5I73B

X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central and allosteric sites
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
218
structure length
218
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAYMELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Sodium-dependent serotonin transporter
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i73B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i73B02
1HXMA 2VAAA 43C9B 2G2RA 4MAUL 1NC2A 1XGYL 4I1NB 5DRZB 1VB9A 4HIIB 4NQTA 4OD2A 3ULVH 3KPQB 5MENB 3BH9A 1HHHA 4ZOEA 1OQXA 4HMDA 1F6AB 1GL4B 3N9GH 3V8OA 5JORA 4QRRE 4BFBD 2OJEB 4QGTA 4MQXC 3VXQB 1J86A 5KG9A 1P69B 1QLRA 4JPIB 3MQIA 3HUJF 2Q76B 3MOBH 1VFMA 1M71A 5IMKA 5E2JA 4RAUA 1KXTB 4X6FA 1ZT1A 3E1F1 4X98B 3HNSL 5IVOA 3NBNA 4PRIA 3UP1A 2G60H 4KI5C 1D9KD 3UPRB 3TA3B 1ZWIB 4DZ8B 3S9DB 4BQ9A 1WBZB 1X5YA 4XMKL 2JK5B 3MV8B 1EHLH 1U3HB 5E2UH 1DVFA 1U2CA 3FKUS 1G7LA 4U1KA 1JF5A 1RUML 3OZ9L 4IDJH 4KJYA 3MYZA 3L3DB 1KV3A 3KJ4C 1NMBH 4JFFD 4LARH 4F15B 4RIRB 4HW6A 4PTUB 4HT1H 1A9BA 4PJEE 5FHBL 4CW1B 3GO1L 4N5ED 1D5ZA 1TDQA 2KL6A 3P4OA 3JWDL 1YEDB 3IKKA 4UIMB 3W11D 2IANB 5DJ8A 2HG5B 1W8NA 4JFDE 3SKNB 2AXGB 4YWGH 2P49B 1VACB 4LVHB 5C6PB 2NXZB 1HHIA 2AEPH 3FRUB 1QYGH 3KXFE 4LCCB 2P8PA 4C4KT 1HOCA 5F3BA 3B4NA 2VLMD 5F7WC 4TUKH 4MXWH 4E41A 5EO0B 3LEYL 1DLFL 2FNBA 4HBCH 2Y06L 1P5UA 4EIGB 5DLML 1QKZH 4PLNC 5IQ7L 3FZUD 5C0ND 4YNYA 3J8F7 2HH0L 4R4BA 3OX8B 1MCDA 4KHTH 4KRPB 1AY1H 3WNPA 4NRYB 1QSFE 2WUBL 4M03A 3GDBA 3IJHB 3VRLF 1AGFA 3KYOB 1WZKA 1JN6A 2OS7A 1I8IA 3E3QE 4MA8L 3ZE0F 2YD7A 5C0BD 3TBSB 3TYFB 2ORBL 3DRQB 1QSED 1K6QL 4JLRB 1ZGLP 4NUGL 1CQKA 3D25A 3UTTE 1IC5L 4FXKA 1HWGB 3CVHA 1LE9B 4Z7UB 2VXTL 2EDBA 3VXRA 3F7VA 4KROC 3JTTB 2VDML 3QEUB 5I9QB 3QQ9C 1WTLA 1KEGL 5BVPH 3CLFL 3HS0A 5E9DB 4OFVA 3D69A 3QUXA 5HYEA 3F12A 3QJHA 5HDOA 2OX5A 1RZIB 1INQA 2H3NA 1R5WB 2XTJB 4JFFA 3G5VB 1P6FA 4AEIL 4TUJA 5FOBA 4HS3B 5FYJU 1ZVSA 2NZIA 3SO3C 5D71H 5I30H 5DTFA 5DJCB 1PX4A 1BGXH 5HBBA 3T08A 2BJMH 2NY4C 4MXQC 1JGDB 3WUWG 3AS3A 3QBTB 5GRXG 4HZLA 1UZ8B 3QFJD 4YBQC 4NZUH 3S3JA 4BYHA 4M7ZC 5DEFA 4RGOH 4P5TB 5IEHA 2LTQC 1S3KH 5HHVL 4CJ1A 3KNBB 3PABB 3P9MB 1I3RB 2F54D 4WW2A 5HVHC 5FGSA 1GIGH 3UBXB 4YHNB 4XPHL 2YBRB 4BSWA 1JWUA 1VFBA 5EORH 5DXWA 1XIWC 3HPJB 3TBVA 1P4BH 4AEHH 1MIEH 3RVVC 1U8JB 3U0WH 4ISVB 4LLVB 4JM2C 2FYYB 4RAVA 1X5GA 2GI7A 3GBNL 5MERA 4NUJB 4OF3A 3VXOB 4LQFL 4UZGA 4RQQA 3UTSA 2O5ZL 1FYTE 4PGCA 4UB0H 4TPRL 2QHLA 4A6YH 3GGWB 2CPCA 3WD5H 3TH3T 1CDBA 1IAIH 3U0PA 3O8XA 1RPQA 5DF0A 5C0BA 1F58L 3RIFK 2XIDA 1JZ4A 5EC2B 4KK5D 5IW3A 4KKBC 1CXIA 4QNPE 1FH5L 5CILL 3HUJA 1I3GH 1AC6A 4WI9A 5B3JE 4AM0B 5KANG 3O3BB 1OP9A 3DYOA 1YMHA 5GGQL 3NZ8B 3VCLA 1WC7B 4PRNA 3KAAA 5I16B 3MA9H 1CVRA 3G5ZA 1A0QH 1NAKH 2W0FA 2NY1D 1OT1A 2E7LC 3HC0A 4LIQH 2HLAA 4ZPVB 2NY2C 1NCAL 4LCWA 2X9XA 5ITFA 4G8EA 4OF0A 3PL6A 4Y4FB 5B3NA 1IAII 1H3PH 2VLLA 1ACYH 1QHOA 3K4AA 4C56E 3U83A 1OCWH 3RVWD 3ARWA 3NFNB 2A6DB 3FN0H 3SKMA 2P7TA 5L2KD 1HNFA 1NSNL 3LPGA 4IJ3B 4Y89A 1BLNB 3VE0A 2C5DC 4RMUA 1N2RB 2E9JA 2ED9A 2I27N 3U36A 2D4FA 3B9KB 1S7VA 3CMGA 4WUUB 4KY1L 3RZCC 3HZYA 5CMAA 1J0IA 4Y19E 5EBLA 2OP4L 2DLIA 3D87B 3I6GA 1ZA6B 2DQIH 1INDL 4GXUM 3MGOA 5KSUB 2QLVB 2LU7A 4LBEB 1PKQA 3MREA 1F3DH 1NCCH 1E6JH 3O81A 2MHAB 3WE6A 3MRFB 3SKOB 1FNSH 2R9HD 1RJYB 4QF1B 1RU9H 3VJ6B 3J7HA 1BOYA 1GGTA 3U6RA 2HA1A 4U6VL 1BVLB 3VI3F 1C16A 4KWUA 2DQTH 5I8CA 2A83B 3F7PC 5H8DA 5CD5D 3QUZC 5ADPH 5DDHA 2MTPA 3QUYB 4I2XB 3T0WA 1DBKL 3TBWA 2X1PA 5TF1H 3IFOA 2C4FT 4IRSD 5C0RL 1N5YH 4R3SB 2FX7H 3NN8A 2DAVA 3FO9B 1DANT 2F74A 1G7PB 3QWRA 1YEEL 5CGYD 1HYSD 1CZ8H 1XH3A 2H6PB 5C0FB 4LSPH 1NGYA 2EDWA 5EZIL 3F58H 4HIXL 5LGHL 5MHSE 3AXLB 1MCWW 4PLJD 1GC1L 3MRHA 1V3KA 5GS2H 3C6SA 4EN3A 3ARGC 1I1AA 3MLXL 4LSRL 3MBEC 5FYLD 3SE9L 3IDJA 2HWZH 4M6OH 1CL7L 3VWJB 1CI5A 1BF8A 1Q94B 4NRXA 1BIIB 2I60H 2AK4D 2BX5A 2XQYG 1G9ML 1YQVH 4G8GB 5D1XC 1E6OL 4FQPA 3P3YA 4M8VA 2XFXB 2BVQA 1NL0L 2ED8A 3TIDB 1KPRA 3FQUB 4YHKH 5IOPB 2HVKB 4YFLF 1QQDA 4I3GA 1EV2E 2YC1A 3W2DL 1ED3A 3CCHA 5AG8A 4I13B 3B5HA 3U7YH 5D2LE 4QLRA 5K59F 3E2HC 1Q0XH 3WNOA 5J8OA 1SJHA 3W9EA 1NKOA 5JXEC 5GGTA 5F9JA 4V2BA 5HYQA 1T3FA 1MQ8A 3HNVL 2JJSC 3RTQA 1ZEAH 5I19L 4XCEB 3FB7A 2R69H 4PS4H 4PRAB 4R7NB 1OSZA 4FFWD 5LBSH 4PJ9D 2BNUA 3P9LA 3KJ4B 3VXTB 1S7TB 3QB7C 3BVNB 4MNQE 1I9JH 4PIRF 2CRYA 1TXKA 3B2VH 1HXYB 2VZ1A 1W8OA 4V1DE 4K3JL 5C0JB 2HRLA 1ZLWK 2GTWA 2FATH 2P45B 4QRPA 2XZQL 2D03H 5J11B 1VA9A 2HKFH 5C8JA 3MJ7B 4ZTOH 5CGMA 3GMMB 1E4XH 1BJ1H 1JHTA 4HGKC 1T5XA 4QTIH 5D7JD 3UTQA 3MA7A 1YEJL 3TV3H 1SMOA 5BVJB 3GSXB 1L7IL 4N0RA 1AE6L 3EO9H 2JB5L 4ESKA 5FAAA 4WFEE 4GKSA 4KVCH 3NGBC 5CUSL 2EZ0C 1S7QB 1DN0B 1FDLL 2EDYA 1VERA 3DBXB 3HAEA 4UQ2B 4JJ5A 1G7IB 1L6ZA 5CJ8A 1JRHL 5TDOA 2RIKA 1DDHB 1F2QA 4D0CB 3VFPA 4L8SC 5C0AA 3ZLQC 1NCWH 2DWEB 5J7CC 2IALB 4TYUA 1IFHL 2WP3T 5FUZL 5IFJB 1R3LA 2AQ2A 3BZFB 1OHQA 3L3HB 3GRWH 1FFPB 4GBXA 4NQCE 1K4CA 4KTEL 3V0AC 4P5MA 2FJFB 4Y4KC 2BHZA 1UCBH 3C5SA 4ZQKB 5EOTA 3CNKA 1AXTL 1MRCH 5E8EB 1KIQA 4J6RH 4UQ3A 3HFML 1YC8A 3SO3B 