2F9BT

Discovery of novel heterocyclic factor viia inhibitors
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
200
structure length
149
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGDERTLVRRNNTFLSLRDVFGKDLIYTLSVQAVIPSRTVNRKSTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of novel heterocyclic factor VIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
molecule keywords Coagulation factor VII
total genus 33
structure length 149
sequence length 200
ec nomenclature
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f9bT00
1MQ8A 3QUML 3WEXB 3L7FB 5C0CD 3E3QC 1HE7A 5K33A 3IAPA 3IDIA 4MD4B 4OJFL 1NFIB 5AUMA 1GIGL 4GRLC 3TT1H 4Z78B 1LP9B 1IGFL 2GFBA 2Q3AA 3QEUA 2R69H 5DMJB 3DUSA 1U8LA 4YHZH 4ZUVB 4X6CF 1A5FL 4YPGA 1UH3A 2F54D 2R2CA 1E4JA 2VLJA 1NFDF 4Y16A 4NNYB 4GG6A 1BGXL 4DGIH 5FYJH 4BFIA 1AP2A 5CSBA 3RZCC 3AAZB 3T0BA 3S5LA 4E5XA 3PIQA 1FGNH 1ZSDA 2VO5A 5E8OA 1Q94B 3IJSA 2ENSA 1MRCH 1GC1L 3NCJH 4P46A 4Z95L 3VXSA 2FJGB 5I19L 4IEFB 3Q6GL 1G9MC 1TVHA 2CUMA 4KVNL 3PL6A 2IH1A 1A6TA 5F1SA 2GK0A 1AD9A 1U92A 1YNLL 1FYTA 1KLUA 3LKNA 2EIZA 4WI2A 3CVHA 5C0JA 4K7PL 1FBIL 1CGUA 4P23A 2FHCA 1IM9D 1CIUA 3QXAB 3LKSA 1ADQH 3VFSB 1E28B 5FOBB 1BOGA 4Q6IA 5GGQH 3NH7L 5FYLH 4U1MA 2G60H 5FKPA 1AGEA 4NO3A 5T1LB 3VFOB 4ODTL 4HFUH 1QNZH 1T5WA 3D25B 3GRWA 5CBEB 43CAA 2DWEB 3CFDA 5IW6A 5ID1A 1UCTA 4LARH 5HHOB 2AXJA 1RFDH 1EHLH 3F62A 3PUCA 1FO0L 1S7VB 5BW7C 5HYJB 1MJUL 1A0QL 3AS3A 4RGNB 4QRQB 4F58H 3EYQC 3MREB 3Q0HA 3C5SA 4NWTL 3SKJL 5IB2B 5GS1C 2VR9A 2QKIA 3IGAA 4QRUA 2QHRH 1N6VA 2FX9H 3SO3B 3AS1A 3QDMB 2ESVA 5JPNA 3P9MA 1QACA 4R26H 2V7NB 5E00B 1WWAX 4HFWB 4NRXA 2LQRA 5D7JB 3TCXA 3ZHDA 1EEUA 5KANG 4JO2H 2V5RA 3VW3H 1MUJA 4WTZA 1Z0MA 2IBBA 1JPFA 1WTLA 5CJOH 4S0SD 4DFIA 5F9OH 3GMQB 4N9GB 2OK0L 5HDQL 1KXQE 5EO9A 3T0EA 3H9SE 3TYGL 2BCKB 3L5JA 4MNHB 4NUGH 15C8L 5H35A 2K7PA 4OFIA 1BM3H 2NY6C 4LASH 3KPOB 3LKRA 4EDWH 3QXTA 1CDBA 3MRDB 1XR8A 2FJHA 3CX5J 5D1XA 5EC1B 4YXHH 3MBEB 1JRHI 5LWYL 4M7LT 3B9EA 5CHNB 5BS0B 4OM0L 3ZDZE 1CGWA 3C8HA 4YXLL 3CFEA 4KU1A 1EJOH 4UMGA 3V5HA 1I7UB 2QEJA 4X99B 4R90L 3P30L 2EZ0D 4U1NB 1CLCA 3U9UB 1NGQH 2NTFB 3LEVL 3QHZL 3ABZA 4DW2H 1TPXB 2ED8A 4EN3C 4Z7NF 2OJEA 4RGNE 2NY0C 1OAQH 1TCMA 4PP2A 4LDOB 5D1ZB 4OKVB 5FIEA 3DVFA 4WV1C 1UM4H 4HHAA 3ZKSD 1D5ZB 2JELL 4QY8B 3FB6A 4XX1G 4Y4FB 1MJJA 5EU4B 5IM7A 3HPJB 1KIQB 5DJZA 4Z0XB 1KG0A 5DUMH 3ARBC 1HWGB 1FP5A 3H42L 5GGTL 5I75C 5FOBA 3UJIL 4EUPH 1ACZA 3O2VL 5HHME 2N7BA 3T0XA 1FAIL 5KN5B 1KPVA 2HT4D 1CVRA 1WBXB 4ONFL 3BRFA 5A3IC 3CDGB 3EOBA 3S36X 3T0EC 4PREA 4UT7L 2CK2A 4P2RE 4PG9B 4JRXB 1U36A 2WWMC 5GZOC 4G9DB 5IESL 3HA0A 5TDOB 3G04A 3WDHA 4OFPA 1YQVL 1OSZB 4KHTL 1RPQA 5DHVB 4X6BA 3IFPB 4P9HH 4XVUC 1DUYB 1MVUA 4H1LG 1DQDL 4NO0A 1CL7I 2APBA 3PWVB 2BMKA 2FLRT 5DTFA 2YPLD 3HTLX 1U8KA 3RNKA 2YWZA 5T3ZL 5IB5A 3K4ZA 3VD4A 5KVEH 2QV2A 2FATL 5DFWH 1CK0L 2UZIL 2EH8H 3DPBA 5DVKA 3PV6B 4PJ8B 5IVXA 4IJ3B 2EEAA 1GSMA 1X5LA 4IRZH 4K9EL 2IMMA 1WZLA 3FO0L 1Q72L 1F90L 1S7QB 1IAIM 3BWAA 4DZBB 1NGZA 1XGQA 4G6FB 2DLFH 1T0MB 1CQYA 3QDGB 1FLRH 2H3NB 1JF5A 5LJYH 3DI3B 2YUXA 4NQEE 1TCRB 3BPOC 5J57B 3GIVA 1I3GH 3GNML 4PJDB 1D5IL 2PXYA 3C09C 1DBAL 4OM1L 4PGBB 5K93A 4JE4B 4JDTH 1IGYB 4WNQA 2MNUA 1V7MH 3UTZB 1IGJB 1E4KC 1WZMA 3V4PH 1DL7L 4UZGA 3OKDB 1R3HB 4K8RH 1NMAH 4PIRF 2Q76B 4NO2B 4QRRA 2R23A 3PHQB 2AI0H 3TJHC 4GUPA 2GFBB 2PTTA 4MQXC 4LFHG 3GHBL 4PTUB 4S10A 5L0QC 3IFOB 1R5WA 3O11B 5IW1A 4JRYE 4XCNA 4Y5XC 1HH6B 3WE6B 4Q6YA 1A02N 2CJUL 3OTTA 3BZEA 1TQCC 4YR6A 4HH8A 4WY7L 4XXDB 1HI6A 4WW1B 2F58H 3K80A 1KIQA 3NCEB 3ZTNL 1ODAA 1HYSD 4KKAC 2NLJA 1U8HB 4UB0H 4BELD 1IQWL 4OV5B 4KZEL 1UQSB 4HV8A 3KLSA 4JGMA 4NO0D 4G42B 4QRSA 3NIDF 2Z93A 5F1IA 2BOCB 4YXLH 3O6ML 4BH7B 3O6KH 1YPZE 3H9SB 3RL1B 1SM3L 4UNVA 1A4JA 2HWZL 2XQBL 4YO0A 3KPLB 1DUZA 4XMPL 1EUUA 1IE5A 1CGXA 4O5LH 3GK8L 4ZD3H 3ARYA 4WGVB 2EICA 2J6EL 3O8XA 3CLFL 1T4KA 2E9WA 1Z6JT 4CU6A 3BH9A 3ROLA 1B0WA 2NY5H 1F45A 3LAFA 3VGGA 2ORBH 2NXZD 4R0LC 3GSXB 1RZFH 1GZPB 2VE6B 4BQBA 2AEIT 2W60A 3JUYA 2ICWA 3RWGB 4X98B 4D0BA 2YA2A 5IMMA 2PTTB 1NCCH 25C8H 4JFYB 5FM5O 3KWWA 3NZHH 3ULUC 1WIPA 1R5WB 4FQLL 3VG0H 1DBBH 1G9MH 1T2XA 5FHBL 5IWLA 4GSDL 1CL7H 1Q0YL 3AMKA 1J0KA 5L9DH 5TH2B 5D96C 1QFWM 4RWYL 7FABL 4EOWH 2UUDK 3GKZA 1XF5B 5I1GH 4JVPA 3MACL 5BQ7A 5C2UB 5ILTH 5I1KL 4P2OC 3OZ9H 3MXVH 4WNQB 4P59L 3NIFE 2ILLA 4GAYB 3TVMA 5I1HL 1OB1B 5E08L 3NAAL 4M7JL 4O58H 1AIFB 3C60B 4PYHA 1EHAA 2YEZA 1JZ7A 4WFFD 2IH3A 5F7KC 4U1GC 1YEJH 1CT8A 2XTJC 4YE4L 1WFTA 5F1NB 1ZXQA 1T03L 2OL3B 1FZOB 4YDKL 3QXDB 4NC1C 4QT5A 5C0AB 3NCBB 2R8SH 3PGCA 1GIGH 4P4KB 3RL2B 4JKPL 4XWGL 1A9EB 2DKUA 5T1MB 3GMLA 4HPOL 3RY4A 7FABH 4N0YL 3T1WA 4JO3L 4R4ND 5F7UA 1U3HC 3O6FB 3IS1X 4PJ7E 4RCAA 4E42A 2H32H 1KPUB 5C1MB 4X5XA 1UZ8A 3LCYA 1SVCP 1U2HA 2FIKA 4NM4L 1RJLA 2X1QA 4HWUA 4RMTA 2IAMA 4Y89A 4F15C 2XKUA 4LSVH 2A9MH 4V1DB 5KOVC 4KGLA 3P4LA 4ZNEE 3MCLL 4G3YH 4Z95H 2K7QA 4GMTL 2I07A 1LDPL 1LO3L 4G5ZH 2HJFB 5FYLL 4BSWB 1I1AB 4EI5D 2XRAL 5BOZG 4Q0XL 1B0RB 5HHVH 5JW3L 5HY9A 2DYPD 4JKPH 4OFVA 3TH2T 1A1OB 3PWUB 3GSRA 