3U2SA

Crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
236
structure length
225
Chain Sequence
ERLVESGGGVVQPGSSLRLSCAASGFDFSRQGMHWVRQAPGQGLEWVAFIKYDGSEKYHADSVWGRLSISRDNSKDTLYLQMNSLRVEDTATYFCVREAGGPDYRNGYNDFYDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PG9 heavy chain
publication title Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 225
sequence length 236
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u2sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u2sA01
1WTLA 5HD8C 4Q58C 3ZL4H 2AJ3A 1EVUA 1IM3B 3MV9D 2BNRA 3QHTC 3ARDB 4OZHE 3WIFB 4WJ5A 1JI2A 5IMKB 4ZDHA 1BJ1H 3OTTA 3DVIA 2BP3A 2I5YL 1UB5A 2FX7H 1VFAA 3NACL 4BFIA 3T2NH 5JORB 5T1LD 1A02N 4M5ZH 4QNPE 4QCIB 2B2XH 4PIRF 4HUXB 2EE6A 3DWTA 4NO3B 3WFZA 1J12A 2YD3A 5JDJA 1MRFL 1NGZA 1FC1A 3OXSA 3WLBB 4NQSB 4WI7A 3PABB 4LL9A 5HVGB 3T0VA 2D7NA 3PL6A 3SGJA 2H6PB 1T0MB 3GMRB 3LKSB 5AZ2L 3O41B 2YPKA 4NQDD 5L2KA 4AM0B 2VOTA 1MRDH 4IRJC 4D94A 3W2DL 3MA7B 4W4OC 3H9SA 4CU6A 5IB1A 1HQ4B 3WHXA 3CFCH 3MLVL 1YN6B 3R8QA 5F7MC 4NIKB 4PLJC 5E8DL 1EEYB 3LEYL 3EFFA 3UTPE 2H8PA 1PKQB 3P73A 3HE6B 3WDHA 4JQVA 4KQ3L 5BXFA 2V7HB 3U30C 5J7CC 5E6IC 5HD8D 1RIHH 3GEWB 4RMTA 5EA0H 1ZTXL 1A9EB 5F9DC 5IIEB 1A3LL 4C56D 2W1NA 3CVIH 3D25A 1AQKH 4L4VE 2CXGA 4FQ1L 5ESVA 4PJFF 3S37L 4LHJB 3UJJH 3IGAA 4KI1A 3KS0J 2X2YA 4LFHG 4K3EL 4QRRB 5DK3A 1KCUH 1IC5L 1KLGA 3DYPA 3QNXA 3BZEB 4GKZB 1PKQE 1A6WH 4JZNA 3DYMA 1X5IA 5IQ7H 5BO1H 4GW4B 1GAFL 1PG7H 1B0GB 2MSPA 3S7GA 4IRJD 4WY7H 2ZCLH 4C4KO 1YEKL 3C5SA 4HDIB 5C6TH 1D6VH 2PR4L 4UUJA 2FZ3A 2ADFH 3SKMA 1I9JH 4PLJD 2NW2A 3NPSC 2ZZUT 2AV7B 3VXQB 1EGJL 4N8CH 3MNZA 2H3NA 1CG9A 4GG8A 4QRRE 5E6ID 5I74B 3L9RB 5GGRY 3LQZB 1KPVB 5LCVL 2ADIA 4X4XB 3P30L 3FFCD 5GS1C 4ODBD 3ULVE 3WIHH 1XH3B 1WFTA 2VLRB 3LHPH 3VXTA 1FZJA 4ESKA 7FABH 2C1PB 1JWSB 4NFDA 2V5RA 2FO1A 2NTSP 2APWA 2NLJB 4PV8B 2R23B 2XG5A 4BZ1H 4LHUA 3CD4A 4XP9L 2Q7YA 2HT2D 4JB9L 2AJUL 3RZCA 4R97B 4XP6L 2VB5A 5DZOA 3GMPB 1A4KA 1NBYA 3OXRB 3GDBA 3L3OA 3T4YB 3PHQB 4OM0L 1SMAA 1KB9K 1KTKE 1R5WB 2BVQA 3VXUE 3RDTA 3VXRD 4S1QH 3U0WL 3WN5C 1TNNA 5JR1H 2F53B 2ZUYA 3BYYA 3NVQA 3MNVB 3I2CL 5J13C 5EUKA 1RMFH 2LAGB 4EDWH 3RU8H 1O0VA 4LEXH 1Z2KA 5HXMA 4HC1H 3PNWA 1K2DA 1SYVB 4CVXA 5TQ0L 4POZC 4JFQA 4KVCL 3REVB 4HUMB 4DGIH 3I3EA 1UADC 4WFHD 4YE4H 5BV7L 1L7IH 4OAWB 3OKMA 5HI4D 1DQDL 5D5MB 2E9BA 3MJ9A 3NCJH 3RUGB 3WL9A 5F6IC 4ZO9A 2EDQA 4XZUB 1FLRL 4EUPA 4WTWA 3T65A 5HJ3B 3P4OA 4GAFB 3CFEB 5GRYA 4WWID 5FYKH 3BKML 1ZLSH 1G9ML 1U8HB 4LIQL 3LAFA 3RA7H 5JIIA 1GGIL 3IJYB 1NCWH 3HE7A 1NLBH 3F7VB 3LZFL 3O6FB 4YXHL 1UXSA 3DO7A 2XZZA 5DHYB 1QRKA 3B9DA 4HUNB 2H41A 4NT6A 1CDUA 2PETA 5JO5B 4UIMA 4LDLB 3WS6C 1OSZB 5D5ME 3KDMB 4X9FA 1I7RA 3JV6A 3RQ3A 4EDXB 1HCFX 1FO0H 2OP4H 2IPUK 5C8JB 1S9WA 1BQLH 5H8DA 3T08A 3KPRB 3R1GL 2P5EE 4POZD 3X13A 1FO0B 4AZ8A 3G04B 4U6VL 3BW9B 4YDKL 1WC7A 1P7QD 4HS6B 3GIVB 3TO2A 2CGRL 4GT7A 2EDNA 3CDFA 2H1PL 2VC2L 2VISA 4YDLB 5HYFA 5BS0B 4LLQB 4NO5A 5ELIA 1S3KH 3GMQA 3KPOA 4K7FB 1WBXA 5C09B 1F3RB 2YD6A 4ZPTA 4TVPE 2WIIB 5IHUL 4YC2B 5LXGH 1UACH 2CIIA 5F89B 4KI5F 5D96C 4F2MA 3FKUS 2LFGA 1MRCL 4KH2A 3RRQA 2FSEB 3KPRE 3QWRA 4YBLC 2BOCB 1QSFA 3ZYZA 3DURA 1S5HA 1VADA 4LSSL 4OFKA 5B38B 1C1EH 1KN4L 5HYQA 3FMGL 1K8IB 2PO6B 3UBXI 1ZVHA 2EIBA 4M7LL 2QSCH 2DKSA 4MNQD 4ODWA 1HHHA 1M7IB 3TBVB 2F58H 1D6EB 5C0GA 2V5SA 1A8JH 3KAAA 3DV4B 3LDBC 4JKPH 5F8RC 4NBXB 3H3KA 1D7FA 1ZSDB 3D2UD 4LCWB 2YRLA 5C09E 3IXTB 5GGVL 4I0PD 4P46B 2VYRE 2DQTL 3MLWL 3A6BL 3HC4H 5E5UB 4AT6B 4P2OB 1H9VA 3DETD 3ZHDA 1F2XK 3EOTL 4EIGB 2FX9L 5DD3H 3RL2B 4NYLA 1F6AB 1BZ7B 1RHFA 1P84J 5CUSH 3LRSA 3MBED 4O2FA 5EFIB 2Z35A 4IRZL 4HIXH 3MRMA 1J0IA 1W0VA 2VDRL 2Y36H 1YEGH 2AXFB 1A3QA 4JZJC 1HWHB 5DVOA 3VFNA 3LN5B 1SY6L 2FWOB 1N59B 5H94A 4LVOB 4PJ8D 1RK1B 4JPWH 5DSCA 1CLYH 2IH3A 1INEH 1PSKH 3FB5A 3UEZA 4J3OC 1PBYA 2ZUXA 2D0HA 1REIA 2LU3A 3GSOA 2A9NL 2ZUWA 4XPHL 2DQHL 3L95B 1BVZA 3KGRA 1KIQA 5BJTB 3REWB 3MRCA 5KAQG 2WK2A 4LARH 4AH2A 1FVDB 3BD4A 2JIXD 4ZFOL 1Q0YH 1U3YA 2B1AH 4IS6B 3SE8L 2EEDA 1DDHB 4XMPL 1A14L 1RU9L 1MHPL 2A6KA 3OKOB 4K94L 3ROLA 5LBSH 5JHDD 1KJ3H 4GW1A 2GK0A 4Y19D 1FFPA 2V17H 3H9SD 1N7MH 2EO1A 3VWKB 4M48L 5DHVH 4GMTL 2V5MA 3BZ4B 5DD1L 3ZTNH 1NAML 3CK0H 3OKEA 1XGYH 5BRZE 5DHVB 1S5IH 1RIVH 5T5FH 5I1JL 4WFFD 4LCCC 3V5HB 3LKOA 1TCRB 2UUDK 4FQLL 2E6QA 2W9EH 3P4MA 1H15A 1M7DA 2DICA 2IQAB 4NQCD 5IVZA 4NC0B 4EI6B 3ZDZF 4Y4FA 3U1SL 2I5YH 5E08L 4P5TC 2FDBP 2YUWA 4MCYA 3NZ8A 4L8BA 1ORSB 4RGNB 4HEME 4JFFA 5IG7B 4N0CC 5FGBC 5DTFA 5EU6D 1YY9C 5AZ2H 4QRTB 3SKJH 3KLHD 2NNAA 3QUMH 3L7EB 4WJ5B 3W2DH 2I9TA 5E7FA 1G6VK 3V6OC 4WW2C 5HBBA 4M6AA 1VFAB 3SE4C 3QUMB 2NW3A 5E8DH 5DT1H 4RAHA 3TF7C 5J1AA 1IC1A 4KQ3H 3LS5L 2AVGA 4FP8L 5EIIB 1ZTXH 3ARGA 5DA0B 4B0MM 3GSVB 4L3CA 3K2MC 3MJ7A 5CCKL 1U36A 5IBUB 3KPLA 1A3LH 1KIUA 4PJXA 3P0VL 3MYJB 2R0ZH 4HW6A 3HI1A 5L2KB 4OCSL 1BIHA 3FO0L 4RA0C 2DJSA 4YQXL 4P5TD 2BNRE 5C0RH 5TDNA 2GCYA 3GB7A 2P7TB 4XPTL 2AJSH 4K07A 2R29L 4K3EH 3EFFB 1IC5H 2IWGA 5ANMB 3HE7C 1ROWA 3HAEG 4N0CD 4BFEA 5BXFB 3P11L 1NEUA 3MRFB 3MGTA 4XC1L 3OKDA 