2PP9A

Nitrate bound wild type oxidized afnir
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Conserved active site residues limit inhibition of a copper-containing nitrite reductase by small molecules.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 91
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp9A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp9A02
1GY2A 1A8ZA 2WSDA 5B7EA 4F7KA 1PLBA 4F2FA 1TEGA 2IAAC 2OV0A 1A4AA 2OJ1A 2VW7A 2DWTA 2VM4A 2XVBA 4Q89A 5F7BA 1NZRA 3SQRA 1V10A 4KOBA 1ASQA 1JXDA 1JERA 2YAFA 1SDDB 3CDZB 4HAKA 2BHFA 1L9OA 3X1FA 1BXAA 1OCRB 1A4CA 2AVFA 2BP0A 1TKWA 1ILUA 4DP7X 2WO2B 3KW8A 1RKRA 3NYKA 1M57B 3GXUB 2PP7A 2ZXWB 2IDSA 2HZHA 3T6ZA 1BAWA 2BP8A 3HEIB 4ENZA 2JXMA 3EH3B 2DY2A 2IWEA 2EILB 4BXSV 5I5MA 2P80D 1URIA 4HHWA 2TSBA 2GBAA 2VW4A 1JXGA 2IWKA 1RZQA 3FSZA 3OM3B 3NT0A 1ID2A 2FTAA 4A66A 5E9NA 1GS6X 3DTUB 1XB6A 4G72B 5I6OA 4YVUA 2Q5BA 1AZCA 3WIAA 4A68A 3OMNB 2H47C 2QDVA 3FU8A 4YVNA 2B08A 2YAEA 4KO5A 2YAHA 5D4JA 9PCYA 4DP2X 3IEAA 3UACA 1GW0A 1PLCA 1PNDA 1DZ0A 3N55A 3T6VA 1ET5A 1L9TA 2VMJA 3TU6A 2IDTA 3OMAB 2AANA 5LDUA 1BQRA 3FU7B 4DP5X 4W1TA 3V9EA 3IE9A 1ZPUA 1GR7A 1AR1B 1XMEB 5IY5B 5B1JA 4A2DA 3GYRA 1L9SA 1GY1A 2HLEB 1SHXA 2B3IA 3FT0A 1NPJA 3S3BB 3ZDWA 1SNRA 4KNSA 3ASNB 2J5WA 1JZFA 3NP3A 1J5CA 3QPKA 5B1BB 2PCFA 1TU2A 1PNCA 3DKHA 4BK5C 2DV6A 2PPDA 4G70B 4AZUA 4YSEA 5I26A 3NJKA 3X1EA 1OOWA 3EH4B 4KNTA 1OF0A 3NJHA 3RYMA 3ZX1A 1NTDA 5I5IA 2TSAA 4NAJA 2VW6A 2AZUA 4QLWA 3UAAA 1JXFA 4AKPA 2CJ3A 4A2HA 1ASPA 3DIVA 2NRDA 2MTAA 5B7FA 1SHWA 1KYAA 2ZOOA 3FS9A 1AZNA 4YSRA 4CSZA 4KOCA 3CVDA 4FAAB 2BW5A 1KBVA 4GP4B 4DPBX 4E9WA 3JT2A 4WKXA 4E9YA 1ZDQA 3AZUA 4A67A 4E9RA 1GS7A 5TK4A 1VLXA 3AW5A 2GSMB 1SJMA 2HX7A 2DWSA 2P80A 2XX1A 1ASOA 1KV7A 3WG7B 4E9QA 2RACA 3WKQA 4GY4A 2BWIA 1XB3A 1NIEA 1JZHA 3FSAA 4P5SA 1ADWA 2GC7C 5B1KA 3NJIA 2FQDA 2XV2A 2YAOA 2H3XC 1WA2X 2J55A 1NDTA 4YSSA 2DYSB 3HB3B 3NP4A 2YXVA 2W88A 3CVBA 2FT7A 5I6PA 4BDVA 4WTQA 2W8CA 4KNUA 5F7AA 4BWWA 1OE2A 4GP5B 1PLAA 1ET7A 2XX0A 2IDQA 4G7RB 2GC4C 2X88A 1NIBA 3NJFA 2BZCA 1OCCB 2DYRB 1KDIA 1MG2C 2BZ7A 3FQ2A 4RH4A 1X9RA 1L9PA 2FT6A 5FC9A 4K9JA 2QPEB 1AG0A 2UXVA 1M56B 1MG3C 5I6LA 5I6KA 2N0MA 2ZWNA 1IKOP 2HXAA 2JKWA 2EIJB 1J9SA 3FSWA 4GYBA 3JTBA 4DP1X 1IBYA 1MDAA 1PMYA 5AKRA 1X9UA 2E86A 2FQEA 4HCFA 2EIKB 1AZRA 3PLYA 1ZDSA 4Q8BA 4TXVB 4NB7A 3FPYA 4YSPA 1KBWA 5A7EA 2EINB 1JVLA 2WO3B 3NSFA 3MBWB 3S3DB 2FQFA 1J9QA 1BEXA 3UABA 3QJTB 5PAZA 2AZAA 2VN3A 1A4BA 2IWFA 3TBBA 1ETJA 4KO6A 2PPEA 1JZGA 4G71B 2R7EA 2UX6A 4MFHA 2J56A 3PCYA 1FWXA 1GSKA 3OQRA 1J5DA 1E65A 3PAVA 2PPCA 3UAEA 1AS8A 2XYBA 1W6WA 2FNWA 3NJJA 1MZZA 4DP0X 3WKPA 2BP0B 2XWZA 3C75A 1A65A 2XXFA 4W9ZA 4E9XA 3CZUB 1EZLA 2VSMB 3NSYA 3V9CA 4YSCA 2EIMB 3FQ1A 5I28A 1OCOB 3QJQB 2BP8B 3AG2B 3PXLA 4N8UA 1L9QA 2X87A 2IDFA 1KGYE 1AQ8A 3S3CB 4NERA 1XB8A 2IDUA 3TBCA 3FYEB 1HAWA 6PCYA 2FQGA 3CVCA 2FJSA 3NSDA 3FU9A 4HCGA 3NSCA 3EH5B 2YQBA 1AG6A 2HRHA 1UATA 2J57A 1NIAA 4E9TA 3EF4A 1IBZA 4DPAX 1B3IA 4A2GA 1CYWA 1RZPA 5B3SB 1F56A 1WA1X 3QJRB 1SFHA 1ZIBA 2GHZA 3OMIB 2HRGA 3WNJA 1JZEA 3PAUA 1AOZA 1J9RA 4JHUA 1CC3A 1E5YA 4M3HA 3WNIA 3AY2A 3X1BA 4YL4A 2GI0A 1BXUA 2I7SA 3CG8A 1N70A 5B1JC 1NIDA 4JHVA 3SBPA 1WS8A 3ERXA 5D4HA 2XV3A 3X1GA 4HZ1A 2JFCA 1RCYA 1N68A 3FSVA 1HFUA 5PCYA 3T6XA 1V55B 2YAQA 4HHGA 4PCYA 3ZBMA 1CURA 3CDZA 4BWUA 3PPSA 1ET8A 4G7QB 1WA0X 3U25A 1CUOA 2YARA 1OE3A 1E5ZA 1PZCA 1TEFA 2CUAA 1ZV2A 1GYCA 2I85A 4AI7A 5AZUA 1QNIA 2PCYA 1E67A 2PPFA 3WI9A 4AKQA 2FWLB 4DP4X 1WAEA 4YSDA 1AZUA 8PAZA 1NWPA 2H5UA 2PLTA 3N2JA 3TA4D 3T71A 3G5WA 4UANA 1NPNA 3UGEA 3H56A 1W6LA 3NJMA 4P5RA 2CCWA 4M4RB 2YAMA 1A3ZA 1NIFA 2XXGA 3TASA 3UADA 2HX9A 5D4IA 1GS8A 1JZIA 3QJVB 4EF3A 1HAUA 1JOIA 4UAHA 1I53A 3ABGA 5ANHA 2XLLA 4A2FA 2CALA 3SBRA 2Y1AA 1BXVA 4GP8B 2A3TA 3PAZA 3X2QB 4DP8X 4G7SB 1BYOA 3ASOB 1KCBA 3H4FA 7PCYA 3S8GB 3X1NA 4GXFA 2BWDA 2LLNA 1PAZA 2QT6A 4QKTA 3FU7A 4YSAA 1NWOA 3AG3B 1PF3A 1PZAA 4ZK8A 3FQYA 2PP9A 3IBOA 4E9SA 1J9TA 4KO9A 3T6WA 4UF7C 4A2EA 4AX3A 4YSTA 3NJNA 3ABKB 4HCIA 2XU9A 4BDVB 2IH8A 1V54B 1KCWA 1CYXA 1SF3A 3D12B 1AANA 2UXGA 5B7MA 2BW4A 1ZIAA 1BQ5A 1R1CA 2HX8A 5B1AB 1JZJA 3ABLB 1NICA 3FPXA 1YLBB 3EHBB 3IN2A 3OD3A 2VM3A 1WS7A 3KW7A 3MX0B 3T9WA 2UXTA 1IC0A 3NJLA 3QJSB 1OCZB 1SFDA 1FA4A 1QHQA 1AIZA 4YSOA 1AS7A 2UXFA 2UX7A 2YXWA 2AFNA 4X4KA 3S8FB 2I7OA 2CBPA 5TK2A 2XUWA 4PAZA 1QLEB 1OV8A 3AG4B 4JKNA 3FYIB 1NINA 4N4YB 2CAKA 4FA7B 1JVOA 2QDWA 5AFAA 1M9WA 1AACA 3L45A 2VSKB 5EHFA 2FT8A 1BYPA 1DYZA 2Y69B 2QPDB 3AG1B 1AZBA 1E30A 1KDJA 4YSUA 3BVDB 3QJUB 4DP6X 4E9VA 4HIPA 1AAJA 2XV0A 5I6NA 4KO7A 3IN0A 2GB2A 2R7EB 2Q9OA 4CSPA 1BQKA 1PY0A 3QQXA 2YAPA 2ZONA 2BO0A 5I6MA 1IUZA 1AS6A 1ILSA 1FFTB 5I5JA 1SF5A 3H4HA 1SDDA 3ABMB 1W8EA 4DPCX 2OCCB 2PP8A 4BXVA 7PAZA 3SBQA 6PAZA 1T5KA 1PZBA 4L0PB 2IH9A 4DP9X 3GDCA 1EHKB 2MRYA 3BQVA 1PCSA 2GIMA 1MZYA 4AKOA 4HALA 1OE1A 3NJGA 4BWTA 4F2EA 1L9RA 2PPAA 4YSQA 3ZIYA
chains in the Genus database with same CATH superfamily
