3U2SA

Crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
236
structure length
225
Chain Sequence
ERLVESGGGVVQPGSSLRLSCAASGFDFSRQGMHWVRQAPGQGLEWVAFIKYDGSEKYHADSVWGRLSISRDNSKDTLYLQMNSLRVEDTATYFCVREAGGPDYRNGYNDFYDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG9 heavy chain
publication title Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 225
sequence length 236
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u2sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u2sA01
1BBDL 2ADJA 4XHQA 3T4YB 5JXAL 4LLWA 4TUKH 2V5TA 4AL8L 4Y4HC 3K2UL 2PR4L 4KTDL 5DJ6A 4NQVA 1OB1B 1NL0L 2E8ZA 2B0SL 4JDVB 4G7YL 2I9TB 3PWNB 3MRGB 5TQ0L 1T66D 2FJHB 3N50A 1YEHH 4TTGA 5C0AD 2NY3B 2PF6A 1PY9A 2AXGA 4PLKD 3KXFB 1CXHA 3U4BL 1HEZB 3WFHB 2DOCA 4LPTA 1YQVL 3QEHA 4ZAKD 3ARBA 5ADOH 3IJHB 1JNJA 1K85A 3ZDXF 4K8RC 5I16A 4UI2A 4P46D 4GW1B 3BAEH 5EN2B 3CUPB 5LXGH 4WW1B 4GQ9L 3IETA 3FN3A 4JCLA 1YEDA 4JZJA 3QDGB 5FO8B 1QKZL 4Y5VB 1NDMB 3ROLB 1KPRB 1D5MA 1HKLL 1I1YB 2F8VA 1NJ9A 1PG7W 3HPJB 3THML 4ZS7H 2PTTB 3REWA 4N1CA 3ARPA 4POYA 1A3RH 4ODHL 3B3IB 3BEVA 4Y4KC 4X7TB 1P5UA 5A2JH 4WW2A 4MJID 4Y16C 2IADA 4O2EA 4JREC 1KCVL 1MCDA 1UYWL 2R4RL 3JV0A 2PW1A 2Q7YB 4M61A 4KRPB 2LE9A 4PJFB 1Z5LB 2YHGA 2KQMA 4M4RA 3ZT6A 3DO7A 4HJ0C 1UXSB 1U8KB 5FAAA 4Z76B 1BZ9B 3BZEB 2CJUH 5T3XE 1CD1B 3I6LD 1CLOL 2DKUA 5EU7C 1ED3B 5GS0D 3AY4C 4LSSH 3ULUC 3S4SA 4BSJA 2YOCA 5D2LB 1TJIL 4WI3A 1BGXL 3FZUD 4KMTH 1CLZL 2IPUG 3RAJH 3UYOD 4MQ7B 3MBXL 1IAIM 4HK0B 4IRSD 4JZOA 2BMKB 3W11D 4Q9BA 4U1LB 4HF5H 5BRZD 1JIBA 4TNWK 1J8HA 3AFLA 4F57L 2AK4E 4BSVB 3HNSL 5KN5B 2VL5A 2X41A 5DHYA 5D7KE 3MRNA 5D1XB 4DWHA 4KTEL 4UDTA 5INCB 1B4JH 4Q0XL 4UB0H 4O4YL 5I1JL 4R4FH 4YE4H 1JGDA 1IEAA 3ULVD 5BCAA 1SVCP 4KV5F 1LQSR 1F2QA 3PL6D 4LARL 4PJHE 1UACL 1EO5A 4Q97A 2GK0B 4XCCH 4BQ8A 5IESH 1J87A 2QEJA 3ARED 3VXMB 2XZAL 2EYRA 4P99A 4XCYB 1HHHA 1JWUB 1JWMB 2EICA 3CFKB 5EZIL 2GCYA 4P9HL 1J12A 1H9VA 3B9AA 1T1WB 1FNGA 4GKSA 4FZ8L 4HS6A 4NM8L 4MJ5A 5KSBB 2X44D 4KMQA 2BCKB 3D87B 4ZTOH 4YPGB 2VQ1B 2JELH 4IM8A 2X4PA 4XVJH 5BQ7A 1MJJA 1HSBB 3O3AB 2HYMA 4GO6B 3P4MB 1D6EA 3CDYA 1G6RB 4R4ND 3V5DA 3T3ME 3QEGH 1NMBL 5ID1B 4JN2B 1IKNA 3U30B 3HC4H 35C8L 4OLUH 4YBHA 3BHBB 1ZA6A 4PJEE 5DMKA 1WCBB 1FIGH 3VWKD 4C4KO 5DD5L 3I3EA 1I4FA 1A6ZB 2K7QA 1R3JB 2RHEA 4YDKH 4BZYA 2P1YA 4HXAH 3RY5A 1J5OH 2Z93A 1S7QA 4HBCL 2UWEB 4K7FA 3QDJE 4NIKB 5E2TH 1KJMB 3GMNB 1R3KB 8FABA 2APWA 1ZGLM 5BW7A 1KGCE 1I1AD 3RGVA 2YD6A 4X6FB 3EZJB 4FQCL 1Y6NR 4X6DA 1BQUA 3PHQB 1V7MH 4NC0B 5HDOA 5C09A 5IMKB 3MNVA 5I2IB 4NN7B 1AGEA 2VAAA 5EU7E 5JPNA 5B22A 3ULUE 1B6UA 2MMXA 3EYUH 1JFQH 2Y6SC 4X9BA 2F74A 2AJYH 3RTQA 5DVMA 2WQRA 3AAZA 5DHVA 5GS2H 5BVJA 1RUKH 3TJEL 2YUZA 2ZUVA 4YQXL 5F93C 1FG2B 3QUYB 1KUMA 3GMPA 4PIRF 1OCWL 2SEBB 3QWQB 5J8OA 1KIPB 3SGDH 5J57B 3SDAA 5JOPD 1U36A 1N64H 5C0ND 3RKPA 1DUYB 2X4RB 4ZDHA 3BZFA 3QJFB 3SDXE 2FB4H 5T5NG 4PJFF 5C07A 4M7ZC 4OZFG 4CDHA 2BX5A 2HTLC 5DRXA 2Q8BL 4PRHD 3LQZA 4PRID 3QIWD 3WJLC 1VGEH 3HE7B 2WUCL 4UDUA 3DOSA 3GGWB 4PGEB 1QBBA 3KDMB 4PJXE 1J88A 3O3BA 2FX7H 4HPOH 4I18B 1MFAL 4PY7B 5F6IC 1RURH 1U91B 1YMHA 3HFMH 1S7SA 4E0RA 3RY6A 5DC4B 5BZWB 2CR3A 1G1YA 2XTJD 5IKCA 5JZ7C 1OGAA 1R24A 2ILLA 1H15A 1J9CT 4LEOB 3DETD 5DQ9A 1VGKB 3D69B 1FVCA 3O6MH 4OF7A 2UV3A 3QIBA 1C8PA 1OHQA 2ID5A 1QG3A 1F3RB 4NJAL 2BNRA 4WO4B 1NCNA 5FO9A 1J0HA 3CMOL 3MYJB 1IGJB 1N2RA 4OGYL 2Q6WB 3MGOA 1S9KC 4H0IA 3BKMH 4HPYL 5BO1L 4XNUH 2ZG2A 5F7WC 2J88L 5IB1A 4XP1L 2EH8H 3VGAC 4R9HA 4X8JA 3CXDL 1U8IB 1VPOL 5E2UH 5E2WL 1Q9WA 3WLBB 4ZUSA 3RVUC 4N0UE 3DRTB 3OG6B 3IFOB 5IG7A 3G5VB 5I71B 3T2NL 1MRFL 5DJYB 4WHCA 5IMLB 3HZYB 1EDQA 2P8MA 3KPNB 4XPTH 5J12C 4JQVA 4FQXA 5DJ8A 1AIFB 4Q6YA 4PJ5A 2DQIH 4J7RA 3EKCA 4OM1L 3MFGB 1U8JA 3M8OL 4N0RA 5JDSA 4JGJA 4JJHA 5T3XD 4FQQA 2FO1A 4ZYKB 3TZVC 3PP3H 2UWEF 1YY8B 4M3JA 1KT2A 2V2XB 1ZLSH 2A1WH 2IFFH 4TVPL 4RDQF 3PP4H 3BVNB 4HUWA 4NKDB 4NUGH 4WV1A 1A7QL 3DMMB 4CL7A 1INEH 5D7JB 3A6CL 5F1NA 3ZDZF 1UT9A 4WHYH 4IIQB 1IM9B 5FYJH 5ABDE 1TJHL 1B0GB 3LKNB 4ZUWB 2EYSB 3QNYB 4JB9L 3RKDD 1Z0MA 4LHJB 4FQLH 4LDEB 1PZ5B 4H25B 4K23H 5IFAH 5JXED 3STLA 3WS3B 5GGQH 1OOAA 5E94A 5HDBF 5FOBB 1F58L 1UH3A 3NA4A 3FO0H 2HRPH 1MVUB 1ETZB 4G42B 4IJ3B 3TLRA 3DYPA 1NFDE 1WFOA 4UV4L 3P77B 3HZMB 3RWJA 3LEYL 4O9HH 3JV6A 5JIHA 2B5IB 2JK5B 4KZEL 3T0XA 1N8ZB 4L8BA 1KTKE 5C2BL 4RGOH 5IBLD 1BWMA 4HK3J 4NFCA 1H3XA 4U49A 1UM6L 1E4XI 5C8JA 1F02I 1E27B 4LNRB 1FPTH 4JHAL 5JHDE 4XH2A 1NGYB 1J1XH 4UIMA 2VZ1A 2BHYA 1D9KD 1FBIL 4X6EA 4DQOL 1U8LB 3ARBC 3F7YA 2IAMB 4J1UA 4NWUL 3KVQA 4O51B 3W9DB 4YHKL 1WZ1H 1AY1H 2VN7A 3FB8B 3HI5H 5ESAB 3S34H 5HHOB 5E99L 2HMID 2F53B 5GGVL 1M7DA 1A5FH 1ZSDA 3VFWA 4QNPE 3MV9B 4KPHL 3V79C 3VXRB 2R56H 4JZJC 4GRLB 2BK8A 4Y19B 2VXVH 1K4CB 1T0NA 1CFVH 5IHZA 4F37F 2PTVA 1DZBA 2VQTA 1JF6A 3T3PF 2Q76B 3FB5A 3ZDYF 2XA3A 1LEGB 3CSYA 1BJMA 4H8WL 1LO5B 4OLEA 1X7QA 1QFUL 3O4LA 1A02N 4EDWL 4OM0H 1CT8A 5E9DE 5T1LB 4MLSA 3QDJD 1LILA 3H7BB 1T03L 5L88H 3WFCL 1NGWB 4WW2C 2VH5L 3W0WA 4X4MA 5C0GB 4TUOA 5J11C 1TJGL 4JN1L 1DN0B 1NCDL 2O5XH 2CK2A 1TDQA 3BUTA 