2F9BT

Discovery of novel heterocyclic factor viia inhibitors
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
200
structure length
149
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGDERTLVRRNNTFLSLRDVFGKDLIYTLSVQAVIPSRTVNRKSTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/blood clotting
molecule keywords Coagulation factor VII
publication title Discovery of novel heterocyclic factor VIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 149
sequence length 200
ec nomenclature
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f9bT00
3ARVA 5BV7B 3TO4C 4FG6D 3RVXC 3F7RA 4KKLC 2G5BB 1PDKA 5CEXB 1CLOL 3DVNB 3U7AA 3L5IA 4LCWD 4NCDA 3TLRA 5F96H 1HHKB 3UMTA 3DROA 1KJ2L 1WIUA 2DMKA 3DLQR 3MRLB 3HZVB 4L4TA 4M62L 3B2VH 3T0EE 4PFEA 3GMOB 2EC9T 4I8DA 1QFWM 1QLFB 3LQAH 8FABB 3GK8L 3EJYD 4P46A 2DQFA 5HYJE 4R4NC 4DOHE 1TXKA 2Q86B 3VG9C 1VFMA 4ENED 1EEZB 4KI5C 4WNQB 5KSBF 3IKCA 2VXQH 4KAQL 5EO1B 4LVNC 3DUUB 3S96A 4MB4A 4JDTL 1G6RA 5DS8A 5D1QD 5IMMB 3PHOA 4KV5F 2J3SA 3T3PF 2Z31D 3MOQA 5DRXB 1AFVH 1MFBH 2NW2A 2HVKA 5I9QC 4PRDA 4RDQG 4RMTA 5GSRB 1JPSL 1T83C 1EBAA 1PKQA 3WFCH 4DGVH 3RDTC 3T0EA 3QIBB 4C54A 3PWUB 2H3NA 3IU3B 2R2EB 3V8OA 3VXUB 2NY3B 3FN0L 3BZDA 1IAIH 3GMNB 2EDWA 5T1KB 4ODSL 4GS7B 5MI0C 2IANB 1QSVA 3DPBA 3P4OB 4QF1A 1U3HA 1BVLA 3VFMA 3U4AA 1S9WB 1ZANH 2OR8A 2VAJA 1RUPL 5DTFB 6FABH 1MCDA 4PP1C 5FO9B 4LF3A 5IW1A 2EDXA 5L2JB 4O2FA 4JZOB 3QNXB 5INDA 1S7TB 3S3JA 3PNWB 4P5TD 3GSNL 1S7WA 3F12B 3DMMC 3EJZD 4O02H 2NR6C 2ZUQB 5CEZH 1NBZB 4GRLD 5GRVK 2OCFD 4KK5D 4TYUA 3SBWC 3H42H 5LAXB 5CZKA 3PQYA 3FN0H 3D85B 3VWKD 1I8KB 3QRGL 5IVNA 4O2EA 3GM8A 4N0FA 1GCFA 2QL1A 2WZPD 1OSZA 3S4SA 4KKBD 4ONHB 3F6LA 1KT2B 2DQJL 3KNBB 4OZ4B 1CICC 4Z76A 1QHOA 3TGXA 1QSFB 4TNVF 2JJSC 2A1WH 1YY9C 2OZ4H 3MGOA 4X6CA 4ZD3H 4JFQA 1Q1JL 2WBJD 3DGGB 1FVEB 2BY3A 1Q94B 1RZJH 4Z77A 3ROOA 4G42B 3QUZD 3O4LD 4X6FA 1ZVSB 1T1YA 2FSEB 3FT2A 4JQXA 1MRCH 2X4TB 3VD5A 3VXNB 5HBBA 4UILL 3ARDD 4XBGB 4LNRA 5FUCC 4C56B 1IILE 4LCYA 3T65A 3SJVB 4PLKD 4NGHL 1R3HA 3V5HB 2O5YL 2LQRA 4MCYB 1ZHKA 2NXZD 3U9UB 2VH5H 4PJFB 5ANME 1AY1L 3CFDA 3WDHA 2ZUWA 2QQNH 5FCUH 3TN0C 4U6YB 1QYGH 4JLRB 3T77A 4QRPD 5AZ2H 1DFBH 1YEFL 5JDJA 4PLNC 1SVZA 2GJ6E 1VESA 2B4CC 3T09A 5HYEA 4EXKA 1FC2D 1JTTA 1MCHA 2W9DL 4UIKH 3C6SA 3WE6A 3CU7A 5D9SB 1OAZL 1DR9A 2EDJA 3GGWA 3I75B 2W91A 1EGJA 4YGAB 2XN9E 2PTTA 2D03L 5T3ZE 4O9HH 4ZO6A 3VJ6B 1X5XA 4BH8A 2O5YH 3KAAA 4ZO7A 5LGJB 1BD2A 3RZCA 1RJCA 2CDEB 3CSPA 1AY1H 1DJSA 5DO2C 3CSYB 4JFPB 1S8DA 1Z9OA 3L3KA 4GBXB 2X4SA 5GRJL 1HH9A 2GJ6A 3WD5L 2W0FB 3FB5A 1YYML 4YH6A 2P8PA 1UZ8B 3DV6A 4JJHA 1TQCC 5DT1H 4K94H 2VR4A 5F9WC 3U30C 3MRFA 1GGCL 4PJHA 3BKYL 3S5LA 1R0AH 1TPXC 5ID0A 5IMKB 4XCFH 2FEDC 2HJLA 2YC1B 4KJPC 2Q1EA 5EO9A 3CFJB 5CKGA 5SV3A 1T7YA 3FO0L 4CN6A 4JHBA 2XN9A 3PDOA 3QDHA 4PJ7F 4DQOL 4DUXA 1F58L 4Y88A 1GGBH 4AK1A 1IGJA 4AT6B 4WO4B 5H37H 3NFNA 3DVGA 3OGOE 1FDLL 1AC0A 4OB5H 3BDXA 1IGYB 3O8XB 4QNPE 4WFED 3VG0L 4PJ9C 2I24N 3AY4C 1EVTC 2VDKH 2UVEA 4XXCC 3O2DH 3G6JF 3KHQA 4DAGL 1YYMH 1T0MB 3MV01 3RWDA 4KHTL 1YPZB 5D1XA 5ICYA 1BFVL 2NLJB 3OGCB 2P5EE 1RURH 4XZUB 4E5XB 1T22B 1RMFL 3DXAB 3MLSH 3WLBA 4J1UA 1MJUL 3TZVB 2C4FU 3FFDA 5BZWB 3GO1L 5F3BA 1HWHB 1D9KC 3T1FB 3BP4B 4HGKC 5CLWA 3BDYL 1AE6H 5DJXA 2B7DT 4HXAL 2EDTA 3KPNA 5HPMB 4Y8AA 4HIXL 1BREA 4AENA 4GXVH 3WIHA 1UXSA 3JV4B 2BXYA 2DI7A 2AS5M 1OPGH 4JGJA 1TCMA 5MHSD 3VG0H 1F4YH 1OAXL 4G8IA 1DBAL 1XFPA 4OGZA 5D5ME 1DN0A 5F1KC 2WINB 1YEJL 4N8VB 3SDCA 1U8PB 3PGCB 4ZPTB 1BFVH 2BRRH 4RGMC 4LHJB 1EHXA 1RMFH 1IQDA 4KPHL 1I3GL 3WBDA 1IL1B 1MJUH 2DM4A 3IVKA 1U8IB 3BQUA 1TJIL 3MRCA 3WL9B 4LHQB 5L88L 3BDYH 3ULVE 3CFBA 4TOYH 1NLBL 5DHXB 1WZMA 4CVZB 1KLUB 5LKNA 1ZLSH 4PJGB 3KLHC 4HIXH 3REVA 1UVQA 3FN9A 3Q1SH 5DMJB 1F45A 2QR0B 1MLCB 1DLHB 2HKFL 1EAPA 4JY5L 1YYLH 4F7MB 1J9CT 5D5MA 4WTWA 2P24B 5DJCA 3QDGE 1OAXH 3ZDXE 1LEIA 3UTZA 3THMH 5F89B 3RNKB 4XMKL 3H9SE 5INCB 5IGXH 1WFNA 2YD1A 5J1AA 3N85L 5L6YH 3QDJD 3Q2CA 1F3JB 1IGIL 5KOMC 1AQKL 2NY5L 4OF0A 3QT2A 3TBYA 4KPHH 5ID1B 1I3GH 3WHE1 3RWIA 3C6LD 3BXNA 1I9RH 4JPVH 2IQ9H 5D6DC 3MV7E 2RHEA 1NLBH 1J87A 2DDQH 1DE4B 3SO5A 1NBVH 3CH8A 1XF5B 4LCWE 5FUOH 3TIDA 4OZIF 3SN6N 4X9BA 2Y9RT 4GAGL 3IXTB 2ITDA 3QDGA 2WWMD 3EYQC 2IPUK 3L3JB 4EUPG 1G7JB 1BAFL 3MJ7A 1VFBA 3HMXA 4H26B 4JY5H 4G7VL 5EZIH 5JQHC 1D5XA 3QDMD 1OGTA 4BA8A 2K7PA 3EYFA 1RUKH 1AH1A 1G7IB 2X7LA 3GMQB 4FRWA 2FGWH 3E6FA 2PXYA 3SDDB 3QAZB 2WLZA 5I1AB 5ITBL 2D0GA 4KDWA 2XPGA 5GGVH 2RBLA 3U7WL 2HN7B 1RZIB 4YBQD 5ETUA 1KENL 3TBTB 3MNWB 3QUMB 1CFSB 2AJYL 1R3JB 3L3DB 1SMOA 2XG4A 4K9EC 4LIQE 4MMZC 1OAYL 3C5ZC 3OAUL 4NKMB 4ZS6C 4UTAL 3RPIA 2H1PL 1ZHLB 3NABL 4LCWA 5J7CC 3RWEA 3MA9H 2Z35B 1MVUA 3E3QC 5D71L 1HHJA 15C8L 5KJRL 2B8OT 1MFCL 1TJHL 3I84A 4L4VD 1M7IB 1YPZF 1ROWA 4Y2DD 1C7SA 3ARBB 5EUKA 4Z95H 2IH1B 3CC5A 4ZDHB 1BAFH 3BEVB 4NZRL 1WC7B 2R0WL 1B0RA 3HNSL 2EH8L 2VKWA 2YPLE 1E6JL 2V5RA 4RGNE 1QVOB 5E8EA 5F7FA 1BJ1J 2HP4A 1AO7D 4NO5A 5FXCH 4N90E 5D1QA 1R3KB 1IT9L 3O3DA 1MCPH 2NXYB 2Z31A 2F53B 3EAKA 1KENH 2BVUA 1IC4L 1HXMA 4KMLB 4B50A 3OKEA 