3U2SA

Crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
236
structure length
225
Chain Sequence
ERLVESGGGVVQPGSSLRLSCAASGFDFSRQGMHWVRQAPGQGLEWVAFIKYDGSEKYHADSVWGRLSISRDNSKDTLYLQMNSLRVEDTATYFCVREAGGPDYRNGYNDFYDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PG9 heavy chain
total genus 42
structure length 225
sequence length 236
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u2sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u2sA01
2AV7A 3KYNA 2W0FB 1R3IH 2NY1B 4MHHI 2IBGA 3MV9B 4QRPD 4JRYA 4NN7B 4FNLH 3VFVA 4PJAF 2FSEA 1CFSB 4FRWA 1WBYA 4TVSa 1UM5H 4X7EC 3H9HB 4JPIB 2CO6B 5IVZB 4OKVB 2ARJQ 3X17A 5BQ7B 2JJWA 2NY3B 1AIFA 5CD5D 3UPRB 1J0JA 4L3ED 2ESVA 4HAFA 2BRRL 3ARGC 1Q72H 3ULSA 1F4XL 1BM3L 4UINL 1N64H 5LWYL 2JB5L 5C0ND 4J8RB 3D3VE 4L9LC 1ED3A 2DM3A 3VXTA 4PRIA 1AGEA 2R4RL 3IF1A 4XX1G 1U42A 2AEQH 1CDJA 3GIZH 3MA7A 3TYGH 2RR3A 4PRDB 3SJVE 5DC4B 3LSOB 1HOCB 2I5YH 3I3BA 5HPMB 4IRZH 3C8DA 1RPQA 1T1ZA 2B7DT 1MOEA 5SX4I 4NHUA 2XQBL 4E5XB 3QXUA 2Z8SA 2BSSA 4K8RD 4UTAL 3UTZB 3F7QA 4U05A 2LTQB 2JTDA 4ODWB 3VGBA 4Z76A 1M7XA 2W0PA 3FFDA 4C55A 4LOUC 1MHPL 4R7NB 4PGCB 5D7JB 2ADFH 4ZUWB 4JFDE 1MLCB 5L88L 3TO2A 2F5AL 3CSBA 5I17A 1B0WA 2VRAA 3KYKL 4LCUA 3TT3L 2ENSA 1WTLA 1S5IL 5CJOL 3QUXC 2I27N 2ZUWA 1KB5L 3GMQB 1HINH 3CFKB 2EDTA 4YAQA 3K4ZA 5LQBL 3D69B 2WBJD 4UMGA 3MA9H 2G9HB 4F8TA 3Q5TA 4P2OB 5JR1L 4FXLA 4YHNA 4M7JH 1NFDE 5ETUA 1G7MA 4I3SH 1DBJH 3QJHA 4X6EA 3HS0A 1C5CL 1EEYB 3CDGA 4FFWC 5F96H 4HWZA 1AQKH 5LWYH 1KYOJ 5ADPH 3BP4A 5DQDH 3GMMA 3WJJA 3L9RB 5IM7B 1LE9B 4FQLL 1NANI 1NMBH 4XXDA 3U7YH 5K9JH 1HXMA 4EUPB 4MAYA 3H3PL 1Y6MR 1FNFA 2UYLB 5HGAB 1KT2B 1T4KA 1UJ3B 3HZYA 4PLKC 3D39D 3IFNH 1T1XA 5DURB 2QHRL 2CR6A 3MRFA 3EOTL 4ZNEE 3SDXE 1ONQA 3PP4H 4JLRA 4G42A 3GUTB 3U4EB 5DJ0A 4Y4FD 4EDWH 3VDBA 3IDMA 1LE5A 5J13C 4HJJL 1AGDA 5CILH 3QXDA 1OGAE 8FABA 1JZ7A 1KTDA 5EOTB 1OCWH 4OKVA 4WUUA 4OF0A 2HWZL 1BQSA 2BHUA 2MWCA 3H6JA 4DCQB 4L4TA 4QXTB 1IGJB 1RURL 1YEFL 5BS0E 1FVEB 4JVUA 5FHAH 3FT3B 2G5BA 1E6OH 5HYQA 1AGEB 5DJ6A 1A6AA 1H5BB 4JPKH 5IVNA 4XP9H 2N1KA 7CGTA 5ITFB 4JFQA 5ESVB 1D9KA 4Y4KB 5F9AC 3Q6GL 3ZE2E 2C1PA 3L7EB 3QHZL 1HH6A 1P84J 3HPLA 3H3KA 3HPJA 2OL3L 2CH8A 2OL3H 3MRMB 5E8OB 3NZ8A 3VXSB 1KSRA 3ARFC 3DMMC 3FFDB 4WFED 4NO3A 1F45A 4GLRI 1DBKH 3MMEA 5DD0H 4LPVA 1BOGB 1DBKL 3SJVD 1MNUL 1Y18B 3V4PL 3MODL 3E2HC 2OJZH 2X7LA 1ZWIB 3BHBA 4HZAA 3RL1A 2ZOLB 4LEOA 5EU4B 1K5NA 1T1YB 4JFDB 1NMCB 4U2YA 4XWGL 3NCYP 3SGJC 5I16B 1ZK9A 4XX1E 4QRUA 1CN4A 1AR1D 1PY4A 3LN5A 3O2DA 4GSDL 1U0QA 4OFYA 4MNGB 1ES0A 1INQB 1Q0XH 1WAAF 1P9MC 4PV9B 4NUGH 3V79C 3M07A 4JO1L 4GG6F 3V7AG 3WFZA 4NJAL 3AROA 3P0YH 3DOSA 1II4E 4NQCD 5TJWK 1WBZB 5DHVA 3ZSTA 4HWZB 4I18B 4NM8H 4NQDE 4LCWA 2JB6B 4OCXL 3WEXA 2DYPA 3MUGB 5T1LA 3QEQA 4LHUB 1VEOA 1NQBA 5JMOC 1G9MC 4FQ2H 1TVBA 4QHNB 4AMKH 4M9OA 4HIEA 3LPWA 5DJ8A 3SN6N 1JPGB 4FTVA 4WEUD 2CMRL 4M1DH 5J8OA 4AM0A 2V2TB 4LCCB 2DQEH 4M9PA 1HHGA 3GSWA 5HI4C 4OGAC 3N9GL 3QUKB 2YD8A 3PABA 3HUJF 4LAQL 5FOBB 3FOMA 5EU7C 4DGVH 5IVZA 1T22B 3BZEA 4HXBH 1DQDL 4Y4HC 3H7LA 4I3RH 1AD9B 5GZOD 5HYFA 1RHHA 4NUJA 1J0KA 3FT4A 4YUEL 4NZUL 5FXCH 1QBMH 3C5SA 3MV8B 2HA1A 2RFXB 5DQDL 3EYSL 3BZFA 4XP9L 2NY2B 3C5ZC 5JNYB 5JW4R 5EOCL 2YD1A 1KJ2H 5EPMA 1LILA 1D6EB 1DBJL 2UVEA 5DVKA 1T1ZB 5HVWA 4QOKB 4RMRA 5HYQB 5ICZA 2BSSB 5B38G 4ZQKA 2EDYA 2F5AH 5DJDB 1N0XL 3U9PL 1KFAH 2DAVA 1JGEA 3O9WD 2C1PB 2HVKA 4DUXA 1E4XI 4HJJH 2VLME 3RWJA 2X89D 2OL3A 1WT5C 3PG2A 3GRWL 3HPJB 1P5UA 5C6TL 4G8EB 5GS0D 1MFBH 5I17B 5HHVL 2VIRA 2OMBA 4NO3B 1K4DB 3QB7C 5JW3L 4KTDH 5E8PB 2PR4H 2QQQA 3QIWB 4M93B 4WFFE 4JAMB 1A8JH 2F8VA 2LABA 1NGXB 5GS1A 1DDHB 1JF5A 2HRLA 3C6LD 2XFXB 4LCIH 4J4PA 3D2UA 3ARPA 3HUJB 4LL9A 1T1YA 3BQUA 5JORA 1QRNA 4L9LA 4MX7A 1GGTA 1K85A 1B3JA 1GC1L 5EU7E 3MRCA 5MHSD 4AMKL 4U6XB 1WZ1H 1TTFA 1LO2L 3S96B 5CAYB 1QFUH 2WAHA 5D1QA 5INDB 3MV9D 4QRPB 2EIEA 4Y2DA 4ZUSA 3BRGC 3KLHC 2VQ1B 1D5MB 4P2RD 3GSNB 2J2ZA 3F58H 3MRGB 4TUKH 1P6AB 4EUPA 4OQTH 4POZD 1G7LB 3MREA 4P23C 4GQ9L 5EZJA 1QFPA 3PP3H 5E00A 1IEAB 4DN3L 3TT3H 4WI8A 5F7KC 3ME0A 4KHXH 2AQ2A 1DSFL 4EQ3A 1P4IL 3ULVD 1KIPB 4HS3B 1MHEB 2OYPA 2WNGA 4XPTH 4ESKA 1MJ7H 4LMQE 3CJJA 5IUSA 1EVTC 1RUQH 3ZE2F 3FCTA 3ULUL 1BWMA 1K8DB 4O51A 4XC3L 5HJ3A 2A74A 5CKAA 1ZHNB 1RHHB 1G7QA 1KLGB 2M26A 3KPPA 4DCQA 3ZKND 2EECA 4MQXD 4N1HB 4YHKH 2Y07L 3JSSA 5GISL 3HLAA 2G5BB 3GJFB 4Z7VF 1IAIH 1UZ6E 1XMWA 4POZC 1C12A 2IPTH 2PTUA 4P9HC 1V3LA 1FNEB 5I30L 5IW1A 2DQCH 3UBXI 1HHIA 1UA6L 1D9KB 2EZ0D 1K8IB 3MJ8A 1JF6A 4X6BA 1CU4H 4HKJB 3MZGB 5IQ7H 4OD2B 1CCZA 1WWAX 4ZQKB 3C5JB 3ZKQD 5BO1L 4IOIB 2V9TA 2E6QA 4UV4L 4IOSD 4Y5XB 1EHAA 5DK3A 3K74B 5JIHA 4Z5RB 3C6SB 2BOCB 5T3XE 5T1KD 5F9OH 5ISZE 3WNLA 4XC1L 2H2SD 4C4KO 4GUPA 2AV1A 3NA9H 3PGFH 4L8SB 2GSIB 5EU4A 4DKFH 2P44B 4BELD 3QFDA 4JFDA 3H42H 3KYAA 3IDYC 1ZA6B 2PTTB 4QRUB 5A1AA 1J0IA 5J3HD 1J0YA 4AEIL 4GXVL 4CMHC 4PJHA 3W39B 1NGQH 1BZ7A 3RI5K 4GRMA 3EHBD 2P5EE 1AY1L 1MREL 1OTUC 4OCRL 3S6CA 5CGMA 1G7HA 3C9NA 3CSGA 4U6XA 5AUMA 4LRIA 1KPRB 5E6YA 1EFXB 4ETQA 2NPLX 1B0RB 4I18A 1MELA 5FK9A 