2F9BT

Discovery of novel heterocyclic factor viia inhibitors
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
200
structure length
149
Chain Sequence
b'TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGDERTLVRRNNTFLSLRDVFGKDLIYTLSVQAVIPSRTVNRKSTDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Discovery of novel heterocyclic factor VIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
total genus 33
structure length 149
sequence length 200
ec nomenclature
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f9bT00
3F65A 3JZ7A 4XBEH 1II4E 5GQBA 4O4YH 4S1SH 4XPGL 2R2EB 3UJIL 4PRNB 5AD0B 5IEKB 3BPLB 4XPTH 2W9EH 2FZ3B 3KPRA 2R4SH 1EFXA 4AIZB 1CGUA 2IBGA 4GSDH 3L3KB 3AY4A 5IKCB 4R6UA 3TO4A 1QBBA 3ULUH 2QSTA 1PQZB 5HYSA 2H32A 1UJ3A 4HS8H 4JFED 1NCNA 1P6AB 2BNQA 4GKNA 4GAGL 4TVPH 2R1YA 3BRGC 3C5ZD 4G5ZH 1VFAB 4PJ5E 1BBDL 4NUGL 2R1WA 3NZHL 4Q9RH 1M7DB 1JZ5A 1IT9L 4IMKC 4UDUA 1I1AC 2NR6C 2DLHA 4JO3H 1U58B 1MFCL 4LPCA 3S35H 2HLAB 4QHNA 3UAJC 5HHQA 4NN7C 1P2CA 3NH7L 5EBMB 4PUBH 4D9RE 5BVPH 1S8DB 2XI9A 4E0RA 4PGBA 5EOTB 4KK9D 1F90H 1CK0H 3CSYA 1J1PL 4LSUL 1OAQH 1U8HA 2FEDD 4WUUA 2Y6SD 1QTYT 15C8L 1HEZB 5CZKA 4MJIA 1UM6L 5FDWA 4FQPA 3TBYA 1N64L 5HI4C 4XNQB 2GQHA 3KXFE 3ECBB 5E9DD 2JB6B 1RZ7H 1BD2E 4I9WD 1V7NL 3RHWF 4RNRB 1EPFA 1FPTL 2ILLA 2B2XH 2WP3O 3IDXH 5I1CH 2YKLH 4N0UA 2OR7A 4S1RH 2R29H 5DC9B 3GEWB 1KCVL 5AWNL 3IB4A 4B0MM 4HUXB 4ZAKB 2GW5A 4WFEE 2M2DA 1I7ZA 2XNAA 4HC1L 4JRYA 5FV1L 3PDOA 4B7IA 3FQNA 1UM4L 3PWUA 4M8QA 1MCOL 3QDGB 1U8PB 3O2WH 5LGHL 4NSKB 4O9HL 5CJ5A 3Q48A 1ZXQA 3W0WB 4F33B 1CR9H 5D6CB 1BOYA 2XOTA 3MV7E 1J8HE 2YD2A 1GAFH 4ZSOE 4WCYH 1X5IA 4UOW0 4MXQC 2DS4A 5SV3A 3HHRB 3E1F1 2V5TA 5IR1B 2IQAA 1U8NB 4KJPD 3KPNB 2DQFA 4IRSC 1OTTC 4XAKE 4NKIH 4QHKJ 1PD6A 3RA7H 4OZGF 3U9UB 1RULH 4U4BA 5IQ7H 2BDNL 1Q9WB 2YK1H 4BH8B 3SDDD 4ZDHA 4QEGA 1NCBH 5FYLD 4U6VL 3S3PA 1TXKA 2XY2A 3PGFL 4N0RA 1MFAH 1WWAX 2Y7QB 1MJ7L 4XVUD 4BZ1H 1ZTXL 3BKML 1RZJH 2J5LB 4M62L 5F7EH 4MNQD 1UC6A 3U9PL 1KG0B 5F7KC 2IWGA 2OZ4H 2IH3B 3A6BH 3QIWC 1FZOA 1JIBA 5DD3H 4Z7QE 3BN9C 3U6RB 3F7RA 3WJJA 3Q5OA 1K9TA 2YXFA 2EKSB 4QT5B 2AXHA 3QJHA 4KU1A 2MKLC 3DVNB 3WO4B 1D5IL 2EDXA 2FATL 3FQTA 1JPSL 3GGWA 1CZ8H 4NKDA 5HHOA 1KCSL 3VCLA 1U8QA 2H2PC 4G42A 5SX5K 1MREL 5MEQB 5E2WL 1J1XL 3FB6A 4UT7H 12E8L 1YJDC 4KKBC 3QIUC 4G6AD 2VJXA 1G7JA 4GQ9L 4K3HA 1B9ZA 3L3GB 1T1YA 4QOKE 4OZGE 4X80H 2Z8RA 4KRMB 1J86A 4WV1B 1HXMB 3V8OA 5I16B 4JANB 4JR9L 5DRWA 3MLTB 3X14A 1MVFA 3EDJA 4TSBH 4WWID 3RGVA 3T2NL 3MCKA 3MA7A 4FQHB 5I18H 3MACL 4MAYD 4GKOA 5C07B 3WE6B 1FFOA 5I75C 1T5WA 2FJGB 4MA1C 1ZLSL 2ARJB 2YPVH 2EDKA 1TLKA 3RWGA 4GRLD 1UQSB 2ZPKH 1AJ7H 2BVTA 1EAPA 2EEBA 3ULVF 2MMXA 1DE4A 1S9WB 1HYRC 5C0CD 4Z7VA 1FSKB 2OI9B 3OSKA 4BK4A 4ONOA 3BJ91 1WZ1H 4JDVB 3P4MA 1PG7W 4E41D 2HVJA 5MEPB 3O3DB 4CW1A 1DN2A 3UC0L 3WL9A 2QL1A 2CDGB 5DFVC 4NWTL 4FABH 1DBAL 3GBMH 3O2VH 4NNPL 5DQJB 3ZL4H 2DLEA 3DXAD 3EYQD 4G8GD 5DHVH 4N90E 1XF2B 1BM3L 2FX8L 1UACL 4M3KB 4RGNE 5GS1C 3BRFA 4KMTH 3ROOA 3QHFH 1NANI 1MRFL 5LQBL 1MCRA 2H9GB 4PGDA 2DTSA 1VGKB 2R4RH 4OD2B 3RBSA 2E5EA 5TF1H 1QVOA 1ZAGA 2ZUUA 3ULVE 3FAXA 4HJJH 4M9OA 2YD3A 3KPSA 5GXBB 4EXKA 3MJ7B 4OIAA 3FO0H 4NFBA 4OCMC 1B0WA 2WWMC 3ZKMC 2WM0A 5EFIA 1UKQA 5DURB 4KRPD 4L8DB 3STLA 3TBVA 3L3IB 1DEEA 1IGFH 3SGJA 1F11B 5EO1B 5ESQA 3DURA 3S4SB 2XWBA 3EYVA 1BJ1J 4X6DE 3W2DL 4BQBA 4HWZB 5IF0A 4C58B 4AK1A 2BC4B 2NTFB 5DMIH 2AXFB 1D5XB 1I1AB 2Z93B 4IEFB 3MROB 1MELA 3U4BL 5KSAA 5JR1L 4PJBA 4NN7B 3BESR 3VWJA 3S5LA 1HHJB 4F7PB 1LE9A 4ODHH 1IZJA 3OJDB 4L1HA 2Q8BH 1AGBB 2GCYB 1LNUB 1MCQA 2PYFA 2XFXB 3TVMA 3ZKSD 4MZ2A 5HPMA 1E28A 2XN9E 2A2QT 3ALWA 3VWKA 4OQTH 1A4KA 5EO9A 5DRZB 2FR4B 5FIEA 3VXNA 4APQC 1ERNA 1HI6A 4JFXA 2JIXA 4F8TA 3H0TB 3GSUB 1RZKC 4BA8A 5HYIA 4EOWH 2IMNA 4YDIH 2NNAA 4BKLA 4M00A 4Y2DA 1HKFA 1UWGL 2C1OB 1ZT1A 5FUZH 1B2WL 3LCYA 5DHVB 5EC2B 3S37L 2EZ0C 4U3HA 3MRLB 5A3ID 3NAAL 4Y16D 3T1FA 3DROA 5IB5A 5C2BL 2QHRH 3VW3H 1U3HC 5FYKL 1D7FA 1MCJA 3VGFA 1KEGL 5GGUA 4OFKA 5TDNB 1JHKH 4LCIH 3HZVB 4ZOCA 2EE6A 2QLVB 1UJTA 3QDJB 1QEWA 2BHUA 3WS6A 1B4RA 1YJDH 3ET9F 4X9IA 3HNTL 1PG7X 4XPAL 5I8EA 3HUJF 1CXHA 1PEWA 3G6DH 4MD5A 2VYRE 3RTQC 5DI8A 2DDQH 5DJ8A 1MWAL 1JRHI 3QQ3A 3LKPA 4KDTA 4HMEA 2X05A 2R2HB 2ITCA 2BNRA 1FYTA 2B20A 4X4XA 3L95A 4JFEE 1IZKA 1W0WB 2BY1A 3V7MA 4X9FA 4C83B 4NYLB 3QISA 4QXUL 1IGIL 4PJCF 4HUMB 1L0QA 4DUVA 4IRSB 1T2QH 1LO3H 3RAJL 3V4UL 1UVQB 5D71L 1NMAL 4U1LA 2OQJB 2K9UA 1INEH 2QADD 2FYYB 2R0ZH 2PYED 4WHTB 3KHOA 5ANMA 5ICXA 2WNGA 1XH3B 2VAAA 4D0BB 2GITA 1GGIH 2NXZD 5GGTH 3QNZA 1U8KA 1X5AA 2YD9A 3RDTA 1J05B 2A77L 5GRUL 4U1SB 3WXWL 3QIWB 3R4DA 3G5ZB 4HGKC 3HUJE 5JW3L 5F1OB 4OD1L 2NPLX 2F15A 2VDPH 5TH2A 2GTZA 4NFDA 1HHGA 4M6AA 3HC0A 1T5XA 2BRQA 2UYLA 1PVHA 1NBVH 1PSKH 1Z9MA 1NCCH 3GMLA 4Y19A 5E9DE 3SY0B 2DQHH 4HEPG 4I9WE 3MV8D 1HKLH 4YHMH 4H25A 4LRNL 3STZB 5HGHA 4HMDA 4XNMB 2ZSWB 3QIUB 2GI7A 3JTSB 2DLFH 4PRPA 4U6HA 4XGZB 4KDWA 2E9JA 3GO1H 1A6ZB 1Q72L 3LN5B 3ARXA 1HZHH 1HDMB 3BX7C 1DVFA 1KJ3L 1C5CL 1UADC 2NLJA 2DI8A 4JPWL 3HI1A 3DX7A 3D69B 5C09B 5IUSA 