2F9BT

Discovery of novel heterocyclic factor viia inhibitors
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
200
structure length
149
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGDERTLVRRNNTFLSLRDVFGKDLIYTLSVQAVIPSRTVNRKSTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Discovery of novel heterocyclic factor VIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
total genus 33
structure length 149
sequence length 200
ec nomenclature
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f9bT00
5GSVA 3CDYA 3GBLA 2BSSB 4LPWA 4PB0L 1JPFB 1OP3H 3IDJB 2FEEI 1FQ9C 3ZYJA 2ZOLA 2BY2A 2DIBA 3RHWF 2ARJA 1MY5A 3L7FB 4R7NA 1RULH 5F3HA 3NTCL 4LSUL 3ETBF 1I4FB 1U8MA 1QA9A 4LLVA 5BV7H 1DANT 4JPVL 2BRRH 3L1OH 2XN9B 1XIWD 2JCCF 4NQVB 4RAVB 1BEYH 4OGYL 4U1GB 2IPKB 1C5CL 3ES6B 4FXLA 1N59B 2GTZB 3DARA 5FA4B 4KKCC 5ADOH 3JTTA 3HCVA 4ZUTB 2QSCL 4P2QD 1QBLH 5F3BA 1L0XA 4I48A 3ILPB 3SDCD 3A6OA 2LE9A 3C60B 2OP4H 4WI6A 1NBZB 5IMMA 2ESVA 1ED3A 1CDJA 5DHVB 1JNHA 2EKSA 2BVPB 3MJ9H 1ZVSB 3D39A 4PP2B 1RZFL 2HVKA 4LKXA 3U9PH 3NCEB 4C56B 1AGBA 1E4KA 4G6KL 3PGCA 3QO0A 2HKHL 2GSIB 4PRIA 2DMCA 2E9WA 1K6QL 1AC6A 3VRJA 3LPWA 1ITCA 3GZKA 3IDUA 4S2SB 3BT2L 3SKMA 1M71B 2Y9RT 4M4PA 5IOPB 1INEL 1BZ7B 2DD8L 4R4NC 1JGVH 1O7VA 4F58H 1AGCA 3MV7E 1BD2A 1OVZA 3WFCH 3D3VB 4F7CB 4HWEH 1MCWM 2BRQA 4FQIL 1JHKH 5F7FA 3CLEH 3NN8A 4M7LL 2C3GA 4P57B 5CILL 1LMKA 3BO8A 3IFNH 3CXHK 4Z5RB 5J6GA 1JYWA 3ULUF 1DQQB 4QRUA 4D3CL 2YWYA 3WKMH 5ALBL 1RZGB 1DVFB 2BSTA 3MLYH 4M1DL 4U1JB 1DTUA 5HHVL 5CP3H 1ZTXH 1A6TA 1KJ3H 3CXDH 4WUUA 4MYWB 4BUHA 4DGYL 2X4NB 3AY4C 4U7SA 3QUMB 3MRMA 2YHGA 3VGEA 5I73C 3SY0B 2OR9L 4Z7VE 2P7TA 2A38A 3MLTA 1N3NB 1UC6A 1RZJC 3UPAA 1X5HA 5DJ8B 4OZHA 4AMKH 2GITB 2AAVA 3IJYA 4JO3H 1EZVX 3TWCL 1KEML 1YYMH 2OZ4L 1QSFE 2YRZA 1ZLWK 5MEOA 2GCYB 4RFEB 4GAYA 4PJAA 4EI6A 3CX5K 4PJEF 3D0LB 1XF2A 3W39B 1WBZA 3QA3B 4MX7B 1C5DA 1PLGH 3P73B 4LLYA 4KI5F 3N1MC 4HD9A 2X44D 1S3KH 3DUSA 1QHPA 4Z18A 5HVGB 4MWFB 1T80A 5AYQA 5IB2B 3MTRA 3ULSA 2A1WH 9CGTA 3BHBA 4OCRH 4HIXL 3S4SG 4K8RL 5INDB 4LAQL 4LHUG 4IS6A 2Z4QA 1H8OA 3TCLB 1RI8A 1U92B 3TM6A 4IDLA 4TUJA 2PR4L 