1QFWL 2DLTA 5FYJD 2NY0D 2FB4L 3ULVE 1EO7A 3MV9B 4UDTA 2JELH 2NY4B 2A6KB 1C5DB 3O3AB 3V6ZB 3NCBB 3PIQB 5ITBL 2W65A 3HI1A 1RUPL 4M7ZB 3WJJC 1AHWC 4JHWH 5F7YC 4WI6A 1TVDA 5FIEA 1JBJA 3DHMA 1J8HA 3LRGA 3ZKNC 3GIZH 1R0AH 2H2SC 2X6MA 2EDXA 4OT1L 2ESVB 1KFAL 3JVGC 3QIBC 4MA3A 2VDPL 1RHHB 1XIWB 4GG6F 4XHJC 4UDUB 2IBZY 3FQRA 2XY2A 3FTGA 3V95A 3MLYL 3HZKA 1CIDA 4JM2B 5F6IC 1IZJA 3ZDZE 43C9A 1IGYA 1U36A 1UZ6E 3T65B 1IGIH 1BD2B 1AFVL 4JRYE 4NFBA 1JVKA 4X4MA 3OAYH 5DRZA 2PNDA 5BXFA 3KPQA 5MENA 4LPYA 4G8GE 1VPOH 4XAWL 2ZG1A 1UJTA 1F6AA 5I6XB 4JEGB 2C7UB 1LNUA 1GGYA 1RFDH 1ADQL 2OJEA 4Y7MA 4X4YA 4TTDC 1G1CA 3BP6B 1YJDC 4OGAD 3NIGE 3VXQA 1WWWX 2M8XA 4Z7WE 5JR1H 4JPIA 3T0EC 2Q76A 5IBLC 1Z3GL 1LD9B 5GGTL 3KYKL 2V5YA 5HGDA 1YN7B 3SO5A 5A2LH 1TJGL 2W9DL 5DD5L 4X98A 4WW1B 2WWMD 4JVPA 2OXHA 4PJGE 5DQ9B 2NZ9C 4P2QB 3VXSD 3ROOB 4QHKI 1DBMH 1F6LL 5F7FA 1JTOA 2XZAL 1Q1JL 2BVPB 2OM5A 1WBZA 4ODSL 2JK5A 3MV8A 5CKGA 5FA3A 1NH6A 4XBPB 1C7TA 4DGIH 3MTRA 1MRFH 3IXAB 3L3DA 2YPVH 4Y88A 1JPST 1Y18B 2K3TA 4Q9QH 4PTUA 1J7VR 3NH7H 1TPXB 3X14B 3K74B 4HJJL 3WFZA 1EZVY 5KSAC 5I1AB 4G6KL 3R1GH 3HE7C 1ZGLM 5F97E 5SWZD 3S34L 5DJDA 3NPSC 2HG5A 4R9HA 2Y36L 4NQEB 3SKNA 2AXGA 4NNPL 4PUBL 5INCB 2V17L 4JO3L 3RZCB 4I3SL 2D7PA 1MWAB 1KJ2A 4MDIB 5HHXH 4EJ1C 4X9HA 2HT3D 3FRUA 5FYLL 1UM6L 1M6OB 3NA4A 2EYSB 3GMNA 4DUVA 5DSCB 5DVOA 3HNSH 1S7XB 5DD0L 3LQZB 5EO0A 4XMLL 1U93B 4Z7VE 4KK8C 1NDMB 3D39D 3RWFB 4XMKH 2ZNWA 3LKRB 3EKCA 5B8CC 3ZHKA 4TNWK 4ZS6C 4QOKB 2GAZB 3OZ9H 2PO6D 1ZA3B 3KPNA 3X11B 3ZSTA 3QUZB 4JQXC 1N3NB 3KYOA 5FHBH 4FQXD 3GO1H 1CDJA 3ET9F 3TBSA 3TYFA 3DRQA 1FHGA 1MAJA 1FRGL 5T5FL 2ITDB 2HN7B 3TESA 3JWDH 3K2MC 1N6VA 2EXYD 2O5XL 5DRXB 1JHKL 1J5OH 1LE9A 1XF5A 4P2YA 4GMTL 2EEBA 3JTTA 4PJXE 4R96B 1R3HA 1YY8B 2C3XA 1YMME 2G75B 3HI6L 3OKLA 3UTPE 2DRUA 4N90E 2HKHL 3VG9B 4YDKL 4HH8A 2RCSH 3OB0K 1CXKA 3MC0A 2X41A 3MRJB 3NFSL 3NCCB 3IFNL 5TGBA 5D7LD 1DLFH 2Y06H 4MD0B 3TT3L 5DJCA 2OBGA 1F4YH 5DLMH 3SCMC 5GSRB 3MV9E 5IQ7H 4KK9D 5SWZA 2D3VA 2DOCA 3MCLH 4ZTPL 2HH0H 4GQPH 5IW1B 2YZ8A 4M6ML 4P5TA 3LRHA 1OAXH 3HHRB 2KH2B 1XT5A 2WUBH 4JY6B 2CR6A 3KNBA 3PABA 4GT7A 3P9MA 5BV7B 3E2HB 1T03H 4ELKA 4LSTH 2ORBH 5KANI 2DQHH 1R3JA 4YHNA 3UBXA 2YBRA 3K0WA 4NUGH 4GG6A 1B0RB 4J3SA 3QEHB 4KQ3H 5DMIL 3GIVB 1EEQA 1IC5H 3QQ3B 5GRZA 3IDNB 1C1EL 2VXTH 2WBJD 8CGTA 4DVBA 2R56H 2VDMH 4LLVA 4LIQE 1KEGH 3CLFH 4U05A 3TCXA 1UYWL 4WHDA 3VXOA 1JGVH 3V5DB 5CIPB 2PO6A 3RVUC 1OTUC 2A6IB 4HIEA 4DFIA 1IBGL 3TT1L 4AEIH 3GGWA 1RK0B 1YA5A 3LDBB 5F3HA 2NMSA 4KJWD 5D1ZB 4JR9L 4YDVA 3MXWL 2APVA 4NO5B 3T3PE 5EC2A 3CMOL 3EJYC 4AM0A 4POYA 3HPLB 3TZVC 1MSPA 3O3BA 3PNWA 3NA9L 5J6GB 5ETUB 3NZ8A 1ZE3C 1AR2A 5HHVH 1RJLB 5JOPE 2CGRL 3BUYB 1WC7A 3KJ6L 5I16A 2CK0L 4PP1D 5FYJL 5A3IC 3C09B 5KSBB 2BVEA 1T7YA 2PR4H 4XPHH 3PP3K 1JCKA 1GPOL 4ZPVA 3NGBB 4D9RE 4ODUB 1A3LL 2C4XA 4WEMB 4Y4FA 4HX1A 1AXSB 3JUYA 3AM8A 4D2NA 4HK0A 2UUDK 2H26A 1Z5LA 3GBNH 4UNVA 2KBGA 3L5XL 4XTRD 3NFNA 1GH7A 3VXMD 4LQFH 2WIMA 2O5ZH 2WWKO 3RIFF 2YD8A 3FHAA 1BLNA 1KPUB 4PRDA 1KJ2L 1N2RA 1PD6A 2D7NA 3SPVB 5JA8B 3B9KA 3DUSB 4OZFA 2N1KA 3HB3C 5I15L 5D96C 4LASL 2OZ4H 4IMKA 2ICWB 1FH5H 1N64L 2A77H 1CT8B 4D3CH 2N56A 3MRMA 1J0KA 1ZA6A 5GGQH 2VXUH 3T2PA 4Y4KB 1PQZB 2VN4A 1KG0B 4NGHL 3CVIH 3TVMD 4ACPA 5JW4Q 1TETL 4LBEA 5DZLA 3C6LC 4N8VA 3K80A 3MRFA 4LVNC 3SKOA 3I50L 4AZ8A 1RJYA 3VJ6A 1Q8MA 5HD8D 5J9PB 1MHCB 5DQJB 4ZFFA 3LQAL 4FQCH 5IKCB 1NCAH 2DS4A 3ARFD 3BPOC 4UOJA 1BVLA 4J3XA 4XP9H 3T2QA 5DI8B 2GITB 2E7MA 4J7RA 3U4EB 3NMEA 3C8KB 5FB8A 2XNAB 4PYGA 4ZDHB 2PYFA 4WTZA 1F6FB 4UINL 4LLYB 2R8SL 3HC3L 1E0OB 3DGGA 4R3SA 4OGZA 5IB2A 3SDDD 2AKRA 1X4YA 2IQ9H 3QIUD 3QIBB 1G7PA 2H6PA 4KY1H 4ZXBC 5DJAB 4MCZA 2OP4H 3D85D 3VMOA 3WDHA 5EWIL 1MI5E 2DKUA 1DSFH 3UEZA 2F53E 3VWJA 4GAGL 3BP7B 2QHRL 1BIIA 1AR1C 4M4PA 3I3EA 4PY8I 4XGZB 1NJ9B 2VMFA 3D48R 1HIML 3GZKA 4YHYB 3GSVB 4JDTL 4G80A 5CEXB 2FECL 3TIDA 3FQUA 4B53A 4U6VH 1WUNT 3RGVD 2APFA 3VXUE 2Q87A 4Z7OF 3MCKB 1FAKT 4KH2A 1MHEB 1RMFL 3QQNA 4G9DB 1TJHL 2DD8H 4J8RB 5EZOL 3TCLA 4FNLL 3BMVA 1U58A 4C55A 4S1SH 4ENED 4Q58C 4K7PX 1AO7B 2LU4A 4R8WL 3RDTC 1SVCP 3O4LB 5T3ZE 1D3CA 3TVMA 4CVUA 2IPUG 1JI1A 5E2VL 3U9UB 4E5XA 5EN2A 4XCEA 3KHOA 2KZWA 1OGAD 4PRAA 4L3CA 4MMXC 2VDRL 2IAMD 4YDLB 3O2DL 4NWUL 3JV4A 1GC1H 2OLDA 1FJ1A 4MVBD 5HVWA 1U8OB 3MLXH 4TSBL 3NTCL 4LSRH 4FABL 4KKAD 1U91A 3SE9H 43CAA 3K1DA 2ZSVB 1HXYA 5HHOB 3Q6GL 3A6OA 2VR5A 1G9MH 4R4FL 1E6OH 1OTSC 3WNKA 3DX6A 3VXPB 2B20A 2NPLX 3REWB 1NL0H 4AENA 3QO0B 3QRGL 4UBDC 1ZGLA 4WNQB 4HQQH 1IMHC 4XNUL 3ILPB 3W2DH 1DANU 1KF9B 4AH2B 5IV2B 4EKXA 4NYLB 1I4FB 4BFGA 3D85A 3GSXA 1NANH 4ZAKC 1YQ2A 5DK2B 4UV7L 5GQBA 3WHE1 5KSBE 3HR6A 1ORQB 2P24B 2XXMB 4M9PA 3HNVH 1FG9C 1S7QA 1KJVB 1DN0A 5DFVC 3DBXA 4UQ2A 1CL7I 4QRUB 1G0XA 3RNQB 4JZJB 3CFIC 4I3RL 3W9DB 2B2XH 3MJ9A 1BX2B 4NOBA 2R0LH 1DDHA 5C1MB 3TJHD 4JKKA 3IDMB 3G9VA 3RGVA 3QXDA 3EJJX 4JN2B 2V2WB 5TPWH 1G7HB 2I07B 2ZCKL 4K3JH 4OLWL 3DIFB 5IFJA 4PJCB 1CFQB 4S1QL 3W0WD 1KTLB 5CZXD 2GSGB 2XZQH 5T3XD 2Y4SA 3DNKA 5GGSY 1U2HA 4G3YL 1FFPA 2DQGL 3DWTA 1JZ6A 3P73A 