4EDXB 2ATKA 5L88L 5I75B 3E6HB 4OZFH 4MA1B 5GS0C 3C08H 3PQYD 1OP5H 3DVGB 4HG4K 3BGAA 3KYAA 4L8SA 4MMZC 2EYTA 4ISVB 1NANH 3S36X 3BKCH 1J0YA 1IEBB 1QFOA 4CMMA 5IM7A 2DOCA 1G9NC 3JV0A 1R0AH 1TTGA 4S11A 5GRZA 1LO5A 2YWYA 3BEWB 1S5HA 4KVCH 3MGOA 4GKZA 1LEIB 2XQBL 5FYLE 3BWAB 2BVQB 3FTGB 1FFPB 4J3WA 5CP7B 1RZKH 4GRWE 1F2XK 4QY8B 4MNQE 2GJZB 2GUOB 3MRIB 5ADOH 1LVEA 4H8WC 3VRJB 3ZHLA 4OCYH 4OF3A 4Z7VF 3QDMD 2GTWA 3BZDA 4RX4A 1NDGA 5GS1B 4FQ1H 1NGZA 3EO9L 5F44A 5FHBH 1FP5A 1CLZL 4OGYL 1UZ8B 5DQ9A 4CAGA 5E2VH 4QRRA 1JF1B 3R0MA 3NCEB 1TZGH 5CZXC 4OGAD 4XNYL 2UWEF 5KSBA 1AGCA 5DD0H 5B3JF 3WUWA 2XIDA 2J8UA 4G3YL 3IF1B 4XAWL 4X4YB 5IFJB 1B90A 3FHAA 3QUZC 3I85A 4BUHA 4PJXA 4KV5F 2Q87A 5C0GB 4XWGL 3VRIA 5FHAH 2AJVL 3MLZL 3BH9A 3FQUB 1EHLL 3RBGA 1CGSH 2DTMH 3H9HA 1L7TL 5E8EB 1AXTL 3RIFK 5FYJL 4HK0B 1NCAL 4P4RB 5LGJB 3U4AA 1UWXH 1HH9A 3UZQA 3UXFA 4P46D 4XRCB 5C0CE 4OAWB 2EYRA 4GG6B 2I25N 3OG6B 1OP3H 5DDHA 1OM3H 3IDGB 1T1XA 1S7QA 3EAKA 1AIFA 1NMCC 3KJ6L 3WXVL 4APQB 4OGZA 4E41E 5FO8B 5FO7B 2BY3A 1DANT 1JRHH 1FVEA 4JN2A 4NO3A 1GGTA 5BRZD 3OF6A 2ADGA 4F7MA 1BP3B 5IJVB 3G6AA 5B3JE 3P9LB 5CEZD 4LKXA 1P7KA 4ACPA 4O58H 3RJQB 5AYUH 1S78C 4LGSB 1A9EA 2HA1A 3OAUL 2PF6A 3UJTL 3DXAE 2YSSA 3QO1B 3PWJA 4G8GE 1LEGB 1G7HB 4O2FA 4JFDB 4Z8FH 4P57A 3VXQB 3T3MF 3DYOA 1CGXA 2NY5L 4FNLH 5D7LD 2QQNH 1U92B 4NO2B 2AJSH 1NBQA 2O93L 5HD8C 3SGDI 4QRPD 4WW1A 1W8NA 2VLLB 3EZJB 5TF0A 1E27A 4NQCD 4YPGA 3RTQB 3F7YB 3UTQB 5F1SA 3SKOB 1A9BB 3DO7A 4FQIL 4MA7L 4MWFB 4OZHB 4KFZC 1NMBL 3IJSB 1X6NA 2AABH 2WBJC 5AZEL 1CFTB 5K9QI 1YEFL 1QBMH 3U30C 2HT4C 5DTFA 1AP2B 1CL7L 1SYVA 2CRMA 2VDMH 3GSQB 4Q6IA 5K9KB 3TN0A 3GI8L 1ULVA 2FB4H 4X5XA 1I1YA 3J7HA 4PYHA 1AFVH 3BI9X 1ZVSB 3WHXB 4FFVC 5EPMA 3T3ME 2PW2A 3MJ8B 4YXKH 1DBML 1FV1B 4Z77A 3SO3C 2X9XA 2JCCB 2BNUB 1JMXA 2Y9RT 1LO2L 1YY8A 2NY7H 4WO4A 1XIWA 2FHBA 3VFUA 4KKCD 5IJKC 2G60H 2P8PB 4FS0A 1PJ9A 1MCHA 1SJXA 2OTUB 5B22A 5JXED 1A7PH 1D9KA 3BE1H 5KZCD 1JUFB 3HG1B 3T04D 3WFCH 1JGVL 5BVJA 1JNHA 3T0BA 4JY6A 4R7NB 2DQCL 1YYMH 4MA3B 3U7WH 4QXGL 2FEEI 3HZYB 4LVNB 1SM3H 3WNMA 2E27L 2R56H 2WQRA 4P5MA 2R2BB 1YC8A 2PW1A 2GKIA 1T0NB 2ADJB 4MJ4A 3VE0B 5FCUL 5CCKH 1N59A 3P2TA 4LDOB 4HPYH 4IOIA 4K3EL 4KI1A 1AQDA 4MNHB 1HHIA 4F9PA 4J3UA 5JUEH 3VXSA 4NZRL 2IADB 3D1MC 3ES6A 3BGFC 3QCUH 1RUKH 3OAZH 3KPOA 3EO0B 1WIPA 1GZPB 1ONQB 2DQIL 3SBWC 1U95A 4ZMAT 4MHHI 3EZ8A 2IJ0C 3GHEH 1YEDA 3F7QA 1KCRH 4XC3H 2NW3A 3OXSA 3WJLA 3WIFB 4YDVA 1QQDB 5DC4B 5JDSA 4UT6L 1AR1D 4KROD 3QCVL 2YD6A 2PYEE 3H9YA 5H35B 2R23A 5JQ6L 1CD1B 4JQVA 2DQJL 3WIHL 4M5YH 5HDQH 3LEXB 2QKIA 1XCQB 1MNUL 4Z5RB 4DAGH 4HFUL 3RI5K 1TZIA 4KJQC 1K4CA 4ZS6D 4PGJA 1F4WL 1TVDA 1EERB 3ZYZA 1MJJA 2DBLL 4X9GA 4GG8B 1NUFA 1OAYH 1I3UA 2YMXH 5DVMA 3ROLB 5ID1B 4WEMB 3MYZA 5E2UL 2ZUYA 2BOBA 4NC0B 1IQWL 4KVNL 1GCFA 3FB5A 4HC1A 3MV8E 2DYPD 2YA0A 3O4OC 1JZ2A 1RHHA 4WW2A 3HC3H 5FA4B 1MRDH 5F72S 3KS0H 4RFOL 3QUZB 1J1OH 2IH1A 4MB3A 4K7PY 4UTBL 3AAZA 4PJIB 1I9IL 2ATPB 2AP2A 4BSWB 5BO1H 2HFGL 4WHYH 3T65B 3MRMB 3D3VD 4CU7A 2YA1A 4P9MH 2UZIL 3VU2A 1JHTA 4MX7A 1BF8A 3C8HA 3FT3B 5IHLB 4XP9H 1P5VA 4K8RC 2COQA 3PQYE 4I2XE 3O0RL 4GW4B 1WAAE 3KYOA 5IROA 4KPHL 4HIJA 4GS7C 2YBRB 3BZ4A 4JFFD 3MLSL 4KZDL 5KTEL 4Z76B 2H2SC 4TVSa 2ZCHH 2DM4A 3SGDH 4EUPA 3TIEA 2IAND 3RKDC 1A4JB 1R3KA 3V7AE 3JTTA 3TJEH 3PDGA 1NMCB 4XXCC 3RNKA 3UTSD 4HIXL 5SWZB 1BD2A 3RPIA 3C09C 1KT2B 1KN4L 5D5MB 5KVFH 1WIOA 2VABB 3F58H 2CDFB 1CXEA 5IV2A 4PRBB 1E0OB 4OF5A 4XHQA 3Q3GB 2E7LA 2XA8L 4G6JH 3BKJL 1DN0B 5ALBH 5TGBB 3BXNA 1UWEH 2IFFL 2GAZB 1LP9B 4HH9A 4JN1H 2CDEA 1T03L 3U79A 3QDME 5DF0A 4FQCH 4HH8A 3ARFA 1JV5B 5K9OB 3V4VL 1ZEAL 3CXDH 1J8KA 5K9JL 2DICA 3IS1X 4D2NA 3LKNA 4DOHE 3RQ3A 5BMFL 4PP2A 1VKXA 4U1NA 5IHBA 1QHPA 2YD1A 1QBAA 2P1YA 4NKMA 1MH5B 1F2QA 5D1QC 2VDLL 2F53B 1DLHB 5ISZD 5CSBA 4NRZA 3DX9A 1I3VA 5T1LB 4YHIB 3QG7H 3S7GA 1T1ZA 4Q9CA 4I0KA 4GKSB 5HDBF 4GRMB 1I8IB 5BS0D 3VXRB 4TSAH 2WBJB 1FNSL 1L0XA 2A0LC 5INDB 1MCLA 4ZPTB 4KTEL 3V6OC 4KHTH 1FLRH 4GUPA 1GC1L 3U30B 4XNXH 5DRNB 4YGVA 5AUMA 4YBQD 5BJTA 1MLCB 2BHZA 3O6KH 4ZS7L 3UROR 2FSEB 4OD3L 1UYWH 3MLUH 4W70A 3FB7A 3ARDC 3V6FA 4X5WA 3SO3B 3FQWB 3B2VH 4M1DL 3B5TA 4JM4L 2BMKA 3CUPA 4PJEE 5IB2A 5J06A 3IJYB 1KB9J 3QUKA 4X7EC 5B39A 1Y18B 1T4KB 4JDTL 1TVHA 1GPOL 5BRZE 5DK2B 4RA3A 5DT1L 3D18B 5CEZE 5C0RL 1BVLA 1FH5L 3BW9A 2ERJB 3DV4B 4WIQA 1S9KC 1PZ5A 3EUUA 4QOKA 4XP5L 2B4CC 1U8OA 2CMRH 3ARBA 3OPZH 4HS3A 1R3JB 2G5BB 1PG7L 5D7LE 3REWA 2VLRB 1IKNC 5B38A 2D7TH 5DD6A 1EXUB 3MRBA 2VC2L 1U6AH 5DJYB 4QRPE 1XR8B 3RL1A 1SVZA 2XG5A 4LSPL 3CZJA 2VE6A 4NQCE 4HFWA 2CIIA 1QHOA 1DBKH 1ZV5A 1P69B 4OQ1A 3S6CA 3HKFA 3BGFB 3AY4C 3SOBH 3PL6A 3TO4C 2N4IA 3FZUD 1FL5B 4HIEA 3H9SB 3P0GB 4V1DB 3D0LA 1NEZG 1UJ3C 2AQ1A 2FBJH 4ZOBA 3RKPA 1IARB 1QO3B 5D7IB 4U1MB 1AGEA 3K4DA 4ZPVA 4KDVA 2EDLA 3SDCD 2CRZA 3VG0H 1ORQA 1NUDA 4R26H 2BSRB 4MB4A 2EKJA 3LEYH 1CXFA 1JFQL 3AU1A 2JELH 5ADPH 3GJFB 2FHFA 1MFDL 1RIUL 3UTTB 5IBUB 4R4BA 1ADQH 3CJJA 4KKLD 5C0BD 1Z6JT 3N85H 1CXKA 2DL2A 1Y0LB 4XVSL 1N8ZB 3PGCA 3U36B 3VA6A 4EI5D 3GMPB 1ETZB 3OB0K 1MCSA 3O6MH 4HSQA 