5I73B

X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central and allosteric sites
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
218
structure length
218
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAYMELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Sodium-dependent serotonin transporter
total genus 37
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i73B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i73B02
4JQIH 1K5NB 3THML 2FEDD 5KZCD 3EYFB 4HF5H 2XZQH 3DUHA 3EDJA 1T2JA 1ZT7A 2KQMA 4WCYH 1T1XB 4MAYD 2ED8A 4RMTA 1TJGL 5GRUH 4FA8A 2H32A 3DGGA 1EHNA 4DGIL 4F37F 4BQCA 2YN5A 1CGXA 4U7KA 2WINA 2GQHA 2X4NB 3HS0B 4JG1H 2A1WH 4XP9L 1WQVT 5I6XC 4IRZL 1K8DA 2Y23A 1AO7B 4BSWB 1MJ8H 3LN5A 4NN5B 4XPHL 3K7UA 5ALCH 4M6NL 2WUCH 3SGKA 4KC3B 4KQ3L 1N5AB 2KZ1B 4H5SB 4PB9H 1C5CH 3WDJA 1CDYA 5EU6E 5JW3H 3Q6GH 3D3VE 1JWMA 3SKJL 4KGLA 4NJAH 5DLMH 5C0IB 4HS8L 3DX8B 3GMQA 1GYAA 1U36A 5I1AA 2GEEA 5DA4A 1AXSA 4KQ4H 5SWSB 4LKCB 3MRJA 2AEQL 1OARH 2BVEA 3EYUL 3CSGA 2IANE 4KUCF 1TZIA 4LPUA 1CL7L 3HC3L 4WU5B 4MXQD 2J8UE 2UYLB 2GJ6E 4J3XA 5SWQA 3CFDB 5E1HB 4PJCE 1HHHA 3M17A 3UTSA 4WW1A 2XN9B 3TLRA 3KXFB 5I1CH 3RZCD 4JZJB 5CHNA 3K2UL 2VXSL 2CKBA 5E2TL 1X7QA 3IT8D 3HFML 3DV4A 1VDGA 3EOYG 3FTGB 2NXZD 3AUVA 4V2BA 1AKJD 3HZYA 1K8IB 4YHLH 4IOFC 4FN0A 1RULL 1LE9A 1OAQH 3A6BH 4NO0D 1XCTA 2LVEA 3MLWH 4NC0B 5F8RC 3B2VH 3QO0A 4LPYA 1AD9B 5J4MA 1NAMA 1IC7H 5DD5L 1UT9A 5F6IB 4HS3A 4YHIB 3X14B 5CHNB 2EDJA 5JW4N 5HI5C 2P5WD 4AQ1B 3S34L 2NY5C 4I2XE 1IC5H 2YR3A 1ROWA 2D31A 5DMIH 1OY3B 1HEZA 1YN7A 4KAQL 1VFAA 3AGVA 3ILQD 5IVZA 4X0KA 2R2BB 5FHBL 3N0PB 1S9XB 4LLUA 4EI6A 4HUVB 2OQJB 5AEAA 1J7VR 2BP3A 4PJXE 5HGHA 1CE1L 1OLLA 2I9TA 1HH6B 1AJ7H 4H8WL 3V5HB 1FHGA 2XIDA 5DFTA 5IROC 3DRTB 5DZNA 1CDJA 5E8NA 1EDQA 2W0KA 2KDGA 4F3FB 3T1FB 5IQ7H 4UTAH 1ES0B 2PYEA 4UAOC 4EVNA 3HG1A 1EPFA 1TIUA 4NT6B 2OL3H 1HHKB 5C09E 1K3IA 4PJ7A 2Y5TB 2B7DT 4HH8A 4KXZI 5ACMA 3HC4H 4M3KB 1SEQH 2EEBA 5JHDE 4D9RE 2XRAH 1KNOB 1IKFH 4JFHD 5T3XH 3BDXA 3WFHB 4IOIB 4UUJB 5CEZD 3TVMD 3O3BA 3LMJL 3NCBB 4OSUL 4YHPB 3BIKB 4LNRA 5TE6L 3MRHB 3OV6A 1H0DA 4UOJA 5GS0H 4L8DB 1QKZH 3I50H 3VGFA 4ZSOE 1L0YA 1MCOH 2YWYA 4FQIL 2VTFA 3G5XA 3OJDA 4OCYH 2W9DH 4RDQG 4OFIA 1K85A 5E5MB 1VFMA 3GSRA 4Y19B 5GS0C 4X7FC 3BUYA 5E8DH 3GMPA 1OB1B 5I8OH 4KRPC 1G0YR 4ZD3L 3ALWA 2XNAB 1Z9MA 3BIKA 3V79C 5DQ9B 3DRTA 2AJUH 4PV8B 1I4FA 1HSBA 1KCUL 4QHLB 2LU3A 3MYJA 4A6YA 3NCCB 2A0LD 5E2TH 3BH9A 3UXFA 5IOPA 3MCLL 1RK0A 3QEHA 4JDVA 4RZCA 3BW9A 3VXSA 2EE3A 1NC2D 3ULUE 5IV2B 2BDNH 3QFDA 4FQPA 1K4CA 5D7IE 5CBAB 5JXAL 4PRID 4L8CB 4HK3J 3O2DL 3QQNA 3QXWA 2YEZA 4E9LA 5I0ZA 1A64A 2B0SH 4PV8A 7CGTA 1AGEA 3U9UA 1JWSA 4JFQB 1MCWM 4N0YH 3QEGH 3GUTA 4E0RA 4Y0GA 3QEQB 5FAAA 5GRJH 2IBBA 5GGSB 3QWQB 4ZFFA 5BZDA 1IGIH 5HGHB 5D2LF 5FHBH 4I3RH 5DD6B 4Z7WB 1QSED 4Y5YA 2P4AB 3UBXI 3L95B 1RJZA 1KENL 1QSFD 5IWLA 1NMAL 3VD9A 4PREA 3L1OL 2Z91A 3EFDL 5DHXB 2XTJD 5E94A 4OGAD 5GGQH 4LCWE 3JZ7A 4H25B 4R26H 1PGRB 3JWOC 3BEVA 4M4RA 3D2UB 4M93B 3RWFA 4NHCL 3P0VL 3BSZH 5J11B 3SKMA 4XNXL 3OWEA 3VJ6A 1KN2H 3H8NA 1Z5LB 1ODAA 5F7KC 2XFXB 5I73C 3GM0A 5GGTH 3PQYB 4M7JL 4O51B 4XVTH 4M7KH 2P5WA 3MX0A 4WU7A 4MAUL 2FB4L 3HUJF 3QO1A 2ICCA 1XF4B 5BXFA 3ZHDA 5EU7E 4EZMA 5JORA 4FOMA 1YEHH 1E6JL 5CZVH 4HUXB 2H2PC 1W2KT 2R1YA 3SKUD 1ITCA 1TETL 4NN7B 1DVFB 4Y4FA 4Y5YC 3QRGL 3PABA 4RGNC 1HZHH 1X5IA 5FHAH 2NY1D 3G9AB 1K8DB 1QNZH 1ZEAH 5IFHL 3MZGB 5DK0B 2M2DA 1A3RL 1AD0A 3TN0C 2X2YA 4WO4B 3FCTB 1KT2B 2CGRH 4ZMAT 3ULVH 5F7EH 4ONHA 4WWKB 1M4KA 3CMOL 2N4IA 3MV8D 3FT2B 1YEGL 4K3JH 4YK4C 1W0VB 3EOTL 3OKMB 4I18C 2XKNA 2NLJB 5E7FA 4OZHA 1A5FL 5AAWA 3HZMB 1A7PL 3LSOA 3DX7A 4NQVA 5KJRH 3FO1A 4UT9L 5SWSA 3EZJB 1A9EA 2FX7H 4WI6A 4DFHA 4LSQL 5HHNB 1S5IH 1PJ9A 3U36A 4N1EA 1WIOA 3O0RH 3VWKD 2YA0A 5ITBH 4NO5B 2B8OT 3KS0J 1I1AD 3NN8B 2NY1B 3BD5A 3FQRA 3NCYP 2GJ6D 2NYYD 4AENB 2QSCH 1T5WA 1TVHA 2JIXD 5JORB 4F57H 3ARQA 4YGAB 3SBWA 4OGAC 2GK0A 3VFUB 3UBXG 4OZ4A 1FL3A 4FZ8L 3RGVA 1LEIB 1BGXH 1IBGH 4BKLB 4CU7A 4YXLL 4R7NB 5D7IA 2IBZX 3MZTA 3ET9F 1I3GH 3F12B 3DTXA 1Z9OA 4FFYH 2FJFA 4NZTH 2PXYC 4PR5A 5FYLD 1ITBB 3RAJH 5ENWB 4EUPH 5JO5A 1YQ2A 3QDJB 3BOVA 5JZ7D 2ADIA 4BZ1H 5LJYH 2E9JA 4G9FD 4QO1A 2QEJA 4XPGH 3CUPA 2ITCB 5J12B 3D5OF 3CVHH 2PXYD 5J13C 3QIBB 5CP3H 3C5JA 5F70A 4KRPB 3RWJA 3FRUB 5FKAB 2DLIA 2V7NB 2GTWA 4LSRL 4LLUB 3S4SA 1VPOL 3GNML 2DI9A 2B5IB 3CLFH 2ZOKA 1AO7A 4BSWA 3G6JA 4LCYB 2G9HB 1UACL 2UWEA 4J12A 4LHQB 1T7VA 3O2WH 3QZWG 5C0BB 5ALCL 4ODVL 3IJSA 3TZVA 5CJ5A 4W81A 3IKCB 5CS7A 4RMSA 4OD2A 3SGEH 3IDIB 4AENA 2AK1L 3SKJH 4HUUA 4ZUUB 1PQZA 5JQ6L 4LLDA 1FGVL 4MYWB 2J12B 1KIRA 4K23H 1RIUL 1AGBA 3GB7A 1N6QL 2B1HH 5E2VH 1ZLVH 3FZUC 4N1CA 4IOFD 1CT8B 4M5ZH 3VXSE 3PXJA 4XI5C 2O5YL 1F6LL 1HHHB 3M17B 4OBSA 3QXDA 2NQCA 3RIFF 1GGCL 4MD4B 2ARJB 3QIWC 4ZS6D 2A6IA 1CFSA 4QXTA 5I1CL 5HPMA 2H9GB 3UTQA 1C12A 1D5IL 1Q9WB 2A74A 3VMPA 4XX1G 5F6HJ 4XWGH 1MY5A 1EEYB 4LEOB 2Q8AH 3P9LA 2ERJB 2K7QA 3SDCD 1I8KB 4GLRI 1YN6A 3VE0A 5BW7C 1WZ1L 3VD7A 5C0CE 1S7WB 4LBEB 3BKYH 4DAGL 4FXLA 4HT1L 