4G82A 4PS4L 1U36A 4WU7B 3VXQB 4HWZA 1MNUH 1N7MH 1ID2A 3MBWB 2H2PC 3OF6A 1J9TA 4WTXA 5I71C 3EJZD 3VU2A 2J6EA 2H4EA 2XBTA 4ZO6A 3O9WD 5BZDB 3FU3A 2NY5H 3QEQD 3FCSA 3X12A 4YDKL 5E1GA 3GZQA 2CDEB 4FQXA 4QOKE 3H0TA 5L0QB 1FL3B 2SEBB 2Y3NA 4W1TA 3O0RH 2NLJA 4PGZA 1MREH 4C54A 3AS2A 3KGUA 4ZOCA 3SE3A 3QIWA 4E36A 4EDWH 5M7QA 1I1YB 5KS9E 5SV4A 4Z8FH 3ZZ1A 4TQEL 5EBWB 2N01B 3L9BA 4FADA 2IMNA 3LPPA 4HIPA 2YPKA 1KTLA 1UM5H 2R29A 2XKNA 2VRKA 2VE6A 2W0PA 4X6BA 3BKCH 1UTDA 4KJPC 4ZMQA 4NKMB 1A7PL 2VXVH 3N6YA 4JB9L 2VXTL 1DJXA 2HFEB 4E41A 2P5WE 2NOYA 1G7PB 1ICTA 1SJHA 4KGJA 2HT3C 3CQFA 1MCCA 2X10A 1MIML 1Z9PA 1N2RB 1T89A 5D1ZA 3HVDA 1RCYA 2IADB 4TVPE 1AO7E 2PCFA 5TE7L 4FA7B 4MJIA 3RYMA 3NA4A 3MUY1 5E2UL 4GW5B 4LRIA 4M1CC 4O4YL 1BM7A 4PJHE 1LYQA 1BZOA 1IM3D 3ABLB 3BPNC 2X42A 2DQ6A 1AHWC 2AEPL 1OV8A 4H40A 4LLQB 4MCMA 1KWGA 2P9RA 2ZKMX 2XQYK 5EC1B 1B6UA 3GI9H 2Z35A 3VFRA 1X4YA 1AE6H 1T7ZA 3D1MC 5HHVL 3FRPB 5F3BB 2EIZA 1G9MC 4UIMA 1NOLA 4Q9RH 5IMMB 3AC0A 4QOKB 4HV8A 2CMRH 2X9ZA 1EA9C 3CSPA 1SDAB 1DVFA 4RGOH 2WZ5A 2AJYL 5D1XA 1Z9LA 1QHOA 5DR5H 3UPRA 5FA4A 3WXWH 1ED3B 1F3JA 1YDPA 2EYTA 4O58L 5J7CC 1RZIB 2VN7A 5DHEA 1GCFA 3VGHA 5D6DA 4FQCL 1SY6L 2WVVB 4NCC2 5AQ0A 3B9AA 3ZHFA 2AJUH 4HJJL 3ILQD 2DDQH 5GS0H 1A7RL 3JTBA 5F71A 3RVXD 1J0KA 5AFAA 3D3VA 3GZKA 5I66A 5GIRA 2CK0L 3DX1A 5A7BA 2B59A 5E6SB 1OT2A 3HC4L 5GZND 1ZKAA 3KYMA 1E2VA 4GXUN 3M1OA 5JHDB 3UIZA 4JZOA 2BSBA 2WNKA 3MREB 4OLZH 3U30B 1UENA 4RISL 2WBJC 2PWDA 1AO7B 5FB8B 2NZ1A 5TF1L 2WMPB 3FT4B 1PZSA 1K4DB 3DV6A 4XPGH 4I1NB 5SX4I 4I8DA 1J5OH 3DC0A 3ZE2E 4ILDA 1I3VA 3DBSA 3IPBA 2PO6A 3KL3A 5EZOH 3X3FH 4P46B 4N2BA 3LV3B 4KV5F 5J11C 4OZGF 1EFXD 4IKKA 4AVIA 5DI8A 3TVMA 5IW6B 3Q8BA 1CL7L 1DP0A 4BRVA 4F8NA 3MLVL 1WT5C 3ILPA 4N1CA 4Z7OF 3L3GB 4HF5H 4ZODA 2IAAC 4M4PA 4QF1B 5BQ7A 6PCYA 4EO5A 2H2PD 5E8DL 1XR9A 5DLML 3MVSA 1W0WA 4O51B 3MO1B 4F58H 4GRLC 2IAMC 1S5IL 1FPTL 4NDMA 1AGCB 1D7FA 4U6HB 3S7GA 2RCSL 5CUSL 3KPPA 4IYKA 1QEWB 3NABL 3SY6A 2O6PA 1GY1A 4CW1B 5EA0H 1SXCA 