3V4VL 1H3PH 1BVLA 1FE8L 1YN7A 4XP1H 1N59B 4NQEB 2NY2C 1I8LC 5DWUH 1JI2A 4X7TB 2HT2C 1MWAH 4LLWB 2UYLA 4KUCF 2B20A 3MV7B 3FB5A 4H25A 4LP5A 2XN9B 4JM4H 3QWOB 4Y5VC 4G7VL 1FPTL 4HUXA 3DX8B 3JWDL 3G6JB 1IAOB 1P5UA 3T65A 3TBTA 1EMTH 1CDIA 1XF3A 3CZFA 2AERT 5C3LD 4MDIB 1U8LB 1JNHA 5ID0B 2B5IC 4PGEA 4OLVH 4OZIA 1G0DA 2CLVB 1ACYH 3GB7A 3P9WB 3MRKB 4R4NC 1N8ZA 2A9NL 3B9KA 2PN5A 4ZOAA 5SWZA 3LKOB 3DX9B 1OAKH 2IALB 1FL6B 3BE1L 1QVOB 2A6KB 2GJ6E 3HNTL 3O4LB 5D7IB 5FECA 5DD3L 2YUWA 2VXTH 4PRIB 1ITBB 3L3JA 1TENA 4J3SA 3SY0A 1FNGA 4UT6L 1R3IL 1VFBB 1OM3L 1CT8B 2AGJH 3KPRE 1NANI 4CKVX 2CR3A 2ATKA 4OUUB 4KMLB 1ZGLP 2GUOB 2YR3A 4D9QD 3QIUD 2NXYD 2H8PB 1A3RH 3GSQA 3OKEA 3VXUA 4YDVB 3VFMA 1QKZL 1F58L 2GUOA 4WTXA 5C09B 2JKXA 2NY1C 1B9ZA 2OS7A 3G6AB 2XN9D 4OLYL 5ESQA 1MELA 1O7SA 1XCTA 4JRWA 1QHOA 4KJWC 4Z7WE 3SDYL 4S2SB 3P0VH 3BEWA 2VWEE 2OZ4H 1PG7L 4JKWA 4I0CC 5K59E 4O2CB 2BVOA 4KY1H 4OI9A 1T3FB 5IVXE 2XG4A 2P7TB 2VABB 5K9JH 4PR5A 1FBIH 1CD1A 5F71A 3VXME 1G7IA 2Q7YB 3BEWB 2ZCHH 2WSKA 4HUWA 4PFEA 5JW5B 1DLHA 1CZ8H 5JIHA 1JVKA 1CBVH 4M6MH 2G2RA 4PRIE 5HGAB 4D2NA 5CBAA 5EO1B 3B9DA 4RFOL 1ZANL 4MNQE 2X4SA 4OF6A 3MODH 4WJ5A 2CMRH 2WW8A 5D7IF 1XGYH 5GISH 4PJ5D 5F7HA 3AUVA 5E24E 1A6AA 3TIEA 4OF8A 1A3QA 4PJCB 3JTSA 4YFLF 3QCVH 1HKLH 4YGVA 4G42A 3HR5B 2AQ3A 3OWEA 4AM0A 4CVUA 3BSZL 2ID5A 5JZ7C 4XNZB 3QIBA 5DURB 3I02B 5JOPE 3G6JA 1H3UA 1KCKA 3OKLA 4ZFZA 3RX5A 4M7LH 5JPMB 5IGXH 5EOQL 2FD6L 3U46B 3QA3B 1FVCB 4NWTH 4S1RL 1MCBA 1LDPH 4POUB 4RMVA 4LF3B 4OCLC 3D0VA 1MAKA 1JMZA 3RJQB 1MFAH 1MWAA 4YBQC 3EJZD 1DQTA 3CVIH 5EORH 4MS8D 2DDQL 1A1OA 1KUMA 4OD2B 2JCCA 3N1MC 4F9PC 1C1EH 4XP1L 1DQQA 4YHOL 4L1DA 5E2UH 2EYTB 4PY8I 3MJ6A 4A6YA 2B4CH 3MRNA 2AJYH 4LNVA 4MLSA 1CFSA 3BZFB 1AGBA 1FGVL 1JP5A 1RUQH 4I0PD 1VERA 2DBLL 4ZS7H 5DJXA 4BK5A 1TQBB 2I25N 1IAOA 2D7MA 3IAQA 2Z35A 5ELIA 3SPVB 3T65B 3RKDD 4QOKA 1MHEB 1KTRL 2A2QT 4LL9A 5KSAB 3O2WL 4R90H 2A1WL 1IBGH 2B1HL 5DMYA 5SX5K 5IHUL 5IQ9A 1BJMA 3HI1B 2QTEA 2VLME 4JFFB 1P4IH 5EU7C 3MRLB 4ZFOA 3INUH 1I8IB 4QHLA 4AM0B 3QQ3B 5ETUA 4L4JA 3EDEA 4XWOD 5F7WC 2XFXB 1J1PH 1DQDH 5E2TL 3VWJD 3FN9A 4XI5C 5GGTA 4XRCA 5L88L 4J1UB 1BIIA 1X9QA 3SDDA 4ZTPL 4ZS6D 4WWKB 2CIIB 1FIGH 4L8BA 2VQ1B 1N7ML 3CH1A 1I9IH 1YEEH 3NCCB 2XICA 5E8PA 2X4TB 3DV4A 3GGWA 3TFKC 4XVTH 4IDJH 5E1HB 1OAUL 5I74B 3VXQA 1DLHB 1IT9L 5TQ2L 3H2WA 5CBAB 4HIHA 4QRPB 5GRXG 2R0ZL 3QUKA 4PJHF 5BRZE 1BEYL 2WWMD 5GZOD 4ZUSA 1HQ4B 3VMNA 3X3GL 1J0IA 1S9YA 3BUYA 5EZOH 3DUHA 2YWYA 1OP3H 1GZPA 1V3MA 2W0LA 4N0RA 4TTDC 1FVEA 1T20A 5CP7B 1A3LH 2HT4C 1AQKH 4RNRB 3BQUD 5DA4A 3AREB 5F1OB 4WW2A 4S11A 2BNRD 4OSUL 1JJUA 3LH2L 1LD9A 4GO6B 1ZA3A 3GSNB 1HEZB 5E7BA 4RA0C 5IFJA 4OZFB 2YPVL 3FQUB 3QP3A 4ONHA 3CGTA 5TH2A 1DANU 2BVYA 3WS6C 3REVB 1V3JA 3OKYA 4Z7VB 1MF2L 3HC0B 4WUKL 2ORBL 3B3IB 3A67L 3DMMA 4NN5B 5BXFA 2E6JA 3R0NA 1KGCE 3DVNA 4I48A 1S3KH 3WN5C 1OAYL 1BFSA 3QCTH 3S6CA 3KXFB 1XR9B 5KBNC 3KPSB 5C0NC 5HDLA 3QDJD 4UB0L 3LQZA 3EYSL 2EC8A 4RAUB 3EYUL 2YA1A 3QFDA 3HAEB 4JDTL 3H9HB 5DJCB 5FYLE 2FBJH 5FYKU 2NX5A 1S7SB 1ONQA 1AKJD 2DF3A 4GRLB 1XGTA 1MH5A 4F7EA 4OBSA 2NLJB 5T3XD 4JCMA 3SDDD 4D0DA 1BZ9A 3BPNC 3MR9B 3QDJB 2VXSL 4LLQA 4KMTL 1TITA 4QTIL 1L7IL 3W0WE 4ETYA 4NHCL 2AJZA 1UEMA 1OWRM 4PJCF 4HUXB 5E9DE 4KRLB 2WIIB 4MJIA 3KPNB 4KMQA 1REIA 3C2AH 3FQTB 3LN5A 4I5BA 1OAXL 5I18H 3NA9H 5FYJL 4FXGB 3QDGA 4LCCA 4ERSH 1YMMA 1HHGA 2D0GA 3KPRD 3I50L 3MRBA 3BESR 4KRPD 4LBEB 3OBAA 3VJ6B 4FQXD 4P3CH 5HY9B 4GMTH 1X5ZA 1JHKL 2KL6A 5CD3B 1KJ2L 5D7KD 4L4TE 3QSKB 4NZUL 2XWTA 4OF7A 3ZHKA 3MACH 1OPGH 5B38A 1IBGL 4N0FA 4PBXA 4X9HA 1INEH 5ANMB 5ACLA 5AAWA 1NGZB 2PYEE 1NCDH 3V7AG 4Y1AA 3SJVD 3F7VA 3GSUA 2XZAL 5IBLD 5FO9A 5D2LF 5DJ6B 2RAMA 1U58A 3U1SL 3DMMD 4E42B 3EW3B 3T3MF 1F42A 3QXAA 5IMOA 4NBZB 4XNUL 1Z5LA 2EIBA 4RQQB 1IC7L 3MV8D 5E4EC 4BFBD 4IMLB 3GSOA 3QBTB 3QI9D 3VFNA 1A22B 1NGXB 1DVFB 5FA3B 4R4BA 2D7TL 4CVXA 3SKMA 4KDTA 4POZC 2PR4H 1PLGH 3CVHH 2AJ3B 5DD3H 1GGCL 1H8NA 3MV9E 1RZ7L 4OKVA 1A3LL 2RFXB 2R1YB 3MRBB 1AGDA 1YQ2A 2FECI 3V6FA 1QFOA 4JKLA 5CUSL 1WZKA 3LKSB 3NFPB 1T1XA 2R2HA 1CLZL 1ZVHA 1G9NL 4GRLD 4DKFH 1R3JA 4PJEA 2AV1A 2NY6B 4P9HC 5IBTH 1DQJB 4FQIL 3U6RA 3ZE0E 4HPYH 3KPRA 3NFNA 1N0XH 3O8XD 1TXKA 3OB0K 4X80H 4WI6A 4UTAL 1AXSA 3E1F1 4D0BB 4KQ3L 3O2DL 4LKXA 2W59A 2VZSA 3QXUA 4RWHA 4K94H 1NBYB 5D2LB 1F2XK 2H45A 1N6QH 4HUVA 1FZMB 3MUJA 3VXSB 1KULA 2JJVA 2GJ6A 2GCYA 4Y2DB 4OTXL 3P73A 4H88H 4P57B 3V2AR 4Y5YB 3DV6B 4ZOBA 1SJVA 1FJ1B 4P9ML 4Y4HD 5EPMB 4U0RC 5DDHA 1EJOL 3ARFC 2X7LA 5E6IB 5CZXC 2EDYA 1E4XI 1W0VB 1LEKA 1UEYA 4Y4FC 5L8LB 1NCNA 4XP4H 3VXOA 3DUUB 1U8MB 5CIPB 2EYTA 3VFUA 4PD4K 3F65A 4M62L 3QEUB 4F7TA 1S78C 1MRFH 3SGDI 4BH8A 2E9BA 5FV2A 3HZVB 4M02A 4G7YH 3CDFA 1DZBA 5D1ZA 3QHFH 5D93C 4NQDA 2CK0L 1DDHB 2GJZB 3T4AA 4LHUA 1NBVL 4LVOB 3OKKB 3BD4A 4M93B 1QR1A 3PWPB 2WNGA 5DWUL 2OL3H 1TCRA 1OM3H 1QFHA 3PL6D 2BXZA 1MWAL 2H6PA 1OAXH 4X83A 1AFVH 3U46A 3B3IA 4EDXA 5ESVA 1LNUA 5CHNA 3BUYB 1VENA 2DI8A 5GGSY 3LQAC 4IMLA 2WP3T 1P9MA 1NC4A 3KPRB 4TPRL 4OGXL 3FHQA 3EO0A 2YXFA 2XY2A 3BRGC 2EYRB 4GW5B 4G8GD 1U8QB 3FFCD 4TNVK 