1GY2A 1LMKA 3KYOA 5DD0H 1SBSH 3NFPB 3MGOB 4F7MB 1M7DA 3PWUB 4XPTL 1NFIA 2K8MA 4YL9A 3L2LA 5DEFA 1RZGA 1TEGA 1EHLL 4WU7A 1UHVA 1DVFB 2DQGH 5CJBA 1XDTT 4F1SA 4OZIF 5KAQG 1XGUB 1MCLA 2JIXB 3P0VL 2VM4A 3WJLA 1O9WA 5K9KB 4D8OA 5HI5C 1U8CB 2HKFH 2YAFA 3WXWL 4UBDD 1BXAA 1OCRB 3EUDA 1A4CA 4PJ8B 4X0NA 3QC6X 1QLRB 5FOBA 2ICEA 5HHOE 3CHXA 5EF3A 2F74A 3X13B 4H8UA 1KJ3H 2WNKA 4P2RE 4YE4L 2VDOL 4UZGA 2BOCA 1A7PH 1MW2A 4ZPVB 2WINB 3LN9A 3RGVA 1MWAB 4HIHA 4MNGA 1MFEH 3BZFA 1KYOK 5E5LA 3CN2A 5AAWC 5IMMB 2NY3C 5BRPA 4N9OB 4Y5YB 3RDTA 2QBWA 5J1TC 2B1HH 4S1RL 1FNHA 1OCWH 5AB9A 4G72B 5DUJA 4Z76B 3UP6A 2CR0A 3VU1A 3GTVA 3TPUB 3HA0A 1AZCA 4P4KD 4HGWA 5FM4A 3WIAA 5J06A 1KCSL 1KN4L 4AGLA 4J3WA 1THCA 1AQKH 2YAHA 4MDIA 5FUZL 1MCBA 4Y19B 5K39A 5LNEA 4ZZFA 2KT6A 3UBXI 5JPNC 1SYVB 1O6VA 2WV3A 4HC1A 3CFCH 4HUVB 4ZNEE 3ILPA 3L6FB 3AS0A 2R0ZL 1CCZA 1MJJA 1RJLB 1BQRA 3EHBD 2GITA 5LDUA 1CR9L 4FYSA 2ZT9C 2OSLB 4AUJA 4A37A 4KX7A 1ZTMA 2NYYC 4LU5H 3RX8A 4WWKD 3SOBL 4BGDA 1QSED 1BFOA 1ROCA 1Y7VA 2IXQB 3L81A 1U8OB 35C8H 5T5NG 1SNRA 1HCYA 2DLFH 1YEFL 3LCYA 3BP5B 3RUGB 1UH2A 5HYJE 4AG4H 2P47B 1BAGA 1KTJA 3Q1EA 2PPDA 4WDIA 3M17B 3VI3F 4GXUM 5T3ZE 2Q3AA 2D2OA 3OGOE 2BSTA 4PS4L 4CUCA 1UWGL 4NAJA 5JTWA 2F61A 2IH1A 4H44C 3AS3A 4K7PY 3GDBA 3VE0A 4AH2B 1NAMA 5LVEA 1U8MA 2NRDA 4LIQL 1YQVL 3QRLA 5CUSH 4JGUA 1MY7A 2MCAA 4FHJA 4DKFH 1T1YB 2HH0L 3CHPA 1YO4A 5CJOL 4DW2L 3RIAK 2VZUA 3K2MC 3BH9B 4NP4L 4ZPTA 4A67A 1G9MH 4E9RA 2P9RA 3FO0H 2ENPA 3K4ZA 1SXBA 1DQKA 4ONFH 3S0PA 1VFAB 3BYTA 2HKAA 5IBTH 1DQLH 4LCYA 1TTAA 1NIEA 3FSAA 4G1EA 4JFOB 1BZ7A 5D1QB 4P5SA 4WWOA 3ZHKA 4OUUB 4AUYA 2BOBB 2Y2TA 2J55A 2DRUA 4YSSA 4G6KL 3QRGH 3IJ7A 4PREB 3U6RB 1QFWM 5I19H 3KPMB 4P4KA 2O30A 5CEYB 2FT7A 1BQLL 1JNNH 2FR4A 3STBA 1T83A 5T1DL 4IKIA 2W8CA 3EDDA 4C83B 2P5WD 2M83A 1RUQH 4ODVL 3OG6B 2NTFB 2B1OA 1KJ2B 2XX0A 5GGUA 3UYRL 4MLSA 3SDDC 3V8OA 2RFXA 6FABH 1OCCB 3VFOB 2C9PA 5DURB 3QXAA 1F3DJ 2HT3C 3BJ91 3QPXH 2ITDB 4JRYE 4K9JA 4PP2B 4U2YA 3WO4C 2H32A 1D7BA 4LP8A 3T65A 1S3RA 3I6KB 5JZ7D 3KGRA 4TL5A 4WWKA 1QSEA 3C5ZD 4G6FD 3VXNA 2PCPA 5F3BB 3D33A 4RQQA 4FQXD 3OHXC 5KVDH 5FO8B 3MBEB 5FCUL 3VGEA 1FG9C 4N2MA 3HC4L 4B3EA 4B53A 2O4EA 3JV0A 1PMYA 4R7LA 1RAMA 1AZRA 1T4WA 4Q8BA 3UDWC 1U92B 4I1RA 4L1HA 1KZYA 3CK0H 4L4VD 4RAHA 5BS0D 4P2OD 4M5ZL 1WZAA 4GSXA 1M7IA 1SPDA 1U93B 2XG4A 4NO5A 5GGTA 1C7SA 4OCNC 2QQNL 2CKNA 3QCTL 1D5ZA 3BUPA 5F96L 4ZUSB 1TITA 3CZNA 2CIKA 5DUML 2YD0A 3VFUA 4QRRD 2GK2A 2UYLA 1FSKB 2XA3A 4KKCC 3LXBA 2Y9RT 3H42H 4M7ZC 2ATKA 3TBTB 3GZQA 3BDYH 4ONGH 4G6JL 5J11B 1W6WA 2QSVA 3T0BA 2APVA 2V4LA 3D50A 3RLSA 3OZ9H 2VLJD 5EC2B 3DRTA 4H25A 4HUCA 4M1GL 3QAZC 5MERA 2IQ9H 1T04A 5T5FA 4NQCE 4M4PA 3A6OA 2ODIA 1RLBA 1FE8L 2X87A 2VZVA 2NUTB 3BZEA 2X4UA 3QHZL 3G5ZA 1MKFA 2IDUA 3GKWH 4JO2L 3GXFA 3KYKL 3LRGA 3CVCA 3CX5J 5L2KB 1ODAA 4LNRA 1A9BB 1JDCA 3HR5B 4F9LA 4PJDA 4LK4A 1T7YA 4AQZA 3EH5B 1AKPA 4PJBF 3MYZA 3T0EB 4Q58C 2P8PB 1BECA 4YFDB 1I1AD 2P5WA 4IMLA 2Q10A 5EO1A 4HLZH 1B3IA 4M5TA 4WU5B 4ES9A 5B3SB 2Y36L 1F4YH 3WFZA 4DEPB 3WNJA 5INCA 3ESMA 3HS8A 5J3HD 3PNRB 1GKOA 5JHAA 2DEXX 1A1MA 3VFWB 1G1CA 2BS8A 5IROC 3PP3H 4AYEC 4C58B 3VFVA 2Q86B 3ABZA 1BA9A 1IGYA 2ZXEB 2GIXA 5C86A 3LH2H 5J1AA 3C5ZA 4OCRH 4WNSA 4HIXH 1IAIM 4FQXA 4OVVA 1HINL 3RL1B 3I6LD 4BWUA 5JIMA 2YK1L 3PPSA 5HJGA 5EEXA 2VLLA 4MCZB 3ES6B 1F11A 3MRCB 4DZBB 1TTFA 3QFDA 4GBXC 4L4VA 5D9SA 5BOJA 1Y6MR 2B0SH 5BS0A 3TESA 4ZX4A 4P2OA 1RPQA 1DN2A 1DQJA 1VZIA 4QO1A 1FFPA 2WYIA 4PB0H 1EJ6A 4HJIA 4JFTA 1U8KA 2A6KA 2FGZA 2Z31D 5DK0B 4WV1A 1LO5A 3FONA 3AY4C 1MN4A 3L2MA 4QRRA 4NM8H 1CF1A 4JVPA 4AT6B 1KJMB 1ZK9A 3H56A 1QBAA 5F9JA 1X5MA 4YHML 4YDLB 4L8BB 1ORSB 4N22A 2FJGA 3UZEA 4TN9A 1DVFD 2H3KA 2ZSWA 4NFDA 4DGIH 5I76B 1RMFH 5I8OL 4JFYB 2HAZA 2VLJA 3MNWA 1MCWW 5D1XE 4S11A 5JIQA 3GM8A 4GSDH 1O7SA 4OB5L 3T1FA 3U46A 4LCCB 3OWRA 4MS8D 2F7RA 1OTSD 5F6IB 1M71B 4KJWD 4CC4C 1D6VL 3TO2A 3H4FA 1TTBA 3B7TA 4AQ8A 7PCYA 4UTCA 1CGSH 4U05A 1UCTA 5DUPL 5DZNA 5IOPA 1VFMA 1H8NA 2RCSH 3MRLB 4PJ8D 2F9BT 4UIKL 3WE1A 3FU7A 4AXWB 1TZIA 2X9ZA 3E1ZA 4RIRB 1C5CL 3HBPA 1SVCP 1E5UI 4DETA 4N6RA 4PGEB 4N2KA 1GGBL 1TLMA 5KSBA 1I1AA 4PJXE 4FULA 1MJ8H 1UWEL 2H6PB 4AX3A 5CP3H 3UEZA 4ZI8A 5EMYA 1DJYA 5BZXA 4GRMA 1GIGH 2F58L 3BH4A 3TL5A 1QEWB 5ID1B 1DLFH 2NQDA 2I32A 1BQ5A 2HPOA 1FLRH 1F58L 4GQ9L 2DS4A 4NZTL 4BA8A 2NPLX 3GUTB 2MPAH 4OUOA 2YGNA 1MXGA 2DQUH 1I75A 1NICA 2X70B 4U0RC 3MCLL 2NCEA 1LEKA 5CCJA 4LHUG 2ZUXA 2E8YA 1DSYA 2NR6C 2QFPA 5C7XL 3BH8B 5HBBA 4KMTH 5DJAB 3BISA 4DTGH 2QSQA 2UX7A 4IOIB 4A7GA 2CGZA 3ARWA 2X9XA 3ARYA 5EIIB 4NENB 5TK2A 5GS2H 3ULUE 2OK0H 1S9VA 4XTRD 4CN1A 1QLEB 3D09A 5F0PB 4XNYH 2EICA 5BV7C 1QWNA 4PW9A 5IFAH 2Z31A 3QEUA 1JVOA 4PWKA 1M9WA 4PSRA 5IK3A 4U1IB 1XHHA 1UWYA 4FXGA 4HT1L 5BRZE 5F3HB 3C09B 4LSTL 2OMVB 4YH6A 1OZUA 4A2LA 1QI4A 3V6ZB 1YSOA 4YPJA 5E24E 2N7SA 5IQMA 1EZVY 5E1HB 2FX9L 2Q7AA 1R5WB 1DVFA 3JWNE 4PP1C 1HQRB 3ZHLA 4QD2E 4H1LG 1FRGL 1HZHH 1E2VA 1NGPL 1Y07A 1BZQK 5K9KA 1HJCA 1FYTD 4JPWH 1LK2B 3OJVC 2Q87A 5FR3A 4XXCA 3B7UX 1ETZA 2OW7A 1P1ZB 4ZUTB 4PJ8A 7PAZA 4OJDH 4JDVA 1YG9A 2CO3A 4JKMA 5CIPH 1E5CA 2CA3A 4PBVC 