2PP9A

Nitrate bound wild type oxidized afnir
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title Conserved active site residues limit inhibition of a copper-containing nitrite reductase by small molecules.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 91
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp9A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pp9A02
1AZCA 4M3HA 1A8ZA 3L45A 2HLEB 1OCCB 5B1JA 2MTAA 2N0MA 2BO0A 3JT2A 3JTBA 3QJQB 2R7EA 4BXSV 2DWTA 3WG7B 3NT0A 3FPYA 2DYRB 1I53A 1AS7A 4YSPA 2FJSA 3NJJA 4PCYA 3DKHA 1SF5A 4AZUA 3TBBA 2HXAA 1A4AA 1J5DA 3SBPA 5I26A 2MRYA 3BQVA 1FA4A 2IH8A 2AZAA 2CBPA 3IEAA 2BP8B 1BAWA 1OE2A 4YSEA 4DP7X 1ILUA 1WA2X 4KNSA 1IUZA 4GP5B 3S8GB 1NWPA 5TK2A 2FT8A 2IDUA 1WA0X 2YAQA 3H56A 4DP9X 2PPAA 2YAHA 3GXUB 2IH9A 1J9TA 3QJSB 4M4RB 1JVOA 5IY5B 5TK4A 3FT0A 1B3IA 1L9QA 1M57B 1SFHA 1V54B 2H3XC 2IDQA 4DP2X 4PAZA 1GS8A 3H4FA 4ZK8A 1M56B 1E67A 1X9UA 2HRGA 3RYMA 3FU9A 5F7BA 3FQ1A 1MZYA 3FSZA 1AIZA 1KDIA 1NIDA 2VN3A 1BQRA 1ETJA 4NERA 3T6WA 1V55B 2XV2A 1JZJA 1KGYE 2OV0A 1L9RA 5B7FA 2IAAC 2IDTA 1SHXA 2FQFA 1HAWA 4FA7B 2WO3B 2TSBA 3CVCA 1E30A 2EIMB 2VM3A 1TKWA 2HX7A 1AZUA 1NINA 2TSAA 4NAJA 2GBAA 1WA1X 2UX6A 1CYWA 3S8FB 1URIA 1XB8A 2XX1A 1A4BA 2CALA 1J9RA 1JZFA 4NB7A 1IKOP 2GB2A 5I6NA 3ABMB 4KO9A 1EZLA 4HHWA 2X87A 1GY2A 4AX3A 2UXVA 1L9PA 3N55A 1AQ8A 3ZDWA 3H4HA 3ZBMA 1ZDQA 2XLLA 3T6ZA 1CUOA 1PAZA 3EH5B 1NIAA 1NPJA 2J55A 2PPCA 3QJVB 5D4JA 3OQRA 3QJUB 1BXVA 7PAZA 1AZNA 1E5ZA 2BZ7A 2CCWA 1GS6X 2BP0B 1BQ5A 1SHWA 3FU8A 4DP0X 1ET5A 2CUAA 4G7RB 1HFUA 2WO2B 1KBWA 1WAEA 3AG2B 3AW5A 3FU7A 2VSKB 3KW8A 4HIPA 2ZOOA 3X1GA 4QLWA 2XXGA 1BYOA 2WSDA 4ENZA 4YSSA 2PPFA 2XV0A 2IDSA 1AS6A 2H5UA 1A65A 4E9SA 2H47C 3U25A 1JERA 1NTDA 1KCBA 3UACA 2PPEA 1MG2C 2PP8A 4AKOA 3IE9A 2XYBA 3CVBA 3CVDA 1IBYA 1JXDA 1PMYA 2FTAA 3ERXA 4YL4A 3UABA 4QKTA 1JXFA 1XB3A 5I6MA 4BXVA 1OE1A 5I6OA 3IN2A 1TEGA 3WKPA 1KCWA 2BWIA 2ZONA 1JOIA 2FQGA 1PLCA 2P80A 3MX0B 2BW4A 4E9VA 2JKWA 3NSFA 2XWZA 5AFAA 4Q89A 2BZCA 5D4IA 3CDZB 3HB3B 2UXGA 4YVUA 1PNDA 3EF4A 4KO6A 2QDWA 5D4HA 4G71B 2EIJB 3PAZA 4L0PB 2QPDB 4YSUA 3FPXA 3AG1B 2DYSB 3IN0A 4BDVB 4G7QB 3PAUA 1F56A 2XXFA 3FQ2A 3SBQA 2OJ1A 1BEXA 3V9EA 3QPKA 6PAZA 3WNIA 9PCYA 5B3SB 2IDFA 5I5JA 1JZEA 3ABGA 3IBOA 1RKRA 2VW6A 1QHQA 1NDTA 2YQBA 4DP5X 2VMJA 4YSQA 3PAVA 1PNCA 1FWXA 5EHFA 4P5SA 5F7AA 3QJRB 4BWTA 2J5WA 2FQDA 4KO7A 1L9OA 2YARA 1N68A 1J5CA 4JHUA 3UADA 4JKNA 5LDUA 4F2EA 1OF0A 2UXFA 1ZV2A 4TXVB 4WKXA 3UAAA 2VW7A 4X4KA 4E9YA 2Q9OA 2VW4A 3OMIB 1KYAA 2DWSA 3ASOB 3N2JA 4KNUA 5B1JC 3D12B 2HX9A 1SDDA 5I6KA 1ASPA 4DP1X 2HZHA 1X9RA 1W6LA 1OCZB 3NJIA 3TA4D 1OCOB 1NZRA 3EH3B 3FSWA 1ET8A 2Q5BA 1T5KA 3QQXA 2R7EB 4HCIA 1IBZA 3PCYA 1NIBA 3NJLA 4G70B 4E9QA 1RCYA 1AR1B 4Q8BA 1ILSA 2B08A 2GC4C 3DTUB 3S3DB 2GI0A 1OV8A 1ZIBA 1SFDA 3FSAA 1KV7A 4KOCA 1MDAA 3NP3A 1DZ0A 4GP4B 4F7KA 1PLAA 7PCYA 1OE3A 1TEFA 3CZUB 2I7SA 4YSDA 2AVFA 3CDZA 2X88A 4KNTA 5I28A 2YXWA 3FYEB 3SBRA 4YSCA 5AKRA 4W1TA 2P80D 4CSZA 1AG6A 4MFHA 3G5WA 1PY0A 2PCYA 2BP8A 3SQRA 1JZGA 2PP7A 4GYBA 3EHBB 2CAKA 2JXMA 1AANA 4A2EA 1GY1A 1PZAA 2YAFA 1AACA 2LLNA 2B3IA 2YXVA 5B7EA 2Y69B 3UAEA 3S3CB 1M9WA 2FQEA 1WS7A 4UF7C 1JZIA 3NSYA 2W8CA 1W6WA 5ANHA 1IC0A 4HZ1A 1W8EA 1E5YA 2YAMA 1FFTB 2XV3A 2BW5A 3FQYA 2GHZA 3KW7A 4A2HA 4A2GA 1RZQA 1UATA 3OMAB 1JVLA 4K9JA 1MG3C 1V10A 3X1EA 4G7SB 2AZUA 2XX0A 3BVDB 2BHFA 3T71A 5PCYA 2ZXWB 4G72B 5I5IA 1QNIA 3PXLA 2E86A 4DP4X 5B1AB 3NJFA 3T9WA 1SNRA 1J9SA 2ZWNA 5I5MA 2FWLB 3NJMA 4GY4A 2PPDA 1GR7A 2XUWA 1TU2A 2I85A 3UGEA 1PF3A 3T6VA 1BXUA 5B7MA 1NWOA 3AZUA 4A68A 2EINB 1PLBA 1ASQA 1AZBA 3NJKA 1ZIAA 1NIFA 4DPCX 2W88A 4BWUA 3AY2A 1J9QA 3EH4B 5AZUA 1E65A 2YAPA 1AS8A 1GSKA 4HALA 3T6XA 3ABKB 2Y1AA 1DYZA 3FSVA 1NIEA 3FU7B 3ABLB 2FT7A 4A2DA 4A2FA 1HAUA 2BWDA 2PP9A 2CJ3A 1WS8A 2HRHA 3FS9A 4A66A 2VM4A 5FC9A 3WI9A 2BP0A 1ADWA 3NJHA 3S3BB 1GYCA 3ASNB 3FYIB 5E9NA 1XMEB 1KBVA 2JFCA 5PAZA 4E9RA 2OCCB 4F2FA 4EF3A 1ASOA 4N4YB 1NICA 1L9SA 3NSDA 2IWFA 3DIVA 1AZRA 2GC7C 1CURA 2RACA 1OOWA 4E9WA 3OD3A 4DPBX 1YLBB 1R1CA 6PCYA 2UXTA 3WKQA 1GS7A 2FT6A 1SF3A 1ZPUA 4KOBA 4BK5C 3OM3B 3QJTB 3MBWB 4YSAA 3PPSA 4YVNA 1MZZA 3X2QB 1ET7A 4W9ZA 1RZPA 3TASA 1JZHA 1CC3A 2NRDA 3WIAA 1N70A 8PAZA 3ZX1A 4YSTA 4BWWA 4HCGA 1AG0A 4FAAB 4DP8X 3WNJA 1PZCA 4GP8B 4CSPA 5B1BB 2IWKA 4N8UA 3AG3B 2XU9A 5I6PA 1NPNA 4AKPA 2EILB 1PZBA 1GW0A 4A67A 2J57A 3AG4B 3ZIYA 2I7OA 1KDJA 1SJMA 3OMNB 1EHKB 2DY2A 4JHVA 1ZDSA 3NP4A 3X1FA 4AKQA 2A3TA 1VLXA 4BDVA 4KO5A 2YAEA 2IWEA 3TU6A 5I6LA 1ID2A 1A3ZA 3NSCA 1BYPA 3NYKA 3CG8A 2VSMB 4E9XA 2EIKB 2GIMA 4DP6X 3PLYA 1QLEB 2FNWA 2QT6A 2XVBA 4YSOA 4UANA 3X1NA 3NJGA 1BXAA 4HHGA 4P5RA 2HX8A 2AFNA 1BQKA 2PCFA 3TBCA 3HEIB 5B1KA 2QDVA 2YAOA 3NJNA 4YSRA 1AAJA 1CYXA 4WTQA 4E9TA 3GYRA 4DPAX 4HCFA 2AANA 1SDDB 4UAHA 2QPEB 4AI7A 3C75A 2PLTA 2UX7A 2GSMB 1A4CA 5A7EA 1L9TA 3X1BA 1AOZA 3V9CA 1JXGA 1PCSA 4GXFA 4HAKA 1XB6A 1OCRB 3GDCA 4RH4A 2DV6A 2J56A
chains in the Genus database with same CATH superfamily