3T65A 4PRHA 2QQKH 3MX0A 1UB5A 2R23A 1TZIB 2VJXA 3RBGA 5FYJE 4XHQA 3QEQB 4ZXBB 2A77H 3LHPH 4RMVA 1TVBB 4QHNA 1AP2A 5HHOB 3ARFA 3DMMA 4R96B 3OL2A 2D4FA 3CLEL 5EC1A 1I3GL 4EDXA 4CNIA 3CVHH 1D7FA 3BIAX 3FOMB 1FFRA 5IEHB 3SOBL 4ODTH 5F71A 5CP3A 4U49A 3WL9B 1FNLA 4KJPC 4PGBB 1XGUA 3A67H 5EO0B 5IV2B 3H0TB 5SV4A 12E8L 4NWTH 1INEL 3M45A 1PQZB 4WEBH 5A16A 2NY5C 1MY7A 2FX9L 5DWUL 4XPFL 4ELME 1G7PA 2Z4QA 1IE5A 4XPFH 3VRIA 4LNVA 4PP2A 3TESA 3MV8A 4LVEA 4MJID 3ILPB 3SO5A 5EZLB 3S5LA 4FQHA 1ZHNA 5C7XL 1WGOA 1YY8A 3B2UD 1F4AA 4OZFH 1Z3GL 5C0DA 4WTZA 4K7PH 4QOKA 3ROOB 3IS1X 2JELH 1DCLA 1U8NA 3HI5H 3KXFA 5LGHL 4RAHA 2YPKA 3STBA 2C7UB 1KPVA 1BMGA 4TYUA 2WBJB 4ZFFA 2R9HC 3UX9B 2FX8H 4P2QD 2HFGL 1H0DA 4X7TA 2QR0B 1MWAA 1LO0H 5F7EL 3G9VA 1DEEB 1NLBH 5FB8B 3JWOC 3BP7A 1MCEA 2DKMA 3VXQB 5J57B 1KLUA 4UAOC 1IC7H 2VZOA 1QOKA 4OFPA 4ORGA 1DDHA 1IBGL 1EPFA 2HT2C 3WSQL 1MCWM 1HSAB 4AH2A 1KXTB 3AMKA 4WFHD 4HUMB 1UM6H 1MJ7L 2NXZC 2P24B 3ISWA 1W0WA 5D2LF 5A3ID 4MJ4A 3IFOA 3O4OC 1FV1B 1CD1A 4MA3A 4N5UA 3GBNH 4S1QH 1HN1A 3EAKA 4Y2DB 4ZUSB 3MRIB 4X4ME 1A6WH 1FBIL 1RMFH 2W9DH 4HK0B 4XB8A 4NC1E 5IMOB 1EZVY 5DD6A 1U2HA 1JUFB 2VUOA 4AQ1B 1MAKA 2AK4B 3HE7C 1E27B 4S2SA 5GGRB 2EDBA 4OBRA 1G6RL 3ALXA 2YUWA 1FL5B 1TZIA 1KTLA 1CF8H 4IM8A 1VFAA 3QPXL 4X4XA 3RWEB 4XAKD 4Z7QF 4NQDA 2DICA 3U1SH 1BVLB 4LCWE 2B1AL 4GW4B 2DKSA 2BERA 4QHUB 3BQUD 5IJKA 1ITCA 4PRPE 4DK6A 1TZHB 4ZAKC 2OZ4H 3KYMB 5DI8A 3I6KB 3L3JA 4UDUB 1MHEA 4JR9L 4KK9C 4Y4KD 5E70A 4NNYA 4ZS7L 4GG6A 3KR3L 4PGBA 1RUML 4XPBH 3RY4A 5C3LD 2EDKA 2VLKD 3OV6A 4JRXB 1R0AH 3LQZB 3MRNA 5A16B 1GZQA 2DLTA 4XNMA 4M5YH 4ZFGL 4XNZC 4F7EB 3R1GL 3T2NH 2DTMH 2HT2D 2Q86B 4K7PX 4OI9A 5I1EH 4FQHB 5GGTL 1I1FB 1M1SA 2LU7A 5JLZB 2ATKA 1IILE 1F11B 1N0LA 2VR9A 3L3GB 1NFDB 5DJYB 4A6YH 4HKJA 3O3EA 4R2GC 4J2XA 2N7BA 3SKMA 4YHIA 1F6AB 1KJ2L 2BVPB 1BZQK 4Y89A 2DQGL 3RZCD 1FVCB 5I1IH 5IMMB 4CVXB 5HI5C 4NRZB 4LLMA 4HIHB 2E9WA 1MCSA 1HHKB 4KMQA 4HCRL 4L8CB 4XPHH 3HE7D 3PWVA 1ACYL 4ODHH 3W0WB 3W0WD 4QNPF 1KEGH 4HMEA 4WI5A 4KPHH 2VYRE 1MLBB 2YHGA 4IDJH 1T66C 2NX5B 4LF3B 1QNZH 5CBEA 3LD8B 3ZZ1A 3SQOH 4JM2A 2DWEB 1OT1A 1FO0A 5CEYB 1AI1L 2Q8BH 3LKRB 4NO2A 4P3CL 1SHMA 4PJXB 1EJ6A 1KLUB 4M1GL 4N1EA 1A7NH 1EEQA 2JLLA 3K1KC 3DRTA 4IMLA 3OTTA 5FAAA 4NT6B 1FSKB 1JTOA 1F8TH 5F89B 5FCSH 3WN5A 3HMXH 3PWJA 4NFDA 4RFNB 1QRND 1L6ZA 1OSZA 5KTEL 3KLAB 3DX9B 4QXGL 2VKXA 5I0ZA 1T66D 5EOQH 5D70H 5TQ0H 3B5TA 4OF8A 5H2BA 3RVVC 2H3NA 4MA3B 3MV9A 2X9XA 3S4SA 4KPHL 3MROB 1F4WL 1UB6A 3IDGB 1UYWH 4MJ5A 4AENB 1P2CA 4A6YA 1K6QH 5TPWL 2EDHA 2Q8BL 4NZRL 5DD6B 3RVUD 3WS3A 1G9MH 1MPAH 3UTPD 5BS0A 3MUHL 3QH3B 5TH2B 4MNHB 2NZIA 1BAFL 2WMPA 1ZGLA 5C0EA 1EK3A 1VFOA 2FBJH 2ADIB 2GK0B 3FMGH 2P1YA 5HYJE 4YDJA 5D7IB 2JK5A 3QCVH 2YK1L 3AM8A 1YEKL 3NCJH 3MPCA 1WFUA 4WCYH 1JFQH 1WICA 1IEHA 3UTQA 2NXZB 4OAWB 4Q9BA 1G7PB 2EKSB 3P2TA 5DMIH 5J56B 3U4BL 4NRXB 4UBDD 2VLRE 5IKCA 2VABA 1YECH 4RZCA 5GGTH 1QBBA 1CG9B 3EO0A 3GDBA 1MCHA 5JHDE 1A9BB 4KI5D 2H2PC 3QO1B 2ADFL 5MI0B 4B50A 1OARL 4F7EA 2I5YL 1Q9WB 2V5MA 2O5XH 2YRZA 4LPWA 3O6LL 4V2BA 5JPMB 3PGDA 5HVGB 1U8NB 1NDGA 1Q0YL 2UZXB 5EOCJ 1XIWD 4RQQB 2IH3B 4JG1L 4LCUB 3WXVH 2PO6B 5JW4N 4EXPX 3HUJE 4TVPL 5J7CC 1P6FA 4O02L 4B7LA 2DMBA 4PPTA 2FL5B 3F7PC 4WNQB 3VXMA 1CR9H 2YEZB 3BH9A 3MXVL 3I75A 4BQ8A 5KSAC 2C3VA 4F33B 3GHEH 1FORH 1YN6B 5E8EB 4NRZA 5I8OH 3O45B 3EYVA 5E08H 5I8KL 2G9HA 1LO5A 4L3EA 1E4KC 4JY5L 1Z3GH 1A9EA 2W07A 5CBEB 3MV8D 1CFTA 3EOBB 4PJ8D 5F6HJ 5BJTA 2Q76B 3KPLA 2MPAH 5IM7A 3UMTA 3T4AB 5J6HB 4P0DA 4I5BB 3FKUS 5AYQA 5AAWA 4X9BA 5HGHB 1EBPA 2Q6WB 4MS8C 4IRSA 4Y1AE 4IRJD 2UYLA 3O3UN 1FLRL 5HGAA 5FECA 1N3NB 1HXYA 3VG9B 3MRFB 3BZ4A 1CFSA 4DTGH 3NGBC 3ZDYE 5E2WL 4XMPH 2W60A 5GGRY 4P4RB 3PUCA 4W6XB 3W0WE 5C09E 3PQYB 2H9GA 1TTGA 4YPGB 3P4MA 4X6CA 1I7RB 1CDHA 4MA1B 5ENWB 3OKLB 4TOYH 1OT2A 4Y19D 4GW4A 1MQKL 4FFZL 4M1GH 4OZFA 4CN6A 1TZHA 4KMTL 4CMHB 4PRDA 5GQBA 1MHHA 3KPOB 3NFSL 4TTGA 5DD5H 5JQ6H 3L3OA 3V5KB 3MRHA 4W4OC 3I2CH 3VFPB 1ACYH 2KBGA 5AZEL 1KEGL 1Q9LA 1DFBL 4DKEL 2RHEA 2WSKA 2NYYC 2HVJB 1U8LA 5ITFA 4XXCC 4ODWA 4Z76B 1T3FB 1NKRA 2D7MA 3GMNB 2B1HL 3L7EA 1X4XA 5E7BA 1XF3B 3IJHB 4QF1A 2ATPA 4RZCB 3S36L 3TJHD 4HT1L 1WCQA 43CAA 2UY7A 5F93C 3LEYH 4FQQA 3RGVC 3QJFB 3FQWA 5C0AA 2ARJA 5D9SB 1IKNA 3QFJD 4G8FA 4QY8A 5SWSE 1FP5A 4KDTC 4ERSL 2W0KA 1RZFL 4B41A 2VLJB 3WO4B 3L3IA 1I3UA 5IVXF 1CZ8H 2AK1H 3RWGB 3TCLB 3UAJC 1UGNA 1BQUA 1EZVX 5IQ7L 4KMLB 3RU8L 3VXMB 3VG0L 4L8CA 5E1HB 4LQFL 4NBXB 1KF9B 1U8HA 2XQBH 3PWVB 3UJTH 1LQSR 3HS0B 2ZKHL 2DQCL 3T09A 3HHRB 4YDIL 5INCB 5FO8A 4TOYL 3CU1A 4HUWB 2MCPH 1CXFA 3NA4A 4QXGH 1YYLH 4CAGA 1S7RA 4MD4A 1F6LL 1WBZA 4J7RA 2DLEA 4GS7B 2XRAL 1L6XA 1U8QA 3BN9D 3LV3B 1GGCH 4CMMB 3X3GL 3HZYB 1U58A 3KPLB 3M8OH 2EIBA 3STZA 4HIEB 1ONQB 1JYNA 1KGCE 1RY7B 3QQ9D 4NM4H 4RMWA 3MR9A 1INDH 3JBG7 4LCCA 5FDYA 3IDMB 4BK4A 5DZOA 5F3HB 2V5YA 4WGWB 2F9BT 4LVHC 4A6YB 4JFOB 3TV3H 5ERWA 2YSSB 2EEDA 4R26L 3U7AA 1RAMA 3FHQA 1LDPL 5HHQA 5IBUB 1C5DA 4JKMA 4JRXD 1FDLH 1T5XA 2XKUA 4YPGA 5KVEL 4NP4H 4FFYH 3RWFB 1IGJA 3IFLL 1N5YL 1V5JA 1JWSB 2B39A 