3U2SA

Crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
236
structure length
225
Chain Sequence
b'ERLVESGGGVVQPGSSLRLSCAASGFDFSRQGMHWVRQAPGQGLEWVAFIKYDGSEKYHADSVWGRLSISRDNSKDTLYLQMNSLRVEDTATYFCVREAGGPDYRNGYNDFYDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG9 heavy chain
publication title Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 225
sequence length 236
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u2sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u2sA01
3FAXA 4LKXA 3HC0B 1IQDB 2OJZL 4OUUB 4PB0H 4GQ9L 5M94B 3W5MA 2I9TB 2IBBA 1A6UL 1ADQA 3PJSB 3S96B 4FZ8L 3BMVA 3E6HB 3LPGA 2CLVA 4MX7B 5DK0A 2DI8A 3EJZC 4YXKH 3RVUD 1JZ2A 1N5YH 1S7QB 1TPXC 3QIUB 4LRNL 2PYEA 4PYHA 5DEFB 5JORA 2VWEC 4RBPH 1GYAA 1YC7A 4K71C 5K9OA 3BVNB 3QIUD 4DEPB 1S8DB 3S36X 3RDTC 3SDXB 3VRLE 1C12A 4OGXH 5D7IA 2X4RA 3MROA 5KSUA 3OKOB 5I8CB 4Z7UE 3OAUL 4JQVA 2CUIA 3ZKQD 2AP2A 2D03H 3IFLL 1UKSA 1FV1B 1XFPA 1KN2L 4JGMA 5DMKB 2YD8A 5TGBB 1GHFH 1J1OH 1EHAA 1FNEA 4NQCD 5J12C 4Z77A 3ZT6A 3PGFL 5HYEA 3TPUB 4LLMA 2EE9A 1MJJB 4WUKH 3WO3B 4RFOL 5I17A 5EOQL 4OF8A 1UM5L 3BGFB 4KXZH 5HI3D 1AQDB 1SYSB 4NP4H 4MJIB 1UQSA 3IS1X 2CLZB 4NZTL 4OZFH 5C09B 1T0PB 5C9JA 3T77B 5BOPA 1N64H 3G04A 1QNZL 4G6KH 2L7UA 4JN2B 4LLVB 4MJID 1QFPA 2X4QA 5C09D 4EDXA 3RAJH 1I8MB 3C9NB 2V7NB 2A0LC 3DGCR 5HXMA 5IWLA 2QSCH 2XN9E 1WSST 1I9RH 5E2UH 4PRDB 4UT7L 5IVXE 2OK0L 2B4CH 3K46A 2BSSA 2EYRA 5AG8A 1A9BB 1KENH 1IQWH 4OCLC 3TBTB 1NGZB 1AXTL 3VFSB 3ELAT 5ESVA 4YXLL 3BKYH 1XF3B 3V79C 5HDBF 3U6RA 1T3FA 3ZDXF 2NY3C 3ME0A 1X6NA 4KZEL 2E6QA 3GJEB 2EC9U 1ND0A 2VISA 4M61A 4MQ7A 4ORGB 2IAMD 1R5WA 1FNGB 1D3CA 3RY6C 5CP3H 5KN5B 4J3UA 4QY8B 4QTHB 2IJ0C 1CT8B 2D7NA 2ZCLL 2DD8H 3LKNA 3CAFA 3MRFA 2YBRB 4G8FB 1MCOH 5TQ0L 5FYKE 4PJFF 4PRBA 2Q3AA 4MA7H 1SY6H 4MXWH 3V6FA 1IRAY 3VGAC 3WFCH 2PW1A 1BFVH 3TNNB 5ISZA 4FTVA 4Z0XB 3S3SA 2DQFA 4GUPA 1H0DB 5GRJH 3MOQA 2FCBA 1GGBH 3E2HB 4JR9H 4MS8D 3VXME 4XZUB 1N0XH 3WBDA 4NT6B 2J88H 2BNRA 3PL6B 4K3EL 3VW3L 3OGOE 3SE8H 5D4QA 4JHZA 4E5XA 4U1SB 5TPWL 4G42B 3JTSA 5HVGB 2JELL 3PL6D 3VE0A 1YYLL 3W5NA 4M6ML 3I3EA 4LCWA 4K9EC 2DQGL 3SDCC 3SCMA 4PV9B 4WUUB 5CP7B 3O3BB 5HY9B 1FBIL 2PCPA 1LEGA 1AKJA 1EH9A 1JPGA 3GSVA 3C2AL 1I3RB 2ADIB 4M7LH 1TETH 1KEGL 1WCQA 3H3BC 4WUUD 4KJWC 1G7LA 1U0QA 2RIKA 5FUCC 5E2TH 3RU8L 2GAZB 5LCVL 3SKNB 1S9YA 2OP4L 3T0DA 1N2RA 4GRWB 2FB4H 4Z76B 3UC0H 3HMXA 3IDMB 4R0LB 5AWNH 5GS1C 1LK3L 1P2CB 2DQCL 4I48A 3IAGC 3MRIB 2DWDA 5KTEL 3KPPB 4IMKC 1HHJA 5L6YH 1VFBB 3FN3A 4JPWH 5F7KC 2O5YH 3U30C 5C0ND 4MSWB 4Y1AE 4PBWD 2N7BA 4MVBD 2EDBA 5LQBH 5E94A 3U7YL 3S88H 4LVNB 3HR6A 2FWOA 4JFHE 3C5ZB 2A83B 3HB3D 1MCPL 2YSSA 2E9WA 2D0FA 2CDGA 2ILLA 2E9JA 4JY5H 3C5ZD 1BOGA 4JM4H 3JWOH 4TVPL 5DRZB 5IQ9B 3QG7H 1AO7B 4QHLB 4UUJB 5DI8A 4KTEH 4I3SH 3OL2A 1XCTB 2XWTA 2EDYA 3MZGB 1AO7D 4PGEB 5T3ZL 3TA3D 1CDUA 3L95A 1FO0L 5JW5B 4P5KB 5DTFB 1O7SA 1P4IL 1FRGL 2C4FU 4R26H 3Q2CA 1CYGA 1P7HL 2CK0H 3UTQB 5CGYC 2BJMH 2FBJL 3HNSH 4CDHA 1NCDL 5CJOH 1YNTB 1ZGLB 3D3VE 3MLVH 1ZTXL 4XTRC 4PGCB 5C0BD 1RJLB 2DTMH 3QXDA 2EDKA 1HOCB 4X6FA 1HI6A 5KANG 3RJQB 3O6KH 3H8NA 3BSZH 1JK8A 3S3JA 3QEQE 4WU7B 4OCSL 5F1NA 1RSFA 4F37K 1NFIA 5L8JB 2IPTH 1AP2B 1I8KA 1NCWL 5DJXA 3QP3A 1IAII 1U8NB 5H37G 2VXQL 4R8WH 4L8DA 1NLDH 2MJWA 4G9DB 3RWGA 1J0KA 4KKCC 5DJ8A 4JM2A 5I73C 1VGKA 2BDNH 5JHDE 4PJDF 1I4FA 4UIMB 5DQDL 4P9HL 1MVFA 3P4OB 3VMOA 5CIPB 3SOBL 4WCYL 2DQJH 4H5SA 4LMQE 5F9WB 1A4JA 3OAZK 5IJVB 5CFHA 4CW1A 1JYNA 1DDHA 4APQA 4XGZB 2VWEE 2Z8RA 3WJLA 4P5MB 5EIVA 4LHUA 4POUB 3ECBB 3U48A 4LHUG 1ZLVH 1TTGA 3C60C 3LEYL 1E27B 2ADGA 3BPNB 4JAMB 5AUMA 2B1HH 4PJAA 5T1LA 1M7DB 1PLGH 4JZOA 1YUHB 5L0QC 2VLKA 4RX4D 2NY2B 2E27H 3LKQB 2W0KA 4P2QB 1W0VA 5IHUL 5DQJA 4D9LH 2ENYA 4R9HA 3FZUC 4HH9B 4JRXA 5EO0B 4PJGA 1ZV5A 3ALXA 5FGSA 1D5XA 3BIBX 1CD9B 4POZD 5I74B 3OX8B 4PJ7A 3V95A 4C4KT 3MRPA 1NDMB 3SDDA 5ALCH 5DF0A 3QXTA 4XVJH 3ARFC 4N9GA 3MLWH 2ZOLA 4YBLC 2VLRB 3M07A 3NIGE 4ODUA 4YX2H 3ILPB 5ANME 3MV7D 3GIVA 2NX5A 1T1YB 2X1WL 3UP1A 3VGBA 3E0GA 4CADB 2AABL 2CSPA 2PO6C 2VLRD 1L0QA 3DX9B 3J8F7 3V5HB 4MLSA 5DHXB 4MJ5A 4Z5RB 3CVHB 2NY0C 2V17L 2X2YA 3Q1SL 2OJZH 4WEBL 1I1AC 3U0WH 4YDVB 3I6KA 4GQ9H 4LHJB 3QHFH 2Q86A 2W9LA 3PQYD 4U3XA 4Z7VE 1A6UH 2B20A 4FZ8H 1RJYB 2APTA 3LPFA 4P23C 1KIRA 5E4EC 4LRNH 4JKMA 1RD6A 4UQ3B 2EYSB 35C8L 1B9ZA 3WNKA 2HJKB 1NCTA 3SDXF 5F88A 3MNZB 4Y5XB 4FQQB 4PJEE 2RCSL 5MENB 4JJHA 3S5LB 3T0EB 2CDFA 1FHGA 3OAUH 1LP9B 1R5VA 3DUUA 3RWHA 2E7LC 2MNUA 1UCBH 4CRPA 1RMFL 3IFLH 5MEND 3T0ED 1KN2H 7CGTA 4LVHC 4X4ZA 3L5XL 1IMHC 2A73A 2GI7A 3PGFH 4L29A 2X41A 3GSUB 4RFOH 5EOQH 2HYMA 3ZTNL 5GGTL 1B4JL 3IXAA 5F3BB 1UM5H 3IJHB 3KPQB 1ZLWK 4K55A 1XH3A 5D8JL 3KPNB 2Y06L 3MCKA 4U1KA 5MI0C 1HQ4B 3VI3E 5ERWA 5D1QC 1CZ8L 3FQTB 3SE9H 4NZTH 5C0AB 3ARWA 3ZHLA 2HFTA 1N0LA 2GKIA 5DRWB 1MI5A 1QNZH 4HKBA 1OGTA 3K4DA 5DJDA 5C07A 4YHML 4RAUB 5C3TA 4QHNB 1BVLB 5C0AD 4MNGA 4L4VB 1PY4A 3RVVC 2AW2A 4LBEA 4Z7WF 5FUCE 1RZKL 2W65A 4UT7H 3LSOA 3QIWC 1CD0A 1JUFB 4HEPG 4QRPB 1JIBA 1C08A 2OK0H 4HCRL 4PRNB 4K2UL 1L9NA 4XMLL 3T3PE 