2VNCA 2NY0C 2CR6A 2H1PH 2YPLB 1JGDB 5AG8A 1EJ6A 2G2RB 2X1QA 3O4OB 2AQ2A 4RAUA 1QSEA 1AQKH 4QRSA 1YECL 4UINL 1A7NL 3TYFB 2D9CA 5IMMB 4UOJA 4P2RD 5FB8A 3MRFB 4HBQA 3O45A 1B3JA 1MWAA 5CMAA 1HSBB 4G8EA 4D3CL 4XMPH 1UG9A 4G6FB 4ERSH 1VADA 1I9JH 2O61A 5KW9H 4JQIH 4LSSL 3UPRA 2APTA 1R5WA 4MQSB 2I26N 4NN5C 4X7DC 2G5RA 3QUXD 4G43A 1NGXB 3S36L 3T09A 1T1WA 2XTLA 5EBWA 1H0DB 4WW2F 4G6KH 3OKNA 4NBZB 1F97A 4GS7B 5CGYD 5DA0B 1CICD 1LDPH 1DUYB 2IQ9H 3VMPA 2D4FA 3SDYH 5CINL 3BP6B 4E5XB 3HE7A 4WU5B 4DZ8B 2Y06H 5C0EB 1YMMB 3HRZB 1TETH 4M1CD 1NGPH 1ZK9A 2HJLA 3C09B 1F6AA 4HX1A 3RVVC 2O5XH 1X4ZA 1MI5A 4IOFD 1S3KL 2E7CA 4OLXH 1R5VA 4XP1L 5E2TH 4Q58C 3FFDB 1HQRA 1H15B 5E0QA 2F19H 3B9KD 4I0PA 1Q94B 1TJGH 2HFFA 1S7SA 5IIEA 3KPTA 2AEPL 3TT1H 3EFDL 4NHUB 4FP8L 4YAQA 5HDOA 2B4CH 4R97C 2VISA 4ODVL 3O6LH 3MR9A 4FTVB 3WKML 5D1QB 4M7JH 4YXLL 2XZQL 5DFWH 1K8DA 3DRTB 5I1JL 5INCB 2X9WA 1EHNA 2I27N 4IMLB 4ONFL 2CO7B 4BZ2H 2J2ZA 2F74A 2Q8AL 3SQBA 3EYUL 4MYWB 1TQBC 1UXSB 1X5YA 4OLWH 1G6RL 4Z7NE 1X5LA 2EDWA 2YUVA 4L5FH 3LPFA 3D3VE 1EVUA 1MRCH 2H32H 1IC7H 3RGVC 5HVHC 1JN6A 2JJVA 1VERA 1W0VB 4ZXBD 3TT3L 3FO1A 4B50A 5J3HD 5TE7L 3ARDB 1RVFL 3I02A 2KDGA 3IXAB 4JFFE 1ZMYA 3VI3F 4HXBL 3SJVB 1KENL 3MCLL 2A9MH 1WVZA 4ZO9A 2IANE 3FN9A 4XBGA 3TNMB 3C6SA 3IAQA 2FX9H 3UTSE 1FL3A 5E9DA 3O3BA 1A3RH 2VZSA 3WBDA 1FIGH 5DSCB 1VACA 3EDEA 4LDEB 4JZOA 2AGJH 4POZC 4ALAL 3TPUA 2R0LH 4RFNC 3HI6H 5ICZA 1BX2A 2AJZA 1T80A 5GGSA 4RBPH 4MD4B 2AXGB 4RMQA 1HWHB 1ZLWH 1QSFD 1AR2A 5ACMA 3TA3D 4X7SL 2SEBB 4L4TD 2DQUL 3OL2A 5F8RC 5IVXE 5F3BA 1CFSA 4QRUA 3WNLA 4NCDA 5A1AA 5KS9F 4KKNA 5D7KD 1MCFA 4S2SA 5ISZE 1MIMH 3VI3E 1O7SA 2X7LA 5EU7E 3KPRB 4Y1AD 5FGSA 3TEUA 1EFXB 3DGCR 4OFPA 5B4MD 3FO2A 5BS0E 3TO4B 4YDKL 4UIMA 3VI4E 5HYSB 1R3HB 2H32B 3QIBA 3T8XB 2AEQL 4HLJA 1UJ3B 3LH2H 2IBZX 4Y5VA 4UT9H 2BNQB 1OPGL 4GKNB 4NKOA 3SGJC 3GHBH 4PJ7F 2BVOA 1KTKE 2R1WB 1RUQL 5GGQL 5GRYA 1IM9A 2I9TA 1GRWA 2C4FU 4S1DD 4UDUB 2CRYA 5C6TL 3HRPA 1U8LA 1ITBB 3CCHB 5KSAC 2VLJA 4QHNB 5HHQB 2A74A 3VWJC 1P2CB 1CIDA 3WD5H 1I85A 1ZE3C 4E0RB 4PGBB 3TVMC 2P46B 4YHNA 2DQEL 1U8IA 3TYGL 3CSYB 4YHLH 3QUYD 3VWKC 1IJ9A 2AK1L 2OLDA 4W81A 1HXYA 1EBAA 1U8HB 4WUUB 5CJ8A 3I50L 4MJIB 1Z3GH 4PJ8C 3MXWH 5FDWB 3BZFA 1DQMH 2H6PA 3TBYB 4YLQT 5CJXA 4J12A 2NY0B 4Y2DC 2CLZA 5CKGA 3QCTH 2AKRB 1ACYH 4FZEH 3VXMA 4EI6A 2VDOL 1DTUA 4PJ7E 4N0UB 2OK0L 2PO6D 5LBSL 3RUGF 2X1PA 4YWGH 2HKHH 1I7ZB 5T3ZD 2CO6B 2XNAB 4JRYB 3PDOB 5T3XH 3DETD 3FQNB 3VGAC 3WS6C 2NZIA 3PWUB 2CXKA 4M8QB 4PP1D 3FQXA 4M43H 3WFEL 1QFUH 3QULA 2C26A 3F6IA 1SY6H 4WEBH 4XVTH 2NY1D 4M6OH 1X5KA 3BIBX 3CZFA 1YEHL 4KDTC 4XP4L 1R3LA 3MGTA 1KTRL 4UILH 2Z35A 1KCKA 5EWIL 3SE4A 2IQAB 4WNQA 1F58H 3AS2A 3W82A 3CFIC 2DQFB 5EUOA 5I1KH 1F4YH 1OLZA 1CBVL 4AJ0A 4ZDHB 3KYKH 2VXSL 4TOYL 3OHXA 4FXKA 4ORGA 4WTWA 5C08A 4XMKH 2IGFH 3CNKA 5C0BE 2P24A 2EDNA 2VDRL 5I74C 3RDTC 1VHPA 2XXMB 5KVDL 1TNMA 2WAHA 4R97B 3AREA 4JHZA 2UZXB 5DQDH 1RURL 3P4NA 4P2OD 1JZ6A 3EOYG 3QJHB 3AVEA 1EMTL 2KH2B 1MHCA 4X4ZA 5I15L 4EN3A 3FQTB 5B8CA 5DO2C 3CVHL 4NKDB 5HHOB 3GFUA 3VCLB 1U8QB 4L29A 1MAMH 4G42B 5E8DL 4P2RE 2XKNA 3FB6B 3WKNA 4GAJL 1E6JL 5DUPH 1TQBB 1G7JB 1F8TH 1T1YB 3MSPA 4JREC 4EXPX 3SE8L 1V8HA 1BHGA 1HINH 5DRWB 3O4LA 1OB1A 1CE1H 2QTEA 3X14B 1DVFC 3RGVB 2HH0L 5HVHB 4ZFFA 3HTLX 3MCKB 1W8OA 2GEEA 3MA7B 3NPZB 2W9LA 4JRXD 5E95B 1FFOB 1T5WB 2J4WL 5I8OH 4GO6B 1U3ZA 3RWGB 1E4KA 4AQOA 1DCLA 4C56D 5FECA 1EAPB 5F21B 3WIHA 2VERN 1DE4B 1MCCA 3MV9A 3O2DL 5IT2H 5KVGH 3W11D 1AXSA 4Z7VB 3NPSC 4JKPH 3VFVA 4L9DA 2X40A 1H3WM 4R4FH 3P4MB 1DLFL 5DHYA 3SHSA 4XWOC 3U82B 4WU7A 3DVIA 2HVJB 4RFNB 4CW1B 4LQFL 4UTAH 1K5NA 2VLMD 1MY5A 3QRGH 3WL9B 1OW0A 3BPCA 1GHFL 4MZ3A 1W72L 2VN4A 3K1KC 1AE6H 1BECA 2Q6WA 2K7PA 3DNKA 1OQXA 3IFNH 2CSPA 5D70H 4W6XB 1H3XA 2GYSA 3CMOL 1QFWH 4TULH 1J11A 4Z7WE 3A6CH 3ARTA 1MJUH 3ROOB 3BPOC 3PE9A 2X1OA 3UCRA 4I3SH 4PGDB 4QCIA 4NQDD 4CRPA 2GJ6A 3HZMA 1QVOB 2V17L 5FDYA 3KPSB 2O5ZL 3B8SA 1YEEL 3SDAA 4PLKC 5A16A 4X98A 4N0FA 5K33A 5EFIB 3STLB 3TBVB 1DEEB 4XPFL 2OYPA 5E5RB 5D8JH 3M8OL 5ESQB 3DURB 2XWBB 2MPAH 1K6QH 3EYVB 1H8OA 3AMLA 1HIML 1IGJA 4PJFB 5IF0B 3MRNA 2I5YH 2XKUA 3FL7A 4RWYL 2MQCA 5ECJE 3K46A 4M03A 1OAUH 4X6FA 5KSAB 2HTLD 5GJSH 1DEDA 4PJBB 2OTPA 3VWJB 3TCXA 3N1PC 3S5LB 5SWSD 4BK5A 4LCWD 1LE9B 3WDJA 4M6NL 2PYFB 3TVMB 5HPMB 1E28B 2BSSA 4EKXA 2VXVL 3VWKB 4X7TA 1A4KB 2WWKT 2NZ9D 2Y07H 5EO9B 1RIHH 1ZT4A 4UZGA 4OF6A 3VXNB 1YY9D 1HI6B 2PTUA 4JFXB 2JIXB 5E6YA 4PJAA 2DF3A 4B41A 3C6LD 1FJ1A 3PUCA 2AJ3A 1A6PA 2NNAB 4BKLB 4Y2DB 4D9LL 2W59A 2HMID 1ZT1B 1BWMA 5TE4H 3OXRA 1QSFE 5IEHA 3T1FB 4L4TE 3N50A 3DROB 5IB5B 4KXZI 1BGXL 4NC1E 1JPTL 1MHPL 2G75A 5DMGD 1S9XA 3VD5A 3WLWC 4AG4H 3VFGH 2OBGA 2Q7YA 1QRNA 5GGUB 3VRLF 3ZTNH 4HXAL 1C1EL 3QFDA 4ZTPL 3PHSA 5FGBA 1QEWB 2MNUA 3VGAB 5D7KE 2MQ0A 2XRAL 2WMPA 5IBTH 2JJTA 3TBWA 4LL9A 5I8EB 4LIQH 4MD5B 2I60H 1IFHH 4Y1AE 5CJBA 1XT5A 5DI8B 4P3CL 3S3SA 2YRLA 3IGAA 5DJ8B 5FO9B 4QTIH 1P4BL 3QQ3B 4OZFG 3LKPB 1AC6A 4NC2B 3BOVA 1P4IH 2VZTA 2ITCB 2BNRB 1G9MC 3P11H 1FYTB 4LVOC 3GIZL 4X4XB 3L95B 3ZT6A 5EU6A 3GMOA 2X10A 