3U2SA

Crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
236
structure length
225
Chain Sequence
ERLVESGGGVVQPGSSLRLSCAASGFDFSRQGMHWVRQAPGQGLEWVAFIKYDGSEKYHADSVWGRLSISRDNSKDTLYLQMNSLRVEDTATYFCVREAGGPDYRNGYNDFYDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PG9 heavy chain
total genus 42
structure length 225
sequence length 236
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u2sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u2sA01
3K4ZA 1AGEB 4OZIF 2ZCKL 4Y4KA 3QWOA 2OL3A 4POYA 5MEOA 4MYWB 1CGVA 4UT7L 3ARGC 2LU4A 5IOPA 5BS0B 4WUKL 5KSBF 1JZ5A 3W9EB 1KPRA 3WHXA 4TNWF 5I16A 4RBPH 1E4KC 3MLXH 1TENA 4EXPX 2APFA 1EO8H 2PXYD 1HIML 3C60B 4PJGE 4NKIL 1RZ7H 1RZJH 8CGTA 3KDMA 3SPVB 3ZYOA 1SBBA 3ZKMD 1XIWD 3IDNA 3O11B 4Z77A 5I1EL 4PB9H 4PJGA 2HKHH 1IJ9A 3MA9H 5CEYB 3LKQB 1BD2B 3RY5A 4U1KA 3UDWA 1LO5A 3OGCA 3EYFB 4OBRA 4OQ1A 4ODVL 3U36B 3V52L 4ODWA 2FO1A 5LCVH 3KXFB 4Y2DD 4UUJA 4BFIA 2A9NH 1BM3L 1J8HA 3HNTL 3MUJA 3WSQL 4JB9L 3KYMA 3N85H 3MRIB 1CXFA 5EUOB 1ES0A 4P2QD 5DZOA 1FZKA 4EI6B 5D1ZD 3MV01 1VPOH 2NY1D 2A6JA 3ZDXF 4W4OC 5JMRA 4JFDE 1ERNA 3KG5A 3IVKA 1LMKA 1NGWB 5GS1A 3SDDB 4R90L 2PTTB 4HJGB 5HI4D 5IP4A 4EUPB 1C16B 1YYLH 3SCMC 3JV6B 3NFPB 1MLCA 2JCCB 4QWWC 4LSDA 3V8CA 2F53B 2IANB 4KJQC 5EBGA 5JPMB 1OPGL 3A6BH 4Z76B 1S7VB 4TOYH 1A4JA 1IQDA 1JPSH 3VWKB 2NCMA 3LKRB 1IL1A 5I1CH 3GK8L 1X5ZA 2FIKB 2R2HA 4C56B 4RMQA 1MCPL 2HN7A 4NT6A 1F2XK 5F7LB 4R9HA 1DVFC 3KPOA 4L3EE 2OX5A 5KS9A 1DQML 1VEPA 1AXTH 3LEYH 1ONQB 4PS4H 5HVGB 1AO7A 3MV9A 2EYTA 4R97B 2AJVH 2X70A 3W2DL 4GQPH 4JM4H 5FDWB 1Q72H 4EI5A 1T1YB 2YD1A 4Z95H 2XZCH 2KDGA 4Y4FD 4XVSH 1Z5LB 2CIIA 35C8L 4PJ9A 4FFVD 5GGQH 4CU8A 2RB8A 5EBWA 1R24A 3KR3H 3NCBB 2NY2B 2AGJL 2X9YA 4HFWB 5DDHB 5HHNA 4XCYA 3ARBD 1J1XL 1WITA 4PJFE 3BDBA 2VDQH 3JWDC 5E7FA 1X5LA 4J23A 3ARDC 3MLZH 3C9NA 3KPNB 4HS3B 2D7TL 1OB1A 4N0CD 4ZFOB 2ZUXA 1T5XA 4O2CB 3C6LD 1M05A 2RJMA 4OM1L 5I8EA 3MBXH 3PDOB 3QQNA 3V7AG 4PB9L 4WHYG 3L9RB 3GMQB 4OBSA 1HSBB 1X5YA 4JG0H 4N8VG 5F8RC 5IVZA 4P4KD 2O93L 1HDMB 3MCLH 3X13A 5FKAA 3DVGA 2BVQB 5SV3A 2PF6A 3EFDL 2CK0H 4PGBB 4S0SD 1A3LH 3TWCH 1CZ8L 4ZXBC 2ARJB 2A73B 2FSEB 1I4FA 1AE6L 4ZUVA 3TJEH 3EGSA 4H20L 4OV5A 4NRXA 4XMLH 4M1DL 1CFVL 4OCLC 2I26N 5ALBL 1H15A 1YPZE 4R26H 1NFDB 1J8HE 8FABB 3EZJB 3D87B 2DQDL 3GSWB 3SDXA 4YHZH 1ACYH 2FB4L 4K3JL 4S1DD 5FHAH 5FAAA 1OD7A 2VLMD 1OP9A 1UADC 2P8PB 3C5ZC 3IJHA 4OZGE 3AXLB 4HXAH 3ULVH 2FO4B 4JFQA 1P4LB 4GMSH 1VFUA 5GRUH 5IMLB 5IOPB 4P2QA 3AY4A 4GG6E 3VFTB 4LL9A 2FJGB 3BIKA 5ID1B 3NFPA 4BUGA 4PV9B 3TBSA 1YJDC 2X4RB 5DEFB 3O4LD 3G6DH 3VFSA 4U6XB 2Y5TA 1DSFL 1T3FB 1T1ZB 3FFDA 5IFHL 1II4E 5IHZA 1T0NB 4KJYA 2ZUYA 1RUAH 2UWEF 5A2LH 4BSWA 3FFCB 5IEKB 4UV4L 1ZLUH 1EUUA 1IGJB 2WQ8A 2CRYA 4LPXA 1BOGA 4V1DD 1SYSB 3KXFA 5MHSD 2BSED 2ZSVB 4LHUG 3NCYP 4U6YA 4LEOB 4UBDC 4DCQB 1HN1A 2COQA 5DUMH 1OCWH 4KJQD 1FLRL 3NPSC 4P5TC 4OSUL 3RY6C 4BKLB 1RZFH 2YUVA 4DZBA 4HIEB 3QNXB 3S34L 2X41A 3QAZB 4R4NC 3ZE2F 5C6TL 4U6VL 1FL3B 2AQ2A 3U2SA 3NH7L 2XY1A 4FQQA 4KUCD 3VRLF 4Z77B 4G9FD 1ZVSB 1XGYH 2ESVE 2M1KA 2VDKL 5EU6E 4PJ8A 3O2DH 3IDMB 5I66A 1AQDB 3UTPE 2DRUA 3IFLH 3NACL 2VDPH 4PLJD 3ZT7A 2VLJE 4MXWL 3NZHH 1QBLL 1FAIH 3ZKQD 4N5UA 5FECA 3C6SA 3X13B 1CGUA 2BC4A 5GGRB 3LPFA 4S1SH 1D7FA 4DK6A 2AJXL 3VJ6A 1MJ8L 2YPLA 3NA9L 5L2JB 5J0BA 4HH9A 3LOWA 5EOTA 1FL6A 2BVYA 1B90A 2X4PA 4WFGE 3MLPA 4G5ZL 3BKCH 4CADB 1YEGH 3RZWA 1N7ML 1G7MA 3DXAE 1CXLA 4NKMA 4KVCL 1EHLH 4F7TB 3S96B 2VAAB 3FJTA 2EDWA 1LO0H 5GRYA 3WL9A 2F58L 4KRPB 4JVWA 4UAOC 5KSBE 3KHOA 1GPOL 4V1DA 3GMNB 1CLYH 3B2UD 2DD8H 2AVGA 2XQYG 3KLAB 2J12B 4Y1AA 3WKNA 2Z9TA 2GJ6E 1N59B 2CIIB 4I3RL 3ZO0A 4HGKC 2CLZA 3L5WA 4YHLH 4GKSA 1HEZB 4JM2B 4ONHB 4RGNE 4IIQC 5EBMB 3IKCB 2XKUA 3N9GL 3WJLC 4G8IA 1N2RB 5DJAB 2L7UA 1RUML 1WZ1H 5E1AA 5C0EB 5FYLD 3T04D 5FFLA 4DZBB 4N8CH 5IB2A 3K0WA 2Y25A 1J1OL 4RFNB 1RZJC 1I1FB 1OWRM 3MUGA 1FP5A 4HJJH 4D0BB 1I7RA 2BVTA 2BVEA 3OKYA 2DMKA 2E6PA 2WBJC 4FTVB 4HSQA 2Y06H 3MZTA 3EYOB 4LHQB 4DFIA 1HXYA 4PRPE 1S7VA 1JP5A 5CJXA 2FGWH 1RULH 5IQ9B 3V8OA 3NZ8A 5F3HB 2J4WL 1NCDH 3M17A 1JPTL 5FGSA 3FN9A 5J4MA 3EDJA 5I1GL 1FCGA 1A47A 4NKOB 5D8JL 5C6TH 4LNRA 1DE4A 3LRSA 2J5LB 1WBZA 4JFDB 3OJDA 3RY4A 4RGMB 3U6RB 3LS5H 3CGTA 3O2DL 4ZAKC 1UKTA 3GO1H 4E41D 1CICA 4LARL 5LQBL 1K85A 4MXQC 2WUBH 1VPOL 5JXEC 3BRDA 4X7SL 4L1HA 1KIQB 1ZA3A 2FDBP 4OUUA 3GSUB 3NZHL 1HNGA 1XAUA 4OLWL 2VC2L 2FBJH 2GIYA 3S9DB 4Y5XA 3QDME 1KJVA 4ZFGH 3P0VL 4LPCA 3LKQA 3DSNA 2NY3D 4M6OH 5CIPB 1WWWX 5IW3A 4N0YH 2ZUUA 5B39G 1QPPA 3MRKA 1I9IH 3BP5A 3BKCL 3EHBD 3NIGE 5D93B 4NFBA 1TTFA 3QWQB 2XTJB 4CRPA 1LK3H 1LK2A 4P9ML 4NJ9L 4ZSOE 2VSCA 5IESL 5DMIL 5IK3B 4Z7OF 1FZJA 1S7RB 5DJ6A 4UT6H 5BMFH 1HINH 3E2HB 1N0LA 1BJ8A 3ZTNL 3DVNB 4HIIB 2Z31D 4ZSOA 5FGBA 1S7WB 4WY7L 1FFRA 4HMDA 5HJ3B 4UT9H 4NZJA 2X05A 4Z95L 5HGHA 4XPAH 3SY0B 3LDBB 1B2WL 2BSRB 4XP5H 4HUMB 2H9GA 3PGDA 4F7EA 1FVCB 1MF2H 1K8IA 1OAQL 2EDHA 3MNZB 4FQLH 4JREC 5F7DB 1BFVH 1ZKAA 4NPYB 1HH9B 2BXYA 3U0TB 1A7QH 1AGBA 4TSAH 1MAMH 3F7PC 1DBBH 1W72A 5BV7H 3CFBB 4YR6A 2DTML 4OGYH 5DRZB 