3U0TB 4F9PC 4WI5A 1W0WA 3P9LA 1M05A 1BJ1J 1MCWW 1AXTH 4OD2B 4OJFL 3UZVB 4YXLH 2OZ4A 4N5EC 4QRPD 2IBGA 4M6OL 2H32H 1DE4A 1YPZB 2BMKB 3B3IA 4P3DB 4XI5D 5JLZB 2FZ3A 1GPOH 3DIFA 3O2VL 2ARJA 5F9AC 4KJPD 4KZEH 4J3WA 4PLKD 4L8BB 1FQ9C 2D31B 4HIHB 3VMPA 2ZCLH 2B5IC 3WKNA 4M1CD 4HPOL 5TQ0H 3PHSA 4ZFZB 1ORSB 3F7VA 4JQIL 2ZP0T 1F6LL 1N59A 1WTLA 2R0KL 2LTQB 5DC9B 1GOFA 1JWSA 3RIFF 2I9LA 2VXUH 4JE4B 3CFCL 4K3EH 2ADJB 3F6LA 3VW3H 4LSQL 5IBLD 3FO2B 2Z93B 1B6DA 4IJ3C 1CN4A 3IFOA 4MD4B 5TPWH 1JZ6A 3OBAA 5L2KD 1YYLH 5C0DA 3BEWA 5TDPA 2OI9C 1Q9KA 2EXYC 4M6MH 1U6AL 4ZXBC 2DQGH 2HVJA 2GW5A 3P9WB 3OG6B 4X4ME 4EQ3A 1BVKA 1FBIH 1V7ML 3X3FL 3PWJA 3C2AH 3CU1A 4A6YB 1TCMA 3DVGB 1KEGH 4F7MA 3M17B 3RU8H 3TYFA 5I76B 5LCVH 4LVEA 5I0DA 4X0KB 5JW3L 3MYJA 1NBYB 3DHMA 2UWEE 4GRWF 2K9UA 43CAA 2G2RA 5A40E 1HHHA 4YGVA 1NDGA 1A1MA 2OQJB 5DUML 2DQCH 5KTEH 1AE6L 5IB5B 5EU6A 3RTQB 5CHNA 4BQ6A 4C4KO 4NQEB 4WO4B 5CD3A 3HI5L 5E8OB 3JWDC 3U7YH 1PQZB 2WUBL 4KGLA 4Y5YB 1I8IB 2DMKA 5DO2D 3RTQD 2AAVA 1T5XA 2IH1A 4NQED 3QI9D 4WO4D 1MCPH 1DFBL 3X11A 5CLWA 3CFDA 3D0VB 3QUYD 3TBYA 2AEIT 3ALPA 3AM8C 3FQRA 2C3XA 3FFCB 4JHWL 4NM8L 3VXSA 4NQVA 4TYUA 4TVPH 4WHCA 1EX0A 1D5MB 2WP3T 1U3ZA 3O3EB 1UH3A 5EORL 1MJUL 4NQXB 1ZVYA 1JGEA 4WFEE 4F33B 2CGRL 2EC8A 3EYVA 5CEZD 1BD2E 5T3ZH 4GS7B 4PR5B 4JFDE 1FO0H 3ARBA 4QHUA 4XWOC 2UY6A 3KAAA 1FRGH 3KWWA 1P84J 1QSEE 4LLWB 2UUDH 4Z6AT 2XWJB 3LV3A 4Y2DA 4PGDB 5D2LA 2FBJH 2M8XA 2CKBB 2QBWA 4WTZA 4WTZG 5I8EB 1NCDH 2Z92A 3PHOA 4Q0XL 5F7FA 4J8RA 1ZTXH 4CVUA 3VWJA 2ATKA 2RHEA 5FHAL 1UB6B 3OKLB 1BVZA 4PJDA 4GRLA 3CZJA 4PLJC 1FL3A 4ZG1A 3QDJD 1K5NB 1EJ6A 4OCSH 5I1DB 1JPFA 3BP7B 3MGTA 1C5CL 5FOBA 1MUJB 2D0GA 3HE6A 4J4PA 1NCWH 4RMUA 1EO7A 4OV5B 1ADQL 4JVUA 1E0OB 2VXQH 3LQMA 4ZNEA 2VXVL 2QHRL 4J3VA 2EE2A 1JPTL 3B9EA 3FO9B 1CF8H 1ZSDA 3OB0H 4W68A 3WEXB 1DBAL 3MRQB 1NEZA 4BZ2L 1S7RB 1GGIL 1NEZG 5BO1L 3T09A 1FE8L 1I1FB 4P9HH 5DQDH 3CLEL 2BVPB 3FO0H 3EOBB 4OIBA 3SOBH 4OKVA 5FF6B 3K4ZA 3PWUB 4WCYH 1LEKA 5J1TC 5DJ2A 1CBVL 3KDMA 3MV9E 1A3LL 3MRCA 5IKCA 3W2DL 5EA0L 3WNLA 3X14B 3MRRB 1H8NA 2NXYD 5GZOC 1BQHB 3LEYH 4M8QB 3VXTA 1F4XL 1WBYA 4XXDA 4HJGB 1X4YA 3MJGX 3MNVA 4Q2ZB 4N90E 2D9QB 5L8LB 5IHUH 3WN5A 1H5BA 4N8VB 3Q48A 2EXWD 2YD5A 3BN9D 4WV1A 3KHQA 2VQ1A 3K8KA 3VFOB 5K9JL 1YJDC 4G9FB 2VSDA 1OP3H 2XTJB 1T0NA 2PYFB 4Y4KC 3WJJA 5KZCB 2H45A 1KV3A 4LDLB 1XIWA 5EN2A 4ZUTA 3WIHL 2PN5A 4FRWA 3H9ZA 3EO0A 3D85A 5CILL 4BKLB 1TNNA 4Z78A 3H9HB 2DLEA 3IFPB 2XTJD 3HRZB 4R96B 4MCYA 1Z0NA 3S96A 2B1AL 2YS4A 2OTUA 3ARUA 5DJ6A 1QLFA 1YYML 2ID5A 4D3CL 3QO1A 4TN9A 1S7QA 2VITB 1NJ9A 2F54A 1CCZA 3X12A 4U1GB 3G08B 1FZMB 4KUCD 1JGDA 2AABH 2ZUUA 3LQAL 4HS8L 4X5XB 5IQ7L 1ZLSL 4HK0A 3BVNA 2V17H 3Q1SH 4WEBH 1YY8A 5CS7A 1S8DA 2GJZA 3KPRB 4PJHE 3SDXA 5LAXA 3VFRA 3Q5OA 3O8XC 2F19L 4RDQF 1QLEL 2FYYA 2P47B 3KPLA 4XH2B 3VXUB 1U8HB 3O6FB 3KPRD 1I9IL 3VGDA 4DGIL 4KK5C 5HHOE 3NIFF 3VFMB 3L5WB 3PP3H 1XMWA 4HGWA 1JGVL 35C8H 1CGWA 3H7BA 4I3GA 4LARH 4PG2A 1NCNA 1LE9B 3JTTA 1TTUA 5E8EB 3TIDA 3TJHC 4LSPL 1OAZL 1D9KC 3LCYA 4U7KA 2R2EA 4LKCB 2RCSH 1QQDB 3VD9A 3FQWA 2OS7A 4JPVL 3BW9A 1BF2A 4L5FL 1R3LA 2FRGP 1NMBL 1LP9F 4DOHB 3A67L 1AQDA 4WTWA 5EC1B 4UV7L 5DVMA 4PGJA 1RMFH 4N8PA 2CLZA 3ULVC 1EV2E 4YHZL 2FD6L 3CSGA 1CL7L 3L5XH 3NA4A 3TFKC 1KB5B 1QVOA 4PJBB 4JN2A 4BK5A 1T7VA 2ZUWA 1TCRB 4E9LA 4AYFA 1A1OB 3QXUA 3ZTNH 4X6DB 1IFHH 5GGTH 1B4JH 1KJ2A 5JOPD 3AU1B 1A6AB 2ORBL 4Z7WA 1PVHA 2IANB 5D8JH 4PREA 2Y06H 4PRDA 2E6PA 3B9KC 4XCEA 4XNMA 5IMLB 3DMMC 3SCMC 3D25B 3BHBB 1CZ8H 2GQHA 3SGJA 5ICYB 3MUGA 2IADA 2IAND 5KS9E 4HIIB 1XF3A 1KTLB 5JOEA 4YHMH 3PXJA 2WP3O 4RGOL 3SDYH 3GMQB 4WVRA 3MA7B 4OF3A 4EVNB 3LB6C 4DAGL 3L3DA 4QXGL 4BH7A 4P2RB 1RPQA 1RZKH 4AENB 1MCBA 1UJ3C 3MFGB 2F74B 4HUMB 5KN5A 2HP4A 4HCRH 4QTHA 2VO5A 1J0YA 4QY8A 2P5EB 4K2UH 1L6ZA 4NRYB 4OI9A 4XMLH 4N0RA 5HYJB 4G8FA 4P2RD 4L4TA 4OJFH 3BJLA 4M6OH 3TNNA 3BIKA 3CZFB 4YK4C 1YPZF 4MNQE 5I66A 4WRLA 2EH7L 2BXYA 3O2VH 3BO8B 4UTAL 3QQ4A 4LNRB 1RZ7L 2VRAA 4JPIB 3K8LA 4ZFGL 5F7UA 4U1SA 1DQML 4Z7OE 2P44B 3SE4A 3B2VL 1OVZA 1WIPA 2X4PB 1Z0MA 4HPOH 1NCUA 3FFDA 1RZJL 1KXTB 1KF9B 1QOKA 2VSCA 5HY9A 5IFHL 2R0KH 4MQXC 5BV7C 1KPUB 1A3RL 2XKNA 2AGJL 2H1PH 1EGJL 3R1GH 4LSQH 5EC2A 3U9PL 1AXSB 2ARWA 3G6JE 3BQUA 3W11D 3KXFA 3JV5A 2GITA 4X80L 1F11A 1BAFL 1S7WA 3NCJL 3NTCL 4PRHA 3CGTA 1U6AH 3C08L 1RIHH 4R0LA 4ZOAA 3VFNB 1FSKB 1S7XB 5IB2B 1V7MH 3EBAA 3X3FH 4LIQE 4BUGA 5JZ7D 4JDZA 4WI9A 3H9SE 1A4KB 2YK1L 2A74B 3G5YA 4TTDD 1EIBA 5DD6B 2P24B 5C71A 2BCKB 5HHPB 2IMMA 3EIFA 1MSPA 5CUSL 5E9DB 5C9KA 5FO9B 5I75B 1WJ3A 1BGXL 1IZJA 3HZMB 4KK6D 3AVEA 3L1OL 3EOYG 1YEIL 1H3WM 1F2QA 5E9DD 1IEBA 1F2XK 1I9EA 4BQBA 4NPYB 2Z31C 5DUMH 5J8OA 1AE6H 4JM2C 2GTZB 4XPBL 4KDTA 4K7PX 1R3HA 4QHLA 2CMRL 4P5TB 3EO1B 3VFTB 3HI5H 4HUKB 2VN4A 3FONA 2Z4QB 1P4LA 2WUBH 3EFDL 3RZCC 2YN5A 1LE5A 5DFWH 1W0YT 1EJOL 4P5TD 1GXEA 1DFBH 5JW5A 3U9UA 5GSVB 5SV4A 5SV3A 4I13B 3HN3A 1XGPB 4XPAL 4KRNA 4NM8H 5ESAA 4JHWH 2PYEE 4ERSL 5IHZB 3IETB 4OZFB 5JXEA 5A2JH 2QADB 3WJLC 2CLRA 5IGXL 1JMZA 1YNTA 4JFFB 5EORH 1MJUH 1NUNB 4QXWA 1MAKA 1OW0A 1ZGLA 