3NFPA 1XAUA 3UTSB 4XGZB 4GQPH 4AEHL 3CFJB 3D39D 3V0VA 2AJZB 4HJ0D 3QO1B 3G5ZB 2IBBA 1KPUA 2JKXA 3VDBA 3NCCB 2NY0C 3FFCE 1BQHA 4JM2C 4NNXB 5E00B 4LASH 1OPGL 4LCWB 5E6YA 2OSLA 1HINL 3HHRB 4DZBA 1Z9MA 3TV3L 3G04B 4KJWC 3EOAB 4RZCB 2H3NB 2C1OA 5JORB 1T5XA 2QKIA 1NLDL 5AUMA 3GBNH 4HMCA 3IDNB 1P7QA 1AD9B 4Y0GA 4P5TA 4KKLD 3B2UD 4IRJD 4AH2A 4DOHB 4G8FA 2DLIA 1G7QB 3CH1A 1HH9A 1QBMH 1IARB 3TN0A 3INUH 4DGVL 1G7LA 2VISA 5EDXA 1OF2A 4RA3A 3NH7L 4FQHA 5HVHB 3F7RA 2HJFA 3ORJA 2EDEA 3PWJB 3W2DH 3V6OA 3DVIA 4URTB 4CDGC 4ZFFA 4BK4A 4ZFGL 2YPKB 4PLJD 5E8NB 1SM3L 1WSST 4DVRH 2ITCA 4XNQB 1ZLWK 3Q3GB 5BS0B 5F3BA 3VFSB 3OF6A 3LVEA 4F7TA 3DTXB 4P5MA 4KKAD 1P7KA 4WHTB 3T77B 4K3DH 5IMOB 3RWDA 4GSDL 1FC1A 5INDB 3WUWA 3PUCA 5FHBL 2VLLB 3GSNL 2VO5A 4GMSL 2BVPB 4CMMB 2VLKA 3AVEA 5ICXA 2V17L 1RZKL 4XX1E 3AGVA 4RAHA 4L3AA 4BK5A 3WFDH 3MJ8A 4YDLB 5J6HA 1V7NL 4G8GA 4HIXL 1IKNC 4WEUD 3JTTA 2KKQA 5A3ID 3DGCR 4K71B 4PB0L 2P49B 1IGYB 3FT4B 1LP9B 5SWSA 5L6YL 3LIZH 1F8TH 4G6JH 4P9HC 4IEFB 2ZJSH 3VW3L 3SY0A 1CVSC 5D4QA 1ZLVK 3UAJD 1EMTH 1MAML 4LBEA 3MLSL 1U3HD 3P4NB 4YH6A 3OSKA 3DURA 3K74B 2IANA 4WWKA 2C1PB 2APFA 4JANA 5BW7C 4GBXD 3RGVC 4XVUC 3STBA 5HI5C 3OB0K 2NW2A 1LO0H 3QISA 3MRPB 3SBWA 1QHPA 1A0QL 3LD8C 5DA4A 1YEIL 3O4OC 5D2NE 1EHLH 3T4YA 2Y6SD 3IXAB 3VGHA 3ZSTA 5FYKU 1MFBL 1T1YA 3RTQC 1OB1A 1W72B 5HI4C 3HE6C 3P30H 4LGRB 1QBLH 4NHCH 2I9TA 3PWNA 4HMEA 3EFFB 1L7IH 1ORSB 1K9TA 3CJJA 3IDYB 3TA3C 1P6AB 1G7PB 3KPSD 1J8HE 1NMAH 4P59L 1YEEH 2DMBA 3C6LA 5IK3B 4OF3A 1U3ZA 1CFTB 2EO1A 5FCUH 3TT3H 3D18B 5IB4A 3VFTB 4APQB 1T5WB 3WFHA 1KB9J 4MZ2A 4NQXA 3J8F7 3IJHA 1UWEH 4ZO7A 3SDAC 4OLVH 5T3ZH 4JY5L 4ODTH 1TZIA 4PJGE 4GW1A 1C5CL 2B4CC 5EN2A 3CUPA 4KJPC 3UJIL 5FV1L 2P5ED 3QDGA 3KYOA 5FO8A 2C4FU 4Y5VA 1NDMA 3ROLA 1KPRA 4M93C 1I1YA 4HS8H 1ZVSB 1ES0A 4DFHA 5DJDA 3HPJA 2WBJC 3PQYB 3LS4H 3V8CA 2P7TB 3GM8A 4KGLA 3QHTC 2NMSA 4ZUUB 3ZKXC 4JKKA 1GAFL 4MS8C 4FTVB 1J0ZA 2CXGA 5EZOL 1JGUL 3GJEB 4M7LL 1EUTA 2BVTA 1AR1C 1XCTB 3U6RB 3B3IA 2DI9A 4IHOB 1RZ7H 3RY6C 1G0YR 1KN2L 4D0DB 1T89A 1HHIB 5JHDD 4FFYL 4K3HA 4X9HA 1RIHH 1A21A 1DLHB 2Q7YA 4PJ9B 3GRWH 2AJUL 2VERN 1VFMA 3SO3B 3MLUH 4PJFA 4FP8L 1C1EL 5BV7B 3QIBC 3V4UH 4L3EE 4NPYA 2EIEA 3T2OA 5TPWH 4F9PA 1UXSA 3BPOB 3VGEA 3RVTD 4Z76A 2JTDA 1BZ9A 3BZEA 4WENB 3TVMD 3O2DA 2BY3A 1ED3A 1FNEB 3BXNA 4XC3L 3N1MC 2HFEB 3IDJB 5CEYB 1V3MA 1B2WL 4OV5B 1OAXL 3ZTJG 5MHSE 1MSPA 3TNNB 3RI5K 1M6OA 1RPQA 1KV3A 1EPFA 1IFHL 3JWDL 3BPNB 4MQ7A 1N5YH 4QRRE 1MJ8H 3I50L 1IGIL 4MA1C 5C09E 4EUPB 3QG7H 1CQYA 2FYYB 1MRDL 3RA7H 3U83A 2ZCLL 1TNNA 5KN5A 4YGVB 3PWPE 4K3EH 5D1XA 7FABL 3FMGH 3ALXA 4NM4H 5TDOA 1K4DB 1G6RL 4U1GB 3SCMB 5L8LB 1ZOXA 4H1LH 4FQXC 4JQVC 5ADPH 3VXMA 1FLRL 1F13A 3QIUB 5LBSH 1UH2A 1JWMA 1JWUA 4EBQL 3CFKA 4YFLI 4NO3B 2WINB 3QDMD 5EO0B 5TH2B 3RUGF 1HXYB 5DMGD 4RRPA 4KQ4L 2XWJA 4LQFH 3IAGC 1SBSL 5I73C 2BCKA 1A1NB 3VXSD 1WZKA 4G5ZL 3GO1L 4FQPA 4WV1C 2VQ1A 3QFDA 4PV9B 4YPGA 1I1CA 3CC5A 4MDJB 2UZIL 4IDLA 1XGPA 1NCAH 5H37G 1A1MB 4LKCB 3O3AA 3OJMB 5C07E 4PJ8D 4XWOC 4FS0A 3QZWA 3QCVL 3BISA 3KG5A 4JN2A 3HB3D 2ZNXA 1XZ0B 3F7VB 3QXWA 3X12B 1DVFB 4JFEE 3MLZH 1D5IH 3B9EA 3FCTB 3NTCH 5I6XB 1R3JA 2XRAL 2VNCA 3IKKA 1T7VA 1SMAA 2H9GA 2DQFB 4XP6L 2UWEA 1UQSA 1KSRA 3EZ8A 4L4VD 2ARJB 4OCWL 4IRZL 4XX1G 3H3BC 1KJMA 3GMNA 3OPZH 1R3KA 1X4XA 1QEWB 4ZO6A 1TITA 3BD4A 3LY6A 1PQZB 4X6FA 1OGTA 1UWXH 3PIQB 5KANI 3OV6A 1S5HA 3MRFA 1AHWA 3PHQA 1RZFL 3IFLH 3WEXB 1QFWI 3IFPB 4CMHC 1G7IB 5IMKA 3FN0L 3HMWH 3O45B 3MNZB 3MRLA 5IW6B 3B43A 4WUUD 4DGIL 5E6ID 2H32H 3FQRB 3ZE0E 5ITFB 4IOFC 5J1SC 5TE7H 3UZQA 4YHNB 2COQA 4BFIB 4IDJH 5E08H 4DN3H 4YUEH 4KQ3L 5DD0H 3MRQB 3QB7C 4LP4A 4YK4B 4I2XB 3DVNA 2YKLL 3H9SB 3NZHH 2SEBA 4Q6IA 4F2MB 3T0AA 2ICES 4YR6B 3AROA 3BIBX 4ODXA 1GOFA 3NGBC 4KKBC 3S88L 3DI3B 2H1PL 4NBZB 2MHAB 3QFJA 1D3CA 4TSCL 4FQIL 4PG2A 4YEFA 4HW6A 4I5BB 4K94L 3QJFA 5ALBL 4R2GC 2Y1VA 2R69H 3CZJA 5IJVB 1EFQA 4MCYB 3UZEA 4CVZA 4J6RH 4JM2D 1YPZB 1T0PB 5CGYD 5C0BD 2I27N 3CDFA 1WBYB 2A74B 2R2EB 3HE7A 5GJSH 4LCCB 2I07B 2ATKB 3WFEL 3WLWC 3GGWA 1PKQB 3HC0B 4OKVA 3BH9B 1WBZB 2X4QB 4YHIB 5CEZE 5D9SB 4UQ3A 1C5BL 3P0YH 2A6IB 3S98A 3Q5TA 4P5TC 5H94B 2X9XA 3U82B 1I3GH 2UUDK 3L3GB 4IS6A 5F7UA 1KCSH 4LEOA 4XNZB 3TN0C 3D69A 1CBVH 4OZHF 1S7TB 1E6JH 1TPXB 2VDMH 1E6OH 3BDYL 4CJ1A 1PVHA 4DFIA 3SGKA 2NYYD 2ZNWA 4UU9B 2EZ0C 3BP7B 3V6OC 1ZGLP 4KKCC 4OF0A 4FG6C 3MYJA 4HQQH 1GGCH 4PJIE 5CJOH 1U8NB 1VKXB 3ETBF 3QO0B 5D96B 4LLDB 4YXHH 3QXTA 3NIFF 2A6KB 3AUVA 3ARDC 3LPWA 2OS7A 4NQDB 4JKMA 2B20A 4JZNB 4ZUVA 1A6UL 3BEWB 3ZKMC 1MFNA 3E6HB 4Y4FB 3WNLA 3QCTL 3DRTA 5GQBA 4M43H 5HHQB 3EW3B 2NX5E 3OAUL 1MH5B 1ZLUK 3MBED 4ERSL 2ZUYA 3KPRE 2YZ8A 2EDBA 2BHZA 3CFDA 4AEFA 2QLVB 5IMLA 1EVUA 4UOW1 3KPNA 4P2YA 5HI3C 4PJAF 1AIFA 1REIA 4DW2L 3B9KB 2FO4B 3U46A 4Z18A 3SDYH 2A77H 3O4LE 3FTGB 1A6VH 5C70A 2AEIT 2UVEA 2F58H 4WFFE 1PG7X 5C0CD 2V2XA 1N3NB 15C8L 4RMSA 3C60A 4XTRC 3T2PA 5JXAH 3QG6A 4EZMA 4HH8A 3W0WE 4OZIE 4X4ME 3RJQB 4XVUD 3K2UH 2PR4H 4KTDH 5D7JA 3S5LG 1NUDA 5A2KH 1MVFA 1NL0H 4IIQA 4LL9A 3KYNB 1DBBL 2B0SH 3DPBA 4QRRD 2HJKB 