1JK8B 1OGAA 3D0VB 4OZ4B 4U6YB 2G5BB 4M6AA 2YWZA 4PTTB 4X7EC 5FM5O 1JE6A 5T1MB 3QG7H 2EDFA 2GJ6B 2WK2A 2VH5L 1OB1B 3TIEB 3BRFA 1L7IH 4F8TA 2W9EL 1AE6H 5F8QC 3O9WD 2NY5L 2JB5H 1HHGB 3H3KA 4LF3B 3BRDA 4X8XA 4YLQT 5CUSH 4MQTB 3SCMB 3CJJA 5DMJB 5EUOE 1DQLL 1FDLH 4OZIE 2A6KA 1C5DA 3U30B 5EO1B 1F11A 3UDWA 4K9EL 1JRHH 2YA2A 5C0EB 3WS6A 4S2SB 3MXVH 1I1YB 5E56A 4PJIF 3QSKB 1WAAF 4P49A 2ESVA 4PV8B 1GVIA 1IFHH 2JIXB 1XF3A 4XVTL 5FUZH 3RL1B 1RHHA 3ZDXE 1QSZA 4UDUA 3ZMRA 1MQKL 3QJFB 1UKSA 3F5WB 3B8SA 4OKDA 1CFVH 4JZNB 3S5LB 3KPSB 3T65A 1BD2A 3OKDB 2ICWJ 3S98A 2HT4D 4BZ2L 2BY3A 4I9WD 4HWBL 3QG6A 4CN1A 1JRHI 4K23L 3IFLL 5IF0B 1I1RA 1QFWH 1TCRB 1T7WA 4U1NA 2C7UA 2XWTA 2FB4H 1MCKA 3QIWB 3BP6A 1N0LA 3P4LA 3QUMH 3W0WA 5ITBH 3HCVA 1RUPH 3U4BH 3C60C 1LD9A 3T0EE 2HTLC 1VGEL 1II4E 3HN3A 1WZMA 1BFSA 4Z76A 3RWIB 4WW1A 5EDXA 1GOFA 5DQ9A 3FQTA 4P2QA 3GBLA 4OT1H 4JPVH 5CZVH 2NY6C 4L29B 1KFAH 4J12A 2BVPA 4GMSL 3W39B 5BMFH 4H8WL 3OGOE 2P5EE 5JW5A 2XPGB 4QEGA 5FA4B 4XBPA 1F4AA 2EKSA 3LD8C 5DHVB 2MMXA 3MLYH 4GRLC 3SGKA 4EOWH 2P8MB 2KKQA 3P9WB 3IDXL 1A7RL 3X14A 5IEKB 3M17A 3BW9A 1EFXB 2GTZB 4G9FB 3WLWD 4BM7A 3IRZA 4G43A 2R2BB 2PTUA 4N0CD 4WI7A 4NQEA 1ADQH 1MUJB 1U95B 1H9VA 3SJVB 4D0DB 4JANB 2PTTB 3F7YB 5SWQB 1MWAA 4MDIA 5LVEA 5DK3A 4KJPC 25C8L 3VD9A 1PSKL 1M6OA 3ULUF 1Z3GH 1IM9D 5E6IC 3WFCL 4Z5RB 2RFXB 5C0CE 1VENA 3KYKH 3EOYG 1B88A 1G7JB 4N9OB 5E7FA 5DD5H 3BDBA 4AIZA 1E4KC 2Z4QA 1TZGH 5DZNA 3PWPD 4R4ND 5ABDE 4GQ9L 3QYCA 5LCVL 2B7DT 5INDB 1U93A 4G8IB 4LVNB 3KLSA 1Q1JH 3WO3B 1NDMA 4P2RB 2GUOB 4ODSH 5ACLA 2Z93B 2CDGB 2LABA 4NQSA 4PR5B 4K3DL 5HHMD 4QOKA 5EOQH 3BZDA 2GAZA 4NHCL 1SJEA 4CJ0A 1D5BA 5KVEL 1ZA3A 4M48H 3U48A 1WF5A 4FQ2L 1IKNA 1M7IB 3UJIL 1I9RL 3OHXA 1OARL 3LSOA 3MRLB 4HJJH 3LKQB 4M3JA 3UTZB 4G6KH 1MFDH 3ELAT 4K2UL 2HN7A 1N8ZB 1NKRA 3HLAB 3L95B 4RGND 3S34H 5DRXA 2BVUA 3WL9A 2Y36H 3S37X 1GCFA 4PUBH 4YGVB 4JO3H 2IH3B 3C08L 4I3SH 4ZXBB 2EDKA 1YY8A 1B4JL 2BOBA 2G75A 4QGYA 1RIVH 3GI9L 5FYLH 1UM6H 3KLHC 5IG7B 4OQTA 3NIDF 5HDQL 3N85L 1NPUA 2FL5B 2MJWA 1ZLUH 2PXYC 3SQOL 3MRJA 1SYSB 2D7QA 3CUPB 5DD0H 3CXHJ 1H3UA 4MD0A 5JHDE 5GSRA 3VI4E 2FBJL 1JWSB 2G9HB 4IS6B 4JFEB 2W0LA 3DRTB 1NCUA 4X6CE 4U1MB 4PJIA 3CSPA 4R7DB 1XR8B 4JRXD 3L3IA 1BQLL 1WAAA 3C2AL 3L5HA 4JY6A 5JUEL 2XYCA 3G5XB 1F90L 3IGAB 5K33A 4PJEF 4X6BA 2QQQA 1L0YA 1JHLL 2B5IC 3V6OC 3PWUA 3VD7A 2R1XA 1FRGH 2IC2A 5T5FH 1B0RA 1MIML 3QEHA 3GIVA 3ULUD 3SDAD 1JHKH 3KLAB 3PWPA 2I5YL 3GSNH 1K2DB 2X7LB 3VRJA 3VA6A 4QXGL 3V5KB 2BNRD 3IDYC 5F6HI 5F89B 3CK0L 1U8LB 3HI6H 4PB9L 4MAYB 4L5FL 1FG2A 2HKHH 2W1NA 4AIXA 5FK9A 3PWLB 5CKAA 4Z0XB 3GSOB 4YDKH 4LCUB 3AMLA 2Y23A 2V5MA 3A6BL 3NFSH 4JCMA 5TE7L 3IFNH 2X89D 3GNML 3SGDI 1H3VA 5E5UB 4DAGL 5T3XL 1YY9D 5D1ZA 2H41A 4NO5A 1CICD 3DV4A 4W4OA 2CUMA 3EDDA 4NO0B 3H9YA 3QDGE 1S5IL 5GHWH 1BJ8A 1MCJA 3K46A 5J6GA 5ETUA 1L4IA 4X99B 5CD3B 4Y2DC 3Q5OA 4ZD3L 1RJLA 1GOGA 3BUYA 3DPBA 1NMAH 1CE1H 4ELMB 4QRRD 4F37K 4ZAKB 1G6RL 3ZKMC 4UU9B 5DMIH 5LKNA 4JPWL 5EIQA 1L9MA 5DZOA 1XGQA 5FDYA 1FZKB 4XP6L 3RWHB 3MNWA 4S1DD 1IAKB 4YHOL 2H32B 1UYWH 3U0TB 1UB5A 1ZHKB 5CLTA 4L8CB 5E1AB 1J0HA 1IBGH 4JRXA 1IE5A 1KPUA 5K9KB 4H1LB 4RAHA 4G5ZH 4YHIB 5DWUL 2OK0L 2CMRL 3DUSA 1S5HA 3CFJB 1FFNA 3MXWH 2FEDC 5HHPB 4CAGA 2C1PB 3G04B 35C8H 3CMOH 2W0KA 4L9LB 4U3XA 2L7UA 3OJMB 3SDAA 1VEMA 1CT8A 3L5WA 1ROWA 3S97C 5GZNC 3BEWB 4GXVH 3NA9H 1DL7L 2QADB 5D7IB 3QWOB 5DK0B 1FNEB 1XGRB 2CGRH 1PQZA 1KG0A 2DBLL 3KJ6H 2CK0H 4JFDD 1OM3L 1RUKL 5CEYB 5HY9A 4G8FB 2ZKHH 3U79A 2F8VA 3ALWA 3T3MF 1HK6A 2X89A 5DQJA 1T20B 4HWNA 3KXFD 4YFLI 5BW7A 1H3TA 1Z0MA 2CK2A 3EYQC 1A3LH 2AS5M 3X3FH 5DI8A 2GITA 1CICA 1ZT7B 1WT5C 3U4EA 2OL3H 3S8WA 3HZMB 5D9SA 3C8KA 4C83A 1JWMB 4Z7NE 5CJXA 1AJ7L 2AEQL 4LLYA 4UIKL 4OGYL 2YRLA 1WIPA 4XP1H 5J89A 2DJUA 4P2OC 2J3SA 3JVGA 2NY3D 3ARBD 3CIQA 5I15H 2C3HA 4Y5VB 4LASH 5DJAA 3CU7A 4OZHE 2J6EH 5IHUL 1N64H 3TYGL 4OV6F 5B3JF 4HJ0D 4BFIB 1FZJB 1BVKB 2ICCA 1RIHH 1BREA 4NGHH 3UTTD 1LP9E 1SJXA 1JZ7A 1LEGB 3BP7A 3MRKA 2VZOA 3U1SL 5SX4I 1KTRL 3ZSSA 3EHBC 3I50H 5FXCH 4POUB 3GSVA 5CEXA 4TTGA 5IESL 1QO3A 4PJDB 4DN4H 5JMOC 4F9LA 4DW2L 2EXWD 1RULL 4JKPL 4CU8A 4LSVL 1MHEA 2YMXH 4G9DA 1D6EB 2EDDA 3C5ZC 1Z6JT 1CLYH 3C60B 4PJEA 4DKAA 1X5LA 3GJFH 2VLRE 4UINH 3V4VL 2R8SH 1IGFL 2P5WB 4L8BB 5DT1L 2NY6B 4N1EA 4QHMB 5DC4B 2E6PA 5C0GA 3B9AA 3ZTJG 5DUBA 2YUXA 4MJIE 3MO1B 5FM8A 3SDYL 3N1FC 4MD4B 2GJZA 3CX2A 4OFPA 3KXFA 1CDGA 2Y5TA 4F7EB 4GRLB 4GKZB 1U8OA 2R0KL 4X83A 2WM0A 4KJQC 5D2NE 4GAGH 2QHRH 5IW6B 4HJGB 5BS0B 1T0NB 1Q9KA 2OTUB 2DKSA 5IJKA 3KYNB 4M5ZL 4HXAH 3VXPA 4XXDB 4ZSOB 3REWA 3UAJD 4FA8A 4ZMAT 3QO0A 4W4NA 4LLQA 1FYTD 1RMFH 5C08E 1CDYA 1LO2H 1CWVA 4UNTA 3ILPA 4LDEB 4AH2A 4FNLH 4WV1C 5HYIA 1WZ1L 4NYLA 1I4FA 2NYYD 1F3JA 5L88L 4WO4C 3VFRB 1MJ8L 3EJZC 3ZDYF 5DK2A 5DURB 3SDXE 3MLWH 3L3GB 2YZ1A 1ORQA 1WCQA 2P24A 3T09A 5E2VH 1R6VA 1RZGA 3B3IB 3QO1A 3X13B 4WHCA 1KJVA 2M2DA 1KSRA 1P7QB 5JMRA 4I0PC 4QRUA 5C86A 2VDRH 4JZJA 4NWUH 3DX8A 4U7SA 4QY8B 3IDMA 4OCRL 4AJ0A 4TSBH 3NTCH 2BY0A 3VFNA 2FECI 4ZNEA 2HTKD 4WFGE 5JOFA 4LCIH 3SE3A 2I07A 