2CGRH 4PGCA 2VXSL 4XC1L 3RIFK 4LU5L 1VEPA 1FFOA 2Q20A 5D7IE 3G6AB 2NNAB 5EU3A 3OKEA 4PS4H 1I1CA 3IKCA 5KOMC 5FM5M 4FXKB 3IF1B 2PKDA 4NUJB 3GMPB 5IFAH 5HTSA 2RBLA 4V2CB 5ACZB 3O3UN 3WLWD 3T4AB 4F15B 2VKWA 3SDDC 4ZPVB 4CMMA 1ZAGA 1UA6L 3EUUA 4DZ8A 4ELME 1U58A 3WFDL 2WNGA 4Q0XH 4R4NC 2I24N 5I6XC 4KJYA 4GG6A 4HS6A 5FHAH 3FB6B 1YECL 1CGYA 5D6DA 4HW6A 5EBLA 5BS0A 3UTTA 4EOWL 1HHKB 4XPFL 3B6SA 1OAXL 1TJHL 3SJVA 5CIPA 4RFNB 1C5CH 1D5BB 4M9OA 3O2WL 5DMYA 1KTRL 5E2VH 4HG4J 2EH8L 4XRCB 1CICA 4JRYA 2WM0A 3VXNA 2GT9B 2F9BT 1ADQH 3OXRA 5IFJB 5CEYB 2VXVH 2QHRH 1QFWI 1JPTH 4E41B 1AGCA 4OI8A 4MQTB 3ECBA 4CBPA 4XAKE 3QG6B 4F8TA 4BZ2H 4DCQB 1GGIH 2HMID 5BO1H 1FE8H 2HTKD 3AB0C 3HAEA 3CLEH 4J23A 4E41D 1M7DA 2VDLL 2Z8SA 1UXSA 3HAEG 1YUHA 2ICEB 3N1GC 5B38B 3RGVC 5CJXA 2V2TB 4ORZC 4O00A 1BX2B 2JTDA 1CBVH 4R3SB 3EYQD 3MLSL 4ONGL 1A3LH 5EA0H 3RWFA 5H94A 4X6EB 5ADOL 2UZXB 3IYLW 2XN9D 4OLUL 4WFFD 4P2OB 2BSED 3WIIL 2VZVA 4WI7A 5DWUL 2A6IA 1E4WL 4ZTOL 4J12A 1ZGLP 5D9SB 4P4KC 4P2OD 2C1OB 1FGNL 4AIXA 1XGQA 4YFLF 5ISZE 4CADA 5K9JH 2XZZA 3V5HA 3ULVE 4O9HL 2N1KA 4LFHD 4GKZB 4NIKB 4XHJD 2PW2B 5A43C 4X4YA 3MLTA 4YDVA 1AXIB 1EPFA 4LCYA 2BNRE 3QCVL 4UOW0 3WIHH 1D5IL 4M48H 4ZPTA 3D6GA 3PGCA 3EZJB 3NFNB 5CILH 2JK5B 3MBEB 4YLQT 4FQXD 3DBXA 2XZAL 1KYOJ 2B1AH 3VFWB 1YYMH 4OM0L 5DJZB 1EZVY 4D3CH 1CGUA 5KSAC 3HE7B 3MBED 1FAKT 5FYKD 3HPLB 1UG9A 4FMKA 3FT2A 3KJ4C 3FB7B 1QR1B 4UQ3A 1DUZA 4RQQB 1J8KA 3LQAH 4A2MA 2P7TA 3W39B 1ZLSH 5IQ7H 1MFEL 2UZIH 3HE7D 2XZCL 3ZKMD 3VXMD 4OF5A 2F5BL 4KWUA 2D7PA 2F19H 4QNPE 3ZSTA 4X8JA 3LD8C 1BOYA 1ETZA 4NC1C 1U93B 1J1XL 1UXWA 5F7EL 3QIBA 2OTWA 5EIIB 1I9IH 4TRPL 4DGIH 3IJSB 1VB9A 3GI9L 1UEMA 1CFQB 2GSIB 4YDKL 5D7JA 1TTFA 1MH5B 1ZVHA 4FQCL 2AI0L 4P0DA 1XEDA 3QNZB 5FK9A 4HDIB 3AREB 1TMCB 3GSUA 2I07A 4LSPH 1OAZH 1Q94A 4F80A 1CDYA 2WQRA 1IGFL 4JPVH 5GRYA 2PXYA 3GBML 3HPJB 3HR5B 4N0YL 3I2CL 1NMBH 3A67H 1G7JA 4UV7H 1Q0YL 3FQTA 3D18A 1U95A 3IDIA 4YHZH 3GDBA 3G5ZB 4I9WD 1KG0B 3OR6A 2FD6H 1HSAB 1CL7H 3HTLX 4P57B 4H8WL 3ULUF 4AH2B 3B9VA 3ILQC 4U1HA 5INCB 4Y1AD 1H3UA 4L4VA 3GJFH 3CLFL 3VD7A 4X6DF 4OCMC 4HUVB 4JFHD 3STLA 5J13B 3SKJL 3G5XB 3LN4B 1NBZB 3RNQB 5F9OL 4X7SL 4PRNA 5H35B 4K9EL 1DQQA 1U8MB 3AGVA 3NAAL 1P9MA 1CQYA 3WFEL 2PTVA 2NYYC 2R0ZH 3IT8D 5EOCL 1EVUA 4RGOH 5HGDB 3V8CA 4KRPB 2KL6A 4ZSOA 2M1KA 4OTXL 3UTOA 1YQ2A 1MCEA 4OQ1A 5DJ0A 4DAGH 3WFBL 1TJIL 1LD9B 4D0CA 4QXGH 4JZNB 5EBMB 4KRPD 4LOUD 4NKOB 1FVCB 1JZ5A 1RJZB 4HUUB 4K3HA 5DC4B 3W0WA 4ZFZA 4PJXB 3D87B 4DUWA 2C3VA 5BXFB 3ARDC 3UJTL 1TQCC 4TNWF 1AR1D 4JFEA 2C4XA 4KVCL 2EH7H 3QEQB 4KQ4L 4UTAH 1T7XA 5D7LE 3O41B 1RZ7H 4HD9A 1OTSC 3P77B 2R69L 1YEFL 1DLFL 1DQMH 3QEQD 3B2VH 1RZFL 1FFNB 4CU8A 1NFKA 2Q76B 1Q9OB 5F9JB 3U4EB 1WC7A 1RZJH 3VH8B 5HDQL 3QUZB 4ZO8A 5D1XB 1NANH 5I19L 4IRSA 5IFHH 1TENA 3QNXB 4MDIA 4A6YA 3AFLA 1A3RH 4OFIA 3KYKL 3T2PA 1EGJH 3TO4A 1W72A 3U9PH 5JHDD 5B8CA 4PJAE 4X0KA 3QDGA 1JF6A 1NBYA 4BSWB 4X80H 1T0MB 1BAFH 3NCJH 3NTCH 1F58L 5BW7C 3MGAA 4YC2B 4YDLB 4KROC 3C08H 3V6ZA 2BSRB 3K2UL 4JRXE 1CE1L 3LY6A 3T1WA 4PTUA 4FXLA 2R23B 5IB5A 4JG1L 2HJLA 4RGNC 4GRLC 1K2DB 1ES0B 2FR4A 1M7IB 4Y5YA 3K3QA 3TBVB 5T1MB 5CUSH 1R0AL 2XA8L 4BELD 1BIIA 3O3DA 1BGXH 2G75B 1QRNA 3HE6C 5DYOB 4J4PC 4NCC1 4UMGA 1HZHL 3L1OH 4G8GA 4QYOB 3MRMA 1YEIH 1EEUA 3FFCA 1MRDL 3O9WA 5HDOA 2F8XC 4GLRI 4JFOB 1P7KA 1R3IL 2DQTL 1G7MB 2X89A 4XPBH 3TH3T 4NJAL 5DXWA 3O3EA 2EEAA 4EI5A 2R56H 3RVWC 4O5LL 1QP1A 3VXQB 4JO3L 3V6BR 2GUOB 3EFDH 1N7ML 3VXPB 2P8LB 4LQ1A 4Z95L 1XGRB 4ALAL 4ELKB 2K7PA 1EJOH 4ZQKB 2C5DC 5DD3H 1JRHI 4PP1C 3PV6A 1XF4A 4XPAH 5EZJB 4ERSH 1P1ZB 4ZS6C 2W1NA 1DP0A 3LKRB 2XWJA 1RULL 4P4RB 4Z7VB 1JN6B 5IGXH 4I0PA 1KCRL 2FH6A 3P73B 4IHOA 5I8EA 5IEKA 2YWYA 4MHHG 4MA1B 4XC1H 1DCLA 4LU5H 2ITCA 12E8H 4PRIA 4BFIA 3NCCB 4Y19A 2A0LD 3TJEL 1Q9WB 1K5NA 3WN5C 2ICWI 4WV1C 4K8RL 1MUJA 2OSLB 4FQJL 3KPSA 2LU3A 1R3JA 4IIQA 2ZG3A 1I7UB 2IALB 3CMGA 3LVEA 1UA6H 4PJEB 1T5WA 3WFDH 1ACZA 4PD4K 4ENEC 5HGHB 4ZODA 1F6AB 3CFEB 1F3JA 4Q97A 1YECH 2NY3D 1MNUL 5J6GB 5IHBA 1HNFA 1I1FA 4EOWH 3MPCA 3QIUC 1OAXH 3MUZ1 4BSVB 1TJHH 2DBJA 3R8QA 3PWUA 3O2WH 2EH8H 4OF7A 2DOCA 3DURA 1KIUA 1MI5E 1PD6A 4N0UB 1X7QA 4HFWB 5HDBE 4WNQB 4HK3J 3ZDXE 3VRJB 4XBPA 3DV4A 1HDMA 5F9DC 5E0QA 2AK4B 1F4HA 5E6IB 3JUZA 4LMQI 1BQHA 1BQHG 3SQBA 1I9JL 2VLJB 1BP3B 1F42A 3HC4L 4BFEA 2AK4D 3EGSB 4N9OB 3GM0A 2VDLH 4NC1E 4F7PB 1R6VA 2ERJB 4PJFE 4RMSA 4M4PA 3F12B 3QA3A 5EZLB 4QHKI 4G9FA 4I1NB 5HI3C 4JKLA 1HHGA 3EO9H 3VCLA 2YMXL 2FJHB 5ADOH 1U8OB 5BRZB 2B2XL 3DYOA 3BGFC 5BMFH 2KPNA 1DANT 4OLUH 4BKLA 1P7QA 4F9LC 3RY4A 3WIIH 5DWUH 5FYJL 4NNPL 3IFPA 3HRZA 1E4WH 5TJWK 5D7SL 4ZTOH 5BRZD 1PY9A 3HMWL 1S5HA 3JVGC 1DEEB 5GS1B 2YXFA 1PG7L 2VITA 1AD0B 3RKDC 3U36A 3UYPA 4OLXL 4QOKE 1INDL 4H20L 4O9HH 2X9WA 1QEWB 1MJ7L 3HZKA 4CNIA 1P69B 2E3VA 3QCVH 1B2WL 2J6EA 3GUTB 2VQTA 4NCDA 4RNRB 3VXUA 4JFYA 2EYTB 2YUWA 4LSDA 1ZLUH 3RNKB 4OM0H 2FATL 1HQRB 4LK4A 5I15L 3L5WA 4XXCA 4J3XA 1MCWM 5CLTA 1MFEH 2XZCH 2QQNL 4LEXL 3SO5A 5IMKA 2F5BH 2VDRL 4Q6IA 3HI1B 4LKCA 1QQDA 1J1XH 1GRWA 5F7NC 5F7EH 2IGFL 5EUOB 2X4TB 