3S37X 1IGIL 4LLUA 1AQHA 1DQJB 4O5LH 5HGBA 3GTNA 4NQDB 3T0XA 2ZUTA 3CXDL 1VGEH 4KVCH 5HPOA 4WTXA 3V0WL 1NMCB 3HAEA 3H9SD 3TA3A 1A9EB 2FHFA 1E42A 3DIDA 4G83A 1ONQA 1NUDA 4AMKH 2E7MA 4RWHA 4XI5C 4UTAL 2IFFH 5D7LE 1MHEA 3FO1B 2CR6A 1CXFA 4WEEA 5I1JL 5HI3D 6CGTA 3OAUH 3HC3H 3PJLA 4MXQC 2OK0L 5AYUH 5H37G 1ZHNA 5L2JA 4XCYA 3W1ZA 2J6EA 1G5AA 3WN5B 3LRHA 3E2HC 1E40A 3W11C 5E1QA 2Q7YB 1CLYL 2VB5A 4K73A 2GT9A 3BKCH 2CKBA 1Z9SB 3A4EA 5B3JE 5AB2A 2OMUA 4E0RA 3LEVL 3H56A 3PXHA 4YXKL 3U4AA 4Z3HA 5I1DA 4MAYA 1RFDL 3D0VA 3O0RH 3WEAA 3NZSA 4WW1B 2C7FA 3QJSB 1F3DJ 3IJYB 3BIBX 2P48B 1DSFH 1WTGT 2F1EA 4KTEH 3ZL1A 5EF2A 1NC2A 3EYOB 3SZKC 5E2UH 3LEYH 2FHCA 4PV9A 1BWWA 4NENB 1ZTXL 5ANMB 3T08A 4DO4A 3UOAB 3GSNH 1YECH 2E4TA 3O4LB 4GW4A 4NRZB 4PJ6A 3VGGA 1KCVL 4G8GA 4LCWD 1UOKA 3POHA 1KT2B 2P8PB 3SO3C 1OF2B 1BOGA 3QAZB 4AZ8B 4CVXA 3UC0H 1WBZA 1JHKL 5AG8A 4ZAKD 1WZ1H 5G2NA 3BUBA 1MIMH 3KYNB 1K5NB 1ND0A 2VR7A 2TSAA 5KEZA 5D9SA 4OLVL 2HT2C 3RBGA 1KGXA 1OK0A 2VZ3A 2X1OA 1O5DT 3HC4L 3UTPD 3SDAA 3UTZB 3WUZA 1CGTA 4J39A 4AYMC 2KYIA 1HHIA 1IB5A 5CJQL 3T0ED 3GI8L 2HA1A 3OXSB 2H26B 3EOYG 1DQQA 4Y8DC 3UCRA 4NB7A 1T1YA 3RDTD 3QWRD 4OI9A 3JWOL 3C60A 3EDDA 1B9KA 2GJRA 4G7VH 3GIVA 3NEEA 4HJIA 3ZBMA 2NY2D 3A4DA 3INUH 3KXFA 5FCUL 3X13A 4CN1A 4RLDA 1MAMH 5T3XD 1MFAL 3KH3A 1G7LA 3U0TB 4PM1A 4NC2B 4PRNB 2QQLH 3IK2A 4LOFA 2BWQA 1I1RA 2HFEB 3HBPA 4E41E 3K8MA 4EDWH 5IF0B 1TNMA 4ALAL 5SWSA 3HHRB 2R9HC 1KXVC 4PJAA 5DJCB 4ZUSB 5DFAA 2XG5A 4HG4K 1T21A 4X4XA 4ZQTA 2Z9TA 3K6NA 3UDWA 2ZSVA 3D85A 4ZTPL 1OTUC 4QF1B 4XPFH 5E7FA 3UO1L 1NAKH 2BFGA 3HHSA 3JT0A 5CWSB 4P5MB 4TF4A 2NY4B 4XE0A 1EEYB 5DMIH 3AB0B 3TEYA 1QR4A 4ZPVA 4EUPG 2A77H 2WMPA 3GNMH 4WV1A 5LQBL 1NTDA 3UACA 4U3CA 4R7NB 4Y2DA 2HT4D 3LAFA 2OMZB 2G0LA 1LWHA 1LTXA 1XBRA 1AP2B 3CHPA 2VITA 2WINB 3QR0A 1XF5B 1UM5H 4OUOA 1BQHG 1HOCB 3KYOA 5KSUB 1JMZA 4YL4A 1JPFA 1T1ZB 1AGFB 3SPCA 2V3FA 4R90H 3CX2A 2IPTL 3I6SA 4OKDA 4AENB 4JGNA 5CMAA 3ASWA 4U6XA 2YGNA 1KCUL 2FH8A 3BP4A 2AK4D 4O2FA 1MRCH 4X80L 4B9CA 4Z7OB 5ETUA 3US1A 4H0IA 1W0WB 3WEBA 4QXUL 5C09B 1MFDL 3IGUA 3TPUB 3NDZE 3V5KB 3ESNA 3P3TA 1T6VN 3CZFB 3N40P 1KYFA 4NO5B 2DWDB 3LEXB 4EI5A 1HJCA 3CDZB 1TTFA 1T3FB 4YHYB 3L54A 5MEQA 4KO6A 2FIRT 2VLJB 4XAKD 5I1AB 3VWJB 3I3BA 2J4WH 1NCJA 2P8LA 3FN3A 4G71B 4EE2A 1RZGB 2BNRA 3INOA 5IVOA 3GUFA 1CCZA 4X6DB 3FPXA 2YD0A 4BDVB 2B59A 1F56A 5EFIA 2KI6A 4KFMA 3QWOB 4G8GE 3KWVA 5DJZB 3KHOA 1IC7H 3QR1A 4PW9A 5IHLB 4WEMB 3IFOB 1I8LA 2RR3A 4TQHA 2VL5B 3NCYP 1S3KL 1YY9C 4PJ8A 2YQBA 5HDRA 1K4DB 4YSQA 2DQHH 3PAVA 1PNCA 2WTRA 1X5ZA 3GSXB 5IBLC 2DN7A 1ROWA 2ZOKA 4PH8A 5EOTB 5JHLA 5EU5A 5DK0B 5LDUA 4JKNA 4U33A 2LW3A 4OCRH 4WI7A 4Z7OE 3BE1L 1TZ8A 1INEH 2DM2A 2ATKA 1LP9E 4PRPD 4YN3A 3TEWA 3N1FC 5EZJA 3RJDA 1IQWL 1FVCB 2VW7A 4N0CC 1ROCA 4TULH 4X4KA 4E9YA 5I1GH 5ITFA 2Z31D 1T03L 3KXFE 2VW4A 1GZPB 1BFSA 4DUXA 3CXDH 3ASOB 1LO5A 5H2BA 3T8XB 5DJAB 5IMLA 3GSWB 3ZDZB 1UA7A 3DO7A 3EYQD 4IBLT 4E9LA 2P47B 2O6EA 1BLIA 1BF5A 2D73A 3D05A 3M17A 1OCZB 1NZRA 2EXWC 1QUNA 1DQDH 1CDYA 4P4KB 3WO4C 1IBGL 4BFRA 3GMPB 4JCMA 4DWHA 5IHHA 1XFPA 5DQ9A 5E8DH 3STZB 2PKDA 2NZ9C 3CZLA 2WLLA 2VJ0A 2W0KA 4HISA 1CGWA 1VDGA 3WDJA 4PCTA 1TVBA 2JJSA 3PNWA 2Z64C 1CBJA 1I7RB 4UMGA 1ILSA 5C0IB 4IBSA 1E28B 1CFTA 1F4WL 3O2VL 3VXQB 2APBA 3GBNL 4L4JA 5J06A 1AHWC 4XNUL 1R3HB 1K3ZA 3P77B 4PJEA 4BZ2L 1N5YH 4P59L 3D08A 3TOPA 2N7AA 1I7TB 3MX0A 4PJCA 4RMWA 5GS2D 3O2DH 3N1PC 3NJVA 4MA7L 2V3EA 2G5UA 1XMWA 1AJ7H 3FYEB 3MO1A 4FXKC 4YZWA 3L3IB 5FECB 4IHOB 4ANWA 4CUCA 1PL3A 4JKLA 3QIUD 4IOIB 2W07B 1KCVH 5HI3C 4F7CA 1I8MB 5LAXB 3VXMB 3ZW3A 4Z7OF 1PZ3A 2A99A 1LP9F 3HC2A 3DSFL 4HSAC 4C55A 1YMHA 1XEUA 2BXZA 3UZVA 1I82A 1IJNA 4JFPA 4NQXB 4M48L 1KFAL 4FNPA 4I18C 2BNRE 5AD0B 5CJQH 4X6DF 5FYJU 4N6QA 2IGFL 5IKCA 3G6JB 4A2HA 2ADIB 1AYOA 3HE6B 4URTB 3DO3A 2IAND 2GK2A 2VXQL 2N01B 3QIWA 5EZOL 4AQEA 3C5JA 5PCYA 4I48A 3OR6B 1Q8MA 5I5IA 2F1BA 3W39B 1B0WA 2X44D 2AEQL 5B3NA 3SJVB 3MOAH 1IL1A 5JW4R 4KJPD 2WYTA 2K7PA 5KG9A 3L3KA 3UGEA 5HHOA 2AJSL 4J6RL 2KZWA 4RAUA 3VXME 4X8JB 4ZAKC 1X6LA 3AZUA 4BD4A 5IHZB 1QATA 2G60L 3QUGA 4LCIL 3KYAA 4D0CB 3EJJX 3GS4A 4Q56A 3DX6B 1JK9A 1YPZB 1JPST 4LEXL 3V7AG 1L7IL 3KPMA 1LNUA 4LBEA 3RDTC 1FN4B 1GA2A 3QULA 1UOLA 4IDJH 5J1AB 3BIAX 3L4TA 4LSTH 5FCSH 1MREH 4CBPA 4BFIA 4HGWA 3HS0C 1WS8A 2ZX6A 4P2YA 3QQ9D 5CLXA 3T2PA 3LKSB 5AL8A 4MHHG 3K5SA 4RX4D 3ARGC 5B38G 2G2PA 5A1AA 2F6AA 3KPTA 1IGJA 2LQRA 1JG9A 1YUKB 3S5LG 1I8IB 3FN0L 5CD3A 1VEPA 4PR5B 2JFCA 3ZR5A 4R0LB 3C6SA 2CCLA 4P04A 1H3VA 1SGKA 4M93B 3MV7D 2E9WA 3FBQA 4PUBL 4LVNC 3LZPA 3TCLA 1P7QD 2ODHA 1M7XA 4XB3A 1U36A 4MKMA 2GC7C 1U4EA 3FUIA 3CMOH 3QXTA 4CRPA 1NCAL 2YEZB 4PJEE 4Q0XL 3P3SA 4QXUH 3RWDA 2YOAA 4MMXB 3P2BA 5L88L 1AGCB 4QTHA 5DI8A 5C0GB 1LMIA 1MCSA 2N7SA 2ZUQB 1HQRB 3AY4C 3QXWA 3RWEB 1HK6A 3GD1C 3PPSA 4B5EA 3L5JA 3QUZA 4PJGB 3NTCL 1T0PB 1RJCA 4JCWA 5FK9A 2HT4C 5C7XL 2J2ZB 2O6DA 3CDYA 4ZFOL 1JGUL 4G6KL 2OSLB 4W9IC 5FA4B 3EO0A 2DOCA 4JRFA 4Y4KA 4BWWA 2WQRA 5SX4H 4KTDH 4Z9KB 5FPIA 3FUJA 4DP8X 1MI5D 1PZCA 1EFXD 1U93A 5B8CA 3FU3A 3QI9A 4M7JL 4M1CD 1A2YB 3RTQA 2O6PA 4GO8A 3W9DA 4A38A 