1EXUB 2ZCLH 4OAWA 1LILA 3UYOD 1W72H 4J23A 5SWZA 1B6DA 5IMMB 3VDAA 1URLA 5ITFA 1U8LA 1X5FA 4ZAKD 1Y0LA 2B2XH 3Q3GA 3DVIA 3MLTB 2BHZA 1VGKB 2Y1VA 3U79A 4L8SB 2LFGA 3V5DB 1AGCA 4Z7NF 1F6AA 4ZUVA 3BPNC 4P46B 4HIHB 5B8CB 4WGVB 4JRYA 2YA1A 1XF2A 2YSSB 5TE4L 4Z6AT 3SE4C 3IJHA 5DJ8B 2P5EB 4NSKA 2Q6WA 4PRIB 3Q6FB 4PGEA 5C0AD 1A1MA 2DMCA 4ORGA 2BHYA 3EO1A 1S8DA 1F5WA 4H0IA 4KZDH 2AV1A 3DXAE 1A6UH 3QUMA 4LU5H 4OLYH 4NO0A 2UZYB 1FNSL 4BZ1L 4NGHH 2ORBL 4ZDHA 4P3CL 4HKJB 3VXUE 4KKLC 1JHTA 4NQEA 1JPST 2YMXH 1HINH 4PGEB 3V7MA 3EOAA 3SDCA 3WLBB 3HC4L 1U58A 4ZQKA 3DROB 4PGCB 4BH8A 1T20A 4DZBA 5CEZL 3GJEA 2ADFH 2NY4B 1YECH 3UO1H 2B5IC 4MWFB 3ARFC 5T3XL 2R0WH 4OLUH 4OZGE 4X8JA 4NN6B 4XCNB 4YQXH 3CXHJ 4ODVH 5F7FA 4KROB 4RMVA 1ZANL 5C0EA 1U8LB 3CFBB 1L4IA 2D7TL 4R6UA 5FYKU 3WFZA 3QXAA 3TV3L 3MUY1 4WI7A 3FB8B 3WO3B 5F88A 5BV7B 4A6YL 3FHQA 4OLVH 3SCMB 5CGMA 4F2MB 1QLEL 4PPTA 4C54A 4BH8B 2XFXA 2GSGA 4WGWB 1TITA 5LWYL 3QNYB 3VA6A 5DSCB 2NY7L 1XGUA 1VSCA 3BZEA 2HLAB 3T1WA 1U3JA 2V5RA 2CDFB 3WSQL 1TJIH 1MF2L 4JFED 1H5BC 4XI5D 2R23B 3GBNH 2Z31C 4I0CC 5F71A 3VFNB 5D2NC 3QUYC 3WDIA 1OT1A 1R3LA 2RR3A 3EZ8A 3RBSA 1XH3A 3L5HA 5EO9A 5MEOB 3DV6B 5KG9A 4TNVF 3U46B 2FSEB 5HPOA 1C5DA 1FVCA 1IGTA 1ETZB 2IANB 2PTTB 5A1AA 1KJVA 4X98B 3CSYA 1SY6H 1YYLH 1X7QB 1BX2A 3EJYC 5DDHB 3VFTB 1S7TA 1R3IL 2VXUL 1G9ML 1J1PH 4X5XA 1W72L 2HVJA 4QRTB 4XCNA 5GSRA 3U0PB 3D0LB 5EBWB 3U4EA 4G6JL 4X6DF 1EO8H 2HWZH 3KR3H 4WFHD 4WWID 1EJOH 5H8DA 4R4FL 3V6BR 1CGTA 4YO0B 4F9LA 4I77L 7FABL 1VCAA 5TQ0H 2X9XA 3DRQB 5HDBE 4JM4H 3WD5L 1CI5A 4H0HB 2V9TA 2VYRE 2AK4B 5FYLL 3W0WA 2AV7A 2EDHA 3ARTA 1T0NA 5CJOL 3UEZA 2QADD 1EO5A 3BKJL 4MAYB 1NCCL 2SEBA 2MQ3A 3IDJA 1NUNB 4RGNE 3MV01 1KT2A 1A4KA 1DQQA 1NCDL 1WWWX 1NCAL 4RWYH 2DLEA 2BZDA 3WHE0 3L3KA 1U8NA 2ADJA 5HI4D 4G7VL 3OKMA 3O3EB 1A7RH 1CFSB 4QXTB 5DC0A 3U30C 1WZMA 4RISH 1V8HA 2OS7A 4MD5B 4PJIE 4XNMA 4DOHE 3QIUB 3X3GL 1U95B 1WZKA 1V7MH 2D2OA 4AM0A 3FQTA 5I8KL 4Z7OE 5GHWL 4XBEL 4Z78B 5I71C 4IIQC 2UZIL 1NCNA 1Q0XH 1BLNA 1H3VA 4GKZA 1T89A 1UWGH 4AG4L 1JTPA 4I48B 1T66D 4Q2ZB 1LO3H 1AHWB 4KTDH 3VRJA 2Y7QA 2DB8A 3IKCA 4IMLB 4QTHA 1HKLL 2VWEE 5D1ZB 4MJ4A 5I1KL 4ODUB 2NY0B 3VGGA 4NIKB 1FQ9C 5EN2B 1CS6A 1T20B 1G7PB 4Z95H 4PRHB 5J13B 3QWOA 2PTTA 2JB6B 3HA0A 4NQCE 5F1KC 3WHXA 5BRZD 2ZCKL 5C09B 2VJXA 3MRPA 4OCSL 1J88A 2JELL 1AKJB 4G8GE 1G9MC 2BCKB 5LGJB 1P84J 3C9NB 5BS0B 3B4NA 5I0DA 2ICES 4JFFB 4QOKD 5D6DC 1MFDH 5KTEL 1OSPL 5CAYB 2E5EA 3UC0H 3O6FB 4Y5VB 1UGNA 1GC1C 1ZMYA 2P5WB 2G5RA 3K81A 2ZPKL 2BSRA 2E9IA 3EAKA 3WN5C 3AAZB 3GMRB 4NN5C 3ARBC 1CD9B 1A9BB 5JMOC 1EHAA 4JFQA 3V5DA 1JWSB 4DGYL 4XP5L 1MFCH 5J9PB 3F6LA 5DVNA 3TJHC 2EO9A 3V52L 2HTKC 2G60L 1GGBL 2XQYK 1EA9C 5B39G 4MB5A 3KPLB 3BPCA 1FC1A 3RUGF 3CSYB 4LEXH 3WS3A 3JV5A 1NDGB 4RFNC 3ZE0E 4GJTB 1HNGA 4LHUA 1FCGA 4JDZA 5K9QG 2C3HA 4YHKH 1H3WM 2R1WA 3LQZA 1M7DA 1IGMH 4H0GA 3D9AL 5MENE 5FYJL 3AROA 2NXYD 3JBG7 4HBCL 4K7PY 5A2LH 3TYGL 1IAOA 3BPLC 5IB1A 3CVHA 4Z7VE 1MWAH 2WM0A 5A3ID 2HTKD 2R4RH 1A6ZB 5E9DE 3T0EC 1WCBA 2CDEA 1A6TA 4OFKA 4XB8A 3ZZ1A 4HSQA 1OCWH 2WBJB 2YUXA 4PGCA 3AAZA 3GMRA 2F15A 1A7OH 3DX7B 5GGRA 3QXAB 3OTTA 3ZYZA 3FQUA 3VXRD 4P5MB 3HG1B 1KCSH 1NUDA 5FGRA 1FGNH 2IQ9H 2NW3B 3NGBB 5CINL 1TVBA 3TZVD 4D0CB 2CIIB 4R97C 2AXHA 2QHRH 4WUKH 2WMPA 4Y4HA 1U8JB 1CICA 4NQUA 3UP1A 4WFEE 5I16B 1J18A 2D9QB 2ICWA 3TBVA 3QPXH 3EO1B 2D0HA 1LO4H 4QKXB 3BKYL 3WNNA 4KHTL 3D25B 3OG6B 4LHUB 5EU3B 5I2IA 4PBVC 1OTTC 3IXTA 3MROB 4N8VG 2G75A 5HYIA 5ESVB 3S5LB 2DWDA 3BP4A 1MCJA 2WBJD 1EERB 3WLWD 3PWJA 4L8SA 1NGQH 2YPLE 5DGRA 1GC1L 2WAHA 1FFQA 1MCIA 4YUEL 1FNAA 4M61A 1FBIL 2QQKL 1UXSA 1O0VA 3RQ3A 1KELL 1AHWA 1OSPH 2P5EA 2B1AL 5B39B 5DK2B 3N1FC 4MXWH 1G1YA 4FTVE 4I9WD 4DEPC 4HIEA 4OM0L 5F9AC 3RTQB 3QNZB 1KG0B 1WCBB 4XC3H 4HH9A 2VDOH 5C8JB 3ZHKA 1CQYA 1OSZA 1UH2A 3ARFA 1A6UL 2FYYB 4NM4L 1OP3H 5EUOB 5I1EH 1QSEB 5INDB 4QF1A 4S1RL 4RBPH 1IM9B 1F02I 4JY6B 2EH8H 2DYPD 3RWIB 1FV1A 1RIVL 5TDPB 5C07A 2UWEE 5DR5H 1YY9D 1J10A 3CZFA 4U1HB 1KULA 3FB7B 2VQ1A 3F7YA 4QXUL 5ADOL 1JMZA 4YHYB 4L8DA 5HI5D 2PYEB 1JHLH 2OK0L 2Y4SA 4R2GB 2ED9A 3LZFH 3QIBA 1ZLWH 2GI7A 2FD6H 3BP5B 3C5ZC 1LMKA 2QKIB 4FFWD 4G8EA 3JWDC 1OAYH 1KBGL 5E4EB 3O4LD 3C87A 5D70L 3QIWA 4NC1C 4WVRA 1WICA 5FYJU 4KKCD 1U8MB 2BFVH 1T0PB 5MENA 4OCNC 3VFRB 5H35A 1CIDA 2BNUA 1FAIH 3NACH 5KANI 1J0JA 3IXAB 1MHCA 4IRJC 1KOAA 3OX8B 3KXFD 4ZUUA 4CRPA 5T1KD 2DAVA 4ETQB 3HE6C 3SDAA 4PJBF 4Y19E 3D85A 1MHHA 2HJFB 2HFEB 3EJZD 4UT6H 5JOPE 3GBLA 3MA9L 1ZLSH 3S35L 4DAGH 3GRWH 4PJFA 2Z35B 4JG0H 2LTQB 4NRZA 4QT5A 4OQTA 5DMIL 1DBKH 2ZP0T 4M7LH 1ND0B 2XKUA 3CXDL 1P7KA 3GGWA 4TSAH 5DC9B 1BFOA 2VDLL 1U6AH 1N59A 43CAB 5ERWB 3CLEL 2H6PA 1OP5H 1AJ7L 1ED3A 4H8WH 5BVPH 4JQXC 5JDJA 2CSPA 1HQ4A 1E6OL 1Z0NA 1DVFC 1S9VA 3P9MA 4JREC 3WFEL 5I66B 3WS6A 4JM2B 1E4XL 4HJJH 5EUKA 3UJTL 1CZ8H 1RVFL 1RU9L 1P53A 4JM2F 1S9KC 1CIUA 2Q8BH 1JZ7A 1YNKL 4CVUA 1R5VA 4FXGB 5HYJD 2OP4L 2C3XA 4ZFZB 3SOBH 3PG2A 3MLYL 4NKMA 3B83A 4PRPB 2CUHA 3ULVF 3AXLA 1G7IA 4HPOL 4NO5A 2BVUA 3PWNA 1A2YA 4A2LA 2X70B 4HK3N 1MFAH 1L9MA 3AY4A 4P23A 