2PP9A

Nitrate bound wild type oxidized afnir
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Conserved active site residues limit inhibition of a copper-containing nitrite reductase by small molecules.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 91
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp9A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp9A02
1JVOA 5PCYA 2BW4A 3GXUB 1AZRA 2Y1AA 6PAZA 3QJQB 2VMJA 1AG6A 3NJFA 1BQRA 1AS8A 2H5UA 3PAUA 1IC0A 3WG7B 5IY5B 4A67A 1NWPA 2IDQA 6PCYA 3AG2B 3WNJA 1NIFA 2PPEA 2DY2A 3UGEA 4AKOA 1BEXA 2CCWA 2PP9A 3FSAA 1E65A 1KDJA 2YAQA 3ABGA 3NSDA 1ZDSA 4BWTA 4E9XA 2HZHA 3FSWA 2VM3A 3N55A 2IDUA 3X1EA 3X2QB 2DYRB 2HXAA 2GC4C 2I7OA 2XX0A 2B3IA 1L9SA 1CC3A 3ZX1A 1B3IA 4DPAX 1NDTA 4BWUA 2VM4A 1WA1X 1NIBA 3UAEA 3WKQA 3CDZA 1J9TA 1PNDA 1NIEA 4EF3A 2IH9A 1AS6A 4HHWA 2GHZA 1N70A 1L9PA 2AVFA 4G72B 1QHQA 2YAMA 3JTBA 4YSTA 3FU7A 2QPDB 5F7BA 4JKNA 4ENZA 4A66A 3GYRA 3ABKB 4YL4A 1CUOA 1ASOA 3ASOB 3KW7A 1GY2A 2YQBA 2GI0A 1E5ZA 3ERXA 1EHKB 1ASQA 3C75A 4QKTA 3FQYA 3OMAB 1OCZB 3T6XA 1AG0A 2BP0A 1PLCA 3NP4A 3CDZB 2FWLB 1KGYE 3NSYA 4G7SB 4HIPA 1XB3A 3FU8A 4YSEA 1BYPA 2FQGA 5I6KA 1NTDA 2DV6A 1CURA 3AG4B 1ASPA 2HRGA 1HAWA 1KDIA 1V55B 3FU7B 4DPCX 3OMIB 3G5WA 1AIZA 3T71A 2IDFA 1OV8A 2DYSB 4N4YB 3S8GB 1NPJA 2YARA 1PZAA 3OQRA 1OCOB 4YSDA 3ZIYA 4DP8X 1AS7A 1GSKA 1BQKA 2TSBA 2ZWNA 2VW7A 3ABLB 3PPSA 4G71B 2BWIA 2BP0B 2H47C 2YAOA 3UABA 2BWDA 3H4FA 1ADWA 2XWZA 1GS8A 1N68A 1PNCA 3NJHA 1HFUA 4MFHA 5B7FA 3HB3B 4A2FA 1ET7A 2IWFA 4YSOA 3NJMA 1L9TA 3CVBA 4X4KA 4E9QA 1AZCA 3NP3A 3NJJA 2P80D 2BZCA 4WTQA 2AZUA 1ZDQA 1WA2X 4JHUA 1AZNA 2FT8A 2OJ1A 1FWXA 3X1BA 5I6LA 4W9ZA 2CBPA 5B7EA 1PY0A 1V10A 1UATA 3V9EA 1OOWA 1GW0A 3PCYA 2QDVA 1JERA 1NIDA 4WKXA 2B08A 5ANHA 1A65A 2EILB 1J5CA 2AFNA 1ZPUA 3NJNA 1TU2A 1PLBA 4TXVB 2YAHA 4M4RB 4F2FA 2FTAA 3FSZA 3UACA 4DP9X 3OD3A 1E30A 3FYEB 1YLBB 3NJGA 1NICA 1VLXA 3NSCA 5EHFA 5I28A 1TEFA 3ABMB 3NJIA 1M57B 3AG3B 1SHWA 3FU9A 2Y69B 4K9JA 4NAJA 4E9RA 1JZHA 2DWTA 3S3DB 3SBRA 2YXVA 3EHBB 1PZCA 3ZDWA 4KOCA 1OCRB 1AQ8A 2BW5A 4GXFA 1DYZA 1W6LA 5AZUA 1J9QA 3QJRB 4HAKA 2VSKB 2XXGA 1NZRA 2OV0A 4M3HA 3EH4B 1I53A 3S3BB 4E9WA 2XV3A 4BXVA 3X1NA 2IWEA 4AKPA 1SDDA 1JOIA 4KO6A 1IBZA 2PPFA 5B1JA 3EH3B 1XMEB 1JXDA 1ZIBA 2PCFA 4HCGA 4CSZA 1SFDA 1BXUA 1PLAA 2J5WA 1L9QA 4P5RA 3FS9A 1T5KA 1W6WA 4YVUA 3PAZA 3D12B 8PAZA 1R1CA 5D4HA 4P5SA 2IDSA 1L9RA 1BAWA 1ILSA 1XB6A 3N2JA 3IN0A 2BO0A 1MDAA 1OE2A 2HX7A 4NERA 1CYWA 2XV0A 4UF7C 2AANA 4E9VA 2XV2A 3NJLA 4A2GA 3TA4D 1SNRA 1QNIA 4KNUA 3DTUB 2EINB 1PMYA 1SHXA 1MZYA 2FQEA 2Q9OA 4BDVA 2ZONA 1SDDB 1WA0X 1PCSA 5A7EA 3OMNB 3T6WA 3DKHA 1A4CA 2VN3A 4FA7B 2QT6A 2BZ7A 1BQ5A 5I6OA 2CAKA 2FNWA 1JXFA 5PAZA 1RZPA 2IH8A 4L0PB 1AR1B 4A68A 1ILUA 1SF5A 4BK5C 4AX3A 4E9TA 1JZJA 2CJ3A 3FQ1A 4KOBA 1AAJA 2GC7C 2I7SA 2JKWA 4NB7A 1IKOP 5I6NA 1AOZA 1WS8A 4BDVB 1NPNA 3UAAA 1A4AA 4YSQA 1JVLA 1NINA 1PAZA 5AKRA 3FPYA 2YAPA 1GS6X 3TASA 4KNTA 1PF3A 1URIA 4G7RB 1BYOA 2CALA 2HX9A 2BHFA 1JXGA 1MG2C 3L45A 1XB8A 2CUAA 2XUWA 1OF0A 1KBVA 1KV7A 2DWSA 2JFCA 3S8FB 3CVDA 2JXMA 1BXAA 4DP4X 3IN2A 3ASNB 3CVCA 3IEAA 5B3SB 2LLNA 4W1TA 2UXFA 4F2EA 3T6VA 1AZUA 1GS7A 4GP8B 4QLWA 5I6PA 1RKRA 4AZUA 3QPKA 1AACA 5FC9A 3BVDB 4YSAA 1ET8A 3NT0A 1J5DA 1X9UA 1TEGA 2GBAA 2PPDA 2W8CA 3GDCA 5TK4A 3FSVA 3FQ2A 3TBBA 1IUZA 3FYIB 3DIVA 2PLTA 2PPCA 3AW5A 1RZQA 2FQFA 2PPAA 3QJUB 4PAZA 1CYXA 1M9WA 5TK2A 2RACA 4PCYA 2H3XC 1SF3A 2NRDA 4ZK8A 4BXSV 2X87A 4HHGA 2J55A 4DP1X 3X1GA 3OM3B 1GR7A 4RH4A 4KO7A 4HCIA 7PCYA 1J9RA 4BWWA 1DZ0A 1AANA 3KW8A 4YSPA 3X1FA 2FJSA 1BXVA 1WS7A 3ZBMA 2N0MA 3FPXA 2HLEB 4E9YA 4DP6X 1KYAA 1OE1A 4HCFA 4DP0X 3PAVA 2Q5BA 1ZV2A 2FT6A 3QJSB 2XYBA 3V9CA 3WNIA 3NSFA 1FA4A 2XVBA 5B1JC 2IDTA 3NJKA 1ETJA 1AZBA 3AG1B 3QJTB 2BP8A 1A3ZA 2YXWA 1A8ZA 2IAAC 4YSUA 2VW6A 2XXFA 2EIMB 3EF4A 3AY2A 5I26A 1J9SA 3WKPA 3PLYA 4N8UA 7PAZA 1TKWA 2WO2B 2A3TA 4G70B 3UADA 1NIAA 2GSMB 3S3CB 2WSDA 1F56A 3JT2A 2XLLA 1JZFA 3QQXA 1SJMA 4GP5B 4HZ1A 4DP5X 4DP2X 1JZIA 5B1KA 2HRHA 1EZLA 4DPBX 3T6ZA 4E9SA 4F7KA 3H56A 2W88A 1FFTB 1KCWA 3IE9A 2EIJB 4G7QB 1JZEA 1ID2A 4UAHA 2QDWA 4GYBA 3TBCA 2AZAA 2PCYA 4HALA 2BP8B 5I5IA 2FQDA 3CG8A 2YAFA 4KNSA 4CSPA 1GYCA 3AZUA 1NWOA 4AKQA 5B7MA 2OCCB 1GY1A 3RYMA 3SBQA 3HEIB 3SBPA 5LDUA 2HX8A 1E67A 2YAEA 2GB2A 3WIAA 2UXTA 2I85A 3EH5B 4DP7X 4YVNA 2R7EA 2VW4A 1E5YA 2QPEB 1QLEB 2WO3B 5D4JA 3IBOA 1W8EA 2TSAA 4GP4B 4KO9A 1RCYA 5F7AA 4AI7A 2XX1A 4KO5A 4UANA 3CZUB 5I5JA 3MBWB 1L9OA 2IWKA 1X9RA 1SFHA 3NYKA 1M56B 1V54B 4JHVA 5B1AB 2VSMB 2J56A 1OCCB 1OE3A 4GY4A 1HAUA 2PP7A 4FAAB 5B1BB 4Q8BA 9PCYA 5AFAA 5E9NA 2X88A 2E86A 1ET5A 3WI9A 2GIMA 5D4IA 3BQVA 4YSRA 4A2DA 2R7EB 4YSCA 3H4HA 2XU9A 4YSSA 3SQRA 2ZOOA 1KBWA 3T9WA 2MRYA 2ZXWB 1IBYA 1A4BA 1KCBA 1MG3C 5I5MA 1ZIAA 2EIKB 2J57A 3U25A 2MTAA 1MZZA 1PZBA 1JZGA 2FT7A 2UXGA 4A2EA 2UX6A 1WAEA 5I6MA 2PP8A 3FT0A 4Q89A 3TU6A 3PXLA 4A2HA 3QJVB 2P80A 2UXVA 2UX7A 3MX0B
chains in the Genus database with same CATH superfamily