1LXMA 2CO3A 2F74A 3U1QA 4QJ5B 3W9EB 2Z3FA 5SWQB 3TZVA 1XCQB 3OZ9H 3T2NH 2X2UA 3I9PA 2AXWA 3CLFL 2XA8L 1ECZA 2W1NA 3CH1A 1YYML 2AXGA 5K1NA 4OZHA 4PYHA 2R2BA 1A7PL 4WJKB 2JJWA 1KJ2B 4X8XA 5HHPB 4I9WD 4MS8D 4YL9A 4N2OA 3OC8A 4QRPA 1TTAA 1T03H 4KXBA 1RUAL 4X2UA 4ZW8A 4HK0B 4X6FB 2XRAL 1E4KA 2FUQA 3QUYD 3CMGA 2ZF8A 4ZMQA 3QFGA 5FV2A 3PF2A 2HX8A 4X6CB 2F54D 5HHOE 4AM0B 3FFDB 3QDMD 5LAPA 2DQFB 4UOW0 1GAFL 1OB1B 4RDQG 2R1XB 3CQQA 1PEZA 3UTSD 2FJFA 2XQYK 2WXPA 4LU5L 5AG9A 2XWTB 1YPZF 2NR6A 3IXAB 4JO5A 3VFUB 4PVLA 4PP2B 3GSUB 3O41A 5EIIG 4JN2B 1TYJA 5HI5D 2BMKA 3QHFH 1T2JA 4QHMA 1IMHC 1I1AD 1ZE3C 3M1CA 2Q3XA 2XFXA 4ODUA 4X6BB 4NZ8A 4D0DB 2J56A 5GGRY 2W0FB 3BXNB 4NN5C 4P59H 4YPGA 1IGTA 5EU6A 3LY6A 2J72A 3GKZA 1OLLA 2IQ9H 3L48A 4WWKA 4I0KA 3NGBB 2NT0A 1IEBA 4OZGB 4WHDA 2GBUA 4QHUA 5D7LD 3TEZA 3CSYA 4DZBB 2BVOA 2FJSA 5TTRA 4Q6YA 1FAKT 3GTTA 4D7BA 4UV7L 1ZKAA 5GGUA 3CFNA 1EJFA 3BPOC 3GHBL 1D2PA 5GGRA 2HXAA 3GLDA 2A4CA 4NT6A 4OGQC 3LH9A 4M61A 4OCSH 2X4RA 2YPLA 5CLTA 5EBMB 3WNNA 1COBA 3BH4A 4MWFA 2MQ3A 3LYRA 1S7WA 1IUZA 2ESVA 4MD0B 3WIHL 4IKIA 5MENB 5GRWA 4L4VE 3FQXB 1IQDB 4I3RH 2UY7A 3E2HB 3KGTA 2VMDA 4M48H 2APWA 1E8YA 4WUKL 5FOBA 4PGEA 1WC7B 3W2DL 4DSYA 4OF5A 1Y7VA 2O4EA 3TNNA 4XMXA 1IBFA 3ME0A 4OLWH 3RIFK 2BVPA 3GPSA 1C16A 1FNSH 4WAFA 2H3XC 3DX3A 1V54B 1CLOL 2ZXAA 3H4FA 2LVCA 1LWJA 3PNRB 5KYWA 1UYWL 4A7VA 3FB5B 2FEDC 3MLYL 3FSZA 3QIUC 1VPOH 2VAJA 3DIFA 43CAB 5DZVA 3UEQA 2HFGL 5L8JB 5F9OL 1USQA 2XHNA 2DB8A 4YQXH 1B4RA 1ZANL 4LLMB 5FX3A 2DEWX 3NCXA 3LKQB 4FFVD 4OZHE 5K9QI 1IGMH 4UU9A 4KQ3L 1HH9B 4J28A 4LEXH 2YRLA 5E6IA 1E3ZA 3L3OA 1L7IH 5C6WH 4XWOD 3MXVL 1ZGLP 1BVZA 5DRXB 3VD2A 4FMFA 3ROOA 5DMJB 2BC4B 2H3KA 2C9UA 1EZLA 3IFNH 3P11L 2GKIA 1TETL 3NCYS 1MCJA 5D7KD 1Y18A 1HNFA 5BUAA 1G7MA 5HGHB 4FMKA 4X6CF 1NCDL 4E41D 4CVZA 5F21B 3ILEA 4BGDA 1JGDA 3P4LA 3WE6A 4GUPB 3VXSA 3KPSB 1KWGA 4KJPC 1AO7A 3NVQA 3FUFA 3MRIA 4OCXL 1I9IL 3CFCH 1BQ5A 4DFIA 3BZEA 2Y7NA 3FHQA 3NG5A 3FO0L 3FFCB 3FU6A 4FS0A 1IGCL 5HYSB 2AQPA 4BQ9A 2LU3A 1N0LB 5K1VA 2WXQA 3IDMA 2V33A 3FCTA 1A6ZB 3GINA 3QORC 3TA3D 1IGFH 1NCAH 4IK6A 1RL1A 5BW7C 3IVKA 3X1GA 5A3ID 4FD0A 2B1OA 5EU6E 5L88H 4ZUTB 1H8NA 2PWDA 4HA1A 3VXOA 3C87A 4HGMA 4R7DA 2VXTH 5IJVA 3QEGL 3BAXA 4LL4A 3PHOB 4PRAB 4TOYL 5JTWA 2ED7A 3O6FC 4MKTA 4OQTL 3BP5B 4Q6IC 2ETWA 1GGIL 4OJFL 1JPTH 2EYRA 1NL0H 3RPKA 4DETA 3KYMB 1F3JB 2B14A 4L23A 5FEBA 2FX9L 1QYGL 3QUKB 1JXFA 4MDJB 2OI9B 4LVHB 1KTJA 1ZHBA 3MYJA 4TLSA 4OZHF 1MWAA 4X9IA 1WP6A 2YPLE 2XZCL 1SN0A 4MAYD 3VVWA 4PGDB 5F7KC 1NUFA 5FGCE 5TE4H 2DL2A 1A9BA 1ZTMA 2Q2EB 3A67L 3ECVA 4N8VA 1SEBA 1IBDA 3KPPA 1CDIA 2FQGA 2YGOA 2O1AA 4JFXB 1CD8A 1NC2D 3RIAF 3LZLA 4WGWB 4CC4C 1W8OA 3CLFH 5KOMC 3V55A 1YYMH 5EA0H 1U8QA 4YFEA 4G8GD 4ZOBA 4AEFA 2HFFA 3VA6A 5C0AD 5H4ZA 4AQ8A 3E3QC 1WCQA 4W9EC 3WNLA 4RIRA 2OJ1A 1RUAH 2AQSA 2CO7A 2VISB 4TVSa 5E4AA 2WUCL 4OM0L 3HJEA 3ABGA 2DKUA 4Z0XA 4PSRA 2ZOLB 3DMMA 4BSVB 1JDAA 4XXWA 4QUOA 2UZPA 4M1CC 3SOBH 5E0FA 4OZ4A 4F58H 3SDAD 5KANI 2QFRA 1B4LA 1TPXC 3JVFC 2IAMA 3L2LA 5DVMA 4DOHE 5GS0D 4LU5H 5C2UB 2Y0SA 4KO7A 3PWPB 2YARA 3C60D 5JPMA 4NNYB 3U4EB 4I7ZC 4B96A 4HUKB 2FBJL 3KXFD 4U0QB 3SDYL 1CU4L 4JLRA 1HZHL 2RTTA 2I26N 4MS8C 2Y23A 1R5WB 5DJ8A 4JJHA 2ENJA 4R97C 4HF5H 2AMUA 2KS0A 3VFVA 3OAYH 5SWSD 5T3XL 3DVGB 3QUYC 3BVVA 3FU5A 5AEAA 3VXSE 5CFAA 2YA2A 4N1HB 3T6QC 3MUHL 5KYXB 1SDDA 2Q76A 1JNHA 1JI2A 2MWCA 3D85D 1YZZA 3GMNB 4BH8B 2XICA 5BUGA 1OCOB 3V9FA 1FGNH 2HG0A 4C83A 1QLFA 1T5KA 2DW5A 2OZNA 1JPGB 4IIQC 5MHSE 5EBLB 3GHBH 2BOCB 3G5YB 2NXYD 4FYTA 4GKOA 4F33B 1OVZA 3LZFL 5HI5C 4LLVB 5FOJA 1EEZA 1A6PA 1HXYA 4N22A 2X70A 1I1AC 4Y2DD 3MBXH 2IJ0C 2HVJB 2D3LA 4K3JL 4TNEA 4K8RL 5LBSA 2E27L 1UQSA 3C8KA 4APQA 2VDPB 1OT4A 4FFYL 5LG6A 4G6JH 4YWGL 1OE3A 1OSEA 5F0MB 4IQHA 1TEFA 2NQDA 4U1IA 4H88H 4O02L 4BIKA 4TNVK 1UXMA 2Y24A 3JBG7 4PRDA 5I28A 1S9XB 4NZDA 5E95B 2YXWA 2D9CA 3BH8B 3H9SB 4NRYA 1UYWH 4A7QA 4F37F 3UTQA 3TBTA 4X7TA 4YHZH 4CSZA 3OJMB 3G5WA 3GB7B 3HIZA 1QWNA 3IDYC 2ZKXA 2OZ4A 3F7QA 3MXWL 1JZGA 2IPKA 2NLJB 2OQJA 5F9OH 2L3BA 1IC4H 1NSNH 5FUOL 2NUTB 2APFA 4EI5D 4QAWA 1ES0B 1MXDA 1OQOA 3VXRE 2YZ8A 5A16A 3MRCA 5I1KH 2WUBH 5JW5A 4XVTL 3IU3A 2B3IA 2EH7L 2Y69B 3QZMA 4XO8A 5KJRL 2BVTA 3WFDL 4OF0A 1P5VB 4AQAA 4H20L 4L3CB 4JR9L 5E2VL 5EC1A 4Y5XA 3V6FB 2W95A 4JY4B 4PTUB 1M71B 4HJEA 3UAJA 2XWEA 1ZEAL 1P9MC 2B77A 1IT9L 3KEHA 3KW7A 3MXVH 4XPAL 4D9RD 4PJ8D 4IMKC 4XCEA 4XNMA 4I18B 3JV6A 5FW6A 3GJFA 4M1DH 4K5LA 5IR1B 5TE6H 2IH1A 1JXJA 1NBVL 3WL9B 4HUUA 2C26A 2QV4A 3LMJH 2V2TA 4IHBA 1ZPLA 3T9WA 3IMVA 2YD9A 5C08D 4BK4A 2VQUA 2BSEA 2F18A 3CAFA 5BQ7A 3QCTL 2EDWA 4QYAA 3WSQH 3OKOA 4LCWB 4YDJA 3AROA 4YHIB 4AYID 1FL6A 1UD3A 3EIFA 3I3EA 5IFAL 5JOEA 4AY0A 4PWEA 5BCAA 5T5FH 3M86A 4FFVC 4HKXB 4Y5VB 5IFHH 2FR4A 1CJYA 1IGCH 4YHPB 4FLOA 4LCYA 4BWUA 4IBTA 3S34H 3Q3GB 2D2CC 4XWOC 1JWUA 2ICEA 3BGMA 2W9LA 4J7RA 4BRVA 3NA9H 4I4WA 5EH1A 2AEPL 2Y07L 2MH4A 3ZE2B 2K1MA 4TTGA 5I66A 3DJTA 1RU9H 2ID5A 3ARDB 1X44A 4TOYH 4KTGA 1L6PA 5E99L 4OQTH 5KVEL 3FCSA 4NUJA 2ZCZA 1I9JL 1Z3RA 4JO8A 2OX5B 