4HEPG 4HJ0D 1YY9D 2VLJA 3D69A 3CFJB 1MWAA 3D25B 4Z0BL 5K9OB 3OKYA 1MOEA 5ESVB 5L2KE 3GMNB 3WUWA 2PR4H 2FRGP 2PYEA 3ROOA 1G6RH 2V9RA 1Q72L 3RVXC 3MRBA 3NFNA 3WFHA 4XGZB 4P9ML 4JDTL 1N2RB 5ANME 1TVHA 1IGJB 1G6RB 5LCVH 2VSDA 3P30H 1FL5A 4HAFA 3WFCL 3AC0A 5CEZD 5TQ2L 3NMEA 1I7ZA 3MACL 4GAJL 2C3VA 4PJIA 1CFTB 1FG2A 2CXKA 1JCKA 4U1NA 3B2VH 4X6BA 4FN0A 4NZJA 2FZ3B 4ENED 3RNQB 1Q94B 3OKLA 4OJFL 3HE7D 4XP9H 3UTQB 4PJ5D 4XP6H 1IKFH 2EYRA 3MNZB 3D39D 4GG8B 4OCYL 5C0EB 1JNLL 4MB5A 2VR5A 2HJFA 4OM0H 2LU7A 2R2EA 5CP7B 1DBMH 1I1YA 2I26N 4N0FA 1LEGA 1AGDA 3NCMA 3MR9B 1OL0A 1FZJB 4ZD3L 3ARBA 5IEHA 5CJBA 1UWGL 4F7PB 2R2CA 5DMKA 1CU4L 3I2CH 2WUCL 2OJEA 2X4UB 5BOPA 5H37H 4LHUB 2DI8A 3RVXD 2Q7YB 4PJHF 4XRCA 4KVCH 4ONGL 3MBXL 3G5VA 1I7TB 3CDGA 3VH8A 1P4IL 4R26H 3L3OB 5JW5B 5FCSH 3FO9A 4MZ2A 1C12A 2WINA 4TPRL 4X0KB 3RDTB 4L3AA 4NZTL 3MFGB 3MUHL 3R0MA 1QFWH 5DUBA 1FLRH 3BEVB 4X98B 1CVSC 3U46B 3VXSB 1T6WA 3CMOL 4YXKL 3QI9B 5I75C 2R2BB 1S7RA 5DF0A 1G9MH 4LIQH 3SCMC 4KKLD 4UTAH 5DRZA 4BSVA 3PNWB 5JZ7D 5CZVH 1GGIH 2X4PA 1U42A 1XF2A 5GIRA 1JYVA 4YXHH 1EBAA 2EIZB 3OKMB 4LLMA 3TH2T 5EWIL 1RZKL 1HXMB 3WHE1 3HTLX 2VZOA 2IPKA 3K4DA 1QZ1A 1D9KB 4X7FC 3K8LA 1XGRA 3KPNA 1T03L 1A7QL 3P4OB 4HX1A 4LKCB 4JGMA 1MNUH 4JVPA 3GSXA 4RAVA 3VXSE 1P7KA 3R1GH 1KNOB 4JZOB 4Y5XA 3Q6FB 2N7BA 4I4WB 3DMMA 3MLRL 4HK3J 2CRZA 4U6VH 3BRDA 4YHOH 5J12B 1T6VN 1ITCA 2CGRH 5E5MA 1MFBL 4TNWF 1QNZL 3RWCB 2VAJA 3L3DA 1BOGA 4PGBA 4NT6B 1X4YA 4P3DA 3QISA 1FC2D 4LKXA 3IDJB 1UKQA 4HMCA 3TYFA 3HUJA 1I7RB 1CN4A 3LKNB 1W0YT 3UO1H 1AIFA 5KSUA 3SCMD 3WNNA 1NUNB 1XF5A 3NA9L 5F1SA 2XWBB 2YHGA 3RIFK 4QRPD 5DD5L 2DF3A 1A6ZB 2MQ3A 3KPSD 4OBSA 4M4PA 3RY4A 5CINL 2APTA 1NCAH 3ES6B 2EECA 3QHZL 4K2UL 2HVKB 2VZSA 5I9QC 4LSSH 4P23C 1HHJB 43CAB 2ZSWA 3CAFA 2H32H 15C8H 5KVFL 2JCCB 4J8RA 4QHUA 5EOQL 3VXMA 3GMQB 4OLVL 4WEBL 2DN7A 4XPBL 4Y4KB 1DR9A 1BLNA 3UBXA 1OT2A 1XR9B 5DS8B 4N5ED 5GGVH 4EXKA 3A6BH 4AQ1B 3LV3A 1UZ8B 4D9QD 4Z7NE 3EOTH 4JANA 2FX9H 3DURB 3FT4B 1VADB 1U6AH 4KDVA 3TIEB 5HYQB 4NM4L 3NPZB 4Z18A 5GISL 3BGAA 2CRMA 5DRWA 5IESL 2B0SH 4ODWB 2ADJA 4YFLI 4MX7A 2JCCE 5C0GB 3VXNB 2CKBH 4M8QA 5DMJB 1YEJL 5CIPA 1SEBA 3ZHLA 4L4TA 1INDL 1IILE 1ZT7A 5FV1L 5ILTH 4LSRH 4HGWA 3J7HA 4JHAL 5IVXA 1MJUH 2OTUB 4J4PA 4U1JA 2CKBB 5IF0A 1NFIA 1T80A 5F3BA 3T1FA 1YN7A 3BPLB 3QXDA 2EDBA 4P23D 4PJGB 3U4BL 5ACZA 4NYLB 1QSFE 5CWSA 5D71L 4N1EA 3RAJL 4X7CC 2PYFA 2WP3O 3WFDL 1X5FA 4X5WA 2AXHA 3LRSB 3M1BA 2N4IA 2Z35B 3AS1A 5DFVC 1RULL 4QTIL 4U1GC 4P59L 2W9LA 3QJHB 3RGVB 3VFNB 3W0WB 5BZWA 1Y18A 5CJOH 4RMVA 4I3GA 2QSVA 3SE8H 2A6IA 3QDHA 1RV6X 1T1YA 4XMPH 1A14H 1RU9H 1CZ8L 1KFAL 1MHPH 3PE9A 5IW6A 2B4CC 3GHEL 4K94H 5DSCB 1WSST 5ALCL 4PGDB 1G1CA 1KCSL 1QQDA 3KYKH 5CEXA 3FB8A 3O3BA 5E2TH 1JHTB 3DI2B 4M48H 3S5LA 4TRPL 3QFDA 2ENSA 3GSOB 5DD1H 3VI4E 3K3QA 2QKIB 1N6QL 1GVIA 1R24B 1BZ9B 4U49A 1NAMH 1CIUA 3TBSB 3Q3GB 5HHVL 1LK2A 1XGQA 2X9WA 2FEEL 5B21A 3UX9B 3Q2CA 2BJML 5JOPE 1RUAL 3KJ6L 3VD7A 1V3KA 1NAMB 1FL6A 3AREB 3D3VA 1JPTL 3PWPD 1UJ3C 4JO1L 5SX5H 3PWVB 4FQLH 1S7SB 3QZWB 2VUYA 5BVJA 4JKWA 5D7LD 4O02L 4Q0XH 4JRYD 3M07A 3WBDA 1K8DA 4OZFA 1PAMA 3AY4C 1PX4A 5DFVD 3MRGA 1MLCA 3MLYH 3GSNH 2OMBA 4NKMA 3C6LA 1JHKH 5DVKA 4A6YL 2VLJD 3SE3A 4F9PA 2Y7QB 2CKNA 4LF3A 3GSNB 2CLVB 1TNMA 1OW0C 5T1KB 3P9MB 2HN7A 3TGXA 3ARBC 3ETBF 1RUPL 3CXHK 2DM2A 1M7DB 5FOBA 5JPNA 5HGAA 5IVZB 4Y4FB 5FO7A 3JSSA 1BIIB 5FYLE 4MCYB 3E3QE 1T0PB 3O2VL 5IB2A 2MPAL 3O2WH 5D6CB 4QXWA 1WZMA 3LS5H 1U93B 2X7LB 4AL8L 2EDLA 2NXYB 4D0DA 3STBA 1XZ0A 5IMMA 5F72S 1RZGB 1FBIL 4KZEL 3DSNA 3U7WL 4XP4L 1A1MA 2NNAB 4OCSH 2QEJA 3QDMA 3FO0H 5BZDA 1Z0MA 3JTSA 1NMCB 4XPTH 2B1HL 3MC0A 5FK9B 1JN6B 4KXZH 3SDCC 3FONA 4TUJA 2VAAA 5FM5M 4CMHB 5I1DA 4XVJL 3U9PL 5EOTA 1NC2B 1RJLA 3I9GL 4JFFE 5I18H 3P11H 4G42A 4WI3A 2VJXA 3NFSL 3V7AE 1N64L 3ARGB 1N6UA 3D5OF 3ESVF 1X5YA 3MJ7B 3V4PL 3CVHL 3ARBD 3KPLB 5HPMB 3GSRB 4JFYB 1NGWA 4S1DC 5C0JA 3EOAA 1MI5D 3Q0HA 2FBOJ 1HN1A 2HVJB 5JW4Q 5DFTA 1NANI 1R5VA 2HTLC 1PZ5A 3GBNH 2IGFH 4GAYA 2AJZA 4PJCB 5I17A 2H9GA 4OFVA 3D85A 3TA3A 4BQ8A 3DMMC 1V3MA 4P9MH 4H25B 4JDTH 2H2SC 3O11A 4L9LB 3DO3A 3MGTB 4WV1A 4RZCB 4UU9B 3GSWA 1G7JA 1T04B 4ODVL 4XB8A 3ARDD 3WFCH 43C9A 1T1WA 2MMXA 4I2XB 4GAJH 2YA1A 3S35L 3L5IA 3JTTA 3VA2C 1UB6B 4PJXE 4U6YA 2EKJA 1KB5A 2DTML 1AD9B 3SDCD 4NWTH 5D9SB 5LQBH 1CFVH 1GGUA 4P99A 3SBWC 1I7UA 1RZIA 3MGOA 3QJFA 3MROA 4F57L 4UTBL 2EKSB 2O26U 4NN6C 4WWKA 4Y1AB 4OCYH 4WCYH 1T2QL 5D7JA 2EC8A 1JNLH 2IJ0C 3VJ6A 2FD6L 5I6XB 3SEPA 5JQ6L 1CT8B 1KJ2L 1P69B 4OQTL 1QLRB 4S1DD 3DVGB 4ZD3H 3F7YA 2C3VB 1DVFC 3VWJC 1FG2B 1UWGH 3VFOB 1ZVSB 2HTLD 3CZFB 4I2XE 4U1NB 5T3XL 4WO4B 3OF6D 4LAQL 1CCZA 1MELA 3S4SA 3MLSL 3HE6D 3E6HA 3QBTB 4M61A 4KZDL 3JWDL 1KCLA 3DMMD 4Z95L 1HQRA 2PYEE 3W39A 1ORQB 4YH6A 4ONGH 4OZIF 1LQSR 4U3HA 5KZCB 1UZ6F 1DBKL 4FZ8L 4XNUL 1U8PA 5KOMC 4NQEB 1BFOA 4NJAH 1U2CA 2E7LA 1GCFA 3IDNB 2Q20A 1X5HA 2DBLL 4NZTH 4X99A 1ZT1B 1AGDB 1HK6A 3BPCA 2QADB 4K3DH 3SKUD 2C4FU 5TDPA 1VPOH 2KZ1B 5T1DH 4F3FA 2P8MA 4RBPH 3CMOH 2J6EA 2V7NB 1RZJL 4NPYB 3BWAA 4ZFGL 2P8LB 1UQSA 3PP4L 