1QBMH 5PCYA 2SEBA 3MHZA 2ARWA 1JWMA 2QELA 3U4BH 5CSZA 3APDA 5IB2B 3TWCH 4KU1A 4YEEA 5IY5B 2B9BA 3EJRA 2OTPA 4QY8B 5AB0A 4KNQA 3BLBA 1H15A 5CIPH 4N90D 3ENEA 4FQXC 4JJ5A 4WU5A 1G7LA 1KDJA 5AYUH 1KYOJ 2CNZA 3RNKA 3TXAA 4H40A 4WIQA 5EN2A 5C0CE 1AJ7L 3C60C 3G6JF 3SODB 3MV8D 4CC4A 4OTXL 4L8BB 3MR9A 3UTOA 4YDNA 4OLUL 1QEXA 2IXQA 4K5MA 5EU5A 1Z3GH 4PJHE 5SX5K 5FO7B 2J8HA 1Y0LA 2X70B 3IU4L 2EXWD 3B56A 3FQWB 3DNKA 2EACA 1OM3L 4WAFA 3WV0A 2DTMH 2O6CA 4WGKA 1BF5A 4I0PC 5LBGA 4EF3A 5JA9A 2WGXA 3TC9A 5L6YH 1XGRB 4DGIL 2YBRB 2BVUA 5AW2B 3OKLA 4P4RB 1A2YA 2OMTB 4DW2H 3JTBA 1R0AH 1EMTL 1P6FA 1ZT4B 1FZKB 2WUBH 5FECA 4AOFA 2XWXA 3GYRA 1PEZA 3HN3A 1TLKA 4HK0B 5EZLB 3GS0A 1GGBH 1ASOA 5AEAA 2RJMA 1DBAL 2YQBA 2JB5H 4CDGC 4E2OA 4GAGL 3VNZA 3ERXA 1ASQA 5KVDL 4LBEB 1GJIA 4G7VH 4P5KA 5G4MA 1MWAH 1OCZB 3CK0H 1YC7A 2Y2TA 3PQYE 3QARA 1GGTA 2IV8A 4HW6A 5E1IA 1KMGA 4TNWF 4TSCH 5I76B 3CXDH 5DJAB 2VOTA 3CDGA 4LPYA 2JB6A 1F00I 1N8ZB 1T5XB 1V55B 3EOYG 3KPTA 1XXDC 4LIQE 1RLBA 3MZTA 2HT3D 3EOTH 2YIHA 3V5HA 1UM6L 3FB5B 2X7LB 1PZAA 3QXWA 2VDQH 2P5WA 4GPVA 5C1MB 4AYFA 2TSBA 3S36X 1TCMA 4DZ8A 1Q4NX 1QLRB 4YS4A 4OF5A 4PRHA 2O5XH 4Z18A 3PV7A 3RKDC 3NSXA 4A39A 1IKNC 1CLZH 3IFOB 1OB1B 1C8PA 4GMTH 2WTPA 4PJDA 1L7IH 3IPFA 5DK0A 2CPCA 4N26A 2F1AA 5HGDB 1KPRA 3LZPA 1AZNA 4JLRB 3CZKA 4JN2A 2CBPA 5FW7A 3WLBA 5LQBH 4MD5B 2XICA 1T6WA 1XIWA 3RDTA 3M07A 3RY5A 3QH3A 3KPLB 2YZ8A 3VX0A 2Z8WC 2VE6A 3S4SG 1G9ML 1RZGB 1TU2A 2V0AA 2QQNH 4NN5B 1LWHA 3G08B 4PJFF 4N9OB 1A7QH 1NICA 4BKSC 3MJ7B 3MKGA 3TCLB 5D70H 4G6AD 3TO4A 4XX1E 1NAKL 3UG4A 3EW3B 4H8PA 4K71B 3VFNB 3DHUA 3OJDA 5TE4L 4DK5A 4U4IA 5EUOE 2EIZA 3VMOA 2DWTA 3KZ8A 2Q76A 1O7SA 3HG1A 4PJCB 1I7RB 2YXVA 4A7QA 1PZCA 4ZMPA 2ICES 1Q9WB 1E8WA 2GTWA 1KXQE 2A6IB 5ALBH 3LN4B 3QQ3A 1Z9PA 2E9IA 3MNWA 4JFUA 5D9SB 1AYOA 1A7NH 1TETH 2Z35B 3IDIB 1ZTXH 4JO2H 5JLZB 1LO3L 4GW5B 3PNRB 4XWOC 2J4WL 4XNXH 3HRZA 2GBVA 3O11A 4UV4H 4E42B 3DX9B 4PJ6A 3WHE1 3FOMB 4YHNA 1PSKH 4OLWL 5A2JH 2O93L 5JA8B 1XH1A 1TTRA 2RB8A 3PJLA 5B1JA 2BY0A 1T89C 1Y7VA 1JRHH 2UY6B 4I4WA 4JFWA 5FM5O 4GQRA 3VRJA 2FEEI 4MAUL 2RCSH 5CHNA 2YD4A 2M83A 1KIUA 3FS9A 1RZ7L 3MLPA 3PAZA 5JOFA 4Z95H 2ICEA 5BQ7A 5TDNA 1P4IH 1KN2L 3K71A 4GAJH 1OE2A 5HJBA 3LD8B 5C2UB 4DH2A 3GSUA 1R3HA 1E4KA 3MPCA 4OLZL 5SWZB 1S9KC 1NBYB 1K4DA 2CDEA 3QVAA 3P4NB 3WKML 1OAUL 1MHHB 4X6FA 1CFTB 3BXNA 5I1AA 3NMEA 4OIBA 3X13A 4HPHA 1B0IA 3CD4A 1OAXH 1CICD 4GLRH 1S7XA 1G9EA 3NIDF 1NC2A 2JJSA 4CMHB 1IM9A 4HDIB 3KH4A 1FVCB 4H0GA 1I8IA 4K5LA 2IH8A 4S2SA 2AXFB 4NQDE 3U79A 1FPTH 4LHUB 2OZNA 4JO3L 2R4SL 1KB3A 1C8QA 1HN1A 1ETA1 4MXQC 4RMWA 4WW1B 4AX3A 3L7EA 2Y7QA 4TUKL 5IMKA 4JFXA 4JW3A 2FBJL 1OP3H 2AKRB 1KEGL 3VXTA 1UEMA 2P43B 5DMIH 5SWSE 3U7YH 4UTAL 3ZK0A 1TQUA 1RUKH 3FQXA 2JLLA 4I7ZC 4PJ9B 3TV3H 1CIUA 1FZMB 1KC5H 3CVIL 3QDMD 4R4BA 1HJBC 1PAZA 1NINA 3L3KB 4G5AA 1PG7H 2EYRB 4WF7A 1FORH 4JMXA 2EE0A 1KEML 5DHYB 1YVLA 2XPGA 2W95A 3JTSB 2D31B 1HWHB 4RA3A 3NPZB 4D3CH 3ETBJ 2EC9U 2CUAA 3ATDA 2Y06H 4JGUA 4BZYA 5E00A 1OOAA 1LYQA 4LDEB 1WHOA 2ZCLL 4AQZA 5LBSH 4YBQD 1S7UB 4HWUA 1FFPA 2XZCL 3IN2A 1NCDH 1Z9SA 3L5WA 2GK0A 3DGGB 1XTMA 4UAOB 3CFEA 1NGWB 3QXVA 4QKXB 1KTLB 4LCUB 3ZL4L 3LX9A 4LPVA 1P6AB 4GP8B 2VZ3A 5F1KC 1T3FB 4ZTPH 2WAQA 5HHVL 2FX8H 2GTZA 5I1KL 3ZKNC 1J8KA 1JK8A 3RI5F 1JGDB 1A4KA 2LR4A 4POZC 1J5DA 1X9UA 1QSEE 3S2CA 2HT4D 1Z6JT 3FSVA 2W60B 5EZOL 5E99L 4IW4C 1HZKA 3CJJA 2AEPH 4WEEA 5EEZA 4LVOB 1RJYB 2M26A 2D7NA 6FABL 2JXMB 3S34H 1HILB 3MLWL 4NT6B 5HPOA 2DZEA 1SF3A 5DFWH 3P0VH 5EZJA 2GK2A 4P99A 4AIZB 1YY9C 3VX1A 1GXEA 2Z0UA 4A6YH 2GSIB 1PGRB 4Q6IA 2OJEA 1YRKA 1H0DA 4M6OH 3GIVB 4JQIH 2QKSA 1VIWA 5GJTH 1U8NB 4FG6D 4W9KC 1IEHA 2QZ5A 1A6TB 4ZMTA 5HGHA 1GZPB 3CN4A 4P57A 4Y9FA 2J6EA 5CP7B 5IMMB 2BRQA 3L9EA 3UJTL 2PYEE 5ALCH 4JM2B 4F93B 4X99B 3T77B 4NQCE 1CGSL 4ANXA 5C70A 3PHOA 4M8VA 2HB0A 4P4RA 4OIFA 4WFGE 5DD5H 3RWEB 4FI7A 5CEYB 4HISA 1SBBA 4AVHA 3G5YB 4KY2A 1I7ZA 5AOMA 5E8PA 3L3GB 4FYRA 2WP3O 1OPGH 4HK0A 2EDHA 2VR5A 4MXWH 5HGAA 1UFGA 1KGIA 3GQFA 3O4LA 3TEUA 2WANA 4OR1A 2C4XA 5A6MA 4NS0A 4CC1A 3STZA 4PBXA 4DVBA 2VW6A 3T2LA 4Z7OF 3K72B 2XA3A 3V0IA 5I26A 1J9SA 4TUJB 1T1ZB 3WKPA 5CUSL 3TGXA 3AABA 1K4CA 4ZFOB 4JY4B 1ADQH 4QMEA 1WBXA 1QLEH 4FI6A 4LCCB 5D7LE 5DYOB 3Q44A 2WSDA 4JRXD 4PJ7F 5DJAA 4KQ3H 1YUHB 3ULVE 4I3SH 2Q6WA 2E7LA 3QNXA 4E9SA 4W9EC 5F7FA 1RZJH 4OQTL 1A7RH 2VO5A 1U3HC 4HEME 5DZLA 3OAYH 4PS3A 2ITFA 3QDGE 4H44C 1G9NH 3CFCL 3SPCA 2BCKA 2A74A 2W9EH 2XSKA 1JRHI 4A38A 4AGOA 2HTLD 5L88L 3KBHE 1YEGH 2A9NH 2BSCA 4PRHE 3UC0H 1H3TA 1UM5L 1C5CH 1QRNA 2HCZX 1KJ2B 4PGEA 2VLKE 2LAAA 3MLUH 3NCCB 3F58L 3OAUL 3D39B 4LDLB 4Y2OB 5ECJE 5CO1A 3T1FB 3WEOA 5IHHA 2ADIB 1JGIA 5C0DB 4Z7QB 1AO7B 2G9HA 1HIMH 2H1PL 5EBWA 4NRXA 1MEXH 3ZDZE 3FUMA 1G7JB 5DJYA 4DP7X 4PS4L 3N0PB 4UTAA 3LIZL 5FHAH 2JI2A 2WO3B 4WNSA 3LNFA 3EJYC 4MD5A 5CS7A 1LK2A 1U8IA 3UBXB 3MRQA 5AOLA 4AI7A 1JNNH 1U4EA 3SQOH 3PHAA 4UB0L 1OT2A 3IDUA 4JM2D 5J6GB 2IWKA 4ODWA 3J2PA 3H42L 1U93A 4G8FA 5C0JB 3G08A 4EI6A 2VSMB 5KZCB 3GMPA 4A63A 1GYAA 2IV9A 1BFSA 4XI5D 3GMNB 4TM9A 1DE4A 5ICUA 2FYYB 3L4XA 2G30A 1WCBA 3VFNA 1IBHA 2Z92B 2DF3A 