5ID1A 3HS0B 5MP6L 4Q2ZB 3WFHA 5DVNA 5J3HC 3ARGB 2BX5A 5E9NA 4EZJA 2PF6A 2FX9H 4XVUD 5GIRB 1QYGH 2C3GA 2VIRA 3BEWA 5CU9A 5FGRA 1TQCC 4PY7B 3KL0A 3FTSA 1KTDA 4N86A 1DVFA 2D2OA 3V0VB 3EFFA 2COQA 2XZCH 3KG5A 3HFML 4RGOH 1FFQA 3B3IA 5ALBH 3WMQA 4PS4L 3ZT6A 1GZHA 3RHWF 1GCYA 4GW5A 3TA3C 5KBNC 5DF0A 1R47A 5KVDL 5A3IC 4C8XA 3NAAL 5IFJA 4WDIB 4BK5C 3T8MA 1B0GB 1XGUB 3IF1A 1BVOA 3RURA 5IIEB 3CDCA 2XQYG 5BO1L 3SYOA 4RGMC 1SXNA 3PHAA 2HMID 2R23B 3GMLA 2QHLA 1WFMA 1P6WA 2QSCL 5F0JB 4HS6B 4Z7NE 4FP8H 4CAGA 2JELL 1WZMA 2GITA 5LWYL 4LB8A 4MB5A 3IMBA 1V27A 1W91A 2BIPA 1UZ8B 5FUCE 1NFDA 3DVNB 1YQVL 1ZXKA 1H9VA 3MMEB 3NIGB 4MAYC 3E6HB 3PS6A 1FPTL 1S7UA 3CFTA 3ZTJH 3DECA 3K81A 1AGBB 2GK0B 4A67A 1P7KB 4E2OA 4AEIL 5BVJA 3BIKA 1W72L 1H6TA 3N1QC 1N4XH 1SJMA 2XIDA 4XXCC 2AK4B 3IWVA 3QIWD 4UQ2B 2FSEB 3WKML 2F8OA 3I6GA 4D8OA 2I60L 2RB8A 4JVWA 2VLKA 32C2B 2MCPL 2FBJH 3SDCB 3SDYH 2YD4A 3MU3A 1G6RH 3TU6A 3LNHA 3L5HA 2EDBA 1FLRL 4XP9L 2OKMA 1RIHL 5DTFB 3AREA 4Y9CA 5D72L 3ATDA 2YKLL 4KHXH 1IX2A 1S5HA 5HHOD 3SOTA 3UC2A 4PJFB 4FQHB 1Q9LB 4G8FB 3FONA 1OCWL 4JQIH 1RY7B 4LCUB 2YAOA 3SDAC 5EU4A 3WFEH 5GS0C 3UL4A 4XVSH 5C71A 1MJ8L 3OSVA 3AU0A 1F58L 3Q1EA 4UAHA 3LPFA 2QPEB 1KJVA 3C60C 3DV4B 3ECUA 4MCYA 2HVKA 4R5XA 3TJHD 1MFEL 5CINH 5D6DA 2BXYA 1BG9A 5DUML 4QEGA 3HCVA 3ZE2F 4NUMA 5HGGS 2ITDA 4K3JH 4K8RH 4PRPB 5CGYC 1AMYA 2P46B 4XNQB 3T3PB 3U36A 5I0YA 3O2WL 2QELA 4XMPL 3G5VB 1BECA 5F1NA 5B1JA 4M6NH 3HMWL 1HHJA 3K1KC 5GS1A 4QRSB 1FIGH 4KZEH 2E9GA 3HLAB 5BZXA 1HNYA 4UILH 1RJZB 1VADA 5D93C 4YSPA 2YXFA 3MNZB 5E4IA 1SOKA 1UD8A 3NJJA 4PJHB 2A6DB 4FJYA 1IIIA 2AXFA 2NXYC 3SBPA 3ETBF 5FUOH 5I26A 5LXVA 2VUYA 3WHXA 2LLLA 3QUZD 3BPOB 4JQXC 2ZSWB 4PRIA 4WV1C 3K72A 1SXSA 5E9DE 4Y2DC 3QDGB 4IRZA 25C8H 1BCIA 4GIOA 5KJRH 5AW6B 2BY3A 2ZX7A 4Y4KD 5M7QA 1QSZA 4H20H 4W4OA 4AJVA 4LE8A 4MAZA 4C54A 1UA6L 2KERA 3L8QA 1ZEAH 5IY5B 1FVEA 2ZWKA 3GK8L 5D1ZA 3QI9D 2YJLA 1B3IA 5L9DL 1AGEA 1M2VA 1SFHA 1NMAL 3MUJA 3EDJA 3RTQD 3S48A 5H37A 4GG6B 4KPHL 3S4SB 1GCFA 4FQJH 3FU9A 5CGBA 3FQ1A 4QTFA 5TDPA 4XE5B 3NIGF 4YDZA 3TZVD 2I9TA 1RJYA 3FUDA 3HE7A 1JZJA 4EI5C 1QFHA 2LHAA 3QIUB 4A7UA 5DHDA 4UM8A 2R1WB 4N8CL 4HUWA 5D71H 3GKWH 4A63A 2AVGA 1EAOA 5IFAH 3NA4A 4LLQB 1TU2B 3NQIA 3RUGA 2VLKE 4QRPD 2YD1A 4ZS6D 1JZ8A 3P4NA 4HXAL 4XN2A 5LHDA 3APCA 3GT6A 4HS8H 4UDTA 3MNDA 1LD9B 5FYJE 1CYWA 1YQ2A 2F5AL 3CUPA 3LN5B 3BVXA 1VKXB 2CNZA 3GSVB 1OPGH 1I8LC 4B9GA 3QG7H 4XBGB 4JKKA 1EZVX 5DZNA 4GI9A 1J18A 1A6TB 2IQAB 3C6EA 4MCZA 5JXEA 1GY2A 1A14H 3TFBA 4NI3A 1SM3L 4KITB 3BWAB 3QUML 1D5ZA 4BQ8A 2UV3A 4GQQA 4OJCA 5E99H 2NR6D 1A6VL 5I1HH 4R4FH 2ZPKH 1SMAA 3UTOA 2IBZY 5MP6H 2GEEA 3K3QA 3ESOA 3X3GL 5I6XB 4XODA 4J8RA 1DVZA 3FU8A 4M03A 1G87A 5IG7A 2VO8A 2J21A 1D5MA 2WO2B 3QDJA 1KBWA 4Z7WB 2R2EB 4EIZC 2WN2A 4OBRA 3EO9H 1S8DB 1F6AB 4MMYA 1O6VA 4WO0A 3NAAH 1NEZA 4GT0A 4HZLA 3VH8G 3QORB 2N1TE 3HZVB 4F3FA 4ENZA 3OAYK 4P46A 3U25A 4NQVA 4Z76A 3MKKA 5CSZA 4EDXA 5D2LA 3IE9A 4DH2A 5LDSA 3FKUS 1XCTB 4HWZA 5GZOA 3O6FB 2VQ1A 1F4YH 2XY2A 4Q6IB 1KC5L 1KG0A 1KN4L 4XVUC 1FYTA 3R8QA 4LHQB 4FQIH 2ESVD 2JJVA 3AXLA 3MBEA 3U9PH 1KPVB 1TEGA 4PRIE 1FC2D 1OSPL 5T5NG 3RWHB 1DEEA 3HG1B 1Q1JL 3C9NA 1FPTH 4L4TE 4EUPA 2BWIA 3MLUH 3MV7B 3HBZA 5CEXA 4F9PA 5JMRA 2AC0A 5CN3A 2VN4A 3R7RA 5T1KA 1BAGA 4ENED 2I60H 1BQHA 2KHAA 4BEIA 4KAQL 5CCKL 1LE5A 3VJ6A 1X7SA 2HMIC 2O6FA 2R8SH 2X6MA 4NEHB 3T0WA 1PG7X 4XP9H 1RIHH 1I85A 3OZKA 3PWNB 3NIDE 4MQ7B 4G7QB 1YJDC 2UZYA 1N12A 6PAZA 4RVBA 4DUWA 1QBAA 2XCMC 4V33A 1G84A 4DCQA 1E8XA 1E27A 2PW1A 4L37B 1FG9C 5CBAB 5IQMA 2VMJA 3KJ4C 2GTQA 3ARBA 1EFXB 1FWXA 4W81A 5CUSH 2J5WA 1CO1A 3PFQA 2DIEA 1NCWL 1MJ8H 2WW8A 4NO3A 1C8QA 2VQ4A 5FA3B 3ETSA 1TPXB 3FB8B 1J5CA 5E1HB 1J5IA 3BSZA 3QIWC 2JLLA 5EOQL 2B9AA 2P26A 4KZ0A 1G9EA 3ZT5A 2VR6A 3OGCB 3PGCB 3H3BC 4KDWA 4JE4B 3VXSD 1B0IA 1AO7D 2K6WA 3Q6FB 5DJDB 4MA3A 3S37L 3VCLB 4EN3B 2ZWSA 4R97B 2VGLM 5F3BA 3D12B 4U1KA 4RGNB 4NQUA 5I6KA 3B37A 3QUYB 2VO5A 5DRWA 1NGWB 3B4NA 2R7EB 3FF8A 3TO4A 3WEXA 2IALA 2VDLB 4TPRL 3WDIA 3TJHC 1INDH 1FH5H 1X4XA 1X7TA 3MJWA 2C3VA 1Y1DA 5D4QA 2D4DA 3CIAA 2OXGB 4I1RA 2C9VA 4TUOB 3UXFA 3N85H 3GSOB 2FEEI 4HHAB 4KC3B 4X6EA 5AKTA 4OZFB 5KAQF 3LHAA 5F44A 3FH7A 1U91A 4KI5D 4F7KA 3UPAA 5D2LE 1UA6H 5FO7A 1T0OA 3VDAA 3TPKA 4N2HA 2DQIH 3CZUB 2ZYHA 1B4TA 1F18A 5L9DH 2F19H 4NZRL 1NMAH 2X89D 2J6EL 3WMSA 1FYTE 3I50L 4KPHH 1TTCA 3VFMB 1HQ4A 4XRCA 3VDCA 5MERA 5DC0A 2BSDA 1LE9B 3EGSA 3QEUB 1SJXA 3FRUA 2MOVA 1QSEA 1EGJH 3L3HB 1VF5C 2CJUL 2P5EE 3AS2A 4GIPD 5TQ2L 1XGRB 3LKNB 5DD3H 3AS1A 2YD5A 3I9IA 2X38A 3OL2A 5E4EB 5F6IC 3MRKA 3TFKD 1P4UA 1WBYA 4B7IA 3UAEA 1UWYA 1RIUH 1VSCA 2Z7UA 5AVTB 1UXWA 4DPRA 4Y4KC 5HHXH 4M29A 3V0HA 1RZ8A 2COVD 4XMLL 2JMRA 1T6WA 3I75B 4OGAD 1JBJA 1AXIB 1UCBH 4A2GA 3DMMD 3QI9C 3JWNC 2XPYA 3DTXA 4N2IA 2FVNA 3RTQC 4NQSB 3ML9A 2IAMD 2EYSB 4QO1B 1SM3H 4JY5H 3P02A 4YK4B 3QUMH 1KTLA 3TZVC 4Q9BA 1A6VH 1J9SA 2WLIA 4E5XG 1FFOA 2PPDA 4KRPD 1GR7A 2XUWA 5GS0L 1C9SA 3WHE0 4HZAA 1RUQL 1PX4A 1L3NA 1PYWB 2E7CA 1ETZB 1PBYA 3GHEL 2EINB 3KEDA 1T2QL 2FE0A 4NM8H 4XGZA 1MF2L 