2EUZA 5E8NB 3RPKA 2BNQE 2EXTA 5KJRL 5I18L 4U1NA 3QI9C 1HQRB 4KQ0A 3TIEB 4AW4A 1MRFH 5E7BA 5IJCC 1HYSC 1CL7I 3N1PC 1U92A 3UC2A 4URKA 4NQED 4I18B 4DKFH 4MAZA 3D48R 1RIUL 2Y9RT 1DVXA 2XIDA 2ZWZA 1ZLWH 4XC1L 2EIEA 4I3SL 5BXFB 4QGYA 1M7UA 1IAIL 3QDGD 5B7EA 1LEIB 4XP5L 1N8OE 3BHBA 4JO2H 1KCWA 5JW4M 1NGPL 3LZOA 3MV8E 3HRZC 1N12A 5CZVH 5F6IC 5LNGA 1IEAA 3SYCA 4YDVB 2XLLA 3KVQA 2HT3D 1Z9MA 3CVHH 4QAMB 3VXME 1DDHB 3ZE2B 4UM9D 4Y9GA 5IESH 3FB5A 3QT2A 2CHNA 5DEGB 1YPZF 3UO8B 5EHFA 2FATH 4NJ9H 1ET5A 1IAII 1MNNA 4MCYA 4PJIF 4N4YB 4JPIB 4M1CD 5IUCA 4LGSB 1AG6A 5LO7A 2UWEF 5AAMA 2XA8L 3VXRB 2ERJC 1BREA 4TSCH 3D30A 2ZCZA 3MLWL 1KPRA 5FR3A 3GBDA 5AOLA 5T3XL 4LASL 3FU7B 3X14B 4ZO7A 4YDLC 4NUGL 3AM8C 5GSRA 2G3NA 4D94A 2EUVA 3BFOA 2BVUA 3V4UL 1RI8A 4ZMVA 2OMYB 1OM9A 2H3NB 2JCCE 2V5YA 3D87B 3Q2NA 1UZ8B 4PP2A 1DN2A 4N8UA 4F2MB 4HJGB 4W9ZA 4P23D 4CMHC 1CBVL 1YEIL 1JV5B 3C8KA 2XN2A 1XXDC 2EEDA 4S1RL 3BVTA 3PDOB 4Y1AB 5DJCA 4U7SA 5C07D 1LE9A 2WSKA 2X4UB 1DEEA 3MZGB 1AJ7H 3QUXC 4HMDA 4PJEE 3D2UB 3TURA 4JQIL 3F5WB 4D9LL 3QPXL 4OCNC 4I2XE 1JPTH 5I76A 1DBMH 2JB5L 4NQXB 4NZUL 4WU5B 5IQLA 1NCNA 3MODH 1JGLH 4WI5A 5CGBA 4G83A 1A3RH 1O75A 1GGBL 1JHLH 5DQDL 1DUZB 3OZ9L 2H32A 4TQHA 3KPSD 5E9DA 3VYOA 4HIIA 4M8VA 2WBJD 4DZBA 3FQUA 4NNPL 1QACA 5IKCA 4RDBA 2W80C 1S7SB 4UTAH 3PREA 5EU6D 5H35B 3G5ZA 2F19H 5F88B 1MKFA 4X6CA 1ZLVK 3ZL2A 1TJHH 5C09D 2JIXA 2BDNH 1IE5A 1PLGL 3E9UA 3PWPE 4PY7B 5M95B 3ULUF 3WYRA 4YUEH 3QR1A 5CFAA 1H3WM 2ZXWB 3N0AA 4GRLD 4K55A 4N86A 3EOYG 1G7MA 4JFFB 4UQCA 1BOGA 1ZPLA 2I5YL 4YMPA 2JCCB 3EUDA 4BWUA 2Y1AA 3U6XS 4OR1A 5DZLA 4A55A 1NSNL 3BZEA 4YSQA 1MFMA 3LN4B 1PZDA 2AFNA 5D71L 3QI9D 3C6LC 4P5TA 4ZPVA 1QBMH 3IU4L 4AT6B 1NEZB 1PLAA 5E08H 3W57A 1FF5A 3HLAB 5FLUA 2AQPA 2NX5E 4PJEB 5FO7B 3IF1B 4GMTL 4JDZB 3ROOB 3IFPA 4R90H 1JTOA 4OBSA 3K72B 2YAHA 1DLFL 4MQXC 3GXPA 1H8OA 2AXFB 4P2AA 5T5FA 5KYWB 5D93B 4AUYA 4FLSA 3GS7A 1JZ4A 1AR1B 1FG2B 1S8DB 2R1WB 2E74C 3SDXE 4PJ7F 1JZ7A 3F12B 2ZOKA 3OLGA 3HC3L 3WUWA 3V9CA 3Q05A 