4K3HA 1A7BA 1JNJA 3IBEA 1KSRA 3EYQC 5KBNC 1NUGA 1ICTA 3ATBA 2P5EE 5EA0H 1EFQA 2D7PA 2IH3A 4PJBA 1YJDL 5EC2B 1N7MH 4YR6B 4FXGB 1A1MB 1JYVA 4JHAL 3X3FL 1WAEA 5DURD 2Z35A 2IDCA 2DQEH 4L4TA 4YDJA 2GITA 4FQCL 2K6YA 2VT0A 2JKNA 5E24E 5KBKA 2BIMA 4HMCA 4HXBH 2PUQT 2ZSWA 4Y4FB 1BQRA 1KV3A 5HGBB 4BFJA 2G75A 4MMYB 1F2XK 1J8RA 2H5UA 1CMOA 5G5DB 1WUZA 1GGUA 1GJWA 3AG2B 5FA3A 4U1KB 2IFFL 2WVUA 2KYIA 3TT1L 4AKOA 3BAEH 4Y1SA 4GRLC 4H20L 5D7KD 1E5CA 2HT4C 4GKZB 3WUWG 1J9CT 3ABGA 1NFDA 3B9KC 2CBTA 3ZTEA 4GI6A 4E9XA 3D39D 3QDJB 5SWZA 3ECUA 1N3NB 3RNQB 4MBRA 5JPNB 3ROOA 3CZLA 3MNZB 3DVNB 5ICYB 3D3VE 3K0YA 4ACPA 3OWRA 4APQD 5T3XL 25C8L 2EDDA 1FNSH 5B1CA 1VCBC 4ZSOB 5B4MC 1YEHL 4BWUA 2VM4A 1ANUA 1TJXA 3B7YA 3UJJH 1RZIA 3QPQD 3PWJB 4Z7WF 5I19H 4GUOA 3SDXB 3UYPA 3D85D 4NO0A 4PJEA 2AXFA 4X4YB 3HLKA 5JIMA 4RX4D 5C07B 4FNTA 1GYUA 3HI6H 5KZCD 3WJLA 4FCHA 1ZLSH 2HKFH 2NCEA 1S5HB 3RHWK 1FI8C 2RD0A 5CGYC 4JKNA 1FYTB 3D52A 2PYFB 3VXME 1HKLL 3INUL 5K39A 5D7JC 3I3EA 1RVFL 1G4MA 2Z3FA 3KW7A 5KVFH 1M6UA 3V0FA 1MRDH 2APWA 3ZQ9A 4PJ9A 1HHHB 1HCVA 2UUDH 1ZA6A 1J1OL 1BZDA 1A7PH 3DUSB 4OQTA 3GWJA 5C97A 1QP1A 4ZUUB 4GKNB 4PJ5A 3BH8A 3LKNB 2H4EA 5I1HL 2D31A 1ZVSA 4TSAH 3VGAB 4IBVA 2VITB 4B53A 2WXQA 3QJXA 5JW4Q 1ZD6A 3GJFK 2MOVA 3KYKH 3BZFB 3OMIB 2CBQA 3RVWD 1MRCL 4JDEA 3M45A 2IAND 2N7BA 2IGFH 4Y4FD 1KBPA 3Q7JA 5IT2H 5I2IB 1VFBB 1IKFL 4ZRGA 4NNPL 5C2BH 2CNYA 4TRPH 5IGXH 1NGWA 5AKTA 3LDBC 2QLYA 1DBML 1AS7A 4P46C 4M4RA 1F42A 2DWYA 2YO3A 3SGKA 4UNUA 2BWIA 1GPOL 1WBYA 3JVFC 3D4CA 3LIZA 5CILL 3IDNB 2F5BL 3V52L 4Q9QL 1ND0A 2CE6A 5DVLA 5ADPL 3GB7A 5FGBA 3GXDA 2IO5A 1BJ8A 3GMLB 2B2XL 4QOKE 2R1YB 3GMOB 1MWAB 3BFOA 4AG4L 3NRFA 3KS0H 1RHHB 2DQFA 3NDYE 5IVXF 5KAQG 1JTTA 4FLQA 3I9AA 4M7ZC 5DUPH 1BJ1H 1PY0A 4IHOB 2O6FA 3V6OE 3U7WL 3JZ7A 5C0BB 2GUYA 3KPNA 4UQCA 5KUMA 2XXCB 2BFVH 5AVVB 3VQ2C 1NIDA 4NNYB 2B08A 4YC2B 4IEFB 3FB8B 1YEDB 1LGVA 4TXVB 4HIEA 3V0JA 4KXBA 1MLBB 2BVTA 3B83A 4P5TA 4PP1D 4N2DA 2YUXA 3GIVA 4IU2A 1UWEH 1HSBB 5ISZE 2Z93A 1FNEB 4PTTB 1A6TA 1YLBB 3INOA 4H8VA 4LAQL 4JRYB 2NNAB 2ZYIA 4OUUB 1RJZA 1EA9C 4OFYD 2I9LA 3F65A 4YBLC 4HJJL 4G6FB 3V6ZA 2ZX6A 1MW1A 2V5YA 4J3OF 2Y7NA 5CEYA 2LVCA 2WZPA 1NCAH 1FF5A 2XNAA 4G9DB 3DJSA 4JG0H 3TN0B 2F08A 4ZFZA 4CJ0A 1OCRB 4HH8A 1MELA 5DF0A 1VZHA 2MIZA 4QXGL 1A14H 3LEVL 2DQUH 1BBJA 1L4IA 1T4WA 3QFJE 5KJ4A 5JW3L 1JI2A 5C08B 4I9XA 2E7MA 1AR1D 3AXHA 2L7EA 3WGVB 2PO6B 4CSSA 4R84A 3Q8BA 5JXEA 5EO1A 1L5GB 3MBED 1WZ1H 5GGUB 3CHOA 4WY7L 1URZA 1ZT1A 2HFGL 4ICWA 1YUHA 2ZG3A 3CXFA 1BM7A 4H8WL 2YD7A 3L48A 4NZUL 5L2JA 3RIFF 3KXFA 3IT8D 3FT1A 5D4HA 4MNGA 4O5LH 3EOAA 5C0RL 1FN4A 2OI9B 2LT9A 4UDTA 2BSSA 1DBJH 5H4YA 3QS2A 4ONFH 4FMVA 3Q9PA 4FHKA 5F7EH 5FKPB 1A3RH 3BEVB 4MMZB 4OZHF 4YBHA 4DEUA 4N22A 3EO9L 2Z8VC 5EOTB 5BV7C 4FTVB 3T6WA 2PTTA 5DVPA 2AQNA 3FH5A 1KPVA 4APQC 5G4NA 1A4CA 4QWWC 2X1OA 4WUUE 1UH3A 3ZLQC 1XGYL 4FJZA 5FUOH 3BKMH 5PAZA 4W9IC 1P0SE 1JK9B 4KQ4H 4XN5A 4KZEL 3C08L 2R4RH 5HI5D 2IG2L 3WEMA 4OZ4B 2JIXD 5CEZE 3EADA 1LP9B 3ZMEA 3TZVC 1EVTC 4UT6A 5HDQH 2QSVA 2ENJA 5C0EA 3OKDB 4UMGA 5FA4B 1GZQB 5JIHA 1WWBX 1DBBL 5HYIA 1B2YA 2NTFB 4FYTA 4G6FD 3QEUB 1EWHA 3VRIB 5E8OB 4J3OC 2F74A 3DPBB 3N1PC 3VXOB 4XPTH 1Z0MA 3CZSA 3DUHA 3T0EC 1TNMA 2F8VA 1DVTA 2Z92A 2QQLH 3OVUB 3H2QA 4CVXA 3SKMB 3DHPA 3P4MB 4CGUB 2DWXA 3ULUF 5C08D 2YOAA 5I1EH 1BEYH 4HU2A 2BHFA 3LMJH 2E4FA 4AIEA 3L4YA 2IAMB 3F6LA 4EDXB 1A1MA 4AM0A 3S8FB 1QR1B 2VR3A 3QNYA 2BOBB 3SJVE 5T1KA 2BIHA 4ADIA 5GZNC 2EKSB 2A4CA 3MXWL 2XWCA 5GGVL 3RVWC 1ZV5A 5IQ9A 3I75A 4FTDA 1AZUA 3PFQA 5ADOL 4X6DB 2N56A 1MFBH 4HUWB 1GHFL 4AY0A 3MRKB 4WNJA 5FC9A 2JKIS 1MCDA 3CHQA 1ZTMA 2WZ5A 3KVQA 5I16B 1SHMA 2RHEA 1A0QL 4W9CC 4A7GA 5G5DA 1H8OA 4WW2C 1MVUB 4PV8A 1HNFA 3CPLA 3DIVA 1CXFA 5LNGA 3QDHA 4N2OA 5LXVA 4S1RL 5GRWA 3QJUB 4M7LL 2HJFA 3Q6GH 4FD0A 5T3ZL 1VESA 3GJFA 1NFDE 3FDWA 4R0LA 2EEDA 4IOIB 3TT3L 3MJ9L 1LNUB 3RNQA 1PIGA 3OB0H 2QKIB 4DP1X 3D4ZA 1N19A 4XE0A 5ICYA 1BF8A 4TNVF 1HSAA 2J6WA 3A0OA 2FECI 2YGPA 3L6FA 2PR4H 4RH4A 2YRPA 1J9RA 2XN9A 4WSJA 3T2OA 1HYSC 4UQ9A 1QNZH 4DKEH 1J05B 2GJPA 1DQDH 2CGRL 3N85H 3ZBMA 1C08A 3DX8A 4KVCL 2MKWA 4QRRD 3PV6B 5FFOA 3KHQA 1OGAB 4JS7A 3HAEA 3EXLA 1R47A 4E9YA 5AAMC 4XPHH 4HCFA 5I23A 3RWIB 2CUIA 3ECVA 4G8EB 1EUUA 1IL1A 2EC9T 4EAEA 4DUXA 2VDPH 1FYTA 2PYFA 4U1NB 1UJ3A 4QHLA 4LVNB 3NJKA 2JJTA 2VZSA 3VXSB 1NKGA 2ADJB 3ULUC 4KKPA 4U6HA 4W9HC 3O2DH 3F7VA 5J12C 3V4PH 2FHCA 3UBGA 2IAMD 5D1XC 4A6YB 4D0CA 5HDBB 4BYHA 3T2PA 4E0RB 1HL5A 1H8NA 4WEUD 3NABL 4G7YH 1XR9A 4UIMB 5KBPA 3S3CB 3B9VA 2ZUTA 3U1SL 1JZFA 1HOCA 3BP6A 1E9PA 3BH9A 1XGTB 4OZGE 3K4ZA 1U3ZA 4OU3A 2ADFH 4DZBA 1A1NB 2DN7A 4KJPC 3BZFA 2AXGA 3R4DA 4BIKA 4KUZL 4F7KA 4I5BB 4IU3A 1Z9NA 3GRBA 2FNBA 4N8CH 1ID2A 1T0NB 1NGZB 1WH0A 3P4OB 4UAHA 5HI4D 5I2IA 5CJOH 3TBCA 1JCKA 4RGOL 2VMFA 2YAFA 2K3HA 2RFXB 3KPRD 3FZUC 3QPXL 2X9ZA 3KLDA 2BZDA 1EANA 3N44B 5B22A 3G5ZB 1V7NH 2N3JA 3KGTA 3LPGA 1FFNB 5FCSH 1X7QB 1N67A 2GJ6D 3GUTB 5ACZA 1FIGH 5EORH 4JFEB 3BGFB 5D1ZA 1FO0H 1CZ8H 2FDBP 2BXZA 2H2SC 1A4JB 3TNMA 4XNQB 1R3IH 4JPIB 5IBLC 