4K8RD 4Q97A 5IT2L 3DIFA 3OR6B 1SY6H 4R4FH 4XC1L 2VKXA 3MX0A 4RWYH 4WWKD 4C56D 2GSGA 3CFDA 1N26A 2P47B 1CS6A 3PQYE 3QRGH 1ZT4B 4JDVB 1A3RL 4L4VB 1JV5B 4EI5D 4LMQI 3T4YB 4X0KB 3D0VA 4OZ4A 4XNUH 1LDSA 3O2VL 4U6YA 5EU6B 4PTTA 4O51B 3AREC 4ONHB 5T1MA 1FFOA 1S9YB 2GJ6A 3FB5B 5H35A 3WN5C 3FHQA 1OB1A 3ES6A 4DQOL 5HVGB 3L7EB 4UV7H 1KPVB 1HHGA 1PYWB 4LF3A 4XMPL 3G6JE 4Y19D 1EUUA 4HC1L 5DJZB 4B50A 2QSTA 4JFPB 5EO1A 3CDGB 2DI7A 5HGBA 5EIIB 4I3RH 1QOKA 1RY7B 5L2JA 3DXAE 1I1YA 4MCYB 3OV6A 5DJ2B 3PWNB 3HR5B 2ZCKH 4X4XB 2ERJC 3NZHL 2JIXA 1BHGA 4OLWH 5J3HC 2XN9E 3RL1A 1EEYB 3EGSB 4X80L 1OP3K 1DR9A 3OB8A 3MNVB 4S1QH 2DQUL 1FYHB 4Y5YC 5ISZE 2R0ZL 4OF7A 4DUXA 2W9LA 4G3YH 3F5WA 2DQGH 2QEJA 3IDYB 3O6MH 3QXAB 2NCMA 3KPSA 5JDJA 3LEVH 4JG1L 4HUNB 1WZLA 4OFDA 3DO7B 1OWRM 5HJ3B 3PHQB 4BKLA 2VH5H 3NIFF 4G6FB 2W9EH 5MHSD 4Y1AE 5HTSA 3O6FD 2NY5H 5F1IA 5B4MD 5C09E 3PWVB 3QIWA 4Z0BH 1LWRA 3S3SA 2W07A 4XBEL 1HKLL 4LGPB 4WWKA 4K9EH 4C56A 5A40E 1J1XL 1QLFB 5IM7B 4MJ5A 4DZBB 1QVOB 2ADFL 5HI4D 3RWIA 3T4AB 3GJEA 3BPNC 3T0AA 5MEQB 1NFDB 5JLZB 3MRQB 4L29A 2PW1B 3BI9X 3MGTB 4ELMF 1ES0B 3BN9C 4XVTH 3D0LB 3W39A 1SQ2N 4LHUB 5HI3D 1WLHA 3ZHDA 2XPGA 1P9MA 4LRIC 1MQKH 1EPFA 5FA4A 4Y19A 5DVLA 5DHVA 5B39A 5TE6L 4HPOH 1MCHA 2J8HA 3BO8B 1NGWB 2CRIA 2P44B 5ENWB 1T2JA 1INEL 5IEKA 1WITA 1EFXA 4UNUA 4OLXH 3WNMA 2GTZA 2DYPD 4HWBH 2DL2A 4G9FA 4K23H 4JREB 5E95B 4ZFGL 2R2BA 1OF2A 3MSPA 3BX7C 2EDLA 1MUJA 1U95A 2N7AA 4LOUD 4EBQL 3U2SB 1G9EA 1RUAL 4D0DA 1EERB 2PTTA 3F7YA 4O2FB 2Z0BA 4MNQD 4WVRA 2JJTC 4POZD 3IAGC 5FGCB 1ND0B 3QEGL 4Z5RA 2RFXA 4V1DD 5F71A 5HGAB 5ID0B 1TIUA 1G7JA 3RZWA 3GMQA 5D7IF 4DFHA 1BOGB 4KHXL 1CGWA 4JVWA 3UYOD 4HCRA 5INDA 4G8IA 4GMSH 3EYVB 4YE4H 1G7QB 4L1HA 2GUOA 4H8WH 4KZEH 1MJJB 5I0ZA 2Z93A 2CDGA 5F1NA 3O6FA 4PR5A 1UFUA 2J8UE 4Q9RL 5ID1B 1BVZA 2BNQB 4M62L 2Y6SC 3ARPA 4I77L 2NX5E 1A7QL 4NFDA 4RRPA 2R4RL 1M7IA 3ZDZF 3IDXH 1UZ6F 1A7RH 2FHBA 4NQDE 4WFED 3MRLA 1KB5L 3LKQA 3RPIB 3TFKC 1N8ZA 3JWOL 3L95A 3RWJB 1ZHBA 3E8UH 5E99L 4BUGA 3OF6D 3ULSA 4F57H 2ICEB 4P4RA 1OT2A 2H8PB 3RPKA 4RGMC 3VH8A 3DROB 1BQHB 4F80A 4JFHD 3UC0L 5DGQA 5JW3L 2L0DA 2KUTA 25C8H 1PSKH 5IG7A 4P23C 1W72L 3WFCH 3UROR 1CVSC 3P30L 1NAML 1KCLA 4PRPB 1SYSA 3CUPA 2A0LD 1XGTB 4ODVL 1UM5H 1QPPA 4GQ9H 4YXKL 4NQCD 3FT2B 2DYPA 4N9GB 5GGVH 5DJ0B 4MS8C 2G9HA 1QRNB 4IS6A 1C12A 1D6VL 4K3DH 1Y0LB 2FIRT 1E27B 2J8OA 4NHCH 4U1MA 3V6BR 4U6TA 4D94A 5KVEH 2HFGL 2Y1VA 1LO4L 3S3PA 3KWWA 3C5ZB 3FFCB 4PV9A 3UJIH 1I9RH 1FVCB 2OYPA 1OARH 4V1DA 3SY0B 5CEZE 3ULVD 1IVLA 3O3EB 1T22A 3V6OE 1F8TL 4K2UH 2IPTL 1T1XB 1T2XA 3GBMH 1IILE 1WBXA 1K2DA 1UG9A 3MPCA 5KS9B 5E2WH 1A7PL 1OGTA 3C08H 4GLRH 3V5KA 3AFLA 4H20L 2X4TB 2VXVL 1U8LA 4HAFA 3GI9H 4MAYA 5AWNL 2NW2B 3ILQC 4AMKH 3K3QA 3PWLA 4K8RL 3GSOA 2DJSA 5HDQH 1XZ0B 3N85H 4LCUA 4MDJB 3SQOH 3UCRA 2APWA 1L0QA 5IQ9A 1V7NH 3VA2C 3S35X 1DVFC 3P2TA 2EDTA 4Z7VF 5TDPA 4R2GC 2FBJH 4NO0A 4S10A 4HLZG 4EUPB 5JZ7D 4JGMA 4JRYD 1AP2A 2Q86A 3QAZC 5I17A 2BOCB 5JUEH 1JI2A 3O2WL 4X7DC 4L4TE 3TNMB 1F90H 3H9SB 4WV1B 3QWQB 4ELMA 3DHJA 4WO4B 2I9TB 1CGTA 1DBJL 4LPUA 1IGCL 5KTEL 4U31A 4WEUD 3NCMA 3OMZA 1FVDB 2NTFB 5EO9B 2I5YH 2YXMA 4G42A 4JHBA 5JQHC 5C92A 1K3ZA 4JQIL 1AC0A 1NBZA 4QXGH 4LSSL 3T1FB 1FZKA 4HLJA 4AG4L 3CK0H 1KJ3L 1IAKA 1JPGB 4J23A 4HKZA 2H32A 4L5FH 3U0TA 1UM4L 1EJ6A 4ALAL 4QHUB 1BWWA 1TMCB 3Q48A 3QPXH 4C59B 5AAMA 5HYFA 1N6QH 4YBLB 5DD3L 1LGVA 4FP8L 1SYVB 1IEHA 5TE7H 2AV1B 5EG6C 2OMNA 3C2SA 4YHIA 1CXEA 3GNMH 2R0WL 5ESAB 3V8CA 4DAGH 2VUOA 1PX3A 1IAOA 5HHPA 1QBBA 5EU5A 1EUTA 4LSUL 5HHQB 4L9LA 1S5IH 3Q1SL 2IFFH 2BFVH 2XKSA 4F37F 3BEWA 5I8KL 3TO4D 5D7IA 3QWOA 3BPLC 5DK0A 4ZD3H 1FNEA 2LQRA 2PYEB 3AREB 1IARB 4PG9B 3QULB 1D9KC 4BH7A 4NWTL 3STLB 5LGJB 1G6RH 4ZUUB 5GSVB 3GSQB 4FTVE 5KAQF 2FRGP 1MJUL 1DQML 3QPQC 3ZTJH 5J12B 5C71A 4JPWH 3UYRL 3QUXC 4OF6A 4N0YL 3VWKD 2X9YA 1G0DA 4XP6H 2Q3ZA 5GGRY 5JIIA 2JJUA 3IDIA 1QBML 4RMQA 4RDQF 1JWMA 4JRYA 4OKVB 5JOEA 4BELD 5I1DB 2B4CL 4DJMA 1NMCB 3DURB 1NLBL 2ERJB 5DWUH 3W11C 3I6KA 2VYRE 2VLKE 2AJ3A 2D7OA 2IMNA 4NQVA 2Y9RT 4Y5VA 4Y5YB 2BSRA 3I75A 3WUWB 4IIQB 4ZO8A 4NHUB 3MJ8B 1T7VA 3TJEL 5FECB 2BVOB 1DL7H 4BFIA 5HHNB 3WCYA 4WW2C 1FZJA 1BVKA 5IJVA 5EBWA 4ZFOA 3FT3B 3VD3A 4F7MA 3W82A 1LEGA 2R1YB 3GUTB 4ZYKB 4HZAA 1OM3H 5DC9B 5SX5K 2X4PB 2ADIB 1YMMD 4KROD 5I18H 3FB6B 3RBSA 2LU3A 1UB6A 3UTPD 3WHE0 3GM0A 4N90D 3FZUC 4LGRB 4UAOB 1BQUA 5I1EH 4X6DB 1MCCA 1D6EA 3RA7H 1M05A 3VRIA 4WU7A 2VO5A 5I71C 3O8XC 3LQMA 2AEQH 1EGJH 3IDGA 4UIKH 1MCFA 3R4DA 4BH8B 5HYJE 2P5WA 1X5XA 2IQAA 2ZPKH 3EFDL 4QHMA 3OPZL 3A0OA 1NFDF 2EH8L 4YBQD 1CTNA 2AXFA 2G5RA 2PUQT 2VKWA 4XP5L 3BFOA 5I1CL 2ZP0T 1WFTA 3MO1A 4NZJA 4YFEA 3I2CH 1M4KA 5IHUH 4MD4A 2AXJA 2VZVA 1NUDA 1WIOA 4K94L 1QA9B 3VWKA 4GKZA 1X44A 2VXQL 1I7RB 5E6YA 3E6FA 5C2UB 1ZXQA 4OFYD 4ETYA 3C87A 5GISH 5F7KC 3RNKA 3VD5A 5HSFA 3ARDB 5IW6A 4HJGA 4Z7VA 3IJYA 3IJSB 2OTUA 3QZWA 3U1SH 3RVVD 1QHPA 3BQUD 3PL6C 1YEGL 4Z8FL 2ZZUT 4XXDA 4ZSOA 5J06A 5IESH 4CN4A 1KIUA 4MZ3A 1NEZG 2DIAA 4DW2H 2DQDL 4XBGA 1RULH 2BMKB 4JKPH 2UWEE 2KDGA 4JZOB 2NR6C 1RURL 4FQHB 4HKBB 