1KXVA 1AXSA 4KVPA 3OKLB 1K8DA 4WTQA 4XCCL 3NJXA 2E76C 3QH3A 4TUOA 5ECGA 5IMOB 1WEJH 2CO6B 3JXAA 1MCPL 3GSNH 4GQZA 3SKOA 1C1EL 5FGRA 1A14H 1ETJA 1MOEA 3QFJD 3WHE0 5JO5A 3OKNB 5DUML 4O00A 2V2XA 4X9YA 3PWPB 3VE0A 4BWTA 2BIIA 3OJDA 3VJ6B 2EDMA 1JNLL 2XV6B 4X80L 5KEZA 4K94H 2X09A 1EHKB 1RVFH 2IDTA 3WNIA 3BFQG 3C5ZA 2HRHA 2MSPA 4XCFH 3SDYL 5IFHH 3MCKA 1I1RA 5KSAC 4KXAA 4XMLL 1KJ3H 3TBBA 5I8CB 2WNGA 3EYUL 2ZSWB 3GXMA 4WJ5B 4G7RB 4AVJA 2HVKA 4TPRL 3IDXL 3G6JE 1UZ6F 2NX5B 2P5PA 3BP7B 4MMXA 2VKXA 3RHWF 1U4FA 5ALBL 4PLOB 3WS3A 3ZKMC 1I9IH 3BQUD 3NCYS 2VJ8A 3ORJA 5DEFB 7PCYA 3CN1A 1FNLA 3RWIB 1Q9WA 2VISA 4B27A 1URZA 1AAJA 1YC8A 2DJSA 2Y4SA 3FFOA 2HRPH 1G9NC 2B3IA 3SDXB 5JA9A 3GQFA 2AV1A 3Q6GH 3VXNB 3COOA 3KBFA 4J3WA 4TSAL 2IQ9H 5T1LA 3OAZK 4YBHA 5D7LA 4HULB 4A1RA 4QRQB 4U1KB 2Z8VC 2A9NL 5F97E 1XSKA 1HX0A 1AFVL 4IK7A 3WCYA 1PY0A 3GMRA 3KXFA 3OHXB 5IOKA 2V7HB 4IEFA 4E5XB 1KV3A 3FUEA 3MR9A 2A6DB 2CBMA 4ZMYA 2HKHH 1H5BC 4JFEE 1U8HA 4NFDA 3IKCB 4GY4A 1GZPB 1TTGA 3CHOA 4JREB 2CBOA 3KPQB 4FX5A 4KK6D 2A74B 1PZCA 5J1TC 4QHNA 3PHAA 1QNZL 1AXTH 4GEIA 5DFWH 4PRIB 3PHQB 1ANUA 5F44A 2VDOH 3PHOA 3BP5B 2N7AA 3MRJA 4OJCA 5DVKA 2ADYA 5GGVY 4ZBJA 3F6IA 3P9MA 4R4FL 4A2FA 5ENWB 3MYJB 2IF7A 1KB5A 1EXGA 2BHFA 5E1AA 5FWRA 3FCTB 4PD4K 3EDEA 5D5ME 5PCYA 3FB7B 3V4LA 2F0CA 1TTFA 3H3PL 3C6LD 5DJXB 2BC4B 1HN1A 2GYSA 4L8CB 1QZNA 3GMQA 3G3LA 1RJYA 3KPMA 3NMEA 3RX8A 4PJAE 1SJMA 3T3PF 3TO4D 1OPGH 2YD4A 3K6SA 5SX5K 3OGOE 1KCSH 1LQSR 3KDMB 2VO5A 1MJJA 2Q9OA 3GPEA 4RFOH 2WLHA 3SYQA 5B38A 1VAHA 4X8JA 5GRVK 3BXNB 3CC5A 4C57C 1UT1A 1JXJA 3U6XA 3GBMH 4HZLA 5T3ZL 1GGTA 3HFFA 2CRZA 3AG1B 3ARZA 3V0IA 4EN3A 4AMKL 2XX0A 2ZXCA 1E9QA 5FPIA 4HP5A 3QUZC 4A63A 2FTAA 3L5JA 4XWGL 4BD4A 5AKSA 4LL4A 3DK2A 4XPAH 3FQ2A 1DUYA 4C55A 3ZUCA 2DW5A 4Y2NA 2NXYC 4F80A 3BGMB 4XH2A 5TPWH 1GJWA 2DL2A 3GM0A 4XVTL 2FGWL 5B1JA 4M8QB 1HDMB 1SBSL 2PR9A 2PTTA 3UZVB 2W8CA 1LL1A 3VI3B 1N6VA 1SLVA 3GNML 4LEXH 3UEQA 4C4KO 4FULA 2NZIA 2WGNB 4MZIA 2HTKC 4U1MB 4N25A 5D96C 1X7TA 