1FO0B 4TRPH 3O0RL 3WHXA 1WZMA 2A1WL 4O2FA 4MZ3A 3U2SB 3BH9A 1KUMA 5EBWB 1T1ZB 3GI9H 1BZ9A 3RI5F 1FIEA 3VD5A 3E2HC 5T1KA 4YDKH 3QT2A 2X4OB 3AY4A 1S7SB 2AI0H 3FB5A 4FQCH 5I1IL 1U36A 3PL6C 5F3HB 3P3YA 3HCVB 4X7TA 1SVZA 3WCYA 3SE4C 3SY0A 1CFVL 3L3JB 2A6JB 1F8TL 1YY9C 4X6BA 4YHIB 1IGFH 3BUYA 5FM5O 3GBMH 4JDTL 2O93L 4N0YH 3AAZA 3I2CH 3T8XA 4AEEA 2F53E 1AR2A 1Q0YH 3RX8A 4Y16A 3VXSE 5DVLA 5ICYA 4QHMB 3SKUD 4H8WH 2VL4A 1HNGA 2GEEA 2IF7A 4M5YL 3MA7A 1B0GB 2DYPB 4EVNA 3CLFH 1U3HB 4KKCD 4HX1B 4C59B 3GBNL 3JBG7 4AENA 1Z9SA 3I6LD 4UT9L 4X7SH 2DYPD 1NEUA 4R0LC 5ITBL 3UPAA 3MUJA 3NAAH 3BP4A 1KPRB 1DQJB 1JGUL 5FO7A 3GGWB 2DQDL 2EDXA 3FT4A 3WFEH 3CSYB 3NCYS 4WWKB 3BT2H 3F7PC 5EOCH 5DK3A 3NIDF 1M71B 4F2MB 4LVNC 3AS1A 2LABA 4JFDB 4OTXH 4WFED 1V3JA 3C5ZC 4HHAB 3WFBH 1TJIH 4S0SD 4RGNE 4WWKD 3ARSA 5C0CB 4JPIA 4PJDE 4FFWD 1AGBB 4XBGA 4JFDD 3C60D 1DBJL 5FDYA 1NKRA 3T65A 2BHUA 3QEUA 3D69B 1QSED 2IQ9L 1FZOA 3MO1B 4PJXF 2KQNA 4NRXA 3B9AA 1YQVL 3FZUD 3JWDL 4KVCH 1X44A 4JZJA 2V7HB 4JG0L 3BISA 3S34L 1Q9LB 3Q6GL 1ZHKB 4NFBA 2XI9A 3ZO0A 5KG9B 5ETUA 4LASL 1VEMA 2W59A 2R69H 1YEFH 5CKGA 1RZFH 1AIFA 2H26B 5DHYA 5CGMA 4K07A 5HDQH 5I19H 1E4XI 2NY0B 3T4YA 3VFNA 5IB2A 3BZEB 3FO1A 1IGTB 4G6FD 3GMNA 1BPVA 3WE6A 3REVB 4H0HB 1A4KA 3KYKH 5T3XL 2KDGA 2NY0D 4X98B 2P24A 3KLAB 1LO5B 5C0EA 2BVOB 3MV9B 1F58H 4LLYA 2FJGB 3V52L 2LQRA 1H8OA 4EUPH 1DN0B 4NPYA 4IMLA 3K2UH 3C6SB 1CE1H 2MCPL 1GOHA 3MV9D 1HH6B 2VR4A 2GTZA 4JG1H 5JUEL 5F6IC 4PJIA 3QPXH 2EO9A 1B88A 1QLRB 2BVQA 2Z4QA 2OMNA 4NO5B 3QWRA 4PGBA 5J1SC 1KT2B 4NOFA 2XA8H 1R0AH 4XNQB 4W6WB 3CNKA 5JPNA 3WS3B 3LS5L 5E6YA 1HZHH 3RL2B 4N90D 1XGPA 4KKBD 1UWGL 2F54E 4RMTA 5INDA 4ETQA 5IHZA 1MRDH 4DGYL 3L9RA 4Y4FA 3O11B 5DJYA 5BQ7A 4OZFA 3NFSL 3OAYK 4V1DA 1R3IH 2ZG2A 4OZFG 4Z7QF 4LSRH 2DQTH 4M7ZB 3PXHA 2EDHA 4NJAH 4JANB 4TNWK 1MY7A 1ZWIA 4O5LH 5FUZL 5TDNB 2NCMA 3SDXE 1JI1A 4GKNB 3BPNC 4JO3H 1N7MH 1K4CB 3WUWA 2NNAA 4Z95H 4ALAH 3WUWG 2NY2C 4POZC 1P6FA 5D2NB 1RZ8A 4NO0A 1TVHB 4ODVL 3IF1A 1MHCB 4NHUB 4PJ8A 1CD1B 4PG9B 3F5WB 4JDVA 4KRMB 5ACZA 5JQ6L 3A6BL 1UM6L 5I74C 3PABA 4XCNB 4YPJA 4XP5L 1RULH 1RUQL 4IOIB 2ZJSL 1KCRH 3OKKB 4EN3B 4DVBA 5IOPB 9CGTA 1WIUA 2R29L 2N4IA 3G5VA 4LSUL 3TH2T 4LPXA 2NW2A 3C5SB 1YEEH 3I9GL 2XIDA 3MRGB 4ZUUB 2AK1L 4WFGD 3QXVA 4NZJA 3TCLB 3TJEH 5HHOB 1YNKL 4TUOB 1FJ1A 3RVVD 3FQNB 3PIQA 1RZIA 1HHKA 4WEUD 1RVFL 4PY8J 1JF5A 4YNYB 5FYKU 4K8RH 3QIWD 4M7JL 2OX5A 1JZ8A 5HHOD 4FQJH 1KACB 2HVKB 4GBXA 1I8LA 2AERT 1XGUB 4NYLB 1SY6A 2GT9A 1EUTA 5K59F 1T2JA 3P11L 3OR7B 3RWIA 2XV6B 3N85L 4JO4L 4X7EC 4YDIL 4H1LH 3VXRB 5HYSA 2DTSA 5HYSG 4RBPK 1LQSR 4Z7WE 1PKOA 5FCUL 1MNUH 3ETBF 5LGHL 2DDQL 3VXRD 1FNHA 2Y72A 4CAGA 3RPIA 5EO9B 5CBAA 2CK2A 4C55A 1BZ7B 5GRUL 4C83A 5I2IB 3ARPA 5JNYA 3BIAX 3TPKA 2VJXA 1NLBL 4IRJA 2DI9A 1BLNB 3UPRB 1WBXB 3VI4F 4Y5XC 4U0RB 2FL5A 1PZUB 3B5GA 4YR6B 1OY3B 1FCCA 3T0EC 3CX5J 2I60L 4I4WA 5EU7C 3HC4H 2D7QA 5LWYL 1BEYH 3M1BB 3BPLB 4TVSa 4NDMB 1ED3A 4Q9QL 1UFUA 1J87A 4L4TE 3MR9B 3BKJL 4QO1A 1Y18B 4F7EB 4NZRH 1QUNA 1F4AA 5HHNB 2QQKL 1SYVB 4L9DA 4OZIB 2UYLB 2PW2A 2AJSL 1T04B 2FO4A 2YMXH 4U6XB 1KNOB 2B2XH 1CG9A 2FX7H 5DDHA 4PP2B 1MCDA 1YMMA 3LKSA 4JO2L 4NNPH 4QF1B 5FYJH 3RL1B 5C6PB 1A6PA 5DMIH 3HMWH 3ISWA 4MNQB 2MMXA 5D71L 4MD5A 1NAKL 1PG7H 5ID1B 4GW1A 1L4IA 4NSKA 3FB7A 3QFDA 4MWFB 2C1PB 4NNXA 4OLXH 1INDH 3NPSB 4H20H 4DGVL 3W39A 4MNQD 1MJ7H 4YFDB 1F5WA 1TNMA 1B2WH 1VFMA 1WWAX 1QHPA 3MRLB 2CRZA 1YN7B 5TE6L 3VWKA 3IU3A 2ITDA 5IB1A 3FRPA 3N1FC 4GRWE 1P9MC 3FRPG 1DVFB 1CQKA 2FATH 2V2XB 4PRHE 4G6ML 1OTTC 4KJPC 4QT5A 3IJSA 4PLKC 5I15H 5EO1B 3V2AR 5K33A 3IB4A 1DVFD 4K3DL 3B5HA 2GSIA 2W9DL 3TNMB 4HAGA 1G6RL 2QQNH 1Y6MR 4HDIA 4M1CC 4LEXH 3QXAB 3AREA 4D8PA 3ARGA 2VDRH 1J05B 2AKRB 3CSPA 1T1WB 1NSNL 3QB7C 4S1QL 2IGFH 2YD4A 5EUOF 3HR5A 3O0RH 2A1WH 3JV4B 4HKJB 2AV7B 3H9SB 2BP3A 2LTQC 4XWOD 2JE8A 5K9KB 1PAMA 1UZ8B 5I1IH 1AO7E 3PV7A 3H9SD 4Z18A 2G9HA 3ZHKA 5I16A 1CFVH 1U8PA 4TULL 1F8TH 4D0BB 1RJCA 4JDTH 1NBZA 3QH3B 4YHNA 5C8JB 3JUYA 4PLOB 2WBKA 4OIIL 4G80A 5HGDA 4XVSL 3RA7L 3TO4C 4M5YH 2B0SL 5DK0B 5F89A 3TGXA 1OD9A 3M8OH 1R3KA 1SBBA 2PYEB 3GBNH 2EECA 4HG4K 1PYWA 4UT9H 5JORB 1FVCA 2APVA 4M03A 1NMAL 1A6TA 2QL1A 4HZLA 1RJZA 2PYED 4LLDB 3VA2C 1JGUH 1C12B 2DQDH 3RTQC 1X4XA 1JNHA 2WLYA 4WO4C 2X4RB 5KSUB 2L7JA 3GSOA 4Y5YC 5ESQB 1K8DA 1E6OL 2ZOKA 1N6QL 5GZOD 4IDJL 2R1YA 3P77A 5BS0E 1DBJH 1X5JA 4HBQA 1SJEA 4ZD3L 3O9WC 1T6WA 2H2PC 3U4EA 4KK8D 3ZT7A 4U3HA 1BWMA 2IQ9H 2ZUVA 4EIGB 1MIML 2M2DA 2VH5H 2YD1A 1AGFB 3QUZA 5D1XA 1MQ8A 5I17B 4S1RL 5F6HI 1P6AB 3T0AA 3RI5K 3TT1L 4AQ1B 3DSFL 5HDLA 3SKOA 2NXZB 4JG0H 3S34H 3Q6GH 3SGKA 4N1EA 3PNWA 4GS7C 1MFCL 4G5ZH 3OPZL 2MKLC 4I3RL 4LASH 5DVKA 1W2KT 5C0GA 1NPUA 2NXZD 3G04B 4X6CB 2AJYL 1QFHA 2YRZA 4P2QE 4XMPL 4HIEA 5CBEA 1QZ1A 4CN4A 4LCIL 5C0BA 4QEGA 5J56B 5EU5B 1UCTA 3T3MF 1R5IB 1IAKA 4LPWA 3MJ6A 3MNWA 4LLQA 1KYOK 1A7OL 5T3XH 2BSSB 2EYRB 2LVCA 1ES0A 3U7AA 5ESVB 3LKOA 1VA9A 4ZAKB 2VLRE 2G75A 4TSCL 5DURD 1G9MH 3U6RB 3V52H 4O2CA 4KK5D 3UPCA 3HA0A 2MCPH 3O3AB 2VISB 4M61B 4MQ7B 1R5WB 3RX7A 4NZUL 5JUEH 5K9QG 