1S7WB 3CSGA 3G08B 1AKJB 2YRPA 6FABL 1I7ZB 3D2UD 4DWHA 1LEKA 1HCFX 1S9WB 3OR7B 4QTHA 4HV8B 5DT1H 5DO2C 3L3GA 1SEQH 4QYOB 1KUMA 1EIBA 4YAQB 3X13A 4AL8H 3MV7E 1A5FL 3GKZA 5JOPD 1RZFL 1FZOB 1MPAL 3UZVB 1FAIL 5K9QG 3QDMB 3OG4B 3ULVL 4NN6B 5ERWB 4PJ5E 5T5NF 3KPRB 3N9GL 1RZKL 4LP4A 5FCUL 2DIBA 4D9RD 2NY2D 5KJRH 4CADB 4I0KA 4CMHB 4FZ8L 5A16B 3OR6A 4I0CC 4A6YA 3BEVA 3VGHA 4GAYB 3SBWA 5ECJE 3THML 2OSLB 3MOBL 3GSRB 4RGMB 4JDVA 2SEBB 4D8PB 3WXVL 4Y8AA 4TRPL 1MH5B 3SQBA 3T4YA 4X0KA 3TWCL 5EU6A 5I1GL 3BRGC 2CKBB 5IHZA 5I75C 3FB5A 5L88H 2VABB 2J88L 2V5TA 1QNZL 1MJ8H 1T6WA 2KQMA 4M43L 2Y07H 2NY1C 4MNGE 3L7EA 4YUEL 3D3VE 1VFAB 4F9PA 1EHLL 1PYWA 4XAKD 1OLZA 2FHFA 1A1OB 3D18B 4HKJB 4IDJL 1XCTB 5DJZA 1YPZB 3WS3A 5JIPA 3BQUA 4EN3C 1I1AC 5EIIA 5MP6L 1NQBA 3L3OA 5L7XH 5GS2D 5LJYH 3RVWC 4PGBB 4OCRH 4OD2B 1CD0A 4MCYA 1H15B 3BH9B 5IMOB 3BDYL 3RX5A 3NABL 5I0DA 4X4XA 5JORB 3D2UA 5IT2H 4QCIB 1CD1B 4QHKJ 4MJ6B 1EEYA 4XC1H 3EGSA 4UTAH 5M7QA 4DEPC 1FGVL 3MNVA 5C07E 3HC4L 1QLRB 2V7HA 3OKEB 4GFTB 4NZRL 4K3HA 1A3RH 5KS9F 2GK0A 4RAUB 2E7BA 3VFOB 3SGEI 3QXAA 1ZT1B 2AV7B 1MY5A 4TUKL 3OAZK 4MXWL 2ILLA 1FL5A 3UJJL 4P46D 3DO7A 5HJ3A 3PHQA 4WJ5B 3RTQC 1UEMA 4XNMB 4YX2L 2R9HC 5F7LB 1OAZH 1TNMA 4NM8L 4XMPH 1BBJA 3KPLB 1DVFB 1T66D 1G7LB 3BOVA 4HC1H 4L3EB 4NM4H 4KHTL 1AY1L 4TQEH 4URTB 4KJYB 4R2GB 3ZE2F 2ZNXA 5IVZB 3OAUL 3ARGD 5C7XL 4E0RB 5E8DH 1MI5D 3MBED 2F53D 2QBWA 2HFTA 4KRLB 1QLFA 5CD5C 3QISA 5LG1A 3RHWF 1KCVL 1D5ZB 3QAZB 1PY4A 2K7PA 1IL1A 5ICXB 5D1XD 3T4AA 3SHSA 4Z7QF 5DJ8B 3LS5H 1NFDA 5MEQA 5JLZA 2GEEA 2HT2C 3MRQA 2PW1A 1ES0A 3D0LA 3VXUD 1RJZA 4X80H 1TENA 4LHUA 4G7VL 3UPCA 4J4PD 2X4NA 1B9ZA 4FQ1H 2R0ZH 4LLMB 2ICES 1UH3A 3DVGB 5F3BB 3ARTA 2IG2L 5T3ZD 4JG1H 4O2CA 5ENWA 5JXED 4PJAE 2DQFB 5EZJB 2CDFA 3SOBL 1ZKAA 2NXYD 1OTTD 4R4BB 4OJFL 3U2SA 1W0WB 2X1WL 1QEWA 4XBEH 4O2FA 3EYOA 1TQCB 2H1PL 1S3KL 3ZT6A 4AEFA 4OZIF 3MRRA 1AGFB 1J1XH 2EYTB 4LAJH 1JN6B 1EAJA 3HE6D 1BAFH 3GSUA 4ONFL 4PJFE 4DKFL 4LLWA 3LS4L 4LNRA 5AYQA 4P46A 1D9KB 3QDHA 1P4BL 3CVHB 3EYVA 4PRHE 3K8MA 1G7QA 3WFHB 4GBXC 3U0WL 1MJJA 2F9BT 4OB5L 4BZYA 1VGKB 3MLVL 3ZDXF 1F4HA 3QJHB 1BZ7A 4OLYL 2BNQA 4PJ9C 3ZYOA 5TE6H 1CQYA 3OQ3B 2Q7YB 1NFIB 3SN6N 4JFFB 1WISA 5IVXE 4UB0L 1GJIA 1RQ5A 2EO1A 5FDWB 5BRZE 2F53A 1ZVSB 3GHEL 1INEH 5DTFB 2N7BA 3RPIA 5TQ0L 3T2NH 1JZ5A 4ZFGH 3TP4A 4HZLB 1I3GL 4X9IA 2JCCB 1KCKA 2ICEA 4HLZH 5DEFB 5ILTL 2H8PA 1RUAH 4EBQH 3DROA 1DFBL 1BQHA 5M94B 5J57B 1OAYL 1Z2KA 3V0WL 5IEHB 3H2WA 4J4PA 1DE4B 2VDLL 3MFFB 2D4DA 3QEGH 2BXZA 5E8OA 1QFPA 5I1IL 4MYWB 4XP4H 2WUCL 4DKDC 2F15A 1AGEB 3QRFM 4LIQL 3DETD 1FV1B 4KHXH 5DFTA 1A8JH 4F58L 2X10A 3ALPA 2Q8BH 3TBVB 2F58L 5L8JB 1F13A 1C5BL 2AI0L 4N9GA 5EIVA 5CZKA 4RAVB 1AQKL 1QRNA 5T1LD 2RAMA 5MERB 1OCWL 4GRWB 1Y0LA 4Q9RH 1E27A 1A2YA 3FN0L 4MB4A 4M62H 2P1YA 3TN0D 2ZUQB 4NSKB 1Y6KR 4JFZL 2R4RH 1ZLUK 4RBPK 1P6AB 2I9LB 3FFCA 2E27H 5I71B 1FP5A 1OSPL 1UQSA 3HE6A 5C0BB 1QSEB 3O3EA 1MHPL 3PP3H 3AUVA 3JWOH 4M7JL 1X6LA 3O6LL 5E99H 5SWSE 3CFKB 4QHLA 5KS9A 3LHPH 4Z18A 1YMHB 2IGFH 5JW3H 1PAMA 2IADA 5FGBA 3GRWA 2H2SD 1W72H 1E6JL 1HINL 4PRIE 5ACZB 3P30H 2W0FB 1K85A 1NAMH 1QP1A 3U7WL 1X3DA 1RU9L 2DLFL 4ODVH 3DUHA 5AYUL 4YXKH 4G8EB 4OF5A 5T1KD 2VLLB 1LO3H 4LK4A 1RAMA 1D6VH 3QFJB 3SKMB 2P7TB 1DZBA 1LO4H 2BOCA 5CBEB 4NCDA 3O4OB 2QV2A 3HZVA 1AQDB 2FX7L 3H9SA 5DGRA 3U36B 2F54B 4CUCA 2I9TA 4J3WA 4F7TB 4DCQA 4I18A 2EDEA 3G6AB 4TTDD 1F8TH 3HZYB 3ESUF 4JFYA 2VDOL 2IPTH 4LVHC 1FVDA 2NTFA 2NXZC 4ZUTB 2HVJB 4OI9A 5EBLB 4MQSB 3T0ED 5IBLD 1A7PH 4K7PY 2E9BA 4NCC2 4LEOB 2VXVH 2A74B 3MGOB 1JPGA 2AJUL 2X1QA 2HWZL 4M6OL 4L4JA 5AWNH 4E41E 2I60L 3TN0A 2Y7QB 4PJ8D 3TH4T 3T0DA 1SYVA 2P5ED 3MOAL 2AV1A 1CN4A 2C3VA 1HZHL 3S36L 3WDJA 3U6RB 5ESAA 3ETBF 5IB3B 4ODTH 2MKWA 4OZIA 1C16B 5HHQA 3KG5A 4OGAC 1V3LA 3LQAC 5TDNA 32C2B 5DDHB 4M00A 4K7PL 2X4SB 4RNRB 2CD0A 5KSAD 3TBWB 5LQBH 3HE7D 3O2WH 2PYEA 4HAGA 1DQJB 1H8NA 2WWMC 4OFIA 1FE8L 1EJOL 3QXWA 1FO0L 2A9ML 4MZ2A 1ZEAL 3STLA 1DBJH 2NY1B 3L6FA 1DQTA 4PS4L 1IGCH 5KTEH 4PY8J 2FIKB 1XCQA 3VXRE 1S78D 3RWCB 5C0CD 4JQIH 4HWEL 5SV3A 1NDGB 4LSSH 5ALBL 5T1KA 4AG4H 3BZ4B 3H7BB 1KJ3H 3IDJB 2UV3A 5TF0A 1J1PH 1LILA 4O4YL 3CFBA 5L2KB 4NRXB 5IK3B 1T7ZA 1UM4H 5I1DA 3TBYB 4ALAH 3QH3B 2OI9B 1YYLL 1T2QL 4KK8D 4XCCL 5DD3H 4FP8H 3DURA 5GXBB 2BVQB 4LSDA 2HKFL 1KPRB 2R0WH 4ZTOL 3BDXA 4H25B 4P5TC 4DEPB 4LSUH 4QTIL 1EAPA 3QUKB 3Q1SH 2ZWLT 3WUWA 4IIQA 1S7RA 5T3ZL 5E5MB 3VFWB 1UWEL 3TV3L 2FGWL 3EDEA 5HHNA 3BKCL 1KJMA 2OR8A 3F62A 5BZWB 2D7TL 3FT3A 2OCFD 1TTGA 2VLME 3W9EB 3ECBA 2LV4A 2CDEA 5EU7E 4ZYKA 3QXTA 5C9JB 2H9GB 4KVCL 3KPMB 4JQVA 4ZUVB 2X4PA 5MI0B 2ADIA 3H3BC 3RBGA 3TC9A 4PJ8A 1MJUH 4YHPA 1DQMH 2B0SL 3QNYA 4DGYL 1ITBB 1OSZB 5D70H 3UYRH 3QHTC 2HJFB 2BNUB 3OKOA 3P9LB 4IHOA 3DYMA 2PO6C 1PY9A 3UTSE 1B90A 1NBYA 5AEAA 3VD4A 1CR9L 1NCWL 1QBMH 1P84K 1CLOL 3GMOA 5EUKA 5JHDD 5J1TC 2B4CH 4XVUC 2GTWB 3WV0A 1W2KT 4IRSB 1B6DA 3HG1E 5C8JB 2UZXB 3IXTA 3HUJE 4HIJB 4KFZC 5DJYA 1WWBX 3UJTH 1UCBL 2XKNB 4PBWD 1QA9A 4PJHB 3GJFK 4PYHA 1YEKH 2EKJA 2UZIL 3P4MB 2D2OA 3ARDA 4P5KA 4GKSB 2AK4B 3IJSA 