2VR7A 3VTTA 5KSAD 4OFPA 3O4OC 2DEWX 3AU1A 4HEMA 3V6OA 3GPSA 1RUPH 4Y5XA 5D2NC 3VFTB 2R0KH 4GEJA 4XBGB 5E23A 3R8BB 2M26A 4XO4A 3BEWA 5FA3A 2LAAA 4OB5L 5DRZB 4QRPA 2UZYA 5ESAB 2ZUSA 3C09B 3HE7A 4E41E 2R2BA 3TBSA 3GK8L 2VJXA 2QKIB 3ZE0E 1PD1A 4FGMA 2FR4A 2FO1A 4MNHA 3R8QA 1AOZA 3VFMB 3BD4A 4YHMH 1AQ8A 4MJIE 2DQEH 4FLOA 4D0CB 1UEYA 1FAIL 5TH2A 3NRPA 1YYLH 3U6RA 1QATA 1XCQA 3V6FB 4GT0A 4OF3A 4X6FA 1ZSDA 4EI0A 5C3LD 4U1JA 1KY6A 1HI6B 3EJYD 4H0GA 2ETWA 1EEYB 1SVCP 4IRZA 5JHLA 5IJVA 5B1KA 4OFYA 4P2RA 3AMKA 4RGNC 1RZPA 5BV7H 3GS4A 4GKZA 4PLNC 3X12B 4BK5C 1RY7B 3E8UL 3N06B 3BRDA 1HQ4B 3NPSC 4EKXA 4PREA 4MAYC 3RUGF 4YBLC 5D1XE 2F74A 3TN0A 3INUH 2WNWA 3VMOA 1U8KA 1RPQA 3FB8B 4CN1A 4H1LA 2QZ5A 4OSUH 1KBGL 2CO7B 3HCVA 4IU3A 1URLA 1U8MA 2I25N 3IGAA 2XPYA 4ZOEA 3SE4A 4HWBH 1TETH 4KJYB 4KK5C 3HAEA 1C08B 1JTTA 3MBXH 3D3VE 1QI3A 1UWGH 4ABVA 1MLCA 1SFDA 1N5AA 2DQGH 1NBCA 3MGTA 5K39B 3U25A 1PF3A 3WNPA 5C0GA 4AQ1A 4YX2L 3U46A 4Z7QB 4Z1PA 3BWAB 4WTWA 5HJ3A 2FGZA 4JZJA 1GVIA 2XZCH 3MV9D 3GIZH 1DQKA 5CR8A 1F8TL 4PVNA 2DLTA 2X9YA 1EMTL 3B7SA 2LLLA 4YSPA 1J0IA 4FHKA 1ETB1 3DX4A 4P06A 1HL5A 3C12A 2AGJL 4PGBA 3IFLL 3QJQB 2Z35B 5MEOA 1J1PH 1B3IA 1HTYA 4PVLA 3CD4A 4RBPK 4WJG3 5FM4A 2GCYA 2QV4A 4QRTA 2EIZB 1JPGB 5AAPA 5A40E 1CK0H 4YHPB 3D69B 3HPLB 1WGOA 5JW3L 4OJFH 2GIMA 4HT1L 4HV8B 4ZTPL 4XBEH 2XWXA 4APXA 1NAKH 5D1XB 2Z93A 3UPRB 2XY2A 1DQLL 4M6OL 4KRPC 1F3JB 4MA7H 2IBZX 4N2DA 4D8PA 4FNUA 3VFWA 5HXMA 4RVBA 2ZXGA 1HJBC 1BFVL 4EZJA 1LEKA 3S3DB 5DDHB 3NJHA 2E7BA 2XTSA 1AVAA 4XPHL 4QXUL 4FABH 2XBDA 2ZOUA 4Z7UA 5EZJB 3RGBA 2X2HA 1X5HA 3TH3T 2B59B 3OC8A 3S3PA 4MDJA 2BVPB 3K8MA 1WCQA 3KYMB 3QZOA 4LAQH 5DHYA 3WNKA 5FOBB 3JWOH 1OAYH 5EOQH 1XAUA 3FTZA 4NO2A 3HUJF 2R9HD 1CFSB 2CR3A 5BVJB 2X89D 1H3XA 3NJGA 4YE4L 2PO6B 4P2CG 1NCCL 2BHZA 1CDIA 3A6OA 4WHDA 5DI8B 5JXEC 4A6YH 3CXFA 4U2YA 1HEZB 1ZAGA 3MRHB 4HWUA 3ZX1A 1V3JA 1XF3A 1D6EB 2DQFA 3S37H 1BIIA 2J72A 4HZ1A 4TRPL 1Q0XH 3CU1A 1JWMA 3RPIA 5IB4A 4AENA 3SSGA 5C8JA 2DTML 3ARGB 2LFGA 