4L4TD 1RU9L 2W91A 5AVSB 3RPBA 5AW1B 5C0JA 1PCSA 5E2UH 5TQ0L 1UB5A 3AS2A 4AKOA 1RZJH 1IC4H 4ZPVA 4YO0B 2EE3A 4MMXC 4ZOCA 3GSNH 2VABB 5GRJH 1QR1A 1FVDB 4Q9CA 2VDRB 1G94A 4LVHC 4WSKA 4FI8A 5HGAA 5FV1L 4K8RC 4OAWB 2EIZB 4YDJA 5FHBH 2CPUA 4X6DE 3IJEA 4PD4J 2Z93B 1B0RB 1ZE3H 2DMBA 4F7KA 2A6JB 4LKCB 4M6ML 2OJEA 3KPRD 3PFUA 1WFTA 3P69A 2WQVA 4ORGB 4TPRH 3V52L 1HVXA 3HMWH 4X5PA 5EBLA 1CBVL 2EABA 2P52A 2XETA 4NZUL 2JJTA 1DO5A 1H6TA 1LO3H 3IAQA 3P0YH 4N0CC 4UT9H 3V5KA 3MROB 7TAAA 2XVBA 3L48A 3TNMB 1JPTH 2CSPA 2YD4A 4P2QD 1HYSD 4OLYH 5D2NB 1ZJAA 2IMNA 3M1BA 3QUXB 5EORH 4NUQA 4QY8B 3HLAB 4HLEA 1IILE 5CZKA 3V9FA 1ZS8B 1D5IH 4Z18A 1OXYA 3V0JA 4DP7X 1S7XA 1TQUA 2OSLA 2QPSA 2J8UE 1HXYB 3L4ZA 4KI5F 4PUBL 2ZXWB 3BKML 4WO0A 2R8SL 2FBOJ 4IOSD 2DQMA 2EDNA 1YQ2A 3NAAH 3R4DA 3BUTA 1U8OA 1DQQA 1UFGA 4K8RL 1CXIA 2FAUA 4PRBB 2D0HA 4HHWA 1A6PA 2VXQH 2B16A 1QBMH 4PG9A 4XP4H 3GMMB 1JXGA 5EU7E 3AMLA 2ZOTA 3AAZB 2K6ZA 4UINH 3HFML 4JO8A 1FZMA 1R3JB 3GRWL 2J6EA 5C3LD 4ZMXA 1G9NH 2FYYA 3N41F 4JY4B 4I48B 1FYTA 1UCBH 3SHSA 2ZOLA 4OJFL 5LGHL 1YMME 4GQZA 3RBGA 3IVKA 3DK2A 2NY4C 4NBXB 1B3JA 3WIFA 1JNLL 3ULUC 1MCEA 5B8CB 2AEOA 1HESA 1RUPL 1YHPA 3WFBL 4L4TA 4TTDC 2YLKA 1DQVA 1KXQE 3SD2A 4NZJA 3H9YA 3TWYA 3LB6D 3LKPB 5D93B 4W1TA 2DD8L 5GS2D 3UTQA 5GRWA 3TBYB 3SQOH 4ENED 1UD3A 1A7RL 3PPEA 2W0FA 1R0AH 1I9RL 3DARA 2NZ9D 4AENB 4YHIB 4ZO7A 5IKCA 1A7QH 4G11A 2IWGA 1PZ5B 1SHXA 2D73A 4X4YA 1PY9A 1SEQL 3AQXA 5ANME 1DUZB 4HPHA 3O2DL 4YDIL 2NY1C 3KYNA 2IQAB 3BESR 3TJEH 3KPRA 4PREA 1W72L 3DTXA 5L2KD 3KPMA 4XC3L 1A5FH 2MCPH 1EK3A 3P9MA 4HWNA 2IC2A 2GJZA 1R3KA 3NG5A 4IKNA 3GXMA 2LVEA 3CTTA 4OGQC 3WFDH 4P2QA 3OR7A 2OTUA 1ZA3A 1NFKA 5HVWA 4LSRL 3EJYC 1JWMA 4MXWL 3CSFA 1KC5L 3UBXB 3OKOA 4LEOA 1AZNA 3EFOB 1OWWA 2FCBA 2ITDA 1MLCA 3U30B 3V0GA 3HZYB 1KWKA 3C6SB 3TVMB 3S3JA 3QNXB 2ZTBA 4IOSA 2V5YA 3SDCC 3PXHA 3AM8C 3G04B 4Q0XH 3H3KA 2HX7A 3DYMA 3KPQB 4NBZB 4KGJA 4RZKA 4WSJA 2XX1A 4WFFD 5CP3A 2QR0B 2XWJA 2RACA 3DMMB 3DX6B 2YN3A 3KWXA 5I8CB 1XZWA 2DMKA 4U3XA 2JB5L 4HV8A 2N56A 4OKVB 1ORQB 2D3LA 4MXVE 4NKIH 5GGSB 4UQ2A 3WIHH 5LWYL 2GEEA 4HGKC 3V8CA 2M8XA 4BQBA 1KIUB 4XMZA 2GABA 1KLUB 3HB3B 1I7RB 3T8MA 2YQ3A 5FYKH 1J0YA 1TQVA 3TF7C 3LKOB 4QAWA 3OX8B 5DVNA 1UWFA 1G7MB 3E6HB 1Z6JT 3WFCH 4OZGF 1ET7A 2NY6C 3BP6A 3C08L 5F9OH 3V0AC 4PTTA 3Q01A 1NIBA 3TBTA 4U1GC 3F8UB 2A74A 3D08A 4GSQA 2DYRB 4HK0A 4G42B 4Q6KA 1T66C 2G2RB 5FB8B 4RH4A 1OSPH 2R2CA 2DWDB 2JTDA 1AQDA 4JREB 5C0AB 1XF3B 3FAWA 1ZV9A 4V33A 4MA1C 5EC2A 4DQOL 1AG0A 4PJ7B 3JXAA 3DYOA 1I8LC 1JF1A 1Q0XH 3FSWA 2CJSA 5G4OA 5SWSB 5EUKB 2MQGA 3CXDH 4XNXL 3BWUC 3BP7B 3EXLA 1FZOA 1K72A 1TVHA 4JN1L 4LGRB 1D9KC 3O45A 4UAOC 5L2KA 4J6IA 4JHZA 5DJ2A 4KQ4L 5E2JA 1C1EH 4DFIA 3W0WD 2EZ0D 5MP6H 3WEXB 5I1CH 1J8HB 2Q6WA 2BIMA 5HDOA 3I9IA 3FB7B 1Q94B 2J88L 3L7EA 3NSFA 2WXLA 1TQBB 2VLRD 3WTSA 1GMEA 3S34L 3UJIH 3FCSA 3WJJA 5E6ID 3UABA 1RFDH 3VFWA 5FW6A 5IB3A 1PX3A 5FYLL 5DMKB 1D7CA 4RGMB 2FK9A 3K8LA 1TG8A 2CJTA 1JD9A 5F7EH 4M8QA 1NKRA 3KPLB 1DQMH 5CIPA 3VXRE 3WCYA 5I1HH 5IBLD 2EDFA 1JZ2A 4OCWL 1NCIA 3L5HA 1ZLVK 1TMQA 5GHWL 4Z7NE 1TSRA 3NSYA 4YSCA 3GSNA 3OB8A 1FGNL 3AG2B 4G8FA 2IDFA 4HJGA 5T3XE 4OIIH 4BFKA 3TBWA 2VIRB 3BFWA 3O6MH 1IM9D 3HKFA 4YOKA 3FU9A 1MLBB 1LQBC 3Q1SL 5DK0A 3GMQA 1G1YA 3T8VA 3VG0H 4JQVA 4XMXA 1LILA 5C0BB 1IAIH 1FN4A 1YEGL 4UT9A 1TO5A 3FZUD 4XBGB 3ZRFC 3TZVC 5I1IH 3UGUA 4HJUA 2H7WA 4FP8H 4MNQB 3WKMH 1ITCA 3NRFA 3KCWA 5JLZB 3CLEH 3CFEA 4F7TA 5B3NA 2MNWA 2XIDA 1BVNP 1OT1A 3QNFA 2V3DA 2OZ4H 4B9YA 3FRPA 3MJ8A 3CPLA 2PW1A 4Z7WB 1ZAGA 3HCVA 3IB4A 2XV3A 3HNVL 3WHE1 3MRDB 4O02H 4X8XA 1EX0A 1ZSHA 1M71A 2BS71 4HUUA 3ZL4L 4B41A 2XTSA 3KWUA 5EF1A 4A7SA 3ROOB 1XSKA 1KTDB 5SX4I 3MJ7A 3NZUA 2VXQA 2OYKA 4OLVH 4G7QB 4C56D 4X83A 3W0WA 2VDPL 3FSOA 3GMRA 4XMLH 4R5XA 1B4RA 1GYCA 1I7UA 1KIPA 1DSFH 4Y9CA 4WTZA 4YGVB 1QNIA 2PCYA 3OZLA 4G6MH 4DP4X 5CR1A 1AR2A 2VLRA 2ZAGA 4XMWA 1QEWA 1I9JH 1SYSA 5ID1A 1BF5A 1JGVH 4Z7VF 5E6IA 4FFVC 4QHUB 3BZ4B 4I1PA 2B4CC 4CMMA 4FFYL 4CU7A 4R4BB 4MS6A 3TIEA 4M4RB 1A6UL 3TT1L 1FH5H 5AOLA 1MHPL 4RGNE 5H35A 1MVFA 1E28B 2CJUH 3TASA 2F54D 1JGLL 1PS3A 2Z91B 5KSUA 4PY8J 2ADGA 2XLLA 4YBHA 2HLAB 3DVGB 3S36X 1CWVA 4ELDA 3QCUL 4A63A 4JY5L 4POYA 5I1AB 1DJWA 2Y1AA 3X17A 4GP8B 4JN2A 2BCKB 4PLKD 4ELMF 1BYOA 2XPGB 4ANUA 5DJDA 3LOWA 4FQHA 1WC7B 4H5SB 4N2LA 4X9YA 1JPGB 2X2JA 4GXFA 2BWDA 5EN2B 1EDQA 1ZHKA 1IM9A 2GSIA 1FFRA 1BGXL 2AEQH 5C2UB 3MJWA 2VN6A 1IL1B 3AGVA 2CHNA 2G30A 2XRAL 4V1DE 5B22A 2OSXA 3O4LE 5F3HA 3T6WA 4JPIB 1BVKA 4WCYH 5EWIH 5FW7A 4QWWC 1JP5A 1KCKA 3V6ZA 5HYSG 3JQOB 4KTDL 1U8PB 1JK8A 2VDML 1CZ8H 2E4TA 1V54B 1CD8A 3MRQB 1KFGA 5GRUL 1AOHA 3QK0A 5IMOB 4MJJA 3PQYD 4UTAL 3D4YA 1JZJA 1KENL 2EADA 3JV6B 5LGYA 3V6BR 5C0IA 1D7FA 4GO6B 2IG2L 1X5GA 3BN3B 5C08D 5KSAD 3W2DL 1JS4A 1FQ9C 4TSCH 3UYPA 1BWWA 2CO2A 2BWQA 4N87A 3V5DA 3RX9A 5TE4H 3IJYA 5ICZB 2FH6A 1SFDA 2Y4SA 4EDWL 1QHQA 3C9NB 3HI1A 2WMPA 5DLMH 1DBKH 3DGDA 4JPKL 1PX8A 1QBLH 5TQ2H 2W5PA 1FNAA 4LLAA 5I1KL 5JHDD 3KJ4C 1I8KA 1G1OA 2I7OA 5E2WH 2OR7A 3G6DL 5CGYD 3MRGB 3DXAE 4NNYB 