3OKLA 4GRWE 2AK4D 2GK0A 3EYUH 3P77A 2VXVH 4P49A 1OP5K 3ZHKA 4YK4C 3T8XB 4M4PA 3BGMA 5EO1B 5F7DB 1KCRH 3G6DL 4YE4H 2ZOKB 1MHHB 3KPOA 4YQXL 5DD1L 3O4OB 5CSGA 4EI5B 3K80A 3HMXA 3CFJB 4R2GD 4OFYD 3MGOB 5C09D 1UA6H 1XGPA 1YA5A 4Z7WB 1LO3L 5TQ2L 2IG2H 3DTXA 3NZ8B 5DS8A 3WJJC 5ICXA 5IHBA 3MYJB 1FO0H 1CDBA 3Q3GA 1CIUA 1AXSB 1UZ8A 5GZOC 2HVKB 1WZMA 4OI8A 1OSPH 1MF2L 3U48A 1FCCA 2RGSA 4JHBA 1U92B 4FFYL 2HJLA 4MAYC 1IC5L 5DJCB 4BH8B 2ATPB 1IZKA 2IH3A 4RISL 4JZNB 3FQWB 5F6HI 2R8SH 2IANE 4UZGA 5E95B 3DARA 5IESL 4AJ0A 4PREA 2FL5A 2VAJA 5JW5A 3G6JB 4NO0B 4CN4A 1FGVL 3LVEA 1P4BL 5ABDE 1N6QH 1LEGB 35C8L 3OBAA 3NACH 4JFFB 2DD8L 12E8H 4NWTL 1NCUA 1QRNB 2J8OA 4L3EB 4PGEA 2FLRT 2EIZB 3CX5J 4CBPA 5CIPH 1A9EB 3HE6D 3PWPA 1G0XA 5D1QB 4YWGH 5K59E 2ZUQB 4S1DC 4KMTH 1U93A 3EOBA 1P4BH 5CEXA 2IAMD 4JN1L 2GSGB 4HBQA 2QSCL 3T4AA 5J6HA 2NX5D 2GJJA 1JWMB 4P5MB 4DW2H 1WWWX 2A77L 3LHPL 4XZUA 1ZLSH 5D93C 3NIFE 4FA8A 5F9WB 4YR6A 5TE7L 2OK0H 2LVEA 1EFXD 3HMXL 3R8QA 2W60B 3MR9B 4FHBD 5D1XD 4BUHA 2GY5A 5E94B 3B5HA 4DVBA 2X4OB 3EYQD 5IB2B 3P4MB 1GXEA 4JFHD 3FT4B 3PE9A 5TFSH 3G6AA 1D5BA 4V2CB 2OP4H 4OZHB 4X5LA 3RVWC 2WUCL 1UENA 3MCKA 1OWRM 2H41A 2DJSA 2D0GA 5EIIA 2YN3A 1JK8B 4YBLB 4HD9A 1K3ZA 1A3RL 5DUBA 1NL0H 1D6EA 3WIHL 3MZTA 3CK0H 3VFPA 4JY5H 4PJ9D 1ED3B 3AB0B 1WFOA 3CK0L 4UT6L 3T2OA 3F12A 1I7TA 2I60L 2B4CH 3EOAB 4MLSA 5CLWA 1U8JB 1G1CA 5I1GH 5E6IB 3SDCB 1Z9MA 2IG2L 5CP7B 3RP1A 5F8QC 1JGEB 2X09A 3HR6A 5FEBA 3MGOA 2EE2A 5IF0A 5GIRA 1DEDA 4YXLL 2AJVL 3QUZB 4FQQB 4X6DE 1A02N 1JE6A 1CL7I 3QXAB 4F7TB 3Q3GB 3WJLA 4HWBH 5D7JA 3SKJH 3IKCA 5HGBB 3C6SA 5MERB 3UYRH 5BXFB 5JHDA 3BPCA 3D39B 2VLJA 4P9ML 1MIML 4UTBL 4JZNA 4K8RH 4NC0B 3MUZ1 3SHSA 5F1NB 2FIKA 1MFAL 3KPQB 2BJMH 1AH1A 4H25A 4AEHL 2FNBA 1A64A 4M61B 5BZWB 2WWMC 4X4MA 2FATH 4E0RA 2AXGA 4LU5H 1AGFB 3BXNB 4G6ML 4M1DL 2DBJA 1X5AA 3QG7L 4Q9QH 4YHNB 3MFFA 2WWKT 1G7HB 4G8GA 5GRZA 3ABZA 5SWZA 4XH2A 4PV8A 3KWWB 4PRNB 4U1KA 5IBTH 2FCBA 1J8HD 1RIVH 4ETQB 1B0RA 4UDTA 3IAGC 1H8NA 2XZAL 3BP4B 5CEXB 3SJVB 2F8OA 3LN4A 2XN9E 4M6MH 3FRUB 3VXOA 1X5KA 3C09C 4TTDD 3STZB 4NZDA 1IEBB 4KI5F 5E08L 5HHOA 4JREB 3KLHD 1YDPA 2D0FA 4EDXB 3MRJA 5D6DA 4OCYL 2EKJA 2OI9C 1UJ3A 4P59H 5JHLL 2GEEA 1RJYB 2PNDA 1DQQA 4MD5B 2H6PB 3PHQA 3LDBB 3MNVA 4JFOA 3FRPA 1ADQA 1YPZA 3IXAB 3WL9A 5KSVA 5JW3H 1GHFH 5DQJB 2X1PA 2DTSA 1G84A 1X7QA 4WHYG 2AK1L 2V17H 2AEIT 4KVCL 3AAZB 5JDSA 2Y72A 4ZTPH 4Y19A 4KRPB 1F4HA 3KYOB 3S5LB 5CIPA 1NBVH 1B6DA 3VDCA 4P2OC 1YECL 3L3HA 3TZVB 4BKLA 3VFGL 4DFIA 3QRGH 3FT3A 3QCTL 3O8XD 4KXZI 5C71A 4P2CG 5DJ6B 4OD2A 3BX7C 2Q7YA 3MLUL 4QXUL 3NCJL 3VXSE 4JPKL 4RBPK 5E6IA 4X6FA 4GMTH 1QP1A 3O9WB 1UWXH 3GMLB 4ZFFB 2E9IA 1LDPH 3BPLB 4RAVB 2ICEB 5HPOA 4I8DA 4LPCA 1DBBL 2IQ9L 1RUQL 4OLVL 4WJ5A 1MJ8H 1PAMA 2VDMH 4KDWA 3MQIA 4K23H 4MA1C 1Y0LB 1J86A 2EH8H 2BVQA 3ZHLA 5J1AB 2QLVB 2J12B 3TVMA 4I3RL 1SY6A 3DVGA 4PREB 5FGBA 2GIYA 3V0WH 5JW5B 1GOHA 3IKCB 5HGBA 4X5WB 3JVGC 5DLML 4AG4H 3DRQA 5F3BB 1V05A 2P5WB 4U7MA 5J13B 1RZJC 4M1CD 1CE6B 1YC7A 4AH2B 3AB0C 1IQDA 1GOFA 3EGSB 5I16A 4NWUH 3ROLB 4HJ0C 1LHZA 1G7JA 5DVLA 2P24A 4UQ2A 3BKYH 4KY1H 1EFXA 1PDKA 2C1OB 1T7VA 1FV1A 4MAUH 5JZ7C 5I1CL 4MAUL 4G80A 1FFQA 3VFTA 3O4LD 1CR9L 4HK0A 3UC0L 1PZ5A 2ZKHH 4LKXB 5FO9B 3K4AA 4N1CA 5DR5L 2J7LA 2EDLA 4JQIH 4MXWH 4P57B 1T5WB 3EZ8A 1ROWA 2E9JA 1HKFA 5F70A 3SJVA 2DYPB 3JUZA 1MRDH 2VMFA 3CUPB 3NN8B 1H3TA 3VXNB 1CGXA 3CX2A 4ZFOB 4ZFZB 3MA9L 4GMTL 1HWHB 3VFSA 1GSMA 4KTDL 2ZG2A 1W0YT 3H0TA 3PWLB 5TDPB 2LU4A 3I6KA 4G6MH 4HF5H 3QCTH 5E9DD 3FAWA 4MD0A 5K9QG 5KSVB 2CDGB 2NY2D 1CVSC 1MFAH 4K7FB 3FQTA 1BPVA 3VFRB 4F9LA 1E6JL 3SDAA 1CLCA 5I1EL 5DA4A 4E41B 1SYSA 3FMGL 5D1ZA 3GIZL 3Q1SL 2GKIA 3F12B 2O5XL 4PIRF 5JNYA 3VXME 1VPOH 4WHTA 1H3WM 3C2AH 3C60C 1OP3H 3N1FC 2WBJA 4HDIB 4OGZA 4RGNB 3AS1A 1NFDA 3QSKB 4HC1H 4LHQB 5GIRB 4YHML 3QHZH 4L3EE 1BD2E 1ZS8B 2C26A 1AE6H 3TYFA 1BIHA 4LLMB 4N0YH 3BVNA 3WHE1 1YEHH 1MCIA 4S0TD 2NQCA 3MRDA 1A3RH 3SDXF 2HTKC 3H9SD 4OCYH 1K4DA 1FYTA 1NCAL 3GJFK 2PYFA 1MRCH 5JPNA 3QDJD 2E7BA 5IB1B 4LSUL 2FBOJ 3PHSA 4IMLB 1S7VA 3BN3B 3AREC 4KHXL 3D2UB 4NOFA 2CXGA 5J6GA 3ZTJH 4FP8L 3MRIA 3IETA 1KJ2A 3E6HB 2P5WE 3VGGA 3KLAA 5DT1H 3WFDL 2B4CC 4BSWB 1CDIA 3ZT6A 3WNNA 3C08L 3KWWA 4PRNA 4M6AA 3S88L 4HSQA 4GG8A 5IK3A 3JV6B 4NC2B 3BSZH 4EKXA 5C2UB 4BK5A 1IC7L 3BWUC 4RIRA 3LMJH 3RZCC 1KELL 4HLJA 3HRZA 5D7JC 1CFQB 2OXHA 3QUYD 3NZHH 5SX4H 1WC7B 5J06A 4MDIB 4TQEH 5D6CA 3UJIL 4P5TA 4NN5B 4N8PA 5C0EB 3QR2A 3MNVB 1IEAA 2YBRB 4EI5D 5C07E 1HIML 3IU4H 4HCRH 5F7NC 2D31A 5HHMB 3FT2B 4IHOB 5TDPA 4JKPH 3KYKH 1U91B 5JOPD 1JNHA 3WNPA 5B3JF 5CWSA 1GZQB 2WBKA 5DEZA 4AEIH 3OJ2C 2VXTL 4Y19B 4BSJA 4OV5A 1B0GB 1S7XB 3VFWA 2NMSA 3P9LA 1H3PL 1WAAA 4XNXL 3FQTB 2DS4A 3A67L 1WEJL 3EO0B 1LK2B 1H3PH 1I1FA 4WCYL 4P48A 4JZJC 1HHJB 5FYJH 5H94B 4CU6A 1YEGH 1UKSA 5ESAB 4LLYB 1Z9SA 3VRJB 3WO3B 4PJEA 4U0RB 4X98A 1F6AA 1NCCH 2BVPA 5DFTA 5D8JH 3D9AL 3CAFA 2PF6A 5KN5A 4KHTL 1S5HA 1J10A 2AQ1A 4JVWA 3SCMC 3VXRD 3VXRB 4U6VH 3KR3H 4F7CA 1XH3A 3OHXA 4H20H 5GS0L 3UP1A 4FQPA 4W6YB 2EO9A 3OXRA 4E9LA 1KC5L 3OKOB 