2CDGA 2AABH 4GW1A 4GMSH 3U6RB 4JFDA 4FHBD 2MOVA 4HV8B 5IHLB 1Q1JH 5EBMA 4QXGH 4QNPF 1P7KB 3ARGC 4IHOB 1AXTL 3MOQA 1U93B 5M94B 2GAZA 4K8RC 4ELKB 3U7WH 3BPOB 1CLYH 1YEJL 1JBJA 5GRWA 5SX5K 1UEYA 1P2CA 3VFMA 2L7JA 2AVGA 4ZNEA 1TJHL 3PUCA 2GY5A 1QLFA 1IAII 1RZFL 3W0WD 2J6EH 3CFJA 2UZIH 4YR6A 4L29A 1KLUA 4XCFL 4UNVA 2YK1L 1A6PA 2NY3D 5GZOC 5EU3A 3DYOA 4PJ5B 4F7CA 5FDWA 5CGYC 5HDQL 3WSQH 4ZFGH 1A7PH 1DANT 2UY6A 1R3KB 2PTUA 3F6IA 2EDYA 2DIJA 4OF6A 1S5HA 5EOCH 4F7MB 2YOCA 5E6IB 4LSQH 3T2OA 5IGXH 2ZOLB 2QQQA 5GXBB 3IAQA 4QCIB 3K8MA 3G5ZB 4WWKA 4RAHA 5IMMA 4TYUA 3ZDYE 3Q0HA 4P2RD 1P9MC 2CK0H 3NCJH 3QT2A 3VFWA 5JPMB 4JG0L 2VAAB 3HNTH 3KPSD 1U8KA 3P4OB 4U1GC 5J06A 5DFWH 3HG1D 1ZHNB 3IDGA 3QDHA 4F7EA 1IGIL 4LLWB 4J4PD 3QIWB 4J3TA 2MCPL 2ZUWA 5BZWB 5CJQH 5DO2D 5DRZB 2CIIA 3VFPA 4MJ2A 4X4XB 3D1MC 3I75B 4Z77A 3IXTB 5FF6B 5CIPA 43C9B 5C0RL 1T83A 2YUZA 3OX8A 1QTYT 4RMUA 4U1HA 4PP2A 3I6LE 2ENYA 4UV7H 3BSZL 3KYMA 1NL0H 1PVHA 5GRXG 4HWZB 3QJFA 2NW2A 5IG7A 2RCSH 4X6CB 1MELA 5ILTL 2NY4C 3D0LA 5EBWA 3GNMH 2DQDH 1H3GA 1U3YA 3C6LB 2OBGA 4X80L 1YMMA 3QI9D 4CDGC 1F8TH 2NPLX 2QQLL 1J0ZA 5FXCH 3KPRA 1IQDA 1EMTH 5D71L 4OD2B 2BMKB 1OF2B 3BPNB 1KCVH 3N85H 4GRWB 1QBAA 1QRNB 5GGUB 3DIFA 2EDBA 2D7OA 2HFFA 3C08H 4WDIA 5GS0D 1RZIA 2EE2A 4P2QB 5DWUH 4GO6B 5EU4B 1NJ9A 5SV4A 4XBGB 2VB5A 3B3IA 4NP4H 5DUBA 2FEDC 5D7IF 5DMKB 1IEHA 2W38A 5F97E 4X7DC 2FHFA 2DQIH 1A4JB 5IHBA 1V5JA 3RWIA 5DMYA 1EGJH 2DTSA 2D7MA 3RNKB 3UYRL 4Z7WF 3RZCA 1IM9D 1FYTB 2ZSVA 32C2B 5CZXC 3WL9B 4S1SH 5ICZA 4TUKL 3JXAA 4Y19A 4K55A 2FX9H 1CD1B 4FXKA 1NAML 1NUGA 4TNVK 4UTBL 1F58H 1JL8A 4EBQL 1LE5B 1P5VA 1IM3A 4PJDB 1YUHB 4TUJB 4X83A 4EI6B 4XGZA 4EN3B 2I5YH 4K3EL 1R5WB 3RKPA 3CDGB 1HWGB 3BP6B 3RU8L 1WBXB 4IDJH 1G7PA 1DQLH 3K4DA 5J6GA 1D5XA 4GXVL 2EDQA 4O2EB 4PJFF 4YDJB 5FM4A 2W1NA 4LSPH 3U1SH 4G8EB 5HYQA 1XF5A 3MJ7B 5D7LE 3QUZB 1FZKB 4CJ0A 4OI8A 3L3IB 5ANMB 4PGZA 1A1NA 5HDBF 1NSNH 4JB9L 2CJUH 2B20A 2V17L 2DJSA 3JSSA 3QFJB 5DEGB 3S37H 4XPAH 4PJ9C 1INDL 5E95B 5JHDD 2G5BA 2J4WL 1BP3B 2VDPH 1TJGH 4MA1C 4DKEH 1G7QB 3FRUA 3RA7H 4NWTL 4P5TB 1J0YA 2P8PB 4PG2C 3BPCB 4QF1B 4H26B 3RPKA 3MRCA 3C5SB 3M07A 1GAFL 1WLHA 3GSXA 4QHUA 2AV1B 4Y2OA 3UDWA 2AEIT 1WBZB 1KC5H 3FT2A 3ALXA 4U0QB 5TF1L 4OZIB 2NCMA 2P48B 4YGVB 3MRPB 1WVZA 3CVHL 4LLAA 3TNNA 3VU2A 3UTPD 4D3CH 4M6NH 1BQUA 1YYML 5JR1L 3SJVB 1NAMB 1MJUL 2ICEB 2LE9A 4XC3L 4ZUWB 4YXHL 4D0DB 2P8MA 4BH7B 3FFCA 1JI2A 4NQDA 3WS3B 2G60H 2XRAL 5IIEB 3V6ZB 4Q74A 3OKKA 1NC4D 3BGAA 3VXSD 4EOWL 5EC1B 5DQJB 4PRBB 4YBLC 4U1SB 4MJIE 5KSVA 4L4VE 4X4YB 2VZUA 2X40A 1I9JH 1A9BA 5D71H 5CEYA 3MC0A 4N5EC 5FKPA 3I6GB 5DR5L 5C07D 2CKBL 5DFVC 4XT1C 4PV9B 4BQ9A 3LEYL 3LHPL 4NYLB 3PWLA 2PW2A 1AY1H 2FWOB 3GHEH 4CU8A 1VKXB 1U3ZA 3QHZL 3IFLH 4M5ZL 4HCRH 4X4ZA 2P45B 1IQWH 4JFOB 4UAOB 4AYFA 4WIQA 2M1KA 1U8QA 1G7JA 3HNSH 4MCZA 2ITDB 1J0KA 2FZ3B 2MMXA 3PWPD 3TJEL 3R1GL 3MLWL 3OB8A 5HHMD 2HJLB 3MODH 2EDXA 5DJDA 4P5MA 2AJ3A 1U93A 2C26A 1C1EL 1UXWA 4GRWH 1SVCP 5L2KE 5E2UL 2GJ6B 1CGUA 1M71A 4KKBD 2HLFD 3P4MA 3ZTJG 1ZVYA 5IBUB 1RUKH 3DUUA 1FGNL 1QA9A 5FB8B 3UPCA 5JTWA 5HHQB 1UQSA 2X09A 5FUCC 4B0MM 3RU8H 5DEZA 4F58H 5I66A 1MHHB 1F4HA 3KHOA 5DT1L 1XT5A 4FQQA 3CFIC 4M43L 2KH2B 3MJ6A 3D18A 4GKSB 3NCMA 2L4OA 2ZG1A 3RVUC 2APTA 4Y2DC 4NJ9H 2JJTA 2EE6A 5FFLA 2JJSC 1SY6A 4JFYB 5GGRB 4Z18A 1U8PB 1OPGL 1WFUA 2OMBA 3HMWH 2D3VA 1XR9A 2BNQA 5ISZE 4WFGE 4NWUL 4UIMB 1UEMA 2F54B 3V4VL 4MDJA 3RVVC 4NYLA 3DSFH 2CLVB 3CVIH 1KENH 3CPLB 4RX4A 4OV5A 1LNUA 5K9OA 3MBXH 4LP4A 4NDMA 1A2YB 4MD0B 3GMLA 3KJ4B 1HSBB 1I4FB 3S9DB 2ITDA 4LU5L 4X6DE 5F1IB 3ZTNL 5I15H 2W07A 1SYVB 5J9PA 2D4FA 2J88H 3KPOA 2Y7QB 3UZVB 3EW3B 3KPSB 3GSQA 1NGXB 5KN5B 3MQIA 1JGUL 4UBDC 1HILB 1FLRH 1NPUA 1BQLL 2EH7H 3KYOA 4DWHA 1YNKH 2FB4H 4WJ5A 5E6ZA 1D9KA 1OAXL 4PJ9D 2Z31D 5JPNA 3N50A 5KVEL 4NO2B 1RZJC 4N90D 4NBZB 4XPFL 3MA7B 4XX1E 3L3DA 1NKRA 3AM8C 3B43A 2R0WL 4YQXL 3JUZA 5EZJA 2BERA 4NRYA 4FQCH 2W9DL 3EJJX 1BJMA 1UENA 1WCQA 4FQLL 3BP5A 5LVEA 1SBBA 3SDYH 5K9KA 2CRMA 1JYXA 4P5TA 4PLJC 1N0XL 4ZD3H 4JRYB 3WN5A 3WMSA 3SN6N 3HUJA 5GHWH 3EHBC 5C0GA 4WENB 3VXPB 1S7SA 4NRZB 4F7PA 5HHOD 2XNAA 2FGWH 3O4OC 3SDXF 1UM4H 1QRND 3CH1A 4LMQE 5ISZB 2NMSA 1AGFA 5D7LA 5ALBH 4ZO6A 5H2BB 1OTSD 2VN7A 1JFQL 3KPNB 2UUDH 2BJMH 2B0SL 5FGBC 2OQJA 4CW1A 2GITB 1ZV5A 4LLYB 1V3MA 3VD4A 2MSPA 4U6XA 4JQVC 5IW1B 3WFDL 3WNLA 2KZWA 4P2OD 4MA3A 2YHGA 5TPWH 1A1OB 1Q72H 1FYTA 5LGHH 3IU3B 4G6KL 4X8JB 3A6OA 5E00B 3QI9C 4JZNB 4WNQA 2O5ZH 3OAZK 5E8EA 2B4CH 5L7XH 3MV9A 2IALB 4YXLH 2VLME 3QJFB 5IG7B 1MI5A 4ODHL 5GRVL 4XAKE 4WFGD 4U6XB 3QAZB 3LAFA 2NTFA 2J6EA 5GGQL 5FECB 4LCWB 3ZE2E 2IH3B 4D9QE 4P4KB 15C8L 1Y18A 2A6KB 4JDTL 4S1QL 2MCG1 2VDML 4YDVA 2FLRT 5F7MC 1KN4L 4JKMA 4XBPB 3UJIH 3OAUL 4QRQB 3RWGA 1CXIA 4ZYKA 5DFVD 4OGYH 3QUXB 4APQA 3KYMB 1QOKA 1JGLL 3MGTA 2VLRE 4O2CA 3MLYH 4GBXB 2HJKA 5CGYD 1U8JA 5LG1A 3V0VA 4FG6D 1BQLH 5AG9A 1TTFA 4JFDB 3E0GA 4Q6IC 3L9RB 4X7SH 1DBAL 2ZNWA 1FPTH 1M6OB 5FCUH 4XZUA 4LGPB 4HFWB 5JQ6H 3BDBA 4X5XB 1IT9H 1X5GA 3IDIA 4K71B 5IB2B 2APXA 2CLVA 4O2FB 3ETBF 1NBYA 4P2QE 4OKVA 