5SX5H 1N5YH 1NFIA 4U1JA 1OD9A 5GS0L 1MIEH 3CK0H 4GT7A 4MJ2A 1YQVL 4U1LB 4RMUA 3TLRA 3WNNA 2HT2C 3DECA 4XB8A 3D9AL 3TN0C 5EU4A 4CJ0A 5ANMB 1FGVL 5ICXB 1J0IA 4M7KH 1G9NL 3QQ4A 2VAAB 2GITB 1SJHA 5GGSY 2Y5TA 3QNXA 3QNZB 3QT2A 1U8KB 1N6QH 2HP4A 1F42A 5I74B 3RDTB 3K3QA 1RUPL 4WO4C 1A7RL 1XIWC 3LKQA 4LSTH 3B9EA 3WHE1 3HFML 4L4VB 1Q8MA 5I1GL 2GTZB 1HHGB 3HC0B 1T5XB 1KULA 1H3PL 5EOQH 1J5OH 5J57B 2UYLB 3VMNA 4P23D 1D9KC 1U8JA 3GMLB 3DUUA 2KPNA 4Y19B 1YNLH 2ITDA 2AAVA 4BZYA 4GW1A 3RPKA 4H25B 3CU7A 3QHZH 3GNML 5HGHB 3OJVC 3TESA 4PB9L 5T3ZE 2Q76A 1IGMH 3QDGD 1I4FA 1DBBH 4HT1H 4U6HB 3ULUD 4JREB 1WGOA 4XCYA 3DUHA 4XCCH 1DL7H 1DVFB 4JHWH 5JLZA 4TVPD 5IVOA 4KGJA 2NLJB 1NFDE 4LARH 3KYMA 3TCLB 3TH2T 3HI1B 2W9DL 4DQOH 2FWOA 1AGDA 3DX7B 3IU4L 3IXTA 4CU6A 2HRLA 2ATKB 4F9PC 1INQA 2F58L 3MRRA 2OR8A 5DK0A 3ZHDA 4AY0A 3RWFA 3QXDA 3EOAA 5E1HB 4LLQA 3LRHA 4TUKH 5EZOL 3IAPA 1CLOL 4U33A 3G6JF 4HUKB 2EYTB 2WIMA 1U8NA 2EH8L 4OTXH 3WN5C 3NPSB 4CMMB 5IM7B 1YPZE 4WFHD 3GBNL 1JL8A 2V6HA 2HRPL 1LO5B 3WJLC 1S5HB 4XPHL 3OKMA 4QHMA 3MGOB 4GKZB 1MEXL 5F9OL 3SGEI 4I4WA 3RFZC 4R4ND 1I8LA 2R8SL 5IESL 4JG1L 3BUYA 3BDBA 3DRQA 2GTWB 4NIKB 5CWSA 1NDGB 4LP4A 1NGZB 4RFEA 3G04A 3CFCH 3BPOB 3W5MA 3OZ9L 1A1OA 5DGRA 5L9DL 5DQ9B 1I9RL 4QRRB 3QPQD 3DSNA 1ACZA 1RJCA 3G6JE 4ODTL 4AYFA 5KSBB 1AGCB 3L3OA 3V9FA 1VPOH 4JM2D 4WW2C 1GGCH 3UJJL 2J8UB 3FHQA 1IBGH 3WUWB 4F7CA 5I6XC 1RPQA 4XI5D 3EJYD 1MJ8H 5GHWL 2VXTH 2HTKC 4PJXB 5C07D 1G9MH 1L4IA 3AS1A 4P3WA 3MUY1 3VRIB 2A9NH 1RD6A 3BH9B 3MO1A 4S10A 4JRXE 3GM0A 1G7QA 4GXVH 3BJLA 3H9HB 1T04A 5EG6C 5CSZA 5E4EC 3JUZA 5F96H 3T0VA 1CFNA 4P4KA 3NA9H 4AENA 5IROC 2FNBA 3X3FH 4C56E 5FOBA 1HH9B 3GKWL 1UH4A 4J4PD 3Q6GH 2Q20A 3NZ8A 1LDSA 5CBEA 2EYRB 4R2GC 1OGAA 1T1XB 2Z0BA 1YA5A 1S7QB 5JMRA 1AIFB 3D2UD 3IKKA 3EHBD 3S8WA 4NHCL 1GOFA 1A5FH 5IG7A 1QSZA 1FVEB 4JN2B 5D2LA 4FXLA 4NO3B 3CX5K 3BDYL 5EZLA 2ADGB 2VLME 4F7MB 1KC5H 3G6AB 3IU3A 5I71C 3LMJL 1CN4A 4LKXB 5AZ2L 1P7KB 5IOPA 2E7LC 1C12A 3P30L 3KPPA 1A9EB 5A2FA 1NCDH 3LIZH 2YSSB 3PWJB 4OLYL 4NGHL 4O2FB 4P57B 3ARFC 3K4ZA 4XPGH 4R90L 5C7XH 2QSVA 1D6EA 4PTTA 5IHZA 4PJAF 4JZNA 4WW1B 1MFEL 4NQDE 3TPKA 1E27B 4YPGB 2DN7A 3PWPA 4O5LL 1G6RA 5DURD 5E8NA 4XZUB 3FFCE 3TV3L 4HPOH 2C1PA 2DRUA 1DFBL 4LVOB 4GAGH 3DO7B 4NQTA 5JOFA 5FM4A 3MRGA 1WTLA 4QRTA 4X8JA 1BBDH 2NR6D 2X1XR 1IT9H 3IKCA 3QA3A 5GSRA 3UAJD 4C4KT 1NFKA 1MFCH 3GSOA 3DMMD 5DTFB 4OB5L 5IB4A 1SYVB 3K1DA 4Q6IB 3TN0B 3NH7H 2HT3C 3OKYA 1KIUA 3EFFA 5SWSE 1I1YB 1GZQA 4KQ3L 3EYOA 4LCWE 5EPMB 2PW2B 3OJDA 4AQ1B 2DJ4A 5HXMA 2WBWB 1J1PH 4Y5XC 4Z77B 3AROA 3K2MC 2VRAA 4K7PX 4OFIA 15C8H 4ZD3H 1YY8B 3NIFF 1KNOA 4WO4B 1OGTA 3L3JA 1XIWB 5HI4D 1UM6H 3HCVA 3ZHKA 4CVUA 4OCRL 3VFUB 5EA0H 4ZG1A 2UV3A 1N64H 4X6BA 4R96A 3O8XD 3V4PL 1PKQA 3AM8A 3PJSA 1WF5A 4DFHA 1OOAA 3DVFA 1BFSA 1NAKL 3HZKA 1D9KB 3GMRA 1V7NH 3QPXL 1P4LA 4JPKL 5BVJB 1JNHB 4QHUA 3CFDA 2P7TA 4JY6B 3PWLA 5AWNH 1KCVH 4BM7A 4QGYA 2KBGA 4P5MB 4HC1H 4X8XA 3GIVA 1QLEL 2PW1B 3G5VA 4MD0B 4PRHA 1OARL 5LGHH 2ICEA 4O9HH 1N59B 4XNUL 1I75A 4DVRH 3SGEH 2C7UA 4HWNA 4IOIB 1ODAA 4K3JL 1MF2H 4WHYG 1NUNB 1AQDB 1EEQA 1OAKL 3LQMA 1HHHA 4QO1A 1HHIB 1G84A 5EU3A 1F13A 1FN4A 4I18A 2IANA 3QWQB 3VXSB 1P7QA 4JKLA 2VUOA 3ES6B 5CHNA 1PDKA 3WS3A 4IRSD 1OTTD 3PL6C 1A6UL 5HHNA 3KPOB 4BSVA 3VXUA 2CKNA 3ZDZF 1EUTA 4TSCL 5FM8A 4Q97A 1YEDB 2ZJSL 2NW3B 1GGYA 3OXSB 3LS4L 5CEXA 3LZFL 4YDVB 1T7YA 5JDSB 4NZJA 4EUPH 4ZFOL 5JPNA 4U6VH 2NW2A 3PGFH 2R23B 3OTTA 2GSGA 1MJ7H 4Y4HD 1KELL 1ZTXH 3BKMH 3ZYIA 2PTTA 1G7PA 4M62H 2QKIB 3QIWD 5M94B 1XF1A 3U9PH 3VDBA 3BN9D 5K9QG 2IFGA 2BSTA 1BLNA 1TZIB 3EIFA 5C0FA 5IB3A 1K4CB 2VDKL 1FRGL 1HCFX 4PBVC 2AK4A 1C08A 1MJJB 3WFZA 3E3QC 3SE3A 5J4MA 1K2DA 1A0QL 1D5IH 1KXVC 2FATH 3MLWL 1YDPA 5DZNA 1JPSH 5C9KA 2BOBB 3WNPA 3FB5B 1KCSH 1ZA6A 2EYSA 4YDJA 1N6VA 4U1HA 1MREH 5E2WH 1J1XH 3MLYL 3ZDZE 12E8H 4F58L 1RHHB 4GQ9H 4WW2B 4DUWA 3C9NA 5H94A 5I6XB 5J7CC 2HWZL 2YUZA 3QDGE 4MQXC 4JR9H 3ULUE 1C5BL 1MHEA 4XGZA 1J88A 2IH1B 1BVKA 4NQUA 3AAZB 1BZ9A 1LMKA 4F3FA 3MACH 3IDUA 1JHTB 1ZLSH 4MX7B 5F7WC 3TZVA 2NMSA 1Q1JH 3EDKA 1JWSA 5E4EB 4HGWB 3KYOB 4EIGB 2IPTL 2EH7L 4HIJB 4XC1L 3VFNA 3BZ4B 3T2PA 4EUPB 1JGEA 1KOAA 3TIEB 4R2GB 5C3LD 4PJGA 4GMSL 3GUTA 4WFHE 1PKOA 1R3KB 3HE7C 3JTTB 3MA9L 3RNKB 1IGCH 1XGYH 3RPIB 1BD2B 5DD5L 5L6YL 5DFVD 5IBUG 1CLCA 1WFNA 4LPXA 4ENEC 5I71B 3INUL 4NWTH 1DBAH 2PCPA 4NNPH 4U1GC 1C5DA 3BXNB 4Q6YA 4WHCA 4ZOEA 1QNZL 4HH9B 4I0PC 4LSRL 2CDEB 3HS0A 3PP3H 3RWEA 3SN6N 2FX8H 2MWCA 1UACH 3ARFB 3CVHA 2R4SL 4IIQA 4OZ4A 2Z8WC 3Q6FA 4GSDL 1NCWL 1MRFH 3LKNB 5LQBH 4PP2B 1VKXB 4U1NB 4HUVA 3CFBA 5D2LF 3BIKA 4XH2A 2X4RA 4NKMB 1L7IH 1KF9B 4TVPL 4X4ME 1YNKL 1JF1A 1G7IA 1YNTA 2NY3D 4X6CA 4B53A 4NRZB 3DX9B 4WJ5A 5JIPA 1T1ZB 2P8MA 3HE6A 2QSCL 1VFOA 2R69H 3RU8L 3OB8A 3LQAL 1H8SA 2APVA 3HA0A 4M4PA 1X6LA 1WWBX 1KB5B 3W2DH 5C07E 4YC2C 1JZ8A 3W39A 4GUPB 2A6IA 4YGVB 5AUMB 5BJTB 3PXJA 3U4BH 1OSPL 4UNTA 5JR1H 4PJDA 3O2DA 3ZMRA 1OAQL 4NM8L 1A14L 1JNNL 3H3KA 4HJGA 3FB7B 2EXYC 2FEDC 2Y6SC 4Y5XB 3V6FB 4X5WB 5E2JA 3QFJA 5D72H 5ITBL 4APQD 5F6IC 1OY3B 2CUHA 1OT2A 1RZ7L 