3DIFB 3R06A 4GRWF 1FO0B 5TF1L 1RUAL 2XZQH 2K7QA 5HTSA 4PJXA 3ZKXC 4AIOA 1MCNA 2R1YB 1J5OH 1U8IA 1V7MH 3O2VL 5KTEH 3OAYK 2FD6H 3LZFH 4G7VH 1BBJB 1HQRB 5JXEC 2OTUB 2FD6L 3LZFL 5F89A 3VI4E 3TFKC 1CF8L 3WN5B 3UTPE 1NBYB 3H3PH 2Q76A 2QADD 3FQNB 3AY4A 3BD3A 3WXWL 1DN0A 1Z0NA 4HFWB 5I1KL 3FAXA 1IGCL 3SDCC 4YX2L 3DSNA 3L5XL 4O2EA 3SDCD 2B5IC 1PY9A 1T03H 2OSLB 3PL6A 5IGXH 2DM7A 3S4SB 3I6GA 2KQNA 1D5ZA 3WUWG 3U7WL 4KTYA 5AEAA 4P4RA 1DR9A 2H2SC 1DQJB 4MNHA 4PRHB 2B2XL 1UT9A 3KPNA 4ZNCD 2BNRD 5SWZE 3MLYL 2ZP0T 4TUKL 5CGYC 3EJJX 4APQB 3VFOA 2Y36H 4LGRB 3T3ME 2RCSH 1MCWW 4ZFOA 3BGFB 2IPKB 4G6AD 2UWEE 1JNJA 3SCMD 1NCNA 4PJDF 2FZ3B 4G6KL 2YD6A 1NUDA 5GS1C 2VXTH 1L4IA 2EKSA 2DN7A 3VRLF 3TBWB 1DQML 1JGUL 1RSFA 1XGUB 6FABH 5EZIH 1VKXA 4GRLD 2FGZA 3EJYC 1MFNA 3DLQR 2R29H 4KHTH 3HE6B 1SYVB 3DO7B 2R29L 1CLOL 1AJ7L 3VFNA 4M3JA 3D3VD 5T33L 2A83A 2KDGA 3AXLB 4KRLB 3W9DA 4PJIF 2Y07H 1IMHC 5GRXG 5FKAA 4ZS7H 1EAPB 3QDGA 2Z8VC 4X0KA 1MJUL 5EBMA 1QSFE 4XP6H 2JF1A 5C0AD 4N0CC 5C0AB 3LMJL 3SDDA 1IM9B 2DIAA 1FYTD 1X6NA 1DL7H 3V7MA 4HDIA 4ODXB 5T5NF 1F42A 5ADOL 2YEZA 3BH9B 3QWOA 4ZO6A 3KXFB 2YPKB 2I9TA 3O4LE 4PJIE 4HIIA 1DBMH 3H2WA 2Q8AL 3WIFA 5KG9A 2ED8A 5HHME 3PWPE 3QWRD 4UILL 3NIGE 1LO5B 5DMYA 2QR0A 2VN7A 1X5JA 5I19H 2EYTB 1K3IA 1T7ZA 2DD8H 1T04B 3BMWA 3OKOA 5INCA 3R06B 4Y4HB 3D18A 5DSCA 3UAJD 2YD3A 3L5XH 3MUJA 3IB4A 1CXEA 3ELAT 1M05B 3HFMH 4NSKA 4RDQF 3X3GH 2VAAB 1UCBL 5I2IA 5I1DA 1U58B 2AKRB 3E6HA 4UIKH 3MLZH 4A2MA 4DZ8A 3C5ZB 4OFKA 4G3YL 2X4UA 5E2WH 2ZCHH 2R2EB 1N4XL 4K94H 2ENYA 3RUGE 3ORJA 2O61A 2PYEA 4OCRH 4DVRL 1F3JB 1A5FH 1HWGB 1RZGB 2X1QA 3DX8B 1YEIL 4JRYB 5I66B 2CO7B 5KVMC 1MI5D 3QIUA 4GW5A 4Z7VA 4K8RC 1MJJB 5GS0H 1KG0A 2NY0D 1WBYB 5F7EH 2CKBH 5ENWA 1J18A 4U0QB 3D25A 4JO4L 5IB5A 4PRPB 1UEMA 5GGRA 2DLFL 1QSEA 4LSDA 4U1IA 2NR6C 4ODHL 3RWEA 2E3VA 3GSNL 1T2QH 1JWSA 3V5KA 3DX6B 3U46A 3QYCA 1KFAL 3AC0A 2EDDA 4OT1L 4PTTB 2OR9H 5F7UA 1F2QA 1NUNB 2DQGH 1OB1B 4HK3N 3MA7B 2HT4C 1AC6A 1HSBB 1NGYB 3L95B 2R2HA 3PP3K 3U30C 4N5ED 3MOAL 5LBSL 4Y5YC 3BEVB 3VFGH 3RVTD 5EOCH 1QR1A 1JGDA 3H7BB 3TIEB 2B0SL 5BW7C 4M6NH 4WW2F 1FYTE 4HWNA 4EI6A 4M1CC 2D2OA 3DWTA 2BP3A 5D9SA 4LLYA 3VRJA 1X5IA 5F1IB 2Q86A 4Y7MA 2XG4A 3V0VB 4G8FB 4QY8B 5I1KH 2RJMA 3C8KB 2PXYB 4BH8A 3DUUB 2PXYD 3TO2B 1IC4H 3W5NA 1V3JA 3T3PE 4MB4A 4P3DA 4RWYL 1U3HD 3VJ6A 4MXWL 4UIKL 3IAPA 5GHWL 1F11A 3CSYB 4QHMB 3QUYC 4PJDA 3IJYB 2P4AB 3BYYA 4HX1B 5GGQL 4E42A 4I0CC 5DMJB 2XWJA 3HZVA 1CI5A 2V5RA 3L6FB 4JDZA 1UWEL 3TNNB 5HYJD 3ZKSD 3OXRB 2GTZB 3RZWA 3TBVB 1ZT1B 1H9VA 1FFPA 5EC2B 2HLAB 5AYUL 4BQCA 5BV7H 4WO4C 4Q2ZA 5C1MB 3NCEB 1U8KB 2A1WH 3GI8H 5LXGL 2A38A 4I1NB 2NX5A 4LF3A 2NR6D 3QQ3B 5T1MB 2VWEE 4D94A 4KRPD 2DWEA 5CEYA 4LLVA 3EYFA 4NO2B 4HWUA 4X80L 4H1LH 4F15B 3DV4B 4HFWA 2FB4H 4P5MA 4P5KA 5CINH 3CDCA 15C8H 2OSLA 3PL6B 4LVNC 1T1XB 4PJBE 3FONB 2X4UB 4HPOL 3BKYL 5IB3A 5ERWB 5H2BB 4KAQL 4B0MM 4TSAL 3BIBX 2E7LA 1WAAE 2R15A 5CJQH 1RZIA 1VFBA 5HHQB 2V9RA 3VWKB 2DDQL 2MOVA 5IB2A 1WITA 4MJ2A 1ZKAA 4HGWA 3RWFA 4JO3L 2CRMA 4NQVB 2GFBB 3ZTNH 1M7DA 4OZHA 5D71H 1KENH 5TH2A 2LE9A 4JO2H 4NQEA 1BQHG 1AI1H 4RGOH 5FUCC 4NPYB 4TVPH 3MRPA 1QSVA 3U6RB 3HNTH 2AJZB 1W72B 3F7RA 3RBSA 3RUGF 1OTUD 1T89C 2IMNA 5C0BB 3MLXL 4AK1A 5DFVC 4HBCH 4XCYB 3QCVL 4JFQB 5ESVA 1AXTL 4DOHE 4D9QE 1OF2B 4X99B 2B2XH 5F97E 3CFIC 1PKOA 3TA3D 1HH6B 1I1AC 1XR9A 3B9KC 5KW9H 2VABB 1FH5L 1PG7H 2KQMA 5T1LD 5EBMB 4JHAH 2ED9A 2R1WA 4JKLA 1IM3B 4M6ML 4NOBA 3QWOB 4X4YA 2VLJD 5EUOA 1EVUA 2BVEA 3O6ML 5HVHB 4JFFA 1JHTA 4EUPG 1WK0A 3EJZD 3VRLE 4OI7A 2CKBB 1YYLL 4YZFE 4C56D 4Z7WE 1T6WA 2XWBB 3BT2L 1U3JA 1FORL 4L9DA 3CMGA 3BJ91 1ES0B 4OZIE 3JV0A 1ACZA 4G9FB 1ZHLA 2HLAA 2VSCA 2VDPH 3B9DA 4H20L 3JWDC 3SQBA 1FRGH 4WWKB 4XPAH 1AQKL 1Q72L 4HJ0D 4Z6AT 5CD3A 3UDWC 5SWQB 3VMPA 1IC4L 5DZLA 4P2RE 1U8MB 3LN4B 3G6JE 4RMQA 4G6FB 7FABH 1I9JL 2EDWA 2WIIA 3SDDD 3ULUD 3MRBA 3WDHA 4IMKA 5I1IL 2IH1A 1L7TH 2Y7QA 5I66A 3NABL 5E94A 5FECB 1N6UA 5E7FA 4U1GB 4YNYB 1ZEAL 2H6PA 3EOYG 3KAAA 1D6VH 3P73A 2PKDA 5L8LB 5HI4D 3FOLA 1WBXB 4F57L 2B8OT 3MV7D 1AD9A 4PJBB 1QSEB 5JDJA 1HKLH 4R97C 2BNRA 2X1WL 1ND0B 4ODSL 4BQBA 1I7RA 5DHYB 5DZNA 1U3HA 4TNWK 1OSPL 2CXKA 3VGFA 2NNAB 1K4CB 3ZDXF 1A21A 1I9JH 4L8BB 4NKMB 2AK4E 4BFEA 4XMKL 1U8JA 3P11H 4HUVA 4N8VG 1AXTH 4JFPA 5C70A 1OLZA 2AJVH 5ITBL 5EBLB 3EYSH 3LRSB 1CL7L 5C6PB 5I71C 1RJZA 2D7PA 5EWIH 3INUH 1PBYA 5HSFA 2IQAA 4LLUA 4ETYA 4LCYB 1IFHL 2ICEA 5F1IA 3DYPA 4G3YH 1ZE3C 4JDTH 4PGDA 1OGAA 1X5FA 5I74B 3DETC 4HJGA 4J3OC 3QIUC 3GGWB 3BKMH 2KPNA 3SE4A 1A5FL 2ARJB 3QUML 4G9DA 3WFHA 4PRAA 1B4RA 2ZUVA 2NY3C 1ZLWK 4JAMA 5F9DC 2GUOB 3CFBB 5BZWA 1FBIH 3GMRA 1SMAA 4KAQH 5GS1B 5F3BA 4FNLL 3JV4A 3RUGA 5K9OA 2P5WA 4WDIB 5B3JE 1INDL 1FE8L 1BIIA 2EH8L 3SBWA 3NIGF 5C09B 4PJGF 3EO9L 2BSRB 5K9QI 3IAQA 3LQAH 1OQOA 3L5HA 3MRCB 3ZLQC 4XP4H 4EDWL 3OJDB 5IBTL 3U82B 3O4LA 4PJIA 1FHGA 1G7JB 4NZTL 2CD0A 1EA9C 2Q8AH 4TSBL 3PDGA 1AKJA 1NC2A 5GJSL 3V6OE 2W9LA 4KKLC 1P7HL 3EYFB 1HEZA 1QFWI 1I1AB 4PJ8A 3B9KB 1ZHLB 3VFTB 3RY6A 2XKNA 3FRUA 3VXOB 1D5MA 5K9JL 2FECL 4JFZL 4FQLH 3SGEH 