1VGEH 2HJKB 3WJLC 4MA7H 4I0KA 5L6YH 1MWAL 4R0LC 2VE6B 1XFPA 1GRWA 4NQTA 4IRJB 4APQD 3J7HA 1RI8A 3O6KL 3DV4B 3MJ9A 4GRLC 5ICZB 4FQQB 5C70A 1T21B 4KK6D 3STLA 2VUOA 2Z8VC 1JF1A 3Q5OA 3BGFC 3V6OC 1D6EA 3FAWA 1AD9A 5ITBL 3T0VA 1SM3H 3OJDB 4RQQA 1DE4A 3VXRE 3UDWC 5CINH 1RUPL 1NAKL 3RTQC 3RUGA 3VE0B 3IDJB 2AGJH 1RZKC 4R2GC 4JRWA 2VABB 2W9EH 5HY9B 3WNPA 2ERJC 3GRWA 3X3FH 1JYWA 2R8SH 5AAMA 4P9ML 5KAQG 4PJ8A 4Z8FL 4MJ6B 4Q0XH 1YY8B 1XIWD 4NQCA 4NRXB 5KSBA 1N5YH 5LQBL 4V1DD 1JHKH 5DXWA 1MQKL 3OXSA 1T1YA 2NW2B 1YZZA 3GSNB 1R3JB 3ZHLA 2BSTB 1FZOB 3L5IA 4UU9B 5E5RB 3VDBA 4PJAA 1FJ1B 2NZ9D 1XF3B 4NZRL 3VFVB 1NEZB 1HHIA 2R0LH 4XP6L 4ODHH 4KVCH 4QY8B 4G8FB 1YEKL 3TBSB 3JTSB 2E27H 43C9A 3BHBA 1NDGA 3QEQE 4MJ6A 4ZXBC 1QRKA 3CFBA 3CLFL 2ORBH 4FXGA 1UACH 1JF5A 3IS0X 5TF1H 3CAFA 1FVDA 3FT3A 1MCLA 1F3DJ 4UT7L 3MV7E 2HT3C 4NM4H 3UPRA 3DHJA 4M5YH 3G6JB 1XGYL 1CWVA 2XN9D 4M02A 4AT6B 4RIRA 1BIHA 3M1BA 5JW4R 1RUAL 4GXUM 1NBVL 1QUNA 1ZTXH 5IMLA 1NMBL 1U3HB 5T1LD 3O2DA 1Q0YL 4QRSA 2XG4A 2D7TH 4QXUH 1OAKL 4JFFA 1TDQA 4XCYB 3L5JA 4OLVL 4XNMB 4M1DL 4Z7WE 2F53D 1RV6X 3R06B 5JPNB 2IH3A 2PO6D 3ARSA 2CKBH 4CN6A 3UBXB 4N8VB 4K9EL 1P7QA 1OAYL 4I0PA 1UWEL 3GMMA 5JUEL 4S1DD 1ZE3C 3UPAA 5J6HA 1MFEH 1OCWL 4OGXH 5ANMA 1UVQB 1OGTB 4Y1AE 3QUKA 1MHPH 4XMPH 3CDCA 2DD8H 3SGJC 3MLVH 1DDHB 1OP5K 3TVMA 1E27B 4PJBB 1YMME 4WU5A 1IGFH 1A6VH 3V0VB 4JGUA 4J4PC 1K4CB 3Q5TA 5D5MA 2P8PA 5HVHB 1ZLUK 3UYPA 4H8WC 4HUWB 1PEZA 2R2CA 1EXUA 1E28A 4LSSH 3I3DA 4RGMC 4UT6L 2CIKA 3QCTH 5KG9B 1MJ7L 1UA6L 3IF1A 1RJLA 4MGXA 4WEMB 5T3ZH 4MCYB 5MENB 2MWCA 4OZHB 4CMHC 1WF5A 1BFTA 3CXDH 5EO0A 4QRQA 1NSNL 4I3RL 4G6MH 3ECBB 1G7QA 3GIVB 3LPFA 4XWOC 1B0GA 5DMGC 5KBNC 3PDOB 2Y36H 4Z8FH 1NCTA 3FO0L 2YPKA 4HK0A 4CAGA 3V6ZA 4I18A 1FBIH 2EDFA 1N5YL 3PIQB 1DJSA 1TENA 1XR8B 1A0QH 2AXFA 3V4UL 1UFUA 4YWGH 3G08B 1CLZL 4FRWA 4MA8L 1KB9J 1MVFA 5EO1A 2E7LC 3OR6B 3UJTH 5TDPA 2LAAA 1KIRB 1ADQH 2PTVA 3N1QC 4JPKH 1RZJH 4YE4L 1MAJA 4NZDA 4HKXA 4HUUB 4DK6A 4Y8DC 4TSCL 2AEWA 4PJEB 5ERWA 4AH2B 3BKJH 4P5KB 1D3CA 3ZL4L 3MLUL 4P4KA 1OAZH 5HVWA 3LN4A 5T3XD 3QG6B 4JO1H 4NQDE 4JRYE 4AJ0A 3FT4B 4TTGA 2GCYB 4Y4KC 2R2HB 2F53A 3U0TB 1ES0A 5JW3L 5DQ9A 3Q6GL 2NY2B 3EJZC 3WNMA 3NBNA 1QNZL 1DVFA 2H9GA 4L4JA 1L6XA 1A3RH 1SYSB 4R4NC 3WUWG 3IFOA 3RWGB 3EO0A 1YEDB 1ZSDB 2ID5A 1NUFA 1CFTA 2XN9E 4Y5XB 4ODWA 4XXCA 2WSKA 3GSVB 3NFSH 4F33B 4G8IA 4N9OB 1M7IB 4F7TA 5FB8A 3QHZH 1SEBB 2VLKB 2X4UB 1AQDA 3MRNB 3E6FA 3L7EA 1MRFH 5DJZB 3FONA 5J11C 3LS5L 1LO3L 2X10A 4PYGA 5KZCB 1RHHB 2DM3A 2P46B 5EIIB 4LSUH 1UWEH 1EHXA 4EDWH 4BSJA 1RZGB 1DVFD 1JN6A 3RY5A 3LD8C 1C1EH 3B5TA 3KLSA 1H15B 2VC2H 3H3PL 1JRHH 3WE6A 1BREA 1K6QH 1RUKL 1LO0H 2P7TA 4N0CD 3ARDA 2VSCA 2FLBT 4OQTH 4XTRD 1G9MH 2H8PA 5EU6B 4DQOH 4CDHA 1I1FB 4QOKA 4NQDD 5JHDA 2VDRL 2DDQH 2H26B 2VDKH 3CFJB 4MVBC 5T3XE 3DIFB 3QFJA 5DEGA 1VEMA 3D69A 3QCTL 4TPRL 2PXYA 1OGAB 4KDVA 3IVKA 3C6LC 1PLGL 3KS0H 4JJ5A 1NBQA 3U9PL 1HI6B 1F11A 3Q1SH 1OPGH 4FQ2H 3H0TB 2YD9A 3MRQA 4WFFD 1CQKA 3MO1B 3V0WL 5I1IH 1FL6B 5I8EB 4DZ8A 1CDBA 1Q8MA 5SWSD 3MV7A 3G08A 4RDQF 2A83A 2DQTL 4OFDA 4U31A 3RX5A 2AJSL 4X6FA 5BQ7A 2J3SA 3OKDB 4Z0XB 3V5KB 4FFWC 1IL1B 4DGYH 3SDXE 3IGAB 3PABB 4P23B 3QFJD 1FZMB 5HGAA 5KN5A 3LS4L 3LQAH 3MLTA 4MA8H 4UMGA 4R0LA 1CDUA 1II4E 2P1YA 1I7RB 3KLAB 4KKBC 2X4PB 3IJYB 4KI5D 2AJXH 2XWJA 5J1SC 2BHUA 2BC4B 4O4YL 1NCBL 4MJID 1YDPA 3DXAD 2D4DA 1CFVH 5SV3A 4HG4K 1QP1A 4BZ2H 3HRPA 5CD5D 3T0BA 2JJVA 2DKMA 4P5TC 2DLTA 2W65B 3CC5A 4TRPH 1J0HA 4N68A 1NLBL 1NCWH 2BNQE 2QBWA 4PRPD 4R97B 1OD7A 4MQXD 4Y5VC 3MRHA 5IVZB 2NLJA 3LPGA 3NIDF 3U7WL 5F3HB 4HK0B 1T1WA 1CLCA 3HMXH 3MRMA 1ED3B 2CLRB 5MP6L 4P23D 4Y1AD 1YPZB 4M9OA 3U4BH 1S5HB 2HT2D 3VWJD 4K94C 3VFSB 5ID0A 1I1AB 4NN7C 1T7XA 4U05A 4Y5YB 4DKFH 1BLNB 1A7OL 3PP3H 4PJAE 1I9IL 4TUJA 3V4PL 3PGFH 4N8CH 5B3JF 4HLJA 4I4WA 3UTZB 1HHKA 3MYJB 4Y4FB 4A6YB 2AS5M 3H9SD 4YZFF 4MMZC 3X17A 1IRAY 3SGDH 3VXOA 1CR9H 1CYGA 2ZCLL 4OLZH 4CVXA 4RGOL 5AG8A 2XA8L 3ES6A 2V6HA 1DQLL 3D3VB 3S3JA 1M7XA 1XIWC 4LVEA 3F7RA 5FV2A 5FGBA 3PQYA 1LO4L 5HBBA 3HUJB 3LQZB 3EGSA 3ZE2F 5MI0C 2YBRB 3IFNL 3PWUB 4HV8A 1JPSH 4Z5RB 5CLTA 2J5LB 1DTUA 5MHSD 5TFSH 2K9UA 5L8LB 4NQVB 4DQOL 4KJQD 4JN2B 5T3ZE 2FBJH 4RGMB 4D9LL 1IVLA 2OTWB 4GUPB 4LDLB 3W0WB 4YZFE 2NY1C 1XZ0A 1SBSL 5E99H 1KCLA 4G6AD 3AMKA 1QQDA 5KANG 1MNUL 3ULUC 3L95A 3W81A 4PJAF 4KZDL 3T77A 4G80B 1OWRM 5I1JL 2WP3O 4Q7DA 4L8SC 4MMXC 3SDAD 4V1DE 3OKDA 2YXMA 3O6FC 2ADJB 2KQNA 4PJ5E 5I1AB 1S7UA 3AFLA 4HHAA 1AE6L 4U0RB 4F7CB 4HWEH 4KPHH 4WI2A 3IDYC 5D7JB 3U4EB 3STZA 4PJIB 3DLQR 3VXOB 4Y16C 4YXHH 4S1RH 4ZNEE 1ZVHA 2I26N 4TULH 4WHTB 3B5GA 3T08A 3HE7B 3MRDA 5HHPA 1XGYH 3DWTA 3IDNB 1DBAH 4X6EB 3IDUA 3SDDC 3LV3B 5CZXD 5BOPA 1E4WL 4FG6C 5DJ0A 3PWLB 3BO8B 1FZJA 1D6EB 1E27A 3ROLB 4OKVB 3CJJA 3NPSC 3R8BB 1I7ZA 4BFGA 3LHPH 3QHTC 1TETH 1LO5A 3CFKA 4I2XA 5F7DB 5MERB 2AEQH 3RBGA 2W0PA 4R8WH 4YAQA 3OJ2C 4PREB 3QRGH 1CF8H 1JNHA 1KJ2A 1CL7H 1IQWL 4NQED 5IQ9B 5HYJA 3BZEB 1KXVC 2HVKB 1F58L 1MCHA 1PSKL 1K5NA 4P57B 1MI5E 5JUEH 2HP4A 2DWEB 1KGCE 2YUWA 5B8CA 3VFNA 3BIBX 1IZKA 