4WV1A 4KJWD 2IMMA 1BJ1H 4GJTB 4GKZB 1KJ3H 1I9EA 2X05A 2PCPB 1ORQB 5F97E 2APFA 4ONGH 1Q9OB 1CGYA 1FE8L 1HCFX 4M7JL 4G6AC 5ISZB 4OCMC 3ZE1F 2A9NL 4C59B 4CJ0A 5F7YC 1I3RB 4GRMA 4D0DB 4QYOB 2AJSL 1OOAA 1VFAB 2RAMA 1INQA 1EGJH 4NQTA 3A6BL 1JWSA 3NPSC 1E6JH 1A4JA 4UV7L 5EPMA 2DJSA 3PE9A 4RRPA 2P5WB 4NKOB 2Z91A 1QBMH 2ICWA 3WYRA 5C0BE 3HUJF 1HNFA 4U6XA 1YN7A 2DQIL 4AEFA 4P2QE 4P5TA 3PV6A 3KPRE 2I9LB 1TTFA 1LO2L 1WIPA 2WIIB 12E8L 3CFIC 3OKOA 5KAQF 4GRLA 3FB6B 3WMSA 5FO8A 2F5BL 2H2PC 4JAMB 3BZFA 3K74B 4YXKL 1NKOA 1TVBB 1YY8A 1HI6B 5CJOH 1RY7B 1UM6H 2OS7A 1RK0B 4UZGA 1LO4H 2NY4B 5CD3A 1T7VA 4JKKA 4IIQA 1N8ZA 3GZKA 2A6DA 3QCVH 4JO4H 1TZIB 1UZ6E 3F5WA 3SO3B 4DZBA 5JR1L 1NFKA 2VDQH 4ZFGL 1RJYB 1MFAL 1Q72H 1KN4L 4QRPE 1AI1L 2WBJA 1CXEA 5IB2A 4NRYA 4YDJA 3QUZA 4KKLD 2J8OA 5BMFL 2YN5A 4H1LH 2DQIH 4P4KA 1XGTB 2ZNXA 3B5TA 4FMFA 3QIBD 3VXSE 4FQQA 3GUTB 3QUKB 1WVZA 2F54B 3VXUD 3DO7B 2FJGA 2A77L 2V2TB 5GGVY 3NPZB 4L29B 4YZFF 1JIBA 5I73B 4QHUB 1FAKT 1JRHH 4EEEA 1EX0A 5BW7A 4H8WC 4HH9B 1G9NC 4IRJD 3OAZK 3TH2T 3QXDB 3M17A 4YXKH 3PWLA 2IAND 1H5BC 2GSIA 4ODWA 1YECL 4NNXB 5T1LD 2R1XB 1T1ZA 2PR4H 4X9IA 2BVPB 3WIHH 3QZWG 4KZEL 2UWEE 4QRPA 4GG6F 1YMMB 2CO7B 2CK0L 3LQZA 3D3VB 2X4RA 2PETA 1NC2D 5JR1H 1OAKL 2EDRA 5J3HC 5FECB 1CFBA 4CADB 4ZFGH 2R1WB 5ADPH 1MFAH 3FQXA 4OI8A 5I1EL 4LPWA 2PYED 5DMKA 3PWVB 2FX7L 5BRZB 1AGDA 4QXUL 5I75B 4DKFH 3TEUA 2QKIA 1QQDB 7FABH 3AUVA 3EUUA 4F9LC 4Z6AT 4RBPK 2KZ1B 3ABZA 2E6QA 3S37L 3RDTD 5I1LA 3S3SA 1FLRL 2R4SH 4PJBF 2RB8A 3RHWK 3HCVA 3GFUA 1CFQB 4XP4H 4MA3B 4OSUH 1TTGA 2R23B 4IMLA 4HK3J 5J06A 5CINL 5EBLA 3RI5K 1N5AB 2BVEA 2JIXB 2EZ0C 4JHAL 3A6CL 3OX8B 3VA2C 2EDOA 4XMPL 1PG7W 1KXTB 4R97B 4KDVA 3C60C 5FYJD 4BQCA 5C6WH 2B1AL 1LO3H 2D4DA 3TP4A 5FGCE 1M05A 5FGBA 4LFHD 5IJKA 3G6AB 5DLML 3DX6B 1S7SA 1H3PH 1KIRA 1N59A 3CDGA 2IBGA 3WFBL 1IMHC 4NQEB 5I1KH 3BGAA 2HRPH 4QXGH 1F13A 3ULUE 2VAAB 4JVWA 4Z18A 4X4YB 3SY0B 4C56D 2FYYB 2NR6D 5EU5B 4F33B 3ULVH 3MRJB 4F9PA 3H7BB 2EIZB 4KVNH 5I1CL 4HWBA 3L3HB 4DN4L 1TJGL 3QH3A 4HMCA 5EC2A 4I13B 4NIKB 1RHHB 4ZO8A 3MV11 1KCVH 5KSAB 3VD9A 1A1NA 1MWAA 2GCYA 3EJJX 3CDCA 3CPLA 1CICD 3HE7C 2JCCB 2BRQA 3VMNA 5HYSG 2WM0A 4YHML 5HI5C 4HQQH 5KVFL 2LVEA 1YY9D 2VZTA 4PV9B 1BBDH 4AIZA 1KB5B 4F58L 1BPVA 5F93C 4Y4FD 4E41D 3QUXC 3FQNA 3PV7A 3B8YA 4MQ7B 3X11B 1FORL 1PYWA 2JK5A 2NCMA 3FOLA 1FZKA 3LH2L 3BMWA 5DLMH 3BRFA 2XTJC 3G04B 5CJXC 5B8CA 3UROR 4ODVL 1UH3A 3FOMB 3WNLA 2XKSA 4QRRB 1IGCH 4L8DB 1P7QB 2FD6H 3BN9D 5J8OA 3R1GL 3ZO0A 3ARPA 4QCIA 5CLTA 4Q7DA 1NAMB 4FTVD 1NCAH 2GY7B 5E6IC 4ZFZB 2EXWD 5I2IA 1RV6X 4JFYA 4IBLT 4NQDE 4LU5L 4X80L 1EERB 1KEMH 5FHAL 3ALWA 5K9KB 4EN3A 1I8MA 2J7LA 4I9WD 4TNWK 1F4AA 3OR7A 4R4BB 1KEGL 2EDDA 2X70A 1YEEH 4WRLA 4LAQH 2JKXA 3TWCL 5F71A 1JI1A 1WF5A 4CMMB 5DJAA 1P1ZB 4NQCD 4ZYKA 5F7DA 2W0PA 2DD8H 4MNQD 2NTFB 3MLRH 1CVRA 3QDJE 1IKNA 4KTDH 3SCMD 5KSBE 5TFSL 3RWCA 3RL2B 1ZMYA 3V0WH 4OLEA 4MS8D 1FG2A 3U0WH 4DGIH 1RVFH 3ROLA 1IGFL 1LK2A 5FCSH 3WEXB 4EKXA 1ONQB 2YD8A 1NFDA 3T3PE 4YLQT 3Q6FA 3DO3A 4NQDA 3C5SB 3ZSSA 2AI0L 4BSWA 3O8XD 4MXQD 3RKDD 1U8HB 4OZHB 4PJ8B 3KPTA 2X89D 5JOFB 2G60H 3S7GA 1WFTA 2AK4B 3P0YH 4FZEL 5CIPA 4WHYH 3JSSA 2R1YB 4ODUA 4X80H 3LKSA 4X7TA 4POZC 5H2BA 3HN3A 2NY7H 1QKZL 1Z0NA 5CJQH 1I4FB 3C9NB 4DUWA 3I6LD 3QDME 3QPXH 4CMHB 2CJUH 3QDJA 4Q9QH 3DXAD 2ICWJ 2DI9A 5IHZB 5D96B 3MOAH 4TSAH 3RL1B 4I3GA 5KSBA 4I0PB 3GJFK 4OZGF 2V5YA 5C9JA 2PNDA 1CXKA 3C6LA 5EBMB 1YUHA 3QG6A 4R2GB 5DJ0B 5EA0L 1NCNA 2JB6A 3IF1B 3OAZH 2GK2A 1CT8A 1MRDL 5GHWL 4Q0XL 1PQZB 3PG2A 4HGMA 1N6QL 5JXED 3T0XA 3DX8A 2AXJA 4ZS7L 4XNMA 4JQVC 3O6MH 4L4VE 3QDMA 3MXVL 1QKZH 3ME0A 3T2OA 5JA9A 2ARJQ 3BKCH 4S1SH 1NANI 1KCRL 3SGKA 4MQXC 1D5MB 1AP2B 1X9QA 4I48A 1AO7E 1B6DA 1U41A 4GQ9L 4JFHD 3IXAA 4MSWA 4UT9H 4D3CH 5HJ3B 4JFEB 4O51B 5LXGH 3SE4C 1WAAF 5IVZB 4FFWD 2P43B 5KVGH 5DJDB 1XCQB 4YXHH 5D8JH 4AIXA 1IGML 3QEUA 1SYVB 4OLZL 4GKSB 4GMSH 4XCNB 1NUDA 5GHWH 4LPUA 4L4VA 1UKTA 3RNQA 4Y2DA 3KGRA 4OLXL 1S9VA 4G8GD 5L2KE 5M94B 2YA0A 5F3HB 2ZOKA 2XWBA 4GW5A 4MA1C 2E6JA 2VXSH 3CMGA 3FTGB 1FZJA 1SEQL 4FOMA 2C3XA 1F6LL 1T04A 2KDGA 5DA0B 4LLWB 4NZUH 4K7PL 1AO7A 3BVNB 4MJ4A 5I1GH 1O7VA 2DQDH 4M1GH 4MX7A 3JTSB 4WIQA 4PBVC 5IWLA 5DHYB 2MQCA 4FQ2H 3S36H 1KLGA 4K7PX 2GKIA 2BOCA 3VFNA 3BUTA 4HDIB 1RZGA 1JGLL 1T21B 1IEAA 1JPFB 3FT4A 1JZ5A 2OP4L 3GSXA 3MO1B 4OV5B 5HHOD 2GK0B 4QO1A 4V1DD 3VE0B 5IBLD 1Y0LB 3KPMB 5L2KA 4R26L 4U6HA 3HAEB 3VA6A 1ERNA 3BRDA 1QSED 3BH8A 2BDNH 3WJLA 4HIIA 4LMQE 4EOWL 4OD3H 1P5UA 5F1SA 3QXUA 1G1YA 1EFQA 3DVFA 2NYYC 3LPWA 4S2SB 2EC9U 2IG2L 3NN8B 4CW1A 3FFCB 3H3PL 1V7NL 1D6VL 2DQUL 3KYNA 5ERWB 4FQXC 1HHGB 1T7ZA 4U1JB 2OR9H 5E94B 4G6MH 5CEXA 5IBUB 5E8OA 3DVNA 4RCAA 4G6FB 4X7DC 4Y8DC 1S5IH 4K8RD 4BH7A 3BZEB 1ES0A 4CKVX 1IGTA 3PGFL 4ZNEE 4JANB 5IFHH 4NO2A 2YD6A 4H0GA 3EOYG 3GMOA 3G9VA 3ES6B 1DQML 8FABA 4IRZL 3OL2A 3VXUE 2V9QA 3EYQD 3VRLF 1UWEH 2Q86A 4J2XA 4M7LT 2QLVB 4RFEA 4QTHA 2IANE 3MCKB 3MRBA 1WT5C 2EEBA 5IMMA 5B3NA 3LEXA 3X14B 1ZS8A 3WS3A 1V7NH 1JHTA 4OLUH 5JHDB 1YDPB 4YFLF 2YPKB 2O5XH 3OKKB 4L8BB 5GSRA 3BPNB 2C1PA 3C5ZD 