4PRHE 4BHUA 4UT9L 1J8HD 2XXMB 2VMDA 4LLYB 5EBGA 5HHXL 3CSGA 4RGND 5E5LA 4CA4A 3WTUA 5FOJA 5L9DH 2CLVA 1G1YA 1PSKH 1BM3L 1FDLL 1N8ZB 1XB3A 4OLYL 5G4NA 4L4VD 4Y2OA 2TSAA 2J8HA 4W6WB 2ZSVB 1JGEA 4MAYD 4ODHH 1AI1H 2YRPA 1MCFA 2E47A 4Y16C 5I1IH 3V79C 1YEFH 1WWAX 1IJ9A 3W39B 4J8QA 5HGAA 4MJHA 3WNNA 1MLBA 1ZEAH 2NYYD 1UUSA 4K7PL 3F7LA 5FUOL 5AYTA 2ZCLH 4IDJH 3VSTA 2P46B 4KK5D 1QLEB 2B3RA 2RR3A 4ERSL 4M5YL 1XGPA 2Q1EA 1I7UB 4K3EL 3KVPA 3VI4F 1LDPL 1IEAB 4KI5C 2PW1B 2UY7A 2ZUYA 1ADQA 1A3ZA 2EAEA 3MJ8B 4HJTA 3LKPB 4L8SA 5E9DE 4GINA 1NGYB 3PHSA 5KSBF 1M7XA 3DYMA 4ZUSB 2QHRH 4RAUA 2DBLL 4QYOA 4A2DA 3F7VB 5L0QC 4G7YL 2JWYA 2ZCHL 3K8LA 1NUDA 4ZXBD 1HC1A 4UZGA 4WWPA 4AMWA 2WWKO 2OW7A 4X6CE 4D7PA 2WUBL 2XN9A 3B5TA 3MV7B 5CKAA 4PRHB 3BDBA 3WE6B 3S36H 5MERB 3IETA 1RLWA 5DWUL 2VO8A 4S2SA 4FA6A 2J6EL 4YHLH 1XFPA 3I02B 4P57B 1KYAA 1JZEA 5H37H 1Z5LB 1J10A 1JI1A 4L48A 1INQB 3FUHA 4Y9EA 1NC4A 3AADB 1I75A 5JR1L 4L3FA 1CFBA 4JCLA 3HC0A 4F8LA 4PP2B 5EMYA 4IKJA 4FJ6A 3LKQB 2YUZA 4NQDD 5DJCB 1CLZL 2JVUA 1CGSH 4Q4EA 4L3CA 4OGXL 5L88H 3DRTB 2YOAA 3P9WB 1ERNA 3GRWA 5D4IA 5BVPL 5ILTH 1UOWA 1U91B 2R29L 2X4NB 2Y1ZA 4OCYL 1IKOP 2VLKD 2NNFA 1IGFL 3NESA 1MI5B 4HOMA 2X0UA 1R24B 1M05B 3CHQA 4P2OA 3SODB 3VQ2C 1CVSC 2VDLL 2Z4QB 1KEML 3G5VA 1JPFB 4YDIL 5JPNB 1L5GA 1HE7A 2IDQA 3EF7A 1U21A 3K2MC 2HJFA 1CTOA 3G5ZB 3UMNA 2EABA 3TL5A 3VM5A 2NMSA 1SPDA 3ALWA 5KVGH 5JXED 1BIHA 2WY3B 3S97C 1KF9B 4P5SA 4G1MB 4Y8AA 3HZYB 4N90D 2HKFL 4MGXA 2QR0A 4X99A 3P4MA 1DFBH 1B9ZA 3ULVF 2C26A 3L13A 1MUJB 1KFAH 5DK3A 1BZ9B 1G7MB 4IS6B 4OCSH 5EN2A 2DLHA 2VR8A 3IJ7A 4DP7X 2K7QA 2OMZB 1E8WA 2OLDA 3KGTA 1OARH 4JCMA 5D1ZI 4JM2F 3O2VH 1M6OA 2HFFA 2H8PA 2YRZA 3NAAL 2D3LA 2ZUXA 3NIFE 3OXSB 4S0SD 5I1EL 3RA7L 5CEXA 4WFFE 4P5TB 1SEQH 1XX9C 3SE8L 1HOEA 1MW2A 4N8CH 3RWDA 2QQLH 4AKQA 4AVKA 5C0AD 2GT9B 5I16A 4Y16D 3IFPB 2LLNA 4W9HC 2KI6A 4BQCA 3MACH 4DPBX 3PY9A 2NSXA 4P46C 3T2QA 5EEVA 3HG1D 4LLDB 5D2LF 4E42A 1IBYA 5BMFL 4IQHA 4OZHB 2NUPA 3BCDA 3Q1SH 3DGGB 3HI5L 4K23H 2I24N 