3RVVD 4XAWL 4XNZB 5GGQH 2VZTA 5T3XL 2GJ6E 1T5WA 3PNWA 5AWNL 4FFVD 3KPMB 4GKNB 3WCYA 3C2AL 1DQQB 4MD5A 1GC1H 4OF6A 3R1GH 1B2WL 2FH8A 4GW1A 4M5ZL 5HVHC 4ZFGH 5M95B 1ZOXA 4ZFZA 4IS6B 3JWOH 3WUWA 1RZIB 1VFBB 1T83A 2CLRB 1QPXA 3EIFA 1XF5B 3OG6B 4XVTL 3SY0A 5F3HA 5SV3A 4HS3A 2CDEB 4UT7H 1JTPA 1C16B 3O0RH 3U0WL 4MD0B 2DQIH 1K8DA 4O51B 2A74B 4KQ3H 2WLZA 1QLRA 1BQHB 3QEGH 2XWTB 5D96B 3G6JF 3MRPB 1DBAL 5DHXB 2OTWB 3L3HB 3PWUA 3LRGA 5EZIL 5L9DL 1S8DB 15C8L 1W72A 2IBBA 1Q9OA 1EGJH 3VXTB 1UXSB 2P43B 3HC4H 5DD3L 3V52L 4KGLA 1FGNH 4JFPB 4OF5A 2CUMA 2N56A 4P9HL 1FSKC 1VFMA 2DLFH 2J8UE 3C2SA 4E5XA 2RCSL 3QHFL 3LRSA 4TSCL 1AGCB 5C0RL 4FQJH 1Y0LA 1ZS8A 2QSQA 1TJIH 4LCYA 4PBWD 3DVGB 3NCYS 3B5GA 3IXTA 3O8XC 2ZNWA 2E7LC 4PGDB 1D5XB 3BSZL 1OGAB 2MFNA 4P5TC 1OM3L 4X4YB 1CD8A 4OD1H 3DRQB 5EOQL 1OP9A 4FZ8L 5J12B 1N64L 5D6DC 1CGSH 3CXDH 4ISVA 3H8NA 3IFNL 4NP4L 1A22B 1BFVL 4L8SA 1JHTB 5EFIA 1CE6A 2VDKH 3RGVD 2D7OA 4PRAB 4U1JA 2CKBA 1KTKE 4L3CB 3L1OH 3O6FB 4GBXD 3WXWH 4YAQB 4UQ2B 2J5LC 3W39A 2MNUA 5C09A 2WLYA 4M7KL 1X4YA 1F3DH 2PW2A 4KK5D 4JHWL 1G7MB 4L4VA 2BVOB 1EEYA 5ALBL 4YHOH 3JTTB 3QDME 5E24E 2ZUSA 4WU7B 2XTJB 3GHBL 4YXKH 1U93B 4AEEA 3LY6A 4YDLB 1UXWA 2WIIB 3HC4L 2PTVA 3FFCA 3MLUH 3A6BH 1D5IH 3V6ZB 4KROD 1N26A 2DQFB 3ARFB 1W72L 3DMMB 4L8DB 3S3JA 3ZDXE 4K71C 2FO1A 2YWYA 5DJ2B 4NKIL 4RFEA 1QFUL 3RKDD 2LVCA 3V0AC 2B1HH 4UUJB 3KS0H 1J0HA 3RX8A 4IRJB 4LPYA 4IS6A 1FZJB 2CDGA 4PJBA 4YFDB 3G5ZA 2CLRA 4KI5E 1U91A 4BZ1H 2Z31D 4OZIF 4BZ1L 2BVTA 1KIRA 2Z31C 1HZHL 1C16A 2FGWH 6FABL 3N1GC 3NFSH 2NZ9D 1W0VA 1A6VL 4I3GA 5GGVL 4Y4HD 5HHNB 5EZLA 1S7XA 5GSRB 3VFWB 5GGVH 2VZSA 3P9LB 4F8QA 3ARUA 3HMWL 3QA3B 1I3GH 4Y88A 5T5FH 1NAMB 4WHTB 4XCNA 1CDYA 4XAWH 5H94A 3PL6C 5CJBA 4XT1C 5EBLA 1KIQB 4ONHA 1SBBA 4XPTL 4PJEB 3RVTC 3RWHB 4OIIL 5FFLA 1RJZB 2Q1EA 2ZUQC 3EOAA 1UCTA 3KS0J 4OLYH 2Z91A 4PY8J 2F74A 1DUYA 1EUUA 5KN5B 3QPXH 2ID5A 1QLFB 2R0KH 2XQYK 4OFDA 2D9QB 4R3SB 1MRDL 3UEZA 2H32B 4UILH 1KJVB 2AJ3B 5M94B 5D93B 5IROA 1RMFL 4OIBA 3VG9C 1X5GA 2CRIA 5E2TL 1OPGL 5L7XH 3HZMB 1KJMA 3NGBB 5IB4B 4FMKA 1F58L 4MJIA 4ELMF 4G9FD 2HAZA 4F57H 3D39A 4DUWA 4YHOL 1JNNL 4BUGA 3L1OL 2X7LB 4ISVB 1EV2E 3MCG1 1ZWIA 4O5LL 4KJYB 4UT9L 2FIKB 5J6GB 4M7KH 1KJ2B 1DQDH 3HNVL 4K8RL 1I7ZA 1IBGH 1CICC 3MNWB 1AGFA 3BXNA 1M4KA 1PSKH 4ZO9A 3I6GB 1RU9H 3S9DB 1H15A 4PV9A 5BRZD 2MMXA 1RIUL 2I07A 4XH2B 4EIGB 1ZHKA 3EYOA 1XEDA 1JV5A 2AK4A 2QQLL 1HILB 1C1EL 1J1XH 2BZDA 3C60A 3PHOB 3LKQB 3WEXB 1WC7A 4I3SL 3D9AH 4X4XB 1MJ8L 4BFBD 3VFOB 4M8QB 5C0RH 2YBRA 1XCTA 1VEPA 1YDPB 4L8DA 3BD4A 3G04A 5C0BD 2D31B 4CW1B 3FT2A 2JCCF 4Y16B 2I9LB 1GAFH 3PABB 4TVPD 4WIQA 5I0DA 4R26H 2DQUL 2NY0B 4WFEE 4I0PB 3QI9C 2JJSC 1R5IA 1WIUA 3D1MC 5A2JH 5DQJA 1OVZA 1AHWB 1NGPL 4JFEE 3LQZA 3MRNB 1YEGL 4OTXL 1ZLVH 4E41D 4ENEC 4JEGB 4XNMB 5MEOB 1YYMH 4JRWA 2BNRE 2YZ8A 2ZG3A 5J0BA 4U1SA 3HAEB 4NJ9L 2V17L 4ODUA 4PJDE 4XAKE 4U1MA 4LIQH 4WV1A 3UJIH 2G2RA 3SKOA 3VMNA 3QXTA 3EJYD 1JBJA 5ICZB 4LSTL 1AGCA 2HLFD 4YHIB 3UBXA 3LEXB 5JHLH 5FGRA 3MACH 4CVXA 1XGQA 3K2MC 5D70L 4QRSB 5BS0D 5CGTA 1EUTA 4R97B 1V7NL 3BDYH 4FQ2L 4JREC 2OL3B 1KELH 4MDJA 3VI4F 1MQKH 4FFZH 4H5SA 4MSWA 2FBJL 4HS6A 2VWEC 3H9SB 4EQ2A 4URTB 4KKLD 1RU9L 4CDHA 5EZOL 1YNKH 5ALCL 4LCIL 1KJMB 2DQEL 4NGHL 3GK8L 3Q2CA 5EFIB 4Z0BL 2I26N 3NACL 1TLKA 4NQXB 1MCJA 3X13B 3FFCD 1ZXQA 3JWDL 1CXLA 3MBEA 1ZTXL 1Q1JL 3P30H 3EGSA 1OSZB 1IT9L 1FNGA 3KGRA 1M6OA 4L4VB 3UTSE 5L2JA 4JANA 4W70A 4WY7H 5DMKB 1HDMA 1D9KC 2PYEB 5L2KD 1DANT 3WSQH 3N1MC 1PG7W 2EYSB 4G80B 1IJ9A 1H15B 1MI5A 3QIUD 4JHAL 3QIUB 4GW5B 4Z7VB 1UXWB 4NQEE 1CTOA 5FO9A 3UROR 2WQRA 1HI6A 3N06B 1HH9A 2E7MA 5BCAA 3W5MA 3EYOB 4XHJC 5IB5B 2DQFA 1I1AD 3TN0C 3WJLC 2MCG1 4XMLL 5I8KH 3OF6A 4RFEB 1B9ZA 4PJ9C 3VD5A 2D3VA 2ADIA 4LFHG 5FYKD 4L8SC 2C4FT 3BUYA 3IJSA 3GMPB 3PWLA 3GSQB 4OQ1A 4E41E 1GHFL 1HSBA 1MCDA 1NGYA 2I9LA 3L95A 1KIRB 3VFNB 3TJEH 3P11L 2NXYD 3KPRB 3MJ9H 4JR9H 4I13B 4JPWL 4L1HA 1G9NH 3RA7L 3UO1L 1X6LA 5HHNA 3BPNB 1G7QB 4GAGL 4ZXBD 2R0WL 3T0BA 3SDAB 3V95A 2CLZA 4MB5A 4HUXB 2E7CA 1CVRA 1KIQA 1QYGL 4ONHB 1JPFB 1RZKC 4U1SB 3C8KA 2PXYA 4M3KB 3CPLB 2Z91B 4P3DB 3C6LA 3P30L 3ZE1E 1J8KA 4NM8L 3O2WH 4YHLH 4X6CF 4FABH 3P4NA 3SKNB 3QULB 2XRAH 2XV6B 4GOSA 4TUOB 3BKCH 1UYWL 2V6HA 1T04A 5HD8C 1S7WA 2GTZA 1F02I 3TBVA 1ZT1A 4MJIB 5B22A 2YUVA 4Y4HA 3ARRA 1MCKA 2GJ6B 3GI8L 5EBWB 1V3KA 2GJ6D 4C83A 3ARVA 4Q2ZB 5LXGH 4WI2A 4P2RA 1CWVA 3MXWH 3IVKA 3TPKA 3NAAL 1F4YH 1T20B 1KJ3H 3T0DA 3FQUB 1MNUH 4KZDH 1ZA6A 2AKRA 3BI9X 3RPIA 3C5ZA 5IB1A 4Z7UB 4I5BA 4LDOB 3BT2H 4HMCA 2APFA 2X4PB 3OAZH 4YHPB 2IBZX 5GRYA 3LIZL 4YC2C 1XGTA 3E0GA 4ENED 2FX7H 3U36B 1NGPH 4PD4J 4QRTB 4S1QL 3IETB 3C9NB 2X5PA 5IMLA 5DMKA 2A9NH 1I7UB 1YC8A 2YA0A 3PHOA 3KPSD 3SDDC 1A3LL 3UTSD 4FQJL 1QYGH 2OR9L 1U8PB 4D9LH 5KSBE 3X3FL 1HH9B 5CMAA 3MLPA 4Z78A 2KUTA 3IKKA 1AO7E 3U9UA 1MVUB 4NQEB 3N0PB 2R69L 3FFCE 4MDIA 2HFFB 1J7VR 3JVGA 3ZYJA 3Q48A 2Y23A 5MHSE 3MOBL 5E6ID 2P8PA 4RMUA 3UZQA 4ALAH 1SBSH 2VITB 4I2XE 3BUYB 3IJSB 4LKCB 3OX8A 2NCMA 1Q9LB 5CILL 4LSVL 3GSQA 3TBTB 2L7UA 3QBTB 5MEND 1H8OA 3OAZK 1T3FA 