4ZS6D 2CRIA 3TPKA 5T5FH 5GRUL 4DKAA 4M7ZC 3QIBA 5FGRA 3F7PC 1JP5A 2H32H 4YR6A 2EC8A 3ULUH 3IU3A 2R2EA 3VXUA 5IP4A 2DIAA 2I07B 3P11L 4M5ZH 5C6TL 3UBXB 1AQDA 2HTLD 4YHOH 4IRJA 5FO7A 2Z4QB 3TVMD 43C9B 2VZVA 3SEPA 2IANA 4PJ7A 4NBXB 4P23C 3P4OA 4RAHA 4Y5YA 1HOCB 2BNRB 4BKLB 5T1LA 1NMAL 4XNYL 4JO2L 5DEGA 1J1OH 2CH8A 4RZCA 1WZLA 1C5BL 5IF0B 2DKMA 4PJAB 3D9AH 3UJIL 4RMUA 2O5ZH 4XPFH 1NC2A 1QSFE 3GJFH 1JPGA 1KPUB 3MRQB 5MEND 4HKXB 5L2JA 1ZWIB 1IC5H 2DJUA 4DGYL 4OF5A 2UUDK 4JZOA 3QNXA 1ZK9A 2PYEA 3MUHL 4PJ5B 3STLB 3PNWA 1JVKA 1UJTA 3G6JA 3VD7A 4Z7OE 2B39A 5C92A 1T83A 3P4MA 4Z8FL 2HFFB 5GRUH 1NBZA 3ARRA 1O0VA 3VRJB 2JJTC 35C8L 3LEYL 3K8MA 3UEZA 1RUML 2HLAB 3B4NA 2F74B 1QFOA 2EYTA 4M8QB 1V3MA 4LSVH 3OJDB 3D85A 3S4SG 4C56E 3SJVE 5C6TH 1CD9B 4LVHB 1H8OA 3LSOB 4R90H 3RWGA 4G8FB 4J6RL 4YHIA 4DCQA 4J3TA 5TDNB 1KT2A 2P42B 4OZ4A 5EU6B 3MACL 4WW2C 5DHVB 4PJFE 1CDJA 1UENA 5MP6H 4WI8A 3MBEC 4XNYH 2R9HC 4JO2H 4G6JL 4PS4L 2YUXA 4V2BA 3V4PH 4F57L 5DSCB 4IJ3B 3CLEH 3L7EA 1Q94A 2WNGA 3I50H 4ALAL 1CXHA 2XKUA 5E56A 3MYJA 4G42A 3C8HA 4KRNA 3BWAA 1ZVSA 3TJEL 3BIAX 2VZ3A 2X4TA 1OW0C 4FHBD 3QCTL 3VXNA 3O2VH 2CDGB 4XBGA 4EVNB 3DYOA 3V5DB 4F37K 4C56A 3QEQD 2VZOA 4X4ME 5DUBA 4XTRC 4HS3B 1J1XH 2CRMA 4YHNB 4HJGB 4WFFD 2BK8A 3GMPA 3TT3H 3X3FL 4RFOL 4PJFA 5SWSB 1PG7H 1BHGA 3KPSD 3VG9B 4KZDL 3S97C 4K3GA 4HKBA 4ZOCA 4JG1L 1CICA 1OD7A 4Q9CA 3VGEA 4LLQB 5HGAA 1YJDH 4FXGA 4PUBL 1KN2H 4E41A 2J2ZA 4Y4FA 5E99L 4I9WE 2W1NA 4M6OL 4OZIE 1R24B 5L8KB 5I9QB 4O4YH 1RK1A 2DWDB 5CP3A 4XX1E 3TJEH 5D9SA 4X4MA 4EI5C 5EH1A 3ARGD 4H20L 4R8WH 3RTQC 3I75A 1QA9A 5BQ7A 4M1DH 5DRNB 4LEOB 4M00A 2XRAL 4NYLB 5IUSA 1SBSH 3O2WH 3MLTA 3VJ6A 4KJQC 3WUWB 1T89C 2W60B 1A2YA 1PGRB 5I8CB 5HYQB 4FTVA 3X3FH 4RFOH 3SGEI 4M7LH 4IM8A 1LHZA 3NA9H 5KN5B 3ESVF 4JFPA 3WIFB 3BRGC 1IQWL 1AD9A 4AIOA 2VDML 3CAFA 4LRIC 3S5LG 1UZ8A 4OZIA 4P3CL 5J3HD 1XIWD 2R69H 3NZHL 3PP4L 3NFPA 1BFTA 2YA2A 4NQCA 3LKRB 4U0RC 4M6OH 1AKJB 5IMKA 1A7RH 1YPZE 2FHBA 2FJHB 3I6LE 4MNQA 2YC1A 3TFKC 1J0ZA 3DXAE 3DMMB 1NMCC 4OCYL 1UWGL 5FUZL 3SCMA 4H20H 5T3XD 4N1EA 4Z7UF 4EDWL 3BD3A 2Q7YA 1CDBA 1ZSDB 3RBGA 2GW5A 2VQUA 2WP3O 3W39B 4XP9L 4OI9A 4OTXL 3S9DB 4RIRB 3RZWA 1IGYA 3O8XA 4NUGH 4OZFB 5F7HA 1DDHB 1H3VA 2DJ4A 3QEGH 1F4XL 5DDHA 2FO4B 3T0VA 4WI9A 4JRXD 3GRWL 3LDBB 3QG7H 3JV6B 1YPZA 1DLFH 2NLJA 2GYSA 4JJ5B 3OGCA 2FNBA 1SY6A 3O3EB 4G8EA 4XZUA 4E5XA 1T22A 4OLYH 3DXAA 2F8XC 3W9EB 4XP5L 3VXRD 5BZWA 4PG2C 5SWZD 3T1FA 2FB4L 4GQPH 1LD9B 3BP4A 3Q3GB 5BOPA 4IRSC 1U8KB 4JFHE 4HPOL 5AYQA 4OCYH 1P7QD 1L7IL 4PGEB 1RPQA 1JV5B 5DJ2A 2A6IA 4OGAC 2XV6B 4D9RE 3MRHA 1S9YB 4GAYA 1MLBB 2X4NA 4HS6B 4HUWA 1OD9A 5EO0B 1LDPH 4AEEA 3NGBC 3Q6GL 3JV4A 3CVHB 4KQ4H 3TA3C 9CGTA 4OTXH 5JXEA 3TN0B 2AJXL 2WSKA 2WW8A 3LEVL 3ARUA 5C0IB 4HMDA 5DJ8B 4G6KH 3GRWH 4HHAB 3HE6C 5C6PB 2ZOLB 5HVGB 4N8VA 3PGCA 2IJ0C 3Q48A 3SKMA 3CX2A 1Z9LA 1ZTXL 3SE9H 3U4EB 2VRAA 1IL1A 4ZSOB 4KVCL 5IHBA 4Y4KB 3I3EA 1EFXB 5JIPA 5FYKE 2C1OB 3QO0B 4WW2F 1XF3B 4PJXB 4CVZA 1KLUA 4C4KT 3HS0B 2RCSH 5HHPB 3MFFB 3EHBC 4PRNA 4G9FD 4PRBB 3EYSL 3HUJA 2J8UF 2QR0A 3MCLL 4O2CB 1MLCA 5B4MD 4ZXBD 3OKMB 4M8VA 1QLRA 2Z0BA 4PGDA 4F7MA 4FP8L 4JFZH 3IETA 1F4WL 5GS0C 3HMWH 1GHFL 4EXPX 4Y4HB 1XGYL 25C8L 1QSEE 4ELKB 2F9BT 1GH7A 5F89A 4K71B 5DVNA 2IAMC 4ORZC 5DD3L 3RNKA 5INCA 1F3JA 3V6FB 3G5ZB 2VISB 4GW4A 3MUZ1 1NLDH 4FQCL 1G6RL 3K7UA 2G9HB 3UTTB 4Z7WF 1C16B 2IBZX 2FZ3B 1SJEB 4PB0L 4ACPA 1IM9D 1NGZB 5ID1A 5TGBB 3KLAB 5TH2B 1W72A 1O7SA 1OGAB 1I3UA 5HHOA 3EO1A 3EDKA 3W11C 5IEHB 4KRMB 3JVGA 2I25N 4Z5RA 1C12A 4P48A 2HFGL 2R4RL 3OXRB 3IXTA 1WBZB 4HS8H 5IG7A 4J4PD 1P53A 1JL8A 1G7JA 2HT2D 1QSEA 3LVEA 4YGVB 2FX9H 3WO3B 1F4WH 2YZ1A 1G7IA 1XGYH 4JGMA 4EBQL 3MGAA 3SDDA 5DD3H 3O9WD 4PJBE 4WHTB 3RVVD 1VKXB 1A7BA 1P4IH 4JFDB 1Q38A 1RZIA 4GXUN 1C5CL 1EPFA 4TTDC 1N5YL 1CFVH 2HYMA 3MNWA 1A1MB 3QXAB 3X3GH 1CFSA 1JZ7A 2BVOB 1R3JA 2F53E 4KRPB 4PY8J 1JNLL 1K2DA 4GG6A 3EZ8A 1MNUL 3UJJH 1ZHLA 4UT7L 2FL5A 2XQYK 4FXLA 4UI2A 2Z35A 3IS1X 4OCWH 1MHPL 3TV3L 2HWZL 2V5SA 3CXHK 2YPVH 5GRZA 3NIFE 5ISZE 2LAGB 2R4RH 4Q9BA 2WWKT 5ICZA 3DSFL 3T04D 2IH1A 3CZFB 2YUWA 1QO3B 3BEVA 1WC7A 4HWEH 1CS6A 4F7PB 3DETC 5EB9A 1KCUL 4PJBA 1TIUA 2X1QA 1LGVA 1N7ML 1ZT7A 1CGUA 1C1EL 3NH7H 4NPYA 5C3TA 3VH8B 1UM4L 4JRYB 5LBSH 1I7UB 4NWTL 4MQXD 3DWTA 2X1OA 4U1HA 1ETZA 3WJJA 2AEQL 5E2TL 4UNUA 2P5WE 1KIUA 1AR1C 4TULH 4MB5A 4GKZA 4ORGB 5KANG 3OZ9H 2PCPA 2EYSB 4OF7A 3SKJH 2VDPH 4D9QD 3EKCA 2N56A 4ZTPL 2OL3L 5E03A 3RA7L 5I1DB 2OJEB 3WHE0 3UTPE 4Q6IC 1VA9A 3QB7C 2V6HA 1I85A 1BQLL 4FFVC 1OP9A 4NN7B 1VFAA 4JPKH 3TVMA 1UJ3C 2H9GA 4KTYA 3FB8A 4ETQA 1E28A 2Y4SA 1KJ2B 4RRPG 1Z3GH 4UIMB 5HGDB 4NKOA 2X6MA 3JWDH 4JFOB 4JY4A 2V5TA 5ENWB 5MENA 2GITB 3QISA 3QIUC 4OT1H 4LLVB 4MNGE 3HNVL 2I9LA 3BPLC 1NGXB 1GAFL 1BZ9B 2XA8H 2F8OA 4NN5B 4WI6A 1RZJC 2KH2B 1SEBA 2OL3H 4LLAA 2HFTA 2NW3B 1ADQA 1J86A 1BEYL 2F54E 3VGHA 5DUMH 3QEQE 3P9LB 4DZ8B 1DANT 1TVBA 1HI6A 3QR2A 4KHXL 3ZL4H 2ICCA 1UFUA 2QQKL 3D1MC 4WFFE 3ZE0F 1MIMH 1ORSA 1AGFB 2NYYD 4JN1H 1F3DJ 3P9MB 3BKMH 1TZIA 5GS3A 1FNEB 1Y6MR 1RJYA 2HAZA 4M6NL 1KELL 2DLFL 3F65A 