4JKWA 3KPPB 3LKNA 4G7YH 4ZUWA 3SBWC 5TQ0H 5F8QC 5KAQG 3CVIL 3ES6B 4H25A 2Z31A 4LOUC 3BDBA 5FOBA 3OQ3B 4U4BA 2JCCB 5DEZA 3U4BH 1MJ7L 1MVUA 1KJ2B 1YQVH 3KPQB 2Y5EA 3HE6D 2APXA 3HZMA 3P77A 1NFIB 1ADQA 2I60L 2JK5A 3FONB 3IS1X 4YBQD 3TA3D 1N8ZA 4XXDA 5F1OB 1INQB 3HRPA 4F33A 2EDKA 4BZ1L 1MLCB 4AIOA 4LNRA 1QKZH 3C6LC 4Z77B 4GS7B 2V7HA 5K9QI 2HT2C 1U93A 4N0YL 4ZSOB 3LRGA 4HIHB 1VEPA 3THMH 3LKOA 2YA2A 4Z7OF 3VMPA 4O51A 1DUZB 1JTTA 4MA3B 1I9RL 2BXYA 3DYMA 2PW2A 4Z0XB 1X6LA 1ZHLB 5A40E 5HHOA 2EE2A 2R4SL 3TIEB 3B9VA 3EJYD 3WD5L 1XR8B 3GIZL 5DJ2B 3SGJA 3OXSB 1RK1A 1M71B 2WBKA 3VXRA 3P73A 5CFHA 3U2SA 4GRLA 1VFUA 3BD5A 1F4AA 1KLFA 4QXGL 1NCCH 5KTEL 1FORL 4YHZH 4Y5VC 1KCVH 2WBJD 4JFED 1OWWA 1UYWH 2R4RH 2EXWC 4QHUA 2X4NB 5HYJE 1SJHB 2UVFA 2Q76A 2BOCA 2VZ3A 2J5LC 1B0RB 1Z9SA 1RIVL 3IDGA 1MIEL 2FLRT 4ODBD 2R0WH 3B6SA 5B21A 2GITA 5AAWA 3CFIC 1CLOH 2V7NA 3L9RB 3V5HB 5GS2D 1J8KA 1NGWA 3F5WA 1VEOA 2XPGB 3QAZC 4HH9A 1T89C 4QRPD 5KZCB 1BX2B 5C0GA 1TJIH 2NY6D 5F7EL 1I7UA 1DN2A 5KSAB 1KXQE 1TVBA 1BGXH 2JIXB 5C0FB 2E7HA 2BSSA 4FQJL 3MBXH 3L5IA 2Q87A 5H2BB 4BKLB 5EC1A 3G5ZA 4AENA 1ERNA 3TYGH 1HYSC 1NEZB 3UDWA 4F9PC 2VLRB 3QNXB 2NPLX 4MWFB 4EI5B 4F57H 3BKYL 4LCWA 3ULSB 4GRWF 3HNSH 1QPXA 3CVHB 5K9JL 3KLHD 4Z95L 3G04A 4RZCA 3EOAA 5DJAB 4KTEH 3U79A 4Q0XH 4O4YH 5I1JH 1KXVC 2IANE 4NQEB 4XC1L 5EIIA 3ZHDA 1AGCB 3MOQA 4LARH 1UACH 3CSBA 1UVQB 4YAQB 1FL6B 4OFVA 1GGYA 3RVWC 4Z0BL 3MGAA 4FRWA 3CFCL 4PRPD 5EZIH 4W6YB 1G7QA 2VIRA 4P9HH 1FDLL 4FZ8H 4OCYH 4G80A 5D1XC 2ZOKB 4JO1H 2IGFL 4G6KL 4L4JA 2OMBA 1PFCA 2YD4A 2R0LL 2ATPB 3QUMB 4Z78A 4OD2A 3O6FB 1FL5B 3P40A 4U2YA 4U6VL 5E8NA 4JY4B 1GJIA 2F54E 1ZT1B 1JUFB 1CE1L 5HHXL 1NMBH 3Q3GA 5BS0A 3L3DB 4N8VA 1BOGA 35C8H 4G9DB 3VFSA 5K59F 3V52H 1JP5A 3DTXA 4D9QE 5DD5H 4L9LB 3G6DL 4I77H 3T77A 3NCYS 5IMOA 3X17A 1Q9OA 2R39A 3QDAA 3WNMA 5E70A 2VLLA 3O41B 5I1HL 2BVPA 4EEEA 4HBCH 3GK8L 4KJQD 5C0AB 1HQRA 3QXUA 3SJVA 4I8DA 3RL2B 3D0LA 3HI6L 5DHVH 5DFWH 3HG1E 4KI1A 3U30C 2A9NL 2DLFL 3P9LB 4P2CG 4ETQA 2FDBP 3FT4A 4Y2DD 4X0KB 3DNKA 3ZKNC 2CUMA 4PGCB 3BRDA 2D7NA 1X5IA 1Q0YH 2PCPB 1W72L 3MROB 3RUGA 1VDGA 2LVCA 2VZVA 1SEBB 4DKAA 1RIUH 5IMMB 2PYEE 4QF1B 4KJYA 2ZUXA 1KENH 4U0RB 5B38G 2NY4D 2IG2L 5E4IA 5CSBA 1X5XA 1AHWC 3DVGA 3TJEH 3QUZA 4W4NA 4YQXH 1AXTL 5FDYA 5D93C 5D1ZD 3C5ZC 3OX8B 1OCWH 2NX5D 3KPRD 4PS4H 5DJ0A 3HLAA 1DQQB 1SMOA 5FYJD 1CR9L 2GEEA 5DUML 2FEDC 5GGSY 4K55A 2BVYA 1W72A 3OHXA 1WFUA 1BD2B 4Q2ZB 3RGHA 4KVNL 2DBLL 5MI0C 2DQJL 2W1NA 4UNTA 3EJJX 4P2QD 4M00A 3EO0B 5T33L 1G7PA 4GKOA 4LCYB 5IBUB 2Q8BH 1GPOL 5IK3A 3RIAF 4Q6IC 2KQNA 3VFTA 4APQA 1DLFL 4RMTA 2WUCH 3LS5L 3OKOB 5GZND 2MWCA 1HHKB 4YC2B 1HSAA 2P8LA 1JZ6A 1AO7E 5E6ZA 1I9IH 4PG2C 1EBAA 4RBPK 2L7JA 4IRSB 3N0PB 4D8PB 5HHMB 3TPUA 5I1DB 4UOW0 4S1QH 2V2WB 1DBJL 1LEIB 1IKFL 1J1OL 5BV7L 1LO3L 3KJ4C 5EU6B 1A6PA 1ZVSA 2L7UA 4QRQB 3MQIA 3HE7C 1NAMB 1NCUA 4I3RL 5D72L 3PQYA 3H9YA 4OUUA 5ISZB 1UCTA 3G08B 3UBXG 3PL6B 4HJGA 4FTVA 4NJAH 3OKMA 4KVCL 4N8PA 5KSUA 4C56D 3AREB 4KK6C 3GJEA 1ZT4A 2AQ3A 3CMOH 2NZ9D 3X3GL 1NC2D 4Y5XA 4IHOA 1MWAA 4OGYH 3NVQA 1W0YT 2YPLA 4O02L 4D0DA 5GZOC 1HHIA 1CICD 1TQBB 4K94C 4RAVB 3AMLA 4NYLA 4LVOC 2R8SH 3ARQA 4HPYH 5F7LB 5BO1H 2LU7A 4PJ9A 2JJVA 3VI4E 4XP1H 4W4OA 3BPLC 5E2WH 4NKIH 1VPOH 4JFFD 3TO2B 3SGKC 3WDHA 1FIEA 2YUVA 1TCRB 1MNUL 3CFBB 4TN9A 2E27L 3PXHA 3IDJA 5EOCL 5CIPB 3T2NH 5FA3B 1MRFH 2F58L 1OW0A 3TNNA 4WVRA 3EO1B 5HYJD 1PLGL 5KOMC 3CPLA 2P47B 4XCFL 2HJLA 4OM1H 5JW4R 4J4PA 4XNMB 2EE6A 1BQLL 1OLZA 3M8OH 2ICWJ 1H8OA 4QY8B 5HDBE 4OZHA 5JMRA 2P5WA 2D4FA 4LK4A 4YGVA 1PX4A 2VWEC 3QWOB 4TVPH 5CINL 3BE1L 2W0KA 5I74B 5C0RH 1K4DA 4Z7VF 3SCMA 5IT2L 3CFEB 1A7QH 1T0MA 2DD8L 3QHFL 3X11B 4P3DB 2DQGL 3CH8A 3A6CH 5FYLE 43C9A 3MRMB 5HBBA 5F9DC 5GGTL 1TJHH 4QYOB 3QIUA 4WDIA 3P4OB 5EOQL 4JB9H 4MXVF 2CDFB 4NO3A 1WIUA 4CW1B 1RSFA 2P45B 4KUZL 1F58H 3LB6C 1HXYA 5EO0A 3QHZL 5TH2A 3C60C 3PJSB 4LLUA 3G5XA 3QFJE 3H42L 1T1ZA 4X5WA 4UV4H 2BVEA 3LEYH 5CZKA 3SDCB 3RDTD 4IIQC 3UROR 1A1MA 1VB9A 3FAXA 4KZEH 5C2BH 1PBYA 5EA0L 1F97A 2EDQA 4U6YB 3ZL4L 3KS0J 3L5WA 3V5KB 2Z31C 3B8YA 5I17B 1T1XA 4JHAH 1N0XL 4MNHB 4PJAA 3X3FL 5GGTA 1YEKL 1DVFA 1D5ZB 3T3PE 2E9IA 4KROC 1U8PB 3ZDYE 1PSKL 1TVDA 1FBIH 1KIUA 4XP9L 4DQOH 1KCLA 4YHKH 3GIVB 1QLEL 2DQFA 5EO9A 5KS9F 5J6GA 2Q20A 3HAEG 5E99H 1FVDB 2FATH 1TVHA 5CSGA 5EBMB 5J13C 4JHWL 4PRHB 2F54D 4OFYD 2DYPA 3N1PC 3QIWB 2BVUA 4KPHH 4FFVC 1FFOB 1EERB 3OGCB 1QEWA 3BI9X 1PQZA 3BP4A 3IRPX 4D9QD 1AP2B 3PIQA 3V4PL 1P69B 3X14A 1IL1B 1KB5B 3EDJA 1IGML 2ZPKL 3IFPA 1EA9C 4MAUL 4H8WH 1EEZB 4OZFB 4U1KB 1QFUH 4NZRL 1DL7L 4XI5C 1T83A 3O45A 4EDWH 1JPTL 3MNZA 5TDPA 3SGJC 3BN9D 2E7BA 3FQRA 4GJTB 1KEGH 1I3UA 5ITFA 3HG1D 3WFCH 3MRDB 4GRLC 5B4MC 1ZHBB 5K9KB 4LQ1A 2VH5H 4HV8A 2XICA 4S1DC 4P49A 1NC4D 1X6NA 3KNBB 4ISVB 1TJGH 1BIIB 2NXZC 3ULVF 3MRQA 3MGTB 4NQUA 5DXWA 3HR6A 3BT2L 4AEHH 4Q74A 1YN7B 2AW2A 1N7ML 1HOCA 3MMEB 1EXUB 3FRUA 4LDLB 3H9SA 1F11B 3IDUA 2ZUSA 4F2MA 1RULH 1OPGH 4RNRB 2VWEE 1HINH 3TV3H 1IC4L 4DVBB 2AV1A 2PYED 4XPFL 4E5XB 3WE6B 4ODVH 3O11B 1NLDH 4I5BA 2IMMA 5ESVB 4R97C 