4TUOB 1J8HE 4ZUVB 3FQNB 4AYBA 1HNGA 1YEEL 4UOJA 2VNCA 3OMZA 4OCNC 4NOBA 1E5YA 2WLIB 1QLEB 1NOAA 5BZZA 1IGML 1KGCE 2L3BA 3HPJA 2OKMA 2Q7NA 1HQRB 4LCWD 3PHQB 2R2HA 4NNYA 4HOMA 2AQ1A 3K4DA 3VSVA 4IBWA 3IETA 3EYVA 4RA0C 3VXRB 3TESA 3TVMB 1YEDA 1L9OA 1OGAD 1SFHA 1A6UL 5H94A 2OMXB 1E6OH 3IMBA 4XC3L 2G0LA 3JUYA 2VLRA 4L9DA 3RWHA 1FNEA 3QIUC 5F9DC 5H35B 4GFXA 1HAUA 2PP7A 4M62H 2NW3A 4JO4H 3FT4A 4JRYA 5CCJA 4WJKB 1S9YA 3UTSD 4MWFB 1WZKA 3FN0H 2PWHA 4G59C 4Z5RB 2JKSA 2EH7H 4D0DA 3VWKD 3UMNA 1JV5A 1ZK5A 2ERJC 4EPSA 3VXSD 4P0DA 5AALA 1KCBA 1BFOB 1QSVA 2XHNA 3TN0A 3WYRA 2EIKB 4PCSA 3VD4A 3MCKA 3LHAA 3GHBL 5DT1L 5DUML 5A2AA 2J21A 3LH9A 4FZ8H 3DGCR 3PXLA 4PGDB 1JE6A 4G8GB 1KCUL 2ZQKA 2UWEB 3MRJB 1DL7H 3QUYB 4Y1TA 5C0FB 5DRZA 1A9BA 3SZKC 2V5RA 1TXKA 2PO6A 4MBOA 3SE9H 1A1OB 2VAAA 5KJRL 3K5RA 1NAMH 3MV7B 1J5HA 1L5GA 1G0DA 2D3VA 1NGPL 5J56B 4AYEC 1SEBA 2G2RA 1NWPA 3TBYB 3VI4A 1PJWA 3MJ9A 2EDRA 4P2RE 4JREB 1ETZB 3KCPA 1MJJB 4M1GH 4NCC2 4OV6F 3VYOA 5J6GA 3QRGL 2XKNB 1JTPA 1U8CB 2QQKH 2WXJA 2FSDA 5DMGC 5D6CA 3Q3GB 5ID0B 1PIFA 1A25A 3HUJF 4BWTA 4TLKA 2F8IA 2IDUA 3GI8L 4JFED 4D8OA 4DN4H 3O3AB 3OAYK 2I7OA 1BA9A 4Z7VB 1K5WA 3B5GA 3C8DA 3OKEA 4LP5A 4DCQB 4PJGE 5L0QB 3MRCB 2CKBL 4OAWA 4AK2A 3HNSH 3D18B 3AB0B 4DPAX 3FU3A 2ZXQA 4LU5H 1ES0B 4L8CB 1EEYB 4ZOAA 3KPPB 3KLAB 2H6PB 3CX5K 4KPHL 4FQHB 1RLWA 5B8CC 4MZRA 5MI0B 2CUMA 1XEDA 4TMPA 1KZYA 4AITA 5IQMA 3VXRD 3PWLB 2HT2D 2IH9A 2FIKA 2OW6A 5H37A 3TVMD 1HHIB 3NCJH 4BJLA 4CVZA 2ZCZA 2ROXA 2P9RA 4Q74A 5F97E 2GFBA 1FVDA 3QUXC 3HMXH 4BE6A 1RZFL 2QV4A 2WLKA 2BMKA 3O0RL 1JP5A 3TPUB 3W11D 1QA9B 2MOQA 3VTMA 5FB8A 1XF3B 1YQVL 2IQ9H 2JKTM 4I0PB 4PB0L 3W39B 2WQWA 3WOVA 4HT1H 4A66A 1MCKA 2FO4A 2J8UB 2CA4A 2FYVA 1X5FA 4N1CA 3CFIC 4W6WB 3SCMC 5E23A 3QEUA 1M7IB 2VXTH 4B9GA 5HYJA 3ARGD 4EVNB 5E8OA 3DPBA 1FNGA 4URKA 4AEIL 2ROYA 2Y7LA 1HXKA 3FCTB 2PXYB 4NP9A 3P30L 5J6HA 2FLBT 1OTSD 1QHPA 2WLYA 4QHMA 4HUCA 2VXQH 1E5UI 2VQTA 3ALPA 4G3YH 1QPXA 5CCGE 4ZTOH 4HK3N 4IRSD 3T0EB 4GQ9L 3GSVB 5E5RB 5I15L 3G04A 4EDXA 4HYTB 1I8MA 1QR1A 1B4JL 2XQBL 4XXDB 5C6WH 1P6WA 3LZLA 1JF1A 5DXWA 1D9KC 5FYJL 4LLUA 1CL7H 3ZIYA 5K59F 4J39A 4FKKA 4KX8A 4YIQB 4LL1A 3BPLC 2NT0A 3DHJA 4HKXB 1HESA 4P2QE 3WKYA 4GQPH 2HMID 4AYSA 1RZKL 1P5UC 4MMXA 5T8IA 3ZE0E 5I1IH 3H4FA 3DOHA 4FXKA 4H1LB 1DVQA 5DS1A 4YHLL 3FW6A 3NJMA 3CVBA 2X4PB 4LP8A 4YPGB 1EO7A 1EHLH 1N5YH 3QCTH 4HOZA 4E68A 2PWDA 5FAAA 4BFRA 4JRLA 2F6AA 5I6LA 5GGRA 4TLTA 5FW8A 1DQIA 4FL4B 5I1DB 5KYXB 1J1XL 3ZHKA 1QX1A 3K6IA 2OCJA 3G6JB 2F1BA 1ZPUA 4XRCB 1PLBA 5MP6L 3UGXA 4P9HH 2Q7AA 1I8LA 3ARFB 4LSUL 3O6LL 5DEJA 2MWCA 4BKLB 1J05A 1T5WA 4NO5B 4P59L 1PX4A 2YKLH 2HH0H 4RGMB 1KELL 4IDJH 5E9AA 5DJXA 3EFFB 3HG0A 3ETTA 2OSYA 2WQRA 5CMAB 1RK1B 2Y23A 1JHKH 3NQKA 3QZWB 3RWIA 4NAJA 4B5ZA 2O61A 4HD9A 4AVJA 3IK2A 4M1DH 4AH2A 2YRZA 3QFDB 2BNRE 4ZUSA 3A4DA 1XR8B 3U4EB 1TZIB 3SDCA 4XAWL 3V7AG 5CZRA 1QVOB 3MLSL 3S88L 2VLME 3HNVL 2ADJA 4H25B 2VSKB 1VEMA 2VDRB 3FXIC 3L5HA 5HXMA 1I53A 5I1JL 4TOYH 3L9RB 1TJGL 2WJ7A 1CI3M 3BEWB 3DUUB 3O3UN 3U30C 3SGDI 3CCHA 1THCA 3HHMA 4G9FE 1IBZA 5ILTH 5EU6B 3N43F 1PLAA 3KYNA 5JXAL 2VXVL 4JDZB 4ODTH 4NQEA 3O9WD 3W37A 2CKBA 3DJZA 4ZFFA 3H2PA 2YD8A 4AM0Q 1MAML 1Q0XH 1ILSA 1T0NA 2B1OA 2PCXA 4HX1B 3B7UX 2MMXA 5AB2A 5IWLC 4LLWA 1KTKE 1S9WA 1YECL 2HX7A 5D2NA 1OXYA 1U8JB 4QDGA 3TA4D 1MCWM 3WL9B 1QNIA 1TQTA 2D7QA 3IMTA 1WIOA 2X6CA 4H0IA 4AZ8A 3DX1A 2YUVA 3H7BB 1AZVA 1SHXA 5GRUL 5IHZB 1AYRA 4YGAB 3GZKA 3GUTA 3GXTA 1G7IA 2RBLA 4ONGH 1WJ3A 1FV1A 4AQAB 4XVSL 4L9LC 3CQQA 6TAAA 4FA7B 2C7UB 2YEVB 2YEZB 1YN7B 3VG9B 4HQQH 3W56A 3HLAA 2R29H 4AW7A 3D30A 4OJEH 1RZJC 3ARFD 4FQ2H 4P9ML 2PETA 4Y4HC 3IJ8A 3F7PC 1HQRA 1CGWA 15C8H 1DVFD 4ZD3L 1XF2B 4IBZA 3W0WE 1H19A 3VW3L 1G9NC 1EH9A 2D4DA 2ZD0A 1MFAL 3EG9A 4WO4C 4NB7A 5HHME 2FJUB 4FN0A 3E2HC 1KCVH 4PJFB 1NDGB 3QORC 4P4KD 3S48A 5BJTB 4G6KH 5DJ2A 4BCZA 2VR4A 2WXIA 3ARGC 4ZPVA 4TNWK 5CGTA 4UV7L 3RLSA 4YZWA 1MCWW 2F1EA 1FL5B 3WSQH 1T1WB 4M56A 3VXPA 2W0PA 1OTTD 1NEPA 1ZEAH 3DSFL 1AGBB 2V2WB 3L45A 3U6RA 1N6UA 1TENA 5T1LD 4AJYV 2FH8A 2BM3A 8FABB 2YQGA 4IRSC 5K9KB 4KRPC 1G6RB 1XGPA 1SHSA 4X0KA 5FDYA 3IEAA 3MRJA 5B3SB 3PDOA 5EU6D 1AE6L 4WHYH 5DC9B 3IJYB 4P2OC 2X53A 1A1OA 2IADB 1XZ0B 4QLWA 2Y36H 4R8WL 2OBGA 1SXBA 1PPIA 3DXAB 1F11B 4HWBL 1VDGA 4J4PA 2V4LA 2WBKA 4NHCH 3WELA 3WIHH 1EFXB 4K55A 3JVGA 4XN9A 1ETZA 1TJIH 3FQ2A 2VDRL 1AHWC 1FGNH 2VJ0A 2VH5H 2XWTB 4KK8C 3RVXD 4CVWA 2WQUA 1A66A 4JFQA 2BK8A 1W0VB 4NM8L 3DRTB 2UY7A 1OP5K 5IOKA 3LV3B 2BVQB 3B2UD 3OR7B 4NCDA 2FX7L 4XZUB 5IK3B 4GNKB 3QJHB 4NJAL 3OHXB 3O3AA 1HWGB 3MTRA 1T03H 4FQXA 2UZYB 1GR7A 1BMWA 3PJNA 3GSQA 4Z3JA 3UERA 4NQXB 1T1XB 3GTTA 3GXFA 1DZ0A 1OALA 4RDQF 3ZQWA 5BOPA 3T8VA 1ZHLA 3C60A 2XTJC 3QRLA 4FOMA 3FPXA 4JNXA 2HLEB 2ITDB 3CSBA 3KYOA 4KDWA 3SPVA 3NIDB 1MI5E 3VH8B 1YNKH 5I8EB 1XO8A 5BVPL 3QHFL 3WFEL 3CFDB 1S8DB 2FB4L 2Q5BA 4RGNC 2R69L 1CIDA 3M1OA 3NIGE 4KHXL 5F7YC 2FT6A 2E5EA 4Z7NF 1QA9A 4AGPA 2DM3A 4I0PA 5JHAA 1OSYA 2VN5A 3QEGL 3N41F 3QZLA 1JGLL 4QCIA 5AOJA 3V6FA 5FIEA 2HP4A 1MPAH 5HYJE 4CNIB 4EVNA 