1W72A 4Z7UA 2BMKB 1CD8A 3BGMA 3CUPB 5IB2B 3QRFM 3L9RA 3IDXL 3QUKB 3V5DA 5B39B 1UWGH 1XGQA 2EZ0D 1TVHB 1B2WH 2OJZH 1JZ3A 1JI1A 4P2QA 5FV2A 3S37H 1FNGA 3BW9B 3ZTJH 3NAAH 4JFDD 1UB5A 4JFOA 3WUZA 5C2BH 3SQOL 1PZ5B 4QOKB 4OV6F 4Q9QL 5FYKH 1T66D 1U8OB 1KEGH 1TQCC 3ARBB 4HS3B 1UCTA 4LLAA 1U3HA 2P5EA 5F1NA 3REWB 1DSFL 5EOCJ 5B38B 5DD6B 5JW4R 3HNTH 3MRBB 3TP4A 2WSKA 3QR2A 4DGVL 3RL1B 1KJVA 4FQXD 2VE6B 4HFWB 1DQLL 2CIIB 4LSQH 2X4UA 1OLLA 4WI8A 5F7HA 1H9VA 1PY9A 4NKIL 5IW1A 1LILA 2R1XA 4H1LG 4KJPC 3PL6B 4KMLB 4XHJC 4QXUH 3GBLA 3T0AA 1IGIH 4HIEB 3QIBC 3D0LB 2HFTA 3RAJH 4EBQH 4HZLA 3V4UH 4Y5VC 5D71H 1NMAH 2B0SL 3RIAK 3BSZH 4KJWD 4LASL 4X0KA 4TNWF 1S9VA 4XVUC 1AGEB 3RY4A 3A6BL 1JCKA 4ZPVB 3LRSA 1ORQB 5C3TA 3BKYL 4DK3A 3D25A 4L3CA 4N8PA 4PBWD 2A77H 5GRUH 2BJML 3AU1B 1I85C 4OD1H 1K4DA 4R4BB 5ESAA 3HG1D 3GB7A 4JRWA 2FLRT 4ZYKA 1B6UA 3PGCB 4PG2A 4OM1L 5A2JH 2XQYG 4UT7L 1ZGLM 4G6ML 3RRQA 3KPLA 1CL7I 1JPST 2BCKA 2NY5C 3K7UA 4LRNH 1JGLL 1N6UA 2J3SA 4JG0H 4BFIA 5DWUL 4YQXL 3PHQA 4X83A 1WZKA 5FEBA 4RAUB 1QSEB 3QDJE 4QRSB 3OGCA 3DARA 2ED9A 1SQ2N 3ABZA 3HI5L 5FB8B 1Q72H 3O45B 4WFFD 1MWAB 1KJ3H 1ZS8A 3FKUS 4G8EB 5CMAB 1C5CH 4KJYA 3VDCA 3GSWA 1VADB 3AUVA 2O61B 5L88H 3HPJA 4E9LA 3UPRB 5F3HA 1ROWA 1BQLL 1R5WB 4GRLC 1I3RA 2GHWB 2XXCB 1XFPA 1CGVA 2XN9B 5C0NC 4G43B 1T1WB 5C0JA 5EBWB 3OKNB 2EDJA 2H41A 5BW7A 4OJFH 4YHYC 4Z95L 4F7TA 1G0XA 1IKFL 3HE7B 4YFLF 3SE4C 1KPRA 1FBIH 2X4SB 5HYJA 2HJLB 2XQBH 4ZUWA 1F6AB 4HX1B 4YFDB 2A6JA 3GKZA 4UDTA 1MI5B 2D7OA 5E1AA 5DMYA 4HWEH 5F1IA 1L6ZA 2VAJA 2VR9A 1WZMA 2VWEC 4U1GB 1R5VB 1HQRB 1TENA 4I0PB 4N8VA 5FFLA 3S9DB 2HG5A 4OM0L 3N0PB 2HFFB 1S7SB 5IIEB 4TUJA 4HJJL 3QQ9C 3EO9H 4YAQB 3MXVL 1JF5A 3I2CL 1CLZH 4OGYH 2VISB 3AREC 3FO0L 3VJ6A 3MR9B 1R6VA 4XNYH 2W0FA 3DUSA 5TFSL 1K8DB 5L2KA 4NQSA 4KRPC 4EN3C 5I8KL 5B8CC 3QUZD 3CVIL 1N2RA 4G3YH 5CLWA 5F7NC 1FFRA 3MNZA 1FORH 1MFBL 2F74B 4HDIA 5DA4A 2EDQA 2HVKA 4XWGH 5C09E 2AJVH 1X4XA 2WK2A 4M4RA 4YC2B 3MLZH 2ZUTA 1EHLH 2NYYC 1LEKA 4JFPA 4PJ9A 4UB0H 2X41A 4KK8C 4FMKA 4ODSL 1L7TH 4KI5D 1AXTH 1JN6B 2A38A 3W5NA 3IDIB 5FYJH 1NCAH 4PRAA 3ZT7A 4YZFF 3O6FA 1EGJL 2W60B 3FO1B 3IDMA 4WI2A 2LFGA 2XWJA 3I02B 3FO9A 3ILQC 3WIIH 1E4KC 4EOWL 2XWTA 1MCKA 5SWZD 4CMHC 3BQUD 2VZ3A 1GJIA 4AEIL 3KJ6H 3WXVH 4XBGB 1NC2A 1WISA 3C6SB 1T3FA 5I1EH 5E9DB 3O3BB 3LQZA 5HYEA 4JO2L 1G0YR 4OGXL 1S78D 2QHRL 1VACB 4IOSD 4Y16C 4KRNA 4ELMA 4JZOB 3TPUB 1O5DT 1P1ZA 3K4AA 5KSVA 3UJTH 1QBLL 5ICZB 1OW0C 1BX2B 2AJZB 3C87A 5GGSB 4ZQKA 1BJ8A 2X4PA 4M6MH 4NOFA 4YBLC 1KJ2L 3IJHA 1TQCB 2NY5H 4JFHD 1G7LA 5HD8D 4GG6F 2NXYC 2DDQL 5F3BB 1NFDA 1CFSB 4EEEA 2QQQA 1WUNT 1QFHA 2F53D 4QRUB 1Q0XL 4YZFE 1MSPA 5T1LD 2QHLA 2KZWA 4S2SB 5F88A 3KPMA 2N7AA 2X7LB 3VXRD 1WFTA 3OB0H 2WBJD 4MAUL 4OIIH 4ZUSA 4FQIH 4MA7H 5E56A 4I77L 2CIKA 1NMBH 4YEFA 3FO2B 4OCXL 1IEAA 2E9BA 5AZEH 5ACLA 4UIMB 5TQ2H 5HYFA 3SDAC 3HR6A 2HT4D 4MSWA 4WGVB 3QIBB 4N9OB 1I7TA 2J12B 2ZOKA 2ED7A 4GBXA 3MJ6A 4Y5VB 5CBAA 2QADC 4NKOB 2FO4A 1CL7H 1JVKA 2BVOB 4RGOL 3GI8H 5GGTL 3BWUC 3GK8L 4YHKH 2I9TB 1IM9B 5JO5A 4OF8A 4RRPA 4D94A 1J87A 4FHBD 4K7PL 4ZNEE 3B3IA 3MRHA 1TJHL 1FL6A 1U8LB 5TE6L 1DBMH 4RZCA 3PV6A 2VLJB 4EZMA 2NY6D 2A74B 3GMQA 4I3RL 2VDPL 3WFBL 1LO2H 4Y88A 4OZHF 1YZZA 1HILA 1CF8L 4N9GA 3QZWA 4YHNB 1U8IB 2NY4D 4IHOA 2B8OT 1HXYB 4YHML 1WLHA 4HGMA 1CDBA 4YHZH 4HF5L 1JGVH 3ARRA 5EBLA 3BZFB 3C60A 4LDLB 2H6PB 2DQCH 1KIQA 4X5LA 2I07A 4FZ8L 4JQXA 4QXGH 4JFDE 2Z31A 4L3AA 3GO1L 5E6IA 2CLZB 2MFNA 2E27H 2VLRD 5JHDA 4EI6B 2XTJC 2JCCF 5A40E 5MEND 2FGWH 5FCUH 5TPWL 4NCC2 1EXUA 3S37X 2CUIA 3C08L 1D5MB 4K3EH 2EIBA 1CCZA 1MCPL 3G5XA 5FGBC 1D5BA 1BPVA 3FQXB 3L5HA 4GRLB 3MTRA 1Q0YL 2JJTC 4NZRH 3NMEA 4OZHE 5TDOA 4RMTA 3QULB 3H9SD 4V1DD 1GC1C 5C0CB 1DP0A 4HIIA 2ESVA 3CZFB 1CS6A 4DVBA 1CU4H 2YXMA 1R3LB 3MGTB 4YHYB 3LKOA 2Z35B 4OV5A 1EX0A 3F7PC 1FNFA 3NACL 4WNQB 2W0KA 4R7DA 3S5LG 4UT6H 4M9PA 5C70A 2A73A 4KTDL 1FNEA 3QCVH 5A2KH 1X3DA 3FOMA 3AB0C 5JQ6H 4IRZL 1FDLL 2DQJH 5EUOB 3WIHH 3H2WA 1AKJA 2D7QA 4KJQD 4I5BA 2JCCE 1MNUH 1GL4B 4QHKI 3UTTD 2CQVA 4HFUH 5J89A 4FQ1L 1XEDA 1OTSC 2W92A 3EYSL 3OHXB 2Z91A 4OFDA 3DSFL 1E4XH 1BQUA 1F4WH 3PHOA 4A2LA 3GJFA 4ORGB 2RQ8A 1MAKA 5C08B 2DBLH 1J0KA 4NRXA 2P24B 5DJXA 3HG1E 3OKKA 2ICWJ 3NOIA 3OQ3B 5FOJA 5E2UH 3AREB 1LO0L 1UEYA 3QQNA 2YPLD 3P4NB 4FA8A 1IQWH 2YZ1A 1V3KA 4KVNH 5DD0L 4BH7A 5F7YC 1A1MA 4CL7A 1MHCB 4KRPB 4HV8A 2PTVA 4NQEA 4PS4L 4EN3B 4WVRA 5B8CB 5FHAL 4G9DA 1B6DA 4RFOH 4G6FD 2DQDL 4L29B 4EIZC 4WFFE 2XKNB 3RY6A 1I9IH 1L9MA 5T1KA 5FKPA 4HUUB 2UZIH 3U46A 2ZKHL 4QTHB 3QXVA 3O4LB 2JLLA 4NO0A 4NRYA 4ZFFB 1CTOA 2FIRT 3O0RH 3X12A 1NSNL 3T4YA 2H2SD 3MRDA 4KPHH 4P46C 4OZIA 3ARPA 1RAMA 3MLSH 3VH8A 4KZDH 3RKDD 5KTEH 3A67L 1IMHC 3JWOL 1YC7A 4ZFOA 1YMMD 1FFNA 5FECB 3FRPA 1A7BA 3BHBA 3MV9B 4PJIF 5IFAL 1AXSB 1KN4H 3VFVB 4K3DL 5J1SC 2AI0L 2MKWA 1KJMA 3PIQA 2XA8H 1EHXA 4FQLL 3VMOA 4U1KA 3BKJH 5DHYB 2KZ1B 4OBRA 4WU7B 3FONA 1XGTA 2QQNL 2NY2C 2IFFH 1K5NB 3PP4L 3BPCB 3I9GL 1KLGA 4YBLB 1UCBL 2Q6WB 2DBJA 1I8LC 3VXTA 1ZEAH 1J10A 2Y23A 3MNWA 5K9JH 2NXYB 1RZFL 5BMFH 4FTVD 3DHMA 1T7WA 2WUCL 