5C86A 3RWEB 2XXMB 4YNYB 3GSVA 3FKUS 1A6WL 3KHOA 4JM4L 5D7LD 1HYSD 4MCYA 2HFFB 1YPZA 4G8EB 1BEYL 5T3ZD 1L0YA 3KPOB 4B50A 1WBXA 1WBYA 2BY0A 2A74A 4LCCA 3UTPE 2ATKA 4JRYD 3TBYB 4DGVH 1IC7L 3HC0A 1CFSB 2X9YA 2XN9A 1PY4A 3BQUD 3NH7H 5C08D 4DK3A 3QXAB 2X4QA 3NN8A 4YHIA 3MLXH 2A6IA 2OXGA 3D25B 4WNQB 3UXFA 2R2HB 3LN9A 1SM3H 2NXYD 3DUUB 4F8QA 2YD8A 4DUXA 2HN7A 4OFKA 3IRZA 5IW1A 3E8UL 4KDVA 4ZNCD 5C6PB 4M7KH 3VWJB 1S7TA 1G6VK 2QTEA 3H8NA 2X4TB 5I8KL 2ZCKL 1AO7D 1JI2A 2RJMA 1BVLB 4C59B 4GSDH 4UU9A 2JJTA 3BP7A 4WU7B 4J3UA 5FHBH 3D2UD 1FFNA 5FYKL 3S7GA 4GMSH 4WCYL 1U8NA 1S9VB 1RZKH 2V17H 2AK4B 4NRXB 1G9MC 1I3RB 3QO0A 5TQ2H 3QZWG 3UTTD 1FGVH 3CLEL 1QFHA 1EVTC 1CN4A 4HD9A 2FIRT 2YA1A 1V7NH 4LLDA 1EFXD 2A6KA 4NN6C 4Y4HB 4PB0H 1R5WB 3NBNA 4LHQB 5L6YH 3ZSSA 4PJHB 3ILPA 1JF5A 5BJTB 3BEWA 3FB7A 1V3LA 1JZ8A 3E6HA 3SDDD 1QFWM 2R1YB 3VW3H 1GC1L 1W0WA 5HHQA 2VL4A 3WL9A 1MH5A 4UBDC 4LVHB 1KYOK 4L8SA 3HPLA 3MLSH 1IM3B 4YDLC 2YRLA 1YNKL 3Q6GL 1D9KB 4K71C 4V1DD 5B39G 5F9JB 4AEEA 1KPVB 2N7BA 4JFOB 3SE8H 3B9KA 4MZ3A 2ADIB 4XVTH 4BH8B 1EHNA 1IEHA 1K8IA 3SGEI 3FTGA 4H26A 1A0QH 2NY2D 2DWEB 3O8XA 1C16A 1YEIH 1N3NA 3TBWB 1CE6B 4WEBL 4PJEB 4G9FE 5EULV 3H9ZA 3C87A 5E1HB 4RFOL 2LV4A 1MFBH 3N1QC 3P9MA 5IWLC 5GRUL 3QSKB 2EIDA 1AD0A 1LVEA 3KYNA 4X5XA 2X7LA 3KPPA 4OGAD 2Y23A 5T5NF 1GGTA 3QUZC 4HKBB 3BP5A 4UT6H 3QDJB 4Y16B 1OTUC 2WP3T 4JREB 3V7MA 1RUML 2QHRL 5CKGA 1ZANL 4L4TD 5SX5H 1KJ2A 3KPQA 3MRRB 3BESR 4L3CA 4ZS7L 4NGHH 1W8OA 4JY5H 2GAZB 5FYLD 2A83B 2Z92A 2V9RA 4J8RA 3NFSL 1Z2KA 1C5CH 3UJIH 4CBPA 1JPFB 1INQA 2NW3B 4OI9A 1IC5L 3VFNB 4D0BB 3U9UB 2AXFB 2GI7A 5IOPB 3S3SA 5A2IH 4H5SB 4APQC 1AKJD 4HIHA 3H2WA 4KTYA 3RP1A 2YEZB 3O2DH 1DUZA 2B8OT 4MA3A 1ZLWH 4PR5B 4Z0XA 2PKDA 1YYML 7CGTA 5EZOH 3TYFA 3TIEA 4IRJB 1JGUH 1YMMA 2EDNA 2VXQH 4JQXA 4M7LH 4FQ1L 5DJ2A 1M71A 2CJUL 3T09A 4XB8A 1R3IL 4LKXB 4JHBA 4MDIA 3G6JF 5KG9B 2PXYD 2AJ3B 1KN2H 3AS3A 1LGVA 2ADFH 5MEQA 4G6AC 4JFYB 4FFYH 3ARZA 1T4KA 2B1AL 2X4NA 5D1QD 4C83B 1SJHA 2AJUH 1WLHA 4S2SB 4FP8H 1C1EH 3SDXB 1F90L 2R9HC 3CVHL 4GG6E 1A7NL 4NOBA 1QQDB 3RRQA 2BSTA 4QOKA 4ZO8A 1MCBA 5JOFB 3KYAA 3QEUA 2IALA 4Y5XC 3L9RA 1VCAA 3RHWF 4NKMB 4YO0B 4KH2A 4XC3H 3D3VE 2DWDB 3SJVE 2XPGA 1S78C 3MXVH 4FXKB 5E2JA 3NFNB 4NCC2 2OR8A 1BX2A 1B2WH 1OAXH 3D0VA 1JZ5A 2JIXA 1IFHH 3JWDH 2FIKB 1H5BC 4PJXB 1Z3GH 1P1ZB 5H2BA 3C9NB 3DRQB 3FQXB 4XCCL 4W4OC 3I50H 5IESL 3QUKA 1IGIH 3L3JB 3PHOB 1JV5B 1HXMB 5C6TH 4EIZC 4BSWA 2VLRA 3BPOC 3E2HC 3QNXA 4EI5A 1EAJA 1MRDH 3ULSA 1G84A 2FWOB 3RUGE 3QUML 3CVHA 3IJSA 4NO5A 5DJAA 5LGHL 4MNQA 4NC1C 2IPUK 2DKMA 4DCQB 1GZQB 1G6RH 5HVWA 3F12B 4RQQB 4ZUTB 3BPNC 4JGMA 1FL6A 1QVOB 1IT9H 4J4PC 1N6QL 2DMKA 1K6QL 3NIDE 4EBQH 4XXCA 2FHFA 2YD3A 3FQWB 5DJZA 5J1AA 3K8KA 1SY6A 3PWLA 2D7MA 2UY7A 1HYRC 2E7LA 5D6CB 1CL7I 4KQ4H 3ARGD 1SBSH 1T3FB 4Z7UE 4U1GC 3GO1H 3SCMC 2DQCL 2EDHA 3O6FA 1FL5A 2UZIH 3X13B 4XAWL 5E8OA 4N0UB 2X4UB 1BOYA 4JY4A 4XNYH 2A0LD 3TWCH 1ZT1A 1JUFA 3QCVH 4B7IA 4LPWA 2PETA 4Y8AA 3AS2A 4ZQKB 4G9DA 3UTPD 4U05A 1GGIL 1AE6L 1K5NB 4FFZL 4L9LA 4PJEF 3RNQA 1MHPL 1IAKB 3I2CL 1ZHNB 2YMXH 3O41A 4XP6H 3BYYA 3C5SA 3C6SA 4MXQC 5C0AA 5JPMB 2FZ3B 3RL2A 4OD1L 1H8SA 4IRZH 3TJHC 4Z7VA 2HWZH 2OLDA 2WQ8A 1QRND 3P9LA 3C8KA 5FEBA 1DVFC 1QO3B 3V7AE 2HFTA 3FQTB 4N5EC 4QXTB 5GS3A 4KI5D 1CZ8H 4P46A 1IGCL 1RZFH 1FZMA 3FN0H 5L9DH 2PCPA 4UNVA 3GSOB 3MROA 3T0BA 5HSFA 4DGIH 3DHMA 2YPLE 2PNDA 1UB6B 3LN4B 4ZPTA 5IMMA 4QF1A 1JPST 4WRLA 5GHWL 4E41D 5C7XL 3UTQB 1NFDB 4KQ3H 5F6IB 3MUGB 3E3QC 4R4BB 5IEKB 5HYEA 2KZ1B 5EBWB 1PEZA 3NCYP 5D71L 3OX8A 1T83C 2YKLH 3CX5J 1KBGH 3HR5B 5FUZL 1DQQA 5JHDB 3ZKQD 5TGBB 3AS0A 5CWSA 4X5LA 2H1PH 1D5XA 4TSCH 1JN6B 4FQIH 2NXZD 5KS9A 3TFKD 4Q2ZA 4K94H 4NO0B 4I3GA 3PGCA 4JDTL 1NAML 5I8CB 1OM3L 5J0BA 4YK4C 4LCYA 2BNUA 3TVMB 4KK5D 1YQ2A 1EGJA 1UKTA 4OZHE 3RIFF 2P5WE 4P57B 3WFEH 4G9FD 1IQDB 2F5BL 4TSBL 1P2CA 3OKOA 4QHLB 1HHKA 3VGAB 2XV6B 3IF1B 5CILL 1A7OL 1C5BH 5DYOB 4IRSA 4PJXF 1CG9A 2OP4L 5BRZA 4WU5B 5I1DA 5E9DB 2WWMC 1UEYA 5ICYB 2QSTA 1JHTB 3BUYB 3NIFE 2WWKT 1FAIL 1XH3B 3OKNB 1YJDL 1X5LA 1X5JA 4LCCC 1EH9A 3M17B 1CIDA 4XCEB 4NZTL 2YXFA 3G08A 2EH8L 5ALCL 3PL6A 3BDYH 2LU4A 3AREA 2XY1A 1S7UB 4R8WL 4KRMB 2EC9T 2RCSL 3FFCB 1BVKA 3TZVB 1JZ2A 1XCQB 4OQTA 2JE8A 1AGFB 4PJAE 1N26A 5T1KD 1NANH 4XNZC 1GSMA 4JY6B 2PYFB 4GAJL 4O2FB 4ELKB 2FEEL 1TPXC 3TO2A 5D8JL 3L3OB 3QCTH 1TCRA 3N06B 3CFBA 2EYTB 4WFHE 3MO1A 3RZCD 3RWCA 2C3VA 4ERSH 5HY9B 3STZA 2D7TL 2N4IA 1L9MA 3GSUA 3KLDA 4LLWB 1I8MB 2LU3A 2YWYA 5D96C 2AERT 2YWZA 4OIIL 4DGYL 1LWRA 3WMSA 3VXPB 1T6WA 3OKLB 3BD3A 4DW2H 5DJ6B 3HA0A 3U48A 3RX7A 3E3QE 5EZJA 1DBKL 4XNMA 1HIML 5TE4L 2XOTA 2FL5B 5IFAL 1NLBL 1BFTA 2FBOJ 1E4WH 3D3VD 15C8H 4XCNA 1TZHA 4L8SC 2MQCA 4XMPL 1I1AA 1LMKA 1QLFB 2HLFC 3QEHB 3CFEA 2RGSA 2CLVA 4LSUL 3X11A 1ZVYA 3O9WD 32C2A 5I16B 3B9KC 1DBBH 1OLLA 4TVSa 3P4OA 3IETB 4H0HB 4RGOL 3CVIH 4ZG1A 3TP4A 3IAPA 4JZJB 5E6IB 3O8XC 4HUMB 4Z7OE 3PJSA 3MTRA 3MV8D 3FQUB 1NJ9B 2JJUA 1GC1C 4M48L 1NCWL 3REWB 1DDHB 2NTFA 2BJMH 4JHZA 1NFDF 3AM8A 2I60H 2E6QA 4D9RE 4X7SH 1UCBL 3BEVB 3QBTB 4U6YA 1OTUD 