1U3ZA 1LO5A 4ODTL 1AXSB 3CFQA 4L37B 3DROB 1K8DB 4HS8L 1I4FB 5KW9L 3HB3B 5D7LE 1IGYA 3ZTJG 3QH3B 5KVFL 1NCIA 4XMVA 3TCLA 4ZD3H 3KXFE 5JQIB 1WIPA 5GHWH 3KLAA 1TTRA 3IGUA 1DBKH 4UTBL 5DJ6B 1F4XH 4KC3B 3WTYA 4ZW8A 3NJVA 2PWEA 3PABA 1KYFA 5F9OH 2RGSA 3DSFH 4I18C 3F01A 4H20H 4KITB 1ROWA 5EFIB 4J4PD 1EJ6A 2ED7A 3V7MA 1S7TA 1N67A 1T83A 1V54B 4Q52A 4JW3A 3AGWA 2QGBA 5AVXB 5IT2H 2WQ8A 1AR2A 4AL8H 1U58B 2HVKB 4B95C 5DJYB 1OSPL 3QEUA 2APTA 3OJMB 5KBLA 4QXGL 4EQ2A 3OKOB 3WS3B 3OKYA 4CADA 1EWHA 1H15A 5CSBA 3GMMB 4JM0A 3VTMA 3BUQA 1HHIA 2RMNA 2XZZA 5GRYA 2XVKA 1N4XL 3K1KC 4ISVB 2R1YB 4NO0B 4N22A 2W94A 3NQKA 2XIIA 5BUAA 1AQDB 4UT6H 4KKPA 2P24A 4R97B 5CJOH 1MJ7H 2Z31A 3AS3A 2R69A 2DWXA 4JRLA 4X5WA 3SO3B 4ZYKA 3Q5OA 4CVWA 1SJVA 3KYNA 4IEFB 4LCIH 3LHPL 5H94A 1PTZA 3QWRA 4MSWA 5C70A 4WI4A 3AGVA 2QADD 3MJ9H 5FYKE 3DX7A 2FT8A 3BVUA 2NXZD 1UD4A 3WKML 5BW7A 2P8MA 2C9SA 2DQIH 4GRWB 4X5QA 4W9IC 4ETQB 3TO2A 5C6WH 4K8RC 3O4LA 3ETSA 3QO0B 2R0ZH 3PAZA 1CFNA 3N9GL 2VWEE 3BJ91 3HE6A 3BD5A 4AIZA 1LE5A 2ZJSH 5DRXA 5MI0B 1A22B 4GS7B 4D3CH 4J3UA 1KB5B 3BZFA 4G5ZL 4G8GA 3MOBL 1G9HA 4LIQE 5LNEA 2P5WD 4XPTL 3V6OE 4Y19A 3PFQA 3QP3A 4P9HC 1UQSA 3US9A 1OGAA 2X3CA 4YSUA 1K5WA 3T2LA 2VRAA 3EOTL 3GMQB 3MFFA 4K73A 1AO7D 4TVPD 2O61A 2PCPA 1Q9OA 2BY2A 1CFTA 2BS71 4HIJB 5I8EA 3K6SB 5E6IA 4QRPE 4MD5A 1MJJB 3CVHA 4MDIB 2CALA 1ZS8B 3IMVA 3MROA 3U9UA 3CFJB 2YKLH 1E3XA 3FT2A 1KG0A 1KT2A 3FTXA 2J1WA 1JFHA 4LSVL 4M1DL 4OQ1A 4NSKB 1HL4A 4FD0A 1XAKA 1Z9OA 3HMXA 4NOBA 2IOIA 4UQ9A 2OAAA 4D0DA 1E9QB 3MRCA 1E0OB 1BFSA 2P80A 4W9DC 2F6AA 3GF8A 5DQ9B 2VSDA 2AQ1A 4F8QA 1ODUA 4P5MA 3NFSL 1TJGH 3ZHLA 1AGFA 1UT2A 3VWKD 1YQVH 2VLRA 1T21A 3S8WA 2AQ2A 3TYGL 3PAVA 2VGLM 4P2RE 3MX0B 2VDML 4N2IA 4LNVA 1F56A 3QK0A 4BFJA 1B0GA 2YK1L 3BAWA 3RTQA 2EH7H 1A3LH 4FNLH 1UOKA 1ZTXH 1FLRL 2FJGA 5GJSL 4PJCA 3MCYA 1H3PL 5D93C 5GRUH 4G7SB 3NIGF 3GMLA 5D6CA 3IJEB 3CXHJ 1AR1C 3GSUA 3JWNE 3OVUB 4LARH 3TCXA 4MZ3A 4QEGA 4I9XA 1NAML 4IDLA 5E2TH 4Y5XB 4XAKE 4MHHI 2C3WA 1E2WA 1IAOB 