4J4PC 4QXTB 4R97C 3LB6C 4WHTA 1HHKA 3QUYB 2Z91A 3PF2A 4YIQB 3C5JB 5DUML 3G5VB 3VH8B 4EN3A 2DQCL 1KACB 3LMJL 4KK9C 3BT2H 3VXMD 1RZKH 1X4ZA 3FHAA 3H3PL 2Z9TA 3CSYA 1DVFD 3VWJD 3G6DL 5FYJE 5DUBB 2DL2A 3FQRA 2QHRL 3MXWL 1Y6KR 5E4EB 3I6GA 1U91A 4KJYA 3O4LA 3BFOA 1G7HA 4J12A 1T03H 1EJ6A 1KXQE 3QQ9C 1BECA 4NOFA 1MHCA 2RR3A 2YPLB 4FQIL 3F5WA 4MXWL 4HHAB 4MS8D 1EO8L 2Q76B 3O6ML 4P57B 3MLRH 5E8PA 1QG3A 2Q1EA 5GIRB 3AS2A 1OGAA 1R3JB 2VLRD 4FFVC 4ZUWA 1MFBH 4V1DA 3QDAA 1OLZA 1QNZH 1AO7A 4Q6IB 2X4SA 5IB3B 1HEZA 2IPKB 1IAIM 2X44D 3UZEA 1ADQL 2FJHB 1CXFA 3BP7A 5IM7A 5HVFB 1XGRB 3MREA 2JF1A 5DJ8A 3BN9C 3LB6D 4RAVB 1DCLA 1OP5H 5DD5H 5IMLB 1A1NA 5CINH 1A2YB 4ZQKA 2ARJQ 4Y5XB 3N50A 1RJYA 4FTVA 1S7QB 5I76A 4RX4A 3O6FC 2XWJA 4J1UA 4YLQT 3VI3F 4Z7UA 3CH8A 4KK9D 5TJWK 1DZBA 4CL7A 4M6ML 2ZG3A 4KUZL 3MMEA 3VFTA 5KVFH 3CPLB 2F53D 2X70A 5EOQH 4OLVH 2BC4B 3GKWL 3GSQB 4PBWD 3BXNB 3QEUA 4XPBH 5JIHA 4CMMA 1TJIL 3QQ9D 2WBKA 1AIFB 5KSUB 4KMQA 1V3JA 4DK6A 3SE3C 2O5ZL 4FQXB 4BQBA 5JOFA 4KROC 4N90E 4FFVD 2OBGA 1MCPL 3DPBA 3BGMA 5DQ9A 5B8CC 1IQDB 1EGJA 3UPAA 4CW1A 5DI8A 4NM4H 3UTTD 3ZE2F 5IESH 3GMMB 4YO0B 3RWIA 4P4RA 4U05A 1MCOL 2CDGB 4HSQA 3ARQA 1E28A 1RUQH 1QYGL 1MEXL 4YC2C 1BQHA 3V9FA 1YEJH 3BN9D 4RGOH 5JQHC 1RY7B 3HCVA 3OHXB 5DXWA 3UBXB 3HUJE 1LP9B 4PG9A 4MDJA 4U2ZA 4JHAH 4HPYH 3RWGB 3ULUF 5FYKD 4JKMA 3O6FD 4GKOA 4WI9A 5JA9A 4HKXB 1MCSA 1S7VB 1HXYB 3U36A 3ULSB 3IFLL 1ZLUH 4JANB 3U4BH 4M7KL 2FL5A 3TM6A 3L3IB 5D71H 4QXUL 4R9HA 5CD5C 3AMLA 3RAJH 3KHOA 4MX7B 3JV4B 1RULH 2E7MA 2JE8A 4QTIH 1L0XA 1XFPA 4P59H 1ZT7B 5K93A 3T0EC 1A6VL 3N1FC 4O58H 4AEEA 1CZ8H 3VFPB 4KROD 3GHEH 4X6EB 1QFUL 1ZHNB 5ALCH 2X4NA 1L0QA 5F3BB 3QXDB 5BS0D 5F9WC 2R1YB 5CWSB 4Z0XA 3NIGE 1JTPA 1XAUA 3NTCH 3PWUA 1N6QH 4MJIA 3MLZL 4IDJH 4X5WB 1M05B 1ZAGA 4X9GA 4EI5B 5H2BA 3TA3C 2WV3A 1GGYA 4XH2A 2BJMH 1RUAH 4LVOC 3HI5H 4JY5H 4OLUL 4JO1H 1JPTH 4L4TE 1LK3H 2A6IB 2CLRA 2ZJSH 1T1YB 4UNTA 2VDLH 1F13A 4JDVB 1N0XL 2ARJB 2PO6D 4JM2F 3Q5YA 4L1DA 5CD5D 2YWZA 5EBWB 1JI1A 2VLME 4LSTL 2IMMA 3QA3B 1FAIL 4LCWD 1D5ZB 1AGEA 4IHOA 1T7ZA 1K5NA 2NY4C 4M5YH 1P2CA 4AK1A 1MSPA 4WWKC 3T0ED 3EOBA 1MAKA 2JB5H 4RNRB 1JF1A 5LVEA 2Y5TB 5B3JE 1WT5A 4GBXA 5FA3A 2JJUA 4K8RC 5D6DA 3VWKC 4ZFFA 1QOKA 2ATKA 2XKSA 1GPOL 4J3SA 2O61A 2H26B 4OZFB 4LP5A 1BP3B 2PNDA 1KGCD 4JRXA 3TA3D 2FGZA 1ZA6A 2MPAH 4XAWL 2Y1VA 3E0GA 3MCLL 3BESR 4U6XA 1C08A 3AS0A 4QY8B 4UOW1 1EUUA 4KJQC 4QRUB 1PD6A 3PQYB 3L7FA 2GHWB 5AAWA 3TCLA 5MHSE 4MZ3A 4KAQH 1FBIH 1WJ3A 3D3VE 5HGBB 4WTZG 4KZEH 2QL1A 2HN7B 2QSTA 1RIUL 4JPKL 3ARFA 1NFDF 3S3SA 4CJ0A 2PN5A 5FO7B 4PGCB 3ZSSA 5FF6A 3MRIB 2B1HH 3I75B 4RGNC 2NY4D 1U3HA 4LSVL 4LVHC 2VZ1A 4PJFB 3MO1B 1J87A 4WWKD 5ETUA 5IB2B 3V52H 4DGVL 1FDLL 1HIML 3RWEA 4PJBA 3U9PH 3GMOB 4R8WL 2QJDA 3TZVB 4EN3C 4U1HB 3BP6B 1N64H 1H3XA 5C7XH 2HKFL 4BJLA 5IMMB 3CVHH 2A73B 3PQYE 5IROA 3VWKD 4HGKC 4DVRH 4G8FA 1YEEL 3MRJB 5D2LF 1OF2A 5ISZD 1RZ7L 2VDOH 3KYNA 1IQWH 4HPOL 3UPCA 2AABH 3PV7A 1JF6A 1RJLB 4KJQD 1Q9KA 1U8LA 1EXUA 1IL1B 5DWUH 3MODL 1X5KA 3QQ3B 4XCYB 1QSEA 1HHIA 2AXGA 2VDML 2NYYC 5FO8A 1SY6A 2XN9A 5I19H 3DLQR 1NGWB 1V7ML 4AG4H 3SPVB 4PYHA 4NJ9L 3MRRA 4RCAA 2WBWB 1C7SA 2DLTA 1ZWIA 1A5FL 2DTMH 3QDME 3V4UL 4RGND 1R5VB 1PZ5B 2HJKB 1PLGL 1WGOA 1XGUB 2D31B 4GAYB 4YDIL 1RJCA 3GJFA 3AM8A 4OCNC 2H9GB 4HBCL 4I18A 4EN3D 4F57H 2AI0L 3QNZB 4IIQC 3DRQA 4GO6B 4OZHF 3O0RH 4Z7VF 3CJJA 5HYJD 1JNNH 4WV1B 4PJEA 5GJTH 3HZYA 3D48R 4DVBA 1JNJA 3K8KA 4G7VH 4ZFOA 1CXKA 5D70L 4D0CA 4NO2B 1WBZA 3V4VL 1FHGA 3RWJB 4ZODA 5KTEL 3P9WB 1DBAL 3JTTB 1L9MA 3H7BB 3KG5A 5T3XH 4LAQH 4QYOA 4JFEA 4HH9B 4MQ7A 1I7UB 3MGOB 3QJFB 4Z95H 3NGBB 4OCXL 2KQNA 5AWNL 5J06A 1UM5H 5I8CB 2V2WB 2ADGB 4V1DD 1DBKH 4XNUH 5D7JB 2NYYD 2AERT 1D5BA 4LLVB 4O4YL 2R0KL 4LAJH 3SDYL 2GAZA 1IKNC 1X4XA 2FJGA 4NN5B 5JNYA 2MOVA 3S37X 3EYFB 3VMOA 4LVEA 5HGHA 4G9FB 2YSSA 4LK4A 4KDWA 1KUMA 4EXPX 2HJLA 4R7DB 1RZJH 2IC2A 3MZGB 5D7SH 3QULA 3S4SB 4ZFGH 3BIKB 2K7QA 3QFJA 2EXWC 3E6HB 4CADA 3C60A 4FQ2L 4JFDA 2E8YA 4N8VA 4JHBA 4GRLA 2DM7A 1IEAA 1M4KA 2AW2A 3RVTC 2DQCH 5DEFA 1U8PB 4N1HB 2DWDA 4DWHA 4D3CL 1OVZA 4H8WH 1BFOB 4RMUA 4O2EB 1IC7H 1Y6NR 3H3PH 1E4XL 1YNKH 4CNIA 4YAQA 1KTLA 1URLA 3BPCB 4LLYA 3G6DH 5TE7L 2R0LL 4QXGH 4MQXC 4WEUD 5TDPB 4M3KB 4R7NA 2BOBB 1NDMB 3PXJA 3FQTA 2YWYA 1DQQA 5MEOA 2PXYC 4Z77A 1QHOA 1HHKB 4MXWH 1EO8H 2Z91B 1T20B 3O6MH 5F7UA 3ILPA 1NGXA 4P2RB 2BVOA 4NWUL 5C0DB 3HAEH 5GSRA 1O5DT 4G3YL 2HFFB 5BV7C 2WSKA 3QIWA 1ZK9A 3FQRB 1ADQH 4KJYB 1U91B 3DI3B 4XPGL 1AHWA 3BSZL 2DQDH 2E27L 3DVNA 5DUPH 1L6XA 2EXWD 5HGGS 4JO3L 2HT4C 1DUZA 1TITA 2VRAA 1CL7L 4AIOA 3ULVF 5F9JB 3OJVC 2I60L 1G9MC 1UYWL 2P48B 1Y0LA 3RVTD 3K4ZA 4HLZG 3IETB 1CQYA 3N85H 4PV9B 4KUZH 1AI1L 1L7TH 2X4SB 3L3JB 1E4WL 4YPGA 5FUZL 3M45A 4JR9L 2ZKHL 3QEHA 4KC3B 4XNQA 4OD2B 5IM7B 4NRZA 2PXYD 4DZ8A 4IMLB 3O4LE 5FM8A 3CUPA 3V95A 3CLFL 3EYVA 3HZMA 4Y5YB 4P2YA 2O5ZH 4Q2ZB 3GUTA 2FR4A 5EUOA 2OSLA 4ZQKB 5LWYH 3HS0A 4XT1C 4WU7B 5J12C 4OLYH 1MCPH 5L88H 3IJSB 4OV5B 4KI5E 4OKVA 3QUXA 1OGAE 4X9IA 3KJ4C 3MMEB 3HNVL 2OZ4H 2X70B 1CGYA 2CUIA 2J8UA 2VDPL 2EE9A 