1M7IA 5EUOA 3VXQB 3TPUA 1ZLWK 2F8OA 1SY6L 4P9HC 3MO1A 3RKDD 1L7IH 5F1OB 5E6IA 5KJRL 1NAKH 4KROC 4JANA 3A67H 5EH1A 4ONOA 1VFBB 1RZKH 2XWBB 4FP8L 5IK3B 2ZUTA 4Z5RA 3OMZA 4EVNB 1ZHLA 3I3EA 2BVQA 3L6FA 1NJ9B 1T22A 4P2QA 4NQEB 3PWVA 4J3UA 4M7ZC 5EBLA 3WLWC 2GK2A 2NY6C 4P5KA 4B50A 4I77H 3FFDA 4PJFE 1B0RA 2KL6A 4HF5L 5EU5A 3HRZB 3TH2T 3C2AH 3ARWA 4P2OB 4RFOL 3FO9A 5CJXA 2A77L 4ALAL 5JHDB 2FO1A 3QUXC 3KYKH 2VITB 4QWWC 4R96A 1GZQA 2VZ1A 2A38A 5DEFB 1KV3A 3I85A 1IGYB 5CUSL 3GJFK 4KROD 5AUMA 4TVSa 3IDMB 3CFEA 4HLZG 4JPIA 3P73B 3MRRA 3KPPA 2W9LA 4XP9H 4WWKD 4EQ2A 5KSBB 3SDCC 2Y06L 3L7FA 1FVEB 5DMJB 3MV8B 4PRDA 1F3RB 4LQFL 4NN6C 1TFHA 3MXWL 4P2OA 1F11B 3FRPA 3LRGA 3O4LB 3RIAF 3AXLB 4LSRH 1CG9A 4K71C 3EUUA 4P2CG 3MJ8B 1Q94B 3MGOB 4MNHA 1RFDH 2FX8H 5HYSG 5J1AA 1XCQA 3CFEB 5FOBA 1NBVH 4ESKA 4AMKH 1G6RH 5DJ0B 2BVOB 1FFNA 4FQCL 1IAIL 2FR4B 3VGAC 1JMXA 3E6HB 1KCRL 2VXTH 5JXED 1KEGL 1D5BA 4ZPTB 1AH1A 3IFOB 4HCRL 1ZT1A 4I8DA 4YHYC 4XVSH 4Z7OF 3DYPA 4IS6B 5GS0L 4MHHG 1I1RA 3SDDA 2FIRT 2X4PA 3H9SE 1W0YT 3U30B 1HIML 2I60L 4PUBH 1IEBA 3P77A 3TJEH 4LHJB 4E41E 5JOEA 3SDXB 5F96H 3C8DA 3LH2L 1T2QL 2J8UB 4NUJA 3L3DB 1A1MB 5B38A 3ARDC 4CGTA 1DLHB 1X4ZA 4HC1L 1U8KB 3PXHA 4M8VA 3ZSSA 5FDWB 4G8GD 5EWIL 5IWLC 1C7TA 3B2VL 4JFYA 1QHOA 4P9HL 5HHMB 1FL6A 3WFHA 4U0RC 4L1DA 2DI7A 5I1LB 4Y4FC 2G2RA 4F9PC 2APVA 2I24N 1WC7B 1NH6A 3T77B 2AK4E 3BZ4B 1WZ1H 4QRRD 5DTFA 2F8XC 3DROA 4GFTB 4LCCC 4NUGL 1RAMA 4J6RH 1AQKL 3RKDC 3ZDYF 5KVDH 5BVPL 3OGCB 3NFNA 3PDOA 5IT2H 4YX2L 5CEZE 2VN4A 1WBYA 1PW3A 1P9MA 4TPRH 5CD3A 1BIIA 5CIPH 1AGBB 3HI5H 1S78C 4CVWA 5CJQL 3QISA 3PGCB 3GSUB 2Q8BL 2XQBH 2A6IB 4ODTH 4TSBL 3QUYA 2J2ZA 4ONGL 1YEEL 3LKOB 4FZEL 2YBRA 4RRPG 2A6JB 4F9PA 2JK5A 4LFHD 5JOFA 5CEXA 1MRCL 4X6BB 4WUUE 2EYSB 3T3ME 1JYVA 1QBLH 4X80H 2AABL 4WI4A 1I1AA 3IJYA 1KN2L 2Q7NA 2CMRL 2Y9RT 2R39A 2ZUQC 5I18H 4K7PL 4XXCC 3DETC 4GSDH 3FOMA 1X6NA 1U0QA 2DQFA 4MAYC 3TIEB 4FFZL 4AEIH 1NCUA 1ZGLP 2HRPH 5IMKB 4I5BB 4K8RD 2E7HA 4ZOEA 2BRRH 2A9NH 2ZOKB 3FO1B 3UO1L 2DQIL 2R4RL 5EZIH 5GISH 2EIZA 1EGJL 4HWBH 4OZFG 2SEBB 1P4LB 1VGEL 3HE7A 4YC2C 3GK8L 4I13B 4WFHE 1ZEAL 5E56A 4UTBH 1JI1A 1MAKA 3RGVC 2XTJC 2FGWL 3BQUD 4OIIL 4ZFGL 2IPKB 1QLEH 3DI2B 1V3LA 1BBJA 1U42A 4CVZB 1N0LA 2VLJD 3VRIA 2OX5A 2AJZB 2VLRB 3TWCL 1AIFB 2EO1A 5BZDB 1MF2H 1DLFH 3KPMA 1M71B 5HGGS 1NBYB 3BX7C 1J9CT 5GS1C 2JTDA 3OJVC 4Y4HB 2I9LB 2XXCB 4OLZL 3QFJE 4JM2A 2FX7L 4S2SA 2DTMH 1PY9A 2AAVA 4HUMB 1J0IA 4JHZA 2FECI 3SKOB 1PKOA 1S5IL 5ID1B 4YGVA 2RIKA 4XXDB 4UNTA 2V17H 5C7XH 2F19H 4GH7B 3PL6C 1NGPH 3DMMC 4WRLA 4NFCA 2CR3A 3EYSH 3IDMA 3HE7C 1YYLL 5IHZA 1FZOA 1IC4H 1LO2H 5C0AB 1HDMB 1ZVSB 1AI1L 2GTWB 5FUZH 3SKMB 1TNMA 4YFEA 1G7HA 1MQKH 4YH6A 3QEHB 4JDVB 4RZCB 3HZVA 3O9WD 4PB0H 4KDTC 5I17B 4OM0H 4QRPB 3SDXA 4MNQB 4Z7NE 3GSUA 2UVFA 1IGCL 4YXKL 1W0VA 4NKOA 1PG7L 2VAJA 4LCIH 1LP9B 4QWWD 2DQTH 3MRIB 1HE7A 2R23A 4PR5B 4NFBA 1LDSA 6FABL 2DQCH 4LLQB 1RMFL 1S9YB 3VD3A 5FK9A 3NABL 3TP4A 1TVDA 1V3JA 2FWOA 2FR4A 5DUML 1IE5A 3GMNA 4ONGH 3IFPA 2OR9L 5TQ2H 3F7PC 2HT3D 4OLWL 3RVTD 1X44A 2XZAL 1FO0B 1XGPB 3I3BA 3O3DB 5DRWA 3WNKA 1EBPA 1S9VB 5ADOH 3MJ7A 4M7KL 4WV1C 4NQXA 4CBPA 3S6CA 3C08L 5L2KB 2NYYC 4A2MA 4C58B 4H25A 2HH0H 1RJZB 3N1GC 3TNMA 5GIRA 2Z91B 4I4WB 3UTZA 2RAMA 2OJEA 2FHCA 4KDTA 4M3JA 5I74B 5I18L 3MR9A 2WLYA 4PJCA 3U2SB 4CKVX 5CWSA 1OAKH 2O61A 3BDYL 4LVOC 1E4JA 2WBJC 2BFVL 5DMKA 5EOQH 3L3OA 1MCDA 3D39E 4I18B 3OZ9L 5DYOB 4QOKE 4PJ8C 3SY0B 2BRRL 4FS0A 2R29H 2OYPA 1S9WB 3O8XC 2FGZA 1Q9KA 1HHJA 3RWEA 2EC9U 1VA9A 4K3EH 2OSLA 1UYWL 2AK4A 3NA4A 1ZGLM 2FJHA 1I9IH 4N9GA 2W65A 4UB0H 1AFVH 3MROA 2IEPA 1GGCH 3JV4B 3OHXA 4APQB 3EBAA 4WV1A 3IDGB 3BH9B 3GRWL 3QBTB 4NNPH 3T0EB 5FOJA 1Z9SA 1OAUL 4F2MA 1JUFB 1DBKL 1W72B 4U1MB 3ARDB 5HDOA 5GRYA 1DN2A 5F44A 5B39A 3KPLA 3TBWB 1ZS8A 5C0DA 5EB9A 5E4IA 1JGDB 1I8MB 3V8CA 5L2KA 1M6OA 4G3YL 2QADB 3D39B 5DJCB 3ALPA 3O11A 5J3HD 3VXUA 1MVUB 3GDBA 5T33H 4JKLA 1DEEB 3QUZC 1QLRB 3BWAA 1WAAF 5C6TL 2C3VA 4X7EC 1QR4A 1C5DB 3NZHL 3OPZH 2BOBB 2NY2C 1UB5B 4F37K 1YEKH 1NC4B 4N8PA 4K3DL 4BFEA 3JTTA 3WJLA 3HRZA 3U7AA 3RWCA 1CGYA 1YYMH 3MNZB 4WW2C 5D4QA 3RWEB 1KSRA 3DVNA 3GBML 4XPGL 1JN6B 4JN1L 1KJ3L 5DGQA 1BVKA 2WUCL 2Y72A 3B3IB 3P73A 4JM2C 3PP4H 4PB9L 4QRUB 1FG9C 4JKPH 4KJPC 3V52H 4Z7VF 1RZ7H 2D03H 5BOZG 1I9JL 1TQBB 2W0FA 1CXKA 3K46A 4QHKJ 4QXGL 3KLHC 3O2WL 1AXTH 2JJSA 2HVKA 3D18B 1Y0LB 3KLDA 4GKSA 4NOFA 4M00A 2AQ3A 1UM5L 4FMKA 1KJMB 3QDJA 1ZSDA 2VNCA 1BVLA 2PXYB 1MEXL 3PDGA 3TT3H 3IDXL 5CWSB 3NCYS 4EN3A 2F54A 4OLUL 3B2UC 1BVZA 3RUGE 1F4WL 4HKZA 5EO9B 1QSZA 2F8VA 3PL6B 1XF3A 4MJ5B 2QL1A 2NY5L 5JA9A 4W4OA 3MODL 3RY4A 1QLFB 5INCB 3QDMB 1T3FA 1IFHH 3ZKND 2AJUL 1A47A 4I3GA 3B6SA 1UCTA 5DD3L 4UQ2B 2D7PA 3MBEC 3P3YA 2H6PB 1O7SA 1BZ9B 3TBTB 2HLFC 3QXVA 2F5AL 3PWVB 1S7XB 3HUJE 1ACYH 1QBML 4XWGL 4DEPB 3HAEB 1TCMA 4D94A 3EYQD 2F58L 2DBLH 1LEKA 3WFDH 2MQ0A 5DJ8A 2V2WA 2J5LC 1KPRA 3VXMB 5IEKB 2IPKA 3W2DH 4WUUA 3PIQA 3MLRL 1I7UA 1T5XB 4OT1H 1KXTB 3V6FA 3X12B 4PJ7F 4JLRB 5I76B 3IU3A 4L9LC 5I75B 3DMMD 1GZPA 2BSED 2WK2A 5EUOF 1JJUA 3UTTE 4U3XA 