2XWTB 1MCLA 2BHYA 4HBQA 1I8LC 4MNGA 4XRCB 3D3VE 2J4WL 1J0JA 1JWMB 3BDBA 4JZNB 1F3DH 4Q74A 4RISL 5TE6L 3GSOA 1R5WB 1DBBL 2VLKD 5EZJB 5J12C 5F9JB 1DCLA 4IMKA 5JZ7D 3HNVH 5D2LB 1SY6H 3O6FB 1WSST 1YN6B 3GUTA 1LE5B 4HCRH 2IBZY 4UUJB 43CAA 5BVJB 3QEQA 2V2TA 1LK3L 4BQBA 4WW1A 1IAMA 2EDBA 5EUOF 2CK2A 5DMIH 2H6PB 5T3ZL 2HLFC 1EH9A 4Y1AB 3NCEB 3S88L 3QXDA 2NY1D 4APQC 3KPSA 1F2XK 3D39D 3GSNB 4NNXA 4YHZL 1HILA 2D9CA 3OR6B 5H35B 2HA1A 2QQKH 3IRZA 2CMRH 4U7MA 4L9LA 4HUKB 3D3VA 5DFVD 1ZT4A 4CADA 2R1WA 2EO1A 2V9RA 4HGWA 4WEMB 3PWVA 4TUKL 2CIKB 4MVBC 2QSQA 5GS2D 1A9EA 4Y5XC 3ARGA 4NQEE 5HY9A 3WKNA 1RU9H 4B7IA 4XCCH 2N7BA 3EZJB 5LGKA 5CUSL 4MA3A 2UYLB 2A74B 5T3XE 1XZ0A 3FO9B 5JLZB 1OARH 4YWGL 4UTBL 3VFOA 1N5AA 3DECA 2OTUB 1WAAE 2ADFL 1HINH 3PWJB 5HYFA 1PX4A 1KJMB 1FPTL 2JJWA 2JCCE 4LSSH 1DVFB 3CVIL 2VIRB 1XIWA 1LNUA 5I1HH 4GLRH 3QQ3A 1WTGT 3CXHJ 4Z78B 3BKJH 4F3FB 3G6AA 1RQ5A 3DX6A 2HKHH 3D0LA 2XA3A 4OQTH 4TUKH 4XNXH 5IBTL 1IBGL 2DBJA 2VAAA 3SDAC 4NNPL 3SY0A 5IOPB 1EIBA 4UBDD 3IFNL 3EFFA 1J5OL 5FYKH 2FH6A 3MRJA 2Q3ZA 5E95B 3H7BA 4HLZH 4QRRE 1HQ4B 2MHAA 3IS0X 1INEL 2VLRB 3L3HA 3BT2L 4I5BB 4K2UL 5SWSD 4K3HA 4UNVA 4YWGH 1WAAA 5KSAA 4CVXB 3V9FA 1HXYA 3CK0L 2JCCA 1GRWA 4LSTL 1BQHB 4MAYD 4O58H 5HDLA 1FPTH 2FECL 5EZOL 1KB5A 3MLYH 3IT8D 2JLLA 1U6AL 2EKSA 4IOFD 4XVUD 1FN4B 1K6QH 1AGEB 4MQ7A 4QRTA 4PJEF 1EMTH 3X11A 2BVQA 5JW3L 5B38B 4R3SA 4M61A 2AXFA 3VXRA 1CU4H 5D7LD 3G04A 1XGRA 5SWZA 2AXHA 4UINL 3I85A 4P46C 5SX4H 4QRRA 4L8DA 1OB1B 2F19L 1P7QA 3QUMH 5FDYA 1KC5H 3QFJD 3DIFB 3IFNH 3O6LL 5T1DH 5ALCH 3D69B 4LSQH 5IEKA 3FO2B 5EC1B 1ZLUK 4UU9B 3PWPB 3ILQC 1CDCA 1YMHA 3CK0H 2JB5L 5K9KA 2PW1B 4OZHE 4YAQB 4KY1H 2AK4E 4R4BA 3HMXL 1D7FA 4HJJL 4N5EC 3MJ9A 5EZOH 1AHWB 4FMKA 3TYFB 2LV4A 32C2B 3T0EC 3ZTNL 5CFHA 1AKJD 1U6AH 3BHBA 3GJEB 4NJAH 4QOKD 1U3JA 4XWGH 2FECI 2VOTA 5L8LB 2ED9A 4PRAA 1FYHB 2NTFA 3IDYC 3QUYB 1A0QL 5HSFA 1RZ8B 3VRLE 4RMWA 4GMTL 4LGSB 5I6XC 3IAQA 3WLWC 1FNSL 3ZKSD 3RL2A 1I75A 2KBGA 2F19H 1WZ1L 1CD8A 2VABB 3MR9B 2DQGH 3O6LH 4YEEA 4U1IA 1U3HC 3H3BC 3Q5TA 4KJQD 3C5SA 4G9FA 3GSWB 2VLME 4J3WA 4R6UA 4PJ8A 5JOFA 5F7MC 2AK4A 3QJFB 4ZXBA 4TPRH 4UMGA 1J1PL 4BUGA 1MAJA 2R1YA 4JVPA 2BOBB 4X6EB 5IB3B 2OI9C 2JB5H 1FNGB 5DRWB 1I4FA 2VUYA 5HYIA 3C9NA 1KJVA 1WK0A 3C60B 1YEHH 2EICA 1EV2E 5EWIL 5GQBA 1A64A 3IFOA 2A38A 5IHZA 2XG5A 3RL1A 3CLFH 2QSVA 5GZOC 3TFKD 1IM9A 4YDIH 5DWUL 5AWNH 3ULSB 3KWWB 5DK2B 3MA7B 5D6CA 1INDL 1CDIA 3V7AG 1JMZA 3WNMA 5EBMA 1B0GA 3PJSB 4JFEE 3IFPB 4YK4C 1WZ1H 3IDMA 2W9LA 1E27A 3B83A 1X44A 1J0IA 2IWGA 1PQZA 3ARFB 5I74C 5E9DB 3AREB 4IOIB 5J9PA 4J4PA 4HAGA 3U48A 5FF6B 1QFWL 1GVIA 1ADQH 4Z7VB 3K8KA 3RVWC 4JQXC 2H2SC 5KZCB 1JZ4A 3CH1B 4NKIH 5JPMB 3QUXB 4HUMB 1G7LB 1Y6NR 3O9WA 1F6FB 2EECA 5AAMA 4XAKD 1AP2A 1CXFA 2ZCLH 2VDLL 5TQ0L 4JFEA 4O51A 2XTJB 4GUPB 4Y4KD 2OMBA 1EFXD 2CLVB 4HIEB 5IVZA 2Y5EA 5HHVL 3VXTA 5DJDA 1XCQA 1INDH 2CLZB 4GO6B 5CP7A 3HFML 4YHKH 1OWRM 4LCIL 2AQ3A 2AQ1A 4QRUB 5DJYB 2OBGA 2EDQA 4GKSA 4XCNA 4JZJB 4P3WA 4UT6L 1T1WB 2X2YA 4JKWA 5E6IB 5FYLE 4D9QE 2AJVL 1MREH 3MYZA 1A5FL 2WQ8A 1QFHA 3Q5OA 1ZGLM 4GT7A 4M4PA 2ZUSA 1X5JA 1DL7H 5KANI 3FTGA 1KGCD 2VC2L 1X6LA 2CIIA 4G3YH 4QHNB 5GZNC 2AJZB 3HE6D 1QFWI 4JM4H 2ESVB 4XNQB 2J5LC 4XPBL 4QTIL 2W0KA 3STZB 3JTSA 1OP3K 4YHLL 4XC1L 2AQ2A 3FFCE 4HX1A 3RU8L 4M43L 4I1NB 3HLAB 4HDIA 1VADA 4TQEH 1MJJB 1JPFA 2ID5A 3RZCC 2AEPH 1OGAD 1MHCB 1NGWB 3MO1A 1F8TL 3CDYA 4P59H 2GK0A 3VE0A 4FFZL 4JO3H 4LCIH 3TJHD 4DN3L 4XCEB 3G5XB 5JOPD 2DQHH 4GRWB 1QBLH 4DFHA 3KYMA 1I7ZA 2X40A 2APVA 3HKFA 1A5FH 3LKOA 4DVBB 1DQDL 2R2HA 3RUGF 2NX5B 5ESAA 5GS0D 4S2SA 4KK9C 1A47A 2NNAB 2VC2H 1T4KB 5IMOB 1NEZB 4FFYH 3JWOL 2CGRH 3D0VB 2ADIB 1W0WB 3VFGL 4U1SB 3LN5B 5ERWA 4QTIH 5E08L 2HMIC 2XI9A 2ZUXA 1Q9WB 4U1JA 1VACB 4YHLH 2AK1H 4P3DB 1MEXH 4XC1H 5E94A 4KRPD 1FJ1B 5EBWB 1UQSB 3RU8H 1F90L 4I3SH 5JHDE 3DHMA 1BM3H 3BZEA 4L8CB 2DWEB 5E2JA 5H8DA 1XEDA 5HVFB 1CK0H 4OCNC 5C8JB 4WU7B 3W11D 1J11A 3T4YB 1S78C 3GBNH 4FFZH 1ZLUH 1LEKB 4R96B 4OIBA 5T33H 3VGAC 4DN3H 2R8SL 1ZA3B 3CU1A 2CKBA 4XAWL 5D7SH 4OM0H 5D1XC 4FQPA 5ALBH 4JG0L 1P4BL 5ILTL 2W9EH 4F7TA 1VSCA 2EDEA 5CBEB 5I1JL 5IK3A 1JGEB 3MCKA 4X4ZA 4GKNB 1IAIM 2BNRE 5K9OA 5GPRA 3N1QC 3X14A 4J23A 3VW3L 2VO5A 2XZCH 2XKNB 4NDMB 4L8SB 5I18L 3WIIL 1GPOL 3QQ4B 4PJAE 3F7YA 4UB0L 2YPKA 3B3IB 1KB5H 2VLKA 2PYFB 3UAJD 4PJ5E 4LPXA 1S9XA 4PRHD 1L9NA 3LHPL 4I4WB 3X13A 1MJ8L 1P9MA 4AH2B 4OM1H 4U2YA 3GIZL 2I07A 4Y19D 4KK6C 3QCUH 3UBXA 4D94A 2BJML 2VTFA 3TPUB 2OXHA 2Z4QA 4L3EB 4M9OA 1ZEAH 4R7NB 2DMCA 3E2HB 1OQXA 5HDBE 2Q6WB 3SDCC 3F58H 1A6AA 1VGEL 3SKNA 3DETD 4Z7UA 1HOCA 4BKLA 3DUHA 1NAMH 4G5ZL 3RAJL 3DV4B 2A6JB 1MWAL 5EU6E 3BQUC 4NQXB 2V17H 4PJAA 1QBAA 5GGSA 4U1MB 2AXGB 2R15A 4GFTB 2NZ9C 2DIBA 3N1PC 4HZLB 5E1HB 1EK3A 3MRQA 1OVZA 5IR1B 1ZWIA 1LILA 4XP6L 2ZJSL 3STLA 3GKWL 3CX5K 5I16B 4KKNA 1CDGA 4P2CG 4YBLB 1AD0A 1FVDB 1X5HA 2WANA 4NO0D 3VRJA 1X5KA 5K59E 1SJHB 3BPCB 2VMFA 5E7BA 1N6VA 3WFDL 3T0DA 4LRNL 2F74A 4M8QA 1NMBH 2QADC 3OJDA 3AAZB 3GIZH 1WCBB 4M03A 1MH5B 1E4JA 4YX2L 3ZHLA 5BVPL 3LSOA 2JTDA 4G8FA 2EXYC 4QGTA 1A7OL 