3BP4B 4Y0GA 2FZ3A 1SJXA 4Z77B 1QVOB 4L8BB 1A7BA 3EYFA 1T5WB 4QT5B 2EDNA 1SEQH 1XIWC 3VFGH 1F4XH 3B6SB 5TF1H 2CKBA 1JPST 1S7WB 4L4TE 4JFFD 3INUL 3LY6A 3WO4C 5KJRH 4HUUB 3WFEL 4ZTPL 4JPWL 1O0VA 3MGAA 3FRUB 1K8IB 3H42H 3SDCC 4TPRH 4MMZC 5D9SB 3EGSB 1CGSL 4TQEL 5D7JD 2A9MH 4U0RC 4JDVB 4ZYKA 2A6IB 1OGAE 3Q1SH 1G7IB 5HHMD 3IFOA 1A9EA 5I1JL 4WJ5A 2NY4C 1G9MH 1T7YA 3Q5OA 4HXBL 2F53E 1MVUB 4PJHF 4L3EB 2XQYG 3B2VH 4BZ2H 2X89A 3VRLF 1BPVA 3RVVD 4HK0A 5D2NC 5F7YC 4XPFL 4LSTH 2ZUQB 4PJXE 5D7LA 2J6EL 1T7WA 5DJCA 4MNQA 3G5ZA 4LSRL 4Y4KA 1LP9E 1ZANH 4Y4FA 1D5MA 5GXBB 4Z76B 4BH8A 1N0XL 3LPFA 2ZJSH 1RK1B 3O2DL 4XXDA 3MRPB 4MD5A 4PJ5A 3E2HB 1A4KB 2EIZA 4QHUB 1KTKE 4X4YB 3QXVA 4N0YH 4U3XA 3RIFF 2ATKA 1F4AA 1N4XL 3U83A 2VDLH 5J9PB 3O8XA 1FP5A 3ZE1F 4UV7L 5JLZA 4OM1H 4Y16B 5KAQG 2F15A 4QTHA 3QUYA 5JOFB 5E5MA 3S3PA 5JXED 2EC8A 5ESAA 1SHMA 1JMZA 1RPQA 2NY3D 3H3PH 2JJTA 1KXTB 2YOCA 4GRWB 1Z0NA 2Q87A 5BRZD 1XCQB 1D5ZA 1MCCA 3DETD 1HH9B 1IILE 2VZ3A 4JRYD 5K9KB 3IDIB 4NN6C 4OZFH 1DEDA 3JWDH 4WFGD 2AXFB 4YX2L 4CMHB 5MENE 3N9GL 5L2KD 1DUZA 4XCFL 1F00I 2J4WH 3TYGH 4DVBB 4JO2L 1BJ1H 1HQRA 1VFAB 5AYUL 25C8L 4KXZI 4PJDF 4QHNA 2Z31D 5FKAA 5FOBB 1TJHL 2WINA 3NA9L 4HPOH 4UTAL 5DWUL 2B1HH 4OM0L 4UQ3B 1FPTH 1S9YA 1U8HB 3MR9B 3ZT6A 3DTXA 5EU6A 4ONFH 3T65A 1T1ZB 5CSBA 4MLIA 3E0GA 1NCCH 4YR6A 3O3AA 1A6ZA 4TVPL 4JM2A 4LSVH 4AEIH 4EDXB 1RUQH 4CGTA 1G0YR 1F6AB 4QEGA 3EJJX 5EC2A 3T1WA 3ET9F 1KELH 5D5ME 2G2RB 1GC1L 4JHZA 1KSRA 2Y07L 4F33B 5IFJA 5BV7B 1J8HE 3WFHB 1FBIL 3PP4H 3QXUA 3MLSH 4XP4L 1D3CA 4NSKA 1P7QA 1KIRB 4FXKA 3E1F1 1TJIL 5IB1A 4WV1C 2Z35A 5ID0B 4NQDE 5DRWA 3VJ6A 4BSVB 3RQ3A 5HGDA 1UG9A 4XX1E 3FHAA 3AUVA 3GBML 5DJAA 4H20H 1JPTH 4F9LA 3OXSA 2W65B 3BZFA 1IT9H 4JRWA 5EORL 1WZ1L 3QFDB 3FQRA 1HHHB 2ZOKA 3S5LA 3QQ3B 1UACH 4RDQF 1D6VL 1G7HB 3LQZA 5KN5B 4M5YL 4OLVH 2YC1A 3FO1A 3EYVB 3ROOA 3OV6A 3KNBB 3HUJF 3ARFB 4EN3B 3U7WH 3OB8A 3F8UB 1U2HA 4MA8L 3RVVC 4QCIA 4D8PA 1AQKH 2D7QA 5E2VH 4YQXH 1LO0H 4JZJC 5I18H 3EYUH 5JR1H 4G6ML 3ZYIA 4JY4B 1BQUA 3MX0A 2EH8H 2NY7L 1S7TA 5CBAA 1FGNH 1YY9D 5IQ9B 4OLWH 5E6IB 2JB6B 4LLDA 1MFBL 2CIKB 4LCUB 4C83B 1JGLH 3GRWA 4P59H 