1ZA6A 3L4VA 2WWMD 4X50A 3E3QC 1FIGH 4EXPX 1AMXA 4DAGH 2R0KH 2YFOA 3UJTL 2GBVA 2XKSA 3KR3L 1TETH 4AYBA 5I15H 4N26A 2YXFA 2VXVL 4QPEA 1UA7A 1NCDH 3NIGF 3FOLB 1OP5H 4QYOB 4D9QD 2BVOA 3FUEA 4KX9A 1EXUB 3WAKA 2WXJA 4F7PA 5IW6A 4OJCA 3VNYA 2CUMA 2F54A 3ARTA 2E9IA 2XV0A 3EGDB 4NHCL 4C55A 5I6NA 1AYOA 1R17A 3ZRCC 4Y1TA 3MOQA 4NZRH 5I6MA 1I1CA 1IIIA 5FS5A 1FV1A 3FFDB 4DGVL 1ZRUA 1NBVL 4HJSA 4X5WA 4RMUA 1IUZA 4P5TC 4BK4A 3V6OA 2HRLA 4JM2B 4RVBA 5DZVA 4OZHE 4ES8A 2IBGA 2NY5C 3HPJB 3WBDA 3LS4H 2B3RA 1YNLH 4RMQA 4YK4C 2GJRA 2A73A 2QLVB 3HG4A 4KHXH 4PJEB 2F5AL 3F01A 3UTPD 2I25N 3PDDA 2AP2A 2Y7LA 5D7IE 3JTTA 4XPFH 3KEDA 1JN6B 3CC1A 1JMXA 1CICD 2XY2A 1OAKH 1HH9B 1NFDF 1UM5L 1ZLDA 1ZLWK 2QJDA 3GBDA 3D07A 1MFCH 1GVIA 3EDKA 4Z7QE 3MXWL 4Z7OF 4RGNC 2CLRA 5I2IA 1NEZB 2I07B 3PQYA 2RA1A 2IDCA 1FCCA 1OGAB 4YBQC 3HRPA 2W38A 5C08A 5F7FA 1ECYA 1JFHA 1AZZC 4K5NA 5KSAA 1DHKA 1CTOA 4JY4A 4I48A 1NGWB 1VCBC 3SPHA 1SHSA 3TJPA 1UA3A 5DRWB 4GRWE 1P84K 2FO4B 3DBXB 5IVXF 5BZWA 1NCCH 1HCFX 1T7WA 1BVOA 1Q9LB 2NY5L 2HMIC 4ETYA 1WK0A 5JHDA 4U1NB 2WOYA 1AGEB 2IADA 5T1KB 2VUYA 5JOEA 4AMXA 1ONQB 2NY2C 4L3EB 2Q3XA 1AHWC 3EDEA 2VJ0A 3LH9A 2AK1L 5I74B 4LEXH 3H6JA 2WGXA 5CJ5A 4R84A 1JDAA 3ELAT 3KW8A 1RSYA 2VXUH 1GJIA 3MLUH 3X14B 5INDB 1K9TA 2E9JA 2X6UA 1XF5A 2X1WL 4HEPG 4GAJL 3R06B 1DDHB 5ETUB 4NDMA 1JFQH 8FABA 4ODSH 3OAZH 4WW2A 1A1OB 1YEKH 2BFVH 5FLVA 4J6RL 4LLYA 2O6DA 2XC8A 4JJ5B 1TZOA 2WZ5A 5LAXB 4X6BB 2FHFA 3MCYA 2PXYC 4LCWD 5IQ7H 3LKRB 5I6OA 2QADB 4LHUB 3RWFA 4MAUH 4JFSA 2H47C 3OB0H 3FMGH 1U91B 3ROLA 1A6TA 4MD0B 4Z6AT 1TNNA 4UIMA 4FJ6A 4NCC2 3LZFL 2R4RH 1VEOA 4XVTH 2JVUA 4JEGB 4X7SL 2FDBP 3CNKA 3W57A 3HZYA 4HMEA 1T80A 4I89A 2ZKXA 1XCXA 4MSWA 2HP4A 1CICA 4HDIA 4ZX3A 4Y89A 4U7MA 3TBSA 4HWBA 3ET9F 3VH8A 5EPMB 4M1DH 2VAJA 2XPZA 3OGCA 4UM9B 2WJ5A 4K3EH 4AQ1B 2B3IA 3D3VE 4L1DA 3D6GA 5D2LE 3ZK0A 2XKNA 5DUBA 5GGSA 4DJMA 1NKOA 2GCYA 3EJZD 3F58L 4K2UH 4WK0B 5DD5L 4OGYL 4ETQB 3VXOB 4M93B 1YPZF 4HU8A 3W11C 3R1GH 4PJIA 4JHAH 1KGIA 4IIQA 3S36H 2UWEE 1OOWA 4M61A 3JV4A 3IFPB 1UFUA 4IRSB 3ZKMD 1DN0A 2W0LA 2WW8A 4H1LB 5J89A 2DQTH 2VW6A 2BNQD 1XEUA 3IXAA 3B1UA 2QQLL 4YAQB 4PJGB 4IMKA 4IRJB 4HU2A 4BJLA 3D5OF 3DIVA 3OMZA 2JK5A 3Q3GA 4UB0H 5ACLA 2E7LA 4D8PB 3U79A 3UCQA 5LO7A 5E94B 5HDWA 2BW5A 5D6DA 1JZ5A 4FOMA 5BJTB 3BVTA 1GS7A 5TK4A 2DTMH 2DQJL 4AV4A 3Q6FA 1AXSB 5IUCA 1T1XA 4WQOA 1MCIA 1YEJH 4ZSOE 1BFTA 2NNXA 2YJLA 3CFJB 3BE1L 3NK3A 4XWGL 5DZOA 4NSKB 5DD6A 4BZ1H 2JLLA 4LCWA 5E6SB 1Z9PA 1GHFH 4RMTA 4UNIA 4F8NA 4PEEA 4HLJA 5FPIA 2KZ1B 4NGHL 3REVB 5G4MA 5BUAA 3LZPA 3H7LA 4WTQA 1KLFB 3WY2A 4P46C 3P73B 3QDME 4FG6D 5ESQA 1EV2E 1H5BB 3M07A 4HPYL 4MJHA 2DLTA 5F89A 3V0EA 2A38A 1KDIA 3CJJA 4JZJA 2JTYA 5ALBH 9CGTA 3GK8H 3L9YA 5KS9A 4BSWA 1LGVA 2FT6A 4R8WH 1G6RB 3DVIA 5FC9A 3CUPB 4QT5B 3S5LG 3G6JB 4B50A 1CG9A 1E8WA 4P4RA 2N0MA 4Q9BA 3TEUA 4LSUH 4RGOL 2BIOA 2EIJB 3VGAB 1A22B 4OBRA 1J8RA 4XMPL 4PMFA 3VQ1C 5AKTA 2BJML 3WN6A 4GAFB 3SY0A 3P2DA 1I9EA 4ZMAT 3GNMH 2AEIT 5DFVD 5KUMA 2YUWA 5FYKU 5C0CE 2K6WA 1CVSC 2ZUQB 4RA3A 5I71B 3WY1A 2WNGA 3I9GH 2BNQA 2EINB 3Q8AA 3BAEH 4W81A 2YUXA 5HVGB 3HZVB 3NCBB 3U7WL 4D0CB 3VXUD 4CU8A 3QXVA 2CQVA 5EB9A 3VVVA 4GB9A 3HC2A 3UZQA 4QRPE 3U36A 2FQFA 3BLKA 2KDYA 5F8RC 4MZRA 3BOVA 5E1GA 2JCCB 5AVWB 3BXNA 4OCYH 3I75B 3GBMH 2AJ3A 1A6VL 4OD3H 1Q9WB 2WXPA 3B9KB 4WFED 5HVHB 1GSKA 3L9EA 4MZIA 3K2UH 3MUGA 5AZ2L 1TKWB 1CQYA 4E9XA 1KELH 3NIDB 1EZLA 2VSMB 1K6QL 4BK5A 1DBML 3HHSA 3AS1A 5CWSA 4XBEH 4BSVB 3VCLA 1RJZA 3QG7H 2F7QA 4UV7L 1KNOA 1IBGL 1VAHA 1OANA 2IAMC 5IQ9A 3ZDZF 4FADA 1OEZW 3C6LB 4YGVA 4KUZL 4GRLC 5L4IA 3ZYOA 1XF2B 2PYEB 5FUCE 1E5BA 2VQTA 1AG6A 4DCQB 1GZPB 3TWCL 1S9WB 1IGFH 3RZCB 2D7TH 4KUCF 1CYWA 2Y7NA 4JUSA 1F56A 4KRPC 2D7NA 4PJAA 2IEPA 4C4KO 2DI7A 2FH8A 3Q8BA 2NSXA 4XZUA 2GI0A 1TXKA 3NRPA 1H3TA 4M7KH 2IV9A 3SBPA 1E5AA 1T89A 3DVGA 5F7NC 1KPUA 5L9DL 4KDTC 3SD5A 2OLDA 3TEXA 5CFAA 1UD5A 2W9DL 1A4JA 3HOGA 4BGLA 3GZPA 4YLBA 4XVOA 1P6FA 4LLWA 4ABQA 3LKSB 1UKQA 1XL4A 2WCPA 2IV8A 2QMKA 1XBDA 2XACC 5EN2A 3T6XA 4YXHH 1ZY9A 2ARJA 2R56L 1DBBH 2DWXA 2BY3A 1XIWB 5BO0D 4XAWL 2FGWH 2IFFL 2IALB 1JK9B 1MW0A 3GO1L 3RVWC 1QZ1A 3STLA 5E6UB 3O8XB 2BH0A 2WYZA 2VR3A 3LRSA 1IGIH 1VZGA 1YJDC 1PG7L 1U8PA 3O6FC 2JKTM 4K71C 3VXUA 5TH2B 3WMQA 1WV7T 2H5UA 4TUOB 2CK0L 2APBA 1X4XA 4XPTH 4H8WC 1ETB1 3L95B 5IMOA 2N7BA 3UGEA 1BBJA 1W6LA 3REWB 4CJ1A 3B9DA 2QKIB 2XIBA 4WKZB 5CP7A 3FUFA 4Y16C 1KIQB 4QGTA 4NNXA 1WFUA 1SVZA 3WXWH 2G75A 5HYQA 1B0GB 1ZLSL 2E6JA 2EXWD 3OPUA 3RNQA 1MI5E 2ARJQ 3RA7H 1RZ8A 2O5YL 3NEXA 4WEBL 1F2QA 3MRGA 3V0WH 4XOAA 2ZCLL 4M5SA 1LD9B 3GIVA 4S0TD 3HUJE 5GS0H 1TJMA 2DWEA 1MEXL 3AG3B 4R97B 4WK2B 5JXEC 3CSYA 2BX5A 1YJDL 5FO2A 1HCZA 3GSXB 4U1HB 5JDJA 4H8WL 4UF7C 2AQTA 1AXTL 5EBMA 2VAAA 4PJ5D 3UAJC 3LRHA 1JHKL 1T0NB 4RMWA 2ZD0A 1AANA 4F8PA 3MR9A 5D7KD 1AIFB 3TNNA 4CBPA 4BZ2L 3GKZA 1KN4H 3WLBA 1MRFH 1P2CB 1PPIA 1ZMYA 2YRBA 5AW9B 3L17A 1LNUB 1LEGB 3RQ3A 5FUZH 2R1XB 2VDNH 3EJPA 1U0QA 1EHAA 3FHQA 5KYUA 1AJ7L 2C5DC 3D4ZA 4XPHL 1MIML 1N0XL 1KEML 3BQUC 2HWZH 2VM3A 3DHUA 4H4NA 3WO3B 