5FM4A 1AO7E 1MCOH 4LPCA 4X4MA 1WWAX 3QI9D 4MHHG 3LKQB 1MEXH 2BVUA 5GRUL 1E6OL 1IGYB 4M3JA 5I71B 5TH2A 1G9EA 2HT4D 3TT1H 4HWBH 5ADOL 5EZLB 4YX2L 4F37F 5IB4A 2EDRA 4OLWL 1NEZG 4XI5C 3G6AA 3HG1B 3MLXH 2AAVA 4XBGB 5FHBH 5L9DH 4M7KH 4FTVE 4JGJA 5ESAB 3KLAB 4CW1B 1NL0L 5DI8B 4PJDF 4XX1G 3T0BA 1T5WB 1D9KD 4U7SA 1H3GA 2Q8AL 4XNZB 1CICB 1KCRH 4NNYB 1E28B 4HIHB 1BQHB 5C07D 3HCVB 4JN2A 5MENA 3TN0C 1A6VH 2M1KA 5L8JB 1OQOA 2GUOB 2HG5A 4LCIH 3CFBA 4WU5A 2D4DA 1IGIL 1JGLH 1PYWA 1ZS8B 1NPUA 3HG1E 1GYAA 3FQXA 4JQIL 2EDTA 2HLFC 2WIMA 4XCNA 3HRPA 1QSVA 5IVOA 4JCLA 5FB8A 4X5LA 5HHXH 1P4LB 1YEFL 3MLZH 4H5SA 2NPLX 4LSPL 5CBEB 1KBGL 5KVMC 1I8IA 1WTGT 3HI6L 3UYOD 4MWFB 1YEHL 2CJUL 1WFOA 1E4KA 2AQ3A 1T1ZB 4M9PA 4XI5D 3L1OL 3CXDL 3STLA 5C08A 2F5BL 5E8NA 1J1XL 3W82A 2XRAH 5DQJA 4UV7L 3BPLC 2APBA 1KEML 2I27N 4IRSA 1WEJL 2K7PA 3QEQA 5A40E 2BHYA 4HUWB 3HC0B 4WFGE 2E7BA 4F7EA 3ME0A 1T7VA 3AM8C 1Z3GH 2XKNA 3DIFA 5MEQA 4NSKA 1OLLA 3RGVC 2EYTB 3TN0D 3MZTA 1QVOB 5DVMA 3CGTA 2CR6A 3H0TA 5IT2L 4MLSA 5D72L 2A0LC 1ES0A 3W9DB 5HHQB 2XOTA 2IBZX 2YD4A 4NZUL 3PWNA 2IEPA 3KPMA 4BKLB 5J6GB 2HLFD 3TIDA 1TVBA 2AJYL 2WBJB 4K94C 1EHXA 5TF1L 1A1OA 1CE1L 5FKPA 1B4JL 1SJEB 1FL3A 4TSAL 1IC4H 3MUGB 2XA8H 4IHOB 4DN4L 1OAYL 2AK4A 4XAWH 4MJIE 4Y16A 3MCLH 3FB6A 3ZDZE 4YDJB 3EOBB 3AREC 2SEBB 3F7QA 5IB5A 4DZBA 1NUGA 2FO4B 4TSBH 1D3CA 1ZT4A 3WNOA 1HDMA 3K81A 3K7UA 5CILL 5F7DA 3BQUA 2P45B 3GMLA 1DSFL 1L4IA 4O5LH 3OB0K 3GK8L 2DQUL 3SJVB 4ZNEA 1QD0A 4NZRH 4CVZB 2O61B 1X5AA 3VD3A 1AQDB 1I1AC 4JRXB 1N5AA 3GFUA 3RGVD 3C60C 3IB4A 1QFPA 3W0WD 4DGVH 4YHZL 2AP2A 5A1AA 4R8WH 5EU7E 5DJYA 2XFXA 1I9IL 4Q74A 2A0LD 4NQXA 2ZNWA 5FUCC 2R1XA 1PKOA 3VRJB 4TOYH 4NZDA 2NY5H 4JJ5A 5J1TC 1UXWB 3SKNB 2G5RA 1ZGLB 3F58L 5GPRA 3HPLB 3ARXA 4GUPB 2GW5A 1MFDL 3BZFA 3H2WA 4XXCC 3ARFB 4XMLL 4NUGH 1RZ7H 3EKCA 4OD3L 4NRXB 1X5ZA 5J4MA 3FT3A 4NKIL 1HYSD 1MIML 4N1CA 2XNAB 1EZVX 2DMBA 3SJVE 3NH7L 4OTXL 3MRDA 1JGDB 4HPOH 3AAZA 1NBZA 3ARED 3BKYL 4JRXE 4APQC 3IAPA 3UYRL 4S2SA 4RFEB 2VQ1B 2VL5A 5D1QA 2LV4A 5F7KC 3MODH 1DLFH 4PGEA 2VDNH 3Q6GL 3PJSA 2VDMH 1FV1A 1OD9A 4PRAB 3CDYA 4G8FB 1V7MH 3MNWA 4NJ9H 1AHWC 4YGVB 2C7UB 3OGCA 5DEGA 1Q9WB 4MVBC 2GY7B 3LY6A 3BHBB 1I1AD 1BREA 3F7RA 4L29A 3C60D 1PLGH 1B90A 1LE9B 4HBCH 3L5XL 1P9MA 1CLZL 1DBBL 2DIAA 4WTXA 3U6RB 4MD0B 3I50L 3DROA 5T1KD 4PJBE 3FJTA 3O3AB 1HHIB 4Q9RL 4LPWA 1WWCA 3EO0A 1DBJH 5HYSA 1HILB 5FO8B 3V4VH 4UV4H 5ICYB 3ZKND 5ABDE 3QQ4B 5KTEH 2F5AL 1CLOL 3MCKA 5F7HA 1DBAH 2CIKB 3RX7A 1KJMA 4GQ9H 1ZWIB 3C9NA 4G8IA 1HH9A 3ZYOA 3ZT6A 1H3PH 2EICA 5K9JH 4EIZC 1I9EA 2EH8H 3GJFB 3VRIB 1RURL 4APQD 2DL9A 1OTTC 1CGUA 2M2DA 4I18B 4OCXH 4L9LC 4HFWB 4FMKA 4ZS6C 4OF0A 3KPTA 4PJHB 3GI9H 1Z5LA 1K3IA 2FATL 5J3HC 1FSKB 5T3ZL 1FRGL 3ZT7A 1BF8A 2OR9H 1AR1C 4O4YH 1JNHA 5GRZA 3KYMB 3SDYH 4DK3A 1QSEE 1WBZB 3VW3L 1I3GL 5CD3A 4JFPB 5DGRA 5GRJH 1JE6A 2ZCKL 2XN9E 4MVBD 5DMGC 5EZOL 4QYOB 3K2UL 1XF1A 4JFEB 5F96H 2OJZL 5CEYB 3V6ZA 1BZQK 1XIWA 4PRPB 1WISA 3TWCL 4AJ0A 3PV6A 4PP2A 1YYLL 1ZE3C 3LQAL 3QSKB 5E00A 1IM9B 3FN0L 1E4XH 3I02A 4PJEE 2GAZB 4A6YA 3B9KA 1U92B 5JNYB 3AU1B 2B20A 4JHWL 4WO4C 2YSSB 5FUOL 4JPIA 3KXFA 5C0FB 1A6TA 2JK5B 1OTSC 2DYPA 5DD6B 1IAIL 3QUZB 3MV7B 1OTTD 4LMQI 4JFEE 3QG6B 5DZLA 2WUBL 3BKCH 1J8HB 1JRHL 4ZS6D 4HJGB 4N8VB 3SGEH 4GRLB 3BP5B 5J3HD 4PRPE 1AKJA 1F4XH 1AR1D 5GJSL 5IGXL 4WUUB 1VFBA 4G3YH 2ZOKB 3G5ZA 4X6CF 2R0WH 3KPPB 1BWWA 1NGPH 3I6KA 5CKGA 1X5LA 4OLXL 4N0YL 1I3UA 4P3CL 1MPAL 4NP4L 3G5XB 5GGTH 4GRMB 1PJ9A 4Y1AD 2EYSB 1CL7H 5I1CH 4HMEA 3HR5A 5L2JB 1BM3H 2AEPH 3MJ6A 5HY9A 3MV7E 3QFJE 1UYWH 4G6JL 3JWOL 3ILPB 4LRIC 3QNYB 4JFDE 1NGXB 1FFNB 4JN1H 1HI6A 5C6PB 1CGSH 2R15A 3LN4B 4NUJB 3MYZA 4HZLA 4NC1E 5E4EC 5ENWA 3TH3T 5FUCE 1A3RH 4ORGA 1UH4A 5FUZH 4WO4D 4WNQA 4JR9H 5B38G 1ONQA 4W6WB 1RZKC 5MEND 4RIRA 4LLWA 1OTSD 4FQQA 4Y2DB 1CDIA 1J0ZA 1WZLA 3VFGH 1BD2B 4B41A 5GRVK 4G9DA 4GKNA 2YC1A 3BH8A 5F71A 5KVEL 4WI4A 5SV3A 2EDWA 4NQED 3JUZA 1Y0LB 4M7JL 4LQFL 4G6KL 1MIEL 2YEZA 4WDIA 1D5MA 5FYJU 1P84K 1VGKA 2V9QA 1FGNH 4N8PA 4Y5VB 1GH7A 2HRPL 3OJMB 2D3VA 3IDIA 4DFIA 1UG9A 2XZAH 1W72L 2A38A 1A9BB 5GRUH 1YECL 1E6OH 5BQ7A 1J5OL 2J8HA 5C0CA 5I30L 3U83A 2XPGB 3IFPA 1WBYA 4AENA 5CJXC 3HNTL 4PJ7A 2AKRB 5ADOH 4YX2H 3GUTB 4OLWH 2EDHA 4YHIA 4QHLA 3KWWB 1KENH 4HCRA 3BQUC 4DAGL 1VKXB 1BF2A 1ND0B 4KKCC 2OL3A 4TUOB 4OF5A 5EB9A 1A0QH 1T83A 2Q8AH 4QRQB 4EBQL 5M7QA 1PQZA 1KJ2A 4OQTA 5SWSB 3EBAA 2YPLD 2VITA 1MCHA 1TJGL 4FQXC 3BISA 4MA8H 5IB4B 4O2CB 2LQRA 1NBQA 2BMKB 3IXAB 4YXLH 4UINL 5EO9B 3MV8B 3W11C 5I66B 5EUOE 3C5ZA 1IGIH 2Z31B 1FGVL 5KG9B 2YUXA 1DUYB 4JQIH 1ZANL 4LFHD 3SDAA 2X10A 4WUKL 1SVCP 4JM2A 3UP1A 2NMSA 1I8KA 3HRZB 1WITA 1EHLL 4NCDA 1RPQA 1KBGH 4BSJA 5EIQA 4R2GB 5B22A 5E9DA 2J8UE 3T8XA 5J6HB 3C09C 4LPUA 1IGML 4X4ME 1YEHH 4N0UB 1AR2A 2CJUH 5HHOA 5D1QC 3L1OH 1UWEL 2F5BH 1J0JA 3C6SB 5F7WC 3RJDA 1J1XH 2HG5B 4AIZB 5FECB 3BQUD 4UV7H 3NIDE 4RFOL 4ELMA 3L3HA 3UTZB 4RMWA 3SE9H 3CCHB 4TNVF 1QFWM 1B2WH 4PRHA 4OT1L 2BX5A 2UZIH 4FABH 4K55A 4CKVX 4IMKA 5F97E 3OSKA 4MNHA 3I3BA 4HIJA 2VXVH 5TGBA 4GXVH 1JHLH 4GXUM 2CK2A 