1YEJL 4L9LA 1ACYL 3LKNB 3MRFB 3KPTA 2VDNL 3L7EA 3VXPA 4PRBB 3TJHD 3V6FB 2PW1B 5ISZB 4FTVB 1ZLVK 1EDQA 1U8IB 4PIRF 2DQFB 4GUPB 4ZQKA 3KPOA 1W8NA 1UWGH 3NIFE 4DGYH 1MCJA 3UZQA 3TBSA 2BNRB 4X9HA 3NFSH 2J8OA 5ISZD 3DJ9A 3LKRA 5FUOL 2V6HA 5LBSH 2AJVL 2JB6A 4P4RA 4HKZB 4YIQB 1TFHA 4BK4A 5BVPL 2YD2A 2BY1A 5FUZH 3TFKD 3JTSB 3CSBA 2EXWC 2BNRD 3VE0B 2HT2D 3BZFA 3V6OC 4LCWB 5MENE 2KKQA 1WIOA 1Q9WA 2PCPB 4ODVH 1LEGB 1AKJB 2BSTA 1KIPB 3GSVB 5I1GL 1LP9E 5EU7E 4KQ3L 3EFFA 4ZO9A 1MCLA 5HI5D 2OSLA 3DMMD 5DS8A 3SCMD 5JQ6H 3A6BH 1UM6H 2XTJC 4XP5H 1AKJD 1RUQH 1S9YB 2ZJSH 4X9FA 2H32A 1N2RB 4LSUH 2R29H 3MA9L 1EXUB 1L6XA 1Z9LA 4FQIL 1F6AA 5CZKA 5FYLL 2AK1H 2D4DA 5J6GA 1YNKH 5E8PB 2VDKL 4I48B 2PUQT 2DWDB 1RVFH 2Q6WB 4U1GC 4M7JH 3QUXA 5C0AE 5E94B 3L3HB 1KCKA 2FWOB 3P11H 2IEPA 2BNQB 3N85H 4YDIH 4JY6A 2YSSB 2BNUA 3K4AA 3L5IA 4HIJA 2VERN 4L4VE 3O6FC 5ADPL 2CDGB 3QWQB 3S36L 3DOSA 3KPMB 1G1YA 5FCUH 2OR8A 3BGAA 3BOVA 3GMMB 2ESVA 2DDQH 3B8YA 4QRPE 3ZT5A 1CLCA 2EE6A 2FECL 3STZA 5IJKA 1KFAL 5DI8B 5GRUH 3WV0A 2BVUA 4PJCA 1NLBH 2KQMA 3G9AB 2XWTB 1YPZE 1MFAL 3T0BA 1S78D 3OMZA 2NY1B 5FHBL 4PUBL 4HWEL 4U1LA 1NGWA 4P99A 4YH6A 3X3GH 2I60H 3DVFA 2VDOL 2EIZA 3ARYA 1JNLL 5LWYH 1RUAL 4ESKA 1S9XA 4Q9QH 3W0WE 3BKJH 4L8SA 1AD0A 3ULUC 1L7IL 3NZ8A 3QXDB 2NQCA 1HI6B 5BVJA 2QQKH 2Z0BA 1JK8B 4OZIF 1SBSH 2AJSH 3FHQA 1NCBL 2DS4A 1OF2A 3TV3L 3DRQB 1CGTA 4UU9A 4LP4A 1A21A 1A8JH 3C8KA 3GUTA 4RNRA 4JO2H 1I8KB 1N6UA 4HJ0D 1IC5L 3RNKA 5D71H 4ZS7L 4L8DB 2CIKA 1NAKH 2CXKA 3PWLB 1HQRA 1IARB 2R15A 3RWGB 5L2JA 5E5RB 1ZA6B 5DJ8B 3OJVC 4JM2B 4CJ1A 3P4NA 1VGKB 4XP1H 1NGYA 5E8NA 4DGVH 1I4FB 3V8OA 1G0DA 3K8MA 1NC2A 3I84A 2G60L 2W07A 4JM2D 3LN5A 4DZBA 2DLTA 5SWZA 4K7PY 4H5SB 5J9PB 4XC3L 4LCUA 5TE6H 1A4JB 1G9NC 2W38A 2CH8A 4QLRA 2A2QT 4CW1B 5FFLA 3RZCD 2NZIA 5EUOA 4FP8L 4O58L 1DDHB 1ZS8B 4BH8B 3HKFA 4G6MH 4APQB 2DL2A 5AG9A 2WSKA 1LDPH 2AQ3A 4YBHA 2GYSA 5EBWA 4LHUB 2DKMA 3QXWA 2W0LA 4K3DH 2ADGB 1HSBB 4PJAB 5T1LB 1G6RH 4NQEE 5F44A 4JZOB 4LHUD 5FV2A 2VLKB 4OZGF 1ZHBA 4FHBD 5L88L 1W0VB 5DQJB 5I1JL 3L3JA 1NSNH 4Z0BL 5F7LB 1OAQH 3TO2A 5T1LD 4S1QH 1F45A 4WW2A 1CE6A 1QRNE 5CZVL 4PJGB 2VLKD 3FOMA 2E7CA 3L3IA 4PJ7B 3MRPB 3FFCE 1IM9B 1HWHB 3MV8A 3K1DA 3SDDB 1NFDF 4QHMA 3TP4A 4JRXD 4OFYA 4JZJC 4N9GB 3KG5A 4YPGA 1Z9OA 2ZOLB 4G43A 3SDDD 3GSXA 4LF3B 4ODUB 5L2KA 3MODL 2YEZA 2ICCA 1U3HA 4GKSA 4TULH 3GIVB 2NX5B 1JNJA 1WZ1L 5JZ7C 3EZ8A 3OGCA 3FRUB 1FSKC 2JB5L 3RX5A 2FGWL 1KPRA 2NX5D 1DQJA 2VNCA 1IT9L 3I6KB 2FLBT 1EEZA 2Q86B 4CDGC 4OIIH 5SX4H 1FCGA 2XYCA 1G7PA 2A6KA 1D7FA 5GGRY 3ESUF 2ZCHL 3KYNB 4QKXB 1J86A 4XVSH 3RA7H 3QEHA 5MEOA 2B0SH 1RZGA 1KIRB 1YEGL 2HWZL 2KZWA 5E24E 4PRIE 4UOW1 5C0CA 4Y19E 5K93A 2JLLA 5T5NG 3RVTC 3MTRA 4DKFL 2VN7A 5JPMA 3H3KA 4D9QE 5KANI 5ILTL 5KAQF 5F88B 5JXAL 4P5TC 1EAPA 1A7QH 4MXQC 4FQHB 4Q74A 1R5VB 3DUUB 5ICXB 3RWHB 3QI9A 3N1QC 1E6OH 2OCFD 3QUYA 4IDJH 3FMGL 4MAYA 5KG9A 1KLFA 1UH4A 5F7DA 2EIEA 4ZD3H 2A73B 2HG5A 2QADC 1MIMH 1CXHA 1JNNL 4WFHD 3DX7A 2WZPD 4DK3A 2UUDK 3DSFH 1XH3B 4W6XB 5GHWL 3MCKB 4U1KB 4JVPA 2YPLA 5GGUA 5ERWB 1MFCH 1E28B 3WLWC 4I3RH 3UAJC 3T04D 1LO5A 1IGML 1OAYL 2B4CC 2FSEB 4JKKA 3V6OE 2AXJA 1XGYL 1ZHNB 1OGTB 5C07B 4X6CF 2AJYH 5DJDB 1I7RA 2BVOA 5D96B 2D7TL 4MNGB 4XMPH 4F15C 1T4KA 2RB8A 3IS0X 2QR0A 1MI5D 3BKML 4LCIH 4FG6C 5C07D 4G9FE 3K7UA 2EDEA 3EYUH 3FCTA 1HE7A 2Q7YA 2W65B 2XTJE 1KJVB 1A7OH 4HQQH 1C08B 1OAUH 1FN4A 1QLRA 1SEQL 4YHYB 1MLCB 1W0WB 3P9LB 4NO3B 1M05B 4QGYA 2NY4B 3OB0K 1KT2A 3D48R 4RFNC 4QXUL 3OKMA 3P9MA 5F21B 2BVTA 5EOCJ 1DE4B 3B3IB 4KZDL 2FZ3B 4HWBA 3DIFB 3WFHA 1JYVA 2ARJB 1T20A 2GJ6A 4M93B 2HMIC 3B9DA 3AXLA 2HTKC 5D7KD 2RFXA 4NZUH 1YEJH 5D1ZA 2JJWA 1ACYH 2VDNH 5HHMB 4OUOA 4N0CC 3EYQC 2EDOA 3VXUE 1GL4B 3FN0L 5GGTA 2N56A 2VC2L 5JW4Q 3F7VB 1TVHA 2EICA 4NWTL 1N59B 4YFEA 3UDWA 1JWSB 4Q9RL 2HRLA 4KH2A 3F5WA 2ED8A 1KTKE 3RFZC 2I9LB 3GK8L 2VLLB 3IDNA 1QHOA 4S11A 3BDXA 1EFXA 5CJQL 3IFOB 5BVPH 1A6WL 5A1AA 3QZWA 1IZKA 2R0LL 4P2OC 3QZWG 5FAAA 3T0XA 3ILQD 2DJSA 3U82B 1OP3K 1UVQA 3GFUA 3C5SA 5TDPB 4ZFFB 1Q9KB 5C0DB 3QPQD 1MRCL 3MRGA 3FTGB 2HVJB 1G7IB 1EHLL 3TCLA 1HHIA 3WXWL 4TUOA 1BVKB 4KRLB 5I1GH 1BJ8A 4WHDA 3RQ3A 2LV4A 4KQ3H 4DOHE 1OSPH 4F7MB 2HVKA 5KVGL 4U6HA 5JOPE 2EEDA 4QNPF 2YUZA 3ULUE 3OR7A 3MYJB 2EDWA 3MBEC 4NO2B 4YO0A 4LAQL 2CXGA 3MA9H 1CXLA 2Y07L 5JDSB 4FQIH 4X7DC 4X6DE 2G2RB 5GGRA 5FYLH 5DEGA 2VR9A 1NDGB 1MRFL 2VDKH 1ZANL 1G0YR 3HE7C 1KCSL 1HYSD 2CUHA 5EU6B 5EO9A 1V3MA 3RRQA 5CHNB 1BZ7A 2WIIA 1TQCB 4H26B 5CD3B 1RK1A 2J8UF 1A22B 4IDLA 5EU6D 1T5XB 2IH1B 1M1SA 2H6PA 3X11B 2Y25A 3BUTA 3C8DA 3CFDB 3TBYB 5ADPH 3S36H 3FQRB 4LCCB 3VXSB 1T66D 3MSPA 4NQVB 1OTSD 1GAFL 1WTGT 2P5EE 2F53D 1HIMH 5HYJE 1KFAH 4NDMA 3VXSD 4UNTA 1JGEB 5SX5H 5IW1A 1MF2L 1Y18A 2YN3A 3EYVB 3AREC 1CD8A 1MFAH 1CDJA 3TZVA 2DM7A 5FHBH 2J7LA 1RAMA 4PUBH 4HWEH 3ARBB 4J3SA 1S7TA 4MAUL 2VDOH 1SQ2N 1JNLH 2JJTC 3LV3B 4Y2DB 4QCIB 3ARBD 5D2LB 4H25B 1RUAH 1IAIL 2Z92B 5B39B 4B0MM 3PHOB 4U6VL 2C4FT 5ID1A 5IB3A 1KIQA 3VWJB 5HVWA 2ATKB 1A7BA 4Y2DD 1L7IH 4MWFA 3H42L 2FEDC 4GAFB 5C1MB 1JFQL 1P4BL 4XCCL 1FL3B 4HS3A 