1HI6A 4LCWE 1PFCA 2XTLA 4Y4FC 3AM8C 4RFNB 3WKNA 3DYPA 1HQRB 1RVFL 4RX4D 5I1LA 4LPCA 2X40A 2BMKA 2YN3A 4PPTA 1MEXH 3RVUD 1OTUD 4M1DH 3NFPB 3V7MA 5B22A 4NJAL 1I7ZA 2J5LC 3H42L 3B9KC 5AAWA 4CVZA 4HV8A 4IMKC 3QDGD 4KKCC 1CCZA 3EFDH 4LP5A 4QYOA 1U6AL 3OPZH 2EH8H 4YAQA 3ZKXC 1K4CB 3TZVD 3LKPB 2WBJC 4XP5H 1UCTA 4UOW1 2VSCA 4Q74A 3LEXB 1FZOA 4PJ9B 4HHAA 4OZHF 1J87A 5KZCD 4K94H 3QDMA 4P2CG 1KIQB 1PKQE 3DVNB 2VXQH 1I3VA 3RX7A 1QFWM 4CADA 5A16A 2VLJE 4HUXB 4X7TA 1YEGH 4Z8FH 1ODAA 2W65B 1MF2H 3HI1B 5FO8A 5JR1L 3LPWA 3VRLE 1K8DA 2OSLA 3GSRA 4BSVA 2JCCF 3ZE0E 2DQDH 2SEBA 5EB9A 1RURH 2O5YH 2VR9A 2XRAL 5D7JB 6FABH 2YK1L 1OAKL 1U3JA 4PP1C 2VABA 1J0YA 3HB3D 1GGCL 4MA3B 2XV6B 1VFAA 4AK1A 3FONB 3D18A 4HKJA 3F8UB 4GO6B 2ZOLB 1MRFL 1XCTA 2X4QB 5BZDB 1IT9L 2ADJB 2X1OA 5BQ7A 4Q9QL 1A5FH 1IGYB 1HILB 1RZFH 3NH7L 3HMXL 2WWKT 4RX4A 1MPAH 1FAIH 4GRWF 4OM0L 3VWJC 4PGBA 2FEEL 3EIFA 3G6DL 3C6LD 5BXFB 3R1GL 1H15A 2QSVA 2Q6WA 5IMOA 1YJDL 3O3DA 1T80A 1XF1A 1RZKH 5FCUH 1LNUB 3LY6A 4X4YB 1P53A 2VERN 4FZ8H 1CD1A 4QCIA 4MJ6A 4Q9CA 4IEFB 5ELIA 3MJ6A 5HHXL 4JDZB 3QDGA 1PKOA 1MFBL 3OKEA 3THMH 3BGMB 3LV3A 5HGDB 3VFOA 3WXVH 1A02N 3FRPG 2AV7A 4TRPH 3TWCH 5I1GH 1U8PB 3TVMC 3MROA 2YD1A 2J88H 4HKXA 4WJ5A 1QNZH 4M43H 4XNMA 4YUEH 2ZG2A 4NJ9L 4QKXB 5FA3B 3QDJD 3KPLA 2NY0B 4L3EA 5IVZA 1T1ZA 2DWDB 3KGRA 4E0RA 1UT9A 5MP6H 3Q3GA 3BUTA 2BRRL 2WV3A 3MUY1 1AR1D 4OLEA 3U46A 1CLCA 5ICXA 4FFVC 4OD1L 3Q6FA 3BDYH 5DJDB 1PJ9A 2X42A 3NABH 3S6CA 1J5OL 2A1WL 4QRPE 5J11C 1ERNA 1B0WA 4QRSB 4NKIL 1NGPL 1A9EA 1KJ2B 1QFUL 2JE8A 1FGVH 2VSDA 3HC4H 4AY0A 4LLMA 4NZRH 4PJ7B 3RUGB 2VLRD 3DVGA 1DUZA 3GMNB 4PREB 2IBZX 3WHXB 2RCSL 2ZG3A 2K9UA 3RDTD 3UJJH 5F1OB 1CFSA 5ANMB 5IBTL 2P8LB 1TVBB 5IB5B 3P77A 1NC4D 1F4YL 3MLRL 1WQVT 2DQFA 5EZJA 4MJID 3ARQA 4PGEA 3WFBL 4YX2H 3MCLL 1VSCA 2BRQA 4NM8H 2V9QA 2Z31D 1W0WA 5FFLA 4OZGB 1OAXL 3CGTA 3KPNB 3RGVC 3RY6A 4JFQB 3OAUH 4NQUA 5C7XH 2Z92B 1L7TL 5D72H 2EYTA 5FOJA 1B2WH 1RSFA 2YPLE 5C0AE 3V79C 3B2UC 1KCVH 1T03L 4JO1H 4LSTL 2A38A 2DQHL 2UVEA 4B41A 2OTWA 5CSZA 4KQ3L 2ZJSL 4P48A 3VXSB 1D9KA 2CO7B 1KGCE 2EE2A 1XF5B 2ZUTA 2D0GA 1KTKE 3WFHA 4UBDD 2R56L 1R3HB 2KZ1B 4OIBA 4G7VH 3IS1X 5C08D 3IAQA 4OV5A 1MCNA 4OZHA 1VGKA 3OKLB 2YS4A 3QDJA 5GJSH 5BJTB 4CMMA 1JGVL 3VMPA 2Q7YA 1NFIA 4MVBC 1MHHA 1EMTL 5FDWA 2IG2H 4YDJB 4KKAC 5FO9A 5TGBB 1KN4L 3KPTA 4LLDB 5GRVK 3VI3E 3DMMD 4JKLA 3SOBH 5SWZB 1CXHA 3UDWC 1JF6A 1EZVX 2JCCA 4HS6A 4OJFH 4JGJA 3WS6C 4UT7L 5F9OH 2H1PH 3OGCB 5E03A 2K1MA 4WFGD 1DE4A 3MFFA 4YC2B 2F8XC 5HGHB 1J8HE 2EE6A 4ONFH 4ELKB 1R3JB 3QEQE 4DKFH 2PR4L 2J2ZA 3LS4H 4EQ3A 1AGEA 4GG6B 2UVFA 1FV1A 2BDNL 3BYTA 1ETZA 4KTDH 3PQYD 3CLEL 2RGSA 3B9VA 4HIHA 5E00B 5I74B 5CP7B 3D39B 3BN3B 4DVBB 2YD6A 3QHFL 4MJIA 3FCTB 4OB5H 2OXGA 5EFIB 3MLVH 4YPJA 4OLYH 2Z31A 3WNLA 2PO6B 3TJHC 4QRQA 4NSKA 4HIEB 4XX1E 3VXNB 4X4ME 5IB1A 3SDCD 1KELL 1T1YA 4H26A 2I9LA 5MENE 5D2NA 3GHEH 4OFKA 4FQXB 4W6XB 5F3HB 5I6XC 3VMNA 1ZLVK 1ACZA 4YDVB 2XACC 1QSEA 4GAJL 2X5PA 5TQ0H 1ZS8A 2OZ4L 1MCSA 3CFKA 4KDVA 2A77L 4FS0A 4U0RC 4D3CL 1C7SA 5ILTH 3PNWB 1DFBH 3DXAD 5K59E 1BM3H 2VXUL 1OAYH 3V0WH 1FSKC 2VDNH 2MCPL 5HDLA 5JW4N 2VDLH 2VQ1A 3CVIL 8FABA 1A1NB 4LPXA 3SGJA 1Z9OA 5I1IH 1G7MA 1WV7T 4OIIL 5ACZA 3KS0J 2XN9D 2WUCH 4PJHF 1NLDL 5ISZD 4FQCL 4F58H 2RHEA 5D7LB 3MV8E 4FMFA 2F58H 1C5BH 3QFDA 2AI0H 4HX1B 1X6NA 4S11A 4XP9L 1ZHLB 2WLZA 3SGKC 1Q9WB 3DMMA 4HK0B 2H26B 1AQKH 4JPKL 1BIHA 1Z5LB 7CGTA 4OCMC 3QFJA 1TPXC 2J8UF 2ENSA 4NCC1 5CBEA 4JFZH 4OSUL 4P3CL 4Y1AD 4PRDB 2ITCA 2BSED 1AQDA 2J5LB 1OSPH 2F54A 2FJHA 2IQ9L 3CU1A 2IANE 4OZFB 5C09D 3WLBB 4F7TA 4XRCB 1MHPH 3G6AA 2YUWA 4M7JH 4WDIA 3O6LH 5FYKE 4GUPB 2V2TB 5DVNA 3MODL 4K71C 4ZUTA 3NCYP 2HVJA 3F6IA 3ZKXB 4OQ1A 2WBJB 3MRMB 2HTLD 3W5NA 3QXVA 4JO2L 1JL8A 4LEOA 1TQBB 2XA8L 2A74A 1DSFL 3MRNA 1HINH 4Y5XB 4N8VB 4HGWA 2Y7QA 3U7WH 3SDCA 2DLFH 4ZFFB 3BE1H 3UZEA 5AYUH 2NQCA 5IB3A 3BGFB 4WY7L 1A22B 4LDLB 3OKMB 2DN7A 1IKNC 4ZO6A 4N8PA 2DD8L 4FFZL 3V4PL 1JJUA 4LGSB 32C2A 5FB8B 2PYFB 4S1SL 2X4SA 4RNRA 2WZPD 1DEEB 3DGGB 1DQJA 3GFUA 3RWGA 3S96A 3V5HB 1EX0A 5IB2B 2AKRB 3RWDA 5HYSG 4WRLA 3BHBA 2XN9A 4MMZC 4Z7UE 5C0IA 2FIKA 1SBSL 2VDOH 4MCZB 3S5LG 1KYOK 4KJPD 1U8HA 3RWCA 3B6SA 1GXEA 4TVPL 5E9DE 1KB9J 5E6ID 2ZUWA 1OAQL 1NDGA 1XGUA 3VG9C 2XTJE 3BZ4A 3H7BA 4FZEL 2XZCL 2AJUH 4EI6B 1KIPA 4X4ZA 3DGCR 3VXMB 5L2KA 1JPTL 1AGCB 5IK3A 3TBYA 5J1AA 3QH3A 1MJ7L 4Y1AA 4DK3A 3MOAH 4G80B 3TH2T 1HZHH 3S36H 5FUCE 1XF4A 4N0CC 3T0XA 3W81A 3X17A 2NX5D 3CZFA 4WFFE 5DR5L 1V5JA 4H25A 4HQQL 4BUHA 2UZYB 3QUKA 2VUYA 2CLZA 3ZT7A 1ADQA 5E5MA 3VFWA 4NQDD 3TCLB 5BV7C 1U58B 4K7PH 1T0MB 4LEXH 4Y4HD 1IEBA 1MRDL 5BZWA 3U9PL 3TVMB 4OBRA 1FE8H 2IMMA 4GG6E 3OXRA 1EJOH 3DSNA 1FO0H 2A9MH 5C9JA 1IC7L 4R4NC 2H9GA 5GS0C 1SM3L 4E5XB 5EN2B 3KPMA 4ZUVA 4M5YL 4L3CB 4OQTH 2B2XL 1VHPA 3UO1H 2R0LL 3JV4B 4YHZL 4LMQE 2HJFA 1FZMB 3ARFB 1FJ1B 3KLHD 5DQDL 4HWEH 4TSAL 5DD1H 5ALBH 4LVOC 3WYRA 1U91B 4WU5B 2PXYD 5TPWL 1I85A 5CINL 43CAB 3DV6A 4O4YH 4H5SB 4F3FB 1JYXA 3LDBC 4QXTA 3OJDA 5D1ZC 1YYLH 1F3RB 1T2QH 1CGSH 1IJ9A 4XCCH 3RRQA 3DX6B 4W4OC 