5GGVH 1P2CA 1A6UL 2ZSWA 2A9ML 3NABH 1TFHA 3TO4D 5SWZB 4Q9BA 3IAPA 4GH7B 4DAGH 4R2GB 1IZKA 4UU9A 2DI9A 3QA3A 1ZT4A 5J6GB 4LSVL 2QQNH 1KPUB 4PJEE 4QXTB 4DFHA 4DTGH 2HT3C 2NXZB 1JRHI 4KK9D 3HFMH 4YZFE 5JUEH 2X4QB 4HFWA 4PRHB 5TF1L 2VABB 1ZLWH 1KCRL 1R0AL 1A3RL 3NGBC 4MHHI 4GXVL 4CMMA 5KSVB 2D7NA 1UA6L 5F9JB 5SV4A 1X5FA 2RR3A 5EFIB 4HK0B 4PRDA 2UWEA 5MP6L 5ANME 1NGQL 2GI7A 1E4JA 1A14H 1BFTA 1E28A 1W8OA 1AY1H 4YFEA 3MRCB 5DFVC 5I1LA 1INDH 5H2BA 3KYKL 4XPTL 1KN4H 4HWZB 3UJIH 5MI0B 5HVWA 4KK6D 3Q6GH 3TVMB 4MNGA 4Q9QH 2FIKA 5JHDE 1QHOA 1YEHL 1B0RA 1S3KL 4XXDB 3JZ7A 4UDTB 3DJ9A 1XGPA 1ZLSL 1T21A 5I1KH 1QQDA 3EDFA 5CEXB 4J12A 2XZZA 4QRPD 1QP1A 5DK2A 3IDYC 4GMSL 2GJ6B 5EU6A 4MJIE 5BJTB 1ZHLA 5LAXA 1XF1A 3MROB 4MCZA 2DQFA 1UJ3C 2JJTC 3HMXA 4GQ9L 2V9TA 4FQQB 5SX5K 3EYSL 3D0LA 2B0SL 3W39A 5I1DA 2V5RA 3TNNA 1AR1C 1NGPH 5BMFL 1FQ9C 5ERWB 2IPUK 4YUEL 4ONOA 5DEGA 4JRYE 4LPUA 5IB3B 4LOUD 1NCBL 5F7WC 1KTDA 4ONHA 2H32A 5E8DH 5CEZL 1FRGL 4S1QL 1D5IL 2ERJB 1HYSD 3T08A 1CICD 2O5ZL 1KXTB 2QKIA 2K7PA 5IIEA 4M43H 1I7ZA 3VG9B 2EEDA 5GXBB 2DQUH 2H1PH 5IVXB 5GQBA 3TESA 4A6YA 1L4IA 1KJ2A 4X6EA 4D3CH 1I1AC 1K4DA 5E6IA 1BGXL 2CR6A 4V1DE 4KY1H 4NPYA 1F97A 4FN0A 4NC0B 3VXSD 1CTNA 43CAB 1T2QH 1QSFB 3TBWB 2ESVB 1FYTD 4YHYC 2MHAB 5ENWB 1TETL 2QQNL 3FT2A 4HGWA 4YBLC 5D2NB 5HI5C 1NJ9B 1UM6H 3HUJE 4Y19D 1XF4A 3L3OB 3PV6A 2FX9H 5TF1H 1NEZB 3RJDA 4WU7A 5C9KA 3O6FC 5HHQB 3G5YB 4K2UL 4XTRC 1U93A 1J05A 2ZCHH 4FQCL 3VI4E 3HLAB 3OPZL 4YFDB 5L88H 4QHUB 1XGRB 4L8BA 3CX5K 2Y23A 4J3SA 3SGJC 1PYWA 1P9MA 3U4EA 1BZ9A 2GITB 3GDBA 3HI6L 3HR5B 4OF6A 5HPOA 1FN4B 4KZDL 4X6FA 3EYQC 4XNYH 2DL9A 5K9JH 1GGYA 5A2JH 2KQNA 2X4UA 5FYJH 3VD3A 3U30B 5C07E 3EGSB 5EB9A 4OV5B 3T0VA 3FAXA 5L6YL 4M7LH 1A7OL 2DDQL 2VTFA 1HQRB 5JZ7D 1FPTH 4J1UA 4TVPD 4HKXB 1DBJL 4OJFH 2A74A 2B20A 3IKKA 5HGBB 2DQHH 5ITBL 5T3XE 4WGWB 2R0WH 2BNQA 1CE6A 1W72L 4RWYH 5D1ZC 4H1LA 2ZP0T 5E99H 2B7DT 1ZHBB 1WIUA 4O4YH 3DRQA 3QDAA 2CDEB 3C8KB 3V9FA 4URTB 5DQDL 1TZHB 4R7DB 1PSKL 3O9WB 1A5FH 4XVTL 5IQ7L 2YN3A 1YEKH 3UAJD 4EDWH 3O8XB 4I0CC 4JRYA 2APBA 5JNYA 4U1LA 5F88B 3FQUA 1VEMA 1L7IH 1CXIA 4HJJL 5IHLB 4RGND 2Z35A 3L7FB 1MWAL 1XGQA 5AWNL 1CDHA 1MCNA 3DRQB 35C8H 2XNAB 4J2XA 3OKEA 2EZ0C 4HDIB 1JRHL 1FBIH 3H3PL 4HAFA 5ELIA 1IM9A 4JDTL 3UZEA 5D96B 4KQ4H 2AK4B 3D39D 5KSVA 4Y4FC 5JW3L 1CDGA 1AGFB 3AS0A 5JW5A 2WSKA 1C08B 4LKXA 3O41A 1IC7H 1MRDL 3AU1B 2E7CA 1U8JB 5FOBA 3WXVH 4XMPL 1MJUL 3IDGB 1S7XB 1B4JH 3FTGA 5CBEA 4PJCF 2F5BH 4AH2B 2E7HA 4P59L 1QSFE 1JFQL 2W9EL 3A6CL 3BQUB 3KPRB 3REWA 4CADA 1YEJL 1HQ4B 5DRZA 3DVGB 3SDDA 4H25B 2DLFL 3DI3B 4XCEA 1K2DB 1C1EH 3QEUA 5BW7C 3VXOB 4K7PX 5CINL 1AR1D 1J1PL 4PP2B 1WTLA 4UINH 4RFNC 4QHUA 4NWTH 2F54E 4X0KA 2Q7YA 3WNOA 5I8EB 3L3HA 4Q2ZA 3OB0H 5DR5H 1EBAA 4AG4H 5A3ID 3C87A 3T2NL 1O7VA 5DJCB 3O3DB 3UYRH 4JM2C 3MJGX 2Z93B 5FYKD 4NJ9H 5IESH 1UENA 2IQ9L 4U05A 3MNZA 3NFSL 1NFKA 4LSUL 4CMHB 2H3NB 3STLB 3ZDZF 5J12B 4HS6A 4MB4A 2FH6A 5HYJB 2W07A 4YIQA 3BGMB 3QUZC 3VGBA 2AV1A 2JE8A 3FQTA 5GRUL 4C58B 2HH0H 2WLZA 5HHVL 3BFOA 3EO1A 3KDMB 3SPVA 4WUUE 3BX7C 1OAQH 4FQIL 5DC9B 2GT9A 5AUMB 1UZ8A 1LILA 1KIPA 4FZEH 4IBLT 4HCRL 5HGAB 1OGAE 1TLKA 4PJDE 5MEPA 4F7MB 4HWBA 2DL2A 4MJIA 1K5NA 1I1AA 3EYUL 4FFZH 4PJ9C 4YQXH 5KVGL 4PJDA 5T1MA 1XF4B 1MVUB 1ODAA 3RIFF 1VERA 4OLVL 5CWSB 2YA2A 2DWEB 2NY1B 1GC1C 3NAAL 3A6BL 3U6RA 1MIEL 1RZIA 4C57C 1F8TL 3RVUD 4LP5A 3OAUH 2JCCA 4X99B 4IOFD 4TYUA 3D0LB 3UC0H 2Y9RT 2X4NB 5C0CA 2QQQA 2IJ0C 4PS4L 1TQBC 4P2QE 3PHQA 1MVUA 1ZMYA 6FABL 2HYMA 4CN6A 4GG6F 2JB5L 2PYEA 7FABL 1G9ML 4RISH 3G6JA 4YPGA 4LNRB 4NNXB 3WFHB 2WBWB 5ID0A 4WHTB 2WWMC 3BSZL 3FO9B 2NXZD 2MCPL 1L0YA 1A1NA 2D7OA 2QQLL 1OL0A 5F7MC 1VADB 3KJ4C 1IQWL 3Q6GL 1KCVH 4G43A 1JFQH 3CU7A 4ZNEE 1PEWA 5DYOA 3U7YL 3HC4H 4Z7QE 4F37K 2XFXB 3RGVD 2EE2A 1T66D 4LLMA 2PW1B 3DECA 4R2GD 4N0CC 1DBAL 4G8IB 2FLBT 2CDGB 3MRNA 1RAMA 3QHZH 1LP9B 3ARFB 2FJFA 4HIJB 1N6UA 5DFTA 2KPNA 1MUJB 3PG2A 1PG7X 4ZUWA 3CMOH 4XCFH 1LNUB 4I0PB 3MBED 2DQFB 2XA8L 2NY6C 4HUUB 1IC5L 3I84A 3O6KL 2R1XB 4NRZA 1PFCA 1LHZA 4WUKH 1QLEL 4EVNB 3MPCA 3L3KA 4YBQD 4LSUH 2EEAA 1A1NB 4DW2H 4D0DB 3OR6A 4U2YA 5CHNA 3KLDA 3RUGF 1MHCB 4Y7MA 4XP9H 4QRPB 4N5ED 4NKMB 1DUYA 4Y5VC 1S9WA 5C07A 1AGEA 5DI8B 2KUTA 1S5IH 4OZ4B 2DQJH 4FXKB 4PTUA 4NN6B 1YNLH 2UY6A 4CW1B 4XPBH 1FVDA 4ODVH 3C5ZB 1E4WH 1YY9D 1JE6A 3DUUB 4UTAH 4ZUUA 2DD8L 2BOBB 2D4DA 1XF3A 4JDZA 5IMKA 4LCWA 2A2QT 3SBWC 1PZ5B 4MZ3A 4HEME 3QDMB 4Y4HA 4NQDD 3L3DA 2VRAA 2BNQD 3TA3C 3JSSA 3S36L 2BRRL 2FHBA 3BD3A 4U7MA 2W1NA 1JPFB 2AKRA 3ULVL 3MRMB 4P9HH 4GKNA 4XCCL 4RMTA 1RIVL 2IANE 4P2RB 1T1YA 3DMMD 4OIIL 4FQ2H 1H5BB 4MA8L 1KELL 2QSCL 3VXME 1WJ3A 4R96A 1Z2KA 3B9KB 3BGFB 2Q87A 3VFPB 1HH9A 1PX4A 3GK8H 2JB5H 4YK4B 2HWZL 3AB0C 5K93A 3ZL4H 3MRJB 4M5ZH 1VGEH 1IGYA 4L4VB 4MNQB 5JW4M 5LAXB 4Q9RH 1HHHA 2X40A 1J5OH 4QRRD 2WAHA 5HYSA 4D9LL 4QRQA 3HC4L 4NBXB 1ETZB 5A2IH 1IGJA 2EIEA 3GO1L 2IALA 4XVSL 5SWSB 3QZWA 2AGJH 1Z6JT 2DJUA 1CXKA 5EUOA 1RURH 4U6XA 4FZ8H 4X6CE 3B9AA 1U41A 3U9PH 3EOAB 5KVDH 4KJYB 5HI3C 4I48A 5L7XH 1MEXH 4N68A 2EDKA 3VFUA 3FTGB 