5TPWH 4NDMB 3MSPA 4K3JL 4HX1A 3T0XA 2B4CH 3U30B 3VFTB 2FJFB 2HVJA 1O7SA 1Z9LA 1K3ZA 4XBGB 3O3DA 5FYJU 4LCIH 4WUKL 5FGSA 4H8WC 4P2QE 5FKPB 3LKRA 3IJSA 2J8UA 1C12B 2IH3B 3KJ6L 4NFCA 4W81A 3V52H 5CEZL 2P5WA 1GOHA 3ARQA 5T1KB 5CEYB 4ZFFB 1OSZB 1YEEH 5JXEC 4ODTH 5D72H 1AC0A 3JXAA 1WAAF 3P0VL 2NY3C 1JHLH 2A83B 4Z7QE 4LL9A 3MNZB 2UWEE 1SM3H 2EC9U 4LFHG 5JQHC 3DETC 5LCVL 1RIUL 3RZCD 1IGCL 4MHHG 4H25A 5D2NE 3KR3H 2V7HB 1FNGB 5CSGA 5IJKA 3VXNB 2O26U 4U1NA 3LVEA 1OARH 3REWA 2I9LB 3H8NA 4CMMB 3T04D 1NCWL 4TSBL 4TYUA 5DRNA 1NBVH 2IQ9L 3I6LE 1EAPA 4LVOC 5B3JF 4WO4B 3TBTA 5JORA 2VLJA 4WEBH 4XCNA 1BBDH 1XGUA 2XQBH 4O4YL 3DIFA 2PO6B 1UM6H 1MI5A 4F7TB 2HJFB 4GMSL 3FMGL 2O61B 2VRAA 3IAQA 5EOTA 3S35L 4F7PB 4MAYA 1Z5LA 5TE7L 5CZVH 1ES0B 2F5BH 1HSBA 4JDZB 3V4UH 2HG5A 5FB8B 1IBGL 1H5BA 5BCAA 3OGCA 4LNRB 1DQTA 3CMOL 5K9OA 2XY2A 1FYTD 1K2DA 3WXVL 4C57C 5C3LD 3FQUA 4I4WA 3RWFB 4OIAA 2FX7H 5F7KC 1MIML 4K7FA 3ZE0E 1KG0A 1AGEA 5IW6B 1ZT1A 3HC0B 3W9EA 4NBYB 4L8DA 4NPYB 4Y2DD 1FV1A 4PV9B 4HS6B 1EGJA 2AXGA 5DMGD 3MRFB 4QY8B 3WNPA 3TBVA 4GKZB 4NQCB 1MQKL 2EDLA 1QKZL 2DLGA 3QWRD 4L8SB 1A6WL 3TJEH 4W6XB 5DJYB 1NAMB 4KK6D 1XCTB 3O4LA 4RISL 2CH8A 1EFXB 3RDTD 2BNRA 4W4NA 2YD9A 4P4RB 2R69H 3ZL4H 1I9IL 2YA2A 1LO4H 2CRYA 2EE2A 1E6OL 1EUTA 3FJTA 4NGHL 1VGEH 4JQVA 5DLMH 1JNLH 1WZKA 1YNLH 2OX5A 5JQ6L 5I8EA 1MCOL 3CDGB 1YY9C 3OKMB 3KLAA 4PPTA 3HMXA 2RAMA 5GRJL 3B9KB 3T4YA 4MQ7A 5D2LF 3MZTA 5L8JB 2W9EL 1F90L 3LS5L 4OZIF 3HAEA 4JFFE 3F58L 2DQFB 2AABL 5KZCB 3KPQA 2KBGA 4XWGH 1F58H 3MOBH 4GLRH 2PYFA 4X5WA 3EO0A 3WMSA 4HW6A 1PSKL 1SBSH 1A4JA 3B5GA 5SWSA 5TDNA 3C2AH 2BCKA 5H35A 5I1LB 4DEPC 5HHME 2V17H 3DSFH 4PJFE 2BVEA 3C08L 5JW4N 2JJUA 5LQBH 3UJJL 3KPSA 8FABB 4I13B 1TVBB 3OR6B 4L4TB 5DA0B 3RZCC 1K9TA 5E8DL 1XGRB 4ZODA 2DQJH 4LCCB 5E8NB 4OZFB 4JFXB 3PF2A 1JGDA 4X0KB 1VADA 1YY8A 3JV0A 5JHLL 3BRGC 4KHTH 3SGKA 1VFMA 3RVUD 5CGYD 3RL1A 1OGAB 5H94A 4XZUA 3QXDA 3CK0L 5DS8B 5TJWK 3UTQB 2VXQL 5I1CH 2VUYA 3TIEB 4DW2H 4WNQB 2H8PA 2M26A 3MXWL 1XGQB 4RMWA 4M6NH 2F53B 3CH1A 3U9UB 5EN2A 1EO8L 4HUXB 1MFCH 3DX9B 2CK2A 3GJFH 3LPGA 4JG0H 4LDEB 3OHXB 2XICA 4JHBA 2CD0A 3I3BA 4PJXB 