3E6FB 1QBLL 1P6AB 4CJ1A 2YD5A 3FMGH 3IETB 4QXWA 4HBCH 4MJ2A 2ERJB 1ZA3B 3CUPB 4IJ3C 5FGCE 3CCHA 4LAQH 2FEEL 5ESAA 3SO3C 3MLSH 4PRPA 4N0CD 4QTHB 4ONHB 2D2OA 4LSVL 3P9MB 1IKNC 3RY6C 5FUOH 5HSFA 1OVZA 3EYOB 1CLOL 4MJ6A 3TA3B 4X4XB 2NCMA 4M5YL 5CZKA 2JJUA 1T2JA 43CAB 3FOMA 4RAVB 3UZVB 4G8IA 2AV1B 3SN6N 4OLZL 1HSBB 4HCRA 4OCWL 1S7UA 1ZS8A 3LQAL 3MBEC 1T21B 4YHOH 1K85A 1S5HA 3KPQB 3MLZL 2MJWA 3LPFA 1RV6X 3HMXH 2HH0L 4M8QA 1A5FH 4ODHL 4ZUVA 2ESVD 1HKLL 3DX7A 1YMHA 1CFVH 2IC2A 5D7KE 3M1BA 4EI6B 4I9WD 1JHLH 3GDBA 4JY4B 4E5XB 1DCLA 3HNSH 3G5XA 1G84A 1KN2H 4WI8A 12E8L 1OL0A 4ELMF 1A7OL 3GJFB 1HINH 5GXBB 1GHFL 2FL5B 3P9LA 3MRMB 4IMKA 4K7FB 5D1XD 5D6CA 3B9KD 1G9NH 4N90E 5E8DL 1T89C 2Z35B 3CMGA 3OKNA 4B0MM 4H0HB 2GK0B 3LN9A 1YY8A 2ZSWB 2HFFA 2X9XA 3HAEA 4I2XA 5HHNA 4LNRB 1YMMB 2ICEA 5JMRA 2PETA 3D0VB 1OQOA 3GEWB 2ESVE 4MMXC 4DTGH 2IWGA 1J8KA 4PJBE 4DKEL 4M6OL 4WWID 2BHUA 1C7TA 1IEHA 4Q74A 4QGTA 1MIEH 2JCCB 5I8KL 4YQXH 3FQWA 3IXAB 1NGPH 2YRLA 2PW2A 5J6HB 1JPTL 2P24B 4TQEL 4AL8H 4A6YB 3S88H 2KPNA 1FNHA 1RULH 4HLZH 4Z0BL 3WS6A 3GIZH 1FORH 1MHHB 1QFPA 2EEDA 1HXMB 1JGVL 4JB9H 3WFDH 5DR5L 4D8PB 1R5VA 1Q9LA 2X1PA 5K9KB 3PGCB 4FXKB 1U91B 4J3UA 3VFPA 1S3KL 5D2LE 3RWEA 2WK2A 5F9DC 2J4WH 2DWDA 5L6YH 4TSBL 5DSCA 4EUPG 4HKZA 4RBPK 3G9AB 2VN4A 1W72A 4NOBA 3WFHA 3BPOB 25C8L 3ROOA 1OARL 3LMJL 4HWZA 4O2CA 3QDMA 4OM0H 3MR9A 2IAMC 3U7YL 4UT9L 4WEMB 4X5WB 4UQ3B 4KUCD 1KJMA 4JM2D 4LSDA 4WHYH 5B21A 3ZE2F 3OG4B 1F4XL 5EZOL 4LEXH 2NMSA 2Y1VA 2DQGL 1NH6A 5I1GL 4JB9L 1NGYA 1R5IB 1UM6L 1AI1L 2EC9U 4PJ9D 2AKRA 4NQUA 3TYGH 1VEOA 2EDJA 5DHYA 3IETA 4EDWL 3AU1B 3EFFA 4TUOA 3TCLA 4PJBA 4UILL 5FV1L 5C2BL 1IAKA 3VFWA 4LAQL 2MHAA 2J4WL 5L0QB 4MA7H 2OSLA 2OZ4A 3C2AL 4G6FD 3GJEA 1QSZA 1AXTH 2FB4L 4KPHH 3FOLA 1IC5L 3MRHB 3JTTA 5LGJA 4X8JA 3O3DB 3U4EB 4XNYH 3CDYA 5F6IC 3MV8B 4L8DA 4LCWB 4U6YA 5HJ3A 1ADQL 4JFZH 5EZIH 3FB7A 1Q9OB 5CWSB 3ZKMD 1P1ZA 2HKFH 4YHPB 1T1ZA 4F57L 2Y06H 4OLXL 4LSSL 2AJVH 2UV3A 1BZQK 2I9LB 4QXUL 4BZ1H 3JUZA 3IKCA 1H3TA 2YRZA 1A14L 4LSTH 5C07A 5F8QC 3GB7B 4NM4H 5DJYB 5F1IB 1RIUH 5C0EB 1RMFH 2Y5TA 1KOAA 4AG4H 4G8EB 4RMWA 5KSVB 4DQOH 4W4NA 4MNGA 4AY0A 3HI1A 1HILB 4P5MA 1TVHB 2CR6A 1NFDB 2IG2H 5LKNA 1L9NA 1HYSC 3IXTB 4ODWA 1KYOJ 1NQBA 1QSFB 3VCLB 1FC2D 2FX8L 1A47A 4BSJA 4DGYL 3P0YH 1P84K 1P7HL 2ADGB 4HUVB 1JZ8A 4TUOB 3U4BH 5EOCL 3ARWA 3TZVD 1U91A 1AE6H 3GMMB 2FO1A 1BF2A 2AABH 3OAUL 5EC2A 2WBJA 3L3KB 4NNYA 4GG6B 1MSPA 5AZ2L 2IANA 3BT2L 5EO0A 5A2LH 1MRDH 2NY5C 5L88H 3CC5A 5E99H 3FRPA 4HJJL 1I75A 3EBAA 3MO1A 4X6EA 3EUUA 1LEIA 4OZ4B 3UYRH 2AAVA 1BM3L 2Q87A 3S9DB 3C5JA 3ROOB 2XTJE 1HXYA 3WIIL 5E6ID 2VXVH 3L5WA 4X0KB 2V9TA 1WCQA 2GIYA 2Y6SC 1NUDA 3HCVA 2DM3A 2OR7A 2HVKA 2IFGA 4DOHB 2WINA 4S0TD 5HGBA 2Q7YA 3SOBH 3MLPA 1EBPA 1E4XL 3BIAX 5E2JA 4OZHA 3G5XB 3QULB 2HMID 2P5WD 3C9NA 4AEEA 1BVLB 4NKMB 2X1WL 4G8FB 4QTIH 5DQ9B 3D69B 2VXUH 3VFNB 4M4RA 1L9MA 2AVGA 4BQCA 5F9AC 2CIKB 3TLRA 4P4KC 3BDXA 4YHLH 3MFFB 2X4RB 5D5MB 4D3CL 3H3BC 1NL0L 1T5XA 5IVZA 4EN3B 4GKNB 4O51B 3K8LA 4OZHE 1NLDH 3BVNB 1SJHB 1QBMH 1PAMA 1KTKE 2RFXA 3FB7B 3PE9A 3R4DA 4NFBA 2VDNH 2F54E 5D6DA 4F15B 3Q6FB 2F5AH 2BHZA 4HEPG 1BBJA 1T66D 4N68A 1BJ1H 2GHWB 3BQUB 5F89A 1V7NH 1FVDB 4FFZL 3KYMA 3ULUF 2NYYD 5A3ID 2BSSB 3AY4C 2R4SL 1QFWI 3BISA 1T0NB 4FQXC 4F58L 4LPUA 1MIMH 5F7MC 3FOMB 5EBWB 3S37X 2PXYD 2IPKB 1VGKB 2IEPA 3EYUH 4BSVA 4MA7L 1UVQA 5ESVB 3MV11 1J86A 2HLAA 3FQNA 3ULSA 3IJYB 1R5VB 1AFVL 3A0OA 3TJEH 4LCYA 1KXVC 3E0GA 1N4XH 2DAVA 2VZVA 4X6CA 3D5OF 3HZKA 1MFEH 3RVUD 4QY8A 3WLWC 1X5AA 3T3ME 4Y5VB 1Q0YH 3UPAA 1R3LB 5D7LD 4GAJH 5DK2B 1E4WL 1J11A 4J8RA 4LSSH 1L7TH 1VA9A 4HIEB 5B39A 4J3TA 2BNQD 4RMUA 5CIPA 2EZ0C 3W9DA 1XGPA 1M05B 4P2QB 3IYLW 2OBGA 2NR6C 3MJGX 5FEBA 4OD3H 1MI5A 1WFOA 1VFAA 1U95B 1VKXB 5J3HD 4NOFA 3IAGC 4JFYA 1HXMA 3DRTA 3I50H 1KTDA 4H8WH 5IFAL 5JIIA 5DVNA 1WICA 5C0ND 1YA5A 2VDKL 1W0YT 2VXQL 5GGRB 3TO4A 1MFNA 1C5DB 1UWEH 5EU4A 3KPSD 5EORL 1UH2A 3P0YL 4NHUA 1OP5H 3GJFH 3AB0B 3BH9B 1P7QB 3G5YA 2EKJA 3WLWD 1RUKL 5ACZA 4GW5A 4EBQH 5D7SL 2APVA 3D39A 4PJHA 4NBYB 2IANB 5EO0B 1CD9B 1INQB 4JM2B 3DLQR 1MY7A 1P7KA 3JWNC 5FUCC 3ZE0F 1EHXA 4IDLA 4R96A 5HI4D 1ZLUK 2BSRA 5INCB 4XP9H 1J0JA 4X7SH 3L95A 1FFPA 5MENA 3QG6A 4JHAL 1FFRA 1YEGL 2ZG1A 3HKFA 5C6TH 3PF2A 1WWWX 5C70A 2BERA 4OIAA 1I1CA 2V5TA 3LEXB 4RRPA 4GQ9L 3MUHL 4XBEH 4ZODA 3VRJB 2F74B 4P9HL 5AG9A 4TUKH 4OZGE 3WKNA 2D7PA 1T1WA 3PQYB 4HF5H 1FYTD 1XMWA 4LRNH 3TN0B 1JGUL 3UDWA 5IW6B 5GRUL 4TVSa 5D7LA 3U82B 1R3JB 4UV4H 4PJDF 3ZYIA 4XCYB 3N06B 2LU3A 4FQQA 4M5ZH 5BVJA 3KYOA 1FZJA 1W0WA 3U0WH 2CDGA 4MJ5A 5KS9F 3EOAA 2ZP0T 1CXLA 1T1ZB 4MAYB 4ODUB 4TNWF 4TNVF 3M1BB 1EMTL 2YZ8A 2M8XA 3G08B 4XWOC 2LVCA 2OI9C 3CVHB 4HUKB 5C0JB 1R24A 1FYHB 4NQDE 5BV7H 1YUHB 5DGRA 1RJCA 1EJ6A 3JSSA 5E1AA 4FQHA 3X14B 3NA4A 4JREB 1FH5H 2J8HA 5I1IL 4PRAB 2A6JB 2I60L 4DEPB 3QRGH 1X3DA 5JLZA 1OTUD 3VFRB 3CD4A 3HC4H 5L6YL 3AAZA 4M8QB 5H8DA 4HDIB 4KKLD 5GS0D 1ZSDB 4TN9A 1JWMA 4M7JH 3UZQA 4E41D 3WN5B 1KJMB 3W5NA 2VDLH 2NNAA 4HXAH 4JO4H 2XZQH 5F6HI 3TO2B 4P2OB 1EEQA 1OAKL 1M7IB 1FLTX 3BKCL 3LIZL 