4IHOB 5D7JC 1A6ZA 1CK0H 3HPJA 4AJYV 2R0ZH 2VMCA 1NMCB 4NX0A 2EEFA 3FU3A 2PF6A 1HSAA 1CR9H 1NBZA 2QGCA 1NCBL 4IK6A 3E2HB 1IBBA 1QG3A 4LLQA 5L8KB 3MRRA 5HGDB 2AJVL 4PRID 3HIZA 4KHTL 3SOBH 3X3FL 5IJCC 4D9RD 4BZ1A 1HL5A 4PJXF 4HWEH 2C7UB 1MCJA 2Z8WC 3DJSA 3FQUB 4KK6D 3QIWB 4N2NA 5IHUH 1X5HA 4Y1AD 2CNYA 2VSKB 4TNEA 2FHBA 1AZBA 1RPKA 1WAAA 3KCPA 1A8JH 2VXTL 3KXFB 4JJHA 4PS4H 4EI5D 1OAJA 4I5BA 3VFGH 4DSYA 1MRCL 4N3TA 1ZGLB 5DJYA 3PWPB 3B43A 5LBVA 1WWBX 1QI5A 5M95B 1HEZB 3GSQB 2Q2EB 1Q38A 3LNHA 1YQVH 4LIQH 3UP1A 2YKLL 2ITFA 4QRUA 2P26A 5CJOH 4CL7A 3S98A 4DW2H 1TVBB 3WL9B 1FFTB 2EECA 1B2WL 3WXVL 3PY9A 1T2QL 3KYAA 4ADJA 1OSZB 1CFBA 4DNLA 3FO2B 3ZPDA 4MX7B 6PAZA 1K8DB 1T1WB 1PZBA 3X3GL 5JOPE 4WENB 3GI8L 4N85A 2HTKD 4YBLC 3WIIL 1BZ8A 4PJ9C 2ZNXA 1DDHA 1NUFA 4PJ5A 2BXZA 5IG7B 4G6KH 1MHCA 4JJ5A 4JRXE 1UASA 4PBWD 4YX2L 3U0TA 5AQ0A 1BQLH 4GH7B 3V0VB 4KQ0A 4HHAA 4OCXL 1P4LB 2YIHA 5TDOB 3EIFA 2WBKA 2QL1A 4ODVH 3TX4A 4S1DC 2GBUA 3QDJD 4JFQA 1YYLH 3UYRH 2HVKB 3IDYC 4IDJH 4X6CF 1TFPA 3QXUA 1FC1A 4MQTB 2X2YA 4UCFA 1LDPL 2WZ0A 3BIKB 3U0WH 4OR1A 4JQIH 4KU1A 3ULVE 5EC1A 3PL6B 4ZMZA 4JLRA 2EDTA 4H8VA 1ZLEA 4NWUL 4PRIA 2XZCL 1PKOA 1U95B 1JWSA 3P9WB 4JG0H 5JQHC 3QRFM 3D1MC 5IJVA 4J28A 4KK5C 4OCLC 4XAKE 4Y1AA 2XA8L 4QTHB 4YHNA 1OB0A 5EU3B 4F2ME 4LNVA 3OHMB 3KPPB 4M62L 4KJYB 3WNNA 4X6DF 3UYOD 1JUFB 1YUHB 1I3GL 2P80D 3DO4A 3PUCA 5HYSB 4YHPB 4EI5A 4CN4A 1RZQA 5IVZB 4Z9KB 4ESKA 5GS1A 5KN5B 2FJUB 3K72B 4WI0B 3OM3B 4L3CB 2IPTL 2QQNH 3QCTH 5A6IA 5DUMH 2J71A 3ARUA 2VQUA 3M8OL 3FCGA 1FLTX 1W0WA 4TVPE 3RWDA 5E4EB 3HRZB 5GRYA 5J6HB 3B2XA 2KLRA 2IMMA 1N59B 1HI6B 2YPVL 3LKQA 4UQ3B 5KJRL 1N3NA 2WXFA 4G6JH 1B88A 4OZFG 5DR5L 1I3VA 4JVWA 3SDAB 2AITA 3UACA 1WVZA 2B20A 4F7CB 5FWQA 3MSPA 3VRIA 2J8UF 3CZKA 5FKPB 1PYWA 4G5ZH 3BN9C 3VYOA 1SOQA 3F84A 3OMAB 5JW4R 2F53B 4PIRF 2EDEA 3LY6A 4FQ2H 5IGXH 4YR6B 4JG9A 1FIEA 2DI8A 3V9EA 3QHZH 1U3HB 4MA7L 4JO2H 4WHYH 5DHEA 3GF8A 2NY3D 3L3DB 5D70L 4IRZL 3K5RA 4QRSB 4MNGE 3WHXB 2NNFA 3MCKA 4EN3B 3V4UH 2O26U 3ARRA 5IHZA 4GPVA 1TENA 1IAOB 1IGCL 1N9PA 3C6LD 1S7QA 2DQDL 3QDJA 4U6VL 2PCFA 3S4SG 1IC7H 2BSED 2PO6C 2Y36H 2YD1A 4MQXC 5I26A 1CI3M 3TEYA 4TUJA 3K74B 1E9OB 3ZX1A 3IGKA 4WJ5B 4Z8FL 2TSAA 2E8ZA 3RZCD 5ID0B 5KZCD 2AQPA 2OXGA 2VDLB 3H2QA 4CVWA 4LFHD 3ARGC 4MJIB 1J0KA 4TLTA 1IAKB 4OZIB 5CBAA 2LAAA 3VI4A 4PVMA 1HINH 2NYYD 1KBVA 4CW1B 4NUGH 4O9HL 4E68A 2V2WA 3AZUA 1J86A 1QSFB 1D5MA 2YFNA 4PV9A 2BRRH 1QI3A 2A9CA 2P80A 3DIDA 1WRFA 4RNRA 4K0OA 3NPSC 2Z1PA 3MNZB 5C09B 1NANH 3MA7B 2FQDA 2YAOA 1O9ZA 4F8LA 3ATDA 1NDTA 3O8XD 1I4FB 2G0KA 2ITEA 3VFPB 2VR5A 1G7HA 1PGRB 1UVQA 3LXUX 5DSCB 4YHMH 4KROC 4WEUD 4LSVL 5JMRA 3TA3C 3CCHB 3HG1B 3DVNB 3RG1C 3G5YA 2VZ3A 3F12B 5I8OH 3BP4A 4PBDA 4UQDA 1UM4L 3ATAA 4XGZB 5F1NA 4ZMLA 4OB5H 4G59C 3D39B 4UDTB 3IMVA 5GJSL 2P7TB 3B2MA 3LNDA 3KLKA 4FLOA 5DXWA 4H8PA 8CGTA 1J7VR 2CLZA 3QDGB 1D6VH 3H9HB 4XNQA 5BW7C 4N3UA 4TUKL 5DUPH 3TV8A 1R46A 1LEIB 1P4BL 5CGBA 1DFBH 2OQJB 3M6DA 1C5CH 2J6WA 2C1OB 1BBDL 4XP6L 4MXVF 3QUZD 2RJMA 3H0TA 1GGBH 1N19A 5J9PA 2PWDA 1IBYA 3VXSB 1CBJA 1ZCRA 3C6LA 3FAXA 4KTEL 3D2UB 2BSEA 1ZD6A 1WZKA 1ZDSA 4LLUA 3VGHA 3KLHC 2BIQA 1BCIA 2F58H 5DMIL 3FPYA 4B7IA 2AXJA 3EOBB 3VJ6B 3ME0A 3RZCA 4R96B 4J39A 4D9LL 5K9OA 1F58H 3SDDD 1BOGB 3MBWB 4NZTH 2AJXL 3BKYL 3IJHA 3TN0C 3UAFA 1KY6A 4ZQKB 4RISH 3CH1A 1K8IA 4HS6A 1BEYL 4DVRL 2VLKD 2HT3D 4BD4A 3QJTB 4LCIL 4KK8D 2IWFA 4S1SL 2Q20A 5DD3H 3VI3B 1RERA 3WJMB 1VEMA 2R7EA 3HPLA 1SDYA 5C7XH 3BPOC 1H3VA 3ZMEA 5CM1A 2WLZA 3IF1A 3PWLA 5SWZE 3RGVC 2FNWA 3D0VA 4OF6A 4KZDL 1I9IL 2RH0A 4GS7B 1QSEE 3HZ3A 1D2OA 5MI0B 4P07A 4ZFGH 1PAMA 2B59B 2ED8A 2ZP9A 3EFFB 2NSMA 4B9CA 3MODL 1YEDB 2JXMB 1L9QA 1TZGL 2OAAA 3FXIC 2D3VA 2QFRA 4OJYA 5LDSA 1U21A 3LDBC 5DRXA 5ALCH 4GAAA 4HT1H 5EUOE 3MU3A 3WMPA 3FYEB 1MREL 1U8QB 3VG9C 2SODB 2X2UA 3BYYA 5D5MB 5EU6B 4EI6B 5JW5A 5CZVL 3QIWD 4OF8A 3JUYA 1ES0A 2P5ED 2P43B 4IU3B 3QIUB 4TUOA 4DKEL 4P23D 4A39A 1IFGA 2FX9H 2J57A 3HBGA 1KB9K 1OY3B 2Y2WA 3P9LB 3QA3A 5I82A 4KKCD 1UZ6E 4Q74A 4YHYC 1QPPA 1FORH 3QNYB 1AOZA 2UY7B 3BEVA 1NGPH 2KZBA 4NKOA 4W6WB 1B4LA 3N5AA 1KIQA 5KVGE 1EFXD 2I7SA 3HNSL 1BPLB 3LIUA 3QWNA 4J3UA 4PJCA 1C5BH 5GS3A 3V7MA 1B0GA 1PIFA 1UGKA 2ZOKA 3S7GA 1J88A 1E90A 3H9SE 3KH3A 5E1AB 5GQBA 1UWXK 3RWHB 4E41D 1FZKA 1DZBA 3QUZA 5BV7H 3U9PL 1RU9H 4LCUA 4LSQL 1S9YB 1TIUA 2YJQA 2ZIDA 3C60C 5TQ0H 3ZZLA 1Z0MA 4DK6A 1IGJB 2DQIL 3QXDB 1N18A 4L1LA 3TLRA 1BM7A 4G8GB 3GS4A 3LQZA 1XF1A 3VWKC 1DQTA 4OF5A 3JVGA 2G5BA 3SDDA 2P5WE 3RUGF 1WAEA 2R23B 5I18H 3LPOA 3ZKSD 4GJTB 1RZIA 3EOTH 5A2AA 2VLKA 2R83A 2VRQA 3FO9B 3CXFA 4M6MH 4KXDA 5IROD 1E2WA 3V52H 3FRUB 1CBVH 1RVFH 4NZUH 4XPBL 1FF5A 3N1MC 2R1XA 2JV6A 4RAUA 3I3DA 43CAA 1P5UB 3OHXA 4OFKA 5DMJB 4HOZA 3V4PL 2RMNA 3C8HA 5A2KH 3S5LB 2ZJSL 12E8H 3UDWA 1BLIA 4P9MH 5C92A 4Q14A 3PL6D 3VU2A 5HGDA 2JE8A 3OJDB 2QGEA 4PUBH 3BKMH 5DO8A 1S8DA 2JMRA 3F7PC 4EIZC 2WBWB 4L4VE 5BS0E 3GMPB 3QIWA 4K8RH 4YSAA 2LLLA 4AIEA 2P5EA 4O4YL 1F4AA 1PF3A 4Y4KC 3BVXA 4P23A 1HL9A 5IF0B 2NMSA 2BVQA 4ZMTA 2AV1B 2FD6H 2KLTA 5BO1L 