4FQJL 5D1QD 5SX4H 2FH6A 3JUYA 2BERA 4AEHL 5D5MF 2VDLH 1EK3A 4WHDA 4ELMF 3IAGC 5I19L 5IMOA 2AV1A 4KUZL 4QCIB 5GS3A 2ZCKL 3NABH 3CFEA 3HZMB 3T2OA 2A0LD 1LP9F 1I3GL 3S34H 4MVBD 4PJIE 2DKSA 1TTFA 2WIIA 4OF0A 5CUSL 3RL2A 1GYAA 2VDML 3SDAB 5A16B 1U41A 4X98B 4N0FB 1GC1H 2HYMA 4AZ8A 5F1KC 2QADB 1AFVL 3G9AB 3B8YA 4ZS7H 4YXKL 2IC2A 3ARDD 4KI5E 1IGJB 4JEGB 3G5YA 3MRNB 4OD3H 5EIIA 5GSVA 1FVCA 5T1MA 5GIRA 3SJVD 4H0HB 1I7RA 4X6FB 4NNYA 4ETYA 2G60L 4M1DH 1KYOK 4JM4H 5JW5A 4P4KC 4KKCC 3BE1L 5SWZE 1YEJL 3WFCL 5D5ME 1LE5A 1MQKL 2BSSB 4X7TB 4JDTH 5LAXA 1GPOH 3KDMA 2EIZA 3HNVL 5DT1H 4LGPB 5C0RH 1ZT4B 1FH5H 5LWYL 2NX5A 4ZFGL 1LP9E 4PJAB 3QWRD 3BZEA 3U0PA 3M07A 4PJHA 1FJ1B 4F37K 1NJ9A 2AJ3B 2C3WA 3FQRA 5FK9A 1WBXA 2D31A 3OXRB 4G8IA 4JPVL 4K23L 2XTJB 5IEHB 1PG7H 1OAZL 4JFHE 5GJTH 2J88L 1CT8A 1Y6NR 5C0AA 3MRPA 2G75B 2VC2H 1S9XB 2F53E 1U91A 2Q7YB 1QRNB 5D1ZA 3QFDB 4OLUL 1EFXD 4KY1L 2EDBA 1JGUL 1SBSL 1FC1A 4QWWC 3TBWB 3TO4D 2M8XA 3VXRE 4WWKD 3IGAB 2BNQD 4YX2L 4RQQA 5J11C 2B7DT 5CJQL 3T8XA 3X3GL 1TDQA 3MV01 4WUKL 5BQ7A 5ACZA 2LU3A 4JY5L 5EU6B 4JB9L 32C2A 2HLFC 3GMOB 4FOMA 1NFIB 4U1JB 4KC3B 4OLZL 1RQ5A 3MZGB 2YOCA 1M71A 2OSLA 4ZS6C 3CCHA 5EU4B 1JFQH 3L3HA 2VDQL 5JHLL 25C8H 1MFDH 1RIUH 4JAMA 3QQ4B 4WUUD 2R2CA 3H3PL 5IFHH 1YEKL 1SJHB 3IFLH 2Y5TB 3QNXB 4MJID 5HVFB 5J13C 1IC5L 2X6MA 4LHUA 3LKQB 43C9B 4NDMA 4RMSA 2HN7A 3SKJL 1SEBA 5D7IF 1INDL 3NBNA 3AM8C 5J1AA 6CGTA 4PRIA 5CD5D 4JM2A 1U8JB 5T5FL 1J1OL 3DUUB 1IILE 4LMQI 3ZZ1A 3BYYA 1YECH 2ITDB 1EHAA 2LE9A 2VLRE 4Q0XH 2AKRA 4UINH 2M26A 4GW1B 3BD5A 2UUDH 2B1AL 3MUGA 5MENE 4JRYD 4P9ML 3VGGA 4D3CH 4LAQL 5FA3A 1PEZA 5KSUA 3BMWA 1F6LL 4XP9L 1ZGLA 2Q76B 3LS5L 1I4FB 1U8MA 4LK4A 4XT1C 4HQQL 4LSSH 4XCYB 4UUJA 5JLZB 4N0YL 3HNSL 4YNYA 1AH1A 3EJJX 1DUZA 2ZCHL 3KYMB 3S36H 5JOEA 2FWOB 1AGDB 1ZHLA 3H9SE 3IXTB 4P46B 4V1DE 1T22A 1INQB 4RIRA 2F8XC 3MRRB 4OT1L 2VOTA 4I18C 4U2ZA 5DK0B 4HULB 3RWFB 3QXDB 3MJGX 3D2UA 3EOAB 5CINH 2ZOLA 4LLQB 3P0VL 5ILTL 5D7IE 2MHAA 3RVVD 3SDXA 4RDQF 2I9LA 4F57L 5ALBL 3P9MA 1GSMA 1S3KH 4LPTA 4ONHA 5TQ0L 5LJYH 2YD7A 3LHPL 4EDWH 2DLIA 3OKMB 4QHMB 4XP1H 1JBJA 2FRGP 3UTTE 2NY2B 3CXDL 1ZLUK 4OZIF 4I4WB 3BH8A 1JTTA 1OP5K 4JGJA 1T6WA 1Z0NA 3P4OA 4IBLT 4YFLI 2AEPH 2JJSA 4LVHC 3EFDH 4Z0XA 4FP8H 3BUYB 3RVTD 4WY7L 4ODVH 3DRQB 4LU5L 1BJ1H 3WKMH 2YPLE 4LCCA 5JA9A 5CWSB 2IBZY 2E7BA 3SE3C 5EU7C 3T4AA 4YXLH 1AI1L 2XZQH 3U1SL 1JZ4A 3H8NA 4OI7A 4RFEB 3G04B 3UYOD 3V52H 1A1OB 2DIAA 4DN3L 1OAXL 3K74B 5T3XD 1OTUD 3GI9L 4ONFH 2OL3L 4KHXL 2YD8A 5E99L 2Q8AH 3ARGA 3L3OB 3EYUH 4F7CB 2ZUSA 3DMMA 5HY9A 3RGVD 2EE3A 1G6RH 3MLUL 4R8WL 4XX1G 3O41A 5I1AA 2YZ8A 3UBXA 3B2VL 4KMQA 2VKWA 3JV5A 3MO1B 5TE7H 1RVFH 2VLKA 5SV4A 5KJRL 1G7QB 3TZVC 1KB5L 1T04B 4HXBH 5CSZB 3BN3B 3QEGH 1H3GA 1KENH 1R5IA 1YMME 3BAEL 1CFNB 3MCLH 4P4KB 4U1IA 4AENB 3O8XA 4LCYA 2EDTA 5FOBB 3MBXH 4I8DA 3NZ8B 5CBEB 4Y0GA 1N5AA 1OGAB 5EOCL 3H6JA 3OPZL 3FJTA 5IG7B 4S1QL 4MNGA 3U48A 5JIIA 5D2LB 2DWDA 3UX9B 5EZLB 5F89A 3IU3B 1BWWA 5I1IL 5IOPB 2MQ3A 4LLUA 5DVOA 1C12B 2DQUH 2F5AL 3KPPB 1UWXK 2EIEA 35C8L 3V0WL 4FTVE 3NA4A 5DEGA 1P6FA 3V5HB 4IIQC 3UPCA 3X13B 3D87B 1D6EB 3CPLA 4PTTB 5IHZB 3KPSD 4JZNB 5L7XL 4PJHF 1QKZL 4H0IA 3PWPB 1G6RB 4QHLA 1ED3A 3V6OE 5MEOA 5E8NB 1F3DJ 4XPBH 5D7SL 5J11B 4ZUTA 3QNYA 3HE6C 5K59F 2C1PB 5DS8A 1OPGH 2GK2A 5JOFB 3MRGB 4F2MA 4QRTB 3HB3C 1EGJA 4M7LL 3O9WA 3SKMA 1X5GA 4X8JB 3C2AL 3ZT5A 1RUQH 1XGPA 5IB1B 4R26L 5GGQH 4Y4HA 2JK5A 4D8PA 3IKCB 3QA3B 5GSRB 5JIKA 4UV7L 3VWJD 4PJFA 3FOLA 5C6TH 3GSOB 1AY1H 5IB4B 1XZ0B 3SJVE 2EC8A 3TVMD 4OKVA 4HWUA 4QYOA 3EFFB 1GZQB 3PF2A 3EYOB 3VWKD 1LK2A 2DQEH 3TYGH 1YMHA 4EI5C 2EDEA 2DWEA 4L8BA 3UMTA 4IM8A 2AK1H 3R06A 5J13B 3VFTA 2JIXD 3I50H 3U7YH 1KNOB 2C4FT 1OGTB 3L3JB 3HCVB 5IWLA 4Y2DD 4PJ8A 1KJ2A 1AQKL 4X6BB 4R96B 3V8CA 3C2SA 1PKQB 3PJSB 3SCMA 3HZKB 3PG2A 1NUGA 3GMRB 1QFPA 4EQ3A 2RIKA 5K59E 1P4LB 2VDOH 4QHUB 3CFDB 2P7TB 1YEIL 2OK0H 2Y36H 2DQTL 3PWLB 4LPYA 5LBSH 1CYGA 3I6KA 4UBDD 4YDLC 5C8JA 4TNVF 1WWWX 1CGYA 3C5JA 4P5TA 5TDPA 2PXYA 3ULVL 3GIVB 2D4DA 4G9FA 3G5VB 4PRHB 1CE6A 4W4OA 1NAML 1E4WL 3WFEH 2ICEB 5GZOC 2DIBA 2C7UB 3SDYL 1FYTD 1HHHB 5I2IA 1YEHH 5EU3B 4XP4H 1FN4B 4PFEA 2BNQE 5FO9A 4GXUM 4I18B 1IGYA 2IANB 2V7NA 3GSRA 3QP3A 4LLVA 5GGTA 3VD3A 1P7QB 5EWIH 1RUML 3MLPA 5CHNB 3WS3B 5HHNB 3L3DA 2R9HC 4BSVB 3VXUB 1K85A 5KOMC 4LSDA 2AJUL 1AXIB 5E2TL 5GGRA 1ZHNA 3ELAT 4JO4L 2F19L 2OXGA 5JW4Q 1I8KA 5EUKA 3KLDA 7CGTA 2IG2H 5CEXB 1CBVH 5JPNB 2VXSH 2NW2B 4TOYH 1RIVL 2GSGB 2CD0A 3RDTD 2PTTB 1G7PB 1A3LL 5B39G 4WUUE 1NC4A 4YK4C 2GY7B 4MJIE 2VDRH 4WFGD 2BSTB 1BLNB 5C0FB 1EIBA 4WDIA 5KVDH 5IB3B 1FLTX 3OAYH 5ALCL 4OFYD 3SDXF 2H45A 1RURH 2AK4B 5FAAA 5HGDA 4HBCL 3MBEA 5DVKA 1C08B 4O2EA 2FX7L 4L4VA 5DO2D 4BZ2L 4PG2C 1OF2A 1EMTH 1H3UA 1K2DB 4WTZA 1NCTA 4K2UH 4LAJH 2N1KA 3ZKND 1TVBA 1YDPB 2J7LA 3DJ9A 4N0UE 3RZCA 3CVHH 4OZFA 4XVJL 1FAIL 2WINA 1RUAL 5B38G 1ZA6B 2EYSB 4YDJB 4U1HB 4CKVX 4JO1L 1XGUA 5E8DH 3D39A 4L5FL 2XZZA 5DLML 3NCFB 4PRPD 1IC7L 4JRYE 4PJCE 1FAKT 4GAJH 1E6JH 3C9NB 5H94B 1DVFD 4H88L 2EXWD 1H3TA 3LSOA 3SE8H 2C3VA 1MHEB 2RFXA 1BVKB 