4ZS6C 1T04A 4F8LA 4ZOCA 3UTTA 4ODWA 1UWGH 1KEML 1N9PA 4AJYV 1E4KC 4OLEA 5D2LF 3ZMNA 2V2XA 2BS9A 1GHFL 2QVMA 2IF7A 2BP3A 1G0DA 3D87B 4JRWA 2XBTA 2FYVA 3GGWB 5LCVH 3S0PA 5KVMC 4A2DA 5IGXH 1N5AB 2MPAH 3E9TA 3GRWH 2P5PA 1AKJB 4LL9A 2GSIB 2C1OB 3Q9QA 2VM4A 1K8DA 3WGUB 1MCFA 5HHNB 2VXSL 1HSBA 4H0HB 1TJHL 1KBVA 2XJLA 1KC5H 1BA9A 1KN4H 5FO9A 4P9HC 1GL4B 1R75A 2X1XR 2X4NA 3BRGC 2P8MA 5KW9H 4APQD 5KSBA 3IBEA 3KM2A 2AERT 4OF8A 4MMZA 1TQCB 4QTIH 4RAVA 5G4OA 1UH2A 4XN5A 1OOWA 1RUKH 4IMLB 3EJCA 2GYSA 5TDOA 2PABA 1Z7JA 5B38A 4LQ1A 4DESA 1ZPUA 2ZXCA 1UC6A 3S5LA 2NNAA 3TA3B 2BSRB 4CN4A 3MBWB 4YSAA 1LO3H 4WCYL 4GH7B 5ESAB 5KZCB 2FX8L 3D18A 4OLYH 3W57A 2J6WA 4LNVA 4UNUA 5DJ6A 2GJPA 2NY6D 2BIHA 3TESA 4OJDH 2HJFA 1T5XA 1U8NA 3EGXA 4M3JA 4XNYH 2CA4A 2EACA 4YMPA 1THAA 5HI4D 3U46B 1A6UH 1G9NC 3F65A 1QSEE 3EYVA 1ZHNB 3DOHA 1M3JA 3HN5A 3S2CA 3WNJA 3HZKA 5GGQH 2Z65C 1C1EH 2BSCA 3QZWA 2K9FB 1IKNA 1LILA 4YZFE 4Y1AA 2GT9B 1NJ9B 5F2FA 1UT2A 3T1WA 1YEIH 2CKBB 1OHQA 2OMUB 1Q0EA 2E59A 3UAJD 5I1DB 1GGBL 2ERJC 3OKMA 5IW1A 4OBSA 3D0VB 4GW1A 4MBOA 1XZ0A 4TNWK 1X5MA 5IBTH 5LNEA 1SXCA 3KGUA 1P84J 5CU5A 5F96H 3SSGA 1CDHA 4PHZA 5DQDL 3DX8A 4M8QB 3FTUA 1NC2B 4CU8A 7TAAA 4U6HA 1SZNA 2IWEA 4FULA 4LMQE 3DSNB 2BSED 1VFUA 2GG1A 4ODTL 1DBAL 1GVIA 4XO4A 5TGBB 1JDCA 5INDB 1Y6NR 4XZUA 3FRPB 5JHLL 5DVOA 3BFWA 1I3RB 4E9XA 1I1FA 4P0DA 2A6JB 1J0IA 5D1XA 1JF5A 5C0AB 2NY7H 1DQIA 2WXJA 4HBCH 4H26A 2DMCA 3B6SA 2XVBA 5I8CB 1TJIH 3L9RA 3ZTDC 3HEIB 4XWGH 4ZTEA 2MOQA 1EXGA 1JMXA 2QDVA 3OBAA 3L5WA 3JTSA 4K23H 1ZVHA 1OKEA 2AANA 3RX9A 3UTTE 2YA1A 1WEJL 3Q2CA 4L8SB 4W6YB 5JOFA 3VXTA 1HHIB 1KCSH 3QO1A 3VGAC 3E38A 4AT6B 3B7YA 3BKJL 5HDQL 2GJ6B 3MRPB 3QGVA 2EDNA 5D8JL 5A7EA 1TQSA 1MCQA 1PCSA 1CLVA 1FRGL 2H32A 3QA3B 3QFDA 1XB6A 2A4ZA 2DJSA 4O2CA 4UIMA 2B4CC 3WUWB 1MJUH 1FFNA 5AVWB 2LAAA 3QZOA 3QZPA 5I8EA 4EKJA 3NN8B 1T2XA 3QXUA 5EV7A 1DVFD 1QUPA 3V7AE 3JTBA 5LN4A 4YZFF 2YUZA 1VFBB 3IETA 3KBFA 3OKNA 5SWSB 5IZ7A 4XBPB 4PJAB 3CLEL 5EIIA 3GWJA 2X4PB 5KSBE 1E90A 4RWYL 1R9FA 3DKHA 3QXAB 3MROA 2NY5C 3FQ4A 4HLJA 1Q9WB 2Z1PA 3F6JA 5D93B 5JA9A 3LIUA 2CJUH 3RL1B 1XSJA 2MRYA 4J3OD 2BS8A 3HHSB 4KV5E 4EZKA 2IH8A 3FOLA 2KL6A 3V0AC 2NXYB 4LAQH 2GJ6E 1T89A 1U2CA 1I3UA 4IRJB 3QNXB 4Y2DB 5JR1H 4ODHL 4K7FA 3FW6A 4YXHL 4PJ9A 4KI5C 1PDKA 3PUCA 4N0UB 1S7TA 4KX8A 3RVWD 5ITBH 4A37A 2ZXDA 1L9QA 1YJDL 3U7YL 1JPFB 3MUUA 4KQ0A 2JK5B 2Y22A 1P1ZB 2VXUL 4DKAA 3KWUA 3MA7B 4Y1AE 3BP4B 4O2FB 1PSKL 4UT6H 4JZOB 2DQCH 3P9WB 3BLBA 4XN1A 1HDMB 5HYIA 2Z7YA 4JHAH 4UINL 1B0RA 1NBYA 3MSPA 3UJIL 1UB5A 3VFGH 4EI5B 3CSPA 4GKNA 4EVNA 1TDQA 2O5YH 3AQDA 3IXTB 3GHEH 4LFHD 3ARED 1MCHA 3Q2LA 4WI0B 4AQ8C 1TKWA 1MF2H 4OW6A 2V2WA 4FLHA 4AGLA 1A4KA 2K9UA 4M7LL 2WN3A 4OGAC 4ABUA 1T4KB 2Y7SA 4L0YA 5C70A 1UD5A 3DMMC 3NZHH 1HCFX 1PJWA 2HRPL 4XXWC 1AI1L 2AJZB 3VXUA 2IAMC 2GTWB 2O93L 4JO1H 4K5NA 1JD7A 3MDJA 4QAMB 1ZLSL 2PTTA 2WGNB 4FEIA 4R9HA 5JPNA 3Q6GL 4JFWA 4YHNA 2HB0A 4N90D 1NDGB 2I24N 1ZLUK 1QR1B 5D4JA 5DQJB 2NW3A 1P4IH 1RSYA 5JPMC 4LL1A 4TVPE 2ZOKB 2H0PA 4KRPC 5EU5B 5HGDA 2AV7B 4X7DC 4KV5F 1BWMA 2ED6A 3VGEA 1KIQA 2Z34A 3BP6B 5C08B 2XPZA 1A3QA 1GS6X 1RZJC 2Q6WA 3WU1A 4U1MA 4Y4HA 5I1LB 3FL7A 2I32A 4WWOA 2N1KA 1HFUA 3L5XH 3DPBA 1WGVA 4PJ5B 4NDMB 1YEDB 3FU7A 3IJSB 5ITFB 4F1ZA 1QHPA 2Y7LA 5ES4B 4NJ9H 6FABH 3BAIA 2YS4A 2EDDA 1JZ6A 2XXGA 1PD6A 2V37A 1LM8V 1VZHA 1F11A 1BZQK 2X10A 4LPCA 5C97A 4YDVA 2VKWA 4HK3N 4G80B 5JDSB 5L6YL 1T22A 1BZ7B 1VA9A 4LO9A 3SHSA 1AXSB 3CVDA 2Y5TA 1E3XA 1BX2B 5DQ9B 4PRID 4U6TA 1LHZA 3BUIA 1CR9L 3O3AA 1E5UI 3BPLC 3UROR 4L3EB 1GH7A 3IN2A 2GPZA 4APQC 2A74A 1CFTB 1F4AA 3HBGA 1WAAE 2HPOA 4Y2OA 5DMKB 1BD2B 5D1ZD 4ES8A 4ZUWA 4G6FB 5FHBH 4ZUVA 2CM6A 3MX0B 4PJCB 5GGVY 1A7OH 3NSFA 4U3SB 2EADA 2CDFA 1C7TA 2DZEA 3N6YA 4HOZA 1PLGH 4ANXA 3A47A 5KS9A 2NY6C 4D94A 3HE7D 5EO0A 5DJ2A 4XCNB 2EE2A 1XBDA 4N87A 5HI4C 2FIKB 5JHLH 3O9WC 1R5VA 1HHHA 2XFGB 3QZBA 3DURA 1OAKL 1JZEA 5TPWL 5BOZG 3QS3A 4JM2A 3QRLA 4OKVB 5ICYB 2ZP0T 4RMUA 1BAFL 3UZVB 2DQTH 4FCHA 5FAAA 5E8EB 4Y5XC 4PBXA 2PO6A 1A0QH 1PU0A 3HR5B 4MB1A 3NZUA 4GUOA 5DUBA 2APTA 3KJ4B 4NN6C 4M43L 2OL3A 1N68A 4PW3A 4X4YB 1BD2E 4BHUI 3S6CA 4KVNH 2VDMB 4K94C 3VXPB 2OBGA 1W8NA 5BRZD 4AQEB 5BPPA 3BJ91 4DJMA 1RQ5A 3VXUE 5AAMA 1T20A 2Q9OA 3BD5A 2A9ML 1UJ3A 1H3PL 4G1MB 5EU3B 4ETQA 3E1ZA 5JIMA 3OMIB 5EO1A 2YSSA 4X98A 4RFEB 1U8PB 3DK0A 5I8KL 3WKYA 1J0KA 1S78C 1XGPB 3QDJD 4EXPX 3F7VA 2XTSA 3LRMA 4AK1A 1WAAF 3CLEH 1QVOA 4P9HL 3TA4D 1RV6X 4FKKA 1SJVA 2ICEC 2WGXA 5T1MB 1YNKH 3QNZB 3WD5H 2IG2H 3KPMB 3MV8E 3PG2A 4TM9A 4PJBB 2XZAL 2Z92A 3CVHB 3NJLA 1FDLL 3TTYA 5JZ7D 4JGUA 3OHMB 4ODSH 3RDJA 4J2XA 5F0PB 1SEQH 2BCKA 4XNBA 1QBLL 1WBXA 3D0LA 4YNYA 5GSVA 3UBGA 1FVDB 4KJQD 1HN1A 1FL3A 1OV8A 1TIUA 2W81C 4K07A 3S88H 1BFTA 3ZTJG 1KLGB 5GZOD 5C92A 2EICA 1ORQB 1FYTD 4YXHH 2B16A 4P3CL 3MBED 5CD3B 2O5ZH 1DVFC 4B60A 1G9NL 3U7YH 1E4XI 4I5BB 4KX7A 1GZHC 4WK0B 5DO8A 3HTLX 1K85A 2WB7A 4Y16A 1W0YT 1Z0NA 1N3NA 2WB1A 1ORSA 5FYLD 3OQ3B 4E42A 4X5LA 4LQFH 5T1KD 4BUHA 1PSKH 2BP8A 2I69A 1QQDA 3V4VA 4OLZL 4J3OC 1IRAY 3RWDB 3MACL 