2VC2H 4OB5L 1J1XL 2Z4QB 3KPRA 5AZ2H 3VRIB 4P4KA 1BQLL 3BMVA 1ORQA 2V5SA 3O0RL 3TCXA 1CGYA 1XF3A 3IJHA 3MLZL 4QF1B 4CADA 3HAEG 5DC9B 5FUOH 1CXKA 5I1JL 1ZLSL 4JPVH 4LVOC 3SKOB 5D7LA 1FC1A 4QHMA 5DMGC 3SDYH 2R1WB 2YWZA 1LDSA 3T0XA 2E6JA 4QGYA 1ZMYA 4PRIE 4R4FH 3OB0H 2Z92B 1BVZA 5HDQH 3O2DL 1KPVB 1JGVL 4CVZA 3EFFA 1UCBH 2JCCE 3O6KL 3TCLA 4OUUB 4W6WB 4KUCD 2VXQH 3HI6L 2ARWA 2VQUA 3G5XA 4HW6A 2HTLC 5EC2A 4MDJB 2ZUXA 1Q38A 2OI9B 2Z31B 5CSBA 2XXMB 2R0KL 3PJSB 1A0QL 4OSUH 2JJSA 3CVHL 4LLVB 4TSBH 5I8OL 5L8KB 3RHWK 2Z8RA 2GJ6A 4C83B 5F1KC 3X13A 1SMOA 4OIIH 4LU5L 3T04D 3TEUA 1IGYB 5IBLD 1NAKL 4WWKA 1XGYL 2LFGA 3SDAC 1S9YA 3IVKB 1HQRA 4XWGH 1NGWB 2NY4B 3HMWH 5SWQA 3T2QA 1SEBB 1BREA 2NY5H 4FQXA 1ZLWH 3C5ZD 3IFPA 3VG0H 1JMZA 4ZYKA 2CUIA 1EX0A 4DGIH 1HDMB 4KVCH 1XGTB 2IH1B 1QFHA 4MZ3A 2BHYA 2ZWLT 1D5ZB 2V5TA 4HKZB 3MNZA 5I6XB 4Z0XA 5T1KA 3SE4C 4PB9L 1HI6B 3H9HA 2K9UA 4S2SB 4KZEL 5EORH 1OM3H 1DQJA 3VE0A 5IHZA 3UPRA 1MFBL 2W91A 4CL7A 4EOWH 3QUYA 2R4SL 4LSPL 5DTFB 5LBSH 1J12A 3SCMB 3FO1A 4P23D 5CMAB 4K3JH 1D5IL 4Q6YA 3TH2T 1QRKA 4HWBA 3ZTJG 1BD2D 2J8UA 4MQSB 1FDLL 5KVEH 3BGMB 2DM4A 1TDQA 4GRLB 2ZCKH 3ZKXB 4UDUA 4C56A 4PJGE 3SE8L 2A9ML 1B4JH 2VLRD 4AQOA 4EI5A 3SDXA 4NHUB 3SKUD 1XR9B 4LKCA 4YH6A 3GBMH 1NSNL 1HCFX 4K3JL 3DTXB 3HE6A 3RTQB 5DS8B 1IT9H 3S97C 3HAEH 2QKIB 4I2XB 3HKFA 1Q1JH 2A83B 3AXLA 4HAGA 1R6VA 1FFNA 1SJEB 4JRXE 4ZOBA 3QDJA 1J1OL 5EUOB 4X0KB 3P9MB 1GPOH 3U0TB 4OQTL 4NKQB 2P5WD 3BN9C 2FX7L 1JRHL 3N1QC 1CGSL 2R0ZL 3WFHB 3QXWA 5KS9A 4DK3A 3NPZB 5FGCE 4Y16D 3GMQA 5K9OB 3U4AA 2XWBA 4JGUA 2LAAA 5TE7H 4N0RA 3CMOL 1HHKA 4J3XA 3UJTL 3MRQB 1FIEA 3GSRB 2X9YA 4X6DF 2ZJSH 1BP3B 1GYAA 1J5OL 5GGTA 2HN7A 4DQOH 4WEMB 1RUAH 2XZQL 4M48L 4YDIH 4XRCB 3QIWD 4ZUUB 1E28B 3ZHDA 3FN0H 3RPIB 1MCPH 3EFDH 4HEME 2VDNL 3T0EB 4LQFH 3KJ6H 2ICES 1S9YB 3WS6C 1LD9B 4LEXL 3QIBD 4XWOD 2FDBP 5SX5H 4JRYE 5MI0C 1B4JL 4WFHE 1PFCA 1DL7L 3PWJB 5C7XH 4XVJH 5I73C 3GO1H 4ODBD 1FGNL 3E8UH 3RPKA 1ZVHA 2R8SL 2Q7NA 4DZ8B 2EH7L 1NGQL 3BP6B 1GIGL 4GXVH 1GIGH 5DJ0B 4LBEA 5EUKA 2ESVE 1AD0B 4RGNC 1KYOK 1IKNC 1TQCC 4HKZA 5E6ZA 3QFJE 4M43L 4N8VA 4XBPB 4EOWL 4MJ5B 1KG0B 1VADA 1BEYH 2SEBA 5DHYA 3G6AB 1D5BB 4UTAH 1KTDB 4RISH 2EYRB 2WZPD 2GI7A 3CFDB 4WUUB 2F58L 2Y9RT 2BNQD 3MCKB 2EEAA 2AEWA 2UZIL 5FF6A 1NLDH 4S11A 1X5ZA 4RWHA 2HFFA 3NFNA 4HUVB 1UVQA 1QKZL 1S8DA 1ZGLB 1FVEA 5C6WH 1EBAA 1GZPB 3V4UL 3DX6A 3U46B 4UU9B 2JK5B 1UXSA 2ICWA 1Z6JT 3HA0A 4TUJA 4HC1L 4TRPL 3UTQB 4JY4A 1Z9LA 5FO7A 4Y1AB 5C0CD 1E4XL 1RQ5A 1ORQB 5FHAL 5IKCB 5IF0B 2A6DB 4MJIE 3GIVA 3RNKB 3VWKD 1CTNA 3MCLL 3TIEA 4LRNH 3GGWA 2OR7A 1QVOA 3OPZH 1A9BA 3D39E 2VR4A 5D7LB 3CFCH 5F44A 3V0VA 4ONGL 1R3IL 1KB5A 3PGDB 2QQNH 3QDJB 4HG4K 3CFBA 4KRMB 3FB5B 3J8F7 4J3TA 5D1XC 3LQAL 1UM6L 2PO6A 1JYVA 2HRPH 3U0TA 5HYJB 5F1NA 2OQJB 3CSYA 4HLZH 4GKSB 5AG9A 2YPLB 4PJFA 3VWJD 1XF1A 2XWJB 1OGTB 2AERT 3O6FA 4WU5A 4DGVL 4Z7QE 4IJ3B 1OAQH 4NN5C 5CJ8A 1CICD 1NAML 3DBXA 2XQYG 4WUUD 4RMSA 5IW6A 4PJ8B 1A7BA 2F53D 5KSBA 2PW2B 3WFCL 4W81A 4Z77B 5I8CB 1U8KA 4PV8B 1FZOA 3EDJA 4WW2B 4UDTB 1MCCA 3CXHK 4KQ4L 1I4FA 2VC2L 4FTVD 1MAMH 4M02A 4LCWB 4XP5L 5BJTB 1QBAA 4B53A 1N7ML 4FQXB 4L4TD 4ZNEA 3V6ZA 5HGHA 3BFOA 3BPOC 2CLVA 4J4PD 4GW1B 5BVPH 4JM4H 3UJJL 3WUWB 2V2TA 1ZT7B 5A2LH 5EU6B 2J3SA 5F1OB 1RIHH 2GJZB 3QUKA 1G6VK 4A6YL 3BZ4B 1TNNA 1WEJH 3WO4C 4HT1H 5IB3B 1FN4B 1J8HA 4ZOEA 1EHNA 2W9EH 4Z95H 5I15L 3RJQB 3MYZA 3QDGE 4L4TE 3G5ZB 1FJ1A 4JJ5B 4N8VB 4XBPA 2OTWA 4HGWB 1NCBL 3T4YB 1E6OL 3AAZA 4RCAA 4DN3H 5JDSB 4EBQH 3TFKD 1CXIA 4K9EL 3CFDA 4XPGL 5HGDB 2EXWD 4GQPH 3I2CL 5HVFB 4QKXB 3SBWC 4UNTA 1G9NL 1GAFL 3RA7H 3UPAA 3BJLA 4XPAL 1LO4H 4RRPG 5BZDA 1ORSA 3VXMD 5C0BA 4LLQA 4D0DB 4OLUH 2ICWI 2Q7YB 3QAZC 1KUMA 5E5MB 3QRGL 4XCYA 4X9HA 4HUNB 4I2XA 2UVFA 3O9WA 1QLFA 4H1LA 4HCRA 2D7NA 5HI3D 2OX5A 3QFJB 2A6KB 3IYLW 4QYOB 2CRYA 4LVNB 2H32A 3GI9L 4GKZB 1RZ7L 3NVQA 4JKWA 5DT1L 2FJFB 4DFHA 1YMMB 3AS0A 2VIRB 5JQHC 3HZMA 4DGYL 1MY5A 3QIBA 1L9MA 5TDNB 2BDNH 5E8PA 4FQIH 5I1JH 1IQWL 5GSVA 3GSVA 1GCFA 5D7LE 5C0CE 5AZ2L 3GMOB 5ANMB 3BQUB 5JORB 3HTLX 2H1PH 2NTFA 2XPGA 4PRBB 4K3GA 1YNLH 2AGJH 3S35X 4HPYH 5B21A 3P0YL 1DBBH 2IQ9H 3OB8A 3RX5A 1SBSL 3DPBA 4KKCD 3QNZA 4EI5C 1IQWH 3PXHA 5INDA 1FCGA 3RDTD 1NMAL 1M7IA 3BEWB 4Z0BH 5BRZA 2BMKB 4OGXH 4PFEA 3VU2A 4WTWA 4UOW0 1NEZB 4FTVE 5GJTH 4G6JH 1LD9A 2JKXA 1CLYL 3WHXB 4I48A 1JRHI 2VNCA 5B4MC 1KCKA 1UH2A 4D9RE 4PJGA 4JY6B 5DURD 1QLEL 4R6UA 4YZFF 3A6CL 4M8QA 3MRBB 1FZMA 5E2JA 5CZXD 5DD0L 5KVFL 2LTQC 3MLVL 3CH8A 1Z9OA 3G04B 3TIDA 4Y16A 4D8PB 2P5EA 4NQUA 4Q6IA 3MGAA 4O02H 5LAXA 3ECBA 1FL3B 1KIPA 5E5RB 1KB5H 5CZKA 2CPCA 4BYHA 2VDQL 3FCTB 4DEPB 5T33H 3DVIA 1EO5A 1Q94A 3C87A 1FJ1B 4U1HB 5KZCB 3RHWF 1WJ3A 5MEOA 4HQQL 4UU9A 2XTLA 3D87B 4UINH 3FTGB 4MWFA 3UTTE 5IEKA 2FWOA 5FYKU 3QEQE 1MRFL 2ICWB 5EG6C 4POYA 4GT7A 2EH7H 5EH1A 3UCRA 2DQTL 2VDLL 5CZVL 4JFZH 2VLLB 1I1CA 5FM8A 5IVXA 4F7PA 1QA9B 2GCYB 1PG7X 5C8JB 5IJVB 1YEKH 5IP4A 2W9DL 4LPTA 2EDRA 2OCFD 3ESUF 1P84K 3LS4H 4Q9CA 5E5MA 1QVOB 3UC0H 4JFED 2VSDA 5EA0H 1XGQB 5T3ZH 3MYJA 5IB4A 2H26B 1TVHB 1N7MH 