4N0UB 1ZSDA 4ZO7A 1MJUH 2VWEC 4PJ7A 4N8VG 1LP9B 5JUEL 1MVFA 4JVWA 3KG5A 3QZWB 5J57B 3WL9A 2AK1L 3D0VA 5BRZE 2AK4A 4I18C 1FNSL 5CIPA 5I75C 4JRYE 4MZ2A 3PWJA 1OTUD 4HUVB 3MROB 1D5IH 4CNIA 4JN2B 4MJ4A 5C0RH 2V2TA 1OTSD 4WFGE 4U2ZA 3FAWA 5L2KE 4JRXD 4XBEH 5KOMC 1KCUL 4B0MM 1YEIL 1DR9A 3LSOA 1IGFH 3LHPH 1XFPA 1YPZE 2BJML 4LLMA 5D1ZB 4Y2DC 4PJCE 4QXUH 2ZSWB 4P9HL 5IF0B 5DMGC 3TIDB 5C7XH 3CC5A 3KDMA 5DC4B 1H3PL 4UBDD 2VH5L 1HKFA 2IBBA 2Z8RA 3ZKQD 4PJIE 1MLCB 4PRPD 3ZE2F 3X17A 4KK6C 5LGHH 3MFGB 4P3CL 1EHLL 2YXMA 4OZHF 3EZJB 5MENB 5FHAH 2KUTA 4NO0B 3A67H 1CFNB 2DQTL 2E5EA 4K3GA 4UILH 5ICXB 1NCAH 1OQOA 4KFZC 1AO7B 1IEHA 4Q6IC 5CBEA 2NXZD 1FNEA 4G7VL 2R0LH 2PKDA 3MCLH 3DX6A 5L9DH 2X9WA 1AH1A 4NWUL 4X6BB 3IDNB 3MRRA 1A1NB 4OF3A 5FUCC 2W9LA 5EBMB 4EDWL 3O4OC 4XH2B 3VW3H 4C54A 4WFFD 4AT6B 4BSWB 4EUPA 5KW9H 3WNNA 5DD0L 5D5MB 5FV1L 5I1IL 5I73B 3CX2A 1S9XB 3DSNA 3IU4H 5FYKL 4DGIL 3UO1H 1J8HB 2X4TA 4XC1L 1MJ7L 3OKLB 1NGZA 2AEPL 1K85A 4K94C 4NZJA 4JFZL 5D1XA 4DAGH 1NDGA 4J2XA 2WQ8A 3SPVA 5I9QC 3G6JF 5DD3H 3QPXH 1ZGLB 1J1XL 4NQDB 4K9EL 3MACL 3D85B 1HHIA 43CAB 3BEWA 4I0KA 1NSNH 2RHEA 1HEZB 3CZFA 1EEZB 4W68A 2V2WA 5TE4H 4OD2B 4G7YL 3RVUC 4OQTA 5CGYC 3NFPB 1BF8A 4E5XA 2Q8BH 3NPZB 3P4LA 1PZ5A 3UX9B 1HOCB 1MWAH 1B3JA 2QV2A 3BP7A 3WLBB 2OJZH 5K9QG 4XWOD 4XGZB 4JHAH 5DA4A 4HV8B 3QEUB 5EUOB 2AJZB 4G8FB 5HJ3B 4ISVA 3P4MB 5DQJB 3I9GL 3BMVA 3C87A 3DMMB 3T0DA 5T1MA 1CLZL 5ACZA 4W4OC 5F7HA 2R8SH 4TSAL 5T3XH 2A77H 3TT1H 3V6BR 3KPPB 4M1GH 4N1EA 1CXKA 1NEZA 1INDH 4M93C 3F12B 3NZHL 4E0RA 1XIWB 2PCPB 2V2XB 3I3DA 3HFMH 3DHJA 4XVJL 3OJDB 3VXTA 4HFUH 5D1QD 1K8DB 1MFEL 3RBSA 2CUMA 2FGWL 3TBYB 3WO4B 1OTUC 1YJDL 2RB8A 4JFED 4P2QB 4ZS7L 2V9TA 3EIFA 4DFIA 1E4WL 3SDCB 1OTSC 3ARDB 2APTA 3BKJH 5KVDH 5EO1B 3GHEL 1YC7A 4R4FL 3SGDH 4H0HB 3MCKB 5D96C 1T0MA 2HFEA 2DF3A 2X4PA 3NCCB 5EZJB 3A6BH 4E42A 3P0GB 4G6FB 1R6VA 2R23A 4EXPX 5GRUL 5KVEH 2R2BA 4HZLB 4UB0L 1YN7B 2H6PA 4ALAL 4JB9H 1NJ9A 4NN7C 4X99A 2AEWA 4TNVF 1TPXC 2VWEE 3OJ2C 3JV4A 2W60A 4WI8A 4ETQA 1IC5H 3LN5A 3HLAB 5EOCJ 1UCBL 4JLRA 4MDIA 4XC3L 4P3DA 2EICA 2FYYA 2NXZC 3GGWA 4CVXB 2VZOA 1G9NC 1A7QL 4X6CF 3KPTA 