5D5MB 3VWJD 1NCBH 4LAJH 1JPFB 3TV3H 5J13C 3MOBL 4RGND 5FOBB 4GRLD 4HLZH 1BFSA 1YN7A 1LO2L 3L3OA 1T83A 3VG0L 1JE6A 2V2XA 4HUWA 4ZS7H 4Y4HA 3EDJA 3HE6D 4J4PD 4IS6B 1ZSDB 3PG2A 4KRPC 1SJXA 4LSTL 1X5HA 5C70A 1NEZB 4PTTB 2FIKA 1XR8A 5CSGA 2G60H 1WFTA 4OZGA 4P2YA 3TVMA 1J05A 3SGDI 2AKRA 1KLGB 3RVWD 1LEKB 4H0GA 4S10A 4XC3H 4DUXA 5DJ2B 5E9DE 1WUNT 3N06B 3CDGA 5BJTA 3KDMB 3WDHA 4FP8H 4O58H 8FABA 1RK0A 3MRCB 5IKCB 3ET9F 3P0VL 1ORQB 4PP1D 1NFDA 2EO1A 4HFUL 5ALBL 2C7UA 3VXTB 2F8VA 1WBYB 4XXDB 4RMWA 4KJQC 1HXYB 3P0YH 1GZQA 1FP5A 3MNVB 5L88H 5DVNA 1H5BB 1IJ9A 4Z0BH 5FCSH 4MJ2A 2VQ1B 5CZVH 4AL8L 4PJGF 1P5VA 3V0WL 3QUZC 5D1XC 4PJ7F 4WJ5A 1RY7B 1T0NB 3T2NL 4ZUTB 1XIWB 3PP4L 5EN2B 3VJ6B 3D85B 3EO0B 4Z78B 1MIEH 3SGKC 4HAFA 1VFAB 1GC1L 4JFFE 4MCYB 4K8RD 1CGVA 2OTUB 1F3RB 1XR9A 5DJ6B 1QLFB 1VPOL 4B53A 3BD5A 3D85D 3QO1B 3MODH 3W82A 4ENED 1NJ9B 1PKQA 2F54B 3X12B 2QSQA 5TF0A 4QRRA 1WZ1H 1JGDB 3TM6A 2VAJA 2DL9A 4YC2C 4YDLC 5HI4C 2DAVA 4HK0B 4CU6A 3NA9L 1J0HA 15C8L 2JB5H 2F54D 2FGWH 4JFPA 1V05A 1YY8B 3VFRB 2GJZB 4LLDA 1IT9H 5LAXB 5KAQG 4JO1L 3GKZA 1J0ZA 2FYYB 1DUYA 3KPLB 1DLHA 2ATPA 3QQ9D 2ZCHH 2P48B 4HZAA 1QPPA 3TWCL 4YGAB 4MA8L 3D2UB 1YEGH 5ESQA 2HWZH 1JTOA 1WEJL 1ZT7A 3O4LA 1QBBA 3D39B 1V8HA 3ZTJH 1WQVT 4HGWB 4DKFH 3H7BB 3TF7C 4G6JL 5I18L 3JTTB 1Z5LA 2F5AL 3TIDB 5ILTH 3EYFA 4D0DA 1AGFA 5JXAH 2R2EB 5E08L 3HG1B 4GXVL 2V9TA 2WMPA 3FQWB 3BW9B 1HH9A 4E41E 1R3LB 1XGTB 3WIHA 3FMGH 4NQDA 1EK3A 1YMHA 4JGJA 2J8HA 2DB8A 3CCHA 1OP5H 4X6CA 4Y7MA 2XPGA 1QVOB 4NOBA 4GAJL 4OLYL 3OZ9L 2UZYB 3VDBA 5GISL 1JNNH 4JJ5A 3LRGA 1KJ2B 3IDJA 3RKDD 4MA1C 4WFFE 5I9QB 4Z7WB 1FH5L 5TH2A 1N4XL 5EU5A 4NGHL 1FG2A 1R5IA 4PREB 2GK0A 5GHWH 4XNMB 4XCEB 1NGXA 3GO1L 2J12B 2AXGA 2CRIA 3HLAA 5GIRA 2HAZA 1WBZA 3MUGB 1EVTC 2IADB 3ZKND 5DUPL 1IGMH 3PHQA 1OAYH 1S9WA 2QQQA 2PTTA 3F8UB 3RY5A 1XGYH 4ZAKA 3A6CL 3ES6A 3I50L 4R2GB 2D7TH 3VFPB 3FQUA 3BKMH 3L3DB 3VMNA 2R1WB 3O3AA 1T2QL 4BH7B 3INUL 3N9GL 4R2GD 3Q6FA 4XB8A 2A6DA 3QCUL 4RWHA 1SEQH 1KOAA 4OZHF 4Z7UA 4L4TB 2VABA 1IAIM 1YMME 2IQAB 3ZDYF 4G8EA 4MB5A 4O02L 4FABL 3QUXC 4QXUH 1F6FB 5HJ3A 1U8IA 3BIKB 1LGVA 3UTSB 2R2HA 5EFIA 1CR9L 5I66B 4KHTH 5F96H 4KZDH 4L4TD 2FIRT 3QQ4B 1UEYA 4K94L 4GG8A 2EDTA 2SEBA 5E6IC 3SBWA 4HKZA 4OQTL 1MAJA 4G8IA 4YIQA 2FGZA 5C0RL 2HKFL 4XNZB 3FFDB 3FN0H 3GJFA 5HVHB 4Z9KB 2ERJC 2VC2H 3EDEA 4NWTH 1YY9D 2O5ZL 1KIPA 4U33A 4MD0A 5F6HJ 4ZUWB 4Q9RH 4P49A 3DXAB 1J9CT 2XKNB 3QNYB 3CK0L 4GSDL 2ZWLT 2I26N 5EC2B 5IVZA 3BQUB 4O51A 5CJQH 3KXFB 1A6WH 2XN9A 5E56A 4NHCL 5DK2A 2GITB 2R0LH 4QWWD 1EXUA 1F11B 1S7WB 5IVXA 4PRHB 3VDAA 3MLUL 3VD3A 1MRCH 1F02I 3ARTA 3KXFD 1JHTB 2P4AB 3WXWH 3T0WA 5E8PA 4XWGL 2V5RA 4I9WE 5DA0B 4KU1A 2Q6WA 3UX9B 4PRHD 1W8OA 4JDZB 2WBJA 3G5YB 5KVGH 1U9KA 2YOCA 3L3HA 2J8UA 2EDFA 2R4SL 4RCAA 1UT9A 2BOBA 1XZ0B 2BNQA 4UI2A 4YXHL 4FQXA 2VKXA 4LAQH 2Y07H 3HRPA 4I18B 4UTBL 1KCUL 2JIXA 4Y5VA 4HC1L 4NN6B 3KPMA 4R4BB 1IEBB 3GMMA 1MRFH 4M62H 1ZANH 1KCSH 1MCNA 3ROOA 1R3HB 1UJTA 4K3GA 3J7HA 3FONB 1J11A 4X4XA 1P4LB 5IEHA 3NIDE 1LE5B 5ENWA 3VGGA 1MFBL 1T89A 4JHBA 3BXNA 5AZ2L 4G7VL 2R2CA 2V5TA 3U9UB 1CGSL 4X5WA 5ESAB 1OHQA 1EGJA 2VOTA 4HUNB 2XZQL 1MJ8L 1GAFH 1OGAB 2CLRB 4JN1H 3PF2A 4UAOB 5HHQA 3QJHA 3LRSA 3PE9A 1Q8MA 4PJXE 2B7DT 3UJJL 5JXED 1H3PL 3DECA 1K4DB 3QWOA 1FFOB 4Y89A 5HYQA 1RUPL 5EU3B 1J12A 3OKEB 1J1PL 3IKCB 3MJ7B 4PBXA 1E6JL 3DRQA 4MAUH 4I2XA 4F58L 5J4MA 1IC4L 4FN0A 3VRIA 3GJFK 1RURL 5D2LF 5DZLA 4CMMB 1IAIH 4DZ8B 1U58B 2AXHA 3PWLA 4KJYB 1ZA6A 4WDIA 1IKNA 4GG6B 3H42H 5F6IB 4HS6B 2J4WL 3IGAB 4ISVA 1P4BH 4XCCH 5EOTA 2GTWA 2EDQA 5EBLB 5BS0B 3UTTB 4PLNC 1U3HC 3B6SB 1PZ5A 5D5MF 1S7UB 2I25N 3SJVB 3TIEA 4P9HC 1LO2H 5J9PA 5BS0D 1N3NA 3VG0H 1CICB 3UTTD 4JRYB 3VXNB 1QO3A 1C5BH 3OXRB 1Q0XL 1ZS8A 4BH8A 1CFBA 4KC3B 4WWKC 5FA4A 1CICD 1AGCB 4FFWC 4M6NL 4OGZA 4FFYL 4LSTH 1JF1A 3WUZA 3W9EA 5HPOA 3TEUA 3UTZB 4AY0A 5KSVA 5DRNA 3X13A 1HSBA 4X99A 1M6OA 1AGEB 3HAEB 4GFTB 1UXSB 3R4DA 1CXIA 2HFFB 5SWSA 2MPAL 2BRRH 4M7LT 1DQDL 4N5UA 2APFA 3U83A 2WQ8A 2NY2D 3GMRA 4P2QD 3RWFB 5H94B 3UMTA 3P0VH 1IM9A 2AEWA 4HFUH 3D0LB 4Z7QE 3D3VA 5ALBH 4PV8B 1GGCL 2VYRE 5I1KL 1KJMA 4PJ9A 2A6IB 2DBLH 1JI2A 2X40A 1U8KA 4ODXA 4OLZL 4LF3A 5IV2B 5IESL 4GW4A 3DVNA 4BSJA 3OXSA 2YUXA 1XGQB 5D6CB 5FB8A 4CGTA 4AL8H 1UWXH 1VDGA 5CEZL 4YUEL 3RP1A 3FRUA 4D9RD 4X4YB 3MLTB 1BQUA 4F8QA 3T2NH 3OHXA 4LCYB 2X1PA 3PP4H 2A77L 2JCCF 1MCHA 3DUHA 4MJ6A 1E4KC 3PGCB 2JJSA 4ZPTB 2W0PA 1OP9A 3GM8A 3DBXB 1NH6A 3DTXA 3KR3L 3KYNA 3NOIA 1GC1H 3CC5A 5IR1A 3GNML 3RZWA 1REIA 1N26A 5BCAA 2XG4A 3AMKA 2V9QA 3FT2B 5DD5L 1DUZB 4C54A 2P7TB 2CKBL 5KSBB 3NA9H 15C8H 1XCQA 2CIIA 3O2DL 3TN0B 3KYOA 4YHPA 3RUGB 5K59E 4X8JB 1ETZB 1GIGL 1UXWB 3RDTA 5AYQA 3L3KB 3QIBB 2OTWB 3TWCH 4MA8H 4KKBC 3ZYJA 4DVRL 4FQHA 4K7PL 1WEJH 1A6ZA 4HWBL 5ICXA 3P30L 1KPVA 2YRLA 5JIHA 3BZDA 3QIBD 3UJIL 1NGQL 5D7JB 3EJYC 3C6LB 4O2EB 4G6JH 5I18H 1FNSL 5FK9B 4S1DD 1CDHA 3ZHDA 4M7ZC 5GXBB 2F5AH 1FLTX 2I07B 3DO7A 1Q94B 2BVYA 4XNXL 4LLAA 4N0UE 2Y36L 5D7JD 2EKSB 5E08H 5ABDE 4GXVH 1IAOA 3VI4E 1TVBA 2AK4E 3FN9A 2PXYB 4LPYA 4OIAA 4YAQA 1G7JB 