4K23H 3EDEA 5KVEE 3SKJH 1WT5C 4LSQL 3ME0B 2WCPA 1NBCA 5JORB 5KW9H 1YNTA 1F1DA 1SVCP 2A3TA 2Z0BA 4F37F 3EUUA 1NIAA 2B1HH 3AROA 5JYMA 1F56A 1V27A 3IGLA 1G0XA 3DK2A 2OMBA 2DWDA 1CE1H 4XB3A 1IBFA 4NUPA 3SE3C 1YZZA 4XX5A 3QG6A 4ZW7A 4B96A 4RSVA 2VDNH 3L5XH 4QRSA 1UACL 1UD6A 2AZAA 4LGSB 4WDIB 5JW4R 1VFOA 1XZWA 4XNZC 4HALA 4YIQA 2YN3A 3F7KA 5TE7L 3IDGB 2ZJSH 1RJCA 4EDWH 4F7MB 1NEZG 5BO1H 4Y1AB 4HS8L 1GY1A 2V6HA 3IAQA 2HX8A 5D1QB 5IJVA 3ULSB 1PX3A 1T66D 1MRFL 3MJ8A 2I85A 3V4PB 3QEHB 5HYQB 5DO2C 3V4VL 3UTTE 2VDOB 3Q8AA 4ZDHB 3CX2A 1YEJL 4IK6A 4RWYL 3HG3A 1W8EA 3D50A 1GIGH 1IKNA 3WGUB 4DIXA 3BAYA 2XX1A 2R8SL 3QUMH 2A6JB 4MDJB 5C0AD 3G6JA 1KGUA 1FG2B 2VRQA 3HR6A 2J2ZA 1DVFC 2X1PA 2BIIA 4ZMQA 1C5BH 1SGKA 1FH5H 3FFCB 3QHZH 4UU9A 1EDHA 1QD0A 2Q8BL 3K74B 3FUNA 3KD4A 4KX7A 3MOQA 5LAXA 4BKLA 4H0HB 3BDYH 3C8KA 3UYRL 3A6BH 3EFFA 1AXIB 4OI8A 1KCKA 1QWNA 1JUFA 3UEZA 3VD5A 4P4KC 4Z8FH 2NY6C 3O6FC 5FUCC 3QZNA 3M7OA 2PKDA 3P3UA 2XOTA 4GKSB 3DSNB 3P1VA 3HI1A 3ZE2F 5IZ7A 2EEBA 1FO0B 2NNFA 3WTUA 3KPSA 5A1AA 3A67H 3PU7A 1TZIA 2FT7A 3EFOB 5B3NA 4JMNA 2C1PB 5DTFA 2AAAA 1QVOA 2E6JA 3ZPDA 2ZX5A 3LKSB 5C9JA 3BPOB 1QUNB 2WWKO 1E4XI 3QJVB 4H25A 4XCFH 4A2HA 3RZCB 2C9UA 3AMLA 4XTRC 4V2CB 3MRNB 5HBBA 1L0PA 2VZVA 4Z7OB 2R2BB 3RI5K 4E41A 1IFHL 1TYJA 1ESOA 2EDEA 3DIFB 4YWGL 1YAZA 3CFUA 1DCLA 2CKNA 2IBZY 1OCWH 5C09E 4I13B 5FM8A 4PJ7B 1EK3A 3QUZD 2ALAA 2O6EA 3P3YA 4QIRA 4FXTA 4GH7B 2DS4A 3LH2H 3V5KA 3RU8L 1FNFA 1Z66A 5LN8A 5I74C 5EF0A 1T89A 1ZE3H 4HG4K 2YQ3A 3HE6C 5D1QD 5DD0L 3ABZA 5B3JF 2J88L 1WEJL 3X2QB 1DJYA 2AJ3A 2DYRB 5HHXH 3NTCL 1DUZB 1SBSL 4L3AA 3B2UC 3WFDL 4DTGL 5FGCE 4M8UA 5MENB 3T4AB 3T1WA 2A73B 5BZDA 2DI7A 2Z91B 3EGSA 4HMEA 5C0CD 1BLNA 1RULH 2R69A 5AAPA 5KBDA 5KSBE 3EKCA 3O81A 2CDGB 5F9OH 1IAKB 5LLIC 2F7PA 1RP9A 1LK3L 3RQ3A 3PNWB 3IB4A 1F1GA 5BOZG 2NSQA 3PGFL 4Z9KB 4AXWA 3PIQA 1VFAB 1UQSB 3H9HB 3OHMB 3VI3A 3UO8B 4ZX4A 3BX7C 3EO1A 1OF2A 4H5SB 1D6VH 3ZE1E 3C9NB 4WWNA 1KCSH 1WAAA 1XF2A 2IBGA 2OXGA 4L4VA 1IGYA 3ARTA 4G1EA 2WZ6A 3F12A 3OBAA 1YUKB 5IVOA 2VDLB 2H3NB 1U8OB 3UDWC 3KDMA 3NZ8A 1R19A 2ZUUA 4PJFA 1E5ZA 3M1BB 1CQYA 3OKOA 1JGVL 1XCQB 4NWUH 3THML 5D7JB 3LRKA 3I6GB 1KGYE 4BZ1H 4X9BA 2YFNA 3NFPB 5MEQB 1JHLL 1N5AB 4APXB 4KXCA 3SOBH 3E0GA 3IMSA 3FRPG 1P7BA 3C6LC 3PQYD 4FRWA 5ETUA 5KVMC 3GMMA 3RZCD 1AIFA 3OC5A 4QTFA 4DHLA 1AKJA 3MRBB 1CE6A 1FDLL 1UT2A 2X4SB 1UUSA 1AIZA 1DFXA 4GKLA 3W9DA 1DJXA 2P48B 3QZBA 4QHUB 5EBLA 2YMOA 5DJZA 2X4OA 2Y5TB 3IJ9A 3OQRA 1J0YA 1SJXA 3EO0A 1EJ8A 1S9XA 2HPOA 2F8OA 5I8CA 5HJ3B 4MA1C 3V4VA 5GJSH 1BVKB 1UZ8A 1YMMB 3NZUA 2Y6SD 3E1F1 4XN4A 3DXAA 1F11A 5CEZH 3REWB 3C09B 1G7QB 1TVHA 2OMWA 4MJHA 3F62A 2E7CA 3WIIH 4Z1PA 5IBUB 5LAPA 2KL6A 4I1RA 2VSDA 1L9TA 3U2SB 4P46B 3LN5B 4PSRA 1MH5B 3DLQR 1OSZB 2UZXB 5CZXD 5CP3A 3W57A 3HS0B 1GGCL 4DQOL 4PR5B 4KFMA 1QSFA 3DRTA 3O2VH 3RGVB 3D4YA 3FO0H 4OBRA 3OR7A 5KSUB 1EO8L 5E6UB 2QVIA 3ARSA 1HX0A 1ORSA 1J5CA 2CIIA 5LGHH 1A47A 5CZVL 4IBSA 5FM5M 2EQDA 1QLFB 4PJHF 3CX5J 4M7ZB 4MJIA 4W68A 4NQXA 1DLFH 3WXVH 4DP9X 3ULAB 5L7XH 3VGDA 4R7NA 5JPNA 2VL5B 2JH2A 3HZYA 4OZFH 1JNHA 3RRQA 1JXKA 1GOFA 2OZ4A 1C7TA 2ATKA 4ODSL 3S4SA 3NESA 4Z77B 5BCAA 3G5VB 4BUGA 4XX1G 3V0WL 4F7TB 4LLDA 3HS9A 1HXMB 2V7HA 3QK0A 3X3GL 3RGHA 1M2OA 1IC4H 2VSCA 2YPKA 1QFUL 2XWBA 3ROLA 3IGAA 3Q6FA 1KB5H 3RWGB 1KJVB 1NZRA 2RQ8A 5GRJH 4AIOA 1U33A 1X4YA 3ME0A 4FADA 3PP3H 1AI1L 4NIYE 3T3PE 5KANI 4L0YA 2WXMA 5DS8A 2CRMA 1QABA 4PHXA 1XCXA 4FQJL 4RNRA 3P73A 3L3IB 3VSQA 1I31A 4N86A 3CLWA 3GLZA 3Q1SH 1MFDL 1U4FA 4YXLH 4Z7UE 1V7ML 1R1CA 1VGEH 2DLFH 2VUKA 5EIIG 1CD1B 1YMMD 2WVSA 1QO3B 1RL1A 2HKHL 3QUZC 3PP4L 1HH6B 5BUPA 4OCXL 4WDIA 3QXAA 2QTVA 4LEBA 3ZKXB 4P23C 4QRUB 3NAAL 3EBHA 2YN5A 4X4MA 1MNUL 5CR8A 3F2LA 1E5AA 3LNIA 4NRYA 3WS3B 4Y1AA 3SE4C 4F7MA 2DQHH 2VIRB 3FHQA 4BDVA 1U3HA 2YK1H 3U4AA 4BK5A 1W0WB 1ITBB 3RGVD 3EYUL 5GSVB 3BQUC 2DYPD 3LS5H 4UCFA 5DZVA 3OGOE 5HHNB 3KEHA 4LB8A 4TTDD 4YHKL 4U1HA 4K7PH 4HJUA 1C5DA 1M6OA 5AOIA 2R0WL 1S7VA 1JXFA 2XPYA 1A21A 2E9BA 5IVXB 4A68A 1ILUA 3UJIH 3MREA 5GRZA 5BV7B 3ZMNA 4F92B 2Y1ZA 3SY0B 4XPFL 3MRDB 2Z31C 4X4XA 3C2AH 4F7PA 1A3QA 1I3GL 2EDJA 2RH0A 3UTZB 3ZOAA 2ENSA 2IBZX 3ATFA 5CJ5A 5F7WC 4RSYA 4K3DL 4P3WA 4X6BB 4NZRH 1I8KB 2W0FA 4Y5XC 5GS3A 4EUPH 5DUJA 1I8UA 5EF2A 3VWJC 3GF8A 3B8SA 4M6NL 4P04A 1TMCB 1FVEB 1QKZL 5EUOF 3GBNL 1URIA 1UHVA 2AJSH 3RTQC 4Z0XA 1FNLA 4IRZL 2MHAB 2PCPB 5BMFH 3DMMC 5F9JA 4PH8A 4HETA 1KV7A 4GINA 5IFAH 2XA8H 4DGVH 3SD2A 1HXYB 2VLJD 3GTNA 1LO4L 2CR3A 2VC2B 5TH2A 3IAPA 2BVPB 1Y1DA 2ZUQC 4PLOB 4PQXA 3VFTA 2ZKWA 4F2EA 3B7SA 4GQZA 5D7EA 2R2BA 5DJDB 3LRHA 5I6PA 2Z6FA 1SY6L 4NIKB 4JY5L 4IMLB 4UQAA 4PD4K 4BINA 3I02B 4NM4L 1UCBH 1WGOA 2H6UA 2J25A 3JV5A 4Y9EA 4AEHH 1M05A 4R5TA 2Y6SC 4PV9B 4NEHB 1FAIL 3WIFB 2HJKA 1IUZA 4TPRL 5LWYL 1I9RH 4O4YL 2L4OA 4ENED 1GYWA 1QFPA 1IAIM 4TVPL 4JPKH 4NQQA 3SDAD 1M9WA 5I17A 3R4RA 1ZSDB 4I3RL 1YN6A 2EEXA 3HC0A 2E4TA 3FJTA 1NEUA 4C56B 4GW4B 2CMRL 1QQDA 2QFPA 4PTUB 1W8NA 5MENA 2R2EB 4JB9L 2GYSA 4GRLA 5CBEB 1E9OB 4OZHB 5LN4A 3B9KA 3QAQA 4N90E 4LEXL 4NWTL 