3MNMA 3UFIA 4TNFA 2QQNL 2VQ1B 4LGRB 1DEDA 3DRQA 4GB9A 4TSBL 3RQ3A 4LPYA 5E99H 1VJSA 5INCB 5FA3B 1QEXA 1QQDB 2Y1YA 3HJEA 5I6NA 3EGDB 3RKDC 3ZQWA 3HE7B 3ZXAC 1DE4A 2DIEA 3QUMH 3ZGIA 5I1HL 3SE9H 1RZ8A 4KFZC 5CEZL 1DVTA 5D7KE 1M9SA 3QZLA 3DETD 4RMWA 1OAZH 3WIHL 1NFDF 3OAUH 2VMJA 5IP4A 2GUYA 4MA8L 3QG6B 3E8VA 4KY1L 3BX7C 1EHNA 1OEZW 1MG3C 1GYCA 3EBGA 4Q6YA 3PWVB 5L7XH 2PW2B 1TQWA 3FFCA 3L5XH 4UMGA 2DPKA 4PS3A 3U6RB 2GPZA 1XCQB 4X6FB 1QFWL 1JAEA 1HKLH 5B39B 2C3HA 3UTPE 2EECA 3QSKB 5EPMA 4HJEA 2XV2A 2BNQD 2EKSA 3FQNA 1YC7A 1A5FH 3KNBB 4DPAX 5IF0A 5IJVB 2X6AA 3QCVL 4PCKA 1A6AB 2XA3A 4NXSA 3CN4A 1AY1L 1B0RA 2HVJA 1Z2KA 1XGRB 5IW3A 2FSEB 4GLRI 1C8QA 3QISA 2W9DL 4KKZA 5EU4A 1OT1A 3Q48A 3C60D 1GYWA 1PPIA 4DP1X 1NBYA 4PJXB 2QELA 5I5JA 3TN0B 4HPYH 2HLAA 3C08L 3V4PA 3B9DA 1MFBL 1MH5A 2B0SL 1QFWI 5HY9A 1MN4A 3W38A 4GUPB 5LN8A 3MV8D 5I2IA 2E6JA 2WCGA 2YMXH 4IU3B 2D9CA 3ISRA 3SQOH 1CZ8H 4GG8A 3MJ7B 4DP8X 2CKBH 4NN6B 4Z7UE 1P7QD 2N4IA 3VXMD 1CR9H 2EIMB 3VD4A 4OZFA 1BVLA 1OCOB 2DMGA 3FNKA 2GY7B 4JNXA 8FABB 2FHCA 3QPQC 2H1XA 3EH2A 4JZJB 5EO9B 1EVTC 2LV4A 4JREC 2O6FA 4FXGB 4NC1E 2A74C 2O5YL 3BKJH 3BUTA 3L5IA 3DMMB 3GSNA 4JHWL 1JYWA 3WLWC 1JVKA 2FX9L 3ME0B 4Y5VC 4OCWH 4NQSB 1UYWL 3H54A 5TDPA 3VWJD 4ABQA 4HISA 2KBGA 4ESKA 4RESB 5AVYB 1R46A 3GZOA 5C0IA 4KUZL 3PJNA 3ATFA 3FSWA 4JZNA 4PGBB 2QDWA 3NA9H 4GBXB 4AEIL 1CIUA 3QQDB 4I4WA 5J6HA 6FABH 1JZ5A 4QRTB 4YHIA 1GTNA 5FX3A 1X6NA 4U4BA 1L6PA 1UWEH 3FHEA 3LB6C 1KIUA 2DWDA 5D8JL 5DMIL 4APXB 1YEEH 4WHYG 4W93A 4Y2DD 4BQBA 1U2HA 4L0PB 1OP3H 1K5NB 3SPJA 2WQXA 1U8NB 3QO1A 3VFWB 4NENA 2NY6B 2K70A 2ZF9A 3X1EA 2UZIL 3V0FA 1XEUA 2FSDA 4H8VA 5B21A 4KZDL 1AR1D 3L48A 4NWUL 4U0RC 2XTJE 3X3GL 4Z7UB 3MLZL 5TE6H 4W9JC 5IEHB 3QIUD 3A21A 1G9MH 4MDJB 1XIWB 5L2KA 1NJ9A 2BLFA 3EYOA 3BW9A 1WK0A 1UKSA 1F6AA 4JKPL 4NKIH 4BRJA 4NO2B 1YHPA 4MMYB 1E5CA 2JJUA 3P0YH 2OSXA 1T2QL 3NZ8A 3WXVL 2FWSA 4A7TA 3WFEH 3CQQA 1A6UL 1YNTF 4GP5B 1QBAA 3PWPD 4XXCC 1W0VA 4QRUB 2GSIA 3T0EA 3ZRSA 4BWWA 4U1LA 4GXUM 