5HHPA 3NAAL 2KPNA 4LOUD 4L5FH 2HMID 1FYTE 2QQNH 4RGOH 4NT6B 4JKWA 1L7TL 1KPVB 4NNYA 4DZ8B 4JM2F 2AKRB 1G7JB 3BJ91 5FK9B 3VFRA 4FNLL 1E4XL 4HMEA 3DI2B 3S4SB 5FYJD 1A7OL 1J0ZA 4XP9L 1WCBB 5DC0A 3S88H 3VCLA 1W0WA 2BERA 3PWLB 2X4OA 4HIEB 1KCRL 3RWJA 2DIJA 2R0WL 4PREB 1RUMH 4NN6B 5FUOH 3IF1A 2K1MA 2Q76A 5I2IB 2C3WA 4I5BA 4QRQA 1P6FA 5LXGL 3RUGF 1F3JB 1R3JA 1MEXL 2I60H 1A14L 5TDOA 5GRVL 4OI8A 1BBJB 2HLFD 3BKCL 3QAZC 4O2FB 4P4KB 2H9GA 3FFDB 2IAND 1HINL 3LDBC 3SE4A 1R5WA 4HJGA 1VGKA 3CSGA 2YEZB 3KYOA 2D03L 1TTFA 3GMRB 4U1SB 3MYZA 2HRPH 5FUCE 4D0BA 4ZPTA 3K46A 1H3VA 1SQ2N 2IQAA 2ITDA 5C0EA 5A2FA 3BFOA 3O9WC 3UTSA 3SJVB 1QEWB 3ULUD 4GUPA 1CK0H 3GJFB 3ZSSA 3PQYA 4YBLB 3C6LD 3MRNB 3X14B 1GAFL 4UUJB 1MFAH 1DQLL 1E6JH 1AFVH 4H26B 1HQ4B 2EZ0D 5TH2B 5FXCH 2M8XA 3QIBA 4PUBH 4HAFA 5BQ7B 4NP4L 1FRGH 1LNUA 1ETZB 2OSLB 1V7MH 3K4ZA 1KC5L 2OL3L 5D1QC 1PG7L 4R3SA 3RL2A 1ZHBA 5IW3A 1SJHA 3HZKA 1I1FB 2R1WA 5F21B 1DL7H 2HJLA 3QULB 4XPGH 2OMBA 2YPKB 5CJOL 3C5SA 1QO3B 2IG2H 1JGEA 4BA8A 5D7JB 1LEGB 5DUPL 3LD8B 1N6QH 4Y5XB 3QQ4B 3LKOA 2CLZB 5HHMB 3IDMB 1CDBA 4XP6L 4PJFB 2D7TH 3B9VA 5C0JB 1Q9WA 5HYJD 1H3GA 3PL6D 5I76A 2BFVL 3IFLH 4PG9A 4PTUB 4KHXL 4HQQL 1YA5A 1HYRC 4Z7WA 1GGBH 3VD3A 3IKKA 3WJLA 3GSQA 4PTTA 1EHAA 1ODAA 1CLOH 1RJLA 1RZ8B 3DV6B 4XI5D 3AC0A 1UVQA 4Q9RL 5F9AC 4FQHA 4L4VA 3PGFH 3VFVB 2BMKA 4FQJL 3ARVA 1LGVA 5A2LH 4AL8H 5J1AA 4R2GD 1R3HA 1I7RB 3AS0A 4JRXE 1IAMA 3T0ED 3BRDA 5CINH 5I1GH 5I1HL 5D6DA 5HTSA 5BW7C 3NIDF 3F65A 4XNQA 4QTIH 4IRZL 4MDJB 5EFIA 4ZOCA 5AUMA 4X6FB 1JN6B 5T5NF 5BRZB 1U8JA 3O0RL 5EBWB 3V6FA 4H88L 2BC4A 4QXTB 5D7SL 4KAQH 5IFAL 4JRYB 2AV1A 4PRPE 3Q6GL 3F62A 3BPNC 5IB5A 3KHQA 4X6DA 5GRXG 4M1CD 4YE4L 2A0LD 5BVJB 4PP1D 3BIKA 4X4ME 5L2KB 4G8GD 4UQ2A 3I02A 1MHCB 3GM0A 1AKJB 4LGRB 2G75B 3TH4T 2Z31B 2HLFC 1X5LA 1BX2A 1BFTA 4NJ9H 4S1DD 1MCPL 2RFXB 4PJCB 4LVOB 2XIDA 1DEEB 1DE4B 4XNUL 4HSQA 4LCWD 3C5JB 3CPLB 4XMPL 5IHUL 4PJIB 1S9WB 2XYCA 1KIPA 2ZUVA 5GSVB 2ZNXA 1UWXH 1MWAB 2OTUA 2XPGA 5HHQB 4ODSH 4Y19A 2QADD 2DICA 3PWVA 3FFCA 3PWNA 3ULUC 3OL2A 1IM3A 4FQ2H 4GRLA 2ARJB 5E0QA 2EIBA 4B50A 4I0PA 3U79A 4WFFE 2NTFA 5T33H 4GW5A 1HHKB 