5CBEB 5D7JB 3T0EA 3HAEA 3QIUD 4M7LT 1IM3B 4MAUH 4GRLA 2EDJA 5F70A 1UWEL 2H8PA 4M9OA 4JY6A 3TO4A 1KC5H 4OUUB 4QOKA 4NRYA 4BH8B 1I8IA 2X9WA 1CD8A 3ILPB 3U82B 4XAWH 2CGRL 2KL6A 3PWPE 4JFFA 1I9JL 4M61B 5E1AB 2N7BA 2OP4H 4UIKH 2EKJA 1P4LA 3E6FA 3RGVA 3GHEL 3O3UN 3H7BB 4H88H 4OFVA 2ERJC 4E0RB 2XZAH 5TPWH 2ZOLB 3H9HA 5IFJB 4LSPL 4OCWH 5FGRA 4BQ6A 4PGCB 5C0CD 2IALB 5HHQA 4ZO8A 5ADPH 3VGHA 4OAWA 2DIBA 4H20H 3HE6C 3HE6B 3VXNA 5B8CB 5ANMB 1S9KC 4GLRH 4UB0L 3BO8B 4ERSH 1R3HA 3QEHA 3L3DB 3IDXH 5EU6D 1EHLL 2Q6WA 2W0FA 2GQHA 3LKNB 3O6LL 5EU7E 3S37H 4Z7UE 5C0BB 3P73A 3N1FC 3NBNA 4U1MA 5T1KA 2YR3A 2W65A 4I9WD 1M05B 4X5XA 3CAFA 1A1OB 4NNPH 4HAGA 4P5TA 2P7TA 3BE1H 1PLGH 4QGTA 3PV7A 3PWVB 3NCCB 2HTKC 2G5BB 2G9HB 3RKDC 3GSVB 2YS4A 1CTOA 1Q94B 3TT3L 3KJ6L 3W81A 1J5OL 1AO7D 5KJRH 4QNPF 2R1YB 1LE9A 3LEVL 4G7YH 4JHWL 4Y16B 4EVNA 4LKCA 4BQ8A 3SGDH 3T2NH 4TNWK 4DZ8A 1FORL 2ATPA 4H1LG 4FNLH 2DQEL 3I9GL 1RUKH 4PJ5A 2AEPH 3GJEA 3TYGL 3B2VH 3KYAA 1H0DA 4WNQA 1FFPA 3TO4C 1FL3A 1YEHH 2X6MA 4TRPL 4U1HA 3DUSA 3MRDB 3TH3T 4MNHB 4L4JA 1JZ6A 3VW3H 2WBJD 2ITDB 4PJEA 1UQSA 4U1JA 4FQXB 2N56A 2BK8A 5FUCC 1HXMA 2FECI 3L7EB 3FOLB 5HHVH 1A2YB 1I1YB 2A1WH 2M26A 2X70B 1QRND 4KFZC 4N0UE 3F7QA 5BXFA 4JFOA 2LE9A 1KN2H 2ID5A 4Z76A 3S34H 4KROB 1NMCB 2UVEA 5F89A 4PRHD 5F3BA 4X7DC 4ZUTA 1DQJA 3O2DA 1OTTD 3SO5A 1U2CA 3BT2H 4JKMA 2BRQA 3MODH 3TIDB 3IS0X 4JJ5A 4ONGL 4JAMB 1NPUA 1DL7H 5FCUH 1RHHA 3BAEL 3FOMB 3HE7B 3IB4A 4HKZA 3ULUL 1J9CT 5DURD 1NGXB 5I1JL 1JNJA 4NSKA 1YPZB 2A77H 1FSKB 4KK6C 1IE5A 2GTWA 2J8UF 3BIBX 4PGEB 4EUPA 4WEBL 5E9DD 5DJDA 3R06A 4TPRL 5ADPL 2VXTH 4M61A 4U3XA 3NCMA 5I73B 5F93C 3OAUL 1J7VR 3TVMD 1PY4A 1EGJH 3LN5B 4WCYL 4GAYA 5GGTL 1ZAGA 4OLZH 4WWKA 4U6YB 2W0KA 4U0QB 1RJYA 4F7MA 4G8GD 3UEZA 3OAZH 3MLSH 3AS3A 2VR9A 1IT9H 3D1MC 3QFJA 2OQJA 5I18H 1EEZA 2CMRH 4GRMB 5ESQB 5ICZB 1TPXB 2DIJA 1RSFA 1W0VA 4YHPB 1BMGA 4FABH 3H9YA 5C0BA 5BZDB 2NTFB 3PF2A 4PRIE 1UCTA 3UTSD 4M5YL 3VGAC 2GEEA 5C2UB 5DQ9A 2QSQA 2E7LC 3TJHD 5B4MC 1EFQA 1RJLB 5KJRL 2GJ6A 5EU6B 5BJTA 1DR9A 4JM2F 2QR0A 3NABL 1RI8A 1NC2D 1FL5A 1LGVA 1HHHB 5EIIB 2XA8H 3KJ4B 4I0PC 5GRWA 2NLJB 3FB6B 4HPYL 3BUTA 5D2NC 3BN3B 1ZS8A 3CFCH 3IJSA 2EDEA 2E9JA 2E8YA 1FFNB 3GMQA 2GT9B 4AEFA 1W0VB 3GMPB 3SN6N 3VW3L 12E8L 4H25A 2P24A 1L9NA 4JQXC 3CUPB 1MLBA 5ETUA 1BIHA 1FFPB 4BK4A 1AIFB 5HD8C 1ZHNB 3ETBF 1QYGH 1QBMH 4X7TB 3H0TA 2Q8AH 3TBVA 3C2AH 4C56D 5I1IL 4IRSC 3LD8C 2ARJA 1U8PB 2HTKD 4UTAL 2VL4A 3AM8C 2NY1C 2DYPB 5GIRA 3JWNC 3K74B 1QFPA 2BVUA 3GEWB 4E5XB 1MOEA 1YZZA 5FIEA 5B8CC 4P9HC 4DJMA 1RUPL 4MD5A 2GSGA 1NMBL 2JIXA 5I1KL 1MNUL 3SDYH 5GGSA 2JELH 1NGXA 5KW9L 1FYTA 3QXVA 4WCYH 3GFUA 5D7KE 5DJDB 3WLBB 3T4AA 4GQ9H 1T1WA 1J0JA 3P73B 3I02B 3UTSB 4NDMA 1UEYA 3TBTA 4NQCD 4IS6B 5J89A 4G9DB 4KRPD 2AEQH 1I9IL 4RFEB 3H3BC 3TBSB 1BD2E 4JDTH 4QLRA 5C0AB 4QRRA 2G75A 4PV8B 1T6WA 2FHCA 4HJGA 2WLYA 1CFSA 1I3GL 4ZUWB 1EAPA 4FP8L 4N9OB 4WNQB 1GOGA 3MO1A 1VCAA 5J12C 3HNSL 1T89C 3OKEB 3SOBL 1MJUH 1JGEB 4G42B 4QT5A 4U1GB 4WENB 1OP5K 5I1HL 2XV6B 2QJDA 3BJ91 1S7SA 4QXWA 5DYOB 3FO0H 1AFVH 2AJ3A 3GSOB 5B3JF 1DQLH 4PRIA 3VD7A 4Z5RB 3BQUC 4BH8A 1RURL 2UWEB 1X5GA 2X4TB 5HY9A 5L2KA 1NKRA 3GI8H 3FB8A 5T3ZH 2VQTA 5ID0B 4LVHB 1AKJA 3TBYB 2HFEA 4L4TA 4PGBA 4NZDA 1HIMH 2V7HA 1SY6H 5CMAB 5DLML 1X4YA 5CIPH 3Q5OA 3C5JA 3BDYL 3HI5H 4LU5L 1ZHBA 2W65B 2YMXL 3QIUB 3UTPD 4HK3J 4M1GH 4DQOH 1OAKH 3GSRB 3V0VB 4P2YA 4HJ0C 4XBGA 5HYJD 5I1IH 2CUHA 3I6LD 1KXVC 1KG0A 5D70L 4XI5C 2YKLH 5D7SH 2KZ1B 3ULUF 4Y4KB 4HFUL 2D0GA 1OAUL 4HIXL 3RRQA 5BVPL 4LLWA 2P5EA 5DWUH 4TTGA 2W60B 1ZLVK 1F4XL 5F21B 3BKYH 3U79A 5FM8A 4WI7A 1FPTL 2M8XA 2RFXA 3MRRB 1QNZL 2V17H 3MRNB 5KW9H 4EDXB 4ETYA 3QFJD 4X8JB 4HGMA 1T7WA 4KTDL 4LLMB 4CNIB 5MERB 1FDLH 1HHGB 1XGRA 2AW2A 4YWGH 4FXLA 1BVLA 4WWKD 2GSIB 4HWEH 1NC4D 4MQSB 3W9EA 5JZ7C 4W70A 4HIHB 1CGYA 1PD6A 5I30H 4LQFH 5K9OA 1C7SA 4G3YL 1XFPA 1BZQK 4U1NA 3OXRB 1A7NL 5DT1H 3SKOA 1JHTA 4HS8L 4ZOCA 1MAJA 4X5LA 4H26B 5FGCE 1AXIB 1RUQL 3GSUA 4PGEA 2PNDA 7FABH 2EEBA 5DVOA 3QUKA 1ADQL 3IRPX 5GS1B 1M71A 5I1HH 4JDVB 5GZOC 3UTQB 3LQMA 1JRHH 3BP7B 4DN4L 3LKSB 4J6RL 3D18A 4F9LC 1A9EB 4R8WL 4Q6IA 3G5ZA 5IVXF 3ARVA 1LD9B 4G7VH 4OTXL 2P8LB 4NC1E 1EHAA 4MXVE 5HPMB 1X7QA 1UH2A 5IJVA 1AKJD 2XN9D 1IGYB 2RGSA 2X4TA 2IG2H 4ODBD 2APVA 3L3JA 2P8PA 2A1WL 5TF0A 1DZBA 1JHLL 1C5CL 3MZGB 4JY5L 3CFKB 4LVHC 1WVZA 3RGVC 4UBDD 1TETH 1QBBA 5HTSA 5J13C 2XQBL 3ZE0E 2FD6H 3OJ2C 1IGFH 5F1SA 1S9YB 4TULH 1NL0L 3W0WD 4X98B 4YNYA 3GJEB 1QRNE 1LE5B 1M1SA 2WWMD 4JKPL 4XPGL 1UZ6F 5I8OH 2AP2A 2DM3A 4JN1H 3L3JB 2G75B 4U2ZA 4CVZB 5E24E 4JPIB 5J57B 5BQ7A 4XZUA 3U46A 1FH5H 2DI8A 2PKDA 2QSVA 3VG9C 3PE9A 4OCRL 5DK3A 3KXFE 2BOBA 1KYOK 3VRJB 1G84A 3D25B 2DM2A 1KJ3H 2F54D 1IARB 3PDOA 3ULUD 3MGTB 3KYOA 3MCKB 3N1QC 4JGMA 4HH8A 1TVDA 5EZIL 1QFUL 2XT1B 3FQNA 4QTHA 1LEIB 5C08A 2CPCA 3ZKXB 3LS4L 4YFLF 1KGCD 5CZXC 3C9NB 3WE6B 4HLJA 3JTSA 1DBJH 4OJFL 4N1HB 3WIFB 5I76B 4O58H 3FCTA 3IXAB 1RIVH 1NBZA 1EZVY 4QGYA 3D85B 1A7NH 5DT1L 3WV0A 1MCFA 4LSRL 3FRUB 2DYPD 4OZGF 4ZQKB 1R24B 2W59A 3SQOH 3T3PE 1MHEA 3LEXA 