5I17A 5DO2C 3OAZH 4JFHD 4O2EB 1CFVL 1D5ZA 3K46A 5CBAA 4N0YH 1U95B 2XN9E 3ROOA 3V0WL 2PW1B 1IEBA 4GFTB 1I9RH 4YDVB 4ZODA 4MJ2A 2R4SH 3DO7B 1FVDA 2NY0B 3GIZH 1U6AL 4JM2B 5GGRY 4PRHA 4PRIA 1KFAL 1X5YA 2YPVH 3QIWA 5D2NB 4NCDA 4ZNEE 1FFOA 5FYJU 3OGCA 4QCIB 4QXGH 1FORH 4GS7C 4DJMA 4I3SH 3U9PL 1JZ4A 3LKQA 3QPXH 1KB5A 2O5XL 4TULL 4U6XB 3V7AG 3FAWA 4PGJA 1RIVH 1EEZA 4OZFA 1QNZL 2ZUTA 4GRWE 1J8HB 1KC5L 4LASL 3K2MC 4X8XA 3D9AH 5I75C 4ALAL 3EYVB 1ZHBA 2VL5B 4QHNB 5DHYB 2VLJE 3MRNB 1J18A 4UDTB 1EAPA 5F7EH 1S7RB 3KNBA 4ISVA 1BIIA 1U92A 5L8JB 4PJGB 4FQJH 3IKCA 4R3SB 3SE4A 4NJ9L 1EXUA 4HSQA 1RK0A 1OTTC 3BKYH 5DMJB 4RNRA 5DD6A 2OYPA 1YA5A 1NGXA 1JJUA 1FNGB 4GKSB 1JHKL 4Z95H 5K9JH 3U1SL 4E5XA 3GB7A 4HS6B 3WE6A 2NY5L 3O11A 4MJ5B 5CP7B 2G60L 3WO4B 1CDJA 5C3LD 4ELMF 2AEQL 3W2DL 1UH4A 2X4PB 3GMOA 4ZOAA 3VA2C 1F3DH 2HFFA 2NCMA 1DQTA 4Z0BH 4X6CE 3LSOB 3MBEB 1D6EB 5I1GL 4AT6A 5DRNB 1AGBB 5MERB 4I13B 4EI5C 2GT9B 4OFPA 1OP3K 1FDLH 1ZA6B 3BPCA 5I18L 2EEAA 3CNKA 2IGFH 4KRLB 3IGAB 2Y5TB 4G6KH 2X9WA 4K3DL 3WHE0 4L3EB 2Z0BA 4WNQA 2R2HA 3FHAA 2Z93B 1S7QB 4U3XA 1TFHA 1GYAA 1CE1H 2HH0L 5HHXH 4XXCC 2OMNA 3MXWH 1WJ3A 2BVQB 3FOMA 1U3JA 8FABB 2ED9A 4HCRL 2E7LC 2C5DC 2DTML 3G6DH 2QBWA 4MSWA 3PWUA 4QRRB 3MLTB 4XBEH 4WU7A 5EOTA 5F1SA 4HWZB 3O6FC 5C09B 3MNVB 5KVEL 4RGNE 4I0PD 5I1HH 4Y2OA 3GK8H 4K8RL 5JXEA 1S9VA 3MUJA 3O4OB 5JPNB 1HZHL 1SJXA 1WWBX 3HI6H 5MENE 3PWPB 2HA1A 4QRTB 3U36B 2X10A 4NRYB 2A9NH 3EUUA 3S5LB 2DLFH 1R5WA 4J2XA 1CVRA 5TE6H 3HE6B 2CMRL 4PJHA 4L9LC 3SGDI 2V6HA 4NQCD 3VXQA 5BJTA 1LO0L 3VXUD 3L3IA 4L1DA 4OI8A 2R1YA 5IIEB 3TA3B 3QI9D 3MZTA 1YMME 3GMPB 2J6EA 1T66C 3QULA 1W72H 4HC1A 2YA0A 2ZCHL 3ARVA 4WI2A 3WFZA 2W0PA 1U8MA 3K1KC 5GJTL 4PLKC 1D9KA 3C8HA 3FT2A 5F9JA 1EK3A 4QTHB 1KPVA 4ZAKC 4N5ED 3V6FA 3P30L 3S36L 4CADB 5J9PB 1MCFA 4P46C 4OCXL 4TVPD 4HULB 1L7IL 3BZ4A 4GLRH 1S9YB 1U2CA 1AXTH 1NUGA 5C07B 5F7HA 4QOKE 4WFHD 5DRXB 4PGDA 3LQZB 4JM2F 4M93B 2VYRE 1CE6A 5FCUL 4PJEA 3TT3L 5DUMH 4D3CL 1VACB 2WBJB 2ERJB 2ZOLB 4JFEB 4UDUB 4LCUA 4MMZC 4OTXL 2YN5A 4GAGL 1H3PL 3ULUL 4U0RC 1MCOL 2DBLH 2DQJH 4LF3B 2D7QA 3MFFA 2AS5M 4J12A 5T33H 1S7SB 4HKBA 3SQOL 1EJOL 1IRAY 5C6WH 1GPOH 4OZGF 3AS1A 2YRZA 3QDJA 2RB8A 1R24B 1H15B 1S9XB 2CLZB 1DLFH 5DTFA 3S35L 2HT3D 3LS5H 2NY6B 5DQ9B 4MNQE 2G2RB 3GMMA 3SKOB 3MNWA 5MP6H 1MHCA 3QIBB 4L5FL 4BQCA 1I8IA 2A83A 4M7LT 5GGSA 3D39A 4TYUA 2F8XC 4PJGF 1WZLA 2K1MA 1UWXK 1IAOA 1RZ7L 1N2RB 1DBJH 5HHNB 3VFNA 1IKFH 4D0BA 1J1OH 1Q9LA 1LO3H 5BV7H 3U9UA 4X80L 3JV4A 3MGOB 4GG8B 5GS0C 3HNTH 4IMLB 2QJDA 3BN3B 2N56A 2NNAB 1GH7A 5D72H 5F7DB 3GRWL 5IB1B 2YEZA 2XNAA 3FZUC 1QR1A 4Y7MA 5KANG 4MA1B 1CGXA 2J8OA 1X4ZA 4IRJA 5TPWL 3TH4T 4IRSC 3W11C 5HYFA 4ZUSB 3W39B 3X3GH 2NLJA 5EB9A 4D9RD 1PKOA 4LKXA 3WIHL 4JFYA 4JO4H 4M1CD 4H20H 3DV6B 4EUPH 5DURB 5DEGA 5C0IA 1EV2E 2I9LA 2P8MB 4C83A 5A16A 4ETYA 4FQXB 3ULVC 3GSRA 3PL6C 2CK0L 4X9FA 1DR9A 3DSFH 5KVDL 3AREC 1T2QL 1MNUH 4HMDA 5JOFA 2E27H 4FQQB 5LQBL 4TRPL 4YO0A 2XKSA 2DWDA 4FXKA 2H8PB 5EOCH 1MHHB 4P48A 1TQBC 4V2CB 1NBYB 4Z7VE 5GPRA 1I9JL 4M8QB 2FIKA 4PJXA 1TETL 1PLGH 4MB5A 1CDBA 1P1ZA 3VFPA 1JYNA 3DRQA 4CKVX 3OKEB 3FQXA 5L2KD 5JA8B 3L3JA 1JV5A 1HXMA 5CJQL 4L8CB 3SPVA 2R29L 3ARFC 1T20B 4BELD 3EYQD 5DQDL 2FWOA 4R4NC 3STLB 2DM3A 5E94B 4BJLA 1P7HL 1MY5A 2VLJD 4LQFL 2IPKB 3KYKL 4JR9L 3BE1H 5CINH 3RZWA 1ZHKB 3VWKC 5IT2H 2DD8H 3QHFH 3F12A 4RQQA 2DQGH 1Y0LA 4ZUTA 1AC6A 4YHML 4JRWA 3U0WL 3V2AR 1QVOA 5I76B 4HEME 4LVNB 5GGTH 4OV6F 1J10A 3HRZA 1XGUA 2A9MH 2GY7B 1HNFA 4PJIB 5E4EC 5KAQF 4X7FC 4EXPX 5F7YC 4MJIE 2D9QB 4LPCA 1LEKA 1U3HA 4XH2B 4KUZH 4G3YL 3QHZH 1D5IL 4UIMB 1FQ9C 4HHAA 1KTLA 1FCGA 4GBXA 1I1AC 4YPJA 4Y1AE 3H42H 5I74C 3WBDA 5CD3A 1OY3B 1UB5A 3F7YB 4J1UB 2BDNH 4LSVH 4K9EC 4JVWA 4TTDD 4XPGH 5KS9E 3Q5OA 3LDBB 3X13A 4MD0A 4MNGA 5I19L 2NX5B 5EA0H 1IZJA 2CGRL 3EAKA 3RPIA 3I6LE 3KPRB 3ZL4H 4ZQKA 3OPZL 1N0XH 2FNBA 3X3FH 4QWWD 1YEKH 4KHXL 5IHZB 1K5NA 5B38B 4WWKD 1PSKH 4PB9H 5F7MC 4XP9H 1X44A 3GJFB 1IAKA 1FE8L 2EIZA 5HVFB 3CSYB 1P4IL 3JWOL 1QLEH 1X7QB 3O4LB 4N0CD 3AM8C 5BRZE 3KPSA 3B9DA 1CT8B 4JHWH 5JPMA 2FZ3A 5DO2D 1PZUB 3NGBB 4OD3H 1MFDL 3W0WB 4OZIB 1QO3A 3ULVE 3D1MC 3V4PH 4KWUA 5E08L 3FQTA 4DN3L 3VGFA 5C0NC 4OLYL 2VDLL 3NFPB 2ZPKH 4MAUH 3UC0L 4UT9H 4LHUG 3V0VB 1W2KT 1L0XA 1UEMA 4NZRH 1DL7H 1EO8L 4QRUA 2P5EA 4RGND 5LG1A 3GSOA 5HGDA 5IVNA 1BQHB 2NY3D 4XMKL 4GAYB 4XP4L 1Z6JT 3K8MA 3LN4A 3QIWC 5MEND 1WF5A 3KXFD 4XNXL 5C0DB 3UTQA 4X7EC 4FMFA 2QKIB 1NFDA 3GMRA 3TCLA 4JE4B 4LHUD 5AUMB 3DYOA 2OXHA 4ZMAT 3BT2H 3EBAA 1N7MH 4P5TB 2R69L 2BHUA 4AH2B 4HWBL 4G8FB 1J0IA 4PLNC 1JTOA 3BZDA 4QLRA 2AABL 2XTJC 1II4E 5JHDA 1CICB 2YS4A 4JO3L 1IC4H 1G7LB 2VISB 1J11A 1R5IB 4P2OD 4BFBD 3UBXB 1OF2B 3DETC 3W5NA 3QRGH 4FQHB 1JN6A 3QQ4B 4M6OL 1T21B 2HJFB 5AZEL 3ALWA 1A6WH 4DKEL 4JM4H 1KIQB 3S3PA 3SE4C 3KLAB 3TVMA 1BEYH 4CUCA 1A6TA 1J0YA 2CKBB 1XMWA 4RMWA 3ARDB 1FO0A 1IQDA 1CBVL 4TUJB 1IC7H 4UUJB 2EC8A 5HYJB 1MHEA 2H2SD 4P5MB 3IF1A 4KRPD 1P7KB 1QPPA 4PTUB 1KIRB 4XBPA 4OUOA 3WUWB 1Q1JL 2R0KL 4WU5A 3K81A 3RBGA 3DECA 1VFBA 1FC2D 5ICXB 1XF5A 4B7LA 1RJYA 