4HS3B 3MNVB 2M26A 3C5ZC 4QHKJ 5CILH 4YBQD 2DYPA 4J23A 4Q9QH 2NY3C 1TQBC 1NCWL 3O9WA 4Y2OA 4DAGL 1RUPL 2DLEA 2HYMA 5JA9A 4CU7A 4JQXA 5CP3A 2L0DA 4I3SL 3TBVB 3VFTB 4M6OH 15C8H 3EO0B 4X6CE 2AW2A 2CH8A 4P46B 1FL3A 1U3ZA 2X6MA 4K94C 4FNLH 5K9KA 4K3DH 2OZ4L 1JPSL 3ZT6A 1SM3H 1XF5A 1U3HB 1JI1A 1KG0B 4MMZC 4QXGL 43C9A 2E7BA 5H35B 4HXAL 4JO4L 4PJEF 2AK4A 1JYVA 2QQNH 4FFYL 1ZVSA 1GHFH 1NGWB 1XZ0B 2AV7B 1CGSL 4CGTA 1DQQB 2EDDA 5DZLA 4XGZA 3SGKC 1GZQB 4Y16D 4MCZA 2C1PA 2DQUL 1YEIL 1FE8H 1L0QA 2F9BT 1KFAL 4HJ0D 1ETZB 1W72L 3DOSA 1TNMA 1YEKL 1MLBA 2F19L 5I9QB 1MNUH 1I1AC 2ZOKB 4PUBL 4AZ8A 3BKMH 4KVCH 1CR9L 3G6JF 4OI8A 2DTSA 1SEQH 2XWBB 5DGQA 1KB5H 1P4LB 5MENB 4CDGC 4F37K 3U7YH 5EBMB 3QNZB 4ORGA 5FB8A 1CF8H 4MAYD 4PLJC 4LK4A 1T0NA 2Z93B 2R23B 2MTPA 3LKQA 3UTTB 3BO8B 4OQTL 2EYSB 1KEMH 3U4BL 4XHJD 3MREA 1DBAH 2HN7A 2NXYC 4NJ9H 3CLEH 3SGEI 1MPAL 5HHMD 1I9RH 4DVBB 5C9JA 1BWWA 1MQKH 2B5IB 3S8WA 1YEKH 5JA8B 2ESVB 5JPNB 1IAIL 3MRRA 1JZ5A 2FATH 5C0CB 2FNBA 4WHTA 4IRJC 3GMLB 1R3IH 5GGTH 4LAJH 4YK4C 1OTSC 5IQ7H 4LMQE 2OSLB 3N9GH 5HGDB 1IM3A 4LQFL 3LQZB 3U0PB 5T1DH 3RA7L 2YBRA 2ZPKH 1AR1D 1LK3L 3OKDA 1EVTC 4KTEL 3VU2A 1M7DB 4CL7A 3SGJA 5DO2C 5GS2D 5D1QA 2R0WL 1AC0A 5C09D 3IS0X 2OTUA 4P99A 3G5ZB 1XFPA 3K2UH 3BPNB 5C0GA 3WNPA 3LRSB 5HYJE 5FO9B 4XPHH 3MOBL 3HZKB 3UP1A 3V5DA 5C2BH 1DQLL 3QDME 1B4JH 1LP9A 2F74A 3QNXA 4RDQF 3D48R 2LFGA 2Z91B 3SKNA 3VFSA 2Y36H 4F7PA 1AR1C 1IGCL 3UJJH 3QUZB 4MQTB 5INDA 4U1NA 2NY4C 4HWBA 1E4XH 3T77A 1NMCB 4MSWB 3GHBH 3SKUD 3L3JB 2F53A 2ICWI 1K9TA 1D5BB 3SDXF 3BPLB 1IGIH 3KYMB 4Y2DC 2VXUL 1BEYH 1CICD 2X1OA 4Y5YC 5HYSA 4KQ3H 3B9KC 3HNVL 2X44D 2DLIA 1AY1L 3L95B 2CLZA 32C2A 2AJUL 4X4MA 5TDPB 1MJJB 3PWVA 1KEGL 5GGRY 35C8H 2VISB 5GJTL 4PJ5B 5TGBB 3RTQA 5CGMA 4K23H 4KZEH 1FRGL 3L3GB 3MRGA 1URLA 5FGCB 2DN7A 3BH8A 3HN3A 2X4RA 4ORGB 5FB8B 4TVPL 4ZUUA 3M8OL 3UTSD 5JHDE 4M93C 4NRYB 5DFVC 2ZUYA 4WEBH 4OT1L 1N5AA 3ARGA 5BO1H 4X7EC 3EO9L 4TYUA 5JTWA 3MGTA 4OZGF 3MRLA 4PJIB 4NPYA 3NCYP 1MCJA 1O5DT 3D3VE 5DS8B 2OR9L 2AJUH 2BNUA 3ZL4H 4YHLL 5SWSE 1U8JB 5I1JL 4WVRA 4HUWB 1OGAA 3FQXB 3V6ZA 4ORZC 4JGUA 1YEJL 1ZT4B 5DJ8B 3KS0H 5TPWL 3RVVD 4XNYL 1KCVH 2CD0A 1GVIA 4IS6A 2ERJC 4YDKH 5ACMA 2F53E 4Z7VA 4QF1A 3IDYB 1KCSH 2Y07H 5B3NA 3PP3K 4WU5A 4MA8H 3N1GC 4RMSA 1ZKAA 3SE3C 3RWJA 1CTNA 3DVNB 4O2FB 4NN6B 3IFNL 3IVKB 1FG2A 3STZB 5JQHC 1T20B 5CP7A 4DFHA 4P4KA 4JPKL 1AJ7H 3AREA 2HJLB 4KJYA 3LS4L 1MLCB 3VXPA 3P11L 3BQUA 5E03A 1MREH 1JPGA 2BY3A 2K3TA 4S1SL 3MNVA 1QSFE 3VGBA 1BFVH 1FNGB 3GSOB 5SV3A 2NY3D 3X11A 4I1NB 4EI5B 5EBWA 4MD0A 3WUWB 4KFZC 2HG5A 5IB1B 4TRPL 1KCSL 3RVWC 4JG1H 3IDJA 1AQDA 3RIAF 3LV3A 3CH1B 5KVMC 3D3VB 4TSAL 1DN0A 3HMXL 3FT2B 5C0CE 2I5YL 2WANA 4NCC2 1N64H 4G6KH 3ARFB 3TH4T 4KKLC 3DETC 5GS0C 3CMOH 4PJGB 3ZSSA 4HIHB 4QRPA 4X7FC 1ORSA 5EIIA 1LWRA 5I74C 3CFJA 3IFPA 4NYLB 5ICXB 2WBJB 4CBPA 1HHJB 4L3CA 5ENWB 2WUBH 4MA1B 3C6LD 3QXVA 4OFKA 3PNWB 3VGAB 1CCZA 3G6JE 3B5HA 3IDIB 3QULA 1X6LA 1S7RA 3F58L 4LVOC 5JDSB 2AGJL 1D3CA 3L3DA 2W0PA 1C16B 4PV9A 5EU5A 3FQRA 4BKLB 3W11D 4L29A 5ERWA 4JZJC 3RVXC 4PJIA 3KLHC 1E6OL 1T03H 3E8UL 4Q9BA 4OIIH 2P43B 4G6JH 1F58H 2CLVA 1F3RB 5T5NG 5C7XL 1BD2E 1PLGL 2DIAA 4MJIB 4RGMB 4YDLC 3HE6A 1SBBA 2GK2A 4LSUL 3JXAA 2E9JA 1K8IB 1KEGH 1JUFA 4DVRL 1FGNL 5DQ9A 3VGDA 1H3WM 3DHJA 2LAAA 3LSOA 3V0WH 4LHUD 2KQMA 4NC1E 3B2VH 4ZDHA 3OMZA 5GSRB 1JNLL 3A6BL 2F5AL 1D9KD 3MLUL 1H15A 1NDMA 3P9LB 1PKQE 1V5JA 2JJTA 4PJFA 1I3VA 1LQSR 2E27L 1CDYA 5FKAA 1CG9B 4OCXL 4Z7UB 3VWKD 4KRPC 4XCNB 1UM5L 3EYVB 4YNYB 2IAMB 5D6DC 2R29L 1QFWH 3ZL4L 3QEQE 3GSNL 2VDMH 4U3HA 5H94A 1XGRA 1Y6MR 3G6AA 4MQ7B 2P48B 2D0HA 3ZTJH 4ZSOE 4DN4L 2PKDA 3ALPA 3ARDA 4CADB 3FQWB 4NZRL 1BBDH 5ALCL 5IB1A 2V2WB 4G7VH 3TWCH 1LMKA 2V7HB 2LVEA 5JIPA 3UTOA 5JQ6H 4C56E 1RFDL 1JZ4A 3C6LA 5I19H 1JTOA 2OTUB 4UOJA 5FO7A 5CEZE 4JG0L 3NFSL 1SEBB 5ANME 1KPRB 2Q8BH 5DZOA 1U9KA 4QHNA 5KZCB 3RAJL 3QI9B 5F6IB 5AEAA 2G2RB 2YD3A 5HGAA 3I9GL 3MX0A 4F7CA 1WISA 3CFJB 1NBVH 5K9QI 3RU8L 2D3VA 3PNWA 1EZVX 1YDPA 3DXAD 1K3ZA 3O9WC 3MRHA 1WBZA 1KPVB 4PB0L 4H20H 4K3JH 4AK1A 1RIHH 5E2WL 1SBSL 5LG1A 4M9OA 4PGCB 3NCYS 4ZPVB 4URTB 4P3DA 3S35X 3RQ3A 3BDBA 3UDWC 4HIIA 1CF8L 4C59B 5MERB 2GITB 4XP5L 4Q9QL 3DX7B 1F11B 2ZOLB 1ZT7A 2AJVL 4QXUH 1ZT4A 3ZE1E 5HYQB 2DQTH 3EYSH 5H94B 4HBCL 3KPLA 1D9KA 5DLML 2ICES 3CMOL 1N2RA 4GKSA 5J13C 3TESA 1RUQL 3ZKXB 3VFWB 4Z7QE 1YJDC 1I9RL 2NTFA 4JANB 4TTDD 4TPRH 4OGAC 1EH9A 2JJSA 2FD6H 2J2ZA 4MHHI 1GAFL 1MLBB 1RHFA 2EXWD 4LMQI 5KSAD 5ID0A 4L4VD 4JPWH 4PG2A 5HI5D 2Q3ZA 4PRIA 4OLZH 4CRPA 1HOCB 3ARDD 4KV5F 3HZVA 5DQJA 1CDGA 5F88B 2CGRL 1CFNA 3MRJA 5EH1A 5C6WH 1KENL 2YPKA 2VRAA 1ULVA 5FUOL 4YNYA 4KTYA 4NM8L 1NUGA 4I3SH 1CFVL 2P24A 1QBAA 4F7EB 1J0YA 2C7UB 1QO3B 4AT6A 3PWNA 4HWBL 4UQ2B 1ZK9A 5TQ2H 1AKJB 2BVQA 3D18A 4ZTOH 2QQKH 3DROA 4HKXB 2I07B 4YXKH 1TZGL 2Z92B 4A2LA 1D9KC 3CPLB 2HJFA 4XP6L 1K2DA 5EU6A 4B7LA 2NW2B 5EOCJ 3GMRB 1HKFA 1L0XA 5DJ0A 1FSKC 1J1PL 5E2TH 1IKNA 4I0PC 2PTUA 4JQIL 2WUCH 4HD9A 4X9BA 3NFPA 5A2IH 3BYTA 1RZ8A 3CIQA 5DRNB 2DQUH 5IROC 1J1XH 3KDMB 1RIVL 4M1GL 3ILPB 3GSNH 2CKBA 