3NCMA 5D2NC 1AJ7L 3JXAA 1E28A 4I5BA 4LVOB 4WW1A 4DK6A 2YD3A 3D18B 1U95B 2VLJE 3IDIB 1B0WA 2CPCA 2PXYD 5ANMA 2FSEA 5KJRL 3GMLA 3OR6B 4ZNCD 1ZHNA 5C08A 4BQ8A 2P8MB 4GAJH 5F7WC 4OLYH 4U1HB 4LDEB 5GS0L 3OZ9H 4PJCE 4EN3C 3HC3L 5GISH 3V7AE 1VENA 2KH2B 4M4RA 1AC0A 1FH5H 3STLB 1N4XH 1ZT1B 5I1EL 1N5AA 25C8L 1KJVA 3GO1H 1LDSA 5BRZE 4L4VD 3EAKA 4U1MB 3MYZA 4YHKL 4OZHA 1RZKC 1X5KA 1DQQB 3QAZB 1MLCA 4NO3A 4QRSA 3WMSA 2MHAA 4M1GL 1BREA 3A6CH 4EBQL 1UWEL 1CGXA 1NCAL 3I50H 4NRZA 4ZSOB 3VG9B 2UY7A 5EU4A 5I1AA 5DJ0B 3V5KA 3JSSA 1OTTD 4YHLL 4D0CB 1T2QH 3INUH 4JFQA 3N9GH 3MXWL 3L7FB 3OF6A 5LGJA 4BQ9A 1RHHB 3RJDA 3QCUH 1G6RB 4NQUA 3W0WB 4O02H 4FABH 1F13A 1H3XA 3A6OA 1AD9A 2C3VB 4V2BA 4AZ8A 1KB9J 1CR9H 1OOAA 1X5FA 1F00I 3S98A 4JFEB 3W0WD 1QFOA 1U92A 2VLLA 2Y7QB 2KUTA 4K94H 4TVPE 1JZ4A 5EB9A 4U0RC 3IRPX 4HMCA 4NFCA 4XBEL 4JFED 4EI6A 4OQTH 2JELH 2HKFH 3RWDB 1WC7B 4DN4L 4ZFFA 3UO1L 5E4IA 1QSFB 1HXMB 3FTGA 3BPLC 1G7IA 5EIQA 4OD3L 4PFEA 1B0RB 5EUOE 5T3ZE 2WBWB 1Y0LA 2O5ZH 4IRSB 5KW9L 4MDIB 5DD0L 4L1HA 3MZTA 3SDCA 5IG7A 2WWKT 3CK0H 4GSDH 5HGBB 1MOEA 2MWCA 4IRSD 3SE3A 2YPVL 1JVKA 1W72B 3TO4B 5F7HA 1A2YA 5B8CB 2MQ0A 4G3YL 3BWAB 4W6YB 1JTPA 1KLUA 2P49B 1O5DT 2YA1A 4M6AA 2OP4H 1UYWL 4NHCH 3QDGB 4NO2A 3C87A 4WI3A 5JDSA 2IFFL 2X7LA 3TO4D 3MLUH 5ACLA 5MEPA 1DBML 2GJJA 1NMCB 3V6ZB 1LK3H 1OTUC 3QDGD 1PX3A 4XWGH 4PTUB 1KB5L 4OCWL 1U8LB 1MCFA 2HJLB 3MV8E 3NABL 1ZLUK 3ZKXB 3NPSC 4H26A 3VFUA 3I85A 4IMKA 2E7HA 1CFTA 3ZE2F 2R4SH 2FR4B 2NZ9C 3W9DA 1VKXA 5IMOA 4YXHH 3RVXC 4DN3L 1BIIB 3KNBA 3I6LE 3O3DB 1C8PA 5JDJA 1QRNB 4UTBH 4UBDC 1X5GA 5EG6C 4G8GB 4HC1H 3MRMB 4LCCA 1DVFC 1XT5A 3O9WB 1MPAL 5AD0B 3TBWA 2P5WB 1P7KB 1QRND 5CJBA 2EE3A 5BOZG 2YA0A 4G8GD 3L6FA 3RWCA 4EI5B 3FFCD 1LO0L 3O9WD 2H2PD 2X4UA 5IBUG 5EWIL 2X89D 1K6QL 4XHQA 4U2ZA 1CFSA 4EI5D 1MFBH 3RBSA 4KPHL 3C8HA 5AZ2H 4G7VH 2Y5EA 1CI5A 1G9NL 1CGSH 3PV6B 1XF4B 1P4IH 5MP6L 5C0CE 4ZOCA 5FGCB 2XZQH 4TPRL 1MJ8H 2CRMA 4QCIA 3MOAL 4GH7B 1A9EA 4I0PB 4H25A 4X4MA 5B4MC 4IHOB 5B39A 4IRZL 5IEKB 5B39G 1WWBX 3UJJH 3BH8A 4ZDHA 5FDWA 3IDYB 1H3PH 2ITCB 4EUPA 4PRIB 1RUPH 4I0PD 4EUPG 4BFIB 1J1PH 4Y19B 3TC9A 1MREL 5D5MA 1A02N 3MLYL 1E6JH 2XNAA 4KUZL 4PRID 1DSFL 2UWEA 4Y19D 5GGSY 4F58H 3KPSB 1WWWX 1IC4H 1R3JB 2X4NA 3I6GB 4IIQB 2IH3A 2Z8VC 5ID0A 3CPLA 1RURH 4CVZA 4PRPA 2EEBA 1GJIA 4D9QD 1T5WB 3KPSD 4U7SA 4B7IA 4IS6A 3GSQA 1OSZB 4E0RB 4GG6F 1QFWL 1F3JB 2J4WH 1PW3A 3U1SL 1CIUA 4X5LA 4D94A 3T3ME 1IGYA 4PTTA 3S4SA 2D4FA 3ROLB 3S4SG 1VERA 2BY2A 4LGPB 1KLGA 1N5YL 3ORJA 3NGBB 3DURB 2EZ0D 5FV1L 1X7QB 4RISL 5GPRA 1FYTB 4XBPB 3DV4B 1HDMB 2P42B 3IAQA 3CFJA 1Y6KR 2OXHA 3IFNL 4M6NH 2GCYB 1ORQA 4FFYH 5IB4A 1A14L 4JQVC 4U1JA 4KK8C 5C0FA 1HXYA 1BD2A 5FO8A 3IDXL 4ZMAT 2NY5L 1ZHLA 3WLBA 2MPAH 3QA3B 7FABL 1NUGA 3MFFA 1DQDH 1QSEA 5GGVY 4NCC2 4UILL 4KTYA 5IIEB 1HHGB 3VCLB 2GJ6E 3T08A 5MERA 1U2CA 3FHAA 2CD0A 2MFNA 2JCCA 3BE1L 4HV8A 1D6VL 1GGCH 3VJ6A 5I1KH 4G9FD 3LOWA 5ICZA 1P7QB 2NXZC 1VFAA 2Y9RT 1K3ZA 3B2UC 1MFDL 2H9GA 1D6EA 5KZCD 4OLZH 4H1LA 1S5HB 4OFVA 1H3TA 3ARFA 4H1LG 5IESH 1P7QD 3U36B 3DYMA 2XA3A 2QEJA 5D2NE 1VEOA 2Y5TA 4NKMA 1AQKL 5JHLL 5CEZH 4YUEH 1HWGB 3P4LA 3HZKB 4U49A 2FLRT 4WEMB 5IWLC 4CNIB 1IILE 5FYLD 2X70A 5TDOB 3LQAC 2A77H 2PO6A 3BDBA 5L9DL 5J3HD 1OB1A 2WUCL 3KR3H 4WFGE 2R8SL 4JFYB 1I1AA 3GNMH 4ZUVB 1MQKL 4BUHA 3D2UA 1HINL 5F8QC 4FOMA 4PRAB 2MQ3A 1IGCL 4ZAKC 3FQXA 1DEDA 3VXUD 4YDJA 5D72L 3D39A 5DD5H 3O6FD 4P23A 1FLRL 4L3EA 4XPGL 1V7NL 2CKBH 5GS3A 5KSBF 1VFUA 2Q8AL 1DQTA 3RUGF 5IMKB 1BF8A 2WWKO 1UH2A 4Q6IB 1TZIA 3HG1A 1GIGH 1HCFX 2HA1A 3OKDA 3VXRE 4DVRH 3CJJA 4K7PH 4Q6YA 3JV6B 4HWBH 2Y6SC 3WHXB 1CFNA 3P30H 4O2FB 1XGTA 2APWA 4MNHA 3BH9B 3OSKA 5A2FA 2F58L 1BZ9B 3UJIH 3WFCL 5T1KB 4Z8FL 1NGQH 2E7LA 3QDMA 5LJYH 3FB5B 3WHE0 1FNSH 2HT2C 1ODAA 4DFIA 2FHFA 2IPUG 3ARXA 4X7TB 4OD1L 2RQ8A 3IXTA 5IF0A 4XNXH 3P4MB 5T1KD 2GY7B 2Y36H 3SY0B 1K9TA 3ULUD 2I5YL 1KBGL 4X6BB 3BUYB 5HI5C 3AAZB 3T8XB 4DFHA 5DHVA 1AJ7H 2H2SC 4Y16B 1NC4B 4XPHL 5D1QA 3SN6N 4Y16D 3CDYA 2P43B 5GS0H 3VFPA 1TZGL 3BEVB 4NQTA 3HC3H 4NBYB 1FFPB 1ZA3A 1SEBA 2R1WA 5E2TL 4OZIE 2AJXL 2Z9TA 5I1EH 3KLDA 1F90L 25C8H 4CN6A 5FXCH 4YHKH 2UVEA 3BP4B 4YFLI 3LEXA 2IQAA 5FO7B 5EUKA 3PDOB 4KMTL 3FT4B 4M1GH 3U46A 5JA8B 3MBXL 2P5ED 3UTSA 4EBQH 1UWEH 5HYJD 3I75A 3QUMA 3FB8B 4YHLH 4ZUSA 2BXZA 5FYKL 3MXWH 5F72S 1FL6A 4XBGB 5HPMA 4Y5VC 4ODTL 2YC1A 4E42A 2R1XA 3T65B 1A6VL 3QEUB 3VGHA 1FZOB 4NRXB 1S78C 4JQIH 1K8IA 1QFWM 4ZUWA 4R4FL 1XF2A 4FQLL 1KCLA 2IFGA 3DXAA 2HFEA 4JZJB 3QNYA 3CFCH 1T89C 2NY1C 4ACPA 1AHWA 5DEZA 4XBEH 1MEXL 5CSZA 5ETUB 3QQ3A 4M43L 3E8UL 4OZGE 1TVDA 4GAYB 1AIFB 4DN4H 3UO1H 4R7DB 5DHYB 3IDGB 1JHTA 4OD3H 3T4YB 3V0AC 2KBGA 5KS9A 4N0FA 1BM3L 5KW9H 1YEKL 3FO1B 4HXAL 4R7NA 5DD0H 1FZJB 3QR2A 3GMNB 3HNSL 4ZXBA 3WE6B 1OWRM 4Y2OA 1T6VN 1NFDE 2X6MA 4MCZB 5CJOL 3UBXA 4BA8A 3D1MC 1CLYL 3UBXG 1J0IA 2YPVH 4HJ0C 5BZWA 2P8PA 1XZ0A 3PWPA 1UYWH 5JW3H 5C0EB 5JOFA 4ODSL 4HMDA 4I18A 4HKXA 4KKAD 4LLYB 4ODBD 1DBMH 4R4BA 3DV6A 2ZSWA 4XNYL 4IMLB 4MA3A 5GRXG 1KB5H 4OCWH 3RVTD 3MLZL 3GSNL 3QDHA 3NABH 1IM3A 1NLDL 4PJIB 1CLOL 