4P9ML 4IRSA 4PRBB 4RGNC 4AENB 4YR6B 3SDDB 5T33L 3QIUB 2DBJA 3RIAK 4HH9B 1ZGLB 4HIJA 4Y0GA 1NCNA 5JDSB 4IMLB 5IWLA 1FN4B 4KMQA 1GZPB 3IU3A 3S4SG 2XWBB 5T3ZH 1JZ2A 4P4KD 1UWEH 2XKNA 3QG7L 5IMLA 4PJHA 5MEPA 5FHAL 2FGWH 3D85B 3LB6D 4PJ7F 5JO5B 5CEZD 3BKCH 3RUGF 3C09C 3MRIB 5GS0H 3ZYJA 2D7TH 1AD9A 4ZOAA 1D7FA 3P4MA 3C5JA 1CGXA 2AK4A 1HWHB 2VWEC 2B0SH 2YHGA 5CIPH 2NNAA 4DGYH 1HQRA 1A4JA 1GAFH 5JPNA 2J8UA 2LAAA 5KSVA 2DM3A 4U1SA 3WFDL 4ZG1A 3RGVB 3MXVL 2NX5A 4HGMA 4R0LB 4OZGF 1JGEA 3QXDB 1CR9H 3NFPA 1CLOH 3GKWL 3WBDA 1E4XI 4ZOCA 1JNNL 1QPXA 4LNVA 4YIQB 2D31B 4WUUE 1C8PA 1Q38A 5FV2A 2NW3B 3ULUC 3T2OA 4MJ2A 3SDAC 1A6VL 1U8KA 3OXSB 2AEIT 3RI5K 3LKPA 1CFVL 3P73B 1G9NC 1PZ5B 4Y2DD 1OGAB 4L4TD 3LEXA 3WJLA 2IAMB 2BC4A 4MX7B 4F7CA 3HKFA 4PJ9A 2NY7L 3DVNA 3ZKMD 4YEEA 2UZIH 1QRKA 4YGAB 2PCPB 4QHNB 1EEZA 5BW7C 4HUXA 1OP3H 3IF1B 3QUML 1F11B 1CICC 1TJIL 3U4BL 1RVFH 3NCEB 2ENYA 5CJXC 5D93B 4I2XE 1DQQA 4JPVL 5D7JA 4NNXA 4P4KA 4NJAH 5CZVL 3EO1B 3H42H 3B5TA 3E0GA 1XF3B 1X5ZA 4EDWH 5BMFL 2FEDD 1CBVH 3VGEA 1H0DB 2FDBP 1L6XA 1X5IA 3BYYA 3FONA 5LWYH 1U6AH 5F44A 2ZOLA 4G6AC 2X4QA 2EDRA 2AJVL 5BZDA 1OD7A 2ADJA 4EOWL 2XA3A 1HILA 1SVZA 3LKNB 4YPGA 4X9FA 3V2AR 4LHQB 1MLBB 4M8QA 4FTVD 4LAQL 4LLUB 3QG6B 4AQOA 4YHYC 4U1NB 3AAZA 2XWTB 3EYQD 2W60A 1Z9SA 4F9LC 1BFTA 1I8KB 3W0WB 1UENA 3JTSB 4JDZA 5KVFL 4NP4L 3HCVB 4U0RB 4KUZL 3BGMA 3PV7A 2GY5A 1MREL 5BOZG 1TTUA 1FSKB 4Z76B 1WCBB 2XRAH 3FQTB 1TZGL 1U8PA 2YK1H 3FFDB 4HXBL 4P2OD 3NVQA 4KI5E 1OAKH 2VLKD 1YNKL 1ZANL 1M7DA 5CCKH 1GGCH 3O9WB 5HDBF 5JW5B 3IETA 2EKSB 4YDLC 5EOQL 2F5BL 2VL5B 3QCVH 4FFYL 4YDIH 1IT9H 4M48L 2DWDA 4XNYL 4GKNB 3V4UH 2CLVA 4H1LG 1AH1A 4CVXA 5F96L 3HMXH 5E2TL 1FIGL 3M17B 3F7RA 3BW9B 4M7LL 3G6DH 3JSSA 4OM0H 3BKYL 4YBHA 1MFDL 4OF8A 5IJKC 3EHBD 2OL3A 4G43B 1YJDH 4JVUA 1RZJC 3G5YB 1ZK9A 4NN5C 4QRSA 4K71B 4KDWA 1MFBH 1RIVL 4PJ7A 3E3QC 3RUGA 4PREA 3JV6B 3WHXA 5E8NA 4HJ0C 4Z77B 5HYJD 1AXIB 2OTPA 3LOWA 2DM2A 4DVRL 1KLFA 4AIZB 4HWZB 1UA6L 2Z4QB 1EBAA 5ANMA 3U82B 1JTPA 3VG0H 2P8LA 1K4DA 1TVBA 5IB5A 3H3PL 1U8IB 4FTVA 2A73A 1JNHB 2BSTB 4NQSB 4NJ9H 4JZJC 2FEEI 2FO4B 1SJEB 1D5BB 4OZGA 2VNCA 3EYUL 1N7ML 2EXWC 3BWAB 5L6YH 4JFQA 2Z92A 4KUCD 4KJQD 2AEWA 2BRRH 3OHXB 3SE3C 3LSOB 5HI5C 4OLUL 2R2CA 2A2QT 3PP4L 1U8MB 4OD1H 3VXSA 2A1WH 3WL9B 3GSNL 3GJFA 2VLKA 2VQTA 3PGCB 4NKIH 1NGPH 1QFUH 5CP3H 3OKKB 2BOBB 3GMLB 2XI9A 5BJTA 5I8OH 3RKDD 2NTSP 3KDMA 3UYPA 4N0UA 5DS8A 2XKUA 1YNLL 2WQ8A 3EJZD 3IB4A 4NPYB 3CH1B 4P3WA 4YDJA 4C54A 2J4WL 4B7LA 1A4KB 3L5JA 5IBTH 1H8OA 2BVYA 4NT6B 4LLDA 1FCGA 1U92B 3MLRH 5IROA 3MV7D 3WFBH 4HG4J 3U30C 4I0PD 5GHWL 4Z78B 1O0VA 2FO1A 4PJIB 5CEZL 3L3IB 4PJ5D 2DF3A 3OGCA 1ULVA 1L7TH 4K7FA 4Z9KB 3ZKSD 3ARVA 4FOMA 4BJLA 1PDKA 1NMAL 1CE1L 1UJ3B 1IM9B 5HGHA 4X6BB 1EK3A 2ESVE 3PWUB 1OAUL 2R1XB 3JZ7A 5C9KA 1XEDA 1A6WL 2EDOA 1CGUA 2ZJSH 4ZUWB 3EAKA 1HHJB 3RFZC 3PWPB 4ZS7L 4QXWA 3OBAA 5E00A 3EZJB 5CP7A 3VRJB 3D39A 4BQCA 1NEUA 1HEZB 3FCTA 5J56B 5EFIA 4HPYH 5HHMB 1FG2B 4L9DA 2PETA 1BD2E 5FK9B 3CFCL 3BISA 4QWWD 1OLLA 4LVOB 4I5BA 3VXNA 3D6GA 1EMTH 2Z35A 3D3VD 3BIKB 3O2DA 5IIEA 4P59L 1ZTXL 4G5ZL 4HDIA 4FQXA 1KN4H 4PJBB 4XWOC 3Q5YA 4ZODA 1VADB 1C08A 4K8RC 4W6YB 3QIWC 35C8L 3DV4B 4Z7OE 4XPTL 4ORZC 4RGNB 1LQSR 4WWKC 4APQD 4U3HA 1I8LA 1DTUA 1HSAB 4GXVL 4FXGA 4UT7H 4MD5A 1CU4L 1MFCL 3L1OL 5I73B 1J11A 1N6UA 1A1NA 4MA1C 3B43A 4P2QE 4PJFF 2ZKHL 3O45B 3M8OL 5KBNC 5C07D 2BDNH 3CSYA 4W81A 3LH2L 1VEOA 3H9HB 3CLEH 5D7LA 1P9MC 3TGXA 1GRWA 3X3FL 1XGQB 2B1HL 3QHFH 1ZHLA 3WNNA 1Q9WA 3MV7A 3MNWB 2GCYA 5AZEL 5T1DH 2OL3L 1OOAA 1J8KA 4GSDL 4U1GB 2CSPA 4U1HA 2Z9TA 4KI1A 4U33A 2RBLA 1UB5B 4I4WB 4RFOH 3N1QC 4YHML 4JRXB 1KELH 4XP1L 5D5MB 3STZB 3HA0A 1S5HB 4XNQB 4ONOA 3WLBA 3BP5A 4LFHD 1FFNB 4XRCA 4GAJH 4NQEE 5KVMC 5CJOL 1QBAA 4GUPA 4XB8A 2J6EL 2V2TA 3SDAB 4FRWA 3L5WB 2FSEB 1KCUH 2WBJA 3BP4A 3ABZA 4M93B 4UUJB 5CGTA 2BNRB 1E28A 3LMJL 3QNXB 1JGUL 1RIHL 2MCPH 3BH8B 2APXA 1N59B 4U0QB 4WGVB 1B3JA 3B8YA 1P2CB 4DOHB 4Y5XA 4OIIH 5HY9B 1A21A 1J18A 1CGYA 3BN9D 4Q2ZA 4Q9BA 1NLDH 4PBXA 3O6FC 4DN4L 3AY4A 5F70A 2BHYA 5B4MC 4P9HC 5I76B 1UVQA 4QOKE 1A6AB 1CICB 1IAMA 3OKMA 2YMXL 4NBXB 5ADOL 4JPKH 4IBLT 1CLYL 4APQA 4W68A 5D9SB 4ORGA 2Q1EA 4C83B 2XG4A 4GS7B 3WIHH 5EA0L 1MCPH 4OSUH 4P3CH 4K3EL 4OCNC 5HI4C 1DEEA 1LE5B 3V5HA 1H5BA 3FQWB 4QRRB 5SX5H 1XF2B 1X4ZA 3E6HA 1UADC 4HD9A 3WXWL 3QP3A 5C07A 4XPFL 4R90L 5HI3C 5JIHA 3MODH 1ORSB 1QR4A 3VDBA 4WI4A 1KNOB 1KB9K 4JO2H 2XA8H 2X4OA 4EI6A 1TVHB 5ESQB 3VXMA 2DIJA 3MRKB 1AGCA 4PRHD 3AB0B 4O00A 3RWEA 2DICA 5I2IB 2D9CA 1DBAL 4P9HH 4HXAL 1OL0A 1MVFA 4DN3L 2DI8A 3KVQA 1QO3B 1WGOA 4WY7H 4PBVC 4HWBA 5FKAA 4B5EA 2FX8L 2QQLL 2Y6SD 5D8JH 1LO2L 3D9AH 5BRZD 5EBMA 3X3GL 4ODHL 4POZC 4PJEB 4WHTA 4FFZH 3V4PH 1WAAE 4U6XA 1T0MA 3P0VH 1A1MA 5F93C 4NC2B 3ZYIA 3TFKD 5LAXB 3MLWL 4XH2B 4JFDB 4DGVL 3KR3L 5C0GB 1K8IB 3OKNB 5DUBB 2ZCLL 3ALXA 1J88A 3SKUD 1S9XB 1SBSH 2GJZB 3K4DA 3KXFB 2Y5TB 4MAYC 1FZMA 3ARFA 4TVPH 4F33B 1U42A 5DRWA 4P23D 1OAQH 5HXMA 4FZEH 3SE4C 2XZCH 4WU5A 5IFHL 4LCIL 4F3FA 4H5SA 3LN5A 4UOW0 1JPTH 3RVTC 5FO7B 1Q9KB 1SY6L 