2XI9A 3QB7C 2VXUH 4YDIL 1SJEB 2ZNXA 1F2QA 4ZUWA 3BZFB 4H20L 1NLDH 4N8VA 4UU9A 5D2LE 3OKLA 4ZSOB 1ZA6A 1A4KB 4XPBL 4AL8H 2V7HB 4EKXA 3QXUA 4JLRA 5I76A 4U1IA 2YRPA 5M7QA 2RFXB 3O6LH 2YN3A 2ADIB 1QYGL 2DQDL 3C60A 1OGAA 3IVKB 4TSCH 3S3PA 3OAZH 2E9BA 4EIZC 1D5BB 4ZPTA 4PRIA 1FVCB 1IGTB 2A6JA 2ZG2A 4H1LA 2ARWA 5D5MB 4LSTL 4L4VA 4U6YB 2B39A 1OHQA 4Y19D 5EN2A 1I7TA 1XEDA 2H3NA 1KLFA 5EUKB 3QIUC 4ODBD 5IJKC 5DURD 2PO6B 4JZOB 2K3TA 2BY0A 5GZND 2D03L 1CDIA 3U0PA 4JHWH 3ZKNC 3TESA 1ZWIA 3RDTB 4S0SD 1NCWL 1J11A 2M26A 3MXVH 2DICA 5IBLD 5A2JH 1IAIH 2V5SA 1PX4A 2BOBA 1AC0A 25C8H 4LMQI 4RMWA 3QCVH 4LHUD 1S7WA 4LBEA 5FYKD 2H3NB 3NTCH 3I9GH 4YIQB 3RIAK 3MUGB 5CP7B 1HNFA 3TJHD 3MACH 1HIMH 1X5KA 2I60H 3BZ4A 4XBEH 3GMOA 4IRSC 1Q0XL 2EEAA 2GSIA 4DVRL 4MWFA 3S96A 4OIIH 5B22A 1YNTB 1G6RB 3ARGD 4AG4H 1CFQB 3FMGH 5IVXB 4MX7B 3O45A 2BDNL 4WW2A 5GZNC 5IVXF 1RUPH 2FYYA 4P0DA 1HK6A 2WWKO 4MDJB 4CW1B 3BWUC 2OR8A 4U3HA 3OJMB 35C8L 4L3CA 5CMAB 3F7VB 1NGZA 1MSPA 4MSWB 5C0BE 4P4KD 1INDH 2D0FA 1BVLB 3MLZL 2R56H 2XOTA 3RRQA 3IFNH 5J89A 4YHZL 1EAPB 5E2WL 4C83A 4NWTH 2D7QA 4QRRA 4OD3H 1FZMA 5HGAB 4TOYH 3MRKB 4R7DA 5I1DA 4RNRA 4LRIA 4W4OC 5ICXB 4NC2B 2YUVA 1T1ZB 3H42H 4GRLB 5E8PA 2X4TA 3X13A 3QI9B 2UVEA 4PJXF 1BFVH 4Q9RL 4O00A 4YHNB 1K3ZA 2FNBA 1W72A 1DQQB 1XR8A 2MKLC 4R4FH 4NNYA 3ARPA 3OR7A 3QUYB 4Z9KB 4MB4A 3JUYA 5DJCA 3STBA 2BNQD 5DK3A 4POZC 2Q3ZA 4R26L 4KHXH 4XNQA 1KJMA 4QHLA 2QSTA 2XKSA 5CSBA 2DM7A 1TCRB 4JY4A 1S7TB 4EUPG 2Y5EA 5F7YC 4XPHH 3MFFA 4PGBA 2EE9A 5FEBA 1TZGH 2X41A 4OKDA 1PD6A 1AP2A 3PNWB 1BZ7A 1RMFH 3RUGB 3FCTA 1FORH 4X7SL 4CU6A 1FLTX 3MBEA 1CICD 4O2CB 5FCUL 5DK0A 3T0WA 5JXEA 4KVNH 3ILPB 4OLWH 2HA1A 1BM3L 2Z35A 2OSLB 3TT1H 5AZEL 2GJJA 3G5ZA 3MNVA 2E6PA 3VFOA 3GI9H 4Z7UB 2R0KH 2VDNH 2ITCA 1VEPA 2AK1H 2VZOA 1FNHA 3E6HA 4GMSL 3BMWA 3EKCA 4PJCF 2ZUYA 3X3GH 1B90A 4DN3H 2P24B 4BFIB 1WBXA 1QEWA 4XCCL 4ZOAA 3SE9H 3LKSB 3WUWA 4L9LB 4R8WL 2IANA 2QTEA 1MCQA 1ZA3B 3GHBH 2DRUA 5TH2A 5GQBA 4NUJB 2X5PA 3O3BB 3WIFB 5E8EB 3E8UH 1RULH 1FL3B 2BX5A 5CIPB 1M1SA 3RFZC 2EEDA 5EU6D 4NZUL 4KKAC 3VXQA 5DZOA 1F3JB 3BP4B 2YK1H 1FSKB 3CZJA 1KGCD 5E1AB 5DT1H 4TTDD 2X9YA 1HXYA 2R8SL 1Y18B 4GOSA 1EZVY 1UB5A 4NM8L 2R1WB 3S4SG 3UJJH 5I17A 2C3GA 2XTLA 3INUL 4HIJA 3TH4T 1IZJA 3THMH 3NPSB 4EN3C 3BE1H 1T80A 5HYJB 1Q94A 3T4YA 1MI5D 1N3NA 5HVHC 1BZ9A 3TBTA 1UCBL 3ZO0A 5F7WC 4AIZB 3UTQB 4KHTH 4BQBA 3CVIL 5DRNA 1P2CB 2R56L 1T4KA 2DF3A 4OFYA 1MNUH 1Q38A 2ICWI 5TE4H 3ULSB 4PYHA 5I15L 1VB9A 1VHPA 3G6JF 4GBXA 2WBJA 5T5FH 1IGYA 1ZT4A 2YC1A 5IQ7L 3NZHH 1UXSB 1GGIL 1KYOJ 3DHMA 5I19H 1K8IA 4YR6B 1U8OB 3KPOB 4ZDHB 3UAJD 1WJ3A 2A9ML 5F9JA 4R4ND 1X6LA 3MFFB 5DA0B 3T8XA 2DIAA 5IB1B 4BFBD 4QNPE 1JTTA 4RSVA 5FV1L 5IB4B 2OR9H 1NGZB 1G7JB 1CGSH 4HS8H 4MCZB 4Z7WA 5GJTL 4LDOB 3ROLA 2YMXL 3ZKXB 4C4KT 2EIBA 3MXWH 2CIKB 4UINH 3BH8B 2IGFH 3OQ3B 4M6OH 3BPLB 3HLAA 1QG3A 3QG6A 5B21A 4LOUC 3P2TA 4OZFB 2XG5A 1DQJA 1YJDC 3HCVB 4X7TA 5ESAB 2WWMD 5CEZH 2ED7A 3ULVE 4M1CD 3MR9B 2X1PA 3VWJC 3HC3H 4OD1L 3JVGC 4QEGA 1KTDA 3MUZ1 5GSVA 2VISA 3SDAB 5FUOL 4LPCA 4OZGF 2R0KL 2VDNL 4WEBL 5KOMC 3CU1A 5E8DL 4MXVE 3MJGX 1KJ2H 3VG9C 3RY6C 5A2FA 2ESVD 3U6RA 2R29L 3F7VA 3MMEA 1P4IL 3SPVA 1ND0A 5E8OA 1FAKT 4EDWL 3VMNA 3HS0A 1D5IH 5DRXB 1YMHB 3U0WH 3TEUA 4OZIF 4X4ME 4CADA 2WV3A 3MCLH 4OZHF 5H2BA 3MOAH 1KYOK 5DD5H 5KS9F 4E0RB 5J57B 2VISB 4UB0L 3RWJB 1NGYB 5D7JA 4NRXA 2HKHH 3C09B 3TVMB 1IAOB 4LPVA 1MUJB 1Y6MR 2FO4A 4X6DB 2CR6A 4NZUH 4HWNA 2Z93B 1ZS8B 2P5ED 3FFCB 5C92A 3ZYJA 4MZ2A 5C0JA 3GJFH 3EO9H 3OKOB 5C0FA 1FH5L 1B2WL 1LEKB 1CLOL 4GXVH 4KI5F 1CBVH 1EUTA 2ARJQ 3DGGB 3ULUD 3OGCA 1GOHA 4PJBE 3U9PH 1FVDB 3FT3B 1LK3H 1CE1H 5CP3A 1G9NC 1J1PL 3J8F7 4WW2F 5JW4M 3S98A 1SQ2N 4HJ0D 3C5ZD 4L8BB 3NH7H 4NKMB 2ZOLA 3OB0K 3IRZA 1H5BA 3SGJA 4JFZH 1NGQL 5GJSL 4PTUB 5TE7H 5D7JD 3EFDH 1QFUH 1EV2E 5EZLB 4JPKL 1RZJL 1T7WA 3LKQA 3P4NB 3DECA 5EIIA 1MHCB 3MRBB 4X99B 2A83B 2EXYC 1AXIB 4ZTPL 1R5WA 3ZYOA 3B9DA 3MGOA 2GK0B 2JF1A 4L29B 4MNHB 2VDOL 1RVFH 1CXHA 2XZCH 4QRTA 5IROA 1RK1A 4O4YH 5C0EB 2V2TA 3SCMD 5D6CA 3TO4C 1LNUB 2UWEF 1NCCH 1SMOA 1CD8A 1NCDH 3RTQA 1F6FB 5D2NB 4QLRA 1Z6JT 4JFEB 5IMKA 3F7QA 5C86A 1MCOL 5DZLA 1HZHL 3RP1A 2YZ8A 3MUHL 5IFHH 3V6OE 3TT3L 3QUZD 1DUZB 1TVBB 3LZFL 5INDA 5DUPH 4GG6B 2HTLC 3U4BL 3C5SA 3QQ3B 4MQ7A 1IQDB 2AEPL 3BI9X 1FG2B 3BXNB 1PZUB 1QR1A 2OXHA 4PLKD 4IRJA 4QRPA 3KDMB 4EN3D 2EDRA 3SPVB 3D25A 2W0FB 2HFGH 4FQ1L 4GAJL 4LIQH 3QZWA 1HYSC 4TN9A 2Q76B 3LKRA 2VC2L 4DOHB 4MS8C 4YEEA 5E6IC 1OGAD 3FO2A 4RFEA 4Z7QF 2UV3A 1I7RA 1O7VA 5JXAH 4XCFH 1QVOA 2XA8H 4G9FA 4CL7A 3BEVB 4OQTL 1T4KB 1JHTB 1YQVH 2Q3AA 4Y7MA 4PRDB 4PJHF 2R69L 5HI4C 3LB6D 4Z7VA 4WU7B 2IBGA 4P9MH 5C0DB 2PW1B 2RBLA 4ZAKC 4F7MA 4L8CA 3RNQB 3RZWA 1Y6KR 5FGSA 1EBAA 2BNRE 2DQEL 4KUCD 2DJUA 4F58L 1RD6A 5AYUH 5SX4I 1SBSH 5E99L 3VFWB 5JPMA 1XF2B 1DQDH 1LK3L 4JVUA 4PB0L 3PHQB 4G6FD 4M62L 2XQBL 2FIKB 4ODTL 1S3KH 2PCPB 2R9HC 3SJVD 1PYWA 4G8GB 2HLAA 3FOLA 1EVTC 1Y6NR 4WDIB 4IJ3C 5E0QA 5BCAA 2IALA 3VXSB 3D2UA 5CJOH 4P3DA 4KHXL 4F7TB 4NBXB 3PWPB 4QRRE 4NJAL 3KJ6H 4G9FB 4QGTA 1NL0L 1MPAH 