5CEZD 5EU6A 5SWSE 5T5NF 3C08H 4H25B 4KDTA 4ZODA 4B53A 4G5ZH 4KI5E 3RAJH 1XF2B 5JA8B 4LFHG 3UZQA 5DD1H 5DSCA 3ZKNC 5C71A 4MJ5B 5KW9L 4PV8A 2V7HB 4Q2ZB 4I77H 1N64L 3EOTL 3SDXB 4Y16D 4MA8L 3PXJA 4QHMB 3L3OB 3GKWH 2D0HA 1EHAA 1IAKB 3O6FD 3V4VL 4BK5A 2CDGA 4EVNA 1H8NA 1B88A 2C4XA 3EDJA 4J8RB 4UQ3B 4KKAC 4NZTL 3OPZL 5C0NC 4Y1AD 3GSVA 4YHNA 1C5DB 4HJGA 3WFDH 4NWUH 3PDDA 2ATPB 2PXYC 5SWSA 4YUEH 1EJ6A 1BWWA 2QJDA 3VWJB 1TZHB 4K3EH 3NCJH 1A7OH 3BD4A 4P5MB 1MCOL 1A1OA 4PREB 1QFUH 1BQUA 4FG6C 3V0VB 1A6UL 3KPPB 1EEYA 4MAYA 5CHNA 2B2XL 2YWZA 5IB4B 4L1HA 3CSGA 2APBA 3GSRB 5KBNC 3OSKA 4ZUSB 1JHKL 2R0ZH 4Z0XA 3WKMH 2ZSVB 1X3DA 1KBGH 3EO0B 4U1GC 3VRIA 2Z8SA 1KIPA 4M7ZB 3ARYA 5IM7A 5DRNA 2XZAL 5KVEH 4NYLA 4JE4B 3QFJA 5ITFA 3ARQA 4NZTH 4Z7WA 1ULVA 4HFWB 5ESVB 4XPHL 2VZ1A 4X5XB 5HYQA 4BFBD 5D1QC 4LLUB 2Z31C 4P23B 3DUSB 4KH2A 3WIFA 5KN5A 2C7UA 3MXWL 2ATKB 5JUEL 4MA7L 2NTSP 2OX5A 3MODL 3GEWB 4HC1L 1A6PA 4K3DH 4WV1C 2J6EH 1DVFD 1ZVHA 1MJ7L 4XNUL 5C0CD 4XX1G 4CU6A 4NQUA 4FQHA 3LKRA 1AKJA 4HF5H 1I3VA 1JHKH 1RUAL 3MROB 3RIFK 4K3JH 1CR9L 4ZUTA 2ARJB 2YSSA 3ZDZE 4RGNC 4PGJA 3U6RB 3IDXH 2V2XB 1X7QB 2E8YA 4UV4L 1ZSDA 4OFDA 1I7RB 1EA9C 2XZQL 1S3KH 5GRXG 4XPHH 2O26U 5EOQL 4MDJB 2HFEB 1MRFL 4OJFL 5TDOB 5J89A 1KPRB 2ZKHL 4OIIH 5FYLH 4ZUWB 1OM3H 4CGTA 3LS4L 4J3UA 2FO4A 3MBEB 3FCTB 4NHCL 4QNPF 2ZG2A 2OMNA 4HC1H 5F8RC 1IM3B 3HAEH 4XVTH 4P5TC 4GAJH 1MF2H 1JF6A 3EJZC 3O3EA 1QPXA 2UY7A 4GRLC 4FQLL 1ZGLP 2DQCH 4KK5C 2VDNH 1TQBB 2MPAL 2IGFL 1MHEB 1LD9A 4XAKE 3Q3GA 4JHZA 5TPWH 5F1OB 1U8KA 1NFIB 1YEIL 2MKWA 4ZSOE 4PGEA 4KKBC 4NFDA 4M48H 1W0VB 4E42A 1N0XH 4HAFA 5CAYB 1S9YA 3EO9L 1MLBA 4IIQC 2RR3A 4HS6A 4Q9RL 1IEBB 3M45A 2FWOB 5E2WL 1AGBB 3C8KA 3TO2B 4JPIB 3OG6B 5H94B 2DICA 4XVSH 4KFZC 1NGPL 4JDZB 4UOJA 3SOBL 4DKEH 5C0IA 1UB5B 1FIGH 5C7XL 4OGXL 3QUZC 1TCRB 4YE4H 3VDBA 4N8VG 4P4KC 3SGDH 1ZHBA 2ZOLA 1G9MH 2VITB 4JEGB 1CFNA 3G5VB 1UA6L 5ADOL 2WBKA 3OKLB 5ELIA 3U4EA 1CI5A 1M7DB 5BW7C 3QWRA 2MPAH 4LQFL 3UTTE 1QEWB 4Y4KA 2HVJB 2LU4A 1EFXA 4EI5B 4M7KH 2C1OA 2QHRH 4X9HA 2NXZC 2D31A 5BV7L 1YEIH 4M1CD 2Z8WC 3ECBB 5F7EH 4JN2B 1XF3A 1NPUA 2R29H 3ULVF 3HS0A 3UPCA 1FO0L 2BNQB 5HHPA 1I1FB 3MFFA 4UDUB 1OGAE 4KGLA 1RIVH 2OK0H 5KAQG 4PTUB 5EOCL 4B5EA 1OTUD 1K4CB 4S1QH 4S1RH 3B9KB 3ILQD 5TE4H 1OAUH 5M7QA 4CBPA 1E6OL 3N9GL 3SOBH 3VXOB 4Y5VB 1SM3L 1FYTB 1T03H 3GBMH 3SQOH 1NCDL 1TZGL 3HE6A 4NM8H 1WLHA 3V6FA 1FSKB 4OCLC 1S7UB 4WI7A 5D72H 4LHUB 2QSCL 3IJYB 3P2TA 3HC4L 4S10A 3UTTA 1C16A 2HJFA 2LTQC 3RGHA 2FZ3A 1SJEA 4JFDE 4U7SA 1FZMB 5HDQH 5HYJD 2QTEA 1NGZA 4Z7QF 3L3IB 3QRFM 5TGBA 1NSNH 5TH2A 5K9JL 3VXMB 1OGAA 1V05A 4AMKL 2BHUA 2Q87A 1FO0H 5IHUL 5E9DD 1FVCB 3K0WA 1EHLL 1WBZA 1DZBA 2EE9A 2P4AB 1U8MA 5FGBC 1F6AA 3RIAK 1NDMB 5EOCH 5AD0A 2GT9B 1Q0YL 5IJKC 5CD5C 2E27L 1E6OH 5DVMA 5E8NA 5CZVL 5EUOA 5KZCD 4PY7A 3HI6H 4MD4B 4WHTA 2QSTA 1VKXA 2C26A 1TZGH 5DHVH 3B5GA 3PHQA 3HC4H 1EJOH 3QXAA 4JRYE 1ACYH 1OF2B 4MLSA 5HI4D 5DJZA 3QIWB 3BE1L 4G7YH 5E5RB 1U8OA 3KYOA 1T0PB 5MEQB 5K9JH 1B2WH 3V4UL 3WFEL 4MAUH 2GIYA 4ELMB 4U1NB 3TA3B 3NZ8B 3KPOB 5E5MB 1FFPA 2PO6D 4HKJB 3CZFA 1T3FB 3V0AC 3SPVA 4OCRL 2AEIT 1B90A 4MJIB 3ET9F 3RVWD 5FYKU 1DBKL 3MC0A 5B8CC 2ESVD 3NMEA 3ARZA 4KQ3H 3AXLA 3VH8A 4U31A 1MI5B 1HYSC 5JHLH 1I7UA 4WUKL 1JZ6A 5FYJL 4CAGA 4ZOEA 4NO3B 5DYOB 4BFIB 4YHYC 4MNHB 4ORGA 2EYSA 4EZMA 4E0RB 5KS9B 4PRHA 4CDGC 4TRPL 5E2UH 3BISA 3V4UH 4UAOC 2X10A 2OJEA 4EN3C 2DS4A 3D18B 2DLIA 5BZDB 5JDSA 2JELL 2FIRT 4QHKI 1PEWA 1F02I 3QZWB 4AQ1B 1GIGL 2MFNA 2BY0A 1J0HA 4PR5B 3DTXB 3R06B 4FA8A 3NCFB 5GIRB 3U2SB 4M9PA 2IAMB 1IKNC 1SYSB 1DANU 4ZTOH 4XXDB 3F6IA 2LE9A 2BSTB 5ENWA 1FQ9C 4KROD 3W0WB 2GITA 4XBEH 2CSPA 5C09B 3UPRB 1I1YA 2VXVL 1ZLWH 4RWHA 5SX5K 1CL7L 3RHWF 1NGXA 3G6DH 1BZ9A 1DSFL 5DQJA 2QQLL 3FT3A 2BNUA 4NO0A 4JPWL 5D2LE 3GJFB 4PJEA 2DQEH 4MJ2A 2VLJB 2NW3A 2DN7A 2GJ6D 3AU1A 1YEKH 1FNAA 1JWUB 2CD0A 3DVIA 5I19L 3UJTL 4DZ8A 1NBYB 3DYPA 3CFCH 4Y1AE 3HI5L 1O5DT 3OMZA 1AIFA 1G7HA 5CGTA 1TVHB 4WHDA 3EYUL 4KK9D 1IFHL 1IC1A 3T8XB 3OKNA 2XN9D 3BUYA 4OZFH 3C6LC 3V2AR 5IB1B 1WFOA 3BGFC 1UZ6F 2BY1A 4WJ5A 2XWTA 4XRCA 4HT1H 1NCCH 5C08D 4JZNA 2XQBL 3U0PB 5DK3A 3U46B 2SEBA 3GHEH 4OGYL 4Y16A 4YNYB 5GJSH 5EZJA 5IT2L 5F9JA 2B4CL 3TT1L 1YJDC 1CDHA 3O6FA 2WWMC 1CZ8L 2OZ4A 2WBWB 1HSAA 5FOJA 5EOTB 3QNYB 2K9UA 4ZFFA 5HPOA 1FFOA 1J8HB 4P2RB 1T5XA 1S78D 1XAUA 1CL7I 2H6PA 2HTKD 1FC1A 3ZLQC 4Y1AA 5JOEA 5HYSB 3O6KL 4GSDL 1MIEH 4KGJA 4PGBB 5D1XD 3UJTH 4HUNB 1JNHB 3SGKC 3GMRB 4YBQC 5HHQB 4LVOB 3OR6A 5H35A 3K2UH 2XOTA 2PW2A 4LSRL 5EZLB 4PJDB 3CVHH 4XT1C 4OIAA 2VZUA 1I1RA 2NY0D 1HHIB 4X7FC 2UWEF 3VD3A 4JKLA 5JTWA 3LQMA 2VWEC 4G80A 2XICA 1KNOA 1CLYH 4CVWA 1CQKA 3TT1H 4Y2DC 4IDLA 2ILLA 5AEAA 4K23H 5C0GA 1JTOA 1M71B 1PBYA 1YNTB 3IKKA 2P5ED 3DX7B 3FO9A 1UWXK 1MAKA 5TF1H 3RVUD 3JV0A 3KS0J 5JO5B 5CJ8A 1UJ3B 5LG1A 4X8JA 5IWLC 3LRGA 5MEOB 4PRPB 2W92A 4UQ2B 4LSRH 1JGDB 4KJWC 1RJLB 5DQDL 3GI9H 1MFDL 1DVFA 5A3ID 3NA4A 3KS0H 2NZ9D 4X6BB 1BFOA 1H15B 1BIIA 1JPST 2B0SH 4LARL 2H26A 3KHOA 3UXFA 3ZKQD 3QIUB 4QWWC 5CKAA 5JW5A 3ILPB 1Y18B 4OD1H 3BAEH 3KYKH 3RWFA 4Y5XA 