3C08L 4L4VB 3UBXG 1HHIB 4ZS6C 1MIEL 2A6IA 3VFRA 3RIFK 2Q86A 4M43L 2AXFA 3GMOA 3W0WD 2SEBB 2GTWA 3MMEB 4XI5D 5DEZA 1HSBA 1ZWIA 5E9DA 3QEGL 5D2LA 3QEHA 2OR8A 2LAGB 2RJMA 3S3SA 3LEVH 1DBKH 4LP4A 5KSVA 1X5YA 5FYKD 3MNWA 5DD6B 2HLFC 1EAPA 5CEXA 2P8LA 3ZO0A 5E9DB 3WMSA 1X5GA 2X4PB 5HPOA 5FA4A 4WUUE 2QADB 3F7VB 3OX8A 3GM8A 3LH2H 5IT2H 1A6VL 3C87A 1SJEB 5JNYB 3TT3L 4N8VB 4LPTA 4P5TA 5I30L 4NZDA 2YC1A 3G5ZA 3QZWA 1A6PA 3A6OA 2FYYB 2Y4SA 1XH3A 3FB6B 4Y4FA 1CGSH 2RIKA 4JFHE 4M00A 4MS8C 5CMAA 3EJZC 5EUOE 5DRZB 4QHLB 1C08A 4PD4J 3LQAH 1T89A 1JZ3A 4R4BB 2KBGA 4H26A 3QDJA 1G7PA 2ADFH 2H1PH 2B1AL 5LBSL 4BQ8A 1E6JL 1YPZB 4QHMA 3O45B 1NC4B 4RSVA 3VFVB 5ITFA 2VLMD 1V7ML 4TVPE 4KQ4L 1MJUH 3PXHA 3MYZA 1AKJA 2BVQB 3FT3A 5CEYA 3AB0C 1VEPA 5F7EL 1J9CT 1B2WL 4UUJA 4XH2A 4XNUH 2J6EH 2VXQH 3BGMB 2C9AA 3CXHK 4JM2C 1MVUB 4LGRB 4JG1L 2X89D 2FSEB 4I2XE 4XPTL 2NX5B 3L1OL 2NW2A 3TGXA 1P7QA 4YHYB 1RJZB 5F88A 3QNYB 3MV7A 4MJID 4LIQE 3EKCA 2XWTB 3UTTD 5FM8A 4R9HA 4D0DB 5L2KE 2H26B 4HX1B 4JY6B 4XAWH 4R6UA 3GHEH 4RISH 5E2VL 4LSPL 1RIUL 3SDXE 1EEZA 5AD0A 5C8JB 1GGCH 3BGAA 1YY8B 4C56D 5IFJB 2OM5A 1VKXA 3QJHA 4F7TB 4YQXL 3HMWH 4FQXB 4F57H 1KJ2H 3LN5B 1MCOH 2YOCA 4GAGL 3KPOA 5C6PB 1X4ZA 2NY1D 4G6KL 3ULVC 5F7NC 3SEPA 3BX7C 1BQLH 1JCKA 1X4YA 1P4BL 5BXFB 5JOPD 4UNTA 4ELMA 1D6VL 2J8UF 2V5SA 4XP6H 5F72S 4JY4A 1BIHA 2XPGB 3GSNA 4Y1AD 4Y19D 3SJVA 3MV9A 3NFNB 3FFDA 3RWHB 1RUML 3RIAK 4OIIL 4I0KA 3NAAH 2A77H 5EO1A 3L3IA 3OX8B 2GI7A 3MOQA 3O6LL 4GS7C 1FCGA 2X41A 4ZAKC 5AZEL 2HT2D 3NIGE 4N0UB 2BC4B 1FL3B 2OTWA 3UBXI 3KPMB 5BS0D 5MP6L 2GTWB 1IFHL 3EAKA 5DMIL 3QI9A 4DEPC 5FHAL 2MPAL 4GAFB 2AXHA 4H26B 1PEWA 1WWCA 2BNRA 4MA8L 5T33L 3HRZB 2H32A 3U9PH 3F5WA 1OAZL 1HHKB 4UU9B 2OYPA 3KPNA 5C07D 3QWQB 2A77L 4GJTB 3WNLA 2C1OB 2G75A 2PYEA 4K55A 1ZLUH 1JGEA 1Q1JL 4K23L 3QDHA 1AO7E 3ARDB 3QO0B 1P7QD 1RK0A 2NW3B 3ZDXE 2V2WA 2BRRH 2GSIA 4G5ZL 4LVNB 3BZ4A 3X3FH 1J05A 1UJTA 3OPZH 4KJQD 4OFDA 1NLDL 5F3HB 2B0SL 1NAMA 4Z8FH 1JNJA 1TZIA 1INDH 1DBJH 3SPVA 2J8UB 4F37F 4G8FA 5LQBL 4JFED 3DGCR 5K9QG 1VADB 3OF6A 4PJCE 3U4AA 1HHGB 2BVEA 2A73A 1QLRB 1YJDH 1NL0H 2EDBA 3KPSA 2GJ6D 3U36A 4OLUL 3FQTA 2QSCH 3ZYZA 4HUMB 4NQDB 3TPKA 1QBML 4PP1D 1NFDE 1WT5C 5JW4R 3UTSB 1PDKA 1MUJB 4BUGA 4WO4A 1S7WB 1NGQL 3SKOB 5KVGH 1C7SA 4H1LH 1FHGA 2DQEL 1B90A 4ODSL 1F6AA 4Z7VF 5JW4Q 4JR9H 4GKZA 5CSZA 2AI0L 2CKBH 1KV3A 4NQDD 1XF2B 1M6OA 5GZNC 5LQBH 3STLA 2DMCA 5BS0A 2BK8A 3CFKA 1QO3A 2PO6C 1YMMD 4YJZL 3OXRA 3LVEA 4N5UA 1FG9C 1UFUA 3U9UA 1JYNA 3V7MA 3VXRE 3OSKA 2F19H 1F4WH 4HKXA 3DURA 5E8NB 3WE6A 4HBQA 5CMAB 2ZWLT 3QA3A 5CEZH 3NH7H 4EXPX 4OZGA 2EIEA 3H9HA 4ZSOB 5KSUA 3RHWF 4APQC 1H3VA 1XR8B 4TOYL 4H88L 1HOCA 4YHMH 1GAFH 5C08B 5T1KA 43C9B 1TJGH 4LEOA 3GI8L 2WP3O 5DYOA 3F12A 1QUNA 4NC0B 5EOTB 4PRBB 5KAQF 1BOGB 4HIEA 4QYOB 5SWZE 2E7MA 1CXEA 3T3PE 3IF1A 4ZFGL 3TV3L 2XY1A 3I85A 4M7KL 5I66A 3K0WA 4Y4HC 5JO5A 5MERA 1NBZA 3D3VD 3FONB 2PCPA 5FAAA 2IPKA 3O3EB 1QQDB 1I8MB 4JZOA 3MV8A 4L8DB 4PJGF 5HJ3B 1A6WL 4KKAD 3MJ8A 4XZUB 2X4UB 4U6XB 4GRMA 2XV6B 2XZCL 2B39A 2V2XA 5DRZA 3Q5TA 1I8MA 1XT5A 2JIXB 3OXSA 3WXVL 2Y06L 1FV1B 2G5RA 1U0QA 4NFDA 1IILE 4P46C 4OGZA 4PJAB 2CGRH 4XPAH 1ZT1B 2Y7QB 5DQDH 3DO3A 3MUZ1 1CDHA 2QKIB 3IGAB 1UJ3A 5EUOB 3MOAL 3SDAC 8FABA 1U8OA 3LKNB 3QEQA 1NJ9A 5KJRL 3BP6B 2YD2A 4YDIL 3DUSB 3BP5B 3QUZC 1AC6A 1YNKH 2VYRE 2WUCL 4IBLT 4Q2ZA 1NMCC 3MLRL 1OSZA 1G7QB 1NGPL 1EUTA 3C6SB 4XBGA 5SX4I 4EDXB 4HXBH 3RU8H 1PKQA 1HN1A 3B9KB 4MB3A 4P2RA 3P4OA 4X8XA 5E08H 1HINL 4KK8C 4HW6A 4PB0H 3QFJD 1T5WB 1TJHL 5I8OH 3FTGB 3JV4A 2C3GA 5IW3A 5A16A 4U1IA 3OKMB 3D69A 5I9QC 1WC7B 5ALBL 5FDWA 5KN5A 3D6GA 3MRCB 2QLVB 4JFQB 4U6HB 1I7TA 3BKYL 1AGBB 3HNVH 2VH5H 1ZLVK 4J7RA 4OCWH 1KLGA 5T1KD 1IC4H 3TJHD 1JPST 2DQTL 2EIZB 1DEEA 1YECH 2ADJA 1AH1A 1S8DB 5J12C 2I60H 5HVGB 3BPCA 5GGSA 1XGUA 3CNKA 2EXYD 5CGTA 2W0FA 1QSVA 4PS4L 2VZUA 1FJ1A 1XGRB 1A9BB 5AAMA 3BN9C 4AL8L 4OB5H 3ZDYE 3EO1B 4FQ1H 4PBWD 2ED7A 1A6UL 4IHOA 3L3KA 1PX3A 3WO3B 4LIQL 4HIJA 3HRPA 3V4UH 2A38A 3MLVL 4UTBH 2BVOB 1XF2A 2VL5B 1I1YB 4I5BB 2C26A 3LKRB 3P0VL 5J6GB 1I8KA 3F6IA 1JFQL 4GXVH 4YK4B 5BRZA 4P48A 2E7CA 5I1JH 4MXWH 4GMSL 4KPHL 1N0LA 5HD8C 3DBXB 2R2EA 4XC3H 3FO9B 4P2RB 1U2CA 4GG8A 4HT1L 5D7JD 4YPJA 1KC5H 1NANH 4N8VG 3TPUB 1QSED 5B3JE 4M7ZB 5DK2A 3WIFA 1OARH 2IBZX 3LMJH 2HAZA 4WCYH 5GGUB 3MRCA 1U8NA 4JN1L 5DK0B 2NTSP 1NC2B 5LCVH 3RKPA 2LE9A 3U36B 4BZ1L 1JPTH 5K59F 1F4XH 3VXMA 1G6VK 3JTTB 3HPLA 2X4NA 1MVFA 2E9IA 1VFAB 4I4WB 3UZEA 2OXGA 1AO7D 1MFAL 5EWIL 1EFQA 4WW2C 5C0RL 5T3ZE 5HYJA 2HJLA 4KJYB 3U7AA 4WHYG 3HNTH 2NY6D 1DFBL 5I1DB 3Q48A 1JWUB 4K7PH 1AXTL 2FB4H 4OF5A 1NGYB 2VXTL 1HHHB 1TJIL 4RDQG 2P44B 1IEBB 2BX5A 4DGYH 3F7YB 2F54A 5L7XL 5T3ZD 3WIIH 4RX4D 3P77B 1U6AL 1FV1A 3I3DA 3U2SA 1CGTA 2DDQH 4I77L 5SV4A 2WBJC 4ZXBB 2HJKA 4X8JB 3NPSC 1P4BH 2MCPL 1U8QA 2YXMA 4OFYA 1MRDL 4LLMA 3QO1A 2BVPA 4MAYC 1U8MA 3RWEB 4FFVC 2EE3A 2J5LB 3PQYD 3MRQA 1BP3B 2F53D 2IBZY 4NJ9L 4NT6B 5C08A 5T1KB 3CX2A 1Q9WA 4LHUG 4NM8H 4JDVB 3O6LH 3UMTA 1CDCA 2LU7A 2WUBL 1W72B 3U48A 4HWBH 4U3XA 1CVSC 4PLKC 3GKWH 4FABH 1QLFA 