4LHJB 4U3HA 3FO2B 4PJGB 4OUOA 4OAWA 2P42B 5KZCD 1Z3GL 4PRPB 2BOLA 3RPIB 3N5AA 1JWMB 5IB4B 4AENB 5IBUG 3PL6D 5FYKL 2CRYA 3FTGA 2WBKA 3DECA 1ETZA 2XN9E 5C8JB 5D7JD 2FJFA 3QDMA 3SYAA 4GKSB 4ODWA 5HDLA 1YMMB 2WINA 5L6YH 1TZ8A 2CLVB 2NX5D 4PHXA 2B4CC 1FGNH 3BH9A 3JWDH 4IGBA 3ZJAA 2K4AA 2EH8H 3QG7L 3C09C 5DRWA 3QUYB 5HSFA 2VLJB 1HNYA 4F93B 2FQDA 3HMWL 4YE0A 1IC4L 2XTJB 2QKIC 5CF3A 2YLHA 4LIQL 5I1KL 4O2FA 3EYFA 3K91A 1UGKA 2C3GA 2J3SA 1P7BA 5FF6A 1C5BL 1V7NH 3DVIA 2NR6D 3ARSA 5LGJA 3B2MA 2Z64C 4N3UA 1HZHL 3ZHKA 1MZYA 2C9UA 3DV4B 1ZE3H 2R23B 2EIKB 2A6JA 3S3JA 5F1SA 5ICZB 4PJIA 3QPQD 3FUJA 1DSFL 2YBRB 4O02H 1TZGL 3K4ZA 4P3DB 3SPGA 4L8SB 1RK7A 1ILUA 2YD0A 3A47A 3IJSA 1TLMA 5D1QB 1JWUB 5KVDE 2UWEA 4GSXA 3DGDA 3TJHD 2WIMA 2YGVA 5IBTH 5IIEB 3TESA 4RAUB 3LNFA 2HXAA 3QHFL 3W2DH 1CICB 1FL6A 1S7VA 3U83A 4FCAA 5ITBL 4BH7A 5HJDA 4RSYA 1AYRA 4NLAA 3L9RB 4TUKL 4YSEA 4AZUA 3IXTB 3IB4A 1WA1X 1SXSA 2XN9B 2WXGA 5CS7A 5HHNA 4Z5RA 3UBXA 5IQ7H 1PIGA 1U8LA 3IETB 4F8OA 3R4RA 2NUTA 3VQMA 5JOFA 1IBGL 3EO1B 2P8PB 4P4RB 4HCIA 4OM0H 3O3BA 2KL6A 2OR9L 2MNWA 1GZQB 3QWQB 1K3ZA 2QPUA 3HPJB 3JT0A 4O5LL 4DO4A 4PS7A 4Y5YB 2CJUH 1FVEB 4ONFL 4ZX4A 1A7QL 2XC8A 4XAWH 1T89C 5AENA 4EXKA 2I60H 4PLKD 2CPCA 4L3CB 5JUEH 4O2EA 1JGDB 1X5JA 2FQEA 4LFHG 4LRIC 3HN5A 3VGEA 2VIRA 1KELL 2MWCA 5A7EA 1CF8L 2YUWA 5IEKA 2CXGA 4JMXA 3MXWL 4P2OB 3UBGA 1UXMA 3DUUB 4JRWA 3CCHA 3WEOA 5IHUL 1NWOA 4K7PY 4ZZFA 4G8FB 4JFED 4XTRC 1S9YB 4MMZA 1C5CH 3PP3H 3G5VB 3U1SH 4GAGL 4PH8A 4LEBA 1JXFA 3GLAA 4MX7B 4NFBA 3KYKL 3WFBL 2Y5TA 5D1XC 1WTGT 2HJFB 1J7VR 2I9LA 2D3JA 4X7SH 5D6DC 4FFWC 1I31A 4PU2A 2NSQA 4I88A 1NIDA 4NI6A 4AGQA 5IHZB 1FJ1A 1KNOA 1G7QA 4QT5A 2G60L 2IV8A 3T65B 2WTRB 3ZQ9A 4ZMXA 3EIFA 2EIJB 3FUIA 4OLXL 4FFTA 1BQHB 5FM5O 4OF0A 4BQ9A 1PCXA 2ZG1A 2DQTL 3QCTH 1WC7B 2O5ZL 2BOBB 1A1NA 4MQSB 1H9VA 1DSWA 2Y1VA 4HWBA 5ALCH 3V9FA 1D5MA 3VXUA 5JLZB 3I9AA 1RP8A 5I16B 4OD1L 3VG0H 1MWOA 4V1DA 3ZDXE 5HYJA 3ETTA 1P84K 3F04A 3ULVL 1Z5HA 1FIGH 4U6YA 5D7IF 3WFHB 3O11A 2PO6C