2BVQB 3CDCA 4RFEA 3Q0HA 5F97E 1QBLL 2FHBA 4PGBB 4HT1L 4G7YL 4DN3H 4M7KL 5JPNB 1P5UA 2QKIA 4XCFL 4MXQD 3QWRD 4ETQB 5INDB 3L9RB 1JRHL 4QRRE 4Y4FB 1MPAH 5DJYB 5BQ7B 4WGVB 2ZZUT 4P46B 4APQC 4JPKL 4V1DB 1FORL 3GKWL 3QSKB 5AYUL 4BZYA 1OGAA 1ZVSA 3AM8A 3DGGA 5DZNA 5B21A 1LO0H 1ZWIB 1NL0L 4RIRA 4V1DD 5TFSL 4UDUA 2QADD 1K4DA 3S9DB 5EWIH 5KVDL 2O61B 3WUWB 1K6QH 4JFFD 3SO3B 1F4YL 1RZ8B 3MJ7A 4NO0B 2PETA 4KPHH 4OCYL 1ITBB 1G9NH 2AJ3A 4PJ8B 3WNOA 5MP6H 3O4LE 2HH0L 3OAYH 4JDVB 4TPRH 4F7CA 5TE7L 4GJTB 3PABB 4NO0D 4F3FA 2Y4SA 5DRXA 3MOAH 1X5ZA 3UAJD 1TJGL 4PJ8D 3MRJA 4WHYG 5HVFB 4DVBB 4IRZH 2W9EL 3G5VB 3QQNA 2NW2B 3GSRB 3IGAA 3QUKA 1FJ1B 4FG6D 3PIQB 1RZIB 1MREH 3MLYH 1OQOA 1S7UA 4KUZH 1DSFH 4LRIA 1ZT4B 4GBXB 3QHTC 3GHBL 3QO0A 4U6YA 4X6CE 3RWIB 5DR5L 2JJSC 5HYSB 1I3VA 4GBXD 3SDAA 1X5IA 4RAHA 3U0WL 5E70A 5GS2H 1DBAH 1QFWH 3QHFL 5GRVL 3EDDA 3U1SH 3UTZA 3O6ML 1T7WA 1AGEA 2DQIL 3QFJA 3RPIB 5CBAB 3T1FA 2VZOA 2CJUL 3MRHA 4C83B 2HFFA 5JNYB 1FDLL 3H0TA 2C9AA 4IRJB 4N0CD 4RISH 1IGJA 3W2DH 5EPMA 1LNUA 5ECJE 2FL5B 3IFNH 3B5TA 4IRJD 3D0LA 1UB5A 3MV11 4PV8A 3Q3GA 3DLQR 1A14H 4I4WB 2DM2A 1F4XH 1NAML 2CO6B 3IDXH 2NY5H 1ED3B 3DX6A 4Z7NF 5IV2A 3BZ4B 4AT6A 1G7QA 1UCBL 3L3GA 4NQCB 7FABH 5E5UB 4FTVE 4NZDA 5D6CA 4GMSL 4GMTL 1YEHL 3U0PA 4UILH 1KXQE 2OLDA 1U3JA 2FO4B 4EQ2A 4ELMA 3DUSA 1CG9B 5D93B 1WT5A 3BE1H 1D6VH 2GFBB 5DDHB 4X9BA 3NN8A 3LKSB 1YMMB 3V5DA 4MJ4A 3SKMA 4Y4KA 5E2JA 4KXZI 1MFDH 3ZMRA 2XG5A 2HLAA 4MD5B 4LCWE 1YMMD 4GW1B 3SE9L 4NSKB 3RWEA 3QFDB 5D96C 4NNXB 1R24A 1T1XA 1AQKH 4HS8H 5JHLH 3VFVA 5KSBA 5CJ8A 5F1KC 3TN0A 3RUGA 5J6HB 4J7RA 5L9DH 3HUJF 1QLEH 2ADFL 1IEHA 2WUCH 4HPYL 2R8SH 4Y8DC 4RWYL 3VWKB 3IU3B 1G7HA 1PJ9A 4YHYC 2ITDB 5IB1B 1CXEA 3PWVA 3L3KA 1MQKH 2CDEA 2NY4C 3O8XA 1HINH 1I7ZA 5DSCA 5GSRB 3L5JA 1IGCH 3LIZL 4QT5B 5FKPB 1WK0A 5D72H 4WIQA 3VWKD 2Q8BL 1FLRH 1U8JA 1JGVH 4XPGH 3NCYP 1V7NH 4M93C 3C6LA 4O2EA 4QRQB 4U1IA 2Q8AH 2IAMB 4OBSA 4D8PB 3ARGB 1GPOL 5HGAB 2NW3A 2OJEA 2R0WL 2J8UE 2B39A 2EKSA 2BNQE 1H9VA 3GMOA 1T22A 2BHZA 2NTSP 1UACL 3O45A 3ARED 3ARGD 1ULVA 4L5FH 1D9KA 2ZNXA 5B3JF 3MUY1 3V9FA 2F58H 1CK0L 1FFQA 3LH2L 4Z8FH 2P8MA 5I0ZA 4KDVA 3EOAA 4X9GA 3QPQC 2H41A 2G9HB 4OD1H 2P46B 2VXUL 5I16B 4H8WC 1URLA 3RGHA 3BI9X 3VD4A 1U8PB 5IK3B 2I5YH 2ORBH 1KBGH 1ZT1A 2FEDD 5E1AA 2OBGA 2OL3A 4QXTA 4YHNB 4N68A 4U1MA 4UDTA 5DQ9A 5IBTL 2VTFA 4XPHH 3B9KA 4M5ZL 3DMMA 1RIUL 4TSAL 4G80B 1DJSA 5CCKL 4KI1A 2AQ2A 3SE3C 1TZGH 3I3DA 5F89B 3I3BA 5T33L 4R6UA 4WGWB 1YEDA 1T03L 1R3KB 4R90L 2AJXH 1HYSC 1C16A 4UIKL 2FJFA 2HTLD 3L7FA 5A3IC 1F90H 1P53A 1PYWB 4L3CA 3F7YB 2GSGA 1RHHA 2VL5A 1A6TB 1AGDA 4HZLB 1G6RA 1A7PL 2EDJA 4I2XE 3FT3A 4CU7A 4ZYKA 1UJ3A 4OLEA 1OT2A 4KMTH 1JNHB 3C5JA 3MBXH 4XX1G 3R06A 3LN9A 3MJ8A 1NUFA 3LZFL 5F1OB 4HWZB 3GSOB 3P40A 1K8DB 1T66C 2Y7QA 2ZOKB 4LSVL 3QYCA 3NPZB 1MVUA 3GIZL 2D3VA 2R1YB 5FYKH 4UNUA 3T2OA 4ZFGH 4ODTH 4LCCC 1SJEB 5CWSB 4WENB 5CZXC 1A6VH 3RWDA 2C3WA 4KJQD 5GZNC 1QSFA 1HXMA 4LP5A 1DL7L 3E6FB 1B0RA 4L4JA 2X44D 5ELIA 5MHSE 1E4XL 1EAJA 4R4FH 2Z35A 3SKOB 2AJZA 4FQLH 4DTGL 2AGJH 3TA3B 3QUZD 1B3JA 5D1XD 5EULV 1SJHA 3PNWB 5HGBA 2XOTA 4MXVF 3ARBC 1BBJA 4XVUD 1MEXH 3BWAA 2HKHL 4M43H 4X9IA 5C0GB 2AXFA 3E8UH 2VLKE 5DFTA 2XWBB 4Y2DC 5SWSE 3BESR 4HIEB 5DGQA 5CBEB 1WFOA 4PJGE 1BM3H 5C0BB 1WVZA 1YEKH 4HXAH 3VWJC 3U79A 4PJ7E 1U8LA 3OB8A 4GQPH 1IAKB 5HI4D 3MNWB 4LLQB 4JREB 3MQIA 4OCNC 1S9KC 2YK1H 3PUCA 2V2WA 1CLYH 1MWAA 3QULB 3LKOB 2XXCB 2VB5A 1IAMA 4ODSH 4KKNA 5E1HB 3OJDA 3CFKA 1MCSA 5DUBA 4O2CB 2NX5E 4UOJA 1YA5A 4XNYH 5DA4A 5AD0A 4YWGL 4U6TA 2P5WA 2BC4B 3WIFA 4GLRH 3MLZH 3GSNH 5I1LB 4L9LB 2CMRH 2Z31A 3VXOA 1CLOH 4WHTA 4PJIF 1NBVL 5E5MA 3L7EB 2YPKA 5D7LA 1CF8L 1QBLH 3P0GB 2E6JA 4HT1H 1G6VK 4G7YH 1N8ZA 4GKOA 4MMZC 4M7KH 4BZ1L 4FZEL 3DETD 3KPOB 4XCFH 3RZCA 3FO0L 4NKDA 4ONHA 1JRHH 3BAEL 3TBSB 4PY7A 5A2IH 4JPKH 5AYUH 1FORH 3GKWH 3S37L 3TT3L 2JB6B 1GGYA 1BECA 4MLIA 4XAWL 4EDWL 3OTTA 1NL0H 1VCAA 4D2NA 2JJVA 2VXSH 4C56A 5TFSH 3BZFB 3OG4B 4JRWA 5KVDH 1FGVL 2BERA 2DN7A 2HT4D 1F4YH 1LHZA 1H5BC 4LEOA 2BSTB 4OCYH 1T7ZA 3EFFB 3K1KC 2HH0H 5DS8B 5SWQB 1KXVC 5TE7H 3I6GA 4K7FA 4K8RC 1CTNA 2H8PA 1TJGH 4WFHE 4BYHA 3WJJC 2FEEI 3MV01 1XIWC 3CXHJ 3GRWA 2H32B 1F3DH 1LK2A 1A64A 5LXGL 2W9EH 3LRHA 4GAGL 1OSZA 4E0RA 1G1CA 2AV1A 3MV7B 4J3TA 3MCLL 1M4KA 4XPFH 3ROLA 2E7BA 4MYWB 4DUVA 2E8YA 3QUXB 4CKVX 2N7AA 5FGRA 3QQ9C 1Q38A 3FOLA 3GHBH 1FL5A 5I71B 2DLHA 5C07E 5C08E 3PQYB 2AVGA 1FYTA 4UZGA 3QUXD 4K3JL 5DR5H 4JY6B 4MNGE 3IKKA 2BNUB 2DQHL 1VESA 4HIJB 4QRUA 2GCYA 3OJ2C 2VUYA 5C0JB 2ESVB 3O6MH 1VADA 2DQIH 5E6ID 5J1AB 3LS4L 1KB9K 1MHHB 4OZHE 5HHXL 3STZB 2CJUH 3ZDYE 3HNVL 4I0KA 2ESVD 2VLJD 1FDLH 3OV6A 4PJCB 4PG2C 2VIRA 1WV7T 3MLSH 4ONGH 3RGVA 5D7KE 2NMSA 1RI8A 2YD9A 1FVEB 1FVDA 1BFOA 5IIEA 5FOJA 4LARL 3ZE1F 1A3QA 4U1LB 1NGWB 1OAKL 3DX8A 2EIZB 1NAMH 4TTGA 3BX7C 2E8ZA 1YDPB 2IBZX 3P2TA 3ULSA 2APXA 5F1SA 3V4PL 1S9XB 5HHME 4HH8A 3V4VL 3BN3B 4L8SB 1QACA 1FGNH 4AEHL 3NZ8B 4GMSH 5K9QI 5BVJB 4GMTH 1YEHH 4NFDA 4RGMB 1WFNA 3NACL 4P4KA 2ENSA 4GXUN 4URTB 1GH7A 4LGRB 5TDOA 1OF2B 3ZKNC 5F1IB 5I9QC