4WI8A 1ZWIB 1SRDA 2D7MA 2DB8A 1DUYB 3I2CH 3KR3L 4KROB 3WFBL 4X5PA 5EULV 3QUGA 3PWPA 3LRSA 2WB1A 2XC8A 4J3WA 2D7TL 3MV8E 4FJ6A 2BHUA 1GTNA 2C9XA 4MS6A 1M1XB 3NIFB 1N10A 2GBTA 3H9SB 3OPZH 3VFRA 4J2QA 1VFMA 1IFGA 1CLOL 1ZV2A 3VFOB 3AWGA 1N0LB 4QNPE 4XNDA 4C4KT 1FA4A 4JPQA 2OYMA 4PB9L 4MDIB 5ITFB 3SDDC 1JWUB 1CFQA 4FKHA 2N1TE 3II3A 1ZLVK 5BV7L 4JO5A 2DMHA 2DDQH 5EBMA 1JGUL 4U1MB 2NY2C 3Q01A 2PMZA 3WTTA 4YX2H 4GSDL 3STBA 1N5AA 3POCA 4V2BA 3JT2A 4Y4KC 1VKXB 3BAIA 1DVUA 1QW8A 2NY5H 3Q13A 5F1SA 3RIFK 1Q90A 4FNUA 5TE6H 3O8XD 2L0DA 2ZUYA 4IJ3C 5DJ0A 3KWTA 3WFHA 4DPBX 5J12B 2WSPA 2W88A 3K2KA 3NDZE 5D7LD 3FOLA 1QASA 5CAYB 5KG9A 3GK8L 1U8MA 5K1JA 3GPEA 2ZPKL 4IKIA 3WJJC 2J1ZA 4AVKA 4JRXA 4L1BA 1O6TA 1JJUA 5DEGA 1BVKA 4MQXC 2NSXA 4G6ML 1F3JB 4FLHA 2OK0H 3NEOA 4PJ8C 3PXJA 2FIRT 4C56D 1GMEA 5JYLA 1J1PL 1JFQH 1A6PA 2UZXA 1LO0H 2VLKD 3KVPA 5IB4B 1MFEL 1F86A 1IQWL 2R7EA 4R4ND 4ZW5A 4ZMLA 1AHMA 2XWJA 2ZNXA 3BDBA 4EOWH 2YPVL 3FB7A 3Q5TA 1WBZA 1MNNA 4OD1L 4GOSA 3RJDA 5F96L 4OZIE 1NCJA 3I50L 4GP4B 4XBGB 3T0XA 3PY9A 5E56A 3O2WL 1HNYA 3MA9L 4KJWC 3Q8FA 5FYLE 3F3HA 3QJOA 1FL6A 3BJ91 3MBWB 4KROD 4WHYG 5GS1C 3MCLL 5E4EC 4HKJA 4PJAA 1FJ1A 1NCCL 3LAFA 2YC1A 1QW9A 4IRZA 2BDNH 3WY3A 3H9SD 4F57L 2ZP8A 2AGJH 3DX7B 5G55A 5GGSY 3AJ7A 4Z7WA 5HI3D 5GGQH 5EOCJ 1ACZA 3PWNB 3EJUA 1G1CA 3QIWC 4Y2DD 1XGQA 1X5KA 3B1UA 4KI5D 3ZYOA 4MZ3A 1UM4L 1N64L 2NYYD 2XVGA 4F7TA 1H3PH 2OM5A 3US9A 2Q7YA 2BLFA 4IRJC 2R1XB 1LE5A 1BVNP 5EG6C 2A9MH 1J8SA 5IP4A 2P80A 1VEPA 1KJVA 2NR6C 1UGKA 2FATL 1YEFL 1U95A 4P9HC 2BIOA 4B6ZA 1G1OA 2Y1AA 4C58B 3H7LA 1CPUA 1WIUA 4OQ1A 5GIRB 5I66B 1E7VA 2YS4A 4O51A 3WFCH 3HR5A 2E46A 5DQJA 2ADGB 3ULVF 3ATAA 1SOKA 3QC6X 3UAJD 3ZMRA 3VFSA 2H2PD 5FUZL 3D09A 4IOSD 5TGBA 2VDKH 2ZX9A 4V1DD 4MHHG 4RBPK 3MV9B 1NLBH 5ENWB 1Q9KB 4YDIL 4TNVK 4DETA 4GXUN 1NKRA 4QRUA 4TF4A 1T2QH 1S3RA 4L3CA 3ULUL 2B15A 3CZEA 4MJ6B 1UWXK 1U0QA 1UXSA 1NGYA 4TL4A 2M8XA 3CAFA 3ILEA 3MRMB 3UPCA 4YHYB 3EH1A 5KVGL 1TQCC 5CLTA 32C2A 2EYTB 2DTML 5HHOB 2Z4QB 5GSVA 3C12A 1QWHA 3WUWA 1NIBA 3MV11 4FS0A 2WTRB 1L7TL 1UB5B 2W65A 4QGTA 4QXTB 4Y19D 1J5OH 3WXWH 4N2LA 4JAMB 2X9WA 4OT1L 3EGDB 3IFPA 3JV4B 4HBCL 4HA1A 1D5ZB 4G83A 4J8RB 1R0AL 3MYZA 43C9A 1L9PA 1QEWA 3IRCA 3Q2LA 2YAMA 4APQA 4XNBA 2QPDB 2WUBL 4YE4L 2VXUH 3SY0A 1ZGLP 3R1GH 1GGBL 3F00A 3QXDB 2X4NB 1UOLA 1JHTA 1FYHB 3F7LA 4G8IB 2YA0A 4JFFB 3HKFA 4MA8H 4BSJA 1AXSB 4K2UL 4FNLL 5EO9A 4NC1E 2MQ0A 2OSWA 1OANA 1AD0A 3L9YA 1EHKB 5JHDB 3D85A 3FUHA 2OJZL 2P44B 2VR8A 3QWOB 4R2GC 4PYHA 3TZVA 3T6XA 1AG0A 2NT1A 1KZQA 3CFJB 1D5IH 3A21A 5AL8A 2X12A 4ZYKB 3KPQA 5ESQA 2BVEA 4U3SB 3ZDXE 1BYPA 1UTDA 3EJSA 2LE9A 1YAIA 2A5UA 3LNGA 4XN1A 2YMXL 5ERWA 3DOIA 4AYMC 1GC1C 3BWUF 1MJUL 4U6YA 1RUPH 3CLEH 2WP3T 4NJ9L 4C4BA 3T0EA 3ARBC 4PJCE 5L2KD 3GSOA 2JELL 3O8XC 4AQEB 3QDME 5IR1B 2BVPA 4CKQA 2NY1B 1M4KA 1TOXA 3HB3C 5D71H 2YGOA 1N18A 4X8JB 1IAIH 2W59A 3ULVC 4KDVA 2FLMA 2GBUA 2YJLA 4LSPL 4G71B 4ALAH 2WCSA 4IKNA 5BPPA 4RCAA 2NX5B 2YPVA 2EO7A 2AI0L 3C5ZC 4JM4H 5GZNA 1ZJAA 5TJWK 4GMTL 5MEOB 1D9KB 3IM1A 1L7IL 1KTJA 2IANA 2IWFA 4M5SA 4U6VL 3S96A 4UTBA 1RUQL 5HHQB 3BPLB 5ID1B 2F58L 4QUOA 3NN8A 4NI6A 5KANG 3AAZB 1P5UB 1FWXA 2GG1A 1NM9A 1ZMYA 1OOWA 5HHOD 1Q94A 2EO1A 2XIIA 3HUJB 5E0QA 4WW2A 4GT7A 2WLLA 1LEIB 5E2VH 1SZNA 2F53B 2QQNL 2UVEA 1A7QL 1FCGA 1G0YR 2FTAA 4OZHA 2WAHA 3B2VH 5GGTH 1A6AB 1I4FB 4HXAH 4U6TA 5KS9A 3VFUB 2KMWA 3VFMB 4XVUD 1ZA3B 3VE0A 1IV8A 2G2PA 1MIML 1SHWA 4JFFD 4EN3C 3FU9A 5IV2A 4FFZH 5CCKH 1M1XA 3FK3A 1LO2L 2FZ3B 4M7LT 4N2NA 4F2MA 4F7EA 5JHDD 4HLZG 4KV5F 4AV0A 1A7NL 5T33L 4GXFA 1UYWH 4EBQL 5AAMA 4BH7B 2KHAA 1C12B 4UV4L 3E6HA 3QCVL 5AZUA 3U2IA 5CIPA 4CSTA 1WTGT 3TJPA 1PSKL 1JXJA 3VGBA 3E8UL 2A77H 5I18H 3EH4B 5J9PB 5A2LH 2CJUH 4U1GB 3D2UB 4JK0D 3BWUC 1IC5L 3QFJD 4DPRA 1JRHL 3MACL 4N28A 3I6SA 1PZDA 1CDJA 3L4UA 4TNEA 2ZOKB 2NY4B 4KKLD 5AW4B 3MGTA 2NY1D 4MJ5B 3T8XB 3J7HA 1Z9OA 5DSCA 1OAZH 1H5BA 5IW6A 2E6PA 5D1XA 2GY5A 3WO3B 2NX5D 1PLGH 2YPLB 5F7DB 4C83A 2HG5A 1F8TH 3QGVA 1YYMH 5E8NB 5M95B 1P4BH 2XZQH 3MBEA 4WI0B 4QGYA 4RWHA 4WJ5A 2QR0A 4KKRA 3BVUA 4OIIH 2NY3C 2HN7B 2I25N 2V9RA 2AV7B 3NG5A 3MNVB 3QI9C 5IG7B 1F3JA 3VRLF 1SXAA 1NGQH 4G42B 3DKHA 1KB5B 3DX6A 4QYOA 5AVWB 1T0MB 3G5XB 5EFIB 1M1SA 4DK3A 4EMZA 1BQ5A 5ESVA 1MJ8H 1THAA 1T7ZA 1MQ8A 1OHQA 3TFKD 4OCYL 3QW9A 4XPAH 4WUKH 3GM8A 4NHUB 4XP9H 5FOBB 5LGJB 3I6KB 2J73A 4RFNC 4ONHA 3RPIB 3HZVB 2FX9H 1BFTA 1BF2A 4AC4A 4F1ZA 4GG6A 4BD4A 4KQ0A 4ZBJA 4ORGB 3U7YL 3MAWA 2JSFA 4PJAE 3QEQB 5E2TH 5HGGS 4K7PY 1AD9A 1HE7A 4XAKD 1ZLWK 2DQIH 3BUTA 5GPRA 3VXQB 1KC5L 4K8RH 5IJDC 3FUFA 2F54B 1KFAL 1GAFH 1A4AA 3DX4A 4XO8A 4Y4HB 1J48A 4XHQA 1HEHC 1JL8A 4J2XA 1NMBL 5AKRA 3V9FA 4CBZA 1U58B 7FABL 3L8QA 2JIXA 1O7DE 3PWNA 3VFPB 4WO4B 4IBUA 4B97A 4PGCA 5DZJA 5BS0B 2Y7OA 5L8KB 3QIUA 4CU7A 1QBLH 2HX9A 4J23A 2VABA 4ODVH 5IMLB 5LBSL 5BNXD 2ZX8A 4M5YH 4NO2A 2GJZA 1DJHA 1NCDL 3H2WA 4IIZA 1RP8A 4KC3B 3VCLB 4U6XA 3D2UD 4AUYA 4EI5C 5EOQL 4M8QB 1S6NA 4P49A 4YQXL 5AYQA 4LSRH 5TQ0L 2R1XA 3GLDA 3H3PL 2Q86B 3HZMA 2NY4D 4W1TA 3NGBB 1KTDA 4YHMH 1YEIL 