4X9HA 2J5LC 4FQXD 2VABB 5GHWL 3BWUC 5F1IA 3VE0A 3AXLA 3QDJB 4NZUH 4XXDB 2DWEA 3DGGB 4UNUA 1JJUA 1OP3H 2NTFA 2APXA 4P3WA 5CP3H 1B0RA 4U1IB 5EO1B 3RWDB 3DOSA 2I07A 4U1MB 1NDGA 2ED9A 4GRWF 5DMYA 1KJVA 3SGKA 1NFDA 4LGRB 4DN4H 1OAYH 4E0RA 5EC2A 5MEQB 3NN8A 1WIPA 1S7XB 4JLRB 3UMTA 1U58B 5AYUL 3H0TB 1JZ5A 2E8ZA 1G0DA 1FNGB 2R9HD 2YZ1A 1X6NA 4PS4L 5E94B 2HAZA 2D7OA 4BQCA 2BCKA 1UJTA 2V2XA 1I3RB 3IU4L 4LCYB 5CILH 3QH3B 2PF6A 3QDJE 1HHGB 4I9WD 1MQ8A 1JPFA 3FOMB 3TIDB 3DSFL 3S6CA 4ODTL 4JG0H 3QEQE 2NY3C 3VGAC 1FL3B 1OP9A 5EBMA 4P48A 3O4OC 1SJVA 3IKCB 4BYHA 1K4CA 2AK4B 4Y16B 1PY9A 2XXCB 1KIRB 2UZXB 3FB6B 4L3EA 2RJMA 4KUCD 1I9IH 2HLAB 2MFNA 5IQ9A 3GIZL 2GFBA 5I0ZA 1E0OB 4XCEA 3OZ9H 3JWNC 3B8SA 2L0DA 1LGVA 1ZHLA 4I5BB 1AJ7L 1PEWA 1QBBA 4S11A 4FXKA 3FRUA 3DXAA 3B2UC 3GMLB 4XMLH 5ERWA 4LPXA 4OD3H 4BA8A 4EI5D 1F90L 3X3FL 3UTSD 1MIMH 3UTOA 3W9EA 4OTXH 1C8PA 2Q86A 25C8H 2QQLL 2ZSVB 1PVHA 3O2DL 4QT5A 1W2KT 2AK4E 4Z7WA 5DJYB 3NIFE 3SY0B 1RQ5A 4NQXB 1LEIB 3VI4F 3RBGA 3Q6GH 1Y6MR 4JJ5B 1N4XL 1V8HA 1VCAA 3U0TA 2ZUUA 1XR8A 3BZFB 4YJZL 2PUQT 5FXCH 4JVUA 2NY3D 3UC0H 1EVTC 1R3LA 3B5TA 5IV2A 2ENYA 4G5ZL 4PREB 2X89A 2XTJB 1JGEB 3MRDB 4ZNEE 4OLEA 4D0BB 3AAZB 2BERA 3L5XH 4NNPL 2AEQL 4O9HL 1DBBH 4ETYA 1GGTA 4S2SB 2GIYA 4ELKA 1D5IH 5GZOC 5J9PA 3EDKA 3EO1B 4HIEA 1EBPA 4PGEB 3IU3B 5ID1A 1CF8L 1W8OA 2XQBL 4D9RD 1MJ8L 5T1MB 2IANA 1FV1B 2BVPB 2XICA 3B2UD 5GRXG 3IRZA 1T21B 1YY8A 2VE6B 1CLOH 5DC4B 4MD4B 1TQCC 3PGCB 5DEGB 4ZG1A 3BDBA 4L29B 3FL7A 1AGCB 2ICES 4XBPA 3EO9L 1GZPA 4RGMB 1TZIB 1RURH 1SYSA 1R3IH 5HDQL 5SWZD 2XTJE 4NO0B 5BOZG 1LD9A 1WAAA 3STZA 4Z9KB 5D7KD 2ZWLT 4LHUG 1PZUB 1UM4L 5C0AD 1FRGH 5CGYC 3ZL4L 4OZIB 1CGVA 5HYSB 3SGDH 2YR3A 3FQUA 3VW3H 4KVNH 5LGJB 1JYXA 4JKLA 2E3VA 3CC5A 1YJDL 4H26A 5SX5K 3HZVA 1AXIB 2FX7L 5DK2B 5IBLC 1HH9B 3UDWA 3DX6A 3K2UH 4H0GA 2OJZH 1AY1H 3P9LB 5KJRL 4YR6A 1LNUB 2MQCA 5KSBF 4P5MB 5GZOD 4ZUTB 4MLIA 3HMXA 4I8DA 4KTYA 5I16A 4R96A 1Z5LB 5IFAL 1P6FA 1YEDB 1YYLH 4MA3B 4YK4C 3LQAH 2PCPB 1NUDA 1JNHB 3FN0H 1MCIA 1KPRA 4LNRA 4KRPB 1MRDL 1X3DA 5INDB 2DAVA 2GJZA 2WWKO 1NCUA 4JHWH 1MF2L 3JUYA 3R06B 3FFDA 2A1WL 2WLYA 3JVGA 4POYA 1IAIH 1Z9OA 1TJHL 1EAPB 4PJAA 4FOMA 3QWQB 1BVLA 1KULA 1FYTB 1SHMA 1RIHL 5IMOA 4Z8FL 4OGYH 5EA0L 3C8KA 1MCWW 3K4AA 5CGYD 3PV6B 2PTTB 5GJSH 4C54A 4PP2B 2YKLL 3MCG1 2GTWA 1BFVL 5E95B 2Q8BH 2X1XR 2F15A 1F8TH 3CVIL 1AQKL 3RTQB 1JP5A 2FCBA 3B9KB 5D7IA 2PW1A 3RP1A 3MV9A 4Y4HA 4OLXH 1VESA 5IBLD 3UJJL 4YBQD 4QOKB 4P3CH 1MPAH 4NP4H 4OD1H 5C0IA 3KXFB 1A6TB 5M94B 4LOUC 1DQML 3V6FB 5TE6L 1Q9LA 5T1LA 1U0QA 1RZJC 2J88L 4QHKI 5E8EB 1T1XA 5C0NC 2DQFA 4G6JH 2EDDA 4Q9CA 1JZ6A 1A6WL 4PJXF 5IQ7L 1YUHA 2FLBT 4OIIH 4L8CA 5IK3A 1VFBB 3G5ZB 4C59B 5AUMB 1IGFL 4WY7L 3L5WA 3WFEH 4EOWL 1S7TA 4NQDA 2FH6A 4H8WC 4U1KA 1DN0B 4EJ1C 3MJGX 3QIBA 3CSGA 3P77B 1PGRB 4MDIB 2ADFL 5L0QB 3RI5F 2CH8A 2GT9A 2NX5B 4MQSB 4C55A 4HIIA 2V9TA 5T3XD 5KVEH 1IGCH 3KXFE 1OPGH 4KDTC 3SDXF 4WI2A 4LQFH 2A83A 5FDWB 4G6KH 3ZE0F 2FECI 2K1MA 3U4EA 1MIEH 2UY6A 1FVEA 3GRWH 1FQ9C 2YD5A 5AZEH 2A6DB 1WCBB 4G9FD 5GGRA 1A64A 3SGKC 5ENWB 1W72H 3VI3E 5E9DD 4JQXC 4C56A 4ORGB 4PJDA 4WNQB 4IOIB 2ICWJ 1YECH 4WEMB 3RNKB 1J5OH 1UCTA 1J7VR 4E42A 2VLKB 4PRNA 4FQQB 3ULUH 4LOUD 1C7TA 1PEZA 4GKNB 3VD4A 3BH8B 4G7YH 5C0ND 3LN9A 1N3NB 4GKSA 3MXVL 3H9ZA 2AJVL 4PRHD 3WS3A 4PJIF 5LAXB 4XMKH 3ZLQC 2XWTA 2F54B 4EBQH 3T0AA 4IRJA 4W4OA 3TNNA 5A3IC 3IJHA 2X4TA 1TZHA 4ONHA 5BQ7B 3TPKA 2HTKC 1RMFL 4Y5YC 3IFPB 4EDWL 1WBYB 3E1F1 3RU8L 5CGMA 1JV5B 3CX5J 4LEXL 4UQ3B 2GKIA 3B9VA 3VXOA 5BMFL 3MRQB 3HKFA 4P2RD 3VA6A 2DB8A 4UINH 3ARPA 5T5NF 3VGFA 2W0FB 1GIGH 4YE4L 5TDOB 5I1IH 1T7XA 5E6IA 1L7IL 3WJJC 1G7PB 1QRND 2OL3B 1DJSA 2MHAA 4WUKH 1FZMA 1AGBA 3U0PB 3FFCA 3FQNA 32C2B 4XHQA 3SQOH 1EHLH 5FGCB 2BK8A 3CSBA 2VR4A 2F54E 4ZPVA 3PGDB 4HD9A 2EH7H 1JGVH 1IGMH 4AY0A 1VGEH 5DJDA 5C0CE 1UWEH 4ODXA 5B4MD 4OV6F 2ESVB 4PJ7E 2DIJA 4N5UA 1CE6A 4LVNB 4RFOH 4NQUA 4TVPL 4RBPK 2IADA 4OIBA 4Z7OF 2Y9RT 4DEPB 4BZ2H 1E27A 4U1LA 2IBGA 5LJYH 1OB1A 1VB9A 1V7NH 3MFFB 3WV0A 4JM2B 1J18A 2OI9C 3EYQC 3VXRA 3S96B 5A3ID 2ZOLB 3WXWH 4MJ4A 4OZ4A 5HHMD 1EFXD 4L3ED 5J8OA 2HTKD 1FO0L 2YA0A 4JAMB 3VFRA 1BQLL 1MREL 1NGYA 1U8KA 5GHWH 1GXEA 5DD0H 1TIUA 1A21A 1JRHI 2WW8A 7CGTA 3DUSB 1MFEL 1QPXA 4G8GD 1P6AB 4MXVF 5I1HH 4X7DC 1F4WH 5JW4M 2MTPA 4F7TA 3JV5A 5GS1A 4ALAH 3KYOB 1U8IB 3DX7A 1S3KL 4NDMA 5C1MB 1ZGLP 1KT2A 1HSAB 3T4AA 4F58L 1YDPA 4U3CA 1UACL 2A2QT 1QKZH 5AYUH 1YQ2A 3HG1D 3ZYJA 1FJ1A 3QAZB 2DM4A 4XP1L 4PS4H 3S36H 4QLRA 1YZZA 4HKZA 5HHOE 3OJ2C 35C8L 1QR1B 3QXAA 2AS5M 2DLFH 4R0LB 3K74B 2NTFB 5EG6C 1BX2B 1FIEA 2YD1A 3DSFH 2C9AA 1B6UA 4OI8A 1EHAA 2X42A 3TO4A 1KTDA 4P2QD 4ODTH 3HUJF 4GW5B 1OP5K 5A2IH 5IHBA 3EYQD 1NDGB 5KSAA 4MB3A 3WN5A 4JKPL 1BJ8A 1NFDB 2AJXL 3QIUB 3NN8B 3H3BC 5EU5B 1U8OA 4JFHD 4FQHA 1UVQA 3IDXH 3Q48A 2XKUA 1FZOB 2HFTA 1JPSH 1U9KA 2GY5A 4ZSOA 2WBJC 2VWEE 4YHKH 3RVUC 3WXVL 5K9QG 1RFDH 2BRQA 1FLTX 1GOFA 4G80A 1G7IA 3BZDA 4UOJA 5CUSL 1F90H 5JMRA 2Q6WB 1J0HA 5D2LB 5EBMB 1CK0L 4HIXL 5KSVA 4PRID 4K3HA 5CBAB 5C9KA 1NFDE 5JW3L 2HA1A 3MRKA 1P5UA 