1AANA 1MCEA 1IAIH 3CFEA 3V8OA 3ULVC 5DUJA 1N0XL 4NWTL 4MBRA 2LT9A 1YEJL 1ZHKB 4MJIA 1F42A 4Z7UB 2E75C 1AGDA 5B7EA 1EAQA 4XCCL 4ELKB 3KL5A 1JZIA 1BVLA 3IJHA 3NSYA 4U1NA 5KS9E 3FT9A 2ZCHL 3VFPB 2IH3A 5DEFB 2H8PA 5DHVB 5F6IB 4RMTA 4OFIA 3OHXA 1J12A 1EANA 3ZDYE 5B4MD 3RVWC 3ZYOA 3UBXG 1AI1H 3ARBD 3K2UH 3QI9B 3DK2A 2JIXA 5TDNB 1WD8A 3NFSH 3LRGA 5E2WH 3Q6GH 1JN6A 3PXLA 2FWSA 3VYOA 3EH1A 5LBVA 2NMSA 4DP4X 3ZSSA 2FWLB 4DVBA 3T2OA 4KXCA 3VRLE 1J8HB 2BNQB 2I85A 1F2XK 5E94B 1BXUA 5D5MA 1TTBA 2OA9A 1TXKA 2AXGB 2MNUA 1AD0B 5E03A 4F57H 3AREC 4DGWC 2PWGA 5EUKA 1UUSA 1JF6A 2R2BB 3WFCL 4R3SA 1K3IA 3P30H 5D2NC 4RDBA 5IB3A 3B9VA 1KJ2H 3BHBA 2MFNA 3CSGA 3B9KA 1JVKA 2ADGB 3VRJA 3ZDXB 2B4CL 4F24A 3LDBB 1FO0B 4Z95L 5AYQA 3RY5A 2Y1AA 2WTOA 2J8UE 2VZUA 2BDNL 3TO4D 2CJ3A 4X8CA 1GJUA 4L29B 5HJGA 2FJFB 1RPUA 3WI9A 1J10A 2BP0A 1QSFB 1UD2A 2X4TA 5HGAB 2V3DA 1DBJH 2B15A 3FOMA 3IS0X 3V10A 1INQA 4NQED 3VWKA 5FW7A 4POYA 4GQPH 2XWRA 1YUHA 4ZFZA 3OX8A 4QIRA 4DW2H 5KS9F 3NSDA 5ILTH 1A4JA 5L4JA 1QBMH 1RJLA 2W92A 1YEHL 3ZDYF 4KGJA 1HX0A 3D7PA 1NGYA 1W0VA 3CXHJ 1IGTB 3O4OB 5GS1C 2MNWA 5BVPH 1GSMA 2DMKA 3KGRA 4TRPL 2NTFA 5C07A 3ZDXE 2A6KB 3FT4A 4ZG1A 1EHXA 4PJXB 3QQNA 4F9LA 2ISDA 1MWAL 2AXHA 4FZEL 3Q8FA 5FKPA 5DRNB 3ZUCA 2Z35A 1ET7A 4DERA 4H13C 2A1WH 3TIEA 3QC6X 1FZOB 1TJMA 2NRDA 2OYKA 4UQ9A 2XKNA 4M6MH 2R56L 4K9EC 2JLPA 3VRLF 4YDLC 5GGRB 2GUOA 3RVTD 5E00B 1QASA 1XO8A 4G7YL 3SY0A 1OAKH 1JD9A 4WGVB 4M8VA 3SKOA 5TPWH 5K59E 4GP8B 1BQUA 5GXBB 5INCA 3KLHD 1U3HC 4LHUG 1MNNA 1XZWA 2L7QA 3APNA 1EBAA 1IAOA 3GDBA 4Z7UF 1QX1A 4MJIE 2IDCA 5DFTA 1QSVA 2XQYA 1KB5B 2DKMA 3VI3B 3MCKB 3MRNB 3SQBA 4FL4C 5D1ZC 5I76A 2B0SL 3ZIYA 4ZO6A 3FO2B 4LKCA 5DLMH 2FJUB 3DRTA 2VDQB 5E8NB 5DS2A 2HJKA 3SQOH 4NPYB 2J8UF 1B4JL 5AVSB 1X7QA 5GISL 3Q1SL 3HE7C 5KYWB 1CL7I 3VSQA 3SB3A 2AI0L 2VSMB 4Y7OC 2A9MH 4XZ4A 3IGAA 1FFPB 4L9LB 5F1KC 4PMFA 4HC1L 4CMHC 1QHOA 3B2VH 4PJ7B 5J6GA 3CN1A 3IRCA 2MEJB 2LFEA 4JPVL 4HCRL 4QRRA 3KDMA 3WY1A 1FC1A 1A7NH 5IB4A 5AUMA 2IIJA 4P5TA 3UTTD 4HGKC 5D5ME 3BT2H 4UAOB 3MRBA 1U92B 3DOSA 3IJEA 4P4RA 1KTCA 1BJ8A 1F1GA 4FDWA 3K80A 1BSIA 1RHHB 2XZAH 1QTSA 3VI3E 4DQOL 5I16A 5DR5L 3ZDXF 4NXSA 1A4CA 1KYOK 2HWZH 1RMFL 3VGAB 2H2SD 4LCCC 1JHTB 1NMBL 4GXVL 4HAKA 1Y18B 4YC2C 1WLHA 3PABA 5C0FB 4RH4A 4Q52A 3PHSA 3E6FA 1E8WA 3U4BL 1LK2A 3ZXAC 2EVGA 3PDDA 3WE6B 4A7TA 1MVUA 2HLEB 1FHGA 4J8QA 4WFHD 1AO7B 2N0MA 2F58L 5K59F 1D5XA 3QDAA 1EV2E 4W4NA 5EN2A 2C9XA 1FNHA 4U1JA 5LGJA 1MH5A 2EE6A 2P45B 3DHJA 2XWJA 3F05A 4N2KA 5BZZA 3SCMA 5DEGB 3LTVA 5I0ZA 5LBSL 3RVUD 1U8MB 1XR8B 2HG5B 4YDKL 4G42B 4MGXA 1MCOH 1ML0A 5JW3H 1N67A 3RGVA 5JZ7C 4JG1L 1YNTB 3T65A 3GEFA 3MACH 5CEZH 2QVKA 4RNRA 2AZAA 3VXOB 4IS6B 5ICUA 5BXFA 5C0BB 3BH9A 3FMGH 5IQNA 3EJPA 5GJSL 1YEJH 3GIZH 4KJQC 2G2NA 3V5HA 3VE0B 4AVIA 3F12A 1THCA 4PJXF 4XCCH 2H3NA 3U0PB 4DZ8A 4HIJB 1EVTC 1N59A 4I3SH 5EZIL 3RNQB 5GZOC 2ZCHH 2D31A 1ZK9A 5L2KA 4AYEC 1EO7A 2OZ4L 5EORL 2CLVA 3T0AA 3QISA 4C4BA 3MBEC 4NFDA 3F85A 4Y1AD 3WO3B 4FQQA 2IDQA 2QZQA 5D5MF 1G7IA 1GS8A 1WCBB 5BZDB 4Y4FA 1G0YR 3RYMA 1Z3GL 4F9PC 2CWRA 3ECBB 2NX5A 2YEVB 3IFLL 4ADJA 3GRGA 4BKLA 2EIEA 1A9BB 3UG5A 1OIOA 2JF1A 2VN3A 3EBAA 4H8WH 3VI3F 1FZJA 4MA1C 1G0XA 3V6ZA 1QW8A 1CDGA 5CN2A 4F15C 2IDTA 1M1XB 4XOBA 3MRGA 1E4JA 2V17L 2FQFA 1UM4H 2WIIB 3Q0HA 4L1BA 4O2EB 4FA7B 4M1GH 3ZMEA 4NIYE 3WFCH 1VACB 3W0WD 3B2PA 5C0BE 3EJYD 3K71A 5D1XD 3C08L 1KLFB 5B4MC 1BHGA 3ABZA 5JW4N 4RIRB 5I2IB 1J9RA 3VDBA 1QRND 4QWWD 4JPWL 2O72A 4PJ7F 1I1CA 3ARBC 4HHWA 4QRRE 1LQSR 3N55A 1QLRA 5LXGL 3LNFA 2BDNH 3KLAA 4OZ4B 1AIFA 3CHQA 3T6ZA 2E0PA 3V5DB 3ATBA 3I85A 5FGSA 3QRBA 4BM7A 3IJ7A 5E5UB 5E5MA 1BREA 1CXLA 2CK2A 1HEJC 2VLRA 1ADQH 1E5ZA 1QA9A 2VLME 2VLLA 3LV3A 3VFOA 5JPMB 2A9AA 2Y5QA 3ALXA 4GFTB 2ARJQ 2VR3A 3MJ6A 5DJ8B 3A6BH 5CZVL 1H15B 1DZBA 3D25B 3N41B 2CDGB 1UG9A 1OLZA 1XV8A 3FB6B 4HIPA 4NUPA 1OP5H 1KIUA 4TRPH 1XWVA 1H6UA 1DJYA 3L3GB 3O2DA 5CJ8A 1QFUL 2NW2A 3TO4C 2WTPA 2J1ZA 4E9SA 3LN9A 5IWLA 3H1ZA 4ERSH 2Q8BL 3D8MA 1FG2A 2WYHA 4JGJA 1CICA 1RP9A 3CVBA 4X0KA 2QPFA 3CDGA 2F5BL 5CBEB 3WS6A 1DE4A 2QV2A 3QR2A 1JXDA 5GSRA 3ESMA 5J5EA 3VFSA 1YNTF 2IXQA 1OE1A 2KQNA 4LZKA 4TUJA 2A83A 1E6JL 2X70B 4ZQKA 3VH8A 3WKPA 3BPLB 4PJ9D 1DTUA 3G04A 2AKRB 2YMXL 3KAAA 1JGLL 3MV11 1CXKA 3C8KB 5E6RB 3LNDA 3T3MB 2B0SH 2FO8A 5EIVA 4JB9H 2VDPH 1TVDA 5CILH 3HUJB 3IDUA 2JKWA 1SY6H 4P2RD 4PGCA 3ZOAA 3AITA 4U1IB 4Q89A 4C56A 4I0PA 5D4IA 1Q72L 3EHBD 3UP1A 3K6SA 3MA9L 4XX5A 4TUUA 3IPBA 3Q1SH 5EEWA 5T1DL 4WU7A 5HYJE 5JQ6L 4J23A 1XEDA 5F9JA 1A5FH 1NGXA 4L0PB 4MNGB 4YSUA 2CRIA 1CFSA 2NY6B 2X41A 1FZKA 3DJ9A 2GY5A 3WCYA 4J4PA 3RVTC 2M2DA 3PAUA 5I15L 2XXFA 4HC1H 5TH2A 1FYHB 5SWZA 4D0BA 4HCRH 5CHNA 4LLDA 5GRUL 1QABA 3IBOA 1RKRA 3ZVVA 2VW6A 3KLHC 2PR9A 3O9WB 5EU7C 3OPZL 5FLVA 1NDTA 4NCC2 4BFFA 4DP5X 2AJUL 3A4AA 3KS0H 4M6OL 2FL5B 3B34A 3V52L 4WY7H 1A66A 1E2WA 5JIPA 3VFTA 3VXUD 1LDPL 4JFUA 4F2EA 1OF0A 5DR5H 4XNMB 3RIFF 1S7RB 3IT8D 1OAZH 2JSFA 1B6DA 3GJFB 1RMFH 2R4RH 4QHPA 3LZNA 2EDRA 1OOAA 3S3JA 4JRXA 3HS9A 1A25A 3BWZA 5DD1L 1EJ8A 1LEGA 5KBPA 