1R5VB 4G6JH 1ZHNA 4OZFG 5FKAB 2MQGA 2X2YA 3DJTA 2YD2A 2YPLD 4KI1A 4NENB 2ADGA 1SN5A 2P24A 4I9WD 2VQ4A 4EUPB 2ZWYA 4LVHB 5JDSA 4N8VB 3UG5A 2OR9H 3VXUB 1K85A 4XMUA 4ONOA 1JPFA 4OCRH 4ODBD 1IAII 2B0SH 4UM8A 4H26A 1ZSHA 3DOSB 2QSCL 1J0IA 4WEBL 3GSNB 1Q72L 4LDCA 5INCB 2BS9A 1G7HA 4M6OL 3ARRA 1EAPB 2VZUA 2XZAH 4JQIL 4MJ6A 4HS3A 4NGHH 5DVNA 4F5CA 4ZQTA 3DDFA 3N0AA 4W6XB 5BXFB 3TJHC 3Q2WA 1KGJA 1M2VA 3MSPA 4ZMVA 3TBVB 1XT5A 3MA7A 3V6OC 3BP5B 4YXKH 3V8OA 2WTRA 5D7KE 5ALCL 2HFEA 1ZHBB 4H4NA 4QRAA 4CADA 1F90L 1CFSA 3D39E 1PAMA 1BBDL 1RFDH 4JPVL 3POHA 4AT6B 1KYAA 5TDPB 2XFXA 5FYKD 3K6FA 4XNMB 2F54D 1TT6A 1A5FH 4ESKA 5L4JA 1OPGL 1EJOH 2XTJB 3H6AA 4FCAA 4JRFA 4ANKA 5B8CA 1TYRA 4MXVF 4NI3A 1O6SA 3BOVA 5C92A 4FE9A 1KLUB 2DIBA 3HC3H 1J12A 2OX5A 1A3ZA 3QUXA 1SJHA 4RGNB 1DQQA 1JNLL 4UUJA 3BO8A 4N6RB 2EIMB 1DCEA 1IGTA 2ZKMX 1ADQL 3B6SA 4AMKH 2AQQA 3B2DC 1EGJH 4S1QH 2ESVB 1KIPB 1NGXB 1NUFA 2BC4B 2FJHB 4KQ3L 4EKXA 1UKSA 2YRBA 4I3SL 3BD4A 2J3SA 4KY1H 1TVBB 1NFIA 3SCMA 3VO0A 4DVRL 2PTVA 1WFOA 1HH9B 5C0NC 1IBGL 1RZJL 4HZ1A 1YY8B 4NAQA 4PJXA 4PJBF 2ZTBA 1ED3A 3ILQD 1G9NL 4ZQKB 3MBXL 4Q6YA 5I5RA 4N0CD 1RERA 1E6JL 3OXRB 4GYBA 2HUEA 2HFTA 1G87A 1T7WA 4X5XA 1NCGA 2P8LB 1YEGL 3UC0L 4K15A 4PD4J 4GXUM 4ORZC 5F88A 5DLLA 2E7LC 3IMWA 3BSZH 2E8ZA 3VXUD 3ZT6A 5F89B 5FWRA 4R9HA 4JJOA 4N2IA 2ILLA 2BCMA 2JTYA 1D9KA 4M1CD 2P3YA 5DEZA 2PWFA 2GB2A 4CUCA 1MEXL 4YLBA 1PEWA 2VYRE 3VVWA 4DKFL 1TTUA 4UOQA 1KYDA 3IDMB 2HA1A 3NACH 5CWSA 2W07B 3V0HA 1SLWA 5TF1L 5FHAL 3MCYA 3V0AC 5E5MA 4FA8A 1P5UA 3IDYC 4F24A 3T08A 4PSPA 3RVVC 5DRWB 3KPRA 1JNNL 1NFDF 3IBOA 3OX8A 5CU9A 1RCYA 3U0TB 5ICXA 3CBRA 1WWAX 3ORJA 3BUDA 3OLGA 4MTMA 5IFHL 1KGCD 3QDJE 5AOZA 2Q2EB 2VL4A 1NSNH 1OCCB 2JV6A 3ILPA 4HC1L 3HHSA 4GW1A 5KS9E 1EEZA 5LBSA 3BRGC 1ET5A 2BNQA 4ZSOE 4EQ2A 1K2DA 4UOW0 2NXYD 3BW9B 4HIHB 3MLRL 4LCWA 2NDFA 4YSRA 5F7KC 4PJEF 3RWJA 1JWSA 4XBPA 1BM3H 3PL6B 5EA0L 5GISL 4PY7A 5LXGH 2LV4A 1N7ML 2I9TB 3SDXE 4YXHH 1ZIAA 3EBGA 5EB9A 1LE9A 1D2OA 1GOHA 3GI9H 4L3EA 4OGAD 3NPSC 5C07E 4Z7NB 2EAEA 3L9BA 4TQHA 1MZZA 2OYLA 4DERA 2DQEL 3O6FB 3B4NA 2A83B 3GHPA 4DAGH 4ZW6A 2AK1L 2ESVD 2EYSA 3N41B 3UH8A 3UTSA 2WK2A 3K6DA 3N9GH 2UXVA 1D5XA 2LU3A 2G3NA 3TYGH 4YFLI 1QFWM 3C5XA 5INDB 5KYYB 4L1DA 4Y7OC 2IQAA 3EGXB 3QJQB 4GKOA 3AY4C 2AJYH 2OFQA 1OAKL 2DWEB 3IGUA 4JFSA 4LO9A 4E5XB 1RZ8B 4AQOA 2ARJA 4MJ5A 4NN7C 3S5ZA 5J4MA 4NKDA 3A22A 2Z64C 4KKBC 4YHPB 2EDLA 2DY2A 4JQIA 1E28A 3MNMA 3RUGB 4K7PX 1CVRA 4F7CB 4QPEA 1SMDA 2QPFA 1B6DA 3TJEH 4UQDA 2CM5A 4BQ9A 1XX9C 3LVEA 3QQ9D 3ARPA 3GO1H 2NQCA 4HFWA 5F0JB 4BRJA 2CBMA 2GC4C 4WGWB 1DTUA 3KYMB 4XMKH 4ZS6C 4FC3E 5IB5A 1UA6L 1B3IA 1XFPA 1CK0H 1FC1A 2XFGB 3AS0A 5BUAA 4UWQB 3QWNA 4B41A 3LNHA 3HE6B 1HHGB 5FW6A 3WKQA 3LKRA 4J28A 3ZL1A 4FLRA 3VD9A 2J5LC 4IS6B 4KTYA 4N3TA 4MA3B 2WW8A 1HS6A 2OMUB 1N70A 4TVSa 5F70A 4G5ZL 3BN9C 4JDVA 4JFYB 3IPEA 4L9LA 3KBEA 5LG6A 2AERT 3MRGA 1ADQA 1AC0A 5AUMA 4QRPA 4WV1A 5C0BE 2XG5A 3MMEA 3ABKB 3QEQA 2CO4A 2Y07H 2WQSA 3GBLA 5CINH 2GI0A 4M7JL 4OGXH 1SN0A 3PL6D 5DGQA 1JBJA 4Y4HA 4FXLA 3BCFA 1MCPH 2K8QA 1UD3A 2B3RA 3QO1B 1LTXA 4LEEA 4QKTA 4F37K 5ANMA 4IBTA 4BH8A 4M48H 3LEXA 4WO4A 4YHOL 2WXFA 4J6RH 1R24B 2H32H 4NKIH 3QORA 2ATAA 3ZYIA 5IMLA 3ISYA 4U1IA 3ZE2B 1IARB 2HRGA 4LQFH 4K5NA 1HAWA 3ECBB 3FU7B 5KJ7E 4B9FA 4QF1B 4ZS7L 3L7FA 3ARGA 3GZPA 3L4TA 5FLUA 4P8QA 2QADD 4A2LA 1IEAB 3P11H 1A6ZA 5IGXL 2D7OA 2D2OA 4AENB 4ZMAT 1BQUA 1IVTA 4KDTC 1PW3A 4I0KA 3IRZA 1AXTH 1BQKA 1I3RA 3L95B 1DDHB 4LSVL 5C08E 2X1WL 4IRSA 3FUJA 3I9IA 1GL4B 3FFOA 2H47C 3NA9H 2FECL 1HFUA 3F7RA 5GS0C 5IROC 4YH6A 4P2QD 3PWUA 2B1AL 5C0GB 4HUVB 1EZVY 3CBKB 1DQTA 4P2OA 5EU4B 3DO7B 1H6TA 3AU1B 3BVNA 2C8NA 3GSWB 5DEFA 2LU4A 4ZUTB 1GJUA 2QPSA 3V0EA 5D4QA 1W91A 4JDTL 2ODIA 3FT9A 2AJXL 4EN2A 3IFLH 1AHWA 1XL6A 5DLML 4BQBA 4MNHA 3LHPL 2Y5EA 2AQPA 5A3ID 4E9LA 1F4XL 2HWZL 3KGSA 4LLYA 4PJGF 4ODXB 1X7TA 4WU7B 4L1HA 4FQ1L 5DFAA 1INDL 1F1AA 3FYEB 4OI9A 4NQTA 3E7JA 3TBSA 2YD1A 3EYSH 4MAYC 1ZHBA 4L5FH 1ZGLB 4H0LC 5EHFA 3RVUC 2Q8AH 5K9JH 1I1FB 2BOCB 1H3WM 1ZTXE 3NCBB 1M57B 4JFDA 2H8PB 4FTVE 1XGUA 1M7DB 2I07A 3OV6A 5CFHA 3L2LA 5DUBA 3PWVA 1D5BB 2NXYC 3ZDWA 3DURA 5F7NC 4ICXA 2K6WA 3OSKA 4XP6L 2FD6L 4Q2ZB 3LPPA 4J1UA 5I6XC 1BQHG 5FO2A 1LP9E 4OGAC 4QRRE 1BVLB 1KT2B 4N0FA 1D5MB 4HVBA 2ORBH 4D0BB 4M3HA 3OZ9L 1AJ7H 2HLAA 3CHXA 2FK9A 3QZOA 1WZ1L 4OTXH 2HYMA 5A43C 4OLUH 2ZNWA 2VLMD 1NGXA 1FSKB 2BVOB 2ZOTA 5A40E 5BRZB 1MCCA 3HJEA 4UI2A 1FFOB 1ZIBA 2X1QA 4RMVA 4CN6A 5F1IB 3A4AA 2ETWA 2EVFA 3DO7A 1J18A 2DJ4A 1FBIL 1OM3H 4PJXE 5HPMA 2UZPA 1WT5A 1EXHA 2CGYA 3NUKA 1P1ZB 3U9UA 2WIIB 1U91A 1DBJL 2ZXEB 1R6VA 2CO7B 3JT0A 5CSGA 4PMEA 5DJCA 5F7EL 2XV0A 4G11A 3NJLA 1EMTH 2F15A 3HPLA 1ZLUK 1CDIA 5HYSB 3U83A 4UQBA 2J71A 5J11C 3IDJA 2FGZA 3OKMB 4FFYL 3ZE0F 2DQCL 3O9WA 5D7HA 3OMNB 1DBAH 2CLVB 4X6DE 4PUBL 4O2FB 4GAGH 4A7GF 5KVDH 5DHVA 2NW2B 2A1WL 4HWZB 4U1JA 3CVHB 3TIDA 1NBQA 2CAKA 2NY5C 2VR6A 1TZOA 3AXLA 5AB9A 4BFNA 3KGRA 1F18A 1G7PB 3BQUB 3LEYH 2YLKA 3W9EA 3O3EB 3HKZA 4U1LB 3KJ6L 2GJ6E 4AV4A 1KYOK 5SX5H 1R3JB 3LNEA 