3GI8H 5J6HB 3E8UH 4AMKL 1KEML 2A6JB 3M17A 4XCEA 1WAAF 1NUFA 2WP3O 5I8KH 2ZCKH 2WLYA 4RGMB 5EIQA 2APVA 3SY0B 2X2YA 4M43L 5FYKH 4YFEA 4WCYH 3DVFA 4DAGL 3QDMA 4PJIF 1CD8A 4ZTPL 4MJ6B 4JO2H 4ELMA 2N1KA 1FYTE 1K3ZA 1UM5H 3DURB 5JOPE 2IANB 3VXSA 1PDKA 4JANB 1R5VA 2PYFA 4O2FA 4XMLL 5EBGA 1MCIA 2G5BA 1MCRA 1MFCL 2NW2B 1FNSL 3L3OA 5D70L 5IFHL 4PJ8A 2EYTA 1GC1H 1QD0A 3RKDC 1RUPL 5CLWA 1S9WB 4PRIE 5JXEC 5HY9A 1NBZA 3PGDB 4EOWL 1I8MA 4GOSA 2AEPL 1WICA 1YNKH 3Q6GH 3VXPA 1JF1B 3OKLA 5CLTA 1T1YB 2OL3A 2DM7A 3OAYK 1H0DB 4PJCE 2R2CA 1KJ2H 5DMIH 4L4VA 4EKXA 2FL5A 5IBLC 3B5GA 2F54B 4N0FA 2XTJE 3C6LB 4LVHC 4KUCD 3EJZD 4RIRB 4WEBH 4FMKA 5IB4B 2WK2A 1QLFA 4M62H 4NQXB 1JRHL 1D9KC 1ORQB 4RFOH 4WFED 3T4AB 4OZIF 5GRUH 3EYFA 2ICWB 1TZIB 5CZXD 3HAEB 5CSZA 1LK3L 4P5KA 3T0VA 2HMIC 2J4WH 3PV6A 4WUUA 8CGTA 1N0LA 3CDCA 2KH2B 3KYOB 5E6IA 5EO1A 3LEXA 3HG1B 1DBAL 1LDPL 1RUMH 2QHRH 3GSQB 1ZANH 4U3HA 1ES0B 3FQUA 4LDOB 4HIEB 4HS3B 5DJDB 1KNOA 2I25N 2KL6A 5CS7A 2J5LB 3O6KH 2EDWA 4HFUL 1FFPA 1DDHA 3J7HA 3NFSH 2WW8A 5GRWA 3BO8A 1MCWW 3B2VL 3G6JE 4M6AA 3QUXD 1L7TL 3FJTA 1IC5H 3F7PC 5KSVA 3QAZB 3VA6A 1NCCL 4NZDA 2XACC 4YHZL 2Y25A 3B5TA 2PYEB 1U95A 1YN6B 3HCVA 1XF1A 3WYRA 2QADD 4Y1AD 1DANU 2C3WA 1Q72L 4OCLC 3TBSB 2X42A 4YDVA 4DUWA 4NPYB 1QOKA 1YYMH 5DUPL 3QUYD 3EOYG 2R0WL 1HH6B 2GTWB 4FQ1H 4JM2A 2GQHA 5C0BA 1G9NC 3HKFA 1R3IH 5D2NA 3DUHA 2D0FA 3BXNB 1OAYL 3ARUA 3GFUA 1KLUB 4QCIA 5J3HD 2B1AH 1MCNA 1HI6A 1HDMA 1M6OB 4U6XA 3VFUB 3RVVD 1IQWH 3DV4B 4PP2B 1L6XA 4MVBD 4UT7L 4N90D 1F90H 3CVHH 3QNZA 2D0HA 1A7NH 2Z8RA 5IEHA 4OZGA 3TPKA 4KKLC 3TYGL 3B2UC 4IRJC 4DZ8B 2IH3A 4NNYB 1I9EA 1RJZB 2VKXA 3EYVA 3UJTH 4QHNA 2F19L 4S0SD 2RBLA 5FGCE 3BIAX 2VXUL 5F70A 5J4MA 2CR6A 1S7RA 4Z7WE 5TDOB 4NDMA 2W9DL 1AO7B 1QFPA 4PJGA 3TBVB 2GUOB 1SY6H 4R3SA 2E9JA 5IP4A 3M1BA 2EKJA 4PLJC 2OZ4L 4LIQE 4X7CC 2OJZL 1OL0A 5C1MB 3QUMH 1MCPH 1EFXB 1ZWIA 1HWHB 4OCYL 1ZGLA 5LGHH 3QQ3B 4HAFA 2XWJB 4JG1L 2GIYA 5CP7A 4JO1L 1UGNA 4XZUB 5F9AC 1OD9A 4KKAC 4M5ZL 3QFDB 1FAKT 1RZGB 3NCJL 3BGAA 3CC5B 4WO4D 3MRIA 3SDDB 4RFEB 1INDL 1XGPB 3ARFD 2DM4A 3LSOA 3TC9A 1N6QH 4Z5RB 1Q38A 1K6QH 3MBEA 3QZWB 1U41A 3CZFA 5DRNA 1AGBA 5MERA 3KLSA 4ZFOA 5C92A 3BP6A 2GT9A 4FXGA 3S6CA 4OCNC 1LHZA 3V52L 4OBSA 5A3IC 2OZ4A 2X5PA 2Y36L 3IGAA 2Y5TA 4XPHL 4I77L 4N8CL 4L3EA 1OSPH 2DQCH 1R0AH 2H9GB 4MYWB 1A9EA 5H8DA 4XAWH 1UQSB 5I15L 3MPCA 1Y6MR 3SKMA 5C0CA 4U1SB 2VSDA 4MB4A 3UAJC 1P4LA 1H8NA 1A1OB 2BVQA 1GGIH 1U3HC 2XG4A 1AE6H 4KK8D 4FFZH 1OGTB 4CGTA 3QP3A 4GBXC 1S5HB 1MHPH 3MRFB 4QRRA 2G75A 3MLTA 1AHWB 3D39E 4NUJB 4HWZA 3I2CH 5D93B 3C5ZB 1F6FB 1KULA 1Q0YL 3MRLB 4KY1L 2ITDA 4RMRA 2B4CL 5IR1A 4OD1H 3PWPA 5IV2A 1RIUL 4QRTA 3U36A 4NRYA 3LEVL 4L29B 5IVOA 1I7RB 3S5LA 1KENL 2H26A 1VA9A 2R2BA 3DMMD 3HE6A 1BM3L 1R6VA 2WWKO 2VABB 5MI0B 4LPYA 1IGCH 4OLWL 1IM9D 1ZT7B 3O3UN 1MLBA 4P2RE 5IIEA 3TA3A 5CD5D 2O5ZH 2Y72A 3WS6A 2MNUA 2DTSA 3DVNB 2APTA 4Q6IB 3FO1A 4ODSL 5ACZA 2VDRL 4PS4L 4XB7A 3L6FA 1E4JA 1BREA 1GL4B 1MAKA 4ODXB 1WWAX 4ZXBD 1FYTD 5GHWH 5C7XH 4QTHA 3QFJB 1WC7B 3VJ6A 2OBGA 1JPSL 4ODUA 5DMYA 5J9PA 4CADA 2C4XA 1S9YA 1DQML 5D71H 5IM7B 4CVZB 2PXYB 5DHXB 5FUZH 3KJ4B 1VACA 1N6UA 3A6BL 2WBJA 2ZOLA 4JFEA 4K2UH 4M4PA 3JWOC 4YHLL 2CPCA 4OKVB 5ID0B 3T0DA 5IW3A 1BBJA 2IAMD 1I9IL 1CK0H 4Q7DA 5IFJA 4PUBL 4LF3A 4UQ3B 5JR1L 4JG0H 3IT8D 5HHOD 2Y9RT 4JJ5B 4JDTH 1NAMH 2F53D 1OM3H 1P84K 5JQ6L 4QEGA 4S1QL 1MRCL 5HVGB 3MV9D 4WTWA 4Q9CA 1VADB 4LVOB 1J1PL 4Y19D 4IS6B 2CLZA 1S9XA 2OTWA 3LHPL 4QRPA 1NAKL 3HUJE 2F5BH 2G2RA 4TSBH 3D85D 3SKOA 3CXHK 2AGJL 3BPLB 3EYSL 5CILH 1A7OH 1MJUL 2CH8A 2EEBA 1SYVA 2KZWA 3E0GA 2OP4H 1SVZA 3RVTC 1A4KB 5JMOC 5T1LD 5HHNA 5HD8D 3TVMC 4GG8A 1K2DA 1HCFX 4YJZL 1FAIH 4LSPL 4IMLA 1A7RL 5F96L 2R8SL 2NNAA 1YJDH 3RY4A 5F7DA 2GTZB 4NZTH 5ALCH 4ZUVB 1C5DB 3UTSD 1BIHA 3MCLL 4B5EA 2YSSB 4NKIL 5CIPH 4XVSH 3W39A 2R0ZL 4R8WH 4MNGE 1AI1L 2RCSH 4PRPA 3ZE2F 1XFPA 3SKUD 5CEZL 4NSKB 4LCWD 2WMPA 4XT1C 5L2JA 3DV6A 5CBEB 3CFDB 4CN6A 5E5UB 3ARGB 3AXLB 3NA9L 4J3TA 4KZDL 2D7OA 3MACL 1UFUA 5SV4A 4GAJH 1CXLA 3VI4F 3U46B 1A2YA 5D8JH 2ZUQC 1HILA 5DA0B 2XTLA 3KWWB 1BECA 3KPSE 5M94B 1XIWC 5FK9B 2H8PA 2D7TH 1MHHA 3C60B 5I1KL 1NBYA 5FCSH 3QG6B 5DMGC 4DGYH 4OIIH 5C0RL 4M8QA 5FFLA 4XBGB 3OKEA 3GM0A 1F3JA 1KCUL 1DBKH 4L8CA 1HIMH 1T20A 2P5EE 4PJ8C 5TE4H 4H0GA 1NLBH 2OQJA 2Z31B 5FM5M 3BMVA 1RMFL 1WAAA 2V5YA 3IB4A 3HB3C 4KROB 2IPKA 4XMPH 1ZHKA 4Y2DA 1M05A 1N4XL 2I26N 2I5YL 4LSUH 3JBG7 1S8DB 5I76A 4ZS6D 4XXDB 5J13B 1KELL 4LGPB 4PJIA 3OMZA 4F33B 3K7UA 5JW5A 3NPSC 2DQDL 4U31A 3QRFM 2V7HB 1N5AB 1FNFA 2W91A 1B9ZA 3LQAC 1U93B 3ZTNL 3ILQD 5FUCC 4M1DH 1YY9D 3LKOB 3G6AA 2EKSB 4M48H 3AC0A 3MODL 4U3CA 1NCWH 3MV01 1DCLA 2PW2B 4F7PB 1F4HA 3I02B 3GBML 1QSFE 2Y7QA 4AEIL 2FATL 5D1ZA 2NX5A 1RK1B 5I30L 1UCBH 1KB5H 3KPRA 4S11A 3P73B 3U2SB 5E6IC 3MUZ1 5JIKA 4OZFH 3H6JA 3HI1B 4XPBL 3A0OA 1JNHB 2FGWL 5B38A 2B1HL 3OXRA 4QHUB 1FH5L 4GW4B 3V0WH 2NXZB 3GJFA 2BOCB 3OBAA 2HKFL 1OAZL 3V4VL 3WFBL 1CF8L 2ZSWA 3IDGB 4P2QA 5I0ZA 2YRPA 4OCMC 1U6AH 1KFAH 3B6SB 2GITB 5GGVY 2V7NB 4OB5L 1KEGL 2QQNH 1J7VR 2QQLL 3F5WB 