1ZVYA 1CGSL 4HDIB 5FW8A 3LRLA 5BQ7B 1RAMA 1CE1L 3M07A 4BSWA 4Y4HD 2RAMA 4Z8FL 2VLRE 2VUOA 1FL6B 4PWIA 4ZMVA 1DQLL 5LUMA 3PHQA 3H54A 2QKSA 4F8QA 4ZYKB 5FWRA 3MLSL 4LSRL 4QT5A 1Z5HA 4LCYB 1J1PH 4N0YL 4YDKH 3SY6A 3CSBA 5GGSA 4GSRA 5IK3A 1YAZA 3LKRA 5IVXB 4I4WB 1M9SA 1MHHA 1GMEA 3VYNA 1LEIB 2H2SC 4M7KH 5GJSH 5I66B 3Q5OA 3LZQA 3MLRL 1SFDA 1A7RL 2XKSA 3TH4T 5HY9A 1XGYL 4DGIL 1I9RL 5B22A 5EF1A 1AY1L 3NP3A 5J11C 4H8QA 4Y9EA 4TQIA 3JV5A 3WFHB 1BIIB 5AVXB 4KUZL 4XTRC 1UACL 4QHNA 4TV3A 1KTDB 1ZLWH 2Q3AA 4LEBA 2XJKA 1Z3GH 3OG6B 2CO6A 4IRZL 3Q06A 4TSAH 3RVUC 3IFLH 5J1TC 1AG6A 4UDUA 3TJEL 5I74C 1PY0A 4NO0A 2HKFL 3ZHNA 3T3MF 2WXMA 1MHPL 3WV0A 3UPCA 3HUJF 5IFJB 2G5BA 1CGVA 3DBXB 4LVOC 3GLEA 1AACA 4NZUL 3M46A 4G1EA 4C56E 3ULSB 4Q7DA 1LL1A 2WBJA 2FQEA 1RURL 3DHMA 3FQWB 2C3XA 4HFWB 3VQ2C 5AB0A 2K3TA 5DS8B 3CC1A 1J7VR 1SOXA 1E5YA 1JFHA 1Q0YL 2DMGA 4LESA 4JM2D 1S7VA 1IKNC 1OAYH 2D3VA 4HULB 5DD0L 4L2YA 2Q10A 1UM6H 3TBWB 1NFDB 2MJWA 2PO6D 1FNAA 1HWHB 3NEOA 1P2CB 5TFSH 4AQZA 5LXGH 1KZYA 2BFVL 3IDIB 1AVAA 4UQ3A 3GXPA 3C5ZD 4WU5B 5C3LD 1B3JA 3WJMB 4C4KO 1KXHA 3IAPA 3NRPA 4Y0GA 2ENYA 2FATH 4BFKA 5BJTA 5DURD 4A7SA 3RIAK 5BNXD 1PAMA 3MNWB 1TZAA 5JDJA 4FC3E 3EJYC 4KZDH 5D1XC 3CGTA 5L4IA 4UQIM 5FUZL 3DGDA 5CFHA 1S5HB 3MR9A 5D2NB 4O9HH 4E5XA 4QWWC 1BF2A 1IEAA 1GOHA 1XCXA 1R6VA 3DUUA 4UT7L 3KNBA 5IQ9B 5FC9A 4U05A 4JDVA 3MV9A 1BVKB 1NUGA 1Q9KA 1UT9A 2R0ZL 2GFBB 5AW4B 1LK3H 3TWYA 3TYGL 3TV8A 2QBWA 5IVXF 4I77H 3QH3A 4AL8C 3P0GB 4HIEB 4WNQB 5HD8C 3DV6A 5A2FA 1PFCA 2W0PA 3ROLA 2WXOA 2YMTA 2C9PA 4ATTA 1ZE3H 3VYPA 3MGAA 3IRZA 4FNTA 3C6LA 1QEWA 4Y16D 1DJIA 1X5LA 5DWUH 1Q72H 2GIXA 5ESQA 12E8H 4HKJA 2EDJA 3CFIC 3DRQA 4JDTH 5E2TL 5T1DH 1S7SA 1S9VA 5JQ6H 3HG3A 5E1AA 1HH6A 3BAYA 5C0EB 2HVBA 1ZT7A 4JFQB 1KCLA 4FQ2L 1PG7L 3VD0A 5DSCB 5KUMA 1JWSA 3WXWL 1S46A 2WZ6A 4PD4K 1QRKA 4YSTA 3RU8H 2BERA 3WHXB 2P9RA 5GRUH 5CEYB 3CE1A 2BRQA 4YDLB 1XSIA 1TENA 1T89C 1KY6A 2EIZA 4QRAA 4NKOA 2VABA 2AJUH 2Y3NA 4PJ9C 1Z5LA 2XU9A 5FYJH 2FBOJ 2EILB 4M6OH 1U3HB 4K71B 5JXAL 2OMBA 3GUTB 1LVEA 3L1EA 3ULVF 2MTPA 2KC0A 4N9OB 2WCSA 3OMNB 3MFFB 4LEOA 4EOWL 1H9DA 1SMOA 3SD2A 4AQ1A 1GTNA 1LO4L 4NSKA 43C9A 1ZGLM 3EHBC 1M2VB 1RLWA 2A3TA 2FLRT 4TNVF 3LQAC 3R1GL 1UKTA 2AK1L 4XC3L 3EOTH 1I7UA 4HIIB 3OB0K 4U1SA 5A2BA 4BZYA 4YHKL 4MD5B 2F08A 3QJXA 4F37K 5F9WB 4RSVA 3BSZL 4YFDB 2X05A 2GSGB 3ZRCC 2DICA 4UM8B 3CZSA 1NC4A 3ZL2A 4UANA 2V7NA 2ITFA 5DA4A 5K9KA 5DCCA 4DEUA 1EO8L 4UOJA 3H6JA 3HR6A 3B9KD 1R0AL 2DJUA 15C8L 1A6AA 2AJYH 4NO2A 2GVYA 5AW7B 3TN0B 2SEBA 3MLSH 4GAGH 4CVWA 4OCYL 4HCFA 4HS3B 1RZKC 3FQTA 2BCMA 2XTJE 3CUPB 4X83A 4PBWD 3HPLA 5IM7B 1G7HB 3IU4H 1CB4A 5JOPE 3EYUH 1NCBL 3C75A 3QJHA 3S9DB 4X5WB 3H7BA 1H5BC 5JPNC 3ZLQC 3OMZA 3WENA 4PN6A 1ZGLA 1GGYA 3C2SA 1IVLA 2NZ1A 3HN3A 1UEMA 3W82A 4O58H 2CK0L 5BRZB 1UTDA 3BWUF 4LCCB 5CJ5A 4CNIB 1WTLA 4W9JC 3VWKD 2ICWA 2EAEA 4Y4HC 1CFVL 2XC8A 4JKWA 1DUYA 1FJ1A 1NH6A 3EYFB 4NC1E 4N6RA 1OHZA 3IS1X 2QSVA 3UZQB 2EIBA 3IJ9A 4JRYA 4N2AA 5AOMA 2YD2A 3WG7B 1EIBA 4FLSA 1KXQA 2RFXB 3EJZD 1NLDH 5D6CA 4EBQL 3TJEH 4MNHB 2CLRA 4NP4L 2XG4A 3PQYD 3RZCB 5ERWB 5C07D 3MLVL 1XH2A 3AT0A 4MMYB 4EPSA 3MRQB 1BOYA 1F97A 4NRXB 4KQ4H 5HPMA 3C12A 3HOGA 1OP5K 5A2JH 1TNNA 2KZ1B 1VB9A 5DVLA 1WA2X 4DP7X 3RB5A 3NCBB 3A6CL 4NQVB 3LKOA 2VDRL 1R3LB 5JIKA 5CSZB 3GXUB 2XQBL 4Y19A 4LSPL 1J9TA 1JZ5A 4HWZB 1DVTA 4P49A 1C5DA 2A74C 3FT0A 3VMOA 4A6YB 4ORGA 2LAGB 2W9EH 3MBEB 3HI1A 2ARJB 2HRGA 5J0BA 3HNTH 2YHGA 4MASA 2R0LH 3HB3D 2QKIC 5ISZB 2I9LA 3BEVB 1ZXQA 2X9WA 4YFLF 2XV2A 1G6VK 3ILPB 2HTLD 5JQIB 1F8TL 4ATWA 5TF1L 1FL5A 1SJEA 1NCIA 2IAAC 4RBPH 4UUJA 4MA1B 2ATPA 4KBPA 3BKYL 1X5XA 4F15B 1LE5B 3SIKA 4U0RC 5AWNL 4TLUA 4QRRD 3FUNA 1I8UA 2UZYB 1NGPH 3DX7B 3M7FB 4JM2C 4P5TD 3NOIA 1Z9LA 3FCUB 2PO6C 1SYSB 1BG1A 1L0PA 4ONOA 3VFWB 4JX0A 2VC2B 2VLMD 3F7YA 2XXCB 3EH5B 1YC7A 3C5ZC 3OQRA 3NPZB 2EXSA 1UVQA 2CLZB 3LRSB 4JZNB 2DMBA 4GRLA 4HYTB 5FXCH 4JAMB 2O61B 2CRYA 1D9KB 3O45A 3ILQD 4R4BB 5AAMC 1BQLL 2ZYSA 3QQ4A 1O9WA 1J5HA 4ZD3H 2AQ2A 1DQKA 2HLAA 3HBQA 2WXIA 1RXLA 1UJ3C 5ICXA 1I3GH 1K6QL 2F53B 1HXMA 2VMFA 1LMKA 3PIQB 4PRHB 1HI6B 3CQPA 4S2SB 3RPIA 2JV6A 3P9MA 1BBJA 4OV6F 4QLWA 3FTVA 3P0YL 1XIWD 4UB0H 1T6BX 3QFJB 2WSDA 1MPAL 1QACA 3SCMD 2XV0A 2CIIA 4GO9A 4HH8A 4ZW6A 5E2TH 1JRHL 1U8LA 5K1JA 5IB5A 1JERA 1KXQE 1KPRA 3EYSL 3RGVD 1DVSA 4H8HA 1EXUA 3TO4B 1JF1A 1A1MA 1L0YA 3WEXB 1IBYA 3OZLA 2EC8A 4F2ME 2G30A 2CR0A 5CGMA 1PMYA 2VDLH 1IM3B 1M7DB 3FXIC 2CGRL 1BMZA 4UTBH 3SE4A 5KSVA 4B50A 4L1TA 1RULH 5J6HA 4FXTA 4N3UA 2OFQA 4F7MB 3MZTA 4NQEB 4F80A 2QL1A 3EGDB 4YDIL 5L2KD 1RIVL 4KWUA 1HCZA 1BZEA 1EDHA 3BQUA 4F7TB 1Q94A 4BH7B 3NH7L 4OZFH 5BZWB 2GJZB 2P80A 3TBSA 4E9VA 5BO0D 3MRHB 4PRHE 2BSSB 3G5ZB 2IO5A 3N44F 3BDBA 3PDGA 4Y4FD 3L4WA 3HG5A 1LO4H 4Y16C 1RZIB 3OXRB 4Z7AA 4P2QA 1XF3A 1NCHA 3QNYB 2NX5D 4D3CL 1PNDA 1XH0A 2ZXQA 2EVJA 4KUCD 3QFJE 1DVYA 1OB0A 3PWLB 3D2UB 4NC0B 2G75A 4YHKH 3BO8A 1ZLWK 4R96A 1DLFH 2OMXA 1D5IH 3EJSA 4H44C 5E8OA 1QHQA 5D7JB 1BM3L 3OHXC 2K78A 1R0AH 2YO3A 15C8H 2Z91A 2QHRH 3VRIA 2G4GA 5T5FA 4P57A 4B3EA 