4E41E 1AIFA 3WL9B 2YD1A 3PP4H 1JBJA 4WU7B 2ICWB 4JAMA 2HP4A 4H0IA 4RGMC 4AENA 4C57C 4JREC 3N9GL 1QQDA 2EO9A 3M07A 4NJAH 4G6AC 1J8HE 4PYGA 1HXYB 3L1OH 1RUKH 3WS3B 1WEJL 4HAFA 2Z31B 3RUGB 2PNDA 2J7LA 1NFKA 4HKZB 3NCFB 3TFKD 1F2QA 4PP2B 3WFEL 5F7LB 3UTSA 1S9XA 1HWHB 1QG3A 3O3BB 1UXSB 3EHBC 4JHAH 5BV7C 4XMLH 3SQBA 1WGOA 2DQIL 1Q1JH 3GBMH 3C5ZB 3IDGB 3GKWL 3E2HB 4GKZB 4HQQH 1G9ML 2F5BH 1MCOL 4GAGH 1MY5A 4WUUB 1EV2E 5L9DL 1JNLH 4QXGH 3Q2CA 1S5IL 1X5HA 4EQ2A 2FZ3A 2VQUA 3C5JB 5M7QA 1G6RA 4XXDA 2VDRL 1RURH 4D8PA 1X44A 2H3NA 5IFHL 4P49A 5F9WB 1HNGA 4YAQA 1NKOA 4N1EA 2KKQA 4PRHD 3WJJA 3UC0H 2FYYA 3UO1L 2IPUG 2R39A 4F3FA 3SE4A 5E56A 1KFAH 2BSTB 1S7WA 4G8GB 3FFCB 5GHWH 1G7LB 3OPZL 3QUYB 2V2TB 1AR2A 3SE9L 5MENE 1M71B 3TP4A 4P5TD 4HT1H 1RK1A 4NZRH 4FA8A 1ED3B 1PX4A 3K3QA 3X12B 4FZ8H 1CU4L 4JHWL 5KVGL 4KC3B 4N1CA 2RCSL 2GTZA 2IH3B 3JV5A 5HYSB 1L7TL 3HUJB 1J05B 5C0IB 3MROB 3VGAC 2UZYB 5ENWA 2BHYA 2CLZB 3NABL 4J3VA 4WDIA 1JIBA 3EOTH 1D6VH 1IGFH 3CX5K 1TFHA 2V17L 4BZYA 2W9EL 5C0EA 2VERN 4NKDA 4U1MB 4P5TC 3QNXB 3D2UD 4BYHA 3HRZA 4KV5E 5I0ZA 3IDJB 1ZVYA 4FQIH 1FZJB 1ZS8B 4F9LA 5HHVL 3ULUL 1GOHA 3ZKXC 5I8EA 4DZ8B 1WBXA 3MLTB 1ZGLM 3NIGF 4HWEH 1EEYA 2DI9A 2H2PC 3G6DH 4ACPA 2UWEE 4MWFA 3RA7H 2CXGA 3MUGB 4JJHA 2E6PA 5EDXA 4JFFE 1CICA 1YJDL 1DLFH 3O3EA 5C0BB 2EDEA 3ARZA 1K2DB 4D9RE 3MJ8B 4Y8DC 1II4E 4WW1A 1FZKB 3QNZA 3O4LA 5D7IA 4WUUD 4EUPB 5KW9H 5L2JA 3RTQD 3BEVB 2AK1L 3HPLB 4XCFH 4XPHL 5C6TL 4HZAA 4I3GA 5KVDL 4P3CL 1QPXA 1AGFB 4S1SH 4ZNEA 4OZFG 2L7JA 3H8NA 3HE6D 5KOMC 3TZVA 1INQA 2CKBB 3TO4D 5J8OA 2BDNL 4YPGB 4KKNA 4OBRA 4EEEA 4AQ1B 4PPTA 3BMVA 3HUJF 5EFIA 4Z8FL 1QSEB 1TZHA 3WFCL 2DQJL 1FN4B 3RI5F 4AMKL 1LEGA 4FTVA 1MF2H 1GGBL 4WY7H 4GAJL 3VRJA 5DRXA 3VDBA 5FO8A 3SDCD 1A0QH 1OGAB 1C8PA 1JRHL 3VWKA 4AEHL 2NY4B 1VEMA 3AM8A 1MJ8L 5J3HC 2JIXD 4FOMA 1J1OH 2ZZUT 4JPIB 3SJVE 1FCCA 4OZHF 3RUGE 3BPLC 5I71C 3LY6A 5HYIA 1A7PH 4MNGE 1VDGA 3BN3B 2DMBA 1FSKB 2Y9RT 3MCKA 4IIQB 5AYQA 3VA2C 3D85B 1CXIA 4LPCA 4IMKC 3KPTA 2XIDA 3BD3A 4BH7A 1Q9WB 4QLRA 3OR6A 5FHAH 1P4IL 2NNAB 4ZSOA 3CFBB 3B4NA 3PGFH 2VDQL 4XPGH 2AEWA 1RURL 1ZAGA 4L3ED 4L5FH 2VH5L 5GIRA 4NO3B 5T1LA 3VFOA 1NEZA 4X6CB 2CMRL 1RZKH 1F02I 5CUSH 2V6HA 3WJJC 3ARUA 1I7ZB 5D70H 3RZWA 5GGQL 4NKQB 3BKJL 1D5BA 1KCRL 2FHBA 4N5ED 2NY2D 1IGML 3DHMA 4JRYB 4OTXH 3AM8C 1I1AA 5T1DL 2A74A 4ERSL 4XRCB 2UY7A 1ZWIB 1GC1H 4Z7WB 1N2RB 4RFOH 4RFNC 1G7HA 4HCRH 3LB6C 3WN5A 5FYKH 3PP3H 5F3HA 3KYOB 1T66C 1EEYB 3OF6D 5C0BA 4WO4B 3OGOE 4ODUA 5C0FB 4J8RB 3V5DB 5KJRH 2OLDA 5F89B 3VGFA 3QUXA 1LE9B 5EBLB 2IQ9H 2V7NA 4HS3A 3D0LB 5FA4B 4QRPD 5CJ5A 1YEDA 5C0FA 3MLYH 1BAFH 2QQLL 2FDBP 2PF6A 3BD5A 5GGUA 5D7JC 2DQDH 4NGHH 1MAML 5I1LA 3SDCA 1CFSB 3BZFA 1JNNL 3S7GA 3V6OE 3DRQA 1YEDB 3QUMH 5EA0L 3MGAA 4YHIB 3V4UL 2V5MA 4NZJA 2HMIC 3SCMB 4H0GA 3BKYH 3ZE2E 3RNQA 4D9LH 3SDCB 3ZSTA 5CZVL 3C60A 2XTJD 3T1FB 2H6PB 5CKAA 3MNWB 5DD6A 1IQDA 4JEGB 1HQ4A 2ADFL 1I7ZA 1YECL 4KVNH 5DTFB 3RNKB 5E8OB 5C71A 4ALAH 1BREA 4PTTB 2EXYC 3IF1B 3BAEH 4GLRI 4WEUD 1KB9K 2EYRA 3VFGL 1MFBL 1PKOA 4LLVA 3H3PL 3KAAA 2CIIA 2CRZA 3GMNA 5FYJE 3FO9A 3MCKB 4IIQA 1SY6H 4WFFE 4WV1B 2QADD 3BHBB 4UUJB 4LOUC 2FX9L 2VAAB 4GT7A 4ZUTB 5I6XB 3FZUC 1P4LA 1Q72H 4LGPB 2EDRA 4MVBC 1WIOA 1QRNA 5EBMA 2F8OA 1ZGLA 4LPXA 2G60L 4KK9C 3KLHD 2FWOB 5I75B 1T1WB 3FO1A 3O41A 1YNLH 5C9KA 3JZ7A 3O3UN 1OF2B 1NCBL 1U8HA 2VDPL 3V0VA 5IHBA 4ODXB 2L7UA 4Z7QF 4I48B 1RUPH 2FBOJ 3QR2A 1FO0H 5D2NC 1QLFB 4DVRH 3WXWL 5EN2A 4K8RL 1UZ6E 3VXRA 2H9GA 3LKPB 2VITB 2BCKA 4PJGA 3EZJB 3REWB 3W9EB 5CGYC 1J5OL 4RMQA 1KBGL 4HK3N 4YDLB 3N1PC 4P2CG 2KH2B 3BP4B 4MAUL 3SDXB 4UILH 5DMKA 2WLYA 4ODHH 2Q8AH 4TUJA 3VWJB 5C09E 1TTGA 3D1MC 2RR3A 4PJ8C 3P11H 1S9VA 4AIOA 4NUJB 1DFBH 1DQLH 3OKMA 2GJJA 2J8OA 1YNTB 5IV2A 1J7VR 1C16A 5F1NA 5HDQH 4MD0B 3WUWA 2MQ3A 5B39B 1Y6NR 5HHPB 3H7LA 4NP4H 2GT9A 5FM4A 5JPMA 3L3HA 3HUJA 5C0IA 3BGFB 3Q6FA 3RY6A 2EC9T 2O5YL 3MLWH 4LLUA 1CR9H 1Q8MA 1U95A 1UWXH 2YD4A 3JVGC 4F8QA 4Q6IB 3C09B 4P2OA 3FZUD 3STZA 4AH2B 3B9AA 5HYQA 2XWJB 4EVNA 3AC0A 3QH3A 3MV7E 4FXLA 3QHZH 4WFHE 5BVPL 2DWEA 3MRKA 4J1UA 5C09A 2BZDA 4AG4L 5EWIH 5E5MA 5CLTA 3KJ6H 4MX7A 3S37H 1R0AL 5DD1L 4Z7VE 1I1FB 4DCQA 1AD9B 5KS9B 1KTLA 3K74B 5IVNA 5FYJU 2UZIH 2X05A 3THMH 1MHEA 3I6KA 2W9DH 3QI9C 1FFNB 4X80L 3VFPB 5KSAA 4F2MB 1WEJH 1IVLA 4PRID 4NHCH 4KHXH 4Z9KB 1ZA6B 3MJ7A 4OLXH 4A6YL 3N50A 2CRYA 2JELH 2Z4QA 4IRSB 3DI2B 4ZYKB 4QRTA 4KTEH 3EDDA 3QIWD 2XQYK 2OX5A 4L9DA 4OKDA 3V0WL 2QSCL 1I9JL 1SVZA 2BVUA 4I18C 5HHXL 1I8KB 2C3WA 3V95A 4Y1AB 2AK4D 4XVUD 2VQ1A 5I15L 3BWUC 1T7YA 2EDXA 5BS0E 3UBXA 1NAMH 3QG7H 4N90D 4BK4A 2DICA 1RZIA 3ARGD 4O5LL 2HFTA 3KPPA 4R0LB 1N59A 3MC0A 4JR9L 4PV9B 4XPBH 1YN7B 2YHGA 5DJDB 4AQOA 5J89A 3PIQB 3VJ6A 1JE6A 3FO0H 3LHPL 3STLB 5TJWK 5EU6D 4ZFZB 4MB4A 2VDML 1Z3GL 5DEGB 1ND0A 2R9HD 3HHRB 1NLBH 1X7QA 5INCA 3MRMA 1OGAD 2HT3C 5DJDA 3WHE0 5DRNA 2B1AH 5LBSH 5TE6L 3TNMA 1CFQB 3JTSB 3RRQA 1CLYL 5D96B 5IB3A 4U6VL 2VDNL 1IEAA 1P1ZB 5GJTH 1RZ7H 1DBBL 4MD4A 5FHBH 1JGLH 3T2PA 4L3CB 4KROD 3R8BB 2XNAA 4RX4A 3S36L 1CFQA 1C5DA 5DO2D 4EN3D 5DF0A 1KNOB 2F5BL 