1AGDA 1G7MA 5F9WB 5DVOA 4BELD 4Y2DD 4DKAA 5ICYA 1FE8L 3BAEL 4PRAB 1I9EA 1C5BH 2PO6A 4JZOA 3BUYB 3ZE0F 5EULV 3TIDA 3WEXA 4PD4J 4U1LA 4ORGB 1VACB 2OTUA 3HMXL 4JFEA 1FGVH 1FNLA 2NX5D 4Y4FD 3I2CH 3LV3A 1EX0A 3W39A 5AZEH 5CLWA 1CXFA 2HMID 3QWRA 2CGRL 1D7FA 3MV9B 1DUZA 3MXVL 4PBXA 1BD2A 5DRZA 3UTSD 4AEEA 5DWUL 5ICYB 2BSSB 2O5YH 4PRHD 1U3HC 3QCVL 5IF0A 5C9KA 3EOTH 1KPVB 1U41A 2GCYA 5JO5B 2ZKHH 5K9OB 4H1LG 4M1GL 2IMMA 3C8HA 1U3HD 5I71B 1XF1A 3GHBL 3NIGF 4MQTB 4KK5D 3AREC 4PV9A 5BS0D 4QGYA 4WV1B 4YDKL 2Y5TA 5EFIB 5ETUB 1KCSL 3GSVA 5I1DB 2IQ9L 1T04B 4PGJA 4LHUG 3ES6B 5FKAA 3SO3B 4PJXA 3OKYA 3MBED 3TPUB 3LEVH 3X14A 2JJUA 2QHRL 3VFMB 2HKFH 3QDMD 1J12A 5TFSL 1T5XA 3PV7A 4GG8B 2LU4A 3O6ML 5CP7A 1YMHA 4F15C 4TVPH 3ARFD 4LSPL 1RQ5A 4CJ1A 1RHFA 1YEFH 3DX9B 5D2NE 6CGTA 2QJDA 4QTIH 4LAQL 4V1DA 1HHGB 2VOTA 5L9DL 4HIXH 4G9FE 3P4MB 3SEPA 1B0WA 5A3IC 5TDOA 4U1NB 3ECBA 2DQEH 4ZS7H 1EIBA 5I1JH 5D7IB 2RB8A 4KY1L 3GO1H 4JHAL 4OUUA 4PRNA 4DK3A 3L3HA 3BYYA 2DMBA 4JR9L 1MUJA 1YMMB 2VRAA 4YUEH 2VLJB 1OVZA 1PG7H 1AE6H 4HWEL 2OL3L 1FDLL 1T3FB 4E41D 4OCRH 2W0LA 3EOBA 1JZ3A 1NFDA 3QSKB 4HFUL 5IESL 4JDTH 1UB6A 4XB7A 4EXKA 1IJ9A 3QPQD 3ZL4H 4KJYB 5D7SH 1QFOA 4PJIF 4XH2A 4NC1E 5B4MD 2EXWC 4ODUA 5HHOB 5JXEC 3MFGB 2HTLD 2V2XB 4Z76A 2X1OA 4PRHE 4X4XA 4DW2H 4W6WB 2FCBA 1AGDB 1G7MB 2H1PL 1EUUA 3P0YL 3VWKA 1QFWM 4KTYA 4S1DC 1UQSB 3KXFA 1YECL 3KJ6L 3W82A 2H2PD 3IJSB 3OKKB 5E8OB 4OAWB 4GW5B 4C56D 3ARBD 3P0GB 3MCKA 1JPFB 2BVQB 4KJYA 2IGFL 1KG0A 3TYGH 3VXRB 2FEEI 3HCVA 5ESAA 1FYHB 1HHGA 5IHZB 4JHBA 5EBMB 3MV11 1HCFX 3WXWL 3PHSA 5DVMA 3LS5H 3WFCL 2XXMB 1K2DA 2BSSA 2EDWA 2BY1A 2D31B 3KAAA 1JGVH 2VZSA 1FL5A 4IS6A 1IM9A 2QHLA 1GGTA 2DS4A 5L8KB 5DJ6A 1CK0L 3WFBH 4Q97A 3CC5B 1H8OA 1KJVB 2E6QA 2G75B 4X98A 4NKQB 3KGRA 3NFNB 1JWUB 1P4IH 2EDDA 4PJ5A 3O2DH 3O3AB 1IKNA 4Y4KB 3R06A 4C56B 1LK2B 1FG2A 1G1CA 5C08E 1V7NL 4WUKL 1F45A 2C4XA 1G9NH 3MLSL 2HYMA 3QEGL 2XQYG 3ROOA 1ERNA 1QSFB 1JK8B 5DJ2A 5I75C 2G2RB 2RJMA 2B2XL 1TZHB 4YO0A 1BWMA 1ZHBA 5ABDE 1F2XK 2LABA 3BP6A 4UILH 2XTJE 4RFNB 1U6AL 1T1YB 4U1NA 1S7VB 1INQA 3OAYH 3RPIA 2R0ZH 4JO3H 5F88B 4YDLB 4LAQH 3TA3A 3KJ4C 4JY5L 4JO4H 4YDIH 3MV9E 3PQYD 2Q86B 4JFFE 1KELH 5HSFA 5CUSH 1BOYA 1S7QB 1FIGH 1QSEA 5BZWA 5LCVL 4MXWL 4PRBA 4AK1A 3STLB 1MH5A 1FNSH 1GAFH 4OLEA 3WD5H 1U8OA 3DETD 1S8DB 4F7PB 2YWZA 3FQWB 3HPJB 3QR2A 3NVQA 3H7BA 4F9LC 4PJGB 3QNXB 4X99A 1EVUA 3CZFB 4R2GD 3G5VA 4D3CL 4OCRL 4PJGF 5C71A 1OP3K 1P1ZA 4UZGA 3PP4L 4XMLH 4QHMA 3JWDL 1JGEA 4EIGB 1PDKA 1A6WL 1U8HA 5CSZA 5CZVL 3AB0C 2NXYC 2GHWB 2V2TB 4XBPA 3HR6A 2GTZA 4I1NB 1ONQA 4URTB 3VFTA 3IXAA 4HAGA 4FFZH 3LKRB 2J8UF 4X9HA 2OJZH 4LF3B 4Y8AA 5DLML 5L2JA 4P4RA 4HD9A 2FD6L 4HIHA 4HWBL 4R3SB 4GAGL 2FBOJ 1JZ5A 2KPNA 1JZ4A 5FM5M 3S3SA 1F42A 4OZFH 3NTCL 1EHLH 4KU1A 4PFEA 1WFNA 2BXZA 1A5FH 5F3BA 3GUTB 1WWCA 4OCWL 4YBHA 1F4XL 1SYVA 4ONHB 4LPTA 3M45A 1S7QA 3ZMRA 3QUMB 4NNXB 5EOTB 5C1MB 4UUJA 4EI5B 4OB5H 2VXSH 5J1TC 4W70A 1JV5A 2DQGL 5DD1L 4U1JA 4XGZB 3D39D 5KW9L 3D0VA 2O26U 4M8QA 5FYKE 1SEBA 5E24E 4KDWA 5C0JB 4P46A 2IG2L 3MA9H 1OTTD 3TPKA 4XAWL 3HTLX 2BJML 5IFJA 3DUSA 4Z7VB 2A6KA 3WNOA 3VRLE 3HAEG 5CD5C 4OTXH 2PYFB 3V7AG 1H3PL 4C83B 4XNYL 1OB1A 3GMOB 1RZGA 5FM8A 3G6DH 4KZEH 3MLZH 1EO8L 4NQSA 4GRMA 1IC4L 1LO2L 1MHEA 2YPVH 4D8PA 1IILE 5SWZD 5KTEH 5BRZB 2MTPA 1F90H 4WNQB 3GJFB 4KI5C 3UBXA 5D72L 2X4SA 5JW5A 1A6AB 5GZOD 1G0DA 4K94H 2WNGA 5AZ2L 3PV6B 1N6VA 2BC4A 4PRAA 5IBLC 1CGVA 5C0BD 2R2EA 1BD2E 5T1KA 3MBXL 3I02B 1RU9H 4WHCA 4UOW1 2DQJL 4PGDB 4X9GA 1JRHI 1T22B 1L7TH 1KN4H 1FCCA 4ZFFB 4FQXA 5HXMA 2FJGB 1JPTL 2V5MA 2YPLD 4ZPVA 4HDIB 2X89D 4YNYB 4KKLD 4XHJC 3MJ9L 3MRLB 1TZHA 4M61B 5EZOL 1A7RL 1X9QA 3AS3A 4HXAH 2DQHH 3SO5A 1EMTL 3CDFA 3F58L 1OAZL 3N85L 2EKSA 4K23L 4E41B 4HGKC 1N3NB 2WQ8A 3C6SA 1CTNA 4HUNB 4B53A 4PLKC 2CH8A 1AKJA 1HDMA 1ZVSA 2LAGB 1F00I 3DYMA 4WJ5B 2P42B 2AXFB 3BT2L 4P48A 4YHMH 1MREL 4AIOA 3DURB 1HILA 1A3LH 4AM0B 2V9RA 2BSTA 2YD3A 3V6OA 4MDIA 2Z31B 1IARB 4G9DB 3JV6A 1RY7B 5I8EA 4JE4B 3SE4A 3NFSL 1EGJA 3MRIA 3BRDA 4FQXC 3BKML 3HE6A 1Q9KB 1KCKA 3QULB 1U8QB 1OW0A 1U9KA 5ECJE 3OKNA 3SKNB 3KYAA 4U2ZA 3VWKC 4KXZH 4LASH 1DCLA 4LLWA 1QPXA 3QG7H 5DS8A 3DURA 4LSUL 1INQB 3RPIB 4EJ1C 4JPVL 3UTPE 2ZCKH 3VH8A 1RZKL 4KTEH 4JPWL 4L3EB 2AKRB 1SM3L 1T1ZA 5A2KH 1M05B 1XGTB 3H3PH 3SBWC 2PUQT 3BXNA 1QR1B 4HGWA 1DL7L 3LN9A 4WTZA 5ENWA 4ZAKA 5ID1A 1BOGA 1LD9B 3QUKB 2YD5A 1BFSA 4GRWF 4ZTOH 3VA2C 5ITFB 4JRXE 3X3FL 1I1CA 1J1XH 3VDCA 5KSUA 4HHAB 4E42B 4HH9B 3NFPB 4ELKA 5D93C 1GC1H 2I27N 4Y16D 3RWDB 4KZEL 3U36B 3ULSA 4TNWK 4XPTL 4NQEE 5EPMB 2ENSA 2X1XR 4MAYA 2QR0A 4ZO7A 3S97C 2B1AH 1FSKC 5C0RH 3FOMB 3V0WH 1MFCL 4NKOB 1JP5A 4HJGB 4JZJA 1CD0A 4U4BA 5GRZA 3WIHL 4XZUB 1ORSB 1FRGL 5I19L 1P5UA 4LLMA 2J1KA 5AD0A 4YJZL 1PAMA 4JZJC 2IC2A 4BQ6A 5KOVC 1WBYB 3W39B 1YEIH 4OGYL 2QADC 2Z93A 1BD2D 3H3BC 3GSNH 5E9DA 3SE8H 1BQHB 5ANME 2GW5A 1A02N 4OQ1A 2WIIA 4OGZA 3WIIH 4HBCH 3PF2A 4BM7A 1UM5H 3MJ8A 2ATPA 1C5CL 4D9QD 2OI9B 1U8MA 1IKNC 2R1YB 3TO4A 1FPTL 1RZ8A 3T09A 3N9GH 5GSVB 1YEHL 4XNUL 3VXME 1OP9A 1U3HA 1ZTXL 3O3AA 