3LPWA 3M45A 4JFFB 2W65A 4UV4L 4BA8A 3OAZK 2MQ0A 4KXZH 2ROXA 3I6KB 4CC1A 1JNLH 2Z8VC 5KSAA 3L3DB 3WNMA 4OD1H 3TWCH 3DX1A 1T7ZA 3MNVB 4B9ZA 3A0OA 4L8CA 3K5RA 4YR6A 3PV6B 1CE6A 2X42A 2XN9D 2DWEB 2FB4H 4TVPL 2VLRD 2BVEA 2PW2A 4ZFQA 3S96B 1AFVL 5T3ZE 5MEPB 1NCUA 5IQLA 1MLBA 1OK8A 4QLRA 4D8PA 4OQTA 3BFQG 4KNUA 3ETTA 4RQQA 1CFVH 5JIDA 4FXLA 4APXB 4GLRI 2D0HA 3NACL 3LSOB 1JYXA 2WWNA 4AMXA 4QHLB 1DP0A 2H0JA 3WIFA 4AIZA 1T04B 3IKCA 3QQ3B 4HPYH 4MAUH 3OKDA 1OAQH 4AL8L 3LS4H 4JFDB 4X4ZA 1GZQB 2ITCA 1IBZA 4GKSB 3PCYA 4NP4H 5IP4A 4M5ZH 3MLVH 2FX7L 4KDTA 4P3DB 5JLZB 4HEPG 3SE3A 1S9WB 3N42B 1UWEL 1OSZA 3BW9B 2IEPA 3EFDL 4JFFE 4U2ZA 4UYQA 5I0XA 4QY8B 3S3DB 4POZD 2L7UA 3WFZA 1CICD 5IV2B 5EEXA 4PCSA 2WWMD 2V9UA 3UGUA 4K4KA 1MDAA 1K8DB 1RK0A 2J73A 4QI3A 3VWKC 1ODAA 1MFBL 3K46A 3PFUA 3B2DC 2V9TA 4KH2A 1HSBB 4F7EB 4Y7MA 4YHML 1CLZL 4FE9A 3VFNA 4MJ6B 4DO6A 3SBRA 5EDSA 3KWWB 2A9CA 1R5IA 2AJXL 1VFAB 4RAVB 1AXTL 2BIOA 2W94A 5JUEL 1YN7B 2X6UA 1HL9A 1KGCD 4JW3A 2PP7A 3ULUE 5EPMB 1U6AL 2GABA 4TNFA 3D48R 1KNOB 5I74B 3WLBB 4JFDE 4F9LC 3GMMB 3HRZA 3MJ9L 4WNJA 2LTQC 4TKWA 3S5LB 1HNGA 3T4AB 5LKNA 2JB5H 2YAFA 1LO2L 3ARTA 3A21A 5FO8A 1N8OE 4MX7B 4P2QE 5LBGA 5DJ6B 4LVOB 3AWGA 2XTLA 2HJFB 3LQMA 3NSJA 2XY1A 4MCNA 3LQAL 4HPOH 4JFEA 2I5YL 2ICWI 5SWZD 1JSYA 5HJ3A 1CFNB 1FFTB 1G6RA 3ZU8A 4S1QL 2CNYA 4JJOA 1TZIA 4DKEL 2GHZA 5F7YC 4X9HA 5CJXA 3UYPA 3TO2A 4L05A 1P5UB 2XX0A 2BHFA 3FU0A 4LSSL 3U1PA 3VX1A 4XPHL 5AZ2L 1NCOA 2DIJA 1GKEA 1KXTB 5IVZB 3HVDA 3HB3C 1FIEA 3B7RL 4JQIA 4JPIB 2B1AL 5IW1B 3FUEA 1SJHA 4XCFL 2VDOL 3JTTA 1RUML 2HTLC 4FNLL 5BUPA 5BV7C 1OO2A 1NOFA 4ZMTA 3T6VA 1M42A 2E6QA 3BUQA 4JRXD 5HXMA 1Q0XH 2VXVL 5D1QB 3EOAA 3REWB 3UBXA 1ZIAA 3CX5K 5DD5H 4AWJC 2LE9A 1IM9A 4BZ1H 3SKMA 3EO1A 4HUXB 1E9QA 5HYSG 3W0WB 4X5RA 4U1HA 4GXUM 4P5TC 1GSKA 5DVPA 3SE9H 3GMOA 4OD3L 3N43B 1G7QA 3MQIA 1WYJA 2VTFA 3D2TA 3MRDB 1OGAA 3GSQB 4GMTH 1U58A 1QRNB 4JKMA 2HRHA 5DXWA 2PYFA 3VD3A 2JI1A 2VJXA 1IZJA 3JWDL 1ZVSB 2GAZB 4XPBL 4ANKA 2WXRA 3NJHA 3OAWA 2BNUA 4OCWH 4U4IA 3ULUF 1XSKA 3HHMA 1YCSA 5LN8A 4AIXA 3ASNB 2EDHA 1NGQL 4PFEA 4LSUL 3ILQC 4ILDA 5PAZA 3ATAA 3D09A 5DU7A 5CD5D 1J8RA 1MXGA 3N42F 2M26A 4WUUB 1TYRA 3TBVA 5DMYA 1HVXA 4JFYA 1PQZB 4X99B 2PWHA 3KCPA 3NIFB 4XMKL 1AZRA 5BS0A 5HHQA 4DN4L 4BKSC 3MV01 5E6ZA 5ALCL 5F97E 2RACA 5CCGE 3SPHA 1DBML 4ODVL 1IU1A 2WLMA 4XMVA 3M8OH 4N0RA 1PFOA 4WO4B 1S7QB 4OJYA 1XIWC 1NA8A 3N5AA 2I25N 3QQDA 2B2XH 3SCMC 4A55A 3V4LA 2UY6B 4PB0H 5LG1A 4YGAB 1GPOL 2R39A 5EF3A 4PJDA 1X6NA 4U6VH 4NO0D 1BJ1J 1RZPA 3RGVC 1DJSA 5DDHA 2VSDA 1O7DE 1N70A 2G2RB 5DJYB 4XNAA 3QSKB 3ZMRA 4XVOA 3BOVA 4K3EL 3DHUA 2WBJD 4GBXA 2XPGA 5I18H 1ID5I 2DM4A 4OGXL 3D9AL 3QXDB 1EDYA 1NFIA 3PRZA 2DWYA 4IBUA 3MUGA 3N04A 4PB9H 3VG0L 5J56B 2AAVA 3KPOA 3CV5A 2MCAA 4K7FB 1P7HL 3H9HB 4RZCB 2KZBA 3ARFB 4Y4FC 5DJ0A 5AW2B 4NUGH 3VQMA 1ZDSA 3X1FA 2OMYA 3OF6A 4YDMA 2GIYA 4EI6A 5C6PB 2RBLA 4P2RB 1WH0A 1WWWX 5LGKA 3C5SB 4NHUB 1DDHB 3AAZB 4HIQA 4LHUA 2MMXA 1WVZA 3BESR 4JN1H 2P7TA 1XAKA 5DFVC 1CTMA 3V2AR 1K5WA 2QT6A 1GGCL 2R2CA 2CDEB 1KN2L 4JMNA 4WEBL 2XV6B 4YX2L 3TVMA 1B0RB 2PYEA 3F7LA 3K4AA 3NACH 4WW2A 3ARPA 4JVUA 3IDGA 3K6IA 1T1XB 4FFZL 4M5YH 1AKPA 5JOPD 1XGQB 1QLEL 1XQ4A 1YMMA 2EDOA 4RBPK 1D6VL 4G9FA 2X6VA 4H5SB 3LKPB 1AR1D 1N6QH 2H9GB 2VH5L 2UVEA 3B5TA 4HX1A 2G3ZA 4H7VA 1QFWL 2GSMB 4FQLL 1G5GA 2QVFB 3P3UA 5ABDE 2ZXBA 3EFDH 3N43F 3UYOD 1JXGA 2ED8A 3L4CA 4FTVB 1OGAE 1H5BB 3HC0B 4R83A 2DV6A 2VDKB 4H4NA 5J57B 3MV9D 4P2OA 1UHVA 4AC2A 4JL2A 1MFBH 5IROA 2PUQT 1U8JA 4LSQL 5HDOA 3UPRB 1MW2A 1PY9A 1QPKA 1D6EB 3JT2A 4U1LA 1VFMA 1FV1B 2IOIA 4GS7B 4LVEA 1UENA 2Q6WB 3RP1A 5IOPA 1CLCA 2X3AA 4Y4HB 3BPCB 3BGFB 2ZUVA 3PL6B 2DYRB 3G3LA 3WS3B 2AJXH 4F8OA 5HYQB 1NAMB 4PCYA 2AQTA 4QYOA 3NIFF 5JUEH 1BF8A 5BS0E 3JUZA 4MDIB 1T80A 2EXYD 3HNVL 2JJTA 4ZI8A 1JPSL 4AIEA 2OMTA 4UM9B 3MJ9H 2NQ3A 1JIBA 3F62A 4GO6B 5JHDB 1LO2H 1ILUA 4G3YH 4POZC 4EJ1C 1CICC 4ELMA 2WWMC 5E1GA 3WS6C 4B9KC 3MC0A 4DP9X 3QHZH 2O30A 4FTVE 4N2DA 4F8PA 1NDMA 4HSQA 1MRFH 4P05A 1FAIL 2CMRH 5JO5B 3V4VL 2EEXA 5C8JA 3CVIL 3O3AB 4PVBA 2I07B 1EBPA 3JV4B 1EMTH 4LSSH 5ESVB 2A74B 5AZ2H 1E67A 1JV2A 1MCWW 3FQRA 4KROB 1EHAA 4JJ5B 1XF2A 1AIZA 2P5WB 3VSTA 4GAYA 2XBZA 3U9UB 4A7GA 1RUMH 2QKIB 4ZUVB 3WKNA 5SX5H 1MCRA 4ZRGA 3U30C 5F71A 2CDFB 3GO1H 3JWOC 2VZ1A 1PZ5A 4GMSL 2XI9A 4KJWD 2TSBA 2VXVH 2EIMB 1AZUA 1S6NA 5EO0B 1GYWA 1ZV5A 3SKNB 2IMMA 2FJGA 1JTOA 2P49B 1NC4D 2XX1A 4U0RB 2Y7QA 5DD6B 1R5VB 4KJYA 1T0MA 4L1HA 2GB2A 5I6NA 1T4WA 3BDYL 1JK8A 4R2GB 4G6AD 1C08A 4JM2B 2UXVA 4G8EA 4AVKA 3VGFA 3VAEA 5ELIA 3ZHDA 2PYEE 3MLXH 1ZDQA 2FYYA 3D3VD 4UOZA 2PO6B 3JWDH 1NIAA 1DJZA 2PPCA 1YMME 2QJDA 3S5YA 3VI4B 1KJMB 5GGTH 4G9FE 3SDDB 3A4FA 2OL3B 4EZMA 2D7NA 1E4HA 2UZXA 3C5ZB 2BZ7A 3ZZLA 5HYEA 2B9BA 4O5LL 1P6AB 4RMVA 2Z4QA 1RHFA 2VDMH 4B9PA 1GC1L 3FUMA 1WE5A 4XMKH 4R5VA 3SPVA 3WHE1 3TURA 3O6MH 1W16A 3S97C 2B1HL 1MFCL 4AMKL 1UJ3B 5BOJA 1PKQB 2V8LA 2Y2YA 3OG4B 4JDZB 4Z3JA 2IFFL 4JRYD 5EC2B 2E9IA 1URLA 5K39A 3V4PB 2OP4H 2K8MA 3OAUL 4L3AA 3TIDA 2OMVA 4W9LC 2QTEA 5EB9A 3ECWA 3CHS