3CDGB 4L29A 4QRRE 2X0WA 4HCIA 1KTLA 3A4DA 3NTCL 3GRWH 4MMZB 1Q9KB 1ZHLA 2I9LA 4I4WB 2G9KA 4WNQA 4FX5A 1EFXA 3VDAA 1X5IA 1ZIAA 5LGHH 1H19A 4XO4A 1SXCA 2G0LA 4O2EA 2J7LA 4UNVA 3HMXL 2VLJE 3FPXA 5B38A 2HJKB 4YIQA 4GMTH 4OM0L 4E41A 1TVBA 1PD0A 5I9QB 4AE0A 1R24B 2I69A 4HXBL 3FB5B 3NJLA 3KWWB 4N9GB 2FUTA 1LVEA 3FJTA 2XBZA 1FA4A 4Y4HD 4MB1A 4ABWA 2DD8H 2UXFA 3GMLB 4MX7A 1XFPA 5I0YA 2YXWA 1S4IA 3TO4C 1JZ8A 5GJTL 4UQBA 1I9RH 5E00A 5TDPB 4XO9A 5F1IA 4XCEA 1XQ4A 4N5UA 4JKNA 3WELA 5KSBE 1F90L 3ZKXB 4KY2A 3O2DH 2FL5A 4YDIH 5IROA 1W72H 1NLBH 3OXRB 4YSUA 1CLZL 4O02B 4I0PC 5GGVH 3GSRB 3GJFK 4FF9A 5TDOA 1L0XA 4C8XA 5IESL 3TIDB 3B8SA 1QTYT 1CTMA 1JPST 4K23H 3L3IB 4U1LB 5LGJA 3ULUH 4PW3A 2NR6D 5AVZB 4R4FL 4MYWB 4A55A 5DD1L 4MXWH 1BQKA 2IH3A 3E8UL 4AEIL 4H88H 2YMTA 3BIKA 3MRKA 1CGVA 1W91A 2LV4A 5EFIA 5CILL 2F6AA 3I6LE 3FUMA 3PL6A 3VWJB 3A23A 2YQ2A 1IEBB 1U3ZA 4X99B 2C9QA 1R3LB 1ZT1B 1TEYA 1VFUA 2RALA 1IKNA 5F7DA 4F9LC 4I2XA 5AVYB 4F37K 3RHWF 4TULH 1E4KA 2OCCB 4R6UA 3RHWK 4BXVA 3CVIL 3AY4A 3HZKA 5K9JL 5JQIB 1KUMA 5C0ND 2GPZA 2WVUA 1ZK5A 3FQNA 3IMSA 1LP9B 3AQYA 3NJGA 4IK7A 4WGVB 5HYSA 4BWTA 1GYWA 5LWYH 1H3WM 3GI9L 4AVIA 4NO3B 3SDYL 2VWEE 3IDMA 3IDGB 4GT0A 4U1JA 3DX0A 3QUYC 1FL5A 3K72A 4PP1D 5JZ7C 4WI5A 4WNJA 3LKNB 1TT6A 4H20L 3C5ZC 4QHNB 1XXFC 3AREB 4FQXC 4ZOBA 5A2CA 1PLBA 4CC4A 3FQTB 2WQSA 1FPTL 1ND0B 4N2IA 4QLRA 1OF2B 2VSCA 3IK2A 4UQ3A 4OZHF 3HG1D 5EO9A 4HBCL 4Y4HA 3U82B 5FCSH 3FTVA 4DQOH 2GTZB 2XZAL 5FKPA 3ATEA 5J12B 2YXMA 2P44B 4B9GA 1B0IA 4ZUVB 4J1UB 1HWWA 3FQ4A 3CDZB 3ECBA 1NCGA 2ZX5A 5DI8B 3X1FA 1EXGA 2C9RA 3IPEA 4U3SB 3KLLA 3MV7B 4CVZB 4JANA 2M26A 4Z7QF 3KYMA 4JN1H 2PP7A 4K8RD 3HI6L 4P0DA 1H0DB 2F8OA 2YA2A 3EJTA 4N2DA 4JFDE 1GGIL 1CE6B 1V3LA 3B2VL 3VMOA 3FTGA 1F45A 2PR4H 3I85A 4KQ4H 1CD1A 4GIAA 4B9PA 4G43B 4IS6A 2WQWA 5J7CC 1YY8A 4MCYB 1IAOA 2HA1A 3QHFL 1F18A 1EGJL 2XTJE 3D2UD 4ODTH 5AW6B 2WP3T 2NR6A 4N0CD 4ALAC 3BGAA 3ZZ1A 2CKBL 1FFNA 1WTGT 1RHHA 5E51A 1OLZA 4LESA 5CXPA 1FGVH 2O1AA 3CFNA 4AQ8C 4BYHA 1KBPA 3QJFB 1BMZA 2ROXA 1M1XA 4MA8L 2B08A 2GJ6B 1KPRB 1Z1WA 3QEGL 1E42A 4DP2X 4OZIA 4ZOEA 1JL8A 3VQ2C 4GAGH 1EFQA 5GHWH 2HJFA 1ET5A 3WN5B 2PMZA 1IBHA 2BSSA 1KB3A 2UV3A 3B9AA 3P0GB 3OC8A 5ADOH 1FGNH 3NEEA 2NY0B 1P69B 1Z5YD 5J3HC 1V3KA 3IKKA 4X5XB 2KLSA 5FO7B 1GR7A 1I3UA 1R3IH 2BHUA 4HUNB 1AR1B 3ZTNL 5IY5B 3F7YA 1QASA 1S7SB 3MNZA 4HFUH 4DUVA 3Q1SH 1ZLUK 5HJ3A 1CLYL 4U1KB 1H15B 1U8JA 1MDTA 1YECL 2A9NL 3VSUA 4K4KA 3QPKA 2VLME 4GT7A 1M9SA 5EU6D 1Z66A 3DKHA 2NY4D 5IJBC 1NCOA 3SKJH 1FYTE 4U1SB 3HG1A 1LWJA 3GS7A 3BDXA 4PI0A 1KZQA 1DVXA 3L08A 2Y3AA 2PN5A 2X3AA 2FSEB 4TTDD 4ERSH 1UENA 3K6NA 3UAAA 3BUQA 3ECQA 3IDJB 2NW3B 2PETA 1KB5B 4UDTA 5TJWK 1MHEB 2AK4E 2KBGA 5H2BA 2P7TA 4OY9A 3SQBA 5BCAA 4L4TE 1TOXA 5D7LB 1A14H 3EDFA 3LVTA 3MRIA 4FXGC 2IOMA 4LRNL 1UOVA 1I3RB 2BK8A 2EEBA 1GGYA 1E7UA 4IBYA 2AKRA 4MZ3A 4CA4A 4FN0A 2OMTB 5JHLL 1ZANL 1L7TL 2XWTB 4X6EB 5D2LF 1RZKC 1QX1A 4GG6E 1Q1JH 3UZVA 2NY1D 2X09A 2VDPH 1NDGB 1DVFC 4GY4A 2C9XA 1QHOA 1BQUA 4RBPH 1JZHA 4J3OF 3D2UA 4RFOL 3SE3A 3GRWA 5ILTH 4NM4L 2ZYIA 2E27H 3KPRE 4QRTB 4PGJA 2UWEF 3MV9D 1QKZL 4MS8C 4XNMB 2XG5B 1OTSC 1NCTA 2QSTA 2DEWX 3DBSA 4FFYH 4ODUB 4XXCC 3EJYD 2KPNA 1A6UH 4PJ8C 1MHPH 4NBYB 4XP9L 4YXLH 4B95C 1Z3GH 4P2QE 4Q4IA 2K45A 1JGLH 2N3JA 4L4JA 3S97C 4GP5B 3VI3A 2L7JA 1OTTD 3LEXA 2YBRB 3L3OB 4LLDA 3TYGL 3WY4A 4B0MM 3T3PB 4NZ8A 1O7VA 3CV5A 3N41B 1WZLA 4JY5H 5ENWA 4JE4B 1G7QB 3L1OH 3OKEA 5C2BH 3WKYA 2R1YA 3VB9A 1E3XA 3MX0A 3K71A 1RZKL 4Y5YC 2L4OA 4TLSA 3MHZA 4Z77B 1BGXH 4NN5B 3O2DA 4L5FE 1FNEB 4XVUC 4K3JL 5E8PA 4HOXA 3KMDA 3SPVB 1FFOA 2EVFA 2O5ZL 5E1IA 2XRAH 1W72A 1Z2KA 4GYBA 5FM8A 1BX2A 4PRAB 2E6PA 2JJTC 1MDAA 5EU6A 4EI6A 4HCFA 3KL0A 2EIKB 2G4EA 3CZEA 2VDMH 2B4CH 5E9DD 1CDGA 4OLXH 4QKXB 5EZLB 5GRUH 1F8TL 4XODA 1NUDA 3MJ6A 3P9LA 3P3UA 4H8HA 5C0GA 2OR9H 3SGDI 3LRMA 3MACL 4F20A 1R19A 1KENH 5FKAA 4Q52A 5FYLD 3L1FA 1SEBB 1T66D 3Q43A 2IG2H 3U1QA 3W2DH 4ONOA 3NDZE 4HKXB 4OZFB 3VXQA 1E9PA 4JFEB 3LHPL 1HOCB 1MWAL 3PWVA 4HULB 4I18B 4EDWH 2DQEL 4J3SA 3RBSA 2C4XA 2G3MA 2PPCA 4AVHA 1HHHB 4ICXA 3FB6B 4JPKH 4XN9A 4PGBA 3C75A 2XXFA 4UWQB 2J1YA 3NCYP 2P48B 3G6DH 1IIKA 2BSRA 3H7BB 3VNZA 4H0HB 5TPWL 1T22A 4R90L 1ULVA 4N2EA 2AV7B 2VOTA 2PWHA 1NPUA 3QXDA 1IEAB 4NQDB 3MV9A 4F3FA 1XB8A 1LWRA 1PDKB 1MSPA 3QQDA 4LPWA 4N8VG 4NNPH 1I8IA 1S9KC 4QXWA 3S4SB 3ASWA 3MLSL 4TV3A 4G83A 4MNHA 2ISDA 4APQB 1XGQB 4I7ZC 4DZ8B 2J25A 4HSCX 4NHCH 2YSTA 2GAZA 1UWXH 1YNTA 3WY3A 1NGZA 5FK9B 4G9FB 4TNVF 2CXGA 2F15A 3AM8A 3H8NA 4U4IA 4TNVK 1TJHL 4DGVH 3DA0A 1NBVH 1VESA 1SY6L 1PZUB 4YPGA 5AW8B 1WFOA 1FG2B 1T20B 2X6AA 1SJHB 4OZGB 3G5VA 2PTVA 4ZRGA 1IKFL 4WFFE 5K1VA 3VWJD 3U9UA 1BVLB 2F5AH 1A3RL 5B39B 4M8UA 1MQKL 5ESAB 3G08A 4YHZL 4N2AA 4W9HC 4JFFD 2Y06L 4NO0B 3RDJA 3QORB 3B6SB 3CQQA 3FUKA 4XMKL 5KOMC 3U25A 4H0GA 5E9DA 2FIKA 3NIFB 3T77B 3MXWH 5IF0A 1UH4A 4PCSA 3FQWB 4BHUI 1ZTXL 3CDGA 4X0KB 4PRNB 2LQRA 1TZ8A 2EUWA 1N26A 4W9JC 5DC2A 1Z9SA 3P77A 4B97A 3RURA 1UJ3B 4X8CA 1Q9KA 2YOCA 3W39B 3C8KA 3BWAB 2VR6A 5FXCH 3U0PA 4PJBA 2ZWYA 4FQIL 