4I48A 4G9FB 4HH9B 1QSEE 4PJDF 1MFEL 4OZIA 5F89B 4OF8A 2LTQC 1A7PL 1DE4A 4W6XB 1I7UB 4L9DA 3U9PH 4R97B 1MAJA 1TVBB 4Z7NF 4TULH 5EU4B 2BSSB 3MJ9A 3RWFB 1R3HA 1JPGB 4PRBA 5EC1B 4KAQL 4AENB 1QNZH 3MOAH 5CGTA 3RL1B 4K07A 1AJ7H 1KC5H 4GAYA 1RULL 5CGYC 5D2NC 3QDME 4ALAH 5JW4Q 5C0DA 3QYCA 4ELME 4ODVL 1U0QA 3G9VA 5EIIB 1S7XA 1WTGT 3VXSE 2HVKB 2RFXA 1TQCB 1T6VN 2KDGA 2CKBL 5I1CH 2V2TB 4C56A 3K0WA 1A3LL 4P2RD 4OIBA 5SX5K 4NJ9H 1RD6A 3S96B 2YUWA 1NC2A 4P3WA 2QQQA 1KCKA 4N9GB 2DRUA 2AK1L 4D2NA 4L8DB 1RI8A 5F9WC 4ORZC 2C3GA 5AYQA 3JWNC 1CICA 2VIRB 3B5HA 3L3KB 3DO3A 1X5GA 1JHKH 1R5IA 3U1SH 3UBXA 2CRMA 4G80B 3UO1L 3PQYD 2XI9A 2NY5H 3QQ4A 2G60H 5T3XH 1T21A 2DIAA 2BNQE 2AEQH 3MLXL 3I6GA 3QXDB 4FTVD 4Z78B 3PHSA 4OD2B 4JFFA 5DK3A 2NYYC 1KIQA 1YC7A 1CCZA 3N9GH 2GW5A 5DSCB 3KLAA 4ZOEA 2QSQA 1YEGL 4ONFL 2HRLA 4L4VE 4WI5A 3RZCB 1IGTA 5I1GH 5F7NC 2W60B 2CKBA 3L95A 5IB2A 4N8VB 4NN6B 1BOGB 1BWWA 3ARDA 4PG9B 4TUJA 4UUJA 4M7KL 5FUCE 1BP3B 5I18H 5E8EB 5HYJA 2FD6H 4PJ9D 3KGRA 3WO4C 4PTUA 1KIRA 1Q9OB 4NRZB 4GG6B 3FFDA 4KXZH 4ZOBA 3UYPA 3UJJL 1HQRB 4WUUE 1WEJL 4LPVA 5TQ2L 2HH0H 1FGVL 3MBEC 3SJVB 3D3VB 5SX4H 3D0LB 2A6JA 1HHJB 2AJVL 4HCRH 2DICA 4ETQB 2DTMH 3K80A 3O9WB 3EGSA 5SV3A 2R1WA 4GAFB 2P8PA 3VFOB 4KI5F 1SBBA 1DEDA 5KVEH 4CVWA 4HT1L 2XKUA 1MY7A 4K8RH 1H3UA 1HZHH 3RUGB 2X89D 2X1OA 4MJ6A 2XG5A 5JNYB 4GUPB 1PD6A 2WIMA 4KJYB 2C4FT 3SE8L 2CMRH 3PDGA 5LGJB 2XA8L 4XVTL 3RDTA 1K8DB 3VI3F 5F1IB 3DVGB 3DX9B 1K3IA 3T2QA 3VH8G 2NR6C 3QUZB 1WZMA 5CMAA 2MPAL 4ESKA 1S9WA 5C0BE 1G0DA 1CWVA 1URLA 1F4WH 2DLHA 2ZCHH 3KJ6L 3DI2B 3OTTA 3PGDA 4D0CB 5DJ0B 3HLAB 1UXWA 4YIQB 1V5JA 2RQ8A 3P11L 1GHFH 2W59A 5GJTH 1JF1A 1GIGL 5AG9A 4O2CB 4JFDE 2H6PB 3ARSA 4Z7UB 3OHXB 2VDKL 2CDEB 2V5MA 5DC9B 1H0DA 1TMCB 4R7DA 3S36H 2HFGL 4LFHG 2VDNL 5E1AA 1EBPA 4OCXH 4R0LA 4YBQC 4OZGE 5J89A 3WS6C 1JHLH 4PRAA 2F54A 1Q8MA 4WIQA 4OFYA 5GSRA 4UT6L 5EU3B 4RIRA 4JPKH 1JE6A 4X7DC 3HMXA 4D3CH 4X4ZA 3O2VL 1G7HA 4NKQB 1ORQA 4OTXH 1KJ3L 3CDGA 4NGHL 3U7WL 4GAGH 3T4AA 3V6BR 1H3PH 3ULUH 1HSAB 2P8LB 3BYTA 1U58B 4LFHD 1F6AB 2ICWA 5DZOA 1MCOH 3HAEA 4AM0A 1XGYH 1BJ1J 3N85L 3EJYC 3TPUB 3SQOH 2EDDA 4NKOA 1EJOH 3GMLA 1FN4A 3HG1A 3F8UB 3FT3B 3GSQA 3MRJB 4HIEA 2BC4B 4HS3A 3S35H 2AKRA 2ERJC 4OUUB 1QACA 1ND0A 3O2DL 4GT7A 4L5FH 3MRCB 1B4RA 4HJGB 3VGGA 3OKMB 2CO6B 5KSUB 1OP3H 1ZT4B 2VXQL 3QQNA 4HG4J 1JI1A 4Y5XB 1MWAB 6CGTA 2GFBB 3H7LA 3KPLA 1OSZA 4BQ9A 2YPLB 1YYLL 2ADFL 4X80H 1E28B 3WV0A 3EDKA 2FH6A 4NYLB 1U8QA 2PYEA 3LH2H 1CFBA 1YN6A 2CUHA 1JBJA 2NY6C 1H5BB 3TBSA 4PGBA 3I9GL 5E95B 4NN5C 2GHWB 5C2UB 5EUOE 5D7LA 1HH6A 2IH1B 1QSFD 1MCJA 1QHOA 2GTWA 2M1KA 3E2HB 3PDOA 5HYSG 4LSRH 4OLZL 4NZUL 4F37K 4TNVF 5C0CE 4JRYA 1KLUA 3WIHH 3MXVL 5DK2A 3KLHC 2I24N 3BQUA 1H3WM 5C08A 3VXNA 3VFUA 3U7AA 1CLCA 1Z3GL 3DV4A 3CPLB 4PP2A 2CK0H 2HJLB 4PP1D 2X40A 4UTAH 1I1FB 5KVDH 5C6TL 4DZ8A 1F2XK 3D6GA 2X1QA 4GG6F 4PTTB 4NNYA 1T2QH 5LQBH 4U2ZA 1RJZA 4TRPH 4OZHB 2P5WB 5D7IF 3EDDA 1QSED 2DI7A 5BMFH 5KJRL 1MCKA 1I9JH 1T0MB 1YECL 1AO7A 5JTWA 3GUTA 4HUUB 1TETH 2GUOA 2Z8VC 3TBVA 3S37L 3F6IA 43C9B 5IROA 1UADC 1IT9L 1CS6A 3Q1SL 5CJQH 3D2UA 4WDIB 1BAFL 4I0PB 1M1SA 3SOBL 1A64A 2R29H 2X70B 1XIWD 4HK3N 3UTTA 5DQDH 2BRRL 2VKWA 3RWHB 5HDQL 4IMKA 2UYLB 1EFXA 3QQ3A 3VGBA 3KYKH 4LLUB 4XZUA 2GJ6E 4JR9H 3T0EE 4P3CL 1OWRM 3G5XB 1T22B 4NNPH 4F7EB 4PJBE 1T1ZB 4OJFL 1RZGA 4NFDA 2X1XR 1H3VA 1FZKB 4X5WB 4YHMH 3BGFC 3SDDA 4RFEA 3LAFA 3U0WH 2IEPA 3QI9B 2DJ4A 3KR3H 4Z5RA 4XNYL 3TWCL 1QP1A 4G7VH 4KJQC 2OX5A 4PYGA 1ONQB 2D4DA 4FABL 3L5WB 3NIDF 1ULVA 2AP2A 4AIZA 4DK6A 1T1XB 5BOZG 4Z8FL 3EDEA 4PJAB 3VGDA 4G3YH 4V1DA 3EYOA 4NQDD 5TFSL 1KLGA 3IYLW 2BNQD 3FN9A 4Y2DC 1MREH 1TCMA 4N1EA 1ZA3A 4Y4FD 4Z7UF 5I1EL 2Z91A 5EO9B 1JNLL 2YMXL 1GOGA 4DEPC 5BZDA 1NSNL 2ARJQ 2CRIA 3BWUC 4LVNC 5J6GB 5I19H 1U8OB 4KGJA 1OAKL 1TVHB 2WIIB 3O3EA 4X4YA 2CGRH 2EDLA 2DYPB 4U1SA 2F15A 1A1OA 2HWZL 1FCCA 3C09C 5B39A 4QRPE 4KHXH 3CX2A 2HVJA 2DLEA 3BP4B 5FYKD 4LLYB 3X14B 2E7MA 4ZPVA 1CZ8L 2NY4C 1TTFA 2C7UA 1FE8H 4NUJA 1P4IH 3JWOH 4GMTH 5L9DL 1MCCA 3LDBC 3C5ZA 2E9BA 1CL7H 3DGGB 5TDPB 5D1ZC 2GSIA 3ZYJA 1CFQA 1JMXA 5FA4B 4L4TA 4RA0C 5DC0A 3HS0A 1HN1A 4L29A 2W0FA 1I7RA 4HV8B 1MFDH 4QHKI 1C08B 4YHYC 2VABA 4OLYH 1YEJL 2VDLH 1ZT7A 5AG8A 2EDRA 3UC0H 4RX4D 1UZ8B 1EO8H 1HOCB 2XFXB 4A6YB 3RNKA 3FRUB 3WKMH 4PRPE 1KBGL 2DMCA 3R0MA 4JAMB 5DI8B 3B8SA 4XMKH 4XP4H 4TNWF 4QO1A 3G5YA 4LVEA 3D5OF 5FHAH 4AYFA 1AKJA 4XNXH 2AV1B 3MLRL 1LD9B 1WC7A 5GZNC 5AYUH 4HGMA 4NWTL 4CJ0A 1D5BA 1QUNA 2W65B 3GSVB 1DQLL 3DIFA 2EE3A 4QKXB 3FQNB 2ENYA 2CDGA 2W92A 2HT4D 5IM7A 4HWBH 4PREB 1NH6A 2PXYA 4Q9QH 1E4KA 3VMOA 2AABH 1WBXB 4JO3H 5I9QB 4AY0A 2QQKL 5D1QA 5ID0A 2XN9B 3MZGB 3W5MA 4JFDD 4M6OH 3HZKB 3MV7E 3NN8B 2H32A 3OAZK 2AXJA 3ZTJH 5AZEH 4LU5L 4DKEH 4JJ5A 4GW5B 3TNMB 4UV7H 2NZ9C 3IU3A 3ESUF 1VEMA 4PJDA 2BOBA 4OCSL 2HN7B 1GZPA 1VADA 3PWVA 1WAAE 1CICC 5IW1B 3DXAE 5I8EA 2VN4A 3WN5A 1CXEA 3KPMB 5ITBL 5DZNA 3C5JA 1ZS8B 1Q1JH 4HIIB 2R0KH 1A14H 4G6FB 4PGZA 4GRWB 5JHLL 1A4KA 1FFNB 5DWUL 1Q94B 1NEZG 3I3BA 4S1RL 3MUHL 2C9AA 3W82A 3MRKA 5DFVD 2VLJB 3RBSA 5KZCD 