5IQ9B 3NIGF 5AD0A 3OKKA 5IW1A 4JPWL 2F9BT 5HHNA 2ICWB 5EU4A 1N4XH 2EZ0D 2A77H 4GG6A 1AD0A 3FRUB 2O93L 4Y4HC 1SJHB 2OTWA 4R3SA 1CFNB 1P1ZB 3FCTB 5DJAA 1Q38A 4G5ZH 4MJ6A 1I8MA 3QHFH 4ETQA 4KK5C 4L8SB 3WD5L 5IVXF 3GJEA 4NNPH 5D2LE 2AEQH 5LGHH 3WUWG 4C83A 1H5BB 1AGFA 1U8JB 1WFUA 2B1AL 3D2UA 2O5XH 4KU1A 2D7MA 1VSCA 4I0PA 5LBSL 1CF8H 2WBJD 4OZHB 2XTLA 2BNUA 4Z7VB 1KPUA 1KJ3L 2DKMA 3RVUD 4FQPA 1CFSB 1I85C 5FA4B 4PB9L 2V17L 1EV2E 2HFEB 3BIAX 1NCCL 3QIBC 5D1ZB 3TJEH 3KPQB 4RAUA 5IV2B 5B3JF 1JWUA 3CK0L 3ELAT 2RFXB 1U41A 4WRLA 3MBEA 1XGYL 2IFFH 4MAYB 3KNBA 1S5IL 1VFOA 4ZFZB 3R8BB 4X6DA 3DX8B 1R3KB 2J3SA 1R5IA 1UM4H 5D1XB 4HIEB 2OK0L 1QBMH 3OJDA 4LPTA 4Z7WE 3SDDB 2W9EL 4PJ8A 3GM8A 4PJ9B 5CFHA 2IANB 4LLUB 2W07A 4Y4HD 3B83A 4MJ5A 3X11B 4Z7VE 1LEKB 2YD9A 1YJDH 2P5WD 4M02A 4KK5D 3L5HA 1QP1A 1FNEA 1KSRA 4LLAA 4FQCH 4XBPB 2FYYB 5KJRH 4ODUB 1JYNA 1TQBC 4XAKD 1LD9B 3X14B 2FIKB 2JIXA 3HHRB 2MWCA 1LO5A 1YMMB 4C4KT 1IGTA 2ITDB 2JTDA 3ZMRA 5IFAH 1KYOJ 4LASH 4L4VB 2GSIB 3RPKA 4HUUA 3SKJL 3VH8G 3QUML 4JDZB 3O8XB 1T5XA 5JHDA 3QIBD 1IZJA 2VQUA 3VGEA 2Q3ZA 2IANE 4Y19A 4HLJA 3O9WB 1MF2H 4X6CA 4XNMA 3CC5B 1G0YR 3LH2H 3QXTA 5CP3A 2A1WH 2X09A 1DQTA 1TJHH 5DT1L 5DQDL 3DJ9A 1OGTA 3OMZA 1VEPA 1A6AB 3WEXA 2EDXA 5GQBA 4JZJA 3H42L 1K6QL 3O3EA 1FSKC 4X83A 4Z8FH 2HRLA 5I16B 4HKJB 1RK0A 4I48A 1WAAE 4UILH 4PY8I 1G7MA 4X6FB 1JVKA 2YKLH 4E41B 1BFVH 1YMME 2R0ZL 1XCTA 5HVHC 4JY4B 5F1KC 3EHBD 4PRBA 2VZVA 1NC4D 3IS1X 4NNXA 1FPTH 5C0RL 2DOCA 3IF1A 4NQCA 5HHPA 2AJSL 1NAKH 4OCWL 4ZAKA 12E8H 3ULVH 4NKOA 3ILQC 1DQMH 4OM1H 5TE6H 3PXHA 2DLIA 2HT2C 2J88H 5KN5B 1EAJA 1G7QA 1JUFA 4MHHI 3K1KC 3VFWB 3IRPX 3M17A 1TZGL 5IMOB 3DBXA 4M1GH 5B39A 5E6YA 1QBLL 2G2RA 5GRVL 5JPMA 3OBAA 4PTUA 1IGFH 3MOBL 4M03A 4E41E 5EU6A 3U82B 1CVRA 4P4KB 2BSRA 2PW1B 4EOWH 4M7ZB 3WE6B 1RZ8B 5C2BH 3QUZC 2JJSC 1QFOA 5E1AA 4YNYB 3X12A 1G6RL 1T3FB 4OFIA 3EOYG 1PX3A 1CFBA 3MLPA 4NN7C 3DX9A 5T1LB 1FAKT 3PIQB 5E2UL 3TBWA 3VXUB 3F12A 4PJAE 2P8PA 4LCCA 2AQ2A 4OF7A 5D2NC 2X40A 4HF5L 3QXWA 5HI4C 4LMQE 3RPIA 4U1KB 4NQDB 3RVWD 5EOCL 4HK0B 3B2VL 1GRWA 1U8QB 3IVKB 5D7IE 3OX8A 4R4BA 3MV9E 4P5TA 3ILQD 1AP2A 4BFGA 4DN3L 3LRGA 3S97C 5ALBL 1IKFL 1R3HA 1S9YA 4QGTA 3MXVH 3UBXG 1U8MA 2AJVH 3IAQA 1IM9D 3PWLB 1QSZA 4QRSB 4ZMAT 5FGBA 3DECA 1KG0B 3U4EB 3TO4C 1DBML 1QR4A 4JE4B 4FMFA 5KSAC 1QO3A 4MNGA 4Z7QF 5I1LA 1RJZA 2OTPA 5INCA 2Z92A 5JXED 3ARSA 4PJDB 1KN2L 2Z8SA 4XVTH 4P0DA 5C9JA 3QUZD 3TNMA 1BMGA 3WKMH 2YBRA 5E2JA 4NQDE 4E42B 3V6OA 4PRNB 4WW2A 1NCDH 2OX5A 3SE4A 8FABA 1J8HD 2X1PA 3CFIC 3Q5OA 4X80H 3S88L 5BMFH 2R39A 4WUUD 5F88B 1FZKA 3MA9L 4R26L 2D7PA 3ARUA 4PY7A 4HUVA 1ZHBB 2XACC 2CDEA 1S8DB 5F6HI 3EYSL 1QFWL 3TBYB 4EZMA 2X1OA 4DKEL 1XF3B 4JFOB 2WANA 2P5EB 2W59A 4PJDE 4KPHH 1KLUA 4CGTA 1K4DA 4F7CB 4PR5A 4UTAL 5KW9L 4LEOB 2FIRT 5CZVL 5SWQA 3BGFC 4RDQF 4PJ5A 3BJLA 1GZQA 4TVPH 3D39A 3DYOA 3U30B 3TO4D 5E6IB 2XZCH 2ZUVA 1S9XB 3B5HA 5KSAD 1ETZA 3UAJC 4HFUH 4HWZA 3T0WA 3SO3C 3G08A 4Y2DD 1BD2D 5F70A 2BXZA 4ZPVB 1UKTA 1MNUL 4CRPA 1MREH 4Z76A 3LPGA 4DKAA 4XNXL 4I0PC 1S9VA 3TV3L 3U9UB 5IJVB 1J9CT 1MFAL 4L8DA 5EZJB 1WWWX 3DETC 1OQXA 2I24N 1MFEH 4YHOL 3CH1A 2OCFD 4YFDB 1A7RL 3OR6A 5EBLA 3TEUA 5CHNB 3O45B 1XCQA 5I8OH 5EU3A 3RHWF 1YEIH 3VXRB 1LDPH 2ICEB 3MBEC 4F58H 3FFCE 4OZ4B 5I1GL 4MAUL 3V7MA 1RSFA 2C1OA 3C2SA 3UO1L 3OB0H 4OZFG 3VFRB 5H35A 3G6JA 3KS0H 4K9EL 3NPSB 2DJ4A 3BMWA 4XP1H 3D18A 35C8H 4PJ8C 1NCAL 5F1NA 4OCMC 4BH8A 4H1LH 4S1SH 3UAJD 4LSDA 5FEBA 1MHHA 15C8L 4F7TB 1T7WA 5GS1B 4Y7MA 3TT3H 2DTSA 3DX7B 3MLTA 5SWSD 4H1LB 4Y0GA 3VXPB 5L6YL 2AJXH 2BNQD 4M93B 2NXZB 3VXRE 5HYEA 1FFOB 1IT9H 1RZFL 5EORH 1SEQH 5DJXA 3MV8D 4Z7UF 3U48A 4HKZB 4QO1A 1CR9L 2HKHH 3QXAB 3P4NA 1M6OA 3WIIH 5DYOA 2X9XA 3WXVH 1U6AL 5DJ2B 4FZEH 1UCBH 1IAKB 4ZUUA 1U8NA 1DLHA 2B0SL 4R2GD 4WFHE 4DUVA 4P49A 2IAMB 1KC5L 1RUML 1EO7A 1PDKA 1CK0H 2VIRA 2CKBL 2VXSL 4GAGH 4CVUA 4X4YA 5KOVC 2BRRH 5J13B 4ISVA 5ILTL 5JW3H 4LSRL 1FVCA 1W72A 4HULB 4X8JB 1MJUL 3SCMA 3E6FB 1OCWH 4QRPA 4FQHB 4GLRH 3DRTA 3KPSA 1OY3B 2R1WB 4Q9BA 5A16A 4G8EA 3F6IA 3VGDA 3HFML 2DQEH 1QA9A 4LPVA 4F80A 1T0NB 5EOCJ 1TPXC 1HH6A 1P7QB 3BUYA 3CFKA 1G7IB 3P40A 4AEIL 5JLZA 4TSCH 3OR7A 3S34L 4ZAKC 3QO1B 3PDOA 2GYSA 4ZUVB 5BRZB 3U2SA 3WD5H 1AFVL 5BW7C 5F6IB 3G9AB 3O3DA 3BO8B 5CGTA 4YFLF 4HS3A 4KTDH 4NKDB 1NJ9A 2G75A 3NCEB 3P0YH 3QDJD 5CJOL 5JDSA 4OGXL 3RL1A 5AD0B 3OKKB 5IW1B 1DQJB 2CO6B 3V0VB 3I6LD 3GKZA 3LEXA 3ZKXC 2JB6B 1P7HL 4KV5E 4PB9H 3KYKL 3MRPB 3KLHC 2VERN 1AD0B 5E2TL 1NCCH 4ZSOE 2OLDA 4W6XB 1QFHA 5FKAB 3FOLB 3LQMA 2Z4QB 4P5KA 5IR1B 4MNQB 4YHPA 3EYOA 3S3PA 1UGNA 4KY1H 3T3PE 4CDGC 2ZP0T 3TBTA 4C83B 3MOAL 1LE5A 4RQQB 1F4HA 3B6SB 2IH1B 5FYLL 2HYMA 1O7VA 3FO1A 4J6RH 5KSBA 2OK0H 4D8PA 5GGUA 1P53A 1JPST 3D0LB 5ICZB 3PDGA 3DUUA 4J3WA 4Q0XL 3MRNA 5AAMA 5IFJB 4P23A 3HPJA 4GG6E 4ZAKD 4HG4J 4YHNA 4ZS7H 3LD8C 2FGWH 4LDOB 2E9JA 4KHTH 2BY1A 1DFBL 4UB0H 3MLYL 3V8CA 5IHZA 1RHHB 3GSNL 5GSVA 5I1AA 4MNQE 3OAYH 4UDTA 2EDOA 4P9HL 1JHKL 5D93C 2DQJL 3MRHB 5D96B 3S4SG 1YPZA 3FAWA 4MD5A 3ARVA 3OJDB 1YQVL 3JZ7A 1CXEA 2AJ3B 4HJ0C 4WIQA 4YBLB 