4OUUB 3WJLC 4H88H 3BH9B 2IFFL 4KRLB 4RWYL 4X6DB 3ULUF 4P9HC 3AROA 4MZ3A 5LVEA 1DQQB 1HQ4A 1XGQB 2QADD 5C07D 4Z9KB 3BOVA 3VWJD 3KR3L 4CVXA 2EXYD 5J4MA 1V7ML 4PB9L 3NIDF 2GFBA 2YXFA 4NBZB 1Z0MA 2VDRH 3PWPE 1Z2KA 5ICXA 1JUFB 5BV7C 4PJIB 2GUOB 4NOFA 3ULVD 4P57A 3HZKB 1BQHA 1PSKL 1OTSD 4MCZA 3MNVB 5DQDH 5E8DL 2EEDA 4KTEH 1YNKL 1FN4A 5C0JB 1X4YA 2IPTH 3SE8H 5B38A 1CLCA 5CZXD 4A6YL 1RUQL 1DQLL 4YDLB 4LGRB 5F9AC 3RUGE 4RGOH 2AW2A 4WWKD 4AM0A 3NACL 2NY2D 4F80A 3P30L 4QRQA 3H9SD 4NUJB 1W72L 3MV8B 1P4LA 1V5JA 5BXFB 3FO2A 2YHGA 5EC1A 3ZZ1A 5E00B 4C57C 1TENA 1SHMA 5FHBH 4YAQA 3DRTB 4FZ8L 1BQSA 2BHZA 3MV7D 3GHBH 5C86A 3DURB 1AHWA 5IIEB 5KSUA 3QIBC 4OCSH 4M5YL 5AZEL 3GJEA 3GSUA 3RUGA 4XPTL 4N8CH 5SX5H 1FGVL 3BZ4A 1RZ8A 4A6YH 1E4XI 2B20A 5F6IC 4IRJC 2IADB 4W70A 3NFSL 3RWHB 5C3LD 4GS7C 5I8OH 1T66D 3GMLB 1T6WA 3JUZA 1U0QA 2VABA 4Y5YC 2OR7A 2MNUA 1MY7A 1P2CB 4MJ6A 2ERJC 5KG9B 5CEYB 3QPQD 4NT6A 3IJSA 3QJFA 5E2VL 1E4WH 5E9DE 2BOBA 1ZV5A 3GMMB 4ODTH 4JM2B 1FNGA 5DRWA 4L9DA 1WWBX 3U36B 4MMXC 4WEBL 3SDYL 2HH0L 1CLOH 4Z7VE 3OF6D 2YKLL 1BX2B 1OP5K 2ZUQC 1RZKL 1T2JA 3VCLB 4QKXB 3IDNA 2Z9TA 4I18A 1KJ2H 3LZFL 5IB5A 2ADGB 2AJ3B 1U2HA 4R7DB 4ZFOA 3FO1B 4XPTH 5HYJA 4M62H 5LJYH 2FLBT 4PRIB 1RFDL 2YPLD 4X0KB 4RGND 1Q9LA 3GK8H 3MRIA 5DMGD 3BIKA 4OFPA 3IDIB 3DGCR 1A6TA 3IFPA 4HBCL 4YDKL 1T2QL 4N90D 4K9EL 4TUOB 2DIJA 3P0GB 4KAQH 2NQCA 3ARFA 5HHMB 3N1FC 5E9DA 3PIQB 3AREA 4JDTH 2OTPA 3QFDB 3WNNA 1J12A 2FIKA 1CWVA 1NGQL 3I3DA 5E2VH 3EYVB 1FL6B 4Y89A 1U58B 4WU5A 2YRLA 2X9XA 3CH1A 5JPMA 1JPSH 1ZT1B 3DROB 3VFTB 4ZPVB 4X6DF 2BSRB 2YKLH 1F11A 2ESVE 1D6EA 1DEEA 2D7QA 2H41A 2BFVL 4WUUB 2BERA 4GUPA 3O4OB 2CLVA 4ONOA 4CJ1A 3T2NL 4P46B 2DQFB 5D7IB 2APTA 3D2UD 2X1XR 3JUYA 3ARSA 1XCTB 4NP4L 4ODSH 2DLEA 1UYWL 3UPAA 2ZUVA 2QBWA 4FQ1L 4LLDA 1A7QL 4QRUA 1Z5LB 5LCVL 1G6RB 4QRSB 4JZJA 5GS1A 3LOWA 4WGWB 4KMTL 5C0BD 2X44D 4Y4FC 3B9KD 1RUPH 2PO6A 4GRWE 2YRPA 2XXMB 5K9QI 4J3VA 2OTWA 1OY3B 1SJXA 4P2QD 1NGQH 4ERSL 4WI5A 3KPRD 2HVKB 1LO5B 3MRDA 4WI2A 5DURD 1R6VA 4IHOA 5J6GB 2DLTA 4QHNA 1FL5A 1T1XB 2NX5E 4P4KD 1PKQB 2ESVA 4BZ2L 2ZNWA 3GSNH 3I02B 4LHUD 5IW6A 3STZA 2NY6D 3BN9C 5JMOC 3HC3L 4BFEA 3E0GA 3LRHA 4MXVE 1MJJA 1HNGA 4WWID 3QRGH 3P4LA 2EXWC 2YUVA 5GRWA 4E9LA 4QF1B 3HI1A 3TBSA 3QA3A 1U3HB 1BVLB 3JWDC 2DQJH 1YQVL 1A7QH 4XCEA 3AMKA 5HHXL 5L8JB 1TTUA 3SKUD 4OFKA 4W6WB 4U1KB 1I1AD 4L3CA 4QY8B 4CUCA 1VPOL 1XMWA 3WXWL 5C70A 1Q1JH 4O2FB 1GGTA 2OI9B 2XNAA 4X99B 3VXSD 1T4KA 5IMOA 1NEZA 5CSZA 4Y0GA 1WFUA 2ADIA 3SCMC 3LN5A 3IU4L 4UDTA 4UILH 3NCBB 5DA4A 1CE6B 3UCRA 3DNKA 4JR9L 1VACA 4MS8C 4P3DA 5I71B 3IFLL 3PQYB 5ANMA 3P0VL 4XPAL 4NGHH 5EBWA 4O2EB 4HWZA 4N0FB 3S6CA 3QIWD 5C08E 4U05A 3O8XC 3O0RL 4MXQC 3RKDC 1UEMA 1U8LA 4G43A 2DWEA 3CDFA 4Z76B 1VGKA 3T4YA 3QXTA 2D7TL 1HDMA 2JJVA 4R96A 5I74B 4JHWL 1ZA3A 5HHXH 4X6CB 1YEFH 4JFQB 2AAVA 4C83B 3ROOB 1KLFA 2RFXA 4H8WL 1VPOH 3WXWH 1G9NL 5CMAA 4L3EE 5CD5D 4X6FB 2RJMA 5CBEA 1T1YB 2OL3B 4GKNA 2W9DH 5DGRA 1A7PL 3TNNA 4LNRB 4OD2B 2W07A 4MWFA 4LCYB 1OAZH 2XKNA 4L8SA 3QQ4A 2BSED 5C08A 1XGPB 2CQVA 1R3HB 2MMXA 4ZUUB 3A6OA 1TMCB 1L7TL 3B3IA 3MMEA 1NL0L 2D03H 1ZHKB 1A8JH 2PYFA 4F37F 1CGXA 3I2CL 3U9PL 5JXEC 2CLRB 2V7NB 3UBXG 4AH2A 2AVGA 2ZSWB 3IYLW 2FX8L 2D7TH 5GRJH 2OQJA 5L9DL 4JHWH 5J11C 5GXBB 3LKPA 3MJ8A 3WD5H 3UTOA 2YA1A 3F62A 1I9IL 4H1LA 4L3EA 2QV2A 3CFKB 3PWNA 1XR8A 5F8QC 5B39B 4YC2B 3VMPA 2Q8BL 1GGCH 3ULUD 3BKYH 1CE1L 4H8WH 4QT5A 3HR6A 4RNRA 1LO0L 1AGCB 2A6JA 3RX5A 1JHLL 3WE6B 1TNMA 1OP5H 3PP3K 1LE9A 1H3UA 2J5LB 4FFWC 2AXGA 1HYSD 3FO0H 3DSNA 4HZLA 3ZKMD 1A6ZA 2AJUL 4PJCB 4YIQA 3CXDL 4DQOH 2PTTB 1F58H 1BOGA 3W0WD 3T2PA 1QG3A 3BJLA 1A14L 3HA0A 5BO1L 4BH8B 5IFJB 1BD2B 2EEAA 3SDXE 1HSBB 1S8DB 1FDLH 4X9GA 4Z7OF 3C5JA 2X4SB 3QHFL 5GGQL 2I9TB 2VLJD 3VFSA 4EN3D 3FB5B 5F70A 2P8PB 3AAZA 1WCBA 2P5EA 3DV6B 1X5ZA 4DAGH 3RGVD 4NCC2 3MRFB 4PJHB 3S5LB 1A9BB 3BP7B 4KHTH 1S7XB 3NTCL 4HMEA 5C07E 2Q8BH 4OI7A 5CGMA 4PJFF 3GO1H 4FABL 5IESL 1HZHL 2D0FA 4U7KA 4XBPA 1NCTA 2X4PB 2V7HA 2WUBL 2AJUH 4HXAH 4Z0BL 3EFDL 4S11A 1IGJB 3UZEA 3QI9B 2YD2A 3T4AA 3JVGC 3F8UB 4QHMA 3L3OA 5IBLC 4NQDD 3DVGB 2BY2A 3BP6A 5E6ZA 1IAKA 3GBLA 4RA0C 3LPGA 1CLZL 3HTLX 4UQ3A 3CCHB 5JPNB 5GGQH 1H3XA 3L3GB 3VGAB 1MCEA 1N26A 1BGXL 1DBAH 2CDFA 3FQRA 1WBYB 3SDDC 2XY2A 5C07A 1A6WL 1G0XA 3VFWB 2JF1A 3VWJA 1A3RL 1EO7A 4MZ2A 1MPAL 3HPJA 2P47B 4Z7QE 2VE6B 4J1UB 1YEJH 3VI3F 3WLBB 3DARA 2DOCA 4P5MA 1QRKA 4PREA 5CGYC 1W0YT 2FBJL 3V0VA 1U8QB 3H0TA 5DJXB 2Y25A 1FAIL 3K2MC 5EFIA 4K8RC 5IB4A 5KVDL 1TJIH 1HZHH 3KPNB 5L88H 1AJ7L 3GSRA 4X7EC 4Z0BH 4R4FL 4TSBL 1QHPA 1OCWL 1UXSB 1FBIL 2ZSVA 2EDNA 3EO0A 4WFGD 1AXSB 3VXQB 1EO5A 3MRMB 2HKFH 4WWKA 5HI3D 4JO1L 3W5MA 2C4FT 3H9SA 2X9WA 3OJ2C 1RZKC 4HFWA 5ESVA 5D1ZB 1BGXH 4X5XA 2DMBA 4FN0A 4XMKH 3SDCB 4LLUA 3N85H 1KCSL 3DUSA 3WJJC 3V6OE 2YD9A 1IGIH 1IQDB 4PRPD 1AQKH 1BIHA 1K8IA 2I26N 1EUUA 2NY5H 3IVKB 3MRCB 3MV7A 1FAIH 3WS6A 3WXVL 4U6TA 1NCWL 2KKQA 1U95B 1AJ7H 5HHNB 2ZUTA 5LWYL 5B3JE 1UVQB 4TSBH 1I85C 1CBVL 5E4EC 2ARJA 1EAPB 2HTLC 4GAGH 1BVZA 4YDVB 1S5HB 1X7QA 2V2XA 2ZCKL 4XHJC 5D5MB 3TVMC 5DJCB 