2HH0H 4U6TA 4ZUVA 2Z4QA 1BZ9B 4P2YA 4F3FB 1T6VN 3M1BA 4HK3N 3TCLA 1G1CA 3P0YL 1K3IA 3THML 3T0EA 3TZVB 3DV6A 3MMEB 1JWSB 5D1XA 4DGYL 2YUWA 1RV6X 1WBZA 5I76A 3O2DH 3VFNB 5BW7C 3ZYOA 1NBYA 1JGEB 3HI6L 3GUTB 3B9DA 4PJGB 1DLFH 4J6RL 1NKRA 5H8DA 3HMWL 2A83A 3L5WA 1SJVA 3C8DA 1ZT7A 4LQFH 5DGQA 3LY6A 5GGVH 1GHFH 3TO2A 1W72H 4PV9A 2W0LA 2P5WA 3WFHA 2PCPB 3ZTJG 2V5RA 1C5DB 3CLEL 3NGBC 5I0ZA 2YD4A 4HUWA 4RX4D 4C54A 1BZ7A 1FGNL 4QRQA 5EZIL 2XZAL 3S96A 3HS0B 3CMOH 4FQXA 3RWEB 3CVHB 4IIQB 4OZ4B 5ID0A 1IL1A 4QRRD 3Q6FB 3H7LA 1VB9A 2VITA 4HUVB 3CFBB 3BIKB 4XH2B 1IAKA 2X4RB 5T3XE 5CSGA 1KBGL 2FCBA 4PLKD 2O5ZH 1YEEH 1G7IB 1YNTB 4X6CB 3FN0L 3LV3A 1EUUA 4WJ5B 4TRPL 4ZODA 2P8MB 3HE6B 2CKBB 3MODL 3QI9A 3LN4A 1ZA3A 3M8OH 3DLQR 3KLHC 2C3HA 1RZGA 1OSZB 4S1DC 1HIMH 3O81A 1NBZA 3WD5L 3W39B 1GIGL 4RWYH 2A6IB 4PJ9C 1QA9A 4CN6A 4EVNA 5DK3A 2D2OA 1A6WL 4PJDB 4Y4KA 3K0WA 3RX7A 3O6FC 4M6NH 4Z7VE 4HJGB 5FYLL 3CX5J 2VXVH 4DFIA 3NCYS 3QFJB 5EU5A 1PZUB 1KV3A 3P9WB 4NO5A 1W72B 4Z7UB 4DN4L 3BGMB 3OF6D 3ISWA 1Q9KA 1PLGH 3L9RB 3RWJA 5D2NA 4PJFF 5FYKU 3V5DB 4D9LH 3R1GL 1XGQB 2B1HL 2UWEE 4PJBF 4YH6A 4P2QB 1WEJH 1FNGB 4BQ9A 1BGXH 4YDLB 1UB5B 4JFOB 3VDAA 1JPTH 1MHPH 1BFTA 4KV5E 3REVA 2FD6L 3DETC 4HXAH 4K9EC 1IC4H 1C1EH 1U3HB 1QFUL 2P5EB 4P3DA 4ZTPH 3D0VA 5F1NB 1SY6L 2IEPA 4WEBL 1RZIA 3RHWK 2XRAH 4M1GL 2YRZA 3KPSE 2NY1C 3ZO0A 2VO5A 4EQ2A 4P3CH 1KJVB 1O0VA 2EO1A 2E8YA 4P49A 4OUOA 1P4BH 2X4UB 4P48A 2P4AB 5JMOC 4XZUA 5DJ0A 3GIZH 2IPUG 5IW1B 2R1XB 5J9PA 5I1KL 4A2MA 5GS0H 2YEZA 4MLIA 2XPGA 1CDJA 4GBXC 2G9HA 4HZLB 5HPOA 3TN0D 5EN2A 4DKFH 1YQVH 3EJZD 1EVTC 4KK5C 2F5BL 3WDIA 3D9AH 4XMKL 4X0KB 5GZNC 1FGVH 1S9VB 1BEYH 5HHMB 1G9NH 4UQ3A 4POYA 4OI9A 2HJKA 3LRSB 4FQ2L 1DZBA 4ZFZA 8FABA 1RJYA 4WO4D 4YK4B 4TTDD 3D25B 4L3CB 2R0WL 1V5JA 1RUPH 4XMLL 3RWIA 1XF4A 2BVPB 3JVGA 4Z7WB 2J6EH 5T5NF 1OP9A 1K4DB 4LLYA 3HFMH 2V7HA 1DBJL 1D9KD 5ESAB 5I1GH 2F54A 3GB7B 4ODXA 3B5HA 4ZYKB 4ZUUA 3GMNA 2WW8A 5E8PA 4H8WH 4F8QA 4Y5YA 3CFJA 4OCNC 3C60C 1J9CT 3OKDB 4HS6A 1X5ZA 3KPLB 2BCKB 2VZ1A 3ZDXF 5I17A 4M5ZL 1MQ8A 4JQXC 1EDQA 1N0XL 3BVNA 2Z31C 5E6IC 4BFIB 3FT4A 2DMKA 3PHQB 4PB9H 4JE4B 5DJDA 1LGVA 3OGCB 2WLYA 1X44A 1OCWL 2CLRA 4MD0A 1VGEH 4MCZA 4JHBA 1ZS8B 5DJCA 3X11A 1ZANL 4KJYB 2VZOA 3GSWB 2W9DH 2P42B 4TPRH 1WSST 3IU4H 3MOBL 1JNLL 3VXSD 3EOBA 3HPJB 2JJUA 1P7HL 3P3YA 2F58H 5F3HB 3D85A 1FYTE 1HSAA 1I3RB 3BQUA 5B21A 3T0XA 5KVGL 1RSFA 1JPFA 5EZOH 1CLOH 5C0JB 4J3XA 4PTUA 4ONGL 1QR4A 4CVZA 5HDLA 2EH8H 5HGBA 1OD7A 4UTAL 2DQGH 3WN5A 4F7TB 3GBNH 1TJIL 1B88A 2HRPH 1KPRB 1OWRM 4MJ5A 4B5EA 4XPHH 3ZDXE 4MGXA 1QYGH 1JJUA 4FXGA 5HYJB 1MEXH 1TZHA 5F9OH 4ZUWB 5L8KB 2A6JB 3JXAA 4UDTB 1MOEA 5E1AB 3CIQA 5D70L 5F1IB 5ABDE 2H26B 3IVKA 4HMCA 2R8SH 2E9IA 5IESH 2E6PA 3NGBB 4JG1H 4WFGE 4LCUA 2BK8A 3KYNA 2JKXA 4N8VB 1WC7A 5HVGB 2HG5B 3SE9L 4LOUC 4V2CB 3VG9C 4K7FA 1N7MH 4TUJB 3VGDA 5MERA 3OZ9H 1ZLVK 4LHJB 1I9RH 2VR4A 3VJ6B 5FF6A 2Q7NA 2GT9A 4JPIA 4N0CD 3BO8A 2WANA 3CC5A 2W0FB 3DUSB 3QBTB 2ARJQ 4ODTH 5L2KB 3DOSA 4NQSB 1KEMH 4PRPE 4LIQE 4WI7A 1K6QL 3UJJH 1N2RB 1PFCA 4JZJC 4MXVF 2HTKD 4DEPC 1JYWA 3MNZB 4PJ5A 4MLSA 5FYJU 3ILPA 4FRWA 4HDIB 4MA8L 1WCBA 2HVKB 3RY6C 2BVEA 3HLAA 1CDYA 2XQYK 1LEKB 4JFPB 5GGRY 4JGUA 4PJ9B 5DJAA 3QEQD 3W9EA 4GXUN 5DR5H 4PRAB 2AJXL 2Y07L 4PR5A 4HGWA 5EH1A 3O6FB 2X4TA 3IDMB 5KSBF 2XWJB 3GKWH 4XP6L 2J8UF 1U36A 3FO9B 1BBJA 2YN3A 2XWTB 1WCQA 2CH8A 4N8CH 4QXTA 2X2YA 5DXWA 3LB6C 1NC2B 4PJXF 4NHCH 1JWMA 1T3FB 2A1WL 1EZVX 1IRAY 3KXFA 5FGCE 3BDYH 4C57C 3LQZB 3JV4B 5AZ2H 5MENA 2XYCA 2OTWA 4ELMB 3P30H 5IVNA 4KQ4L 2NQCA 1PBYA 4R9HA 1P1ZB 5KSVB 3ARFD 5J0BA 3SKNA 4HW6A 4X7FC 5BV7L 4MS8D 1AO7D 4OLYH 4ZQKB 2X4PB 4NGHH 5DJ6A 5M7QA 3IJHB 3KAAA 1G7LB 4R90H 5FUCC 2OL3A 2IAMD 4H0GA 4HIHA 3JWDL 1C16A 1NFDB 1X7QA 4MDJA 4QRRE 1N4XL 3MV7A 1T7ZA 4XCEA 1MFEH 1J8HA 2NY1B 4RISL 4YBHA 5F70A 4ZSOA 5KSBE 2X42A 2QQLL 4O5LH 1CQKA 4I13B 1A64A 2D0HA 2J8UE 5F88B 3KPMB 3TV3H 3WYRA 1IAMA 4LEXH 4IDJL 1WZLA 1DFBH 4I3GA 4RBPK 4PLJC 4ZUSB 1ZLWK 1ORSA 2CIKB 3CK0L 4PJXE 4WI5A 3ARSA 3IDNA 5IHUL 1IEAB 2RHEA 4MSWB 4PY8I 1C7TA 1QLFB 3DGGA 1KB5A 1I7TB 2EE9A 2ZOKB 4GBXB 5CBAB 5CP3A 2HT3D 2FO4B 2DI7A 1XR9A 3L1OL 3RVWD 5ELIA 1BJMA 1JTPA 5JO5B 3MPCA 3QJFA 2VR5A 2FJHA 4KQ3H 4HKJA 2QJDA 3B3IB 5EO0A 1ZHKA 3MRHB 1FL6B 4ODWA 4RZCB 3PV6B 1TCMA 4OBSA 1L0YA 3GMQB 3EKCA 1IM3A 4Y5XA 2FL5A 5JXAL 4JVPA 1HILB 4N9GB 2QQKL 1TMCB 4OCRH 3QZWB 5IBLC 4NKQB 1UH3A 4P23C 4LQ1A 4IHOB 3V4PH 3TJHD 3U0TA 4K71C 2X4QA 3NIDF 1NAKH 3GJFH 1IAOA 2CK0L 2GY5A 1WFUA 4JPKH 4WI4A 5EBLB 3C60B 4U7KA 5HDBE 1KIQB 3ARBD 2I07B 4AM0A 2Z31B 5E6IB 4KK6D 5I1DA 1AD0A 3ULUC 5JHDB 4OZGA 1EJOH 1QLEH 4XCFL 1RMFH 3CX2A 5E08L 1OARH 3QB7C 4DWHA 4DQOL 3M45A 3UEZA 4XNUH 3WLBA 4XB7A 2EIDA 3V95A 4K3JH 5D1ZC 1AD9A 4YE4L 5JA8B 3EYFA 2FECL 3LQAC 1OAKH 2VXQL 3G5XB 4MXWH 3WO3B 1D5BB 3B4NA 2W38A 3F62A 5TDOB 3PL6D 3NTCL 4WI6A 1GGBL 1WQVT 1A6UH 4DZBA 1URLA 1S7WA 1VDGA 3MREA 4HIIB 2ESVB 4DVBB 2VN7A 1MY7A 3NIDE 4KZEH 4K8RH 4NPYA 4P9HL 4TSCH 5JPMA 3LKOB 4OV5B 3D5OF 2ZJSH 4OIBA 4IRJA 3DX6A 3LS4H 2H8PA 3LZFH 4R7DB 3N9GL 2OXHA 2Y1VA 2A73B 