3U79A 2VUOA 2BNRB 2Z93A 2AK1H 3NFPA 5F9OL 4ZDHB 1L9NA 2IG2H 1M1SA 1UB5B 3DGCR 3THMH 4BFIB 3OL2A 3O2WL 1CIDA 2D9CA 5DQDH 4OZGA 3X17A 3N1MC 3K80A 3H42H 1K6QH 2JIXB 1ZHKA 1NGZB 3OXSB 3PWPA 3PL6B 3IFOA 1AXTL 1CXLA 2DMCA 4FXGA 2YMXH 2YPKB 1QEWA 3IDYC 2X4QA 1T5XB 1ITBB 1JZ4A 1IARB 2ZCHH 5IHLB 4UDUA 4WFED 5D7LA 3H9SB 4X6CB 4S0SD 4JRYA 1GGCH 2KL6A 5IB1B 3HB3C 1J05A 3WHXB 3NA4A 5EH1A 4OCWH 2NY2C 4ENEC 3BP4A 4KRMB 2GJ6D 4LQ1A 4ZXBA 2H8PB 3P73B 2ERJC 4JZJB 3BE1H 1WUNT 5I18L 2DQIL 3AB0C 1G9NH 1TZGH 4NQVA 2X6MA 3VFSA 2W65A 4I48B 2CK0L 3SDXA 3L6FA 1QBLH 4NFCA 1ZVYA 4L4JA 3MOBH 1XCTB 2ORBL 3C08L 3LQAC 1YYMH 2KQMA 5JHDE 4W70A 5E24E 3GBNL 3IGAB 2LTQC 2PW2A 5HHPB 4Y19E 1JFQL 2IGFL 4POUB 4PJBF 1ZGLM 3H9SE 4X6CE 4NO0D 1NEZA 5DRNA 4NKOB 3CX2A 1KLGB 4HT1L 5E70A 5E2UH 4Q6YA 4J3VA 1JUFB 5E8OA 3QNXB 5HGDA 1RVFL 4JZNB 1NSNL 1UJ3A 3O2DA 4HF5H 3RTQC 2G2RB 3PHOA 2P49B 3DHJA 5T3ZD 4WFFE 4ONFL 4DTGL 2BSRB 3C5SB 5EOCH 3HB3D 4WW1A 3P2TA 4UUJB 4NWTL 2NY2D 4PD4J 5LQBL 3SKMB 1SM3L 5GGSY 1CFVL 2NW2B 4NQCE 4DN3H 3AY4A 1LMKA 1VHPA 3JBG7 5ALBH 3VRLF 4Q97A 1QLEL 4KKLC 5IVNA 1RI8A 4LSQL 1KEGL 2H3NB 5IW3A 1CG9B 5JZ7C 4YEEA 4WCYL 1UEMA 5A2FA 3G9VA 2A74A 2UWEF 2ADIB 4S1RH 3JWOC 1D5XA 3FB7A 2C4FT 2EO9A 5K59E 1OW0A 3VXTB 1PFCA 5F7EH 1JIBA 3MRLA 4AIXA 3RPIB 1UM6L 1S7UA 3UJIL 1WIOA 1KN2H 2EEBA 1T4KA 1MI5A 5EU6E 4ZYKA 5DMIL 3BVNA 3OX8B 5GS0L 5CSZA 4B50A 4PUBH 3LSOA 3RZCB 1FYTD 3D0VA 5FYJL 3S88H 1R3HB 1BQHG 4PJEF 1KLFA 3GJFK 5CLTA 5DRXA 5KS9A 1A4KB 1NBYB 1U8MB 3MA9H 3PGFH 5FIEA 5I15H 4HQQL 4Q7DA 3RTQD 3BH9A 5F7LB 2BVQB 4NJAL 3A6OA 3EYSH 3ARDA 4U0RC 5GGQH 4K3DL 5IMKA 3WIFA 5I1LB 3BPNB 4QOKD 2Z92B 2EDFA 1MCQA 2BY3A 1VPOL 4DKEH 5ITFA 5T1DL 3D87B 5EUKB 5JORA 4QCIA 3SDCA 5KW9H 4HUXA 2GQHA 4NO3A 1K2DB 4CVXB 3ULUC 4JFQB 3MJ9H 2EC9T 3DARA 3WLBA 4NQSA 5CEZH 3ZDYF 4EUPH 3B9AA 4J7RA 4BK5A 2H6PA 1T0MA 3GMRA 3BT2L 3LKSA 4X7EC 3O41A 3ZO0A 4HUKB 4NFBA 4AM0A 3V2AR 3FT2A 3WL9B 3MA7A 5BCAA 4EUPB 2NX5D 1A7NL 1EA9C 1LO3L 1HQ4A 3T65B 3NOIA 4FRWA 1TTUA 5CJQH 3S3JA 2XV6B 5C86A 4CDHA 1EEYA 3OF6A 1JBJA 4XNXH 4N5EC 1EUTA 4JREC 3V6OE 3TV3H 3HE6A 4WHDA 1MFAH 3HE7B 2V7HA 2P4AB 3QCVL 1JMZA 3P0GB 1GZQB 5JW4R 3RKPA 1MAJA 1UXSB 3DO7B 5DVNA 5JMOC 1A7RH 1IFHL 1X9QA 3IAGC 5DJCA 3IS0X 3U7YL 4UIMB 2COQA 4I77L 2EDJA 2VLKD 3ZE1E 4U2YA 3JV6B 3WDIA 3TVMC 5I1GH 4TNWK 4MAUH 5CEZE 4GRWB 1S9WB 2BHUA 4QRRA 2RCSL 3R0NA 4K9EH 3SBWA 1S9VB 3ULUD 4LVNC 2E9IA 3BUTA 3RWFA 2IMNA 1GSMA 3X13B 3BZEA 4GKZA 3MTRA 2WP3T 4OF6A 1WC7B 4GW4A 4GXUN 3TO2B 1TTFA 4PJ5E 1B0GA 2F54D 3OR6B 2VISB 3R4DA 2XG4A 3D39E 5HSFA 4NO5B 2Y5EA 3KPOB 5I8EA 1WBXB 1N0LA 1LO4L 5L6YH 1DVFA 2EIEA 3VWJA 1R0AH 4ZPTB 4MXQC 4XWGH 5I73B 4JKKA 1RZFH 2CIIB 4F2MB 2AV7A 3VXQA 4GRWE 3N1QC 3FAXA 1SBSL 1CR9H 3L9RA 5F1NB 1QSFB 3LQZA 2Z0BA 4BH8B 2YRZA 1IVLA 1NKOA 1S5HB 5BVPL 5L7XH 4X4XA 1JZ2A 4MA1C 2UZYB 2VLRA 2LU4A 5CZXC 1ZA3A 3L3KA 5ADPH 3T2PA 1HHHB 1JWSA 1KC5H 1MHEA 1KIPA 1RUMH 4YHLH 5KANG 5HI5C 1RUQL 3TVMD 2KDGA 3MLUH 2VXSH 3WIHA 5EUOF 2ARWA 4PV8A 3BI9X 2R23A 4RGOL 3RBSA 3LCYA 3QAZC 2ESVD 2KPNA 3OWEA 1A7PH 4HPYL 5DJXB 1VDGA 3GMPA 3G6JE 5CJ5A 2XY2A 4HBQA 1M6OB 3HFMH 3T4YA 1R5WA 2J8UF 3LEVL 5DLML 3NCCB 5E03A 1MCRA 1NMBH 4AEIH 1T2XA 3S34H 1HKLL 3QIUC 4O2FB 2F53A 1AFVH 2YA2A 4ZXBC 4U1SA 4MXQD 3NIDF 3MRMB 1GOGA 1W0VB 3E2HC 4DGYH 3SQBA 3DNKA 5I75B 4O58L 2FB4L 4OGXH 5H94B 3SCMB 1SYVA 2IBBA 3REVA 3KPSB 5C0BD 2IH3B 5A16B 4OAWA 2DDQL 3FB5B 4HC1A 5EN2A 3AROA 4LBEA 1Q8MA 5CZXD 1J8KA 3CFKB 1QFWI 3NTCL 2WLZA 3RUGA 4XZUA 3OR7B 4BELD 5HI5D 4IDJL 3PDOB 1KIQB 3UTTA 1GL4B 3U2SB 1Z9LA 3N9GL 3MRCB 1F58H 1JTOA 4LU5L 4AH2B 3MOAH 1MJJA 2A9MH 2G75B 3MUZ1 3HI5L 4JY5L 4UQ2A 3QDGD 5CSBA 1LK3L 2ZJSL 5FYLH 3WDJA 3IJYA 2R69L 2ZPKL 2A6KB 2VDLL 5HDBE 1V3LA 3ROLB 3F7VA 3O6FA 4GW1B 2GK0B 4QRPE 1FFPB 3KPSE 5DHYA 3CSPA 2PTUA 4OI9A 5JO5A 1TVDA 3QIUD 3ARZA 4M6OH 1OSZA 3CU1A 3KDMA 4P5KB 4ZXBD 3WSQL 1IAMA 4EDXA 4NKQB 2FLRT 4YHPB 3OKEB 1DFBH 3EYOB 4M5YL 4K71C 1XGPA 2JB5L 1LE5B 4LSUH 3KPRA 1ACZA 2Y23A 4P9HH 5K33A 2DQJH 1FO0A 3LKOB 5KSBB 1S78C 4TQEL 1YQVH 3G04A 5GGUB 3P4MB 1BJMA 1H0DA 3BW9A 3GIVA 2GTZA 1FCCA 1H15B 3DUUB 2NY6B 3MRNB 4RFNC 4B7IA 5B8CA 5F9OH 4P23B 3HPJB 1X5GA 5BS0A 4LLQA 2NY7H 4MMZC 4YHNB 4K7FA 3NZ8B 4M43L 1I1CA 4L8BB 1OP3K 5IKCA 3PP3H 2WIIA 4JFFB 4DJMA 5GSVB 5F89A 2C3WA 4X9BA 5D1XC 4YHMH 5FCUL 5I8KL 3SDDC 2OR8A 4LHQB 1UENA 2FSEA 3WJLA 2BOCA 5DTFB 4KAQL 2D9QB 3EFDL 1AXTH 3ARDC 5DURD 5B38A 4N8VG 5KSBE 3D1MC 2Z93B 4TULL 2GITA 1B4RA 2PO6A 2I9TB 3NBNA 1M7IA 3TBVA 1D6EA 3NIFF 3DV4A 2NW3B 3RFZC 1ZSDA 4LCWA 3V52L 1YJDC 3AUVA 4L5FH 5J1AB 3WUZA 1AXSA 4RMRA 5I1EL 3T0EA 2DQIH 4AT6A 1S78D 2OYPA 3WFBH 1CTNA 5C7XL 2CK0H 4L3CB 2DMKA 1JK8A 3RL2A 4FXGB 4OFDA 1YPZE 4PJXB 4DVRL 3HI1B 1F6AA 2X4QB 1BZ7A 3O9WC 2ORBH 3LKRA 3C08H 4UDUB 5TDNB 3A67L 4JRYB 2GCYB 1HINL 3ARWA 2VDOL 3GB7B 4HK3N 1IQWL 1JFQH 5EFIA 3IFNL 4NBYB 3H8NA 3HE6C 2AXFA 4HT1H 4K7PX 5D1XD 2AABL 3LN5A 1MWAH 2FWOA 1N59A 3Q1SH 4U1GB 1T66C 3SDDD 1RVFH 5DWUL 1X5XA 4PJ9D 1RK1A 1NSNH 3IT8D 1EMTH 3OKDB 3WNPA 3SDXB 2NR6C 3D69B 2VLJB 2R8SL 1TDQA 4OSUH 2BXYA 2OR7A 1W0WA 