1JGUL 1LEIB 4LBEA 3UTZB 4G7VH 3OB0K 1FLTX 3RVTD 3MLXL 1EO8L 3QHTC 3V6OA 1I7RA 3LN4A 5J1AB 1JYVA 4MDJA 2HFEA 2Y5TB 2JJUA 1KPRA 4CRPA 5ITBH 4XH2B 1GC1L 8CGTA 4U3XA 3U7WH 2FDBP 4GKOA 4L5FL 2A6KA 4DW2L 1RHFA 2EDHA 4GRWH 3AGVA 2B1HL 3EYOB 1IM3A 5B22A 5DUPL 2AJYH 5IROA 4YFLI 1IRAY 3BXNB 1QLEL 2ZPKL 1OAYH 3OAUH 3OF6A 4UTAH 2FJFB 2H1PH 3NABH 2OM5A 1A22B 3C09B 1YC7A 4LDLB 3TIDB 2ZG3A 3SE3A 3HR5B 4M3KB 4DEPB 4QWWD 5D71H 1NCBL 5L2KD 15C8H 1MHEA 1W8OA 5KJRH 2ITDB 1MFCH 1CBVH 5D2NB 1TJHH 1FH5L 3MJ7B 1VFBB 2E7MA 2YPLA 3PABA 4XI5D 1CF8L 1OGTB 2OJZL 1A4KB 5TQ2L 1U92B 4Z7NF 3N06B 2ENYA 1BF8A 4NZRH 3EYFB 4P2OD 2R0WH 3HNSH 2X7LB 2EH8H 3MOBL 5GSVB 4TTGA 2PXYB 4NQSA 3SO3C 1K3IA 2BNQE 5IFAL 2DBLL 3M8OL 5ETUB 5I66A 4LCCB 1IT9H 4KK8D 4OKVA 4PJGF 3BMVA 4KKCD 3PP3H 5DVOA 5F9OL 3LIZL 1IC4H 4ISVA 1T5WA 4IMKC 3RPIB 4M6ML 3QEHB 3U0TB 1FYTE 1QLEH 1A7NL 1MVUB 4M02A 5J13B 4AEIL 1KCLA 5I73C 1FE8H 1M7DA 4M7JH 2A9NH 4JQIL 1QEWA 2HVJA 3CC5B 3D2UA 2AJSH 3ECBA 1B0RB 4NHUA 1P7HL 3A6BH 1CIUA 4LEXL 5E8EB 1CD0A 2B5IB 1U8JB 2BNQA 4IS6A 3VXME 3ARTA 4L9LC 4PP2B 5F7LB 4AL8L 3KJ6L 2LABA 4UV7H 4N5UA 4PTUA 3MFGB 5C0BA 1K4CA 2MOVA 5J1TC 1WITA 3B9KA 4YFDB 2CKBL 1HXMB 2CXKA 5I75C 4P2QA 3KG5A 3KPRA 3OKEB 4WV1B 4Y5VA 4ZMAT 1FYTA 5D93C 5F9OH 3LIZH 5L7XL 4I0CC 1AR2A 3P77A 2XFXA 4M6MH 3ARGC 4U6VL 1S7UA 1LO2H 4LHUA 1XGUA 4J7RA 12E8H 5EDXA 2NY3D 2VXUL 4ODHL 4OFVA 4GRMB 1JYNA 3L3IA 3C87A 1BWMA 1AXTL 5KSVB 2F5BH 5T1KD 2H8PB 1INQB 1JPTL 3MLZL 3UC0L 3VXMA 4OLVL 1QFPA 2ORBL 3A67L 3ZYOA 1WBXB 1FVCA 3ZKXC 4NM4L 4R97C 4ELME 3RWJA 3KJ6H 2Z91B 1I1AA 1XIWC 3L7FA 1KN4H 1AI1H 3TCLB 3NIGF 3VXSA 3QO1A 1IKFL 5IVXB 4MD4A 3HPLA 4MJIE 5CILL 5BMFH 4NSKB 2YD5A 1E4KA 4HPYL 5F88B 1FGNL 2VDOL 1QRNB 5M95B 1U93B 4I0KA 1F3RB 5CWSA 4U6VH 3MCG1 4N0RA 1MI5E 4WUUD 2AKRB 3O3BA 2A77H 5A43C 3D85D 4NZJA 3VWKB 1KYOK 3GKZA 1S7RB 3S37X 5FDWA 3QIWA 1CFTB 4N0YL 5BJTB 5KSAC 3MLZH 5MEQA 4ONFL 5J56B 2UWEA 1CTNA 4YO0B 1MCKA 5DD6A 1YECH 5E6YA 3ARXA 4IIQB 1N8ZB 1U9KA 1XT5A 4ELMA 3S35L 5JQ6L 4G9DB 1QSFD 5KS9E 3F5WB 2YN3A 4KZEH 3L6FA 1GZQA 3KPOA 4NM4H 5E5MA 2P48B 2DI8A 4HKJA 2CK0H 2WBJB 1I7TA 4AJ0A 5LGHL 3NIFF 1OAKH 3S35X 4NRYB 4YDJB 5I1EH 3VH8G 3O4LB 2FX7H 5IMLA 4QXUH 4ZOAA 3H6JA 1MCWW 4LKXB 4FQQB 3H9ZA 3ARDB 2Q76B 2VXTL 2FJGB 3S37H 3SJVD 1FLRH 5I15L 1YNLL 5F6HI 5F7NC 5DI8A 5DYOA 4BFIA 3M17B 2NXZB 4X7CC 3NIDE 4ODWB 3W0WE 5C09E 2A0LD 4N0YH 4E0RA 3OB0H 5KS9A 1R5VA 5HVHB 5CINH 3QJHA 1X4XA 5LQBL 4JHAH 4NQVA 5DVKA 1KPVB 3A6CH 3LQZB 4XMPH 2X4RB 2NMSA 3BYTA 3GSQB 2VLJE 2EE2A 3O45B 4NJ9L 5C0DA 3L95A 2B1AH 3CMOL 3DTXA 5C0AB 5LGHH 1PAMA 5GIRA 3U2SA 1AGDB 2H32A 2LU7A 3GIVB 3EOBB 2QKIB 4F7EB 5GJTL 4GG8A 1SYSA 4ZAKB 2FR4A 3WFBH 1G7QB 4JB9L 4OQ1A 4Q58C 4P9ML 4U4BA 4XXDA 1QPPA 2VXTH 1OLZA 4JFXA 3W0WA 3TNMB 1T0NB 5ABDE 5C09A 5I15H 1NQBA 3W9DA 5I1CH 3C2AL 1JN6B 3MJ6A 3VFPA 5EBLB 4PJ8C 4DN4H 2GAZB 3P4NA 1TJGH 5B4MC 4ZXBC 1HHHA 5FM5M 2QEJA 4GBXD 4LP4A 3QXVA 1MAML 3GJFA 2VLJA 4BM7A 1JWUA 3FAWA 4YHMH 1J8HE 4P2RE 5KVFH 1N4XL 1NBYA 2Y72A 3RGVA 4CMHC 1N2RA 1AC6A 5JW4R 4F58H 3HNTL 4LPVA 4WDIA 4YXLL 4CU7A 4HKZA 3FQWA 3KVQA 3CDGB 1FORH 5FA4A 3LH2H 2WUCL 3HB3C 1TVDA 4NC0B 5IB1A 4YBHA 4ODVH 4R2GC 3KXFB 3MBXL 3T08A 4PJDE 5HVWA 3UYRL 4OBSA 1A6VL 4PBWD 3U0PA 3R1GH 4FQIL 3U46A 4YNYA 3RKPA 2R0LL 4WO4D 3PDGA 3C2AH 4OAWA 3TBWA 1MWAB 4J4PC 4NKQB 4ZUVA 1FL3A 5HGHB 2HT2C 5EOTA 1J8HA 1CD1A 4LU5H 1UH4A 2UZXB 4WFGE 4L3AA 2VB5A 5FHAH 5IVXF 1EUTA 5I8EA 1LMKA 5C0RL 4AIZB 1OSPL 1KEGH 3O9WC 1N4XH 3RVVC 1JNHA 3TWCH 3GMRA 1PYWB 2JK5B 3HNTH 5DC4B 1TITA 3TZVD 1JYXA 1WWWX 2G75A 5EZLA 5B8CB 2CKNA 2MCPL 1HHIA 4PRPE 1CVSC 3MBXH 5TFSH 1NUGA 3ALPA 4P49A 4QCIB 5EG6C 1A6VH 2Y6SD 3KJ4C 2F5AL 3O11A 1GC1C 4TSCL 1IGFH 4QXWA 2R0LH 5GGUA 2DKUA 4XC3L 3MLWL 2AI0H 1W2KT 3MLVL 4NKDB 3ARWA 4FZEH 2F15A 1I8MB 2Q7NA 1M71A 3OR7B 1NANH 4KMQA 3FMGL 4WFHD 5E1AB 3DX7A 3WHXA 4X6DE 2DTML 4WVRA 5DC0A 5DJAB 1OSPH 4ZYKB 2GSGB 3O3UN 3EW3B 2GTWB 3R8BB 1KYOJ 3FQUB 4F2MA 2R2BA 4BZ1L 1MY5A 4PRPA 5MEOA 4RBPH 3V7MA 1JGDA 4D9RD 1RJLA 4N1CA 2VR5A 3U4BL 1BBJA 5EIIA 3O3AB 4PJIE 3BP5B 2Y7QA 2UV3A 3RWCB 4F7CA 5JORB 3I6KA 1RIHL 4WTXA 2JCCF 4HK0A 3ROLB 3WN5B 1LK2B 4DTGL 5J6HB 1NFDB 1HIML 3EIFA 5EA0H 3Q6FB 3V52L 3GNML 2F5AH 3ILPA 1MRDH 4XGZA 4BSWB 4TSCH 4Q0XH 1ZXQA 2BMKA 3W81A 2IH3B 4LPCA 4OUUA 3KLDA 1N6QH 5CIPB 1ZAGA 3MNZB 4X6DA 4ODUB 2GJZA 3HZYB 4ZS7H 5I30L 3LKSB 4X7TB 2I60L 5H2BB 4WTZA 5D7JB 1DQQA 3BPOB 3E8UL 4I3RL 3FMGH 1YEGL 3MXVH 5CSGA 3LS5L 2W65B 5EU3B 3MV8E 4LQ1A 2YK1L 4HFUL 3L5WA 1BQHG 1KCRH 3BEWB 5FYKD 4P4RB 1JUFA 2GUOA 1BOYA 4W4OA 5H37G 3HZKA 2GI7A 4GQ9H 5C9JB 5ACMA 1X5YA 1YUHB 3QG6B 5SWQA 3MNVA 3U4BH 3I9GL 5B38G 3DX9A 1UCTA 5F1NA 1MUJA 3JWNC 5C0JA 1G84A 4DTGH 5E24E 4HJ0C 2ZUUA 1IGMH 4D8PB 3MUJA 1WTLA 3MRGA 4AG4L 3OJMB 4OLZH 4XNMB 3DI3B 4HV8B 4OLXH 1QUNA 4NUJA 1A3LL 1CGSL 3MV8A 4P2OA 2Y07L 3T2QA 1SEQH 3SDDD 1AXIB 3INUL 5E00A 1IC7L 4K7PH 3IGAB 3G5YB 2YBRA 4I48B 4MSWB 4HFUH 3DBXB 5JIIA 5CGYD 2EDYA 3PL6B 1RIUL 2G5BA 4OZHF 3DURA 4XPGL 1JGLH 4LDOB 5IIEA 5GS0L 4W81A 1JNNL 1PW3A 5JZ7C 1HHKA 1OAQL 3N0PB 3QYCA 2LFGA 2OP4H 4IDJL 