4R8WL 1BZ7A 2XRAH 3NGBC 4IRSA 3GRWL 4UI2A 5FF6B 4Z7NE 3DO7A 1TZGH 3NABH 4Z0BH 1C5CH 4JANA 3FRUB 3C60C 3WV0A 1J8HB 1UVQB 5EIVA 1AXIB 3UTTE 3OAYH 1WC7A 4MNGB 3O6FD 3GO1H 2VABA 3BDYH 4U1GB 5A40E 1FVEB 1HIMH 3IXTA 1BFOB 1VPOH 4ODWB 4L4VE 3ULVF 3KR3H 4QHUA 4N5EC 4YDJA 4EIGB 4X9IA 1NC2D 2OJZL 3KPMA 5KS9A 1T1YB 4LDLB 1J12A 1FG2B 4QXTB 3ZDZF 2GITA 3VXTB 2E8YA 1IL1B 3TC9A 3VFMB 3CSBA 2EDFA 2WIMA 4HPOH 1HHJA 1B0GB 2MKLC 3GSWA 3TIEB 5D1QD 4I0PA 4U1HA 3WFBH 2NZ9D 1GXEA 4QXTA 4S1QL 5B39G 5EUOA 3WFHB 3BT2H 4XC1L 1U8OB 4ONGL 4LSPH 5E4IA 4Y0GA 3IFNH 3ZDYF 3FQXA 3LKPA 3GZKA 4K2UL 2CK0H 2X42A 1MJ7L 3HE7B 3CFDB 4GW4A 1WK0A 3OR7B 4HZLA 4TUJB 3VWJA 2R4RH 2ZCLL 4RIRA 1RJYB 2X4UA 2KDGA 3F58H 1IGMH 5HI3C 4XP4L 1S9VB 1DN2A 3ROLB 5IV2B 2F15A 4P3DB 3QIWB 4TULL 1U8NB 3VG0L 2AEQL 3SDAA 1IM9B 3OJDB 1UWXK 4ZO8A 4YFEA 1GYAA 3AMLA 2EE6A 1LP9F 4EN3A 4X6DA 3VXOB 4GRWF 4NUGL 2VC2L 4IRSD 1DEEB 5CZXD 4X7SL 1IC1A 1BD2A 1N64L 1U8JA 4NQCB 1WFUA 4XTRC 2VUYA 4NDMB 5CJXA 3VMPA 3GMNB 2EKSA 2AK4E 5DYOB 5ILTL 3SKOA 2VITA 4U1JA 3GSVA 4JHZA 3HG1E 2ZSWA 3LQMA 4I2XB 4YBHA 1MAMH 2HTKC 2AK1H 4XCFL 5TFSH 1CL7L 5ITBL 1JNNH 4B7IA 4HS6B 1OF2A 3MLUH 3RGHA 1VHPA 3PGDB 4AEIL 2DRUA 4LU5H 1BHGA 3O8XC 5EU6E 2R4SH 1VACA 5I1KH 4PJ9B 4I8DA 5MEQA 4KTDL 1CWVA 1K5NA 2UWEB 2P49B 3TVMC 4WI3A 3DVIA 3JWDC 4BM7A 1GGTA 3EOYG 3T2NL 4UAOB 2MWCA 5C7XH 4LVHB 1UJ3B 3D3VA 4K7PY 1OTUC 2W0FB 1FPTH 5FUZH 1ITCA 2GY5A 3ESUF 4HGWA 4FQJH 1KN4H 2BMKB 1IGTB 4H8WL 5DI8B 4XB7A 5HGHA 5ERWB 12E8H 2VN7A 1CDUA 4JO3H 1VADA 4FTVE 3ARED 5A2JH 3SKNB 3FO1B 2V9RA 2HTKD 1KB5A 1INEL 5J1AB 4NDMA 1M7XA 1KTLB 1OT2A 4NO5A 3PGFL 4Z7WA 4DZBA 2BVTA 5JR1L 1X6NA 2BY1A 3ZHLA 5DJ2A 3MLXL 5IK3B 4ODVL 1F4WL 4YWGL 2P42B 4UT6H 4DKEH 1ZA6A 3MJ7B 4ZO6A 4D3CH 4EVNB 2DL9A 1GOGA 4EI6A 3IFLH 5EU5B 1ZV5A 4JJ5A 2QQKL 4NO0B 2LTQB 5EZJA 3WFBL 5DMIH 1WBZB 3HE7D 1K8DA 4CU8A 2D7OA 3O3DA 5T1MA 4WI4A 3U4EA 1CXHA 3VXNA 4JFEA 4N0FB 1KELL 4K7PX 3OAZH 1MHPL 3O4OC 4U6TA 2ARJB 2BFVH 4JHBA 4RZCB 4Y1AE 3MBXH 3BIKA 1G1CA 1N7MH 4Y7MA 5EC1A 4YXKL 4L4VA 1G7LA 3MQIA 2DLHA 3X3FL 2CO6B 4PRBA 4LLYA 4CN4A 5HVHC 4TUKL 4PV8B 4M6ML 5TDNB 1PFCA 2WWKO 1V3LA 2AABL 3OAUH 4X9FA 5MEQB 3ARDC 2JCCE 2W9LA 3OG6B 2OJEB 5TDOA 3IRPX 4FHBD 4XXCA 4DAGH 5FYJD 1A1NB 1LO4L 1FNFA 1Z2KA 2E7HA 1DANT 2DQGH 4M8VA 1ES0B 5CAYB 4M1DL 4NNPH 1A4JB 4JO1H 4YO0B 3CPLA 2XA8H 3UYRL 1FO0B 5F9JA 1KCLA 3ULVE 2Y23A 4K3DL 2F8XC 1JWSA 4PGDA 3O11A 5IW1B 4WTZG 3O2VH 5BRZD 4Q97A 3P73B 4P57A 1QPPA 1IC5H 4L4TA 2X4OB 3H3PH 2E7LC 4FG6D 1MI5B 3QNYA 2JLLA 4PJDE 1T1XB 4L8SB 2NPLX 3DMMB 5JXAL 1FNSL 3QUYC 2YPLB 2FGZA 2D9QB 4GW1B 5CD5D 1PEZA 3QDGE 4JLRA 1EO7A 3J8F7 1W2KT 5F7DB 1IC4L 5MEPB 2MMXA 4PJDA 3IU3B 5GGRA 4NKIL 4OGYL 4DN3H 5JW4M 1I9JH 1I7RB 4JFPB 1EGJH 4IDJL 5C0BE 3CFKB 5D71H 3W0WA 5ITFB 3VFVA 2GCYB 4NQVA 4FQLH 5CEZL 2CQVA 2R1WA 3IT8D 4RGND 2GQHA 1OGAE 4UDTB 2NXZB 2AJ3A 1OSPL 1ZANH 4L9LB 2VZOA 1QA9B 3MODL 4P5TB 5JUEH 4MJ4A 1UGNA 4FQ2L 3KXFE 2ZUWA 4HMCA 1U58B 1J0ZA 3U30C 1NCUA 1Y18A 3QEQD 4PJFF 1EDQA 3ILQC 2FEEI 1ZHLB 4MDJA 2HVJA 3HI6H 5I1CL 2OCFD 3K8MA 3G9VA 1RZGA 5TE6H 2IGFH 5CJ8A 3UROR 4JQIH 5D1ZD 1HQRB 2XYCA 5J1TC 5IK3A 5TE4L 3PQYA 1M71A 5I30H 5E95B 2WM0A 3CDGA 1I1RA 3H9ZA 3PG2A 5IVZB 4XB8A 3U0WL 1J18A 1QRND 1BIIB 3S35L 4UT7H 1MCFA 2ZPKL 4U6XA 3S5LG 3IDMB 4MJ6B 3EOAB 4FZEH 1NC4D 4OLUH 3QQ9C 1MCIA 2BNQB 1FNEB 1DBKL 1U8KB 2YUVA 3KS0J 4U6VH 5DJZB 3DROB 4Z0XA 1R24B 3S4SA 4P5KA 4NFCA 4KROB 3I75A 4N0UE 4XNMA 2VLJD 3RHWK 3CXDL 4WIQA 5F9WC 4IM8A 2HRLA 4GG6E 4L4TB 5C0DB 3MO1B 3TT3H 1ROWA 2R0KH 2DQFB 5DHVH 3VXUD 3CK0L 4QRSB 2DD8L 2X89A 4ETQA 4Z78A 4FN0A 5GGVY 4GW1A 3ULUD 5EU6B 2YD6A 4HH9B 3MV7D 3R06B 4JKKA 4EBQL 3RVXD 2VR5A 1ZTXL 3HS0A 2MCPH 3HZMB 3HFMH 1G6RL 3T08A 1ES0A 5TPWH 3T09A 1NCAH 1FIGL 3TF7C 1Z9LA 5IVXF 3ZLQC 1RJYA 3OQ3B 3MV9B 3RWHA 2DYPB 1JGLL 4AT6B 2X9WA 5D7JA 2MKWA 3QB7C 2IJ0C 3LDBC 4WFGD 2R56H 1A7PL 2DLTA 1F4AA 3HMWL 5SX5H 4TQEH 3W5MA 4JKMA 3RX8A 1XH3B 3VFUB 4JY6A 4XBEL 3W39A 1ZHNB 2MFNA 1P7KB 4V2BA 1EO5A 4NNXB 3U9PL 2J1KA 5C0AE 4V1DD 1NUFA 1TDQA 1QRNE 3FJTA 3FFCE 4G8GE 3ZKMC 1RUMH 1CXFA 3MBEA 1NSNH 4QCIA 2VR4A 4Y5VA 3S4SB 3P40A 1AO7A 1KIUA 1MWAB 5I0DA 4HC1H 3DECA 1MFCH 4GXUN 5I8CB 5FK9B 5LGHL 3BRDA 2BOBA 3KR3L 1N6QL 2COQA 3F8UB 4M5ZL 5F3BA 2VKWA 4BFGA 2XZCH 2HG5B 4R3SB 4HIXH 1TTUA 4P9MH 2B0SH 1MNUL 4U0QB 5CKGA 2EDQA 4NKOB 4MNQA 4OQTA 2XKSA 1VGKA 1BFOA 3BW9A 1FAIH 3QZWB 3P77A 4WCYL 1DBJL 5IFAH 1ORSB 1BVKA 2DQEH 4KUZH 2G9HB 3SQOL 3B8YA 3RWDA 4KK5C 3NTCL 4JDZB 4KRNA 1YC7A 3QHFL 4M7ZC 3IRZA 3QIUC 3QIWA 3L3OB 5J06A 2O61B 1NCDL 3R0MA 4OAWB 3GUTB 4ZFOB 1BAFL 3RVVC 4E9LA 1BLNA 4UNUA 4ZPVA 5I16A 1WAAF 1T22A 3OHXB 4TVPH 5DSCB 4O02H 3V8OA 4WEBL 1UCBH 3S3JA 1L0YA 1YYML 4JZJA 2YD7A 1KF9B 3GMOB 5I1DA 1WF5A 2IBGA 3PWJB 5JOEA 2BY2A 3AS0A 3S5LB 2O5ZH 5L7XH 4KUZL 4DK3A 5T5FL 3C8KB 5IB5B 4NZTH 4P2QD 2I5YH 5DURD 3OKOA 5HHOD 4MZ2A 4BJLA 3SDXA 4U0RB 1BQHA 2BSTA 4GBXC 5SWSB 3RGVA 4KXZI 1KNOA 1UWGH 5GGVH 2YKLH 4PJ9A 3DX6B 4FQHB 3X14A 4WO4D 1OLLA 3R8QA 3TN0A 4OF0A 4XBPB 1K5NB 2DKSA 5DJ0B 4G9FA 3QUMA 4PJIE 4FQ1L 3BVNA 4ZXBC 3QWOA 5AUMB 