4P5RA 4JZNA 4FQQA 2BNRB 3BIBX 1MUJA 5JMOC 1DL7L 1I8LA 2NY5H 3MBEC 4CSSA 2AAAA 1FZJA 3GIZL 3HG2A 4KXZI 3MRBA 4XCNA 3ABGA 2XWDA 2R69L 1IRAY 4G3YL 1MRDL 2AK1H 2HVJA 2YC1B 3QNZB 1XX9C 1U3JA 2E4FA 4NQED 2ENSA 2XWXA 5LNGA 3L5WB 3ZMRA 5L2JA 3EAKA 2AXFA 5TDPA 5IMLA 1AO7B 4AK1A 3W0WE 1KJ2L 1DE4B 1E4XL 2DLEA 2X40A 3U4EB 1FSKC 4AYDC 2VNCA 3O9WB 4J6RH 2VLRE 4U0QB 3FL7A 4FZEH 1J18A 5ERWA 4M8VA 4DO6A 3CZFB 5J11C 4UILL 2O61B 4JPSA 4YFLF 3UGXA 3LB6C 3SYCA 2APWA 3TIDA 3GEFA 2NOYA 1ZVYA 4U1LA 1WWWX 3STZA 3BMVA 2ERJC 5LUMA 1CL7L 1MFUA 1PD1A 3N1QC 2NZ9C 2GIYA 5K93A 5ACZA 1PG7X 4HJ0D 2CDFB 2NLJB 2OMWB 4LKXB 4ONHA 5DK2A 2YA1A 3PDOA 3Q13A 4L8DB 3LZFH 4FABL 5JPMB 3AWFA 4X7SH 5IFHL 4DH2A 3KLSA 2ID5A 2R2HA 3DURA 1M6OB 1R3LA 1II4E 1X5ZA 3ARFD 5A40E 4NLHA 3FW6A 1EJOL 2V3EA 4JFFA 1AS7A 5EOTB 3TP4A 4XE0A 2X05A 3KLAA 1KIRB 2ED6A 5IHHA 1E6OL 3PDGA 4U3CA 4Y5VA 4EZMA 3TZVA 2CRIA 4DEPC 2EEDA 4B27A 1GPOL 2IBZX 1T03L 3MLXL 4BBWA 3HW7A 1J0JA 1JF5A 2QDWA 3AU1A 1EAQA 4FFYA 4WI7A 5DD5H 4FNSA 4OGYH 1WZMA 1GRWA 2OP4L 5C3IA 5FECA 3GGWB 3O6LL 2B5IB 3DSFL 1WFNA 1CLOH 3UTTB 1P7QA 3MJGX 1TNMA 3QJUB 3EYQC 3QXWA 4MDJB 3OKMB 4H2AA 1ZT7A 2VITA 3LQMA 4W9CC 4E9VA 1EXHA 2ZCKL 1WO2A 1ND0A 3SJVB 4K7PL 2QQLH 3MLWL 1JYWA 4G8EB 3H6AA 3MRPA 3ZZSA 3PWJB 3OKDA 3T4YB 1AI1L 3T3ME 1PY0A 3JWNG 1U8HB 4TSAL 3KGUA 2ZONA 3R7QA 5IB2A 4NQEA 2X4PA 3N04A 3UMNA 3VFNB 1L5GA 3DX9A 2VXSH 4Y2DB 1AS6A 1ZVHA 4MDRA 4HUXB 4F33A 1SF5A 4MAYB 2NDFA 4TSBL 4WW1B 3L4CA 2IGFH 4UOW0 5DC9B 5FW8A 3SE9L 1VKXA 2OMYB 4QNPE 5KW9L 2JSFA 1C08A 5LXGL 2C3WA 2AQ3A 4TVUA 3HJ0A 4L0PB 4YDNA 1N5AB 4B0MB 1M3IA 4CDHA 2HN7A 4DP9X 3KNBB 4Y2OB 1CF8H 3F3HA 3HG5A 1UD2A 1H0DA 1WE5A 2Z4QB 3BE1H 1EEUA 3NGBC 4KVPA 4U1NA 4XWGH 4YDLC 1NGXB 1SZNA 2GUOA 4KZEL 2FEEI 2W80C 1UZ8A 4UTAA 4Z7UB 1GTFA 2BCMA 2X4QA 2YRZA 2Z0UA 3HKZA 3K2IA 1U41A 4P05A 1QRND 1TZAA 2GT9A 3DV4A 1PZSA 1R6VA 4NGHH 3ZIYA 1D6EA 2H1LM 2F54E 4LCCC 4XHJC 5LCVH 2ETWA 2EYSB 1OSYA 5B7EA 1IBFA 3K81A 5F6IC 2QHRH 3BKCL 4MJ5A 1VPOL 3PV7A 4P5TD 4BZYA 1CGTA 3WENA 1Q9OA 3IPBA 4JG5A 2WXQA 3ARFA 3NCWA 3K7UA 4NPKA 3OKLA 3X12B 1YUKB 3V6OE 3FF8A 4MQSB 1T4KB 1S7TB 1FVEB 3Q9PA 3FFCD 1CIUA 4ZFFA 1INQB 5E8DL 5DRZB 3A67H 1WJ3A 3DX7B 1S78D 1U8NB 1VF5C 2BP0A 2YEZB 3SPCA 4X5XA 1ZT4B 3EYOA 2VR4A 4IDLA 2BSDA 5AVUB 2R2EA 5H8DA 4KX8A 3N91A 2P24B 5E8NB 1OOAA 3A47A 1NBCA 1S7SA 2A4EA 3O6KL 4HIJA 5D71L 4U6TA 4QOKB 2VDNB 3GSUB 4ENZA 5I66B 4Q9RL 2OTWA 4YBQD 1FNSH 3VGGA 2RHEA 3PQYE 2IGTA 4KDWA 3L5JA 4X7DC 3RRQA 2I60H 2VZOA 3FSZA 5C08E 4Z5RB 3U7WH 3VFSB 1EEQA 3NIGB 5B3JE 3P11L 1ACCA 3AADB 3DTUB 2HMID 2VN5A 4R0LB 1P4IL 1T5XA 4HUWB 1Z5LB 1N7MH 1U58B 3BPLB 5LN8A 3ULVF 4KAQH 3U2SA 3JWDC 4JY6B 5JHDE 2NXYB 5AG8A 1IGTB 3DUSB 5HPMB 2YAEA 5JORA 1C16A 5AZ2H 3ARBD 5ITFB 3WKNA 2EUVA 1KXTB 4N0UA 1BIIB 1CFTA 1ZLUH 4X6FB 3C09C 3RJOA 3ZQ9A 2Q8AL 4UNUA 1NL0H 1K6QH 5DFTA 1WGOA 3FH7A 4HZLB 1UXMA 1T1ZB 5BQ7A 3L5IA 4GMSL 1NBYB 4HW6A 2PWFA 4Z3JA 1ZPUA 3FHEA 4QF1A 4I85A 1U6AL 4UV7H 5JPNB 5KBNC 1IBGH 1VERA 4D9QE 2XN2A 1BFSA 5KSVB 4F8TA 3CX5K 4DN3L 1QRNA 4KUZH 1S7RB 5BVPL 2P4AB 3B3BA 3GLEA 2PXYD 2AC0A 2ZWSA 3BUYB 4X98B 2DMGA 4OD1L 4XNMA 2QQKH 2G3ZA 3TWCH 3GSWB 2HFFA 3DX3A 4P5TA 3WUWA 4YUEL 5E5MA 1NFDB 5FHAL 3DOIA 1EO8L 5K1NA 3DHMA 5C0EA 2XWBB 1QA9B 3FU6A 4Z7OB 1MVUA 3VD1A 4PGDB 4YN3A 3I2CL 2XN1A 2GTWA 5C07D 2H9GB 3FFCA 5MEOB 4E2OA 1OT2A 1SDAB 2X1XR 4GW4B 2HFEB 4G9FD 2V5MA 3FBKA 2CJ3A 3CLWA 4XWOD 4P57B 4A7VA 2EKSA 5CLYA 3ZE0E 2W9DH 1G7QA 1CFVL 4GNKB 4PV8B 3UTPE 3VA2C 4WFGD 3LX9A 2WYTA 5D6CB 2EVIA 2LHAA 2DDQL 4NAQA 5DJCB 4FAAB 1HKLL 5IVXB 1XCTA 4NZDA 3KDPB 3QQ4A 5MEPB 4MASA 4XP5H 2EDJA 2R56H 1FJ1B 2ZKYA 2AI0H 1G84A 3O3AB 4XAWH 3SPVA 5SWQB 4TMPA 2IFFH 1VGKA 2WVTA 3QJOA 4L1BA 1F4XL 1H8OA 3IU3A 4HIEB 3QEQB 5EZJB 2LU5A 5F7YC 2C8NA 5AAMC 4NO0D 4C47A 2HRPH 3T6QC 1KXVC 3U4BL 5B1KA 4PCTA 4UUJA 4WWID 2XV2A 2CK0H 3UTSB 4FQ1L 1N8ZA 4ZDHB 2CO7A 1S7UA 4PJIE 3L7FA 5D2NC 2H0EA 1CXLA 4D0BA 4X8JB 3QUXC 2B14A 2FLBT 4X4ZA 5HHME 2HB0A 5IFJB 3ZXAC 1NGYB 1XF4B 3SGEH 1BJ8A 2Y07L 1GGCL 1O5DT 2ICWI 3ARBA 3Q5YA 4Q2ZA 4OFPA 4GG8B 4XO8A 2W1NA 4N8CH 4NOBA 3WV0A 2BZCA 4CU6A 1G7PB 3ZSTA 4JM2F 4YEFA 1UT2A 4WEBH 2ZCLH 2BIHA 1KTKE 3FC8A 5CSGA 2VTFA 4TRPL 4PJEF 3TBVA 4AC4A 2L7UA 2ATPA 1OD9A 2ZWNA 3NMEA 4XXWA 3RVXC 5HHOB 5JW3H 2PXYA 5AG9A 5KSAC 2FWOB 5KYYB 2V2XA 1M7UA 1YJDH 3ZHDA 5E08L 1BD2D 2VQ1B 1NM9A 1AFVL 2DLIA 4DP1X 4HIQA 3P4MB 4H8WH 4LCWE 2J20A 3VMNA 1AXTH 4XOEA 2C1PB 4P46D 1AGCB 3DJ9A 4XR8C 5C07A 2X9WA 3BIAX 3QUMB 4NJ9H 2WO3B 4P3DB 1KFAL 2Y5EA 4R5VA 4EQ2A 3MLYL 4LSPL 4G9FA 1AGDB 1AJ7H 4XPHH 1N0XH 1KEMH 2WTRB 4QHLA 4ZFQA 3TBBA 4FZ8L 3DIFB 1PG7W 2MH4A 2Q8BL 3MNDA 3OC5A 2DKMA 5KS9E 3FQXB 1NDMB 5F1OB 3SGJA 1GXEA 1XL6A 3NJJA 2HUHA 1O5PA 1NCBH 3I02B 4WW2C 4BRJA 1BVLA 1KTBA 2P8MB 2PUQT 5T33L 3HVDA 2AJVH 3QJXA 1A7OL 1Q0YL 3DSNB 5DT1L 3X3FH 4NQXA 5JO5A 3MA9L 3O3BB 2H2PC 1C12B 4NO0A 1A2YB 2D7MA 5DMGD 1URLA 1URZA 1YEWA 4EMZA 4MD5A 4B9FA 1XVSA 3DPBB 4JM4L 5JIHA 2BOLA 1QFUH 2V8LA 3ECVA 2H45A 3MNVA 3QFJE 3FOMA 2OSWA 1NGQL 4OSUL 4PW4A 4AM0B 3D18B 1B90A 2VXTH 