1P9MC 3MRLA 3HZVA 4DUVA 2ITCB 5HD8C 4R0LB 4WENB 4L4VB 4LPTA 2IADA 1QLFA 3ARBD 3RWHA 4R26H 2NY1C 1S9VB 3GRWA 2ZOKB 3V6BR 2XWBB 1EEZA 4WNQA 1FZJB 4EOWH 5DMYA 1FRGL 5EO1A 2R0KL 3DUUA 1A3LH 3LD8C 4XMLL 1PLGL 1CGSH 1IZKA 1P2CA 3T0WA 1FCCA 5CEYA 5I1IL 1I9JL 2IG2H 5DFVC 2NXYD 5HHME 2F53D 3H3PH 3BFOA 5DRXA 1D6VH 2DQUH 1V3KA 5DRZB 1OHQA 3OBAA 1KLGB 3GMMA 5DFWH 4JM2A 3VFNB 3R0MA 4CVUA 3FT4B 5D7KE 2E7LA 4ZNEA 1BX2A 4DVRL 1KXQE 3GSXB 3B6SB 4ZG1A 3VCLA 2CO6B 3B2VL 3PWUA 4F8TA 5ISZD 2D7PA 3PGFH 1ZKAA 3LQAL 4R7DA 3FO1A 5EULV 3GMNA 3ZE2F 3U79A 4X0KA 4LVHC 5T1KA 1DQMH 4HIIB 4IRZH 4QXTB 1L4IA 1SJVA 4WUUE 2VXQL 4XHJD 4CN4A 1U36A 4XP1L 4P0DA 3LB6D 5D7IE 4TUOA 4KDTC 1BFSA 1D5BB 3OHXB 4CW1B 1S9WA 1SQ2N 3PIQA 4RFNB 2P5WD 4IJ3C 5I1IH 5DTFA 1AFVL 2X4OB 5FO9A 1FL6A 1OT1A 1U58A 3WO4C 5E8OB 1PD6A 1S7TA 2YR3A 4YHPB 1FO0B 3WFCL 4BH7B 4DGVL 1ES0B 1IGTB 1ZT1A 3F12A 2IEPA 3VFTA 4ZPVA 2BSRA 2D2OA 3UTPD 4DVRH 3HC0B 3HG1B 4UBDC 1EEQA 1IAIL 1PKQE 4NO2B 3WV0A 5JMRA 4H0IA 2R2CA 4WUUA 5LAXA 5GGRY 3RX8A 1I8KA 5D7IA 3RBSA 3P11H 1FFNB 1ZE3C 2CRYA 1OLLA 1XCTA 4RFEB 4ONHA 4QTHB 2NY4D 3KNBA 4XP1H 4EJ1C 2ICEB 4U3CA 1ZANL 3MRBB 1Z5LA 5KTEL 3K3QA 4QRSA 1NMAH 1QSFA 2Z8VC 6FABL 4OFYD 4MAYC 3LEXB 3BYYA 1ZS8B 2OXGA 1C5BH 3WS3B 5C2BL 1JHTB 3UJIH 3DGGA 1FVEA 3BWUC 3RQ3A 1MCNA 4IOFC 4XVUC 1LO5A 4ODBD 3TO4B 3P9WB 4DGYH 2C1PB 5J6GA 2FSEA 3MLPA 1T1XA 4O02L 5CEZL 5MERB 4YR6B 3I02A 3V95A 1D3CA 3H42L 5T5NG 4Z8FH 2F54D 1CYGA 1T80A 3ISWA 4AZ8A 3PXHA 3SJVA 35C8H 3LEYH 3LN9A 4K7PY 1RJZB 1RUMH 1AQDB 3V5HA 5F6IB 4IRJB 4TUJB 5FO7B 4MCYA 1CG9B 3U9UA 1IAII 3PQYE 3VI3E 4M4RA 4PJ7B 4Y5YB 4J6RH 5T1LB 5GGTL 4LVNB 4U6YA 1G0YR 5DEGB 3MACH 2A1WL 4JLRA 2OZ4L 4RZCB 5KTEH 2BSSB 2ERJB 1YMMD 4ZD3L 5F44A 3D3VD 4G6JH 4PS4H 4U1KA 1NC2B 3OWEA 4N9GB 3NAAL 1RZJL 3MV9B 1JPGB 4QY8A 3NCCB 4F57H 5C2BH 4S0TD 2Z8RA 4X6CE 4XNZC 1NEZG 4F15C 4ALAH 5BRZD 3VGFA 2PYEB 4C55A 4X99A 1MRCL 3G6JB 4LNVA 4LK4A 4EIZC 3P4MB 4NC1E 1QRND 3RDTB 3QCTH 2MQ3A 3MRPB 1CE6A 1QBBA 5EBGA 2EYTB 3H9HB 3SGEH 2VH5L 3AFLA 5E5UB 3RWGB 5LGJA 2X4UB 4OCXL 2QQNL 4YHIB 5FCUL 1QZ1A 2WQRA 1UB6B 2YWYA 5MI0B 4DCQB 1QYGL 1Z6JT 3ZHDA 2CDEA 5A16B 2JIXD 3CSYA 4KZDH 5AZ2L 1DFBL 4GBXA 1NUFA 3V79C 5GGTH 3JTTB 4JG1H 3LDBC 2W0FA 1K8DB 3MUGB 1IEHA 3L7EB 1J05B 4C83A 4PUBH 3NAAH 3MYJB 4UIKL 5E99H 4NFBA 3BWAB 4NQED 1CXLA 3S98A 2J88L 2OL3A 3CFJA 5J1SC 3AS1A 1J7VR 4OD2A 3FKUS 3UTSB 2RQ8A 4O9HL 5DUBB 1XGPA 3AS2A 4ZUUA 2XRAH 3GMPB 4PJCE 2UVFA 3KPLB 4AT6A 4PJAF 4WO4A 1S7QB 3H8NA 4LLYB 5KSAD 2VL5B 4OCXH 4HKBB 2CLRA 2V7NA 1BD2E 1CICB 1WCQA 1X6NA 2OLDA 2ZSWA 4H1LG 5HGAB 1IQWH 5DT1L 4K94L 1D5ZB 4FXGB 3AM8A 2VDMH 1T0MA 1X5FA 5F1IB 3TCXA 1R0AL 4E41B 4Y4FB 3CFKA 5B39A 5C0AD 4XCFL 4P3CH 4WFHE 3NCYP 3PP4H 3NZHH 2D4FA 4HCRA 4PJHE 5HDBF 4YEFA 1AGCA 1RK1B 4ZAKD 3TZVA 4Y4KC 5IKCB 2J88H 3R0NA 4BFGA 2G5RA 4QRRD 1QA9B 4Z7NE 5BQ7B 1GGBL 4PJCA 1YA5A 1UWGH 5FUZH 3UYPA 2GTZB 3MLTB 4EDWH 3SHSA 5HPMA 4X83A 4TVPL 1A2YB 2CR3A 5HGBB 4PYGA 4FTVB 2Z93B 4OB5L 5IFJA 1WV7T 2XXCB 1HSBA 4XP9H 4PJGE 2VDKL 1L9MA 4LSDA 1EAJA 3O2DL 4B0MM 1RD6A 2I9TA 1AD9B 1J0YA 3W5NA 4Y4HC 1F4XH 4K71C 4OZIB 5K59F 3EGSB 1P69B 1RURL 3NFPB 2WINA 1A9BA 6CGTA 3BP7A 3MLSL 2L4OA 4NQCB 1U8PA 1S7XA 2UUDH 4ZPTA 3X17A 1VENA 3SGJA 4MNQB 5E7FA 2IPUG 1AE6L 3IDGB 4XP5H 2P8MB 3KXFD 1U8IA 2FB4H 3WL9A 3SCMB 4OUOA 4KI5F 4PG9B 1CDYA 2Q7YB 2X4PA 4HPOH 1L7IH 2YRZA 2BVTA 3RIFF 4GXVL 3QI9A 3TJHC 3BSZL 4PJGA 1MVFA 1OPGL 4TVPH 1DLHA 4PJ8D 3Q6GH 1FHGA 1F4YL 2AK4D 2EE3A 1QD0A 2HT3D 5DDHB 2P24A 3X12B 3CCHA 5JPNA 3ZDYE 2AJXH 3LEVH 3L3GA 4OQTA 1WBYA 4LDEB 1TQCB 2BRRL 5F9WB 5FKPB 3U30B 3VFWA 4G8EB 3FRUB 1TPXB 2VE6A 3P40A 4OF3A 3WFHB 1BP3B 4I0PD 1ZTXH 1WIOA 5GRVL 1U8QA 4KRPC 3HB3D 1DQJB 4TOYL 4KVCH 1TDQA 4R2GD 5DJ2B 2A6IB 3MPCA 1ZLSL 5E8PB 3K1KC 3MRHB 1X5GA 1DE4A 4GAYB 3Q1SL 4HUWB 2X4NB 2VLMD 3BX7C 3QBTB 3GI8L 4PYHA 1XF5A 3BSZH 3TIEB 1VFOA 1YYLL 3EYSH 1TNNA 1AXSA 3MCLH 3L3JA 3U83A 3VXQA 3FL7A 3MRMA 4X7SL 3U7YL 4ZFOL 4H26A 4PJ9B 1NGYB 3NIGE 3THML 2W59A 3B2UD 4FP8H 4XVJL 5IGXL 1GHFH 5J11B 5D1ZA 5L6YL 1PVHA 25C8H 3GMQA 1ZA6B 3FJTA 4BUHA 5I1AA 3LQAC 1KUMA 3SKMB 1WJ3A 2HN7A 1BZ7B 3MRKB 4FQCH 3TBTA 2DM2A 3QUMA 4I2XB 1G6RH 4JFED 2BX5A 1D9KB 1LVEA 4PB0H 3L3DA 1KTDB 1I9RL 4JPVL 4NKMA 2IQ9L 4QLRA 3UAJC 2CRZA 2DDQL 4MHHG 1NBVL 5ACZB 1U95A 5FUOL 5HHNA 4PRNB 3HUJB 3GI8H 1HH6B 2IFGA 4NN7C 1M7IA 4YJZL 3Q5YA 2HFGH 1QLRB 3ARBA 3KYAA 4PGDB 1MQ8A 1S5HA 4YDVA 5EZIL 5JW4Q 4G8GB 3IETB 4X7SH 3U7YH 4ZDHA 5D2NE 5D7JD 3ZDZF 1RUKL 1B6UA 4HXBL 3OG4B 5EIQA 4ESKA 2FGWL 1QVOA 4XVJH 1M1SA 5GGVL 4EBQH 4A6YB 4GW4B 2Y5TA 1R3KA 5JXAL 4XH2A 3M07A 4RX4D 4RGMB 2F53A 4N9OB 1C5CH 1N5YH 3EYOA 2HG5B 1W72B 1JNLH 3MA9L 1WQVT 1ORQA 1MNUH 4WHYG 2FJFA 5IQ9B 5HHOB 5FYLD 1Q9OA 3EO1B 4NN5C 5D70L 4UT7H 4V1DB 4ODXB 1CQYA 5ISZA 3HR5A 4Z5RB 5T1MB 5B21A 1C12B 4RAVB 1I3RA 1MHPH 3TV3H 2HWZH 4D0DA 2IF7A 5IG7B 4Z95L 4QYOA 5D2NA 5JIHA 4F8QA 1QSEB 2EYRB 3QWOB 1YEDB 3DSFH 3ZSTA 1A4KA 1U92A 2EIEA 2X4QB 4HXBH 2VLLB 1KCUH 2FH8A 5GSVA 5HDOA 1BVKB 1G0DA 1N7MH 1MCPL 3OTTA 3RIAF 3FFCD 1C1EH 4QEGA 2P5WA 1UM4H 4LCCA 4PJXF 3PHSA 5KOVC