3BGMB 4AMKH 1KEMH 2GTZA 4JFXB 4YDJB 5KSAD 2O61A 4HUXB 3JUYA 2AAVA 3OZ9L 4Y89A 1C5DA 3FRPG 3ILPB 2YSSA 4G8IB 3FB7B 2G9HA 3FO2A 25C8L 1W0WB 4XAKD 4PY8I 3WL9B 1OP5H 4NSKA 2AJSL 5IHBA 4DAGH 4L8SB 4ODWA 5H37H 3HPLB 5FYJE 4ZTPH 5CBEA 3ARGA 3AXLA 4NQED 1VFOA 1MPAL 3UYRL 2DDQL 4RMVA 4WTZG 4YGAB 4XMLH 1MF2L 2VDQL 4QTIL 1MFCH 1WTLA 1FNSH 4P2QE 4RGMC 5D70H 5IFHH 4ZOCA 1C7TA 1K8IB 3AB0C 4H26B 5ETUA 3KWWA 4X6CB 1RUPH 5FK9A 1RU9H 5GRYA 1E4WL 3O8XB 1C16B 5L8KB 4EOWH 1ADQL 2AEPH 3OR7A 3GSNB 4MXWL 2XWTB 5I8OH 2V5SA 1DBML 4JFPB 5FIEA 1BPVA 3P9MB 5ANME 4YXLL 4XBGA 5HGAA 12E8L 1AD0B 5DS8A 2NR6D 4TPRL 2FBJL 4X5XB 2X7LB 3RDTC 3Q0HA 4W6WB 3BP5B 2D2OA 5HYIA 2Q3ZA 1IAIH 2E7CA 3VFMA 2K9UA 4CU6A 1QRNA 3DSNA 4YFLF 1XGTA 3QA3B 4JKPL 5ENWA 4L3CB 1M7IB 1JRHH 3FOLB 3VXOB 1G9EA 3LN5A 5F9OL 1S8DA 2BJML 2Z92B 4J8RB 4C56E 1RZ8B 4BUGA 4PJ7E 4RGNB 1LK3H 4R0LC 4JVUA 3LKPB 5HTSA 4X7SL 4TOYL 2CKNA 2GSGA 2MCPH 1QFOA 5TF1L 5MENB 1T80A 1DBAH 1HQ4A 1N5AA 1RUQH 1LDPH 4E41A 1S3KL 4OGZA 4UAOB 4NBXB 2GJ6D 3IJYA 3T0ED 2EKSA 4WI9A 1VFAB 4EN3D 5CJXA 4HFUH 4LHUB 4F7PA 4J3VA 4JFFE 2E3VA 3I02A 3TYFB 4KFZC 1YMMB 4U7MA 4ACPA 1MI5E 3B2VH 2DF3A 3WXVL 4FFWC 5BVPH 1I8KB 3VFVA 1L7TH 2YPVL 4CNIB 5I75B 4MDIB 1DQDH 3BN9C 2M2DA 1XGRB 1T7YA 5MEQB 2O5YL 2UY6A 1F42A 3HI1A 3T8XB 4P2OB 1T4KB 1JNHA 4JPWH 2GYSA 3TM6A 4I3SL 3QPXL 4GW4A 5JW3L 2NY7L 1ZTXL 1Q72H 5KOVC 1E4XL 4MAYD 3OKKB 1X5ZA 5DUPH 3BKJL 2WANA 3RWIA 4XHJD 2BSTB 4QOKB 1OAQL 1GCFA 4C57C 5IBUG 4U1IB 3QEUB 2IALB 3D9AL 4TSAL 5D5MF 4X98A 1OAYH 4G9FA 1YNLL 3V95A 3PG2A 3DJ9A 5F89A 1KTDA 3D0VB 1JL8A 1RVFL 4FZEL 1N59A 5EU4A 3RWFA 1BD2D 3QWRD 2YXMA 4GKZB 1JPGA 2LAAA 1XF4B 1GGBH 4UT7H 3I6KA 4WHDA 5J7CC 3QUKB 2G5RA 5HPMB 2DJUA 3RL1A 2OM5A 5IUSA 4BSWB 3BH8A 4HZLA 5DGRA 4MA8H 1X5AA 3CK0L 2VZOA 1DEEB 1I85A 3IJSB 4NO5B 5DQJB 4WEMB 1WT5A 1FGNL 2F19H 3VRJA 2VXUH 3C08L 4MNQB 2YBRB 1G9ML 3BQUC 2HVKA 2W9DH 4P4KD 2V2TA 3WIFB 5DT1L 4JRXE 2IBZX 1KCRL 5TDNA 3S96A 4RFNC 5HHMD 4K7PX 2OZ4H 4N9GA 1ZKAA 4L8DA 2NXYC 1UZ6E 3EO9L 2OJZH 4P0DA 5DJZB 3DBXA 5CEXB 3QQ9D 3L3KA 4KK9D 5EU6D 5J1AB 4HUVA 3OAYH 3PWLB 5T1KA 3BSZL 1WIOA 3OL2A 2BVOB 4F9LA 2ESVE 4JG1H 5I1LA 5ISZD 3PF2A 3TCXA 3QXDA 4M5ZH 3NCJH 1HE7A 4YHPA 1INDH 1QLRA 5DSCA 3QPQC 5IROC 5E8OB 3WNKA 4UTBL 3RZCA 1DTUA 2W60A 2DQUH 4X6CF 2NTSP 3IU4H 3MXWL 5FXCH 2VDOL 4PG9A 4IMKC 3WJJA 2W9LA 2VTFA 5E8EA 2X4OB 1YEFL 2Y36H 3RNQB 4XPHH 2QR0B 4N8CH 3MV7D 4XBEL 4NRZA 1O7VA 4GG6A 3SDDC 2P46B 3WDJA 4F7CA 2IFGA 3C5SB 3C6SB 5D7IA 1JGLL 5I15H 2FX9H 4PFEA 3D3VA 4GKNB 4Z7VB 4LPXA 3DXAD 1HHJA 1EIBA 4PD4K 4FOMA 4ZAKB 3C8KB 5TE6L 4K3GA 5L0QB 3O9WA 3LRHA 4P46B 4RMQA 2MKLC 1CFNA 3VFOA 3CLFL 1OQXA 2MQ0A 1FZMB 4WY7L 2XQYK 4KY1H 1TXKA 4Y5YB 2NY2C 5F3HB 2B4CH 3QDHA 5FUOL 1LDSA 1CDUA 1NKRA 4PRDB 5JUEL 3ELAT 3QR2A 3MREA 5JNYA 4ZPTB 4GUPA 4WHYG 3MV8A 4HLJA 1BZQK 3LEVH 5IWLA 4U1JA 1BM3H 3HNVL 5LGJA 3ESVF 5IBTL 1K8DA 4OLWH 5F1IA 3DX9A 5D7LE 3UCRA 1RZJC 2EDXA 4OGAC 2J8UE 2H2PD 5ILTL 2KBGA 3QUXB 5T3ZE 1Y6KR 4MJIB 4ODSH 4ENED 4DUVA 4D0CA 2VDRH 2BRQA 2C26A 2PN5A 4JRYE 3L7EB 3IXTA 4YIQA 2JLLA 5CWSB 3DUSA 2PO6D 2QADB 5C08E 5C0EB 4LRNL 4O2CA 1D5XB 4Y1AB 2H6PA 4Z7UA 2EDJA 4F58L 1JPSH 2CDEA 1CGYA 5KS9B 1A3QA 4IOIA 5D6DA 3SDCD 4ZD3L 3PGCB 5GS1C 1YNTA 4BM7A 5J06A 1DQMH 5EC2B 3OR6B 5DRWB 5HYQB 2BNUB 3F7QA 4WI7A 5FF6B 5EU3A 5SWQA 1ITBB 4QT5B 1RJLA 2VB5A 3A6BH 3Q6FA 4LSQH 4YHLH 5HXMA 1P2CB 3P4LA 1MWAL 2HKHL 3OKYA 3MJ7A 5MP6L 1FVEB 1U58A 1F6AA 4UMGA 4O58L 4BUHA 4J3OC 3GKWL 5DD1H 4PUBH 5JR1H 4GXUM 5F7FA 1F4XL 1CG9B 5BRZB 2X4SA 3RJDA 5JQ6H 5IVXE 1MRCH 3V9FA 3UTTE 1GOHA 1CDGA 3FT3A 2PXYC 3HNTL 1E4KC 4EDXB 1J1PH 4LCIL 4WI4A 5KW9L 5EZLB 3L5JA 3LHPH 3MRJA 2BC4A 4YX2L 1NAKH 5IF0B 4M9OA 5ERWB 4N68A 5D2LF 5E0QA 5D1QC 4M6MH 3O3DA 4J3WA 2AGJH 3MRCA 1OTSD 3EYSH 1X5KA 1MJUH 1NANI 1FV1A 2DIJA 3ZE2E 4U1MB 1CXIA 1NBVL 2YC1B 3FO9B 1SEQL 1BVKB 2GFBA 1UJ3A 2YD7A 4Z9KB 5CGMA 2XQBL 2ED7A 4GH7B 1E28A 1CDHA 4JO4L 3F58L 2CO7B 4H20L 4LSPH 1A7RH 5F96H 1S7WB 4OLXL 4YZFF 4G43B 1VSCA 3TO4D 4V1DE 1H5BA 2AQ2A 3WN5C 5C9KA 1I3VA 5DVNA 1RHFA 4KU1A 2EXYD 3DSFL 3MCLH 3IFNL 3FL7A 2IH1A 3ARFB 3L3HB 2R0ZH 1MI5D 1AI1H 3MO1B 3ZMRA 4BZ2L 3RWCB 2C3VB 5CEZH 4FXLA 3STZB 5EU5A 1JYVA 3GSUB 4YDIL 3VWKB 3NA9H 4KZDH 2FRGP 3OG4B 3MACH 2NY1D 5KSBF 5SWZE 1SYSB 1N6VA 5EZJB 1I1FA 1BLNB 1JYXA 5E4EB 3NIGF 3Q5YA 4PTTA 4P23D 1JZ7A 4C58B 1FSKB 3CSPA 3ECBB 5EPMB 1I7TB 4XCNB 1TZHB 5I1KH 4L4TE 3QEQE 4KUCF 1Q9KB 5FGBA 2WZPD 5FO7B 1I1AB 4POZD 3ARGC 3TBTB 2CLVB 4HUUA 3EOBA 32C2B 2W9EL 1KCUH 1YDPA 1X3DA 3TIDB 4I0PA 4Y88A 2X70A 4U6HB 2XZQL 2A9ML 3C8DA 2D31B 2A0LC 3RWHA 2UYLA 1RMFH 3VE0B 4PBWD 3VWJD 3HC3L 4RWHA 1NGZA 2E6JA 1T22A 4F7EA 4M7JH 1N4XH 2I5YH 4F3FB 4NQCA 1FZKA 1RY7B 2BDNL 4LSVL 4XPGL 3VXUA 2NTFB 4ZFZB 2VZUA 4JRXD 3QI9A 4NO2A 4RMUA 5CZVL 1KELH 2AK4D 3GJFH 1ONQA 2DQDH 1CTNA 5D7KD 1LO4L 2A73A 4Y4HD 4ZXBB 1FYTB 3MJGX 5CBAB 3ZTNH 2ESVD 5HJ3B 4PB9L 4UQ2A 4HWEL 3QXVA 3ROOB 2D9CA 1IEBB 3MODH 3DWTA 3ZHKA 2HLAA 4HDIB 4KI5C 3RFZC 3OJVC 5T1DH 4HUKB 3GBMH 1H3GA 4AEIH 4ONHA 1U8OA 2WIIA 3LPGA 1WQVT 3CSGA 4PRIB 5I30H 4RAUA 2J1KA