1FNEB 3FOMB 1KELH 1YEGL 1AKJB 4G7YL 4KH2A 1QACA 4I5BB 4DTGL 5I1LA 3TFKD 3GSNL 3NFPA 4L9LA 1YN7A 1KN2L 1FIEA 5CEZL 1AGFA 4PGEA 2Z91B 3CFCL 3PHOB 4Y7MA 4K94L 5I1HL 3T0WA 4NRXB 3VG9B 4FFZL 5DJXB 3OKKB 1BAFL 5FYKD 1A0QH 3MLWH 3MJ9L 2N56A 1FZMA 1FO0L 4N1HB 4HKBA 2ORBL 2BX5A 4BH7B 1QSED 1A1MB 2ENYA 5IW3A 1CLYL 1NAMA 3MLYH 4JM2C 4F58H 4CUCA 2W0PA 4HV8B 3MRCA 4NQEB 4H1LA 2WLZA 4P5KA 1REIA 2EECA 1ND0A 4JZJB 4G9DB 4DEPB 1A1NA 1C5BH 1RK1A 2V2WA 2D3VA 4X6DA 4L3ED 3CFKA 4CNIA 4J3TA 5F9DC 4DW2H 2ADFL 5T1KB 2DIJA 5FKPB 3Q1SL 4XX1E 3VXSE 4MJ6A 3U46B 4DCQA 4HKZA 4NO0B 3TNNA 4NRYB 2EEAA 4NJ9L 3X12B 4J8RA 1JWUA 3RWCA 3T4YB 2IPTH 1SMAA 2EH7H 3MRDB 2XN9A 4XC1H 1N3NA 5DVNA 4OZIB 3VH8B 1T0PB 1KCLA 5C9JA 1SBBA 5KANI 1KFAL 4ZFOB 2YS4A 1FFNB 1JMZA 3EHBC 3I75A 2IPKA 3SGKA 3BHBB 1MI5D 4ENED 3WFDH 5DD5H 5HI5D 2X4SA 5L6YH 4AEEA 3MUHL 1I1RA 3EW3B 4LBEA 1KJMB 3INUH 3PIQB 4U1KB 1EAJA 4DKEL 4I0PD 1A6VH 2IBBA 3FONB 5E00A 1SHMA 1XGTB 2X5PA 1QNZH 1FE8L 5C7XL 4LSRH 5SWQA 1KLGB 4F9LA 3VXTB 2LV4A 3FRUA 2JJSC 3MNWB 3GM8A 1NCWH 3UBXI 1SYSA 1XF5A 4Z6AT 3C5SA 4JFYA 4WWKA 3CSBA 6FABL 4ZO7A 4LCCC 3MQIA 4HPOL 1OHQA 2K7QA 1YNKH 4D0CA 5GS2H 3B6SB 3RIFF 3DPBA 5IMOB 2AV1B 4O51A 1J7VR 4M7ZC 4JFEA 2QSCH 3RU8H 3LQAH 3CFEB 3C5ZA 2EC9U 2WIIB 1MUJA 3RL2B 3ARGC 4P59L 3DMMC 5FXCH 1PW3A 1NKOA 1S7UA 1OSPH 3UTPD 4HLZH 2M1KA 5I30H 1JK8A 3QEQE 2EXYD 4NM8H 1A14H 3G5YB 3GSVA 4ZD3L 5EIIB 1YYLL 1JNNH 3IDIA 3LD8C 5GSVB 1BIIA 1FVCB 5T1MB 5GIRB 1I7RB 2W60A 4NNYB 5EA0L 5ITBH 2VMFA 3HUJA 1RI8A 5JW5B 2CK2A 1MFNA 3O8XC 1KTLA 1U9KA 5C0DA 3VFSA 1LE5B 2DM2A 4RMVA 4P23B 4K71B 4UV4L 5LAXB 3VFWA 3KDMB 2EIZB 2KKQA 3CDFA 1KPUA 4IS6B 5BCAA 2NX5B 4PJCA 3U0PB 3BZEB 4PJHB 1NJ9B 3FQRB 3SQOH 1ZSDA 1L6XA 5FK9B 4Q9QH 4DVRL 4Z7QF 1AO7E 1WBXB 2D31B 5HYQA 4G8IB 4P0DA 1MF2L 1EFQA 7FABL 3LDBC 4YO0A 3NFSL 1DSFH 2D0GA 4S0TD 1CT8B 1CVRA 4HHAA 4YEEA 5EZJA 5C0AB 3MRPB 1V05A 1DQTA 4HJ0D 1U91B 4BSJA 5D1ZB 4DGVH 5CGTA 2W65A 1DQLH 2UZYB 3UTOA 4XHJD 4GLRI 3LKSA 3ZKXC 5K93A 3QIBD 5C2UB 4PY8J 5FYJD 4RQQB 4HWBL 3OKLB 2B0SH 5BQ7B 1IM9D 1WWCA 5ACZB 3PWNA 3O9WC 3LKRA 32C2B 4LASH 3SDDA 2O5YL 1FFQA 4Y4HC 3SPVA 5BOPA 1SEQL 2C9AA 2VLJD 4B7LA 3BT2L 3BKYH 1CFQA 2VXUL 1HH6A 1MLBA 4MNQA 1M71B 2WWKO 2OSLB 3PNWA 2FH8A 4PB0H 2BJMH 3L3HB 5DD1L 5B3NA 1CDIA 5LCVL 4JAMB 4G80A 3MLXL 4KWUA 5KS9E 3RGHA 3U2SA 3TH4T 4OM1H 1F02I 4LHUB 4BFGA 3HC4H 5IWLC 4X6EA 2CJUL 4NDMB 2HN7B 4G6MH 1SEBB 5LXGL 1GXEA 3S3JA 1KXTB 5EIVA 1JGLH 5J1AB 3VXMD 3SCMC 2C5DC 4PRIB 1SY6A 4JM2B 5DWUH 4YQXH 4JVUA 3E6FA 3MNVA 2JB5L 3HI5H 3MUGB 2QV2A 5J6GA 4U3CA 1A21A 4P5TC 4FN0A 1KGCD 5FA3B 2PXYC 5KSUB 2RR3A 4PY7A 1ZGLB 1Q1JL 4Y4FD 4MAYA 1U8MB 3R8BB 5ESVB 1UA6H 1D5MA 3HMXL 2AQ3A 2JJWA 4W4OC 4ZTOL 1BQLH 4UUJB 3F7VA 1CDCA 5C0ND 1A2YA 5DZLA 4GRLA 4YNYB 5HHPA 1DUZB 2DLTA 1RU9L 1S5IL 4BELD 3BP4A 1ZHLB 2ICWA 3OR7A 4NN5B 1T22B 1UXWA 3RI5F 3S4SG 4RIRB 5C0CA 2E6QA 1BFOA 1IGCL 1XGYL 4PGZA 4Z95H 3D2UB 4X6DF 2YC1A 2Z92A 1IKFH 2ZOLB 5L2JA 4E41A 2MHAB 2GIYA 1CTNA 3H42L 2UWEA 3SDXB 2I9LB 1LD9A 1EEUA 3P9MB 3HAEA 3QO0A 5C6WH 4X7CC 4OCLC 4ONHB 5GRJL 3CDCA 3DXAA 5C08D 2BVUA 3RUGE 4G8GA 4QNPF 3IYLW 2GSIA 3KLSA 3E3QE 3BH8B 3OKEA 1RFDL 3V0VA 4OM0H 3QQ9D 3ALPA 5FGRA 3ARED 3P4OB 4KRLB 4FG6C 1L7IL 3MOQA 4Z0XB 5T33L 1BQSA 3MXVH 3I2CH 5FYKE 5E5MA 43CAA 3MBEC 2NY3C 4LCCB 5E70A 4EN3D 2R69L 3T4AB 5TFSH 4AMKL 1QSEE 2PR4L 1F5WA 4O02L 5I8KH 3RZCC 4M7ZB 1SMOA 3CVIH 3QEUA 5JZ7D 1MFBH 2ZNXA 3MLVL 1V7ML 5MP6L 1BFVH 4PGCB 3ARQA 3DYPA 2NYYD 3ARGB 3FT2A 4L3EE 1CGTA 1UM5L 1FYHB 3O4LD 4KK8D 2QEJA 3DMMB 4D0DA 5HY9B 2VQ1A 5D6DA 1QR1A 3ARUA 4XXDB 4ODSH 4HUUA 5KVMC 3O41B 2NCMA 1BQHA 4QTHA 4O2CA 5I1AB 4N5EC 4QNPE 5D72L 3S88H 5F9WC 4OCWL 1I8MA 3UBXB 3AGVA 1DQDL 2CKBL 1EGJH 3LD8B 3ILQD 1QLRA 3IT8D 3U0WH 2VLKB 5IQ9B 3T0EC 5C6PB 1B0RA 4GW5A 4NM4L 5D1XC 3MV9D 4I48A 1R5IB 4U1IB 4AEIH 2EO9A 1E6OL 3O8XB 1I7UA 4LCYB 2OJZL 1DQQA 1MI5E 3G08A 2P47B 4JO2H 4OGXH 4X99A 1N5AB 4GLRH 5E7BA 2D03L 2LVEA 4HCRL 3ARVA 4MNGB 4Y16A 4NWUL 1NGWA 1QBLH 2DWDB 1T66C 5F89B 4YHOL 2NXYD 1KJ2H 2WP3T 4CVXA 2AJYH 4LLUB 3MFGB 2K3TA 1HE7A 3LDBB 5LKNA 5KN5A 1A6AA 5CFHA 1CG9A 4LSQL 1KTDA 1Q0XH 3JWNC 4FQXC 3GMMA 3CH1A 5DEGB 2X4NA 3FMGL 2VH5L 4M48L 3TBTA 4YUEL 3CLFL 2GJ6D 1FG2A 1MVUA 3WNKA 3CPLB 3EOTH 4MAUH 5J8OA 1HQ4A 4EBQL 2OP4L 5T1DL 3SDAD 4NJAH 4I77H 3ZKXB 4YXHL 4OCXH 4BQ8A 2X89D 4QHLB 1ED3B 2ZCLL 5MEOB 3BSZL 5L0QC 3FFCD 3QEHA 4ZUTB 3QNYB 5DS8B 2Q86A 4GOSA 3QI9C 2V2TA 4KJWC 2WQ8A 1JHLH 4F2MB 3O9WB 3SKMB 4RGOH 3UTPE 2PYEA 2WUBL 4LLMA 1XGPB 1KYOJ 3CGTA 3GK8H 3IETB 3KJ4C 2JK5B 3KR3L 4Y4HB 3JWOC 4D8PB 1A02N 1H5BA 1T2JA 2RCSL 4K7PH 5HTSA 3FOLB 5D7JD 3S35X 1EO8L 1TJHH 2OM5A 5TE6H 4I3RH 3WFBH 2ZG3A 4OFYA 3P73A 4OKVB 4Y4KC 4QYOB 1CF8H 1LK2B 1YMHB 4TQEL 1T20A 2DWEB 3AXLA 4L8BB 2I24N 2P8LA 3R06B 2Q3ZA 4J2XA 3VFTB 1HNFA 3BEVA 3IFOA 2D9QB 4JG0L 4LVNC 4HF5H 3J8F7 3QUML 3MV8A 4PJ8B 2H3NA 1KJ2B 5D2NC 2UVFA 1CIUA 3DX8A 3K2UL 4FZ8H 4GRWF 3TWCL 2D7MA 3AS0A 2XTJD 4U3XA 3SCMB 1X4YA 4JFZL 5HHVL 5DMKA 4JHAL 1ITCA 3Q2CA 3HPLA 4MDIA 1GOHA 1EEYA 4Z78A 3I6KB 1QRND 4Z18A 5C8JB 1ZLUH 3C5JB 2PNDA