3DHJA 3H9SB 3MBEC 3BKJL 1VSCA 3A67L 3BP4A 5L8LB 2WIIA 2DMCA 3B2UC 1L0XA 2FJFB 3S4SG 1VGEL 3GMRA 4WIQA 4MJ2A 1R5WA 4XP6L 3AS1A 3BXNA 4GAJL 1CIDA 3G04B 4XP4L 3VXSB 4F7CA 1HWHB 3IU4L 4Y89A 2C3HA 3LD8B 1LO4H 3QCTL 4NRXB 3BISA 3GKWH 4XBEH 5KVFL 5E4EB 4NO3A 4Y2DB 3BH8A 4KKLD 2VDMH 1MJ7H 1P4BH 3CMGA 4EN3C 4KQ3H 2XKNB 6FABH 3H3PH 2YD9A 5KSAB 4ZSOB 4DGVL 5IROA 5LGHL 4P46C 1KOAA 5KTEL 3P0YH 4HUXA 1DEDA 4I13B 5JXED 5FGBC 1FZMB 2VDOL 5MENB 4L8DA 4YHKL 5FV2A 1N4XL 1NMAH 1FNSH 4JFHD 2FR4B 4W4OA 1D5XA 3REWB 1K8DB 3SKOB 4JFEA 2DLTA 4D9RE 2AABL 4P59H 5HI3D 2CGRH 5T5NG 2G2RA 4WHCA 2VLRB 4WTWA 5KAQG 4OZHB 3KPLA 5HHOA 4EXKA 1ADQA 2AJXH 2L7JA 5D72L 3O6KH 1BWWA 2ZOKB 3GJFH 3BQUD 3KPRD 1DVFD 1YMMB 3PP4H 1KLGB 1TNNA 2FJGA 3BIKB 5JPNA 4IRSA 2NNAA 2XACC 3ROLB 1EEQA 3O45B 1T04A 3O8XC 2GTZB 3B9KA 3VFPA 1UKQA 3KXFD 2E5EA 2N7AA 1C5DA 1F13A 4PJBE 4EDXA 4L8BB 2RAMA 2X5PA 2B1HL 4KDTC 5EZLA 4OD2B 2VKXA 5FYJD 4KVCH 4M62L 3FB7B 3VI3F 1YY8B 3G5YA 3LCYA 1XEDA 3DI2B 2XN9A 5C09E 4M7ZC 1ZA6B 4YAQB 3P4LA 1XZ0B 2AV1B 4I3SL 3ARZA 3MJ8B 4LLWB 5DSCA 4RIRA 3D85A 4U4BA 4K7FB 5EZJB 2VXVL 4HHAB 2IGFL 4YGVA 2HRLA 4ODSH 5TDOB 2CSPA 2IANA 4NYLA 4KMTH 1MHPH 3PABA 5DC4B 4XP6H 3UTOA 3N1PC 2YPVL 3D3VB 3K1KC 3IU4H 4LRIA 4L29B 5C0EA 4POZD 1MCOL 3JVGC 4MZ2A 3IAGC 3OG4B 3VFVB 5F1NA 2BNQE 2R0KL 4NHCH 4XWGH 5IB5B 1FHGA 1N5AB 1IGTA 4Z0BH 4HX1B 3VXOA 4OLVH 3BP6A 4WUUB 4XVJL 1SJXA 1Q0YH 4EQ2A 4N8VA 3IS1X 4JHAH 1Z9OA 4OKDA 1NAMA 2CJUL 2NQCA 3ET9F 3QJHA 4KHXH 5FM4A 1IVLA 1NCDL 1A4KB 3NIGF 5IJKC 3Q48A 3ZL4L 4X80H 4WTZG 1ZA6A 1G7JA 5FYLL 1OTSC 4X7TA 3DBXB 1WFOA 5BVPH 4LRNL 3O6MH 2VITB 2BX5A 4E42B 1LP9A 3ARFA 4NM8L 1JWSA 4X9GA 1HHGA 2EXWD 4P4KA 1YQ2A 3V6ZB 4L8SA 4KKCD 4HDIA 1U3YA 1EFXA 3VE0B 3CIQA 3L3GA 3MROA 1DANU 1FL6B 3IF1B 5TDPA 3MNVB 1UCBH 4LHUD 3FN0H 5F7HA 1W8NA 2AABH 5C0AA 4M1CD 3CVHH 1TQBB 3HI1B 5JQ6L 4IIQB 4JO2L 4DCQA 1ONQA 3BHBB 3KPSB 1FL5B 5EZOH 2G2RB 4KDVA 3S37X 3U1SL 5JDJA 1QR1A 3PP4L 4PJ5E 3MJ8A 5FM5O 1ZWIA 2DQIH 3HHRB 3HRZB 3WLBA 2SEBB 2NPLX 4G6AC 5F96L 4GFTB 5CJQL 3CU1A 5EIVA 4G6FB 4IRZL 2B4CH 4LOUC 3RVWC 5DHVH 3CCHB 4QOKE 1KXQE 3FQRA 2NY5L 3RNKA 4YC2C 1QLEH 1DLHA 4F15C 4L5FL 3EIFA 4LLDB 3MBEB 5D9SB 4XB8A 3TN0C 4XAWL 3WN5C 3LQAL 5K59F 4LCUA 4MA1C 4FQXD 1HNFA 1DBMH 2CKBH 3X12B 5FYJE 4PJBF 5DD6A 1OTTC 5C7XH 4AM0A 5D1QA 4C4KO 3HE6D 5ISZA 3VFTA 2IQAA 3NCEB 3LQZB 1BM3H 4WI2A 3KPMB 4XNXL 4DN4H 3F5WB 4JFQB 1ITCA 4U6TA 2X4UB 1AHWA 1D6EA 1EBPA 3HPLA 9CGTA 3RWGB 5DJ2B 3G6DL 3QHTC 5DUPL 4MJ4A 5LJYH 3ULVE 5B22A 1F45A 5JO5B 4P2RD 1QTYT 4XNMA 1GIGL 1JZ3A 1GHFH 3VRIA 5D7IE 5F89B 4DVBB 3VG0L 2BY2A 2FRGP 2R0LL 5BXFB 4DTGL 3RKDD 1G7PA 4U1IA 5DS8A 5HGHB 5JUEL 3TPUB 1GZPA 2FWOB 4MD4A 4UQ3A 3ARDD 4Z18A 1J8HD 5TE7H 3OXSB 4UDTA 3VWJC 3TT3H 5EOCH 4WGVB 4CGTA 5MEOB 3RP1A 3MA9L 2NY0C 3IJHB 1GOHA 3SDDD 1I1FA 1HSAA 2Z31B 1NJ9A 5CBAB 2R23B 1K2DA 3MV7A 4ONFH 2XZCL 3HTLX 3KGRA 3TJHC 2F8XC 3V52H 2HLFD 5CGYC 4ZFOA 3R0NA 1Q9WA 3EYVA 3D0VA 3RAJL 1RK1B 2DQGH 3QUYD 1ZE3C 3K2MC 2ATPB 3NOIA 5J7CC 4L3CB 2DMBA 4R7NB 4PJFA 4JREB 1N3NB 4WW1A 1NC4B 3WYRA 3QO0A 5ITFA 3GSXB 3VGAB 1S7UA 2K1MA 4K3DH 5DDHA 3WFBL 2WK2A 5JW5B 2H2PC 2QKIB 2BSSB 3IXAA 1T89A 1MCJA 3BD5A 4ODUA 2ZPKL 3KS0J 3WDJA 5EWIL 3WFCL 1EV2E 1A0QH 3HUJB 1R3IL 3RHWK 3VGDA 5F7YC 3H3KA 1Y0LA 4L9LC 1QRNB 4ONGH 4KKAD 4O2CA 3MGTA 4I18A 1KJ2H 5C92A 1YEIH 1B6DA 2XTJC 4CVWA 5DD1H 1N64H 4ZFFB 4ZOBA 3DMMB 5DD5L 4Y4KD 3JXAA 3AM8A 2VLRD 3G5XB 4MDJA 4M43L 2B1AH 1BAFH 3MLVL 4Z7WE 3CXHJ 4OB5H 1A21A 3RBGA 4QHMB 5I15H 3UTSA 3M1BB 1V3MA 1MIML 3GKZA 1FGNL 3VE0A 2ADIB 2HFTA 1A6AB 1HILB 3O45A 1B0RB 2VDML 4POUB 4ZPTA 2VWEC 4ELMB 3BDXA 4X6DB 3IKCA 4AYFA 2X89A 4NNYA 1VFMA 4LEXL 1I3UA 1T7VA 4L3EB 1INQA 2CMRL 4OQTL 5KSAD 1MI5A 5TFSL 4MNQE 2J3SA 2C4XA 2OQJB 3QWRA 4MXQD 5DRWA 3GIVB 1E6OL 4XXCA 3B8SA 1I7TA 4HG4J 1VADA 4FQXC 5CUSH 1WQVT 2NZIA 3ARFC 4NZUH 3S5LB 4HIHA 2XWBB 3MV9E 4HKJA 4NCC2 4K94L 4OKVA 4YXKH 4NN7C 1JPTH 2D4FA 4JFZL 3SE8H 5ICXB 1MLBB 3V6OA 3QWRD 3LN9A 4ELMA 2EKSB 2OZ4L 3IVKB 1BZ9B 1FNHA 2GITA 3QA3B 3VXTB 4YBQC 5INDB 4HULB 3REVA 4RNRB 3VJ6B 3FQRB 5K9KA 2OK0H 2Z91A 2BDNL 1Y6NR 4H0IA 4MCYA 3TJEL 2DDQH 4S1RL 1FVCA 4H1LH 5D5MA 1P7QB 3LZFL 4XMLL 4PJAF 1JZ4A 4RZCB 5I1EH 5ALBH 4BK5A 3AMKA 1LEGA 3BN9C 5DD3H 3TYGH 5C0JB 2FZ3B 1AQDA 3AVEA 1KG0B 2FB4H 2FBJL 3GZKA 5ACLA 1SM3H 4KHTL 3RWJB 2OR9L 1A2YA 2HVJA 3OKNA 4KJPC 4PRHE 3CLEL 3WIIH 5K9KB 4HWEL 4J7RA 5DJ8B 1NSNH 5TDNA 5FKPA 1XGTA 3GHBL 3LMJH 5FUZL 2PUQT 4J3VA 5D1XA 3BWAA 3IFPA 4JZNA 5F9WB 3WSQH 5IWLC 1CBVH 8FABA 5T3ZE 1UXSB 1I8MB 3PJSB 3CK0L 4OGZA 3WKML 1BFOA 1X5IA 2Y5EA 4MSWB 2ADGB 4RRPA 1RZ8A 4HMCA 1CF8H 2HP4A 2JJUA 3FB8B 5CJBA 2C26A 3F7YA 3Q5TA 4X8XA 4MQTB 1LE9B 1B2WH 4YHIA 1TVBB 1NLDH 2HT4D 5GHWL 3BH9B 15C8L 2UWEE 3WJLA 2D3VA 4TUKL 5DHYA 3L5HA 4JFYB 4RCAA 1EGJL 5DGQA 3DUUA 2E9IA 4M7JL 5GGTH 4FQ1H 4YHML 3R8BB 5E8NB 4OTXH 1BFVL 4X80L 4QRPA 5JW3H 1T03H 5EBLA 4XCEB 2WZPD 1CS6A 4L3AA 2VO5A 1A6UH 5DVKA 1IBGL 3VFOB 1E6OH 2PR4H 1GXEA 2VH5L 3BPCA 5DJ0A 1XIWC 4QHKI 2MSPA 4P2QB 5FK9B 1P7QD 3ORJA 3VFNB 2DIAA 2VDNL 1UCBL 2DQTH 5CLTA 