3KPSB 2IFFL 2IAMB 4O4YH 3T0VA 5DJCA 3MV8E 4H5SB 3OXSB 1LO2H 4MSWB 4GKZA 5GRVL 1G9ML 4UV7L 2EO1A 2AV1B 4JZOB 4J3UA 4KJYA 1FYTB 3REVB 4PTUA 3VXPA 4U33A 1UWEH 1QEWB 1I7ZB 2GUOA 5EN2B 3T0ED 2IPUG 3FJTA 4YBLC 4AG4L 1PVHA 4S10A 4H26B 1A7NL 1LEGA 5EO9A 2HJKB 1I75A 5D5MF 2CRZA 1G1YA 5IBUG 3HNSL 5IW6B 1LEIB 3VGAB 3R0MA 1FNGB 4IDJL 2I07B 3HFML 2OR8A 2F54D 2VE6B 4LLWA 2AJYH 1UACL 3ARWA 4NQTA 3D85B 3D85D 3C60B 1I4FB 3MLRL 3WD5L 2WUBL 4Z7OE 1UB5B 1I1AA 5FHBL 2ICCA 1F58H 4KI1A 4UT6H 5LQBH 5J11C 4UB0L 5GZNC 2EDNA 3V8CA 1XCTB 1L7IL 1ZT7A 1J0ZA 3KPMA 4CW1A 1C08B 5D6CB 2GJZA 5D2LE 3SGDH 4PJAE 4I0PA 5FHBH 2DQDL 3M1BB 3ZDZF 5KSBF 1JCKA 2MKWA 5LAXB 3TN0D 3T4YA 4GKOA 5EORL 1CGVA 2VO5A 1LP9B 1B0GA 5EIIB 1BGXL 4U1HA 4KKBD 2XWTA 4U1MB 1LK2A 3PWUB 1IVLA 4F3FA 2AEQL 2AXHA 5ESAA 3MBXH 5BZDB 2BRQA 2FWOB 1VERA 4GLRH 3RIFK 3CZJA 2R2BB 4UV7H 3PGCB 4F15C 1TPXB 3BDYL 2C7UA 3NZHL 1AGBB 4TTDC 3C09B 1P7KB 4R4ND 1P7QD 1QA9A 2GCYA 3P4LA 3FL7A 2IFFH 4O4YL 4R4NC 3UTOA 3SKNA 4DW2L 2A6KA 3KHQA 4Q7DA 5CINL 4F7CB 2OZ4A 2FJFA 5FB8A 1BM3H 1S7WB 3ARXA 2AW2A 3RX7A 1WWCA 3QG6B 2D7QA 2M2DA 3TPUA 4DEPC 4FABL 4JDVB 2X42A 5EBWA 3MV7E 4Y8DC 4NZTH 4KKCC 1TXKA 4NJ9H 5HYSB 3RDTC 3B4NA 3GMOA 4MNGE 5ANMA 3HI6H 3DGCR 2V7NB 2X1XR 2EDOA 2YUXA 5JUEH 3FQUA 3VXPB 5IW3A 1DN0B 3GBNL 5L8JB 4L3CA 1FZKB 4U6YA 3OPZL 3PQYE 4ZMAT 4JANB 5D96C 3IFOB 1MVFA 2ADGA 3R4DA 1U95A 4JQXA 1WVZA 5EIVA 1BF8A 1WCBA 2VZ1A 1ITBB 3BO8B 3B2VL 1NC2D 1A6VH 1AKJD 1JUFA 3O9WC 3VH8A 4GFTB 4WU7A 5GZND 5FYLH 3KPNB 3SGDI 2HJFA 2W38A 2ZUYA 3S37H 4PJGB 3TZVD 32C2A 4C56E 1L0YA 4F9PA 3PL6D 3V5HB 3P4OB 4BZ2L 1LO0L 4X5XA 4ZOCA 4FQXD 4FFWD 4I0KA 4JB9L 5DJ2A 4LPUA 5KSUA 3KYMA 4ELMA 1PX4A 3L5JA 3MRLB 5HD8D 2H32H 1WLHA 2R9HD 2ZCKL 1C5BL 2AXJA 2F19H 4R7DB 2VITA 1YZZA 1FZJA 4Z7OF 4JRXA 1U41A 2DQHL 1QR4A 1SYVA 3A6OA 3QDJE 3FQXA 4M93C 3DO7A 4HPYL 4NQCA 1DBAH 2GYSA 4UAOB 4HUXA 4P4KB 1E4KA 1YMME 5ALBH 3W9DB 1JPFA 1QBML 1W0VB 5GGSY 3KXFE 5FKAB 5C07D 1S7QA 3CPLA 2OK0L 3QA3A 3C6LB 4XI5D 4BKLB 5J11B 4O2CB 5JLZA 4I77L 2NXYC 4LASL 4W4NA 4ODXA 2XG5A 1DFBH 5E4EB 1L9NA 4ONFH 5DJYA 5L2KE 4JGJA 4XCCL 2FYYA 5EULV 2I9TB 1AGBA 4LSQH 1N4XH 3LH2H 4ZAKD 5C0BE 1GVIA 4APQC 1MSPA 1MHCB 4YDKL 5FM5M 5DR5H 4ZPTB 3VFUB 5AD0B 2BY1A 1S7UA 1MCOH 3IDUA 5AAMA 5ACZB 1KJVA 4KUZH 2VDPL 3H9YA 1TQBB 5TF1H 4JM2B 4ONFL 5GRJH 3WKMH 5GGSA 2YN5A 2AJSL 4PTUB 4LDEB 1NCCL 4KWUA 4MNQD 1RZFH 1IAOA 4JDVA 3LKNB 3QXVA 3K0WA 2PR4L 4NFCA 4L1DA 4L4JA 4NWUL 3NBNA 3RVWD 1UWXK 2HJKA 4WO4D 1GH7A 1MFDL 4BZYA 2F8XC 1TCRA 4HC1A 25C8H 2FH6A 4XP4L 5DDHA 4UQ3B 1LEIA 5I1DB 4DKFL 1DVFA 1MH5A 2DQJH 4P2QE 4FP8H 1B90A 2BY0A 2AJUL 1FZKA 3CDYA 1QHOA 3IFPB 3MLTA 3WFEL 4LLDB 4N0FB 1NFKA 4Q9RH 1N0XH 1BX2B 4HKXB 1RZGA 3DX8A 3HC3H 3O11B 4NKIH 4WW1A 5I9QC 1EERB 1N2RB 3MROA 1UB6B 1LEKA 1PZ5B 1XZ0B 4M7ZC 3WS3B 4PRPA 3V4VH 4HLZG 1HILA 4G9FE 3U9UB 1RK1A 2MQ3A 1X44A 3VE0B 3KNBA 5IHZB 4TQEL 3O8XA 1IRAY 2JJVA 1C08A 2Z93B 5DEFB 4OM0H 3CXHJ 3IU4L 2WK2A 2E27H 4YDJB 5KAQG 3SE3C 4KZEH 1YUHB 2DI9A 1OB1A 3ZSSA 5KVGL 1F00I 3N1PC 5CSZB 3NTCL 4U3XA 1J1PL 1ZHBB 3G08B 4HXBL 4Y2OA 4G6KH 2ADJA 2PYED 3SDXB 1HHHB 3BW9B 1R5IB 4Y2DD 1TCMA 1AY1H 1MREH 3LD8C 4XNQA 3V6BR 4GAJL 5DC0A 1GGUA 1LP9E 1GPOL 4R0LB 4OD1L 1R5WB 4ZDHB 5E1AB 5IHUH 4PB0L 2FHFA 5CUSH 3P9MA 2E6PA 3BYTA 1ZTXH 5L6YH 3UTTA 4PG9A 5J1TC 1QFWM 1JGLL 4WNQA 1FE8H 1C7SA 1VCAA 4QTIL 5DUML 1BF2A 5J4MA 4LDLB 2KL6A 2R0LL 3UBXB 4AT6B 2VZVA 4G7YL 2VLKE 4NBZB 5JA9A 1QSZA 3QWQB 1MFCH 3DI2B 4OF3A 5D72L 5B8CC 3LKOA 1KCSL 1QD0A 3TYFB 3O45A 3QG6A 1FFPB 1JHLH 1G0YR 1RZ7H 1DJSA 2EDQA 2G75B 2HKHL 2D7TH 4S1RL 5D2NA 3IRZA 4NC1C 3T0AA 4ZD3H 3V6FA 3B3IA 4OQTA 2HFEB 4Z7WF 2BX5A 5I1CH 1I3VA 3ARDA 3DV4A 5I75C 1IGFL 3E6FA 2EE9A 3U0WH 3BD5A 1ZVSB 3MBEB 5DDHB 3O3DB 5L2KB 3EHBC 4ODVH 5GGVY 4OM1L 2LV4A 4FQCH 2ITCB 2O5ZL 3UYRL 3BP6A 2I24N 4KU1A 4XNYL 4GAYA 5L2JB 1XT5A 4LSVH 5I8EA 1BX2A 3A6CH 2QSTA 5JXAL 4OZGF 5K33A 4GG8B 5IK3B 2H9GB 3GSOB 5C2BL 3OKNA 3GSXB 1ZV5A 2BCKB 5DVMA 1G6RA 1P5VA 4U7KA 2NYYD 4M6OL 3F7VA 2X41A 3CC5B 1RK1B 1A4JA 5FF6B 5HHMD 4NPYA 3E3QE 4UB0H 2ZSVB 1FPTH 1OAKL 3D5OF 4YGVB 3U9PH 5J12C 1NMCC 2XZCL 1RZKL 4ZUVA 4DKEH 5DQ9B 5KSAB 3LS5L 1WZLA 3TWCH 4IHOA 4NZUH 2HVJA 4FG6C 5CD5C 2VDOL 5CWSB 5IFHH 5FGSA 2Q3ZA 1MUJA 1FG2A 1WUNT 2J5LB 3BW9A 2OP4L 4HGMA 1A6TA 4RNRA 1FFNB 1SJEA 5IR1B 1KEMH 2A6DA 4KVNH 5D71L 5CEZL 2E7HA 5I9QB 4Z7NF 1MFEH 3BDXA 4PP1C 2NY6C 5ACMA 4F2MA 4LSSH 1D3CA 1F2XK 1UM5L 2K7PA 5KS9B 2NY1C 3NFPB 3F65A 4NN7C 4N0UE 3O6FD 1T0NB 3FO0H 2MPAL 3GNMH 5HYJA 1S7TA 2EEBA 2DL9A 5D1QD 1EO7A 3PIQA 4GKSA 3BAEH 3GRWH 2XT1B 3L3KB 2YPLA 3HE7B 4PJFB 1G0DA 1A6UH 1WIOA 3CCHA 2HN7B 1J87A 1QO3B 4PJ9B 4X8JB 4ZUUA 5KSBB 2VDML 4JQVC 1XGRA 2IALB 3AM8C 4ORZC 4XPHL 1FZOB 1RK0A 2A1WL 4WW2A 1MRFH 1TCRB 1T20A 3ZE0F 5C0GB 4NCC1 1A7PL 4R0LC 3FQNA 4TULH 3I9GL 1IZJA 3P0GB 3WIIH 5L9DH 3ARED 4HIXH 3E6FB 4LLDA 1MHPH 4O2EB 2IGFL 3VGDA 2FATL 2DB8A 4YUEH 4D2NA 4LFHD 3U36A 1AD0A 4QRTA 5D7KE 2VLKB 1KXQE 4JFXB 5FYJU 1RHFA 3H9ZA 1LEKB 3QI9D 4MCZB 2SEBB 3D3VB 4J23A 4KRNA 1J8HB 3MODH 3QIBC 4XWOC 1F6FB 1OAUH 2MHAB 