3C6LC 4R7NB 5GS1C 5FECA 1AXSA 2ZWLT 3GMQA 2Q3AA 4LLVB 4LEXH 2DJ4A 4XP1L 3OAYK 3FB5A 2NPLX 5I8OL 1T22B 2EZ0C 1KJMA 4G3YH 5KSVB 1J1OL 2HH0H 2J3SA 1BIIA 2CJUL 5GISL 1YMHA 4Y5YC 4OF7A 4I48B 4CADA 1NMBL 1A7RL 4LEOA 1R3LA 4M7KL 3O2WL 1DBML 4U49A 3IDXH 1ED3B 1JNHB 4KJPC 1VKXA 3O81A 3X3GL 1CE1L 5FGCE 5KSUA 3FZUD 1AGBB 2F5AH 2PETA 1P7HL 3L9RA 4HKBA 2FD6L 1HHGA 4R97B 4RWYL 3EJZD 5GS2D 4PRIB 1FO0L 2VXUH 1ZA6B 3VRJB 4BYHA 3BWAA 1S7RA 2EC9T 2XKNB 4KI5C 1MCFA 3BKYL 1E28B 2ICCA 2Q1EA 3SKMB 3IAPA 4QHKJ 4HUMB 3VH8A 1FDLL 3MGOA 2CDFA 1EBAA 1NEZG 2MFNA 4YZFF 1KB9K 4D0CA 1I3RB 4M8VA 1DUYA 4PRDA 5E2UL 3ZTNL 1KCVL 4KMTH 4XI5C 1QFOA 1MCRA 3GHBL 4K23L 4MD0B 1X6LA 3GRWH 2AJVL 3NN8B 4JPKH 3VGDA 2FX8L 3BO8B 5IVXE 3MBXL 1I9RL 4PJ9D 3I84A 4ZSOA 1F4YL 3EJYD 4P2OD 1QR1A 2LU3A 4KVCL 4JFEE 1FFNA 4MB5A 3BUYB 4R2GC 4WEMB 5E24E 2X40A 5F1SA 4I8DA 4K71B 4YUEL 4APQD 3T0EC 5DJ0B 4CW1A 4MA7H 4KKAD 4PJ7F 1KIQB 5D6CA 1G0XA 3W0WD 3MRMB 3P3YA 4ZUUB 4XPAL 2X7LA 1QNZH 1CVRA 1T0NA 3MLTB 1JNNL 5E5UB 5ACMA 3CLFH 1RZKH 3R06B 1ZVHA 3IJYB 2DMKA 4M1CC 1P4BH 2A0LC 4PP1C 4WI3A 1FE8H 1FIEA 5MEOB 2EDXA 2J88L 4PR5A 4PJAB 4EI6B 3DXAD 1I7UB 2R29H 3CVHA 4S1DC 2VDKH 5IMOA 1WBZB 4FQXA 5FO9A 4OCLC 5MEQA 3MBEC 2A6KB 4Y8DC 2AJ3A 4K07A 3OPZL 1RUPL 1OL0A 3C9NA 2F8OA 5JW3L 3QQNA 2KDGA 3QIUC 4MJ6A 4JM4L 4NM8H 4NNPL 3ULSB 3U0PA 5F9OH 3LKSA 1AY1H 4J8RA 3TEUA 2MCPL 3RX8A 5HHNA 1OWRM 4E41D 1I1AC 5FYJE 3T3PF 2QHRH 3WS3A 3C8HA 4R4BA 5M95B 1B0GB 3GIVA 3NOIA 4PJ8D 1T2QH 1FYTB 3EYFB 5LBSH 3TBSA 5F7UA 5FGRA 3AB0C 1JMXA 2OQJB 3MODL 4F8TA 3Q3GA 3VWJD 5ITBL 4JN1L 4YDJA 5EZIL 4Y2DB 1EGJH 4G9FA 4OCMC 3JWNC 2C3VB 2IANE 5SWQA 1OCWL 2DMBA 4ZYKB 4JVPA 3FZUC 2KQNA 2W92A 4XBPA 1KN4L 2J2ZA 5EOCL 4WJ5B 4Y7MA 4NO5B 5E8EA 1OAUH 3T2NL 3RDTB 4LLQB 3EJZC 4FHBD 4GXUM 2MPAH 1W0YT 2EO9A 4RA0C 1HNFA 1NLBH 5D93C 1H8NA 4IMLA 4JY5H 2B1AH 5DK0A 2MKWA 1T1WA 3MLWL 3ULUE 5GGQH 4TTDD 2GY5A 4J23A 1Q9KB 5D7LB 3MA9H 4Q6IB 5DJCB 5M94B 5DRZB 3G5ZB 5GGTL 3HMXH 1Q8MA 5B39A 4QOKA 1D5MB 3MC0A 1CD8A 1A1OA 2E7LC 2Q3ZA 5DQDH 4H8WL 3QO1B 1CI5A 5DDHB 5LJYH 3QG7H 3WFDH 4OUUA 3DRTB 4PJ5B 1OB1B 4PJ9C 1MCLA 3BXNB 3O4OB 3EJYC 3MCG1 1F8TL 1RU9H 