3FOLA 3V6BR 2VQ1A 3TBTB 1JF1A 2FH8A 4PPTA 4WWKC 1FZOB 5FXCH 1WAAA 4PYGA 2L4OA 2PCPA 3S4SB 1S7QA 2IBBA 1P4IL 2BVOA 2HVKB 2GAZB 3MFFB 4OFIA 5AAWA 3FONA 3B9EA 1ED3B 5CP3A 1T6VN 1DLFL 5E7BA 3QDGB 3RWDA 4R2GC 4GSDH 4WFEE 4NQEA 3MRBA 4P3DA 4C55A 5JPNB 4HWUA 4X4ME 4L5FH 1WC7B 2J8UE 4G43B 3CFCL 3L7FA 4OZIB 1F4HA 1QA9A 1X6NA 1PEZA 1NC4A 2ARJQ 2HJKA 3P9LA 1A1MA 4LSSL 4OT1H 4JB9H 4KZEL 4PIRF 2BNRE 2EC8A 1R6VA 5HDOA 3PUCA 3WE6A 1MELA 5C7XL 1LVEA 2ICWJ 1SYVA 2AK1H 5D7LE 2O5YH 1T20B 4F7TA 1SJVA 2F58H 3OR7B 4LARH 1ZWIB 5I9QB 4WEUD 4X6DE 2HJFA 2XWTB 4U1NB 4I3GA 2A6KA 2VXQH 1OLZA 3BJLA 3FQXA 4TNVK 5GSRA 2EDRA 1QACA 4MSWA 1R5VB 5IJKA 2DICA 4J4PD 1PKQE 4PJDB 1IKFH 4GBXA 4Z7WB 2BC4B 3HR6A 1A7RH 4JHBA 3OMZA 4GKOA 1UH3A 4GW1A 1Q9LA 2C1OB 3MFGB 2HKFL 1GCFA 3VXUE 2MQCA 3TNMA 1V3KA 3EJJX 5CEZE 2PCPB 3RFZC 1EFXD 1X5HA 1NFDA 3VI4F 1MJ7L 3ILPA 4W6XB 4YHOL 1FLTX 3MJ9L 5ICYA 4KI5C 4Y0GA 4G6JH 4GKNB 4UNTA 4GXUM 1CDBA 4I48B 4PLNC 2DQGL 1WBYA 1CR9L 3O3DA 4S1DC 4ZYKA 1SJEA 3UTQA 2XIDA 4F2MA 3OB8A 3SOBH 4MXVF 4ZOAA 1KTRL 1PZ5A 4FQCH 3S88H 3CC5A 3RPIA 1C12B 4NQTA 1FZKB 4I4WA 4NHUB 4H26A 4CW1A 2OCFD 4KPHL 3P0VH 5JOEA 3TZVA 1ETZA 1E27A 1T0NA 1KCUH 1VFAB 4ZUTB 2FEDC 4OT1L 5C8JA 2F74B 3SGKA 3IDGA 1CK0H 3I6LE 3BDYH 1IEAB 4YDLC 4LRIC 1U58B 1G6RB 5E94B 5F1IB 2XI9A 3STBA 3VH8A 4GRLC 3MRLA 1DN0A 2O5XH 1HINL 3PQYB 1C5DB 4GJTB 3RX7A 3CSPA 5H37H 1N8ZB 1N2RA 5DJAA 3V6ZA 5FKPB 1NUGA 4EI5B 4RWYL 1KLGA 3LB6D 1FGNH 2B5IC 1CVSC 1UB6A 1ZLWK 1M7IA 1S7TB 4QY8B 5LGKA 2BNRB 4HKBA 4J8RB 1RIHL 2CLRB 1H15B 3BIAX 4LEXH 1KIUA 2J8UB 3VWJA 2CRZA 3SKUD 1I3VA 3CVHA 2ZNWA 4OGYL 4OZFG 5GGVL 5C08D 4L8SC 1Q94A 2LABA 2LU3A 3O8XA 4NNXA 3WFHA 3L7EA 3BPCB 4PJBA 4OZHE 3B83A 4PJHA 4XTRD 1P69B 4C83B 5A16A 1T4KB 4M3JA 1A7PH 1YA5A 3C5JB 3MREA 4I3RH 4EUPG 1M71B 3BVNA 2DQCH 2V7HB 1XGUA 4M03A 3EFFA 2HWZH 1S7UB 2FIRT 1U6AH 3QUXB 4DVRH 2VZTA 5I74C 2IFFH 5D2NE 1WZ1L 5GJSL 2GJ6D 5TE6H 3OF6A 1NFDE 1IAOA 2AJYH 2Y6SC 3E3QC 1G1CA 2YHGA 5E08H 3LH2H 1REIA 1FC2D 2OK0L 1TTGA 1TJGL 3IXTA 3MRFA 4BQ9A 1OARL 1ND0A 3G9VA 1I9RL 3IETB 1FG9C 4QNPE 5FYLE 1ZVSA 1ZT4B 2XPGA 3IDJA 3MUY1 4KY1L 5C3TA 4LPTA 5D2LF 2WIIB 1UXSA 1I8MA 2X4OB 5IB4A 3EYQD 1J1XH 1U93B 4H0HB 2UZXB 3WS3A 5GPRA 4F3FA 3CH1B 3TH2T 2R23A 4QYOA 3ES6B 5D8JH 1UM6L 2DM4A 4NWTL 4D9QD 5AZEL 2I9LB 5E6ZA 1H3XA 1JHLH 1TVHA 1CK0L 3CDGB 4NQDE 3T3ME 4JN2A 2K3TA 5T33L 3T0EB 4HHAA 4PJIF 2IF7A 5HHOE 4JR9H 5C8JB 2BSRA 2ZSVA 5D7JD 4K2UH 1Q0XH 3NA9H 5ANMA 2XZQL 1WCBA 4PLOB 4AY0A 1P7QA 1D5XB 4OLWH 3KYOB 1DBML 2Y7QB 3GMOA 3QYCA 2NR6D 2CKBL 2LQRA 2DBLH 3OJMB 3QFJB 3QO1A 4BZYA 4E0RA 1FZMA 1NLDL 2UY7A 1D5IH 3E6FB 4NQCE 1V7ML 4N0YL 5HGGS 4XNXH 5IMMB 4ZXBA 3SKMB 5CSZA 4NQXA 5LG1A 2IC2A 5I8KH 5CMAA 5MEQB 4HBCL 1IKNC 3PDDA 2CXKA 1BX2A 1SMAA 5T5FH 1K5NB 1UZ6E 1JPGB 1XCTA 2VUYA 2HA1A 4CKVX 5DK0A 4PR5B 5DEGB 4PREB 4AL8L 1FG2A 5KN5A 5E2TL 3IU3A 1KIQA 4M1CC 1OAYH 1JNHB 3HE7D 4NJAL 3JWDH 4UTBH 3ESUF 3MV7B 4O58L 5JW4N 3WNMA 1JWUA 2HT2C 1T2XA 3LN4B 1ZANH 4P5TD 1PSKH 3BPNC 5I16B 2VLKB 1DQJB 3D9AH 4LHJB 2DWDA 4F7PB 4OZIE 5I17A 4OFKA 5J6HA 3STLA 4YXLL 1M7XA 2NY6D 1U91B 3MRMA 3QCVL 5HDBF 3WS6A 4ALAL 5HSFA 4G7YL 4JHWH 4FQXA 3C08H 2C1PB 3NFNA 4QXUH 3ZKND 5I19L 4OLYH 1NBZB 2OMNA 1A64A 1MHHA 3FT2B 4P4RB 5JW4Q 1JNNL 3L95B 1TMCB 3TZVC 4PLJC 5K9JL 2AXGA 2NZ9D 5BZDA 1U36A 2PO6B 1A3RH 4WFED 2VISB 1CDCA 4NP4L 4P5KA 4LVEA 4KDTA 2CLVB 5GGSB 2WBJB 4YH6A 1DUYB 3SKNB 1MCRA 5GSVA 5TQ2L 4B41A 3WHE1 5T33H 3T4YB 3HA0A 4OFYD 3RTQC 2IQAB 5C0AD 3E1F1 2HTLD 4UU9B 1KJMA 4I2XB 1JZ8A 1DUZA 2MJWA 4IRJA 3LSOB 4G9FB 1CGWA 5IHBA 5DVMA 1LO2L 1OTSD 4JFPB 4Z7NF 3B43A 4R7NA 4OD3L 2LV4A 2WW8A 3CFIC 4LCWB 4GW4A 1C1EL 1QFWM 3H0TB 3MV9D 5CINH 4IJ3B 3RA7H 2R1WB 2HMID 3LKNA 4EBQH 2QBWA 1U3HA 1MHHB 4OZHF 3I2CH 3IFOA 3R1GL 1FV1A 1YUHB 2H9GB 3PGDB 4KKAC 5DR5L 1LP9E 4WY7H 1F4YL 2AXGB 5L2JA 1CD0A 4WW2A 4WI6A 4HUKB 3SDDC 4Y5VA 1F58H 2UZIL 4MWFB 3PP3H 1Z9SA 1UEMA 4YDIH 3V6OC 3BRGC 3MLSL 4YHOH 3FB7A 3VWJB 5AYQA 2D7MA 2P5ED 5D6CB 2QR0B 2MWCA 1TZHA 3MR9A 3LPWA 4NJAH 1SBSH 3T8XA 4M62H 2JIXD 3DVNA 4HIIA 5TFSH 2GYSA 4JRYD 3TYFA 1MFNA 4FABL 4ZUSB 2GKIA 3RY6A 1NEUA 4H1LB 4HC1L 3QUKB 1IMHC 2MPAL 1S9YA 1J0YA 3IDYB 4XX1G 4HKJB 3IT8D 4NN5C 3P3YA 3HAEB 3ABZA 1YQVH 1Z3GL 1I3RB 4YHLL 1BIIA 1MCEA 2LTQC 3B9VA 4LLQA 5KVGH 3VGGA 4JG1L 5I71C 1A6WL 3FT3A 4FXGA 5DJXB 2E7LA 4Y5XB 5D7JC 5D4QA 5DURB 5CD3B 4QXGL 4M4RA 4OZHA 1I1RA 1HYRC 1G0DA 4Z6AT 4XC1L 2DKUA 4N8CL 4M48H 1AC0A 1FNAA 5FOJA 1GAFL 4P5TB 1DE4B 1NCWH 5HGDB 4ZUSA 3QP3A 5ACZB 4ZO7A 5SWSA 4RDQF 4X5XB 1X4XA 5TQ0H 3G08B 3WNNA 1Q0YL 4XPTH 2Z4QB 3DGGB 4DKAA 5EPMB 2FGWL 3MV8A 3RVVD 3WN5B 3M17B 5E56A 3IDIA 3WCYA 4AEHL 3RWJA 5FM5M 3U9PL 2E3VA 1ZHKA 4JANA 4L9LA 1ZLSH 3TM6A 3QXUA 4ELKA 3SY0A 2BFVL 2PYFA 3ARPA 4XNYL 4FTVE 2HH0L 5DZLA 2EYRB 4FFYH 4PRNA 4XAKD 1HK6A 1U95B 3B6SA 4KROD 4DOHE 3OX8B 2X4OA 4WFFE 1MNUH 3MJ7B 3SDYL 4MNGB 5JA9A 4HCRH 2Z92A 1KGCE 4TUOB 4R6UA 1P7KB 5GGSY 2N1KA 3PGFL 4H5SA 4N9GA 3T2QA 2V7NA 1DQDH 2AI0L 1KPVA 4YE4L 3RL1A 4YQXL 4LGSB 2D31A 1MFCH 4E42A 4K94C 2R1WA 2V5TA 1W72H 1JGUH 4Z8FH 1U8LB 2EXYD 