2JJTA 3N9GH 1X3DA 3LPFA 3RGVB 5GS0C 5I18H 3IS0X 2WQ8A 3BIKA 1T5XB 1ND0A 1OARH 1UVQB 1EHLL 4EIZC 2PO6D 2AV7B 4ZD3L 5IHLB 5CHNA 5HBBA 1GZPA 1JGUH 1A7PH 4CJ1A 3AU1B 3K1DA 4QRRB 3CC5A 1JL8A 2IPKA 1YUHA 4TUJB 2YA1A 1RULH 1XGYH 1JHLL 2OXGA 3OWEA 4YGVA 1YQVH 1LK3H 1BAFH 4BM7A 4Y1AA 4YEFA 1YEDB 4F37F 2YXFA 4BQ9A 3S88H 1ORSB 3X11B 1WF5A 5DQ9A 3OX8B 1OL0A 4AY0A 1T7WA 3GIVB 3RNKA 4D0DA 1VKXB 3OKDA 4P99A 4NHCL 4LLUB 4K3DL 4GSDH 1Y6KR 4PS4H 1UZ8B 2V9QA 3I50L 3JZ7A 4QYOA 2HJLB 1EAPA 4O58L 1C1EH 4X6CE 4MXQD 3QDGB 3F5WB 3FB5A 3KXFD 1I3RA 2X05A 4NZRH 1A7OL 4P23B 1OP3K 3LSOA 4LSUH 1YMMA 1HOCA 1KB9K 1IM9A 3S4SG 5C9KA 4ZPVA 3MUY1 3ZO0A 3BAEL 2ITDA 3IDIB 3OR7A 1YEJL 4XBEH 3BKML 4F80A 4CVZB 2ZPKL 3EOTH 4HHAA 3OKKB 1MI5E 4R7NA 4BFIB 5C08E 1IFHH 2RBLA 3DVNA 1MIMH 5DEGB 4K2UL 5T3XD 2YRLA 3PJSA 1AXIB 5BVJA 3QNZB 5FYLD 2UUDH 1CE1L 3V6FB 5TDOA 3B3IB 1HEZB 4NKDA 1JNLH 2NY4D 4MNQA 1NFIB 2DJ4A 2QQKL 3SE9H 2XZCH 3X12B 1IGYA 4JO2L 1NSNH 1XGRB 3CFKA 1CLYH 5LJYH 2FHCA 4KK5C 4PJAA 1OTSD 3TWCL 1OW0C 1PLGL 1YNTB 2BVUA 2PXYC 3LKPB 2WUCH 1DE4A 1A7QL 4GAYB 4TSAH 3MRKA 3RVXD 1GGBH 1EO8L 5TFSL 4K07A 4UOW1 3QCUL 3PDDA 4Q6IB 3GSXA 1XF5A 3B2UC 4XNXH 3LQAC 3SY0B 4KDTA 1R3KB 1N5AA 1UWGL 1G6RB 2CDEA 5T1KB 3RKDC 3ESVF 3D3VA 1HXMB 3D25B 4LGSB 4Z7UF 5IIEA 2PO6C 4NN6B 2X1OA 1KV3A 4XVTH 1FQ9C 5DRXB 4P46B 3RWDB 5FGBC 5BO1H 2DBLL 1VACB 2Y6SD 1Q9OB 5D2NC 4DQOL 2R4RH 2HP4A 4EN3B 4HZLB 4LLQB 1AQDB 4J4PC 3QXDB 2NY5L 1X5HA 3SDCA 4M62H 2ZSWA 4JN2A 4PLJC 4H1LB 1IKFH 4KDVA 4XVUD 4EJ1C 5C8JA 3AMLA 4W68A 4U1LB 5HY9A 3S34H 2AP2A 1QBLL 1AO7D 4Q0XL 3OKDB 1NAMH 2FEEI 1YJDL 3H7BA 4MJ6B 2NY4C 1ZGLM 4OCWL 3RTQA 4D9RD 1YEEL 2AJXL 1X9QA 3QXAA 1ZSDA 5DGQA 3QIBB 4AIXA 2J6EL 3QNXA 4XMPL 3IXTB 5J9PB 1HYSC 1ZT4B 3ARGD 4IMKC 1A6AB 4YXKL 3LEVH 4OBSA 5MERA 3DUUA 3N85L 3O2WL 3FQRA 3O6MH 4WTXA 4LCCC 1J05B 4XNUH 3WFBL 4P23A 2AABL 3VJ6B 1S7TB 4JZOA 1X5YA 4DZBB 5FDWB 4S1SH 4LASH 5C2BH 1U6AH 2NTFB 2XPGB 4PRBA 4ELKB 2VERN 4U1JB 43C9A 5EN2A 3HZVB 1WFNA 4PBXA 1QFOA 5L6YL 4E0RB 2XTJE 3TBYA 3H42L 4GO6B 1A14L 3DSFH 1TETH 3DVNB 1BOGA 3MFFB 1MJUH 5BOPA 4G8GB 5B3NA 5FUOL 5A43C 1BZ9A 3QDAA 4U1KB 5BVJB 4NQDD 2ZOLA 4LEOB 3D85A 4YQXH 5T1MA 4J3WA 3WHXA 4I48B 1AJ7H 2VXUH 8CGTA 3UPCA 1E28A 1PD6A 5CFHA 4JY6A 1OAYL 1TJIL 1LO3H 4MMZC 5DUPL 5T5FL 4P5KB 2P8LA 4XTRD 1VDGA 3HR5A 3LPGA 2Y06H 3MRJB 2EXWC 1Y6NR 4ZTPL 3TIDB 1H3UA 1RJYA 2WBJC 3FONA 1R24A 2R69H 1FL3A 4NZJA 4OJFH 1PZUB 1QPPA 1QG3A 3HC3L 1UM4H 3IGAB 2I60H 2RQ8A 1KPUB 4WTZG 4R8WH 2BNQB 3QUZC 5KOVC 5IWLC 3SEPA 2ZG1A 1NL0L 1VADB 3ZKNC 2GFBA 3QDHA 5DJ8B 3AU1A 3D2UD 3OKYA 5IEKB 5C0IA 4KQ3L 3TV3L 5T3ZD 3KYOA 2FIRT 3GZKA 2FB4L 2VLLA 1NAMA 3K2UH 4HUKB 3U6RA 3V8OA 3ULVC 4X83A 4F7PB 4MXQC 3BZEB 3U0PA 4NGHH 3NMEA 3OR6B 5B38B 4XVUC 2XTJC 5AZEH 1P1ZA 3S34L 3AREA 4NUJB 1I9RL 4G8GD 3M8OL 1DUYB 4JHWH 2F54A 3RY6C 3GMLA 2J6EH 1OF2A 4X99A 2OLDA 1TVHA 1OTTC 3SE9L 1MPAL 3MSPA 4KK6C 1NH6A 1EXUA 3VFMB 3LH2L 4OLYL 2VLJE 4WJ5B 3GFUA 4YGAB 1I3RB 3OGCA 5D5MA 3DGGB 3SDYL 4OLUL 3CVHA 2BVQB 5J1AA 4F9PC 1FG9C 1ZSDB 4PJHE 1MCOL 1ZT4A 4NN6C 4X7SH 4X5WA 3T3PF 3VW3L 4HV8B 3IDIA 5C3TA 2PUQT 3TH3T 4GH7B 5H8DA 5HYSA 4FZ8H 1WIPA 4H26A 5EO9B 4HHAB 2HH0L 2OQJA 3W9EB 1BWWA 3DXAD 4LVHB 3EO9H 2AEPH 3ROLA 4P2YA 5DLMH 5E8NA 4QEGA 2C5DC 1DQMH 4NIKB 3MNWA 1QACA 2R56L 2ADGB 4OCLC 5TDOB 2AJUH 3ARZA 4UV4H 4G9FA 4S0SD 3CFEA 1WCBB 1I9EA 1YQ2A 4YK4B 2NY6B 5GGUB 1ZHKB 5I1GL 4YPJA 4KRPC 4OLWL 3UO1H 1J9CT 4K3DH 1JV5B 1CU4L 2QBWA 2Y06L 3F6IA 5CD3B 1MCPL 2Q3AA 3TZVC 2M8XA 3S8WA 2EDXA 3O3AB 1URLA 3Q6FB 3NN8A 4N9OB 1U9KA 5I30H 3VXNA 1KGCD 5IQ9A 2CLVB 3RIAF 5E9DA 1OAXL 4IRSD 4JGMA 3P4OA 4YHMH 2JIXA 1WQVT 1TJHL 1CDCA 4Z7UE 5EU6A 3ZT5A 4DAGL 3RY5A 3VGHA 4UT7L 4XCFL 1R24B 4RGOL 4XVSH 2DL2A 5FA3A 1FN4A 1QSFB 3MRGA 1W2KT 3DSFL 5IIEB 4R7DA 1LP9A 4XBEL 2FJHA 4QOKE 2BNRB 1JZ5A 2YOCA 4P46A 1Q8MA 3IDYB 2OTPA 1SYSB 4NQCB 5D1ZB 2BNQE 3CXDL 4IJ3C 3WKNA 1DVFC 4L8BA 4NKMA 5B39B 4HZLA 1OD9A 4LAQH 4ODUB 1NJ9B 4HPOH 2R2BA 5L0QC 5JXEA 4LAJH 4N8CL 4O2CA 4JN2B 2G2RB 4TVPE 1SEQH 5D7SH 4ONGH 5JW4M 4X9IA 1R3HA 4LQ1A 4HG4J 1P1ZB 2IQAB 1Q0XL 3KPPB 3WBDA 2FYYB 3H3BC 1NANH 4QRQB 5JIPA 3DYMA 1NAKH 2EE3A 3ARBC 1EMTL 3HLAB 3S3SA 3TO4D 3QNXB 4IOFC 2J88H 4PJBF 5EB9A 1T0MA 3BVNB 4HJGB 1DTUA 3H9SA 3MLWL 1A6UL 5F9WC 1CT8A 1QRNE 2V7NA 4DZBA 4OD3H 2PYFB 2HTLD 3PV7A 4AEFA 3RKPA 5IESH 4NQXA 3IDJA 4LOUD 3GSVB 1ZLUH 4RBPH 3C5JA 3GMRB 3T1FB 4LSTH 3JV4B 5IJKC 1X5XA 3TBYB 1A4KB 3W9EA 3LKSB 5GHWH 4NCDA 2E8YA 3OKMA 4JKPL 2OJZL 1CLOH 2OBGA 1F8TL 3MLTB 1BZ9B 1YPZF 3D0VA 4MA8H 3D48R 3ILQD 4ZO7A 5ISZD 3EDDA 3JV5A 2GSIA 3IU3B 2EYSA 1CDGA 3B9KA 3PV6A 5ITBH 5J1SC 4XVSL 1N2RA 2PTTA 3OSKA 4PY8I 3TM6A 5DO2C 3QPQC 4OB5H 2XKSA 2HFGH 4RIRB 4MAYD 1VEMA 1EGJA 4MNQE 3V5HA 5E6IC 1ADQH 4DN4H 1W72H 4OGXL 3O8XB 1YN7B 1BFOB 3S98A 4P5TB 3U83A 1BJ8A 1VGEH 4LIQE 2ZNXA 1OCWL 4JFEB 1VGEL 4I4WA 4DUVA 1EH9A 2ZCLH 3IDXH 2LAGB 4J6RL 3U2SA 5GS2D 1DZBA 3ZE1F 3AS2A 3ECBB 3CVIL 3O6FC 2IF7A 2D4DA 1FFOA 5BMFL 3F6LA 4N0CD 5EC1B 4CNIB 5JW4Q 1QLRB 1RUPL 1S7QB 1U3ZA 2X2YA 4WUKL 4PP1D 1FVDA 1IGTA 4JKKA 3DYOA 1H3GA