3WN5B 4RZCA 3VU1A 3BP7A 3GKWL 5F44A 3CQPA 4BK4A 3FT3B 1HI6A 1UM6H 1QPPA 3GMQA 5DR5L 3P2BA 3VGFA 2V2TB 3TCXA 4Y16B 3N1QC 5F93C 1PY9A 2EDNA 1IEBB 4JFZL 4WWKD 2Z31B 1PCXA 4CMMB 4B9IA 1NL0L 4FX5A 1WYJA 4PU2A 3MODL 1DVFA 5E08L 2AP2A 1P1VA 5I1EL 1KLFA 2E0PA 2MOGA 4X7SL 1D2PA 2WLZA 4B27A 5B38G 1X3DA 2OW7A 1OGAE 2KZKA 4Y5XB 4PJIA 2QLVB 4KUCF 3WLWC 1WD9A 2ZYHA 1I1AB 4I77L 3BMVA 3VWJB 3K7UA 2G0KA 2WBJC 4P4KA 4HJ0C 4HH9B 2UZIL 1NC4A 1S2EA 5BRZD 5A16B 2LLNA 5JR1H 4J7RA 3ZKMD 4PGBA 1YPZA 4RFOL 4W9DC 4JANB 3GKZA 4ODHL 4XP5L 5A2KH 3VXSE 1G9MH 4KK5D 1PZ5A 1DN2A 3PUUA 1P4LB 3EHBC 5T1LA 4OCSL 4E5XA 3HE7D 5FYLH 4ZMYA 4ZTEA 3HJ0A 5HDBE 3PDDA 5EC1B 4GG8B 2YGQA 1N6QL 2PLTA 1HL9A 5E6IC 1YA5A 1NAKH 5DWPA 2FQFA 4FABL 3QIBC 4J3XA 2FJFA 5TE4H 1XSOA 1H8LA 4HIXL 1CYXA 4RLDA 4AQ1C 1BOGB 5IQOA 2OMYA 1AFVL 1UZGA 4UM9A 3ESOA 1DVXA 2G5BA 4HKZB 4ZK8A 4FG4A 4LKCA 2PR4L 2Z7UA 3ES6A 4ODUB 5KSAC 1ZHKA 1B9ZA 2X4RA 5EBGA 1DQDL 1VGKB 3N85L 1LO3H 1ZKAA 5AG8A 2X4TB 2J4WH 4QT5B 2HJLB 4IKJA 3BHBA 3CIQA 2MPAH 5BW7A 3TA3D 1MY7A 2FJGB 4OLWH 3ARED 3W81A 3FMGH 4M43L 4JFEE 1MCBA 1JF6A 2JCCA 3PJSA 2VDPL 3RAJL 1BD2B 2WOBA 3NJXA 4Y16D 2EDXA 4XCEA 4B60A 4MAUH 2WWMC 4HJSA 3MRPB 1ACCA 1RZ7H 3WNIA 1SLVA 3CVHL 1OSPL 3MZGB 4MNQB 4WJG3 4PLNC 5IROD 3S5LG 1MCJA 3QJTB 3VXRE 1EZVX 3VJ6A 3LKQB 4S1SL 3U46A 1CFVL 3UZQB 2CLZA 4XN2A 2BERA 4NXSA 1KBGL 3AY2A 5LHDA 4C59B 4X42A 2X10A 3PLYA 1A6WL 1I1AD 5CBAA 7PAZA 5I1CL 3WKMH 3BDXA 1TKWA 3MUGB 2WO2B 1Q9LB 3BMWA 1R24A 4WI6A 3SDDB 5EUOB 2GSMB 3MC0A 3UDWA 2RAMA 3BC9A 1I3VA 2JJTC 3AWEA 4AEEA 3MLZL 2JE8A 4QRBA 2WIMA 2NY2B 2EADA 3L17A 1K5NB 5AW6B 4R96B 4FFYA 3ZUCA 2DQGL 5DU7A 2EIJB 5HYFA 3IU3B 4HS6B 2FVNA 2BSDA 2OMZB 3APNA 2PCYA 4JO3H 2R4SH 4Y4KB 2MNJB 3C6LA 3CG8A 3MUZ1 4LSTL 4TUKH 4YO0B 1Y6NR 3KNBB 5D6DC 4IJ3B 3BIAX 2FBJH 5E4OA 4LNVA 1KEGH 4G8GE 1ACYL 2UWEE 1HHKB 1JMZA 2OTUB 5K9OB 5IFJB 1CGXA 4PRPA 1R3IL 4UTAH 3VMNA 5E9DA 5HY9A 3MV7E 1UOWA 3STLA 3Q2NA 4UQ3B 2IPKB 5D5MB 3CVIH 1BPVA 5EUKA 5DMKB 5DFVC 5HVHC 3BT2L 2DM2A 3PF2A 1NEZA 3F7YA 5D4JA 2B5IB 4BZ2L 3N42F 2QGEA 2XN2A 4PJ8B 2HLFD 4A1RA 2DIEA 5FDWB 2VB5A 2A6DA 2ZCLH 1TTCA 1X9QA 4MVBD 4KTEH 5B1AB 2LW3A 4CU6A 3MRIA 4LIQL 2XZCH 2V9UA 3PUCA 4JO4L 4Z7VE 2C1OA 1BD2D 5D2LA 4R26L 2DLGA 3IVKB 4L0ZA 1IC1A 3REVB 4QXUH 5C0AA 4MNQD 3K2UL 5E94B 2GSGB 4QO1B 3L3HB 3NIGF 1A4BA 4N5EC 2VN7A 1WFIA 4JKPL 2EZ0C 2DJUA 5EZOH 4FZ8L 3H0TA 5E99H 3FCSA 3ZKSD 3N5AA 5TFSL 3IJEB 2Z7WA 4L8SB 5I75C 1DN0B 1SUJA 4PRIB 2R0ZH 4B9CA 2WNXA 4GBXD 4HIJB 6FABH 4LT7A 1PZ3A 5SWSB 2BSRA 4NN6C 2O5ZL 4MCYB 3MLWH 1D6EB 3FTGB 3EYOB 4FG0A 2J8UE 1QFWI 3BD3A 1AZRA 4UQIM 4JPWL 4LEOA 4JKKA 1AG6A 4BK8A 3D9AL 3G6DL 1DDTA 1LDSA 1U8KA 1FFOA 3QQ4A 4DGYL 4M1GL 2B59A 5I73C 1N0XH 1TYEB 2NXZC 4NFBA 2AK4A 2QQKL 1ONQA 4I2XA 3HE7C 2YSTA 4O9HL 5AVZB 3UGEA 2EDBA 3BZDA 1U21A 3ARDD 4AMXA 4TSBL 5E95B 1CGSH 2WIIA 4HHAB 3QT2A 3D8MA 4DN4L 1IM3A 2XWRA 1QYGL 5IVNA 5AYTA 1MCEA 1ZV9A 4ZAKC 3ELAT 1C16A 4XVTL 5F72S 2P7TB 1F97A 1WFMA 5CLWA 1EX0A 2SEBB 3OKMA 4ZXBD 3QUZA 2N4IA 5CSZB 4XH2A 3V8CA 2L7JA 3W38A 5IHUL 1N12A 3FQRA 3N40P 4P23A 4FQPA 5GRVK 5B39G 1FCCA 3DETD 5KVFE 4A7SA 4HWZA 3NCJL 1O7VA 4PLJC 5FR3A 1H15B 2Y4SA 4U05A 5CUSH 3SE4A 1ZPLA 3VGGA 2WBWB 4JJ5B 2G9KA 2WO4A 3BVTA 1INEL 4L05A 4WU5B 2DJSA 4G72B 3AREC 3BQUA 2A0LC 3RNKB 2F7RA 2J1KA 5C0CA 5EN2B 4BFKA 2CRZA 3CH1A 3VFGL 2KT6A 2A4ZA 4OQTH 4KMTH 4OLEA 3MR9B 3H85A 4HUXA 2IXQB 5EU5B 4PJHA 3P02A 4NNXA 1PU0A 1Y0LB 3GHEL 2WNWA 1TITA 3CFCH 5EEXA 5J1AA 4AW4A 4O58L 2BS8A 3WO4B 4CMMA 2VXQL 1QZ1A 2PYEB 4JG1L 4Q14A 5L88H 5D96B 4NQCB 3FU8A 1UM5H 1IO4C 4AK1A 2GJRA 3OAUH 4BFIB 3OKLB 4JL2A 1A2YB 2EVIA 4XXWC 2R56L 2H1PH 1R75A 2WXPA 3R8QA 3SYPA 5FECB 4L23A 4PS4H 4HPYL 2Y25A 1QTSA 5A16A 3RTQA 5GRVL 4XO3A 3I3DA 4A7UA 3DMMA 4OD3L 1JZDC 4BFOA 3FRPA 3S97C 3C8HA 4WQOA 3T09A 4BSVA 4K8RC 1MQKL 2VW7A 3ABLB 1MFUA 4P5KB 4RMRA 2ITCA 4UB0H 4XOEA 3S0PA 3PQYA 1C1EL 4Y88A 3ARBB 1ADWA 1EEUA 3H42H 2HRPH 4WI2A 2C3GA 3HB3B 1LWRA 1N5YL 1NCBH 3CV5A 5EC1A 3CDGB 4WTQA 3GMRB 1ZDQA 2C9PA 1CGUA 1EPFA 5EU6E 3TEWA 3WJMA 4I1NB 4ZO7A 5JHMA 1JPTH 2RMNA 3VAEA 2H0JA 2C7FA 1BAFH 3QJZA 4QXVA 3V5HB 1BPLB 4WKXA 5ANHA 4P9HL 2P5WB 3B7RL 1YJDH 1H9DA 4Q97A 1J0KA 4AYFB 3CFKA 2ZUXA 1JPST 4N87A 3TIEB 4PRHB 1CJYA 4ZUWA 1OTUC 4OCLC 3X3FH 1V8HA 5TQ2L 3WMQA 5KSBF 4FQCH 2QHRL 5TDOA 1Y6MR 2BY3A 4H8QA 1E4HA 4ZFQA 3AS3A 4XODA 3SOTA 5DK0B 3UX9B 4Z6AT 4P2CG 1KPRB 2F61A 4PMFA 3I9GL 2YXFA 3WAKA 5MHSE 3GIZL 2E9WA 4JN2B 3WLBB 2E6QA 1NAMA 3D69A 3TNNB 1XIWB 4FFWC 4LMQE 2H1LM 2AEQL 4X7CC 4LASL 1AGEB 1IJ9A 3B2XA 4KJQC 2APBA 2VE6B 5JPMC 1ZVYA 1TU2B 5IQLA 2F68X 1B2WL 4JZJC 5T1DL 1WC7A 2ZKHL 1AGCA 5AG9A 1OARH 2H0FA 3JWNC 4XOCA 1BVOA 5DWUL 5CSBA 1BQLL 1OQXA 2EDKA 2WKGA 1X4XA 4GBXC 3X1NA 5D72L 1UKTA 3TO4B 3NCEB 5ILTL 4AL8C 2PPFA 3SDCC 5IUSA 1Q9LA 4PPTA 5T3XH 3OJDB 25C8H 5EUOA 2EIZB 5K1VA 3ZGIA 2WPGA 5AW0B 1SFDA 4AQ8A 3GZOA 2Q76B 3HG1B 4P5RA 4PRBA 1FE8L 1WHPA 3L1GA 3ZZLA 3F64A 1KXQA 2GTWB 5AW7B 1LM8V 1S3KL 3QQ3B 5IMOA 3MNWB 3MRLA 2WWKT 4Y4KA 1H6UA 1M3JA 4NERA 2Y1VA 4YO0A 4A2GA 4JFPA 2DI9A 5D7IA