3ARBB 5GHWH 5BRZD 1I7ZB 1KJVB 4ZFZA 3GI9L 4P2CG 1V8HA 2VLJA 1UFUA 1X5XA 1KIRA 4MB3A 1A3QA 1BQHB 5CILL 4UDUB 4MJ6A 4RAVB 4PRIB 2R0ZH 3QUXA 4XVTH 3RKPA 3BGAA 5ETUB 4IRJD 5HI5D 3BEWA 3FO2A 5GZOD 2MOVA 3LH2L 2VQUA 1EX0A 2PYED 1MREL 5DI8A 5F6HJ 2P4AB 1BFSA 1NMCC 2W92A 1A1OA 2ADFL 1T20A 2J1KA 4E41B 4QRTA 4APQC 3K80A 4YJZL 5T1KB 2XKSA 5L0QC 2FEEI 2YPLB 1PGRB 2P47B 2EDOA 3TPUA 3C09B 3FAWA 1CVRA 3SDXE 1T7XA 4JQXA 3TV3L 4OQTH 3QDGD 1PQZB 4MD0A 3O6FB 1FGVH 4KVNH 3FHQA 5CSBA 4RIRB 3B3IB 4HIJA 1GHFL 1OGAA 2VLLB 4HWBH 1T1WB 1PX3A 3H8NA 3HZKA 5LBSL 1H3GA 3MRBB 1FV1B 1JYXA 4HKBB 1RD6A 1FFOA 3PNWB 2XG4A 3RWDB 1NBYB 2XWJB 4R3SA 2F5BL 3EJZD 4JO3L 2R4SH 2R2EB 1SEQL 4LHUA 4PJHE 4XWOC 3RVXC 1ZGLB 1BBJA 3QNZA 4RX4A 5I8CA 4LSSH 1YEFH 3HMXH 4O5LH 5F7FA 1EXUA 4EI5D 2XNAA 3GSNH 4K7PY 2WMPA 1G7IA 1KBGL 3ARFD 5DZNA 3MV8E 1J1PH 2VABA 4OCYH 2A74B 4WRLA 3MXWL 1NGQH 2VZ3A 2O26U 5D7IB 5H94B 1KN2L 4K8RD 1AY1L 2F74A 3WIFA 5TH2A 3KWWA 3RZCD 1NCAL 1MLCB 3O9WA 1RQ5A 1D5ZA 3PWNB 4AMKH 4X6CF 5JIKA 5E99L 3ZSTA 3NFSH 1FAKT 2IH1B 5T3XH 2FR4A 3O0RH 4IM8A 4QKXB 4NBZB 4OZ4A 3TIDA 1HKFA 5E9DA 1O0VA 4CVUA 2X1XR 1U8NB 1S9WB 5DVNA 3QO1B 2BY1A 3F7YB 4HUVB 1QR1B 5BV7C 1EDQA 2J8OA 3GMOB 5B38A 1BREA 3EW3B 3VXPB 5CILH 4BFIB 2QADC 2FWOA 3E8UH 5AUMA 3NZ8B 1YN7A 2GCYB 2H6PB 3NCYS 4D2NA 1CLOL 2F15A 4EN3B 4Y2DA 3IDMA 3BWUC 3EYOA 2AV7B 3MRGB 1FBIL 5IK3A 4KJWC 2LTQB 5E4EC 3CZFA 5T1LA 3MJ9H 4RBPK 1U8QB 5J1SC 4KV5E 3K8MA 3RHWF 2CDGA 1OT2A 1YJDL 1KEGL 4M93C 1JHKH 3KPSD 1J88A 4MMZC 5DHXB 3U0WL 1RV6X 3ZSSA 2V2TA 4R96B 1JNHA 5TDNB 2ZCLH 1D6VH 1H5BA 1MH5B 1R3JA 4M5YH 1UVQB 3IDJB 1OTUD 2V9RA 3DNKA 3WXVL 4WUUD 4IRSD 4XBGB 5DD0H 3KLAA 3KNBA 3MYZA 2Q8BL 4E41E 1U8NA 4TQEH 4Q7DA 3K46A 2H32B 4M8QA 4W4NA 2IAMA 1L0QA 4PJ7A 3TT1L 5EDXA 2XQBH 5IMMA 2EKSA 4P57A 4U1SB 5KVDL 3VGEA 1BLNB 2HJFB 2XWTA 3TBWA 3X3FH 3OKKA 5FUOH 5INDA 1H3WM 2I5YL 5JA8B 3AROA 5ALCL 1XGUB 3PL6A 4JFFE 1S7XA 5I8OL 4MAYD 1F3JB 1YECH 3H9SE 4E9LA 2XICA 3RIAK 2RHEA 4LDEB 5F7EH 1U42A 4XCYB 4G9FE 1IAIH 4NOBA 4MB5A 3P30H 1RJYB 3BHBA 4P99A 4JRWA 4YX2L 3U46B 4UZGA 4LCCA 1TVHB 3I75A 3P9WB 3MV8D 1B0GA 1YEDA 3HI6H 4DEPB 3QDGA 1I7RB 2XZAL 3D3VD 3AXLA 3EO9L 1F11A 3WHE0 4DN3H 3EO0A 5I1AB 1M6OA 2FJHA 2I60H 3VH8G 1IEBA 5EUOE 1BJ1J 2ADIA 2BVOB 4DOHB 4CVXB 3ESVF 5ERWA 1UB6B 2WINB 4U1HB 1DN0B 1FZOA 1ORQB 1MCWW 3TA3B 1HEZA 4NRYB 5GRJL 5EU7C 4NKDB 4OGAD 1QLRA 3OHXB 4KRNA 4LCCB 2GAZA 1PQZA 1AO7B 2PW1A 2EZ0D 4F9LA 1CFSB 3RTQB 3T77B 2APTA 1W2KT 4BKLA 3EO0B 4TVPE 1IC4L 2L0DA 5CJOL 5I1AA 3WIIL 1SJHB 1YNTB 2P8MB 4KAQH 4N8VB 1A7PL 4KGLA 4QRTB 4POZC 4LEOA 5LXGL 3DETC 1MPAL 2P8LA 1CL7I 3S36H 4Y5VB 4Y19A 2P7TB 4KTEH 2NY3B 3NN8A 4EDWL 3TZVB 1FYHB 1F90L 1F4AA 3QCTH 2E9WA 4ZAKB 2ZCLL 1CGXA 3CXDH 3W0WE 2VDRH 2P46B 4J3UA 2CH8A 3MRIA 1UH4A 2YA1A 1OWWA 3QPXH 4TUKH 5BO1L 1NDMA 4UV7L 3SGEH 2NY3C 1HZHH 1U3HD 3V4VH 3BPNB 4GUPA 2YA0A 3RZCC 1RZ8B 3WO4C 4LCWE 4W68A 2BXZA 4XH2B 3OQ3B 3X3FL 3P2TA 3SE9H 4MDIA 1BVLB 5AZEH 4LMQE 3CMOL 1ZS8B 1OAXL 4WFGD 3IFPB 4JZNB 3G6JE 3MRKB 4PG2C 3V2AR 3U7WL 5HDQL 2VR5A 2DAVA 4MD4B 1F6AA 3DX8B 2JJSA 4NO0B 1CYGA 4N90E 1U58A 5E94A 3MTRA 4BQBA 3PGFH 4C56A 5CJ5A 5SWQB 2AV7A 4XP1H 4KKBD 5DQ9B 3RWCB 2DLFH 3EOTH 1BEYL 2C1PA 3NFNB 3BESR 5JIPA 4GT7A 4YBLB 4O2EA 1HKLH 4P46A 3GSQA 4NO5B 4JE4B 4LGRB 2BMKA 4P49A 3FFCA 4M6ML 2VE6A 1ZXQA 3GUTB 4X4YA 3HG1A 2O5XL 1QKZL 2DS4A 1JK8B 3HZVA 2ICEA 4PJHF 1BQUA 4PGJA 3T3MF 5LVEA 1DANT 1R5IB 1AKJB 4CU7A 2UZYB 4PB0H 4GG8B 1GSMA 1L6XA 2VXVH 3LN5A 1UG9A 32C2A 2GK0A 3UZVB 5LXGH 1WIPA 2AK1L 4LCIH 1JF6A 3T1FB 3VFUB 1A6VL 2NY0B 2EH7L 4NWUL 5CZVH 3D9AL 1UXWB 3RVTC 1QFWL 1CI5A 4G6FD 2BY3A 4O02L 3B4NA 1T22A 5L9DH 3HE7A 1RHHB 3T0WA 1QFHA 5H35B 3VCLB 4NM4L 5DFVD 3MOAH 3ZZ1A 5T3ZD 4ALAH 2OL3H 2GTWB 3GBMH 4BSJA 3IGAB 2E6QA 4I0KA 3MLRH 1CLCA 1UJ3B 1N5YL 2EH8H 1I8KB 2OI9B 3BKMH 3RL2B 4Z7WF 4P2RA 5HHXH 4JFHE 4JO4H 1JPSL 1SHMA 1MHEB 4HF5H 1I1YA 4J6RH 4ELMF 5IM7A 2F53D 3FRUA 3GSNB 4G7VL 1DFBH 5DQJB 2OR7A 2YC1A 3QFJE 1WFUA 3BP7A 4OZFA 4KWUA 2VLKE 3H42H 2NX5E 1F3JA 4G9DA 3KYNB 2NY4B 2E27L 3DX7B 5MI0C 2NW2A 4OCXL 4JRXA 2NX5A 3ARUA 4ISVB 1BD2D 1HOCB 5TQ2H 5IB2B 1UQSB 4RQQB 1GZQB 3ULSB 5C08E 1SEBA 1EFXB 3K8KA 1BVZA 4P2OC 5HDQH 5JOPD 4YHIB 1JL8A 4WV1C 1RUKL 4JFPA 3HUJA 3MLWH 1OAZH 1R3KB 4K55A 5EC1A 4LVOB 4G6KH 5IROC 1CIUA 4XVUD 3FB5B 2XXMB 4Q6YA 5D5MF 2EDLA 4NQSB 3W9DA 1TCRA 3Q5YA 1T5WB 3RIAF 4D0DA 4A2MA 3X11B 3MLZL 5GGVY 5EOQH 3V0WH 5LGJA 3VFRB 3IXTB 3MRFB 1G9NL 3QG7L 4S0TD 5F1NB 1MFAH 1NUFA 3MLTB 1WT5C 4FFVC 3WIHA 1FO0A 1I9JH 4HUUA 1I1AD 5DTFB 5C0CE 3RX8A 3B9KD 1U8LA 1RU9H 3ARBA 4JR9L 4M1GL 4DQOL 3PJSA 1RZKH 4X6FB 3MFFA 1CL7L 2ZZUT 3MCLL 1R3HB 3QEHB 4F57H 5C0ND 4LAJH 2J7LA 4NN7B 3I50L 4XMKH 5HHOD 1RFDL 1CLZH 1MCQA 1LEGB 3R0MA 3T0BA 4RFOL 2NZ9C 4YO0B 1OAUH 2R2HB 1YJDH 1S7WA 1ZVHA 1KEGH 1MHCA 4WO4D 2W0FB 3MV7E 4HZLB 2NLJA 3FB6A 3BRFA 2VXTL 1OY3B 3CVHB 3GBLA 1CDYA 1YNTA 5IGXH 4KI5E 4KK8D 2ZUQB 4EN3D 3UO1H 3L3OA 3PV6B 1I8LC 5FO8B 5IM7B 2C3XA 4M7ZB 4OLXH 3UPAA 1BOGB 5CCKL 4Y4FB 1GL4B 2BJML 1MFEL 3AMLA 1KCLA 1JZ7A 5M7QA 1UWGH 4HV8A 4QCIB 