3HE6B 2BNQE 5JW4Q 5HYJB 3MGAA 4TM9A 3OLGA 4PRPD 2ZZUT 2HRHA 1UATA 1MRCH 3BWAA 1SM3L 1IBZA 3W9EA 3CFKB 3UTTD 1G7IB 3F7VB 3AMKA 4X4XB 4ACPA 4ZS6D 1S5IL 3F5WB 4HWZB 5T1MB 2YKLH 1CC3A 1OP3H 3DMMC 3WNIA 3BC9A 2VISA 1KB9J 2FX8L 1PJ9A 4FCAA 4E5XA 2VN7A 1T2QH 3MO1B 4V2BA 4BUHA 4EUPG 1T0MB 1BAFL 3MLTB 5D96C 1RJYB 1X7TA 1RCYA 3X3GH 1KBGL 1JWUB 3BO8B 2WLIB 1FNGA 5F8QC 1BD2A 3ESUF 3GI8H 3D0LB 3HB3C 3PV6A 4G80B 3WIIH 2DKUA 5EUOF 3CN3A 1IQDB 4DOHB 4UNTA 4FFWD 2OYLA 1ET8A 1FO0H 3P02A 1DLHB 4GUPA 1OE3A 1MCOH 3NH7H 1MF2L 4P46A 2CUAA 4CNIA 3DX2A 5EU5B 2J2ZA 4IMKC 1NCWL 2VL5B 2I85A 2D31B 2J8HA 4YX2H 4KRPD 2VQ4A 1E67A 4GQRA 1UZ6F 3B5TA 4YSDA 4OCXH 4NO2B 1AZUA 4APXB 4KXAA 4ZNCD 1EA9C 3GXPA 2WTOA 4JREC 4WTWA 2A83B 2P46B 4ELKB 4KKZA 3VFMB 4OT1L 1ZSDA 4PJAE 4AJWA 4EN2A 1HH6A 4GBXB 2EDDA 4ZG1A 3QZNA 2CDFA 1KN2L 3K91A 1SBBA 1EJ8A 1LDPH 5BVJB 2AS5M 1QTSA 5FOJA 1E4WL 2D7PA 3K80A 4DO4A 4MMYA 4NWUH 4IU2B 2XZCH 2B9AA 1IVLA 2QZ5A 5ISZB 3B7SA 3T0VA 3F7LA 5C6PB 3QO0B 1M7XA 4JRYB 4Z0XA 4HD9A 4UM8B 1IJ9A 2QTEA 4LDCA 1I7ZB 2W07B 5D72L 5EZIH 2XA8H 3QWOA 3TT3L 2XV6B 1QW9A 3TFKC 4B5ZA 4M62H 3NQIA 4R7DB 1S7WB 1H9VA 3O6FD 5JIKA 1CFNB 1I3GH 3IDNA 1BLNA 1EDYA 1XZ0A 4JS7A 5E5RB 1KT2A 4PRPA 2EO7A 4RGMC 4YC2B 4JR9H 4XO5A 3VXUE 3CBJB 1CYGA 5DTFB 3VRLE 3S8WA 4NRYB 1YYML 1PJWA 4JDZA 1KTCA 3UTTA 2IPTH 3NJNA 2OMUB 1B4TA 1DFXA 2WAHA 3D69B 3M8OH 3KL5A 4R26L 4WFEE 5CAYB 1J5OL 1SF3A 2EYTA 4Y16D 3D12B 3ZYIA 1K4DB 3MPCA 2YPVH 5EBWB 2AJUL 1UACH 3UG5A 4Z7VA 4XPAL 2O6EA 4S1QL 4PU2A 6TAAA 3VFNA 5EZOH 3Q0HA 3EJZC 3EFDL 3ISWA 2AMGA 2IAMA 1Z32X 3O3EA 2NXYD 4JL1A 1S6NA 3KH4A 1WUNT 2OM5A 5CLTA 5GRVK 5TE6L 4JUTA 3G6JF 2AAVA 3UH8A 4PM1A 5JXED 1DJXA 5KG9A 4MA7H 3KNBA 3TYFA 4NQCB 1IV8A 3U6XS 2Z4QA 3X11A 4PAZA 5D70H 4IRZH 4N8VB 1CFSB 5FYJH 3GSOB 3FCTA 1QVOB 4KPHL 3UAJD 3BFOA 5MENE 3MREB 2EC9U 1LO4H 2W60A 1TSHA 1IGCH 2EDLA 4BCXA 5GSVA 2L3BA 2DQDH 3AXLB 2WVVA 4AGMA 5KTEL 3ZE2E 5GIRA 3NZHL 5LG1A 3Q2WA 4NKQB 4G8IB 3BVDB 3ZQWA 4HJTA 3RVVD 5FM5O 1QNZL 4KDTA 1HNFA 5GGVY 4IBTA 1KACB 5BV7B 3LSOB 5E56A 2FSDA 1MFNA 3A6BL 1OGTB 1PZDA 5BNXD 4XP1H 3RU8L 1HXMB 4V2CB 5D7JD 1RZFL 4TNGA 3BGMB 3EBHA 4JZOA 3V55A 3LHAA 2JCCF 2CBTA 3RVTC 1PIGA 1S7TA 2Q3ZA 2ADIB 5JUEL 1A9EA 4J27A 2V7NA 4YDVA 1A7BA 3OKNA 5LBSH 4A2MA 3R7RA 4B5EA 2R29H 4Y88A 2FJFA 3NIDF 1AC6A 3IJ8A 3O11B 3O6FA 2YEZA 2NZIA 1ZT4A 2YR3A 1XH0A 1A9VA 4RDQF 1WTLA 2XN9D 1HS6A 1TYRA 2G60H 4R7VA 2NSQA 2CRYA 5AVTB 2E47A 2ZWKA 4BZ2A 5CGTA 2QVMA 4PVBA 3QEQD 3P4NB 1BQHA 3RWGB 4FA6A 4Y16A 3NIFE 3D0AA 3QR1A 4KZCA 1KLGA 3T0WA 2HG5A 2QLYA 4BH7A 5HHPA 4LL9A 4U4BA 2XWCA 4LSVH 2WSDA 2Z6FA 3EYUH 2WLJA 2XQBH 5E95B 1ED3A 4BKLB 5JIPA 3RGBA 2CIIA 2WLNA 1WBYB 2EACA 1OAZH 3FK3A 2NXZB 5F7WC 3DJZA 2OJ1A 2VW7A 4F7EA 3DUSA 3KG5A 4FDWA 4LSDA 4UZUA 5DFVC 5AW7B 5GJSH 3SDXE 2RD0A 4IBSA 2Y3NA 4A7GF 4AQAA 5I8KH 2H1PH 4JFXB 3U9WA 4F15B 5D1XB 5A6LA 4IEFB 5JXEA 1XGRA 4TUKH 2V37A 4QYAA 3UERA 5E4IA 5I0WA 2CDEB 1WCQA 25C8L 1WQVT 2UZYA 4EVNB 3RWIA 2WLMA 1P4BH 5E8EA 2ADJA 5JHMA 2A9AA 4NQUA 2DJSA 3UAJA 4JPVH 2GSGA 2FATL 5FFLA 2HCZX 1CLVA 3GXUB 4JO5A 4KZ0A 2R4SL 2A6DA 4PJ5E 2IDSA 4KTEH 2DQFA 4MCNA 2NX5D 5IM7B 3RX7A 2BP8A 2PW2A 4FTVE 1UC6A 3UBGA 3KPOA 3WFHB 2AQRA 2DY2A 5HVFB 3BT2H 5D7KE 4P2RD 4OJEH 5KVMC 4PJXB 1ERNA 3PE9A 2X4RA 4D9LH 1UXSB 4CC0A 4MJ4A 2AJXH 3BKYH 4OIFA 3N40P 2XWBA 2VE6A 5D7JA 3U2IA 3ZR5A 1A02N 1XH1A 3CGTA 4G8AC 4WUKL 2N1KA 4A66A 3TPKA 4DVRH 3GTNA 4NHUB 4QXGH 5E9AA 2B1AL 2HFTA 5TD4A 2NNRA 4RFEA 3CX2A 3QDHA 3L3JB 5AZEL 4UU9B 3GC3A 5CNHA 3PHQB 4PRIE 4W9EC 5KOVC 1QFHA 2VDKL 5D6CA 4KK5D 4CVXA 4D9RE 5IT2H 1VCAA 2E7BA 1NCAL 5DDHA 1EUUA 5I17A 2YMXL 3T6VA 2XN9A 1FJ1A 5JOFB 2IDTA 5J5EA 2UY6B 3BGFB 3MODH 1D5XA 1YN6A 4Y1AE 2MJWA 5CD3B 1TZGH 2LU4A 5IOKA 3LS5L 4H2CA 4OD2B 4DP5X 4TVPH 2YSSA 3ZO0A 4RRPA 2VJXA 2BSCA 4FNQA 1BF8A 2VH5H 3QEQA 4EIBA 3GYRA 3CFBA 5GGRA 3S37H 4MA3A 1GY1A 2OCFD 4JFVA 4HXAL 1CFQA 4K94L 5CZVH 1ANUA 1EPFA 3QYCA 5CF3A 1NPJA 4DKEH 5BRZB 4MWFB 2WLLB 3TM6A 4L8CB 4URTB 2J5WA 1B4JH 3NP3A 2CM6A 4JM2C 1YN7A 3CLFL 3V0IA 5I73B 1SLVA 1TU2A 3H85A 3J27A 2XT1B 4J3OG 1MFBL 1XF4A 3AT8A 3IGAB 4UV4L 1LE5B 5I5IA 2F5BH 3PJSA 3HNSH 5TGBA 2J43A 4OLWL 1WBXB 2QMJA 2H2SD 2IOIA 2X3CA 7FABL 1AKJD 4A2HA 4QRQB 5B7FA 2IPKA 1ZVSA 1L0PA 4OV5A 1VA9A 1DR9A 2QEJA 1IO4C 1FBIL 4UQIM 4LSQH 3A4AA 4XOBA 4E9YA 4WHTB 5C0DB 4HA1A 4LLVB 1MCWM 2NX5A 3WTXA 2GSMB 2DQIH 1KG0A 4P2RA 1D3CA 32C2A 3TV3L 1S9XB 1MVYA 3L4XA 1MHHB 2AJSL 1XB3A 1SHMA 3L3HB 1R3HA 2PO6D 4MQXD 4BFNA 3OPZL 3O4OB 3IFNL 4HC1H 3H54A 3I50L 1NC2B 2EXWC 3US0A 3PP3K 3SDCB 3QDJE 1J5HA 2YPVA 3PAYA 3PGDB 3W3BA 1KGWA 1DTUA 4RMSA 4X6DB 5AB0A 3BW9A 3ARGD 1PLGL 2Z0BA 4XPBH 1A66A 2J1KA 4I3RL 3DYPA 3TGXA 1TJXA 4OFDA 2OMZB 4BFOA 5F9AC 5I6PA 4BDVA 1QRKA 1YPZA 4XNDA 1RP8A 4QCIA 2ZSVB 4Q4EA 4GW1B 3DTDA 3U1SL 1JV5B 2QGBA 4HKBA 3WNPA 5TF0A 1MPAL 3FQXA 1XGTA 3EGXB 1S3KL 5HY9A 3VI4E 1IGML 4RESB 2DYPB 1I7TA 4FNUA 2F7OA 1E6JL 1MG2C 4XX1E 3QUKB 4GO9A 2P8MA 5BMFL 3HNTL 4GG6F 3HLKA 1HQ4B 2BHYA 3Q8EA 1OKEA 3NQKA 4IRZA 4O2FA 3I9PA 5EO0B 1NJ9B 3BVNB 2UXVA 4HFWB 5L4FA