4YHML 3A6BH 4L8SA 4P2QE 5B8CB 3CXDH 5IG7A 3KDMA 4FFYH 3DURB 5BJTB 4DKAA 1UCBL 3MRNB 5JOFB 4AIZA 3GBNH 3UPRA 3HCVB 1MH5B 5JHDA 2JF1A 5E6YA 4U1LB 5DD0H 2Q86B 2DI7A 4MD5A 1YEIH 5JXEA 1AE6L 3DIFA 3UJTH 1HYRC 4JFQA 3U79A 2CPCA 5HBBA 5E2UL 1OQXA 3BPCB 5EU7E 5GGSB 1SQ2N 1ZTXH 1A6WH 5HYEA 1OOAA 4RRPG 1N5YH 4U1LA 4JM2F 3WFEH 1JTPA 3BKML 4KVCL 2JB6B 3PXJA 3WIHH 3RUGA 4WO4C 35C8L 2A0LC 1LEIB 4OGXH 3CH8A 2DJUA 3P4NB 4G8EA 3TO4B 1CTOA 4MX7B 1CGYA 5T5NF 1U42A 4HAGA 3QUYD 2AQ2A 4Y19A 2VISA 3O3AA 1EBAA 5D7LE 1QSFA 3WDIA 5BRZB 5IF0A 4H8WC 3I3EA 1CLZH 4Z5RB 2ENYA 3TA3C 1KPUA 4RAHA 3UJTL 4HJGA 4HIJB 1FO0A 3FOLB 1ZT1A 1MQKL 3E2HC 9CGTA 5EZLA 1OTSD 1JK8B 3SCMD 1OY3B 3PWLA 4JAMB 5E6ZA 3EDFA 4IRJD 4NCDA 3GMPB 3SDCC 2DMKA 3KYKL 3OHXA 4DUVA 5IG7B 5DZNA 5HHOA 2GT9B 3DTXA 3QUXD 4R2GB 4M6AA 4J3OC 5FGRA 5F93C 1QR4A 4N8CL 1ZHKB 1QEWA 2XZZA 1RAMA 2VJXA 4MHHG 4FZ8L 1Q9KA 5JW5A 4RFEB 2HH0H 3Q1SL 1A4KA 1P84J 4POYA 3RZCB 1JWMB 2PYED 1ZLWK 1ZHKA 4IOIB 5IMKA 3S97C 4L8BB 5IB2A 5DMKB 3T04D 2BNRB 4ONOA 1XGYL 5GISL 5J56B 1K3IA 3WUWG 3RWDB 2X4SB 4IOSD 4KKBD 4ELME 4RFEA 4JFOA 1RU9L 5FDWB 2BFVL 1IM3B 2MQCA 3G5VA 4NBXB 3QAZC 4R4FL 4XCEA 2HFEB 1T83C 2FR4B 4CW1B 2OQJA 5JR1H 1M4KA 1W72H 1AJ7L 2DTMH 3H42H 4ZUSB 3VXNB 5GSVB 5LAXA 4F33A 5DA0B 1EX0A 3UJIH 3ULUE 3B6SA 5ISZE 5LXGH 3GSQB 5AWNH 2KZ1B 2HFEA 3F12B 2ITDA 4Q2ZB 1LHZA 4W6YB 2Y72A 5F3BB 4TTGA 1KGCD 4CUCA 2R8SL 3WXVH 1WJ3A 1R5IA 4OCYH 1QKZH 3QJFB 4N0YH 3HI5L 4MQ7A 3QUYA 2V2TA 3ULSB 4X6EB 4M1DH 4NNPL 1E28A 2CO7B 4MXWL 3ECBB 3GMPA 5D7LB 2E7LA 2F8VA 4PJAE 3GSRB 3VWJC 4FMKA 5T3XE 1KB5B 3M8OH 1IAIH 4OCSL 4W4OA 5FGBA 3DBXA 3NIDE 3T8XB 5A43C 5KVFL 3MZGB 4PB9L 2Q20A 1LO5A 3L6FA 5BJTA 3ARRA 4HXBL 2VLKD 2VXSH 3E6HB 5FK9A 3WHXB 1FNSH 4C4KO 5HGGS 1KEML 4B53A 5BZWB 3UC0L 5CSZB 5EUOF 1K4CB 4HEME 4BH8B 3CC5B 3OJVC 3VW3L 2IFFL 1Z9MA 3HR5A 4OZ4A 3S4SG 4OGYH 5MI0B 1EZVY 3QCVL 4KKCD 5ACZB 4LKCA 1D5MB 4PJGE 4UIMB 3UYOD 4Z77B 1MCQA 1QLRA 4U49A 3NGBB 3HLAA 5I1LB 2DQCL 3NACH 4LASL 4HK0A 3MFGB 3T0VA 4CVZB 5IJKC 3AROA 3RTQB 3S35H 3STBA 2GY7B 1DL7H 1JHKH 1T21A 3VCLA 2A6DB 3L5HA 1NMAL 3HE6B 5CZVH 2ZKHH 3LOWA 4YLQT 4ENED 3CZJA 1A21A 4LLWA 5DXWA 3T1FA 5LGJB 2VOTA 3HS0B 1A7BA 2K1MA 3C6SA 1IQDB 1O0VA 4Y8AA 5MHSE 2DM2A 2VLLA 4PJ7F 2GW5A 4GAYA 2F53B 4XVJL 1ZHBB 5C0BD 3WO4C 5I71B 4ZO9A 5HYJD 3HI6L 2C4FU 5DT1H 2ADJB 3FONA 1TPXC 5J7CC 3NIFF 2CDEB 4XAKD 3VDCA 5IKCB 4LLMB 3MBXL 2I9LA 4PJXB 3ARTA 1M7DA 2R1XB 4NKIH 4XXCC 5D1ZC 1G7MA 3SKJH 1LO0H 4XMLL 1WT5A 2ICWJ 3H9YA 3GBML 3JV0A 2CDGB 4MJ5B 5MEOB 3L3GA 2HVJB 3LS5H 5AYUH 4GRWE 3EFDL 4NQTA 3SGEH 2FGWH 2B4CC 4WGWB 1A6ZA 1B6DA 4X5XB 4G8IB 4X4ME 5MEND 4U1SA 5BQ7B 3Q5OA 1LE5A 2XPGA 1JPGB 5HI3D 2NQCA 2QJDA 4Z7UF 2BJML 5F7YC 5IR1A 4ESKA 5H2BB 4F7MB 3NBNA 1T2QH 5FXCH 2DIJA 1P5VA 5D2NA 4R3SA 3GI9L 1NEZG 4DQOL 2BNQE 1T4KB 3CDCA 3EOBB 2PCPB 2R15A 4H5SB 4JQXC 5DS8A 5L2KD 2BC4A 3V4PL 3JBG7 4RFNB 2XWBA 3SHSA 4QHNB 1U93B 3KYNB 4FXGA 4LCCB 1RIVH 4FABL 4DK6A 2DTML 2DKMA 3PJSB 4L4TD 4O00A 2QSVA 4FQQB 5BVJB 1YMME 5IIEA 4R7NA 1BVKB 1NCCL 3MRIA 1FQ9C 1IL1A 4GBXA 2GYSA 4ZQKB 1RIHL 5E2WH 5D1QC 1B0GA 4IRZL 4K9EH 4QOKE 4OIBA 3D39B 3BH8B 4B41A 1EK3A 3FAXA 5LGHH 2OMNA 4HV8B 4H25B 5DMGD 3KLDA 1Y6KR 2XKNB 3FB8A 1UENA 1VCAA 2P5WB 1H0DA 4NP4L 4OLEA 1MFDH 4HSQA 1Q0XH 4JRXE 3TZVB 4NPYB 3BIBX 1A2YA 1J8HD 4HH9A 2ZUSA 3NA9L 3KJ6L 4OZHB 3SCMC 5HHQB 5D71L 7CGTA 3O8XB 4V2CB 4WHTB 1UH4A 2X70A 4EUPA 2NR6D 3O6MH 2Z8WC 3TA3D 2P8MA 3EO1A 2W91A 2A83A 2E8ZA 1T7ZA 2ZSVA 4ZFFA 4LEXL 4JPVL 1JV5B 3QIUA 3DYOA 4X6FA 1D5XB 1AI1H 1FDLL 5IESH 2AXGA 2UY6A 4LLVB 2IPTH 2NY5L 1UJ3C 4U7SA 2AEPL 2EYSA 3TT1L 3WBDA 2R29H 2VAJA 4GG6F 1QSEA 1TZHB 3S96A 1D5XA 2WV3A 2WMPA 2XN9A 5IROA 3UO1H 2OTPA 4TSCH 3BP7B 3UTQA 2VDPH 3GHEL 4RISL 5HHNB 3FKUS 3O9WD 3IDMA 4R7NB 3RNQB 1KTDB 1AGDB 3V6FB 5EG6C 1JYWA 5FYKE 2AS5M 3BQUC 4L1HA 3ORJA 1BOYA 2DQIH 3NCMA 4F2MA 3ARGB 4ODXA 2DS4A 3BIKB 1F6AB 5EU3B 1KCUL 1QYGH 1HI6B 4MSWA 4NT6A 3CU1A 4QKXB 3HE7C 5IR1B 1UC6A 1RUAL 4PY7B 3TBSA 1KBGH 5D2NB 1C5BH 1NGXA 3V4VH 2GSIB 1A7NL 2V9QA 4WRLA 2IMNA 2ARWA 5TDNA 4JFDA 3CLFH 5E5MB 4BQ9A 4PJ5A 5TGBA 3L5XL 1MPAH 4PGBA 3R1GH 3DRQB 3QIWC 3ARFA 5BZDB 4M6NH 1SJXA 2RQ8A 3QDJE 3PJSA 1IGJA 3QIBD 2I26N 3E6FA 1IEBA 1G7HB 2CSPA 3KLAB 5GRVL 4J6RL 1FFQA 3FAWA 3C08H 2HTLD 3EJYD 4WWKD 5TE7L 2XFXA 5IWLC 3WFCH 4M43H 3QUXB 4R2GD 2C3XA 1T22B 2MPAH 1NLBL 4CN1A 3EYOA 3TA3A 4KK8D 2C3VA 4WFHD 4X4XA 2X4NB 1SEBA 3C6LC 1T0MA 2E27H 5E99L 5FM5M 2XXCB 4QHKI 2Z8RA 1JGDB 4HGKC 1NCAL 4WUUA 4PJXF 3NPZB 3GI9H 5CSGA 1G0YR 5I17A 4Q6IC 3QH3B 4NQSA 3QDMD 2B7DT 1ED3A 3B43A 3VD3A 1TNNA 5IT2L 4ELMB 3SE3A 2R2EB 4JM2A 3BZDA 4DN4H 5CD3A 5DUBA 4QOKD 3AS2A 1X5FA 4F3FB 5D9SB 4UAOC 4LVHC 3IJHA 4Y4KA 5SWQA 3IDNA 4N9OB 1G6RB 1S7SA 2XTJB 3PL6B 5E8NA 4HLJA 4LLDB 4JVWA 1N5YL 5DVLA 1RZKL 5GS3A 1QA9A 4RBPH 3V7AE 2J12B 1DVFD 2FEDD 1FIEA 5BCAA 4YR6B 4QOKB 5GIRB 1T80A 4L8SC 1A7QH 1ZE3C 1N6UA 5GS0H 1RK1B 5IHZA 1A3RL 1ZVSB 4GLRH 4L8CA 3ULVL 4I18A 4IRSC 4MAUH 3H9SD 1SMAA 2E5EA 2AJSH 1NGWA 2AV7A 5E00A 4PRHA 1XR9A 1CZ8L 4OT1H 5CINL 2UWEA 1JPFB 1OAQL 2YPLA 4I18B 2GAZB 5D8JH