3NPZB 4RWYL 5EPMA 1MJ7H 4PRBA 4MS8D 5DRNA 5FM5M 1F45A 4NN5B 4YR6A 3SDDA 3QIUA 2NY3B 3ARBB 4NKOB 4HH9A 5MEOA 4LLQB 5DR5H 2BVTA 5DHXB 5DJ6A 5JDSA 1NC2D 1P4IL 4IMLA 2YD5A 1FN4A 4NKDB 1GZPA 2XWBA 3VFMA 4PJFA 1F3JB 5JO5A 1PG7X 1HCVA 3MRIA 2DQCL 1MRDH 1FVEA 3U9PH 3UTTB 2JB6B 3CDFA 1XR9B 5SWSD 2A0LC 4OCWH 4X7SL 1IC7H 1SM3H 1RZGB 3QO1B 1J9CT 4PRHA 2DJ4A 4F8QA 4M5YH 1YDPA 2FH8A 3DX8B 4YHZH 1ZSDA 2V5RA 4PRID 5DQDH 4R0LA 1S9VA 4TSAH 5IVXA 3VFNB 3O11A 1X7QA 5JOFB 1MAKA 5CINH 5EOCJ 3ZYZA 3ULVC 4IOSD 4YIQA 2D31A 4P9MH 3CFDB 4L9LC 1ZAGA 2VISA 3DOSA 2NW3A 5T33H 1KB5B 1QTYT 1NANI 2EH7L 1MFAH 4XI5C 3OXSA 3ULUE 3O6ML 1PZ5A 4HUKB 2QADC 3B83A 4XCYA 2IAMA 3HMWH 4FHBD 3FOLA 3LEVL 4MX7A 3N1PC 1FFOB 5H35B 5FHAH 4EXKA 2ARWA 7FABH 3ES6B 1X4XA 3NCYS 5ACMA 3GB7B 1TZHA 2PCPA 4QHNA 3OL2A 3CSBA 4Z0BL 1LK3L 3IF1A 5DD6B 4NC0B 2GSIB 5HGBB 5F21B 2YD4A 5JZ7C 3V7AG 4X8JB 4E41D 4H1LH 5L2JB 3WFDH 4U49A 1FYTB 3OAZH 3EO1A 5AD0A 3GKWH 3BKJL 3RI5F 1JNNH 3WDIA 2CKNA 4JY5L 4Y5VC 1H0DA 2AQ3A 5J13C 4YK4B 5SWSA 4JFOB 5JA9A 1A6VH 3GMRB 1S7UB 4HPOL 4TSCL 3BT2H 3NIDE 2DB8A 3LKSB 3LKNA 3MRDB 4PGZA 3NCJL 2OMBA 1QG3A 4O02L 4TN9A 1MLBA 2NY7H 4OLXL 3R8BB 5CJ5A 4BKLB 1UGNA 2AABL 4CVWA 4LLUA 2MPAL 3VXRD 3QPQD 1CDCA 4EUPG 2E6JA 5F1IB 1R5VB 3QUXD 4PJBF 3NOIA 3FT4A 3IU4L 1I8KA 4KVNL 4JAMB 4WWKB 3JTSA 1TJIH 4C56B 5D1QD 2IEPA 3JUZA 4PLKD 3ZE1E 3MUZ1 4OD3L 4MJ5B 1WFUA 1FGNL 4PB0H 3EYFA 3TO4C 3FO2A 3P0YL 4KV5E 4EI5B 4U2YA 3ZTNL 3GJEB 1WCBA 4MA1B 2W0PA 3HRPA 3FFDA 1AO7E 2GHWB 3BIBX 2HFEB 3MRBA 3O4LE 4KKNA 2I25N 4YE4L 3WEXB 5DMKB 5GRVL 4KZEL 4WFHE 3O9WA 3CXDH 4Y19B 5B39B 1G6RA 4UTBL 2VL5A 2AJVH 3VWKC 1QFWI 4N68A 4GKNA 3RGHA 1LHZA 4LKXA 3PHSA 4X5LA 5JNYB 2X70B 1J1OH 4LAQH 5HHOE 5GGVY 1CDIA 2BSSA 1OF2B 3G5YA 3E8UL 5D5MF 3LRSA 4F57L 3PHOA 4MNHB 4ETQA 2D9QB 3UTSD 1UXSB 5KVFH 4NP4H 1I7TA 4KUZH 2AGJL 2MOVA 3O8XD 1MREH 1NEZB 4UT9L 3M1BA 3JV6A 3K1KC 2YR3A 5A2KH 5EZLB 4Z77A 2WAHA 3GMQB 1MNUL 4HWZA 1HSBB 3HG1D 4HXBH 1UM5L 3OSKA 4JHAL 1T89A 4M02A 1CTOA 1YNKH 1ZANH 2GK2A 1U8IA 5GGVL 2K7QA 1JNHA 2BSTA 2FJGB 5F1NB 3O6FB 4KQ4H 2ZOKB 2FO4A 3R06A 2F5BH 1I8MA 4FFYH 3BWAA 1PBYA 2UYLA 4XNYH 5D1QA 5F96H 2QJDA 5E2TH 4ZNEE 1FIGH 1FLRL 4M7LH 3BKYH 5FUOL 1DLHA 2VITB 4KDTA 4LCWD 3QHZL 3IS0X 3IKCA 4Z6AT 1U8MA 3PL6D 5IFAL 1HKFA 1ZHBB 1Q9OA 4PJCE 3SBWC 3GBML 5H2BA 4OTXL 3ULSB 2X4UA 1EGJA 2YUZA 4P4RB 5E2WL 2R2EA 3VH8B 2GW5A 3DLQR 4P99A 2XY1A 3PGCA 2CKBL 1PW3A 2M26A 2GQHA 3OKKA 2NR6D 1NBVH 3GMLA 5D2LB 4AMKL 4FG6D 5D6DA 2FH6A 2GJ6E 5FYKU 4NPYA 4RBPH 3T3ME 3CH1A 3ZZ1A 4DVRH 3A6CH 1UA6H 1A4KA 1V7NL 4LFHG 4TNWF 5DO2D 4F9PC 4IOIB 4NT6A 2R1WB 3RY5A 1U92A 5GGRB 2DYPB 3H3PH 5CWSA 2P48B 5J4MA 3BQUC 1C12B 4HG4K 4D0BB 1E4WL 5DJXA 4Z78A 1CFBA 3EYUH 1N7MH 4MNQB 3KWWB 1KACB 3QI9D 1U9KA 4PV9B 1UJ3A 1IM9A 3BD5A 4V1DB 4OLUH 1FNFA 1N0XL 2VLJD 1CF8L 5D4QA 1T22B 1F4WL 3D5OF 3PP4H 2UY6A 3BXNA 4H88L 4ZUWA 1HHJA 3HG1A 1WBXB 1OGTB 1KULA 4FN0A 4GW5A 1KEMH 1HEZA 3L3KA 4U1LB 5B21A 1IGML 5LGKA 4M3KB 3KPSE 5B38G 3QQ4B 5GZOC 1OW0A 4JFXA 5K9OB 1W0VA 1YNLH 3QPXL 3QWRD 1N6QL 3VGGA 4OCSL 5EC1A 3BIKA 2J4WH 3S35H 5IQ9B 2DQEL 3GSWB 4PJBA 4FQJL 1VADA 2OQJB 5TDPB 2ARJB 4IOFC 5D6CA 2A9NH 1B0GB 4EN3D 1I1AD 1SBBA 2IFFL 2BFVL 1T04B 1HSAA 1AP2B 1CXFA 3CDCA 3CX5J 5CHNB 2Q86B 2CJUH 5CEZH 5I17B 4PP2A 2QKIB 2EDNA 5FV1L 1EXUB 1OAUH 4FQLH 3O45A 2DLEA 2CIKB 1A6WH 1EO5A 3MRCA 4EQ2A 1MCEA 1KENH 3H9HA 3WFEL 4ZS7H 4G42B 5IHBA 1D5XA 3LN9A 4NQCB 1NBZB 5F7HA 5GS1B 2ATKB 1LO5B 4NO2B 4HKZB 4I4WA 5CSGA 3CFCH 5C6WH 3RTQD 1O5DT 5M95B 4XNZC 1S9KC 3QI9A 1BZ9A 4JN1H 4RMRA 5D5MA 4G9FE 4P59H 1ZTXH 4JREC 3STZA 3JBG7 4XNQA 1IAOB 1FBIL 4RSVA 2VLJA 1T0PB 5EU5B 4X5XB 3SJVE 3PWJA 4XPTH 5GGUB 2DTML 3TPKA 3DUUB 2V5SA 3LKOB 2FSEA 2Z8RA 4UUJA 2BNRA 1CU4H 5I66B 3CVHL 4GRMA 3ZDYE 1MFCH 3AS1A 3QNXA 1LO0L 3L1OH 3BH8A 1N59A 1P2CA 4P46C 4QRPD 3WO4C 4BH7B 2D0HA 2HT2D 5DA0B 3DO3A 3M8OH 5I18L 4P2RE 3LH2H 2IFGA 3MLZL 5IBUB 1V05A 1NGXA 3BJ91 1T66C 5FF6B 2O26U 5I1EL 5I76A 1A6AA 2B1HH 4G6JL 5AZEH 3IDIB 4GSDH 3RA7L 4YXHL 3ZHLA 4HC1A 4JRYB 1EGJL 1PZUB 2GIYA 4YHMH 2EIEA 1WSST 1FC2D 4XC3L 3TEUA 1RIUL 3PV6B 1IC4H 2ZPKL 1LE5A 4ZO7A 5HGGS 1EBPA 4R26L 3FQWA 3I6KB 4QRRA 1XF2A 2VDQL 2AJ3B 1XMWA 4NQVB 5A2IH 5CJOH 3P40A 1WFOA 5J13B 1QSFD 2BSRB 4Z7WB 3I75B 3I2CL 4XZUB 3V0VA 4J4PC 4QNPF 2YPLD 5C0AD 1ORSA 2EECA 4UV4L 4Y16D 3DX9B 1M1SA 2E3VA 4OCXL 1KNOA 4NDMA 4LCYA 5IJVB 5EBWB 4ZFOB 3LMJH 1JGUH 4PJGB 4F7MB 5GISL 1TVHA 4TVPE 5ESQA 1KGCD 5L8LB 2AK1H 4S1RL 5I2IA 4O5LL 4GBXD 5GJTL 1UB6B 1RUQH 2NXYC 4U6HA 1OTTC 4JFEE 2XXCB 1BF2A 4OUUB 2YPKA 5ADOH 1M05B 3VRIB 4PY7B 4WU7B 4YH6A 1OVZA 2ADGA 2W38A 3VFTB 3HE6C 1XAUA 3TO4B 1NCDL 3IDGB 5EA0H 3QCUL 2HJKA 4K3EH 3GMPB 1BFOA 2IQAB 5LAXA 4OGXL 2DDQH 1SEQL 4XH2A 1HQ4A 4JFDA 3EO0B 1K8IA 2AXFB 3OKNA 1IEAB 4AL8L 3WXWH 4U1JB 1UH4A 1S9XA 4XPFH 5C0DA 1FPTH 4R90H 5FGBC 2VXSH 2DMKA 1J8HD 4KK6D 4F33A 3VWKB 3I02A 3QEQD 3Q0HA 3RVXC 3I6LE 3E6FB 3NIFE 4LKCB 3T77A 3RNKB 1SEBB 2HMIC 5I1JL 5KJRL 4Z7VB 3IJYB 5FO7A 1FL6A 3QZWB 4MWFB 1IQWL 4IRJD 4JE4B 3PGFL 4FQQA 1DBAH 2MQCA 5F9WC 3IFPB 4DN3H 4MB5A