1MWAB 5I19L 4DTGH 4ONFH 3PWPE 1MVFA 4AG4L 3UTPD 3VDBA 3T0DA 3L95A 4NGHL 3WUWB 3T04D 5BJTA 2WWMC 3HNSL 1SM3H 2PYEB 5D7LE 3ROOB 4JRYE 1FVDA 1QLEH 3MRBB 3NFNB 4LSQH 3BYTA 3WFHB 5J89A 1KEGH 4KTEL 4IS6A 3O0RL 4L4VD 1JNNL 1A6UH 1TVHB 2HH0H 2C5DC 5GJTL 2GI7A 3OKOA 3O8XD 4XVUC 2X1WL 1FL5B 5JA8B 4G7VL 1DL7H 4P4KC 3O9WD 3OV6A 5C6WH 3SDXE 1I7ZB 2VLJE 3VWKA 4OFYD 4PJIB 3UJIH 1UM6H 3BZ4A 3ZE0E 6CGTA 2XT1B 4X6BB 5DMIH 5GS0H 1S9KC 5ISZA 1PW3A 4GSDL 3OKLB 2BSTA 1LILA 5DHVA 5C71A 1YNLL 5I74C 5FYJH 3EJJX 2EYRB 1UM5L 1T66D 4MS8C 4CVWA 4E41D 4DKDC 3RY6A 2BSED 4HQQH 1TCRA 2A74B 3V5DA 2NR6D 1TLKA 2HJFB 2R2EB 1I1YB 4AMKH 4N0FB 2I25N 4XBEH 1LEGB 2IQAA 5IEHB 1C5DA 3ARBB 4EI6A 3GNMH 5DMKB 2WWMD 4QRRD 4PJIE 1GGBL 5D7SL 2OJEB 1KCKA 5CSZB 1MVUA 5IG7A 3LSOB 4XRCB 3ULVD 2ZNXA 4K7PH 1VENA 5DR5L 3CDGB 1H3TA 1PG7X 3HMWH 2XXMB 4XVUD 2QQQA 4OQ1A 3FO9B 3BH9B 4H8WL 5HYJA 1C12B 4P4KD 2WINB 2J6EL 1IC7L 4QRTA 1YNKL 1SJXA 1BVKA 3L7EA 4QXGL 3VGHA 3P3YA 2CR3A 5ITFB 1A7NH 1LO3H 3QUMA 4R4FL 1S7RB 2ZG2A 4YBHA 1MI5E 3SDCB 4M4RA 3VXUD 5DRZB 5EZIL 4BSVB 4WI5A 4LP4A 4ERSL 4UT6L 4YDVA 2X4PB 3X3GL 1EEZA 3QCVH 5EIIA 4PBVC 1XF2B 1CDJA 4F15B 3BJ91 3GSVA 4DFHA 2EC9U 5KS9E 4LLMB 1IFHH 3B5GA 3MYJA 1DEEA 3FT2B 3QT2A 4ZOEA 5FM5O 3U7YH 2DBJA 4I77H 4Z7OE 2X41A 2P7TA 5K9QI 2DQDL 1JWMA 3KPNB 5L8LB 4KXZI 5DUPL 4HX1B 5JUEH 1LWRA 3GSXB 5ECJE 2RCSH 1MFCL 1P7KB 5ANMA 2D03H 4YUEL 2W9DH 1AE6H 3DMMB 4IIQA 1CGTA 3MRFA 3F6LA 3C8DA 2MKWA 3H6JA 1HNFA 3U7AA 5E5MB 3CFJA 3N85L 3QWOA 4AYFA 4EQ3A 1L7TL 3L3DB 1BOGB 4PGBB 5DJCB 5K9OA 4P3DB 4CUCA 4LKXB 3O6KL 4KJPC 1LO4H 1CD8A 3GMNA 4MXVE 3TYFB 3HUJB 5E7BA 4YEFA 2D2OA 5JW4N 2JKXA 1DANU 1XF5B 1AC0A 1OSPH 4XGZA 5LWYL 1SBSH 2DLEA 3MV01 3RWFB 1N2RA 2D4FA 4NN6B 1IGJA 1G6RA 4OLYL 3SKOA 5BVPH 5L88L 4YDLC 2ZSWB 3EW3B 2OZ4L 4J8RB 5MI0B 4QHUB 1IKNA 3N1PC 1CFTA 3VXMB 3LOWA 3FO2A 2P5ED 5I8EB 3GI8L 2YXMA 4I3SH 1DP0A 1DVFB 3AS3A 3VWJB 5I1KH 1BLNB 3TT1L 3RNQA 1Q94A 4HWBL 4TUKL 3UTQA 5TF0A 3WJLC 3LV3B 2FX8L 2VH5H 2DI7A 3MLXL 5C0EA 2WZPD 5FHBL 1N5YL 3GGWA 1PY4A 5L9DL 2PO6C 5CP7A 3LEVH 4WI6A 5DLMH 5KAQF 4TVPD 5CIPH 3MR9A 1NGQH 1ZA3B 3L3KB 4KJPD 5DRWB 1HKLH 2ADJB 4M93C 4PG2A 1KIPB 1MHEB 2NXZC 3GBMH 1KCRL 4PJ7F 4F7PA 2F19L 1NCBH 4M8QB 3KPRD 3VXME 5CIPB 2X4UA 4P46C 1SEBB 4L4TB 4K23H 1HOCA 3CNKA 4HGWB 4FNLH 4P2OC 5IVXB 2PXYA 2FB4H 5FV2A 4U1JB 1DN2A 4LCIL 5IF0B 4HJJL 4JG1H 5DGQA 1I7TA 5F8QC 1NFIB 2D0FA 3T1FB 1JGLL 1NKRA 1YN7B 4JO4L 2DDQH 5JW5A 5ACZB 4R90L 4X0KA 4PLOB 5DJ6A 5C09D 2IAMC 5I0DA 5HHXL 2PYFB 4DQOH 3BEVA 4X98A 2VLRE 4OB5H 3M1BB 4JM4H 3U46A 3VXSA 4U1SB 3NZHH 3N9GH 1YC7A 4LU5H 3RKDC 3QI9A 5J1SC 5EULV 2R2BA 3GO1L 4DKFL 5BZWB 1Y18B 5A2JH 4RWYL 2R69H 2ZPKH 2XRAL 5IW6B 5IVXE 2DJUA 2EIZA 1QQDB 5CEXB 4W6YB 5EN2B 2BDNH 3FB8B 3O3BB 4LBEB 3S5LB 3QFDB 1I1FA 1HXMA 4PYGA 2E6JA 2NXZD 3NABL 5HYSG 4NCC1 1D9KA 3WSQH 3UTTB 2M8XA 1Z3GL 1LK2B 1XGQB 4P46D 2QBWA 1NCTA 2YN3A 4LKCA 2F53E 2XQYK 4P2OD 1MJJB 1KNOA 4ELMF 4JZOA 4XC3L 4UQ2B 5C07A 1FL6B 3D3VB 3K8MA 3Q6FA 4IOSD 4I4WA 1TENA 1TMCB 5K9KA 3QCUL 4TQEH 4OZFH 2Y06L 5AEAA 1C16A 1VEMA 1AH1A 5BVJB 2YD2A 3RWCA 2IAMD 4KGJA 5JHLL 3MSPA 2LE9A 1JL8A 1K8DB 1B3JA 1VERA 3IDJA 1IC4L 2XA8L 4M43H 3RUGE 3MRGB 3LKNA 1MLCB 3RKDD 3HA0A 4BZYA 3UTTE 1XGPB 4ZUSA 4NKMB 1BFTA 2XWBA 3C6LB 1A6ZA 3RY6C 1BGXL 4M8VA 5FCUH 5I8KH 3TESA 4OF3A 4TSBL 2P43B 3ES6A 4LF3B 1CDHA 1SQ2N 2HVKA 3EFDH 1H0DB 3DUHA 5J56B 4KROB 2GTZB 1HHJA 3ZKMC 2F8VA 4O5LL 5E2VL 43CAA 5FOBB 4TULH 5JPNB 5FYKE 5BRZD 5B8CB 2JCCA 4NC2B 5HGAB 4NZRL 1F3JA 3N1GC 3T77A 1VACA 1F4AA 4Y4KA 1MCBA 5IKCB 2H32A 5JXAH 3PG2A 3TYGH 2YPVL 1OAKH 1XR9A 5DS8A 5I1EH 1RD6A 2V5TA 3TN0A 4NRYA 1UZ8A 4D0DB 4TOYL 1XZ0B 2NY5L 2VXUH 1ZLWH 3FT4A 3TIEA 1A1MB 1EHNA 1WF5A 3QDMB 2GITB 2RBLA 4GFTB 5BZDB 3MX0A 3JTSB 4NUGL 4QHMA 3VFVA 3A67H 4ZTOL 1HINH 4YPJA 2QQNL 2VO5A 1BEYL 2R4RL 3VXNA 5BS0E 2VXTH 3FONB 4TUJB 3IFNH 2Z8VC 2VAAB 2N1KA 5I1DB 1AXSB 3ZTJH 5EOTB 5IBTH 2OTUA 3T0EB 4DUXA 3BPOB 4G42B 2CKBA 3PL6C 3SGJC 5IEKA 1J1OH 1DLFL 5KVGH 2VDNL 2K9UA 2R8SH 1HNGA 1JK8B 1MJ7L 4PJGA 3ZKMD 3DHMA 2UWEA 3A0OA 5F9AC 5C0JB 3WLWC 3EOAB 3D9AH 3LKRB 5F9WB 1BQSA 4NGHH 3BRGC 5FFLA 1J0KA 3HNSH 1JZ3A 2AJZB 5I17B 4Z7WF 3FN3A 4JQVC 1OAUH 3D85B 3TA3B 3QJHA 3QQNA 3RGVA 3W0WA 4KTEH 4LCWE 3QEGL 3O11B 1HYRC 1KB5H 2BNRD 3GSWB 1G7JB 3T0EE 4PGDA 43C9B 1DBJL 1I3VA 1G9NC 1OWWA 1T1WB 4UV4L 1W0WB 3DVFA 1JHTA 4U6YB 1KB5B 3EUUA 2QKIA 4GQ9L 4MQTB 1R24A 1BZ9A 1I4FA 3CX5K 1H3PL 3TBSA 3Q3GA 5K9JL 4GSDH 5DJ0A 2FEEI 2EH8L 1RZIB 1YNLH 2KUTA 3WO4B 2NY4B 3MROB 2W92A 4WWKB 1NAMA 3AREA 2AXJA 1KGCE 3PL6D 3PWVA 4K8RH 3GI9L 4LPYA 3VJ6B 5L2KD 3N0PB 1S7SA 2E5EA 2OR9L 3QZWA 1YC8A 3WLWD 1I75A 3F7YB 4U4BA 5GRJL 1H8OA 8CGTA 1BAFH 1GGBH 2BFVH 5F96L 1SVZA 3I3DA 5ISZB 1WAAF 4LLDA 4Z7QE 1F5WA 4M61B 3QG7L 1I1AA 2BSTB 1HQRB 4D9LL 3W39B 5DR5H 5F7YC 1BWMA 4CN4A 2Y7QA 4EKXA 3V5DB 3GSNA 2CLVA 2WQ8A 5DJZA 5T1KA 2J6EH 4YZFF 3P9MA 2EXYC 1XGTA 4X99B 4PG2C 1I9RL 2CMRL 1C5DB 4OBRA 5D8JL 1IJ9A 1BIIA 4XXCA 4F3FB 2G60L 2P8MB 3NACH 1GC1L 3TP4A 4R4FH 2QTEA 3BWAB 3RZCC 1UQSB 1MVUB 5D6CA 4LVHB 5EZIH 4XCCL 2XQYG