4XCEB 3GSVB 3H9SA 4ZQKA 3QUYB 1V3LA 1P1ZA 4APQC 4O58H 1VENA 4KKAC 5DURB 5AG8A 1NFDE 4I77H 4N8VB 1ZHKA 1FGVH 1AI1L 2ZKHH 3AU1B 1FL5B 5I9QB 3QUKA 4ONGL 2G60H 3S35X 5HYJE 4KI5E 4FQCH 1Z2KA 5IBTL 4GRMA 4ZTOH 2E7HA 3MA7A 4DVRL 1X4XA 1GGCL 1NGWB 1G7PA 4GFTB 5E94A 3TVMD 12E8L 1ZT4B 1JI1A 1NCDL 2XY1A 1W2KT 5FKAB 3RX7A 5KSAD 3N85L 5EWIL 5HYSG 4XXCA 3TN0A 1IQWL 1EUUA 2FLRT 1S9YB 1XF4A 1AD9A 2E9JA 4MXWH 2VXSH 2X41A 3DTXB 5EU6B 3O6FD 4B7LA 1LK3L 5DUMH 1QFWH 1ZT7A 3MXVH 1JF5A 1CICA 1I1RA 4YR6B 1A6ZB 4M7JL 4OF5A 3BD4A 1S8DA 4L1DA 3FQNB 3S8WA 2X4SA 3T0EE 2NY6D 2I26N 4HKZA 5HI4D 1E4XI 3LKNA 1OAZL 4UT7L 1XR9B 2O5YH 4NZUH 1ZAGA 3WKNA 3K1KC 1OP3K 4HH8A 4GKSA 1RVFH 5CIPH 4PJ8C 1GZPA 1UJ3C 3SGEI 3VXMD 4I2XE 4F9PC 2ZCKL 3NVQA 3QDGD 2Z35B 2OI9B 2A73B 5DRWB 3QFJD 4DQOL 5GGUA 5D96B 5KS9B 2Z91A 3VWJC 1TNNA 4X6EA 2UZIH 4IHOA 1NBYA 5DJAB 1IM9A 1OM3L 3UDWC 3DV4B 5CD3B 4M48L 1YEJL 5HGBB 4LCWE 2ZOKB 3VI4E 5TQ2H 1L9NA 3D39D 5C09D 1CTNA 1HI6B 3G04A 4PRPB 1UH2A 2QL1A 2YC1B 2DQGH 1A5FL 1Z0MA 4NOFA 1NGPH 2VITB 1PAMA 1HDMA 2C7UB 3LZFH 5J8OA 2I9TA 4QCIB 4D8PB 4TTDC 3LV3B 1MFDH 3TO4D 2D0GA 3VXSD 1HHJA 2NXZB 4KPHL 3MLPA 1EJOL 1KV3A 4G43A 3R1GH 4G8IA 2Q8AH 4PLNC 5D71L 1W0VA 4C4KO 1PKQE 1WTLA 3SKOA 3IVKA 4UT6H 3KXFD 2BDNL 2HVJB 3CD4A 1PBYA 5IT2L 3C8KB 1MPAH 2BSED 3O6ML 5I8CA 3IJSB 2J8UB 1ONQA 2CXGA 4EUPH 5GS0D 2P5WB 4EBQL 3WNMA 1IAKB 3QJHA 1E0OB 1KCKA 1JHTB 4HWUA 5L8LB 3K2UL 1QLEH 1TNMA 1T21A 2OZ4A 3TA3A 4OF6A 4N0RA 1XH3A 1NCTA 4H25B 4JO4H 5BS0E 1BLNA 1TJGH 3HR6A 5F88A 1FC1A 1YC8A 1QQDA 1ZVYA 4QLRA 5DT1L 4GSDH 4U1NB 1DFBH 32C2B 1YNTA 3I50L 3O3UN 3TVMC 3U7YL 4DTGH 1L0QA 5HGHA 5SWZE 4FZEL 2VQ1A 4OQTH 5EA0L 5KSAC 5CJQL 3RKDD 3T0BA 3V5HB 5IROA 3MRJB 3NIGE 5JORB 4PGDA 5HDBF 3OF6A 4Y4HD 4LQFL 1ZLUK 1MI5B 1H3WM 1KJVB 1OAXH 4JREB 4POUB 2HA1A 4ZOBA 4X5XA 4U05A 4FP8H 5GGRA 4Z7WF 1Z5LB 3HE7A 4UOJA 3KPOB 2NY6C 2RGSA 1HSBB 3MUGB 2VLKD 4YK4C 5HI4C 1CL7H 1EEYA 2AJUL 3WYRA 2R9HD 2X1QA 3W0WE 3GK8L 4WCYH 5IP4A 1LEKA 5K9OB 5DMIL 4AIOA 1YN6B 4FXGB 4YNYB 3D1MC 1RJYB 4R7DA 5F7DB 3JWOC 3FQUB 1HCFX 2KZWA 2NX5D 3GI8H 2GIYA 2CSPA 1F02I 2WK2A 2YMXL 2ORBH 4JKKA 5EU4A 2DYPD 2EEBA 