2CRMA 4YHZL 3HE7C 1RIHH 5EC2A 4ZXBD 2G60L 1JV5B 5IHZB 5IKCA 3I6KB 3QFDA 1NLBL 4WEMB 4U49A 5JO5A 3UPRB 4QHNA 4K9EH 4PREA 1QD0A 5T3ZL 4ZMAT 1VKXB 3KPLB 3U30C 5L0QB 3DETD 4LSQL 1J1OH 2CUIA 3ZTJH 5DJXA 3LKOA 4GKZB 2DWEA 4GRWE 4JFXB 1WWCA 4MVBC 5FUCE 3PIQB 4P3WA 3W82A 4WI9A 1IGIH 2IAND 4K23H 1W0WA 1VESA 3ARDB 1FNEA 1CDIA 2VXSH 5D7JA 3OKDB 1OGTA 2F8OA 1DSFH 3ZKNC 3RU8L 3PWVA 3PQYE 2B39A 5IR1B 4LCYB 1QEWB 1OP5H 4Z7UF 5KSAA 2SEBA 4QOKD 3QUXD 1JNNH 5DJ8A 2VDOH 1CDJA 4R8WH 3ARBC 5I1DB 2HVJB 3OKNB 3CCHA 4IHOB 5BS0A 2DKSA 3QDJA 3SDCA 4PJFF 1I9RH 4R97C 4JAMA 3BKYL 2EO1A 3NCJL 4LGPB 3T8XB 3UYOD 5E1HB 4PGDB 4K3DL 5F8QC 1IAIM 1R3LB 5DMGC 4PLKD 3U83A 3WFBH 3STZB 3LRGA 4JVPA 1T21B 4R4ND 1D5MB 4ZTOH 1S9VA 2XA3A 4G80B 3B5HA 3C2AL 3VXSA 4F7CB 4MNQA 4LASH 3GBNH 1FDLL 4Q6IC 4ODXA 3QUZA 1J10A 4PD4J 4X0KB 5E6ID 5F44A 1YDPB 1R3IH 4KI5F 4GG6A 1CZ8H 4JFED 4ODUB 4Y5YA 4F57L 3LEXB 4PJIB 1P9MC 4F8TA 3C5SB 3I50H 4PRPA 3C6LB 1FO0L 4J3TA 3CFJB 1I8IB 4KTEL 2VIRA 1A4KA 1MRCH 1JNLH 4N1EA 1Q9KB 2HKHL 2P43B 3MMEB 4NUGH 3U0PA 4MMXC 4F37F 3U4BL 3VWKC 3NTCH 1F90H 4I18C 1G7JB 4HMEA 1UGNA 5A3IC 3V7MA 4Z7WA 2AJSH 3O3EA 1HCFX 1QSED 4UAOB 4WHYH 3GIVA 1AGDB 4G9FA 1F4YH 1C08A 3TLRA 3K81A 3PWPD 4XP5L 2EIDA 4NCDA 5TGBB 1BF8A 2C7UA 3W0WA 1VEOA 4PJIA 1KPUA 4NUJB 5SWSD 4WUUA 3UAJC 4WI5A 4G8GE 5ISZE 4D9RD 3QCUH 1OHQA 2GHWB 3LS4H 2OMBA 5IVXE 2BSTA 5C0FA 4XGZA 1W72B 3RDTA 4RQQA 1U0QA 4MNGE 3SE9L 4XX1E 1BWMA 5EA0H 5JQHC 1EJ6A 4W6YB 3D2UB 4HC1H 5CP7A 3T3PF 3KPNA 2VZ1A 5DJYA 5J1TC 2YPKA 4I77L 1IGFL 4IS6A 3TPKA 2DWDB 2ORBH 4NNPL 1SEQH 3VXNB 5B8CA 1FNLA 3ZDXE 4ZFFA 2NY7L 3EOBA 4QHLB 1AC6A 2CDEA 1QSVA 2IPUG 1QRNA 5J9PB 4QXGH 4F15B 5MP6H 4OZFH 4DVBA 5ECJE 3OHXA 4OCYL 5ESQA 3P11L 2AJVL 3LIZL 4OSUH 2B5IB 3M8OH 2BNQB 4M48L 5SX4H 3MYJA 5F9WC 1SY6L 2EYTB 4A6YL 5I19H 1IGMH 3ROLA 5LKNA 1MQKL 5ILTL 4YHNB 4EUPH 5ADOL 1EO7A 5LCVL 5JHDB 1G9EA 5J11B 4V1DB 5C86A 2WANA 4RA3A 1N0XH 2VLRE 5GS0H 3SKMA 5DK0B 1SMOA 2YRLA 3P9MB 2WP3O 3S97C 4UQ2A 5D7LB 5KTEH 3W11C 2R2BB 4WO4A 3RWIB 4EEEA 1Q9WB 3LMJL 5FUZH 5D71H 1FVEA 4LSTH 1FN4A 1ACZA 3INUL 3MGOA 5GS1C 3CD4A 4IRZH 1J18A 3VXRA 1IILE 1ZT1A 2HFGL 3HRZA 1F4XH 1ZHLB 3BPOB 3QIBD 4HH9B 1QFWH 4HXBL 5DF0A 1ES0B 2VXUL 3T65A 4OD3H 5GISL 4K8RC 4PUBL 1P53A 3QRGH 1QLFB 5I0DA 4G8EB 3ULUH 3RA7L 3ISWA 4OV6F 4GAJH 1Q38A 4GRWF 3GRWA 1IC1A 4MJIB 1CCZA 3U0WH 3S7GA 3W2DH 1VFBA 2HAZA 1P7HL 2X9XA 1K3IA 2Z8VC 1RIUH 5KVFH 2HFFB 5C0GA 1BGXH 3L3GB 2EE9A 1K4DB 2C5DC 2XFXA 3GMRB 1B88A 4GBXB 4PJ8C 3BGFC 5EORH 5K9QG 4ZDHA 1QO3B 4XNQA 1A8JH 1BJ1H 2DM7A 2YD2A 2LVEA 1V3JA 3UYPA 1H5BC 3QULA 2R0LH 2EIZA 5J6GA 2D03L 4B7IA 4JZJB 3K1DA 4PJ7F 3VWKD 3ME0A 2P42B 2AQ3A 1R3KA 5I2IA 5DLMH 3X14B 5D1XD 2EECA 4Z7UA 5IB3A 5EOCL 4LCUB 4TSAL 5BV7L 4F33A 2Q3AA 1F5WA 4NQED 1FNFA 3GSRA 4PYHA 4JRXB 4XCNB 5DJZA 4YDKL 1E0OB 1NANH 3EJZC 4JFEE 1A6WH 4A6YH 2BOCB 4EJ1C 2AXJA 5H94A 2EDDA 5J3HD 4WFHD 4L4TB 4HIXH 1YEEL 1EJOH 3FT4B 5IUSA 2QV2A 4OKVB 4NZTL 1F42A 5F3BB 4P3DB 1EHXA 1TZGL 5FA4B 1NCTA 3S8WA 2FGZA 4BH7B 3RI5K 2QEJA 3L6FB 3L3KB 5MHSE 4LLQB 3VFWB 3BW9B 5SX5H 1MCSA 1FLRH 3INUH 1S5HA 2AEWA 3BOVA 1QYGL 2XTLA 1GGBL 5C0BE 5ITBH 3QQ3B 3MV9B 5F9DC 4KUZL 1E28B 2ZPKH 5IGXL 3OAZK 3CFKA 3QDJE 1JWSB 2NMSA 3MO1B 4FG6C 1J87A 2R2EA 3FN0L 1EAPB 4D0CB 4R4BA 2BJMH 1CT8B 3D69A 2YPKB 3PNWA 5BCAA 4DZ8B 5KSAC 4JZOA 1CG9B 2Z31C 5HXMA 4MA7H 4TVSa 3GJFK 4PGDA 3K7UA 4LAQL 1LDPH 1YN6B 3WUWB 5I75B 1BAFL 3EOAA 4LSQH 3Q2CA 1HCVA 4YBHA 4JDVA 5CJQH 2X89D 4HG4K 2V2WB 4R90H 6CGTA 1Y6KR 3OZ9L 2CKNA 1JYVA 1IAMA 1A9EA 2UUDH 2VE6B 3L3IA 1KSRA 3MRCA 2BMKB 3ULVC 3D3VA 2Z8SA 1NGYA 3GMMA 1WWAX 4BZ2H 1WICA 1JHTB 5FGCB 5J1AA 3SJVB 1YEGL 2GJZB 1HQRA 2HLFC 4OGXL 5CGYD 2X1PA 3NIDE 5JXEA 4GW4B 2FATH 3OF6D 2WBKA 5GRVK 2YUWA 3SE3C 2BSSA 3EYFA 4XP4H 2IADA 5ICYB 1I1CA 4L3ED 4NM8H 4LKXB 4OUOA 2EICA 4IRJB 3BN9D 1IC7L 3QEQE 4PJXE 3TA3D 4LLUB 5AZ2L 5FO9B 4U6VH 3S88L 3NPSB 5GGQL 1R3JB 4CL7A 3HFML 4X5WB 5EZLB 1LK2B 3X17A 1FE8H 1HHJA 2P48B 1U95A 3B6SB 4HWNA 1VFOA 5D7LD 2V7NB 4GOSA 3SBWA 3IFLL 1R5WB 1HSAB 4AIXA 1ND0B 4Z7VB 1XGQB 3A0OA 3AAZB 3BGMA 3G6AA 4XC3L 3WLWD 4JKWA 4GW1B 1QBLH 5CP3H 3V5DB 1JN6A 5HYEA 3ARGB 4X6BB 3KPSE 1IQDB 3QDMA 3QDJB 4Z78B 3T65B 2HMIC 4HEPG 4EKXA 4GW5B 2OJEA 1FC1A 2YMXH 3HPJB 1WT5A 3SJVA 3C5ZD 3MNWB 2A6DB 3GM0A 3OPZH 3DARA 1J0HA 1K8DA 1ZT7A 3MV7D 1H3PH 3UBXB 4L8CB 3WEXB 3SGEI 1U91A 4BFBD 3OKOB 3C6LC 4KHTH 3FCTB 5ICZA 3UTZA 1TNMA 1CD1A 2ATKA 3DURB 4HPOH 1MI5D 1WAAF 5D70H 4XRCA 1WBZB 3P0GB 4JFDA 3TBYA 4ZS7L 4BJLA 4W81A 1NUNB 1ZT1B 5A43C 1U8IB 1IRAY 4NKOA 4HQQL 4BQCA 3ARDA 5T1DH 3S5LA 1RJCA 4PG9A 2HJKB 2IMMA 2YUXA 1A6VH 4PJCB 2ZUWA 5IG7B 4QRQB 1CLYL 3KPQA 1NCAH 2B1HH 1BIIB 1LDPL 1KB5A 4Y16D 5L9DL 3X11A 4AMKL 4NM4H 4JZOB 4ODTL 4NQSA 3W9DB 5CD3A 1U8OA 1OT1A 5D1QB 3OZ9H 3FFCE 3I6KA 3QFDB 5FHAL 5BQ7B 5CFHA 4ZFGL 5EU4A 1DDHB 3GM8A 3CFEB 1KLUA 5CSZB 5GJTL 3T0AA 4LDLB 1X5AA 4MLIA 1N8ZA 3SQBA 4JO4L 4QT5B 3MRPB 1SEBB 1PAMA 5EN2A 3QUYB 3R06B 4LQFL 1Y6MR 2LU7A 3W11D 3UC0L 1A5FL 3WHXB 5EC2B 4RFEA 5F1KC 4O51B 1E6JH 3FOMA 3AS2A 3BPLC 3IYLW 5E2JA 4AJ0A 