4N0FB 4WTXA 5EFIA 5ETUA 5L88L 4TRPL 4DN3L 4FNLH 1WEJH 2IFFL 5KAQF 4G6AC 4KMQA 1AHWC 1D6VH 1B4RA 3A6CL 1Q9OA 5ID0B 3LPWA 4RAVA 1TJIL 4PRHA 1NGWB 4N5ED 2CKBB 4DZ8B 5C9JA 1IAKA 1HXYB 4YHML 4NCDA 4HCRA 4HFWA 5IP4A 2YKLH 3C09C 2WWMC 1JGVL 3QULA 3OF6D 4PJ8B 1D5ZA 4NNPL 4P9HH 1XGRA 2K1MA 2VLLA 3HFMH 4OGXL 4JFDE 3FFDB 1YEGH 3V4PH 4WTWA 1FIEA 1MLCA 2DBLL 2APBA 1OSZB 3T0EA 1FNGA 3B5HA 3EDFA 2V5TA 1R0AL 1HHIB 3GMQB 5CILH 4NSKB 2Q6WB 1WBZA 1A6VL 1T2XA 1MFBH 3CH8A 2YD2A 5T1KB 1OF2A 3MRCB 4JPWH 4OF5A 4BYHA 3S34H 5FO7B 1KLGB 4K2UL 3ULUF 2GFBA 4HPYL 3IETB 1FNFA 2VKWA 3QUYD 2GUOA 4XH2B 4X5WA 2BVPB 1A7NH 5D9SB 5DUBB 4ZG1A 5LQBH 3KPPB 3B2UD 3BN9C 2CRZA 4LSVL 4U6YA 3SJVA 2DLFL 1MI5B 2FBJL 4D9LH 4JM4L 3GO1L 4JHAH 4L9LA 2E3VA 2ZUSA 3F8UB 1PYWB 4G8GA 4XP6H 1CZ8L 5TGBA 1MRDH 2C4FT 4CN4A 1UM6H 1PKQA 3DUSB 4JRXD 5IQ9A 4I0PC 3TNMB 1QYGH 5KVGH 3U7YL 5FO9B 4ELME 3VI4F 3EYFA 1A3QA 4N0UB 3SOBL 4P2OC 3NCEB 4TUOA 5TDOB 4JM2D 4GAFB 4I0PD 1RK0B 2UWEB 5BRZA 1CU4H 2ICWB 3TBVB 5DHVA 4Z0BL 5D2NA 1SEQL 3A0OA 3P0YH 4U1LB 1A6WH 4ODSL 4DUVA 1X5ZA 1C16A 3ARGA 2XWTB 2DLHA 3GZKA 1MWAA 1GPOH 2X4QA 4OD1H 1ONQB 4LLDB 3BQUA 5DHYA 5K33A 4AIZA 3FQUB 1AY1L 3GHEL 4HZLA 4N5UA 4R4BB 3HG1E 5D70H 3UTSE 3MV8A 4YPJA 2MKWA 3WN5B 2ADGB 2DIBA 3ARBA 5HVFB 1SYSA 1LK2A 3D0VB 3WO4B 4P4RB 5HGDB 1ULVA 3O3DA 4FTVA 1GSMA 1JUFA 1ZA6B 3FN3A 4HDIA 1JYNA 5SWSE 1D9KB 3VMOA 3DV6A 2APWA 4MLSA 5IR1B 2CD0A 1JVKA 4GAGH 4W6YB 4DJMA 2CK2A 3S88H 1EFXB 5IHUH 4DTGL 4U7SA 3U0WL 1UZ8A 3T1FA 3MOAL 4OCWH 5ADPH 4AH2A 2CXKA 2VDQH 4PJDF 4D0BB 2PR4L 3FN0L 1NC4A 2PO6C 1YQVL 5JW5B 3BEWA 4OCSH 4CMMA 5D1QC 1P4BH 4IJ3B 3OR7B 3MLSH 4H88L 3SCMA 1ADQA 4G42A 5HI3C 3EYSL 1TPXC 1VFBA 1DSFL 1LO0L 3I6LD 5DJXA 5DJ6B 4BK4A 4YHPA 2GY7B 3CLEH 4XHJD 5EZLA 1TCRA 4JY4B 2AV7B 3GMLB 5GS1B 4G6KH 1I7ZB 4OIBA 4DUXA 3BO8A 1EZVX 5GGTA 5CCKH 4P2RB 3HB3D 1JGEB 4HPYH 1DBML 3FL7A 3RVVD 3IJHB 1M05A 1XGTA 3MUGA 4Z7UE 4GRLA 5E8PB 1A7NL 3W11D 1KEML 4LLYA 4PJAB 1VFAB 2RHEA 4LRIC 3VH8B 3MMEB 3WJJA 4R96B 1MCKA 2JCCA 3FQWA 3HPJA 8CGTA 3T0AA 1XGQA 2X05A 5B8CC 1J87A 3PHOB 4GKNA 3H9SA 2IH1B 3QH3B 2A77H 3B9VA 4YFLF 4ZAKB 3UJIL 4ALAH 2FATL 1CXEA 3O8XD 4F8QA 1MRDL 2AJSH 1EEUA 2AJYH 5IVXA 4IMKC 3B9KA 5KS9B 4Z76B 3LQAL 3LS4H 3CFDA 3LKNB 3LN5B 3O9WB 5FGCB 4IMKA 1TLKA 4MS8D 4XMKH 5C0AE 3D9AH 1HSAB 3D48R 5FYJH 1BBJB 4CVZA 5GGTL 1CL7I 1MLBA 1FN4A 3GI9L 4JFXA 3BDYH 3NPZB 2MPAH 3DX8A 4ERSL 2ESVB 1MIEL 2IPTL 4QHNA 3RY6A 1SJHA 3F58H 3JWNC 2YA2A 3QEUA 3ARUA 4L8BA 4RFEB 4IDLA 1S78D 2AEPH 4YBQC 5IKCB 2DYPA 3P30L 4S1SL 4FMFA 2JJWA 1UYWH 3QNYA 5FHAL 4W68A 5ACLA 2J7LA 1EHLL 3P4NA 4DCQB 2LQRA 3ULVL 5F7EL 4BSVA 2FJHB 4N9GB 2NY2D 1A14L 3HZMA 1PZ5A 4U33A 3W9EA 1KTKE 2LTQC 4ZFZA 3S88L 1H8SA 3DSNA 2W60B 1I3RB 3E1F1 5GGSY 1HH6A 3ZE1E 1NGWA 1G6VK 1VADB 2ESVE 5ESQA 2VLKD 4RGOH 2QR0B 4EEEA 4PLNC 5LGHL 3DGCR 4HIJB 4XNZB 4H1LH 3NIFE 3BQUC 2Y07H 4GW5A 3PGDA 5DJDB 3NZ8B 4XNYH 2RFXA 1FYTD 1OOAA 3LEXB 3T0DA 3AM8A 3GSNA 3OPZL 3WE6B 1ZHKA 1PLGH 1DQDL 2QQKH 3AS0A 3STZB 4HLZH 3ZDZE 3TCLB 3ULUL 2XZQL 3DBXB 4DVBA 2I9LA 3ARDD 4GBXD 1AD0B 5GGVH 1S3KL 4GMTH 5C0GB 5HHQA 4PY7A 5C0CD 2EZ0D 1I75A 4JN1H 1YJDH 2A2QT 4M03A 5H35B 2Y6SD 3FQNB 3OAUH 1MCPH 3KPSA 4N0RA 1L0XA 5ELIA 1TZGL 2C9AA 3B8YA 2V9QA 1MCFA 4C57C 4KKAD 4U1KB 1JNLH 1KIQB 5E1AA 1XMWA 1I3UA 1D5XB 1CVSC 4BJLA 3M8OH 3ZLQC 3T2NL 3AS1A 1FE8H 4G42B 2DI8A 4XCEA 4G43B 2VMFA 1J8HD 4IRJD 1UZ6F 4LVOB 3ILPA 3MNWA 4HXAL 1KPVA 1GJIA 1S9YA 5D1QB 2VLLB 2P43B 1IGJB 4K7PH 3MRFB 5GSRB 5JMRA 4M1DH 2WW8A 1A7QL 3I84A 3RVTC 3HNSL 1QA9B 3BP7A 3O6KH 3MRLA 1N6QH 3KYNB 2XWTA 4M1GH 3DX6A 3ZKQD 4O58H 2IBZY 5HYFA 5HJ3B 5HD8C 3E6FB 4LQ1A 3PQYE 3CSPA 4K3JL 4M6ML 1NFDF 4HZLB 2EKSB 5E2UH 4E41A 1DZBA 1GH7A 3O11B 4GQPH 2CLRA 4RA3A 1OAQL 3U1SL 3WJJC 2X4QB 4NM8H 2DD8L 4WFED 4P3DB 4QRRB 1KUMA 3H0TA 3HN3A 2VKXA 1T1XA 1G7LA 2BVYA 3IB4A 3AS2A 4X6CE 5I1KH 1S9WA 1YPZF 1FH5H 3QFDB 3RVUD 3DOSA 1EFXA 3EOAB 4UDTA 2CDEB 1RUQL 5K93A 4ZO8A 4ZUSA 3KPQB 1KB9K 4J3OC 1A6ZA 3TIEA 1VACA 1LE9B 1RZIB 5FF6A 1VESA 1J1OH 2QSCL 5CEYB 2YZ1A 1I1AC 4D8PB 4ZTOL 4N0UA 4H20H 4BUHA 4PLJD 2OJEB 5IB2A 1R6VA 2QSQA 4YAQB 1U92B 2EC9T 1G7LB 4K2UH 4D0CA 1AR1C 2Q86A 3MOBH 3MRFA 3ARFB 4B7LA 5CBEA 1WC7A 5EBLB 1GGYA 4JY5H 3D3VD 3EYOB 1KC5L 5E5MA 2CO7B 3BGFB 1DBJL 1P4LA 2VXQH 1JGDA 1A0QL 4HS3B 4YHIA 4HXBH 3VI4E 4ELMF 1FNEA 5T5NF 4BSVB 1TXKA 2DLFH 1F97A 1HWHB 1UKQA 5GGRY 2OP4H 1AXSB 3ARVA 5GGUA 3TC9A 3O41B 3TNNB 3H3KA 1MJ8L 5IOPB 1KIPB 4R4BA 4HKJA 3QDME 4LEOA 3CMGA 4MNGA 1MFAL 1YEIL 4IOSD 2YD6A 3SDDB 2D7NA 4U1MA 2I9TB 3K1DA 4DZBB 3SE8L 2VIRA 2VLRD 2IMNA 3HZYB 5EO1B 4NT6A 4Z0BH 4TNWF 1KPUB 4FQLH 5IVNA 4DUWA 1OLZA 4OZGB 4PJEA 1ZANH 5KS9A 1DEDA 3L3HB 4U6HB 4KK5C 4GG6F 3SY0A 3JV6B 1IAKB 3FFCD 3LIZH 5HDQH 2Z8RA 4X6EA 4XVSL 5IW1A 3C60D 3PWUA 3NMEA 2WBKA 4DN4H 3WXVL 2VLMD 1JNNL 4LP5A 2X1QA 5F96L 4BKLA 4J3WA 1MLCB 5FDYA 4LVNC 5IGXL 1CTOA 4G5ZH 3O45B 4WW2B 4CUCA 4M6MH 3RJQB 1LWRA 1YEDA 3TCLA 3PHQA 4U6TA 5ADPL 4CVXB 2N1KA 5EU5B 1FYTE 1QFHA 1J8HA 1U2HA 3L5WB 4JAMB 5TPWL 4HGWB 4HT1H 3M1BB 1BX2B 5DJAB 3W9DB 2XYCA 1DR9A 2IPUK 3HC0A