1N26A 3FN3A 3D2UD 3HS0A 3LIZH 3OSKA 1MCHA 3KR3L 1F2QA 2AKRB 3CVIH 4I5BA 1M7DB 1G9MH 4RISL 3F7RA 2JF1A 1HE7A 1CGSL 4A2LA 2IAMD 5D2NA 5F88A 2BHYA 5D6DA 4JN2B 3MCG1 4UV4H 4QRSA 1U3HC 3P0YL 4BSWB 1CU4L 4WDIA 1HHIA 1BVKA 3FT4A 5D2LA 5KZCB 4PJ5B 4YEFA 3IF1A 3QUYA 5TDPB 1CICC 1KYOJ 2ZG3A 3S36X 1MAML 4MNHA 1XF5A 2A83A 5EUOF 5DD0L 4BZ1L 4JG0L 5L88L 1DDHA 4XC3H 4U0RB 4XHQA 4TQEL 3TFKD 3WO3B 2YPLE 3AREC 4EOWH 3T1FA 3R4DA 2EDYA 2YWZA 4R4FL 3H2WA 3QI9D 5KZCD 1FO0B 2CK0L 1A6TA 3H9SD 1A3LL 1U92A 4J4PC 3TH4T 4TULL 2R4RH 1NAMB 4XB7A 4PRPB 3T09A 1TCRB 4NFCA 1A7OH 2ADGA 3GSWA 2I25N 1RVFL 1MCBA 3H9ZA 1CFVH 1KCKA 4RFOH 4OLUH 2HLAA 3PQYD 2DQJL 3CUPA 3DURA 1XF5B 2A83B 2LFGA 2O5YL 2VN7A 4I3SH 1XGTB 1IM9D 3SCMB 3EO9H 4OCSL 2PO6D 1G7PB 5DS8B 5H37G 1JIBA 2YK1H 1PKQB 1BP3B 3BO8A 5JXAL 1EUTA 2A6KB 1R3LA 4FRWA 1CE1H 1LO3H 4Y8AA 5GJTH 2OS7A 4APQD 3JV5A 5C71A 4JANB 3DYMA 4IOIA 2D03H 4JFFB 2X42A 3PWJA 3S3SA 4Y16C 5IFJA 1OB1B 1YYLL 4LVNB 4YHYB 1P84K 1G9NC 3KWWB 1DJSA 3TF7C 3MRPA 4FA8A 4HUWA 1URLA 3CVIL 5JHLH 4LCYA 3RI5F 2Y36L 4WW2F 2O61B 2R2BA 4WO4B 3FZUD 3RWIA 1MCPH 5DRNA 4QOKB 3TVMC 1KCSH 4UQ2B 3MLRL 3N50A 1OGAD 3QIWA 2F9BT 1UA6H 3O8XD 3ULVD 4GXUN 4G8GB 5DUML 2DN7A 3SE4A 4PY7B 2D9QB 2Q86A 4JM4L 3HZYA 4ORZC 3F12A 1E27B 1YMHA 5JLZA 5C0IA 4YPJA 4PRAA 2F19L 2IPKA 4WU5B 1T03L 1EIBA 3J8F7 3ZYZA 1VGKA 4PBWD 4I4WB 1H8NA 5DD3L 2YN5A 1YPZA 2PR4L 1O5DT 1GGBH 2AEIT 4NGHL 4JO2H 4KUZH 1XR8A 2OTWB 2WUCH 4JY4B 3V5HB 5IV2A 1XMWA 1A7BA 2AXHA 3G5XA 5DJYB 2AK4D 3D39B 2OSLB 5FO8A 2QQLH 5FDYA 4NQUA 1QVOA 3P77B 3T0DA 5FYKE 4G8FB 4QHMA 3RTQA 3T77A 1AQKL 1WGOA 2B4CL 4NO3B 1N4XH 1MWAA 3UBXI 4JPKH 4Y19E 3CSYA 3T0ED 3DUSB 3ARED 3WKMH 4OLUL 1EPFA 3DXAD 3QUZD 4X7SH 2ED8A 1GGCH 1OP3H 3U4BH 3DRTA 4IDJH 4YFLI 1WTGT 2JCCE 1PBYA 2MKWA 3BEWB 4G5ZH 1TQCC 1X44A 3EOTL 1JGVL 5HYIA 5KSUA 3MLTA 1FIGH 1N7MH 2Q86B 5C9JB 4YDIL 4X6CB 4JQVC 2ICES 1RZKL 2WWKT 1BZ7B 5FOBB 5LWYL 1AE6H 1GGTA 1QUNA 3K3QA 3LVEA 2YEZB 5L6YH 3TFKC 2C7UB 2J88H 3RQ3A 2X1WL 3GNMH 5E5RB 1LK3L 4D3CL 2J6EH 4GAGH 2IH3B 2AK4A 4R0LB 5EA0L 5M94B 4PJHB 1T2QL 2IBZX 5FDWA 4IOFC 1QOKA 3C5ZA 3NAAH 4GS7C 3BVNB 4XHJC 3L3IB 2VZUA 2P8MA 4ODSL 2BRRH 3OKMB 4YK4C 1N6QH 1KEML 2MKLC 5F3HA 3CSGA 2IFFL 3DLQR 5TE7L 3ZHKA 1BF2A 5I66B 1UYWH 3PWPA 1AP2A 4KTYA 4APQB 4DKFH 2ZCHL 4WHDA 4ODHH 1YMME 3FL7A 4PBXA 4W6WB 1KT2B 3QDHA 2HKFH 5IMOB 4ONFL 5B39A 1CG9A 4OF0A 2BNRA 5HHXL 2EC9T 1LNUA 4I0PA 3EDEA 3HG1E 5E03A 4PP1C 4K94H 2VLKA 3RAJH 2GSGB 4YXKL 3PL6D 2NTFA 1HH6A 5C0BD 3ULVF 2D2OA 2VOTA 3WFDH 3L5WB 4X4MA 5ESVB 4KQ4L 3DMMC 4E5XA 4KZEH 4WU5A 1ZSDB 3V6FA 4DUVA 4WW2C 5FYLH 4RMVA 2IFGA 3PIQA 4J1UB 3X12A 4XCFL 3HN3A 5C07D 4NN6C 5F9OL 4PJEF 5IBLC 5FA3A 25C8H 4S1RH 2X4NA 5C0CB 4J3OC 3WD5H 4FTVD 2PETA 4HXBH 3S98A 3RPKA 3VXRE 4XI5D 4DW2L 4Q9QL 2GY5A 3IDNB 3BAEH 4IOIB 4F2MB 3OKOA 1XGYL 2VDKH 4ELME 4U3HA 4N90D 1SVZA 3M1BA 4JPVH 2FX7L 3T0EC 4P57B 4U1SA 3MLVH 2MTPA 4HZLA 2J88L 4M9PA 4O2EB 2FO4A 4P46B 5KS9F 3PGCA 4PV9A 4WWID 3DV6B 2NY5H 5CGMA 3OKMA 5D5ME 1E6JL 4NUGL 5HI4C 3RWCA 3ZMRA 1HYSC 1UJTA 1PZUB 3LQAH 1ORSA 1NBQA 2X7LA 3MYJB 4OFYA 4Z7NE 4YIQB 1IAKB 3U7AA 1N6VA 3Q6FB 4MDIB 5IEHA 4U1JB 2ADFH 5IW6A 3KLSA 2D7PA 1FFOB 2DTMH 1VACB 2FSEA 4LKCB 1I7UB 2GCYA 2H6PA 1LO0L 2R69H 4N0RA 1WZLA 4M4PA 3CFEA 4ZQKA 5HBBA 4L1DA 1KPRB 3QCUL 3QR2A 1SQ2N 4GKSB 5BVJA 1HI6A 1RK0A 4OLXL 1N3NA 3RZCA 3WMSA 4TVPH 5IB1A 1NFIA 1YPZF 3S37L 5LGJB 5CD5C 3LKPB 4QXUL 1NLBH 3N9GH 3ULUC 4WV1B 4PG9B 3VG0H 4MCYB 5B38B 1S8DA 1QRKA 4HX1A 3S35H 2DQCL 1MRFH 5HHME 1J12A 3W39B 3VRJA 2WIMA 4AH2A 3WNPA 3QUML 4DVRL 4ZFOL 5E2UL 4UNUA 1P4IH 3KJ6H 4MQ7B 2R56L 1HQ4A 4NO2A 5ESAA 3C8DA 4QRPE 5GRXG 3FRPA 1TJGH 5FV1L 5TE4L 3DSFH 1WSST 2XN9B 3NMEA 4K3GA 3ARGA 4KRLB 3IRZA 5ILTH 2YC1B 2R29L 5L7XL 1NSNL 3B2VL 4P23A 2X44D 2AXFA 5T3XL 3C6LA 2R1XA 4NRZB 4OAWB 3QEQD 3RNQB 4BSVA 2Q76A 2FYYA 3MOQA 4PBVC 2IPKB 2OR8A 4PGCA 1UM5L 2RIKA 3DRTB 3QRFM 1JF1B 4QF1B 1G7QA 5I6XC 2HN7B 4NT6B 5EFIA 4ODXB 1YEDB 2VWEE 4JKLA 4ZTOL 4WTZA 2KBGA 3KPMA 3F62A 3PXJA 4HIEA 4OF3A 5IT2H 5ISZB 1QG3A 2FJHB 1KLUB 4NOFA 2HFGH 4Y8DC 1DQQA 1F11B 1Q0XL 4I2XE 3SDAA 5IG7A 1EVUA 2XZQH 2P5WA 2AEQL 2P44B 2QQKL 4H8WH 2G9HA 5E8NA 1JI2A 2P5WE 4FG6D 4RGNC 4AEIL 3BZFA 1UB5B 4X99A 5DD5H 1CD1B 2CKBA 3GMMB 3QIBC 4PP1D 2Y7QA 3GJFB 2OXHA 2ESVD 2ZNXA 2AJSL 3IFNL 4BA8A 2XYCA 3OKKB 4YEEA 3RVVC 4ZNEA 2A38A 1BQHA 4UOJA 3W5NA 2VLJD 2MCPH 4F7EB 3FO2B 2H41A 5BVJB 4FTVA 3UJTL 1UVQA 2MMXA 1F6LL 3NIFE 4MX7A 2IBZY 1T0MB 2DTSA 5IVNA 1JTTA 4G6JL 1A7QL 4P9HL 1C5BH 5FYKL 3UPRA 3H9HB 3G6JF 4RMRA 3D0VB 2I5YH 5E5MB 4MA8H 2E8ZA 5KSUB 4TSBH 3VMPA 3DVFA 4XXCC 3MOBL 4PJ8D 5EO1A 1W0YT 1XT5A 5GRVL 5E2UH 3EO1B 2FCBA 4KKBC 4Y5YB 4NZUL 4OD1H 3BWAB 4YXHH 3MLUH 3UJJH 3QCVH 3KPOB 3GMNA 3ZLQC 1UT9A 1NCCH 3QJHB 3UTSE 1ZHKB 4L9LB 3NPZB 3QNYA 1R0AH 4P5MB 2OZ4H 3P4NA 3BPOC 1IAII 4RNRA 4UINL 3L5XH 2I60L 4PP2A 5DWUL 3VXTA 3JWOH 1OP3K 5ABDE 1EA9C 3MREB 3VD4A 4AG4L 3FQXB 4NQCB 4HUNB 1MQKH 3WJJC 3KPRA 3BQUA 2Z91B 5CJ8A 5D2LB 3CSBA 4XNUH 3QXAB 4QTHB 3CDYA 3VXQB 4B50A 3QEUB 2IBGA 3V79C 1YYMH 5C2BH 5JR1L 1GOFA 3WUWA