1A7NL 1ZT1B 2EO1A 6FABH 5I19H 4Z8FL 1GIGH 2ADGA 3GMMA 3DXAE 5D4QA 3X3FH 3BDXA 2X05A 2GJ6A 1NH6A 2QQKH 4YIQB 3GSRB 1JBJA 2FEDD 4OCWH 5FCUH 5FO7A 1E4KC 4HEPG 3TFKD 2HWZH 1L6XA 4X6DF 4I9WD 3RNQA 5EZLB 3LMJH 3UC0H 5EOQL 5ISZD 4HC1L 4GQPH 4GBXD 2PW2A 3TNMA 3F6LA 4E41E 1R3IL 1ZEAL 1JTOA 4WWID 4OGZA 1HNGA 5DR5L 1OGTB 1EJ6A 1SJEA 4UV4L 1F4WL 4EI5A 4MQ7B 3K2MC 1VPOH 1HZHH 3MO1A 3BD5A 4GKNA 2R4SH 1BQHG 2VR4A 1X5KA 4KKNA 5GGVY 3RWIB 2HJKA 5J1TC 5ENWB 4XRCA 2VKXA 2PYFB 3EO0B 5I30L 1GGIH 1TMCB 3BYTA 5GS0C 3BGMA 3LEXB 3RFZC 4JFPB 1OP9A 1AD0A 5H35B 3QUXD 1WC7A 1GCFA 3QNXB 2ICWA 5MERA 4QRRD 2FDBP 4LLWA 3SHSA 1RHHA 1G0DA 3SE3A 3U36A 1LD9B 1OHQA 1T03H 2DS4A 35C8L 5C2UB 3TBWB 3V7AG 3FT4A 1FAIL 4CDGC 3OXRB 4HBCL 1MELA 4BZ1L 1CBVH 3LQAL 1UB5B 1V05A 1G6RL 2EYSA 2BSSA 4PYHA 1BIHA 3K80A 4ODUB 3IDJA 3UP1A 5IBUG 2COQA 4QRPD 1I3UA 4RSVA 3RL1B 3GMPB 4MB4A 5H94B 4XZUB 3L7FA 1G7QB 3RKDC 2H8PB 1I4FA 1NL0H 5F89B 5F8RC 5DJ2A 1SEBB 3VXQA 4JFHD 5HGAA 4ONOA 4Y4HC 2X1PA 2XN9A 5DUBB 2Z8VC 3GNMH 4NQVA 4WTXA 4D9LL 4WW2F 2IPKA 3ES6A 3TYFB 1X5ZA 2CR6A 4DUVA 2Z8WC 4OLXL 1J9CT 1L7IH 3BDYH 1B2WH 1FZKA 2YK1L 4ZUTA 4YFLI 3GSXB 3BQUD 1RULL 1HIML 5BMFH 1I85C 2EDEA 4P9ML 2XG5A 3QCTH 5DHVA 4LNVA 2BRRL 2VSDA 3L1OL 3RTQA 4OAWB 5BO1H 1BEYL 1ZVSA 2SEBB 4C56A 2X4QB 5ADOL 4CNIB 4Y5YB 3LS4H 1IKFL 2GSIA 4NO2B 3NCMA 1IAIH 2B8OT 1QBLL 1CDCA 2WBKA 3QUZD 3EOYG 3PWPD 4O5LL 5DJDB 3LSOB 4S2SA 4GAJH 1M71A 3MGTA 3MJ9L 5CJBA 5IOPA 1NCBH 1NFDB 1ORSA 3CC5B 3KDMB 5JNYB 1H0DB 1YQVH 5DZOA 3ZHKA 3PL6B 4F7CA 1MNUH 2NY0D 2AERT 2H26A 5D2LE 4PV8A 3MV9A 4P57A 2N1KA 4OZIE 3TFKC 4HXAL 4Z5RA 1DQQA 1BAFH 3FCTB 3N50A 4GBXC 4MAUH 4I3RH 2NY2D 4F58L 2IGFH 1MAMH 4POZC 4U1MB 4U1JA 2ARJQ 4G8EA 3WFCL 1FNEB 5EBLB 4HWEL 2GW5A 1JHKL 3CLEL 1TXKA 3ARED 3IFNL 5HGGS 3VXME 3GJEB 3MRRB 2X4NA 4YLQT 3FT2B 4YDKH 4R2GB 3IFPB 3WKML 1N3NA 4DUXA 4DKFH 1ZHNB 3QFJE 3MLYL 5DJ8A 5CJXC 3QRFM 4MVBD 3DNKA 4LLUA 1ZTXL 3QIWD 1X5JA 4RX4A 4LHQB 4M4RA 5GRWA 4RFEA 4MXQD 3BKMH 2X4TB 3QUXC 3D39E 3ALPA 5C09E 3D0LA 4HWBA 1MF2H 3W39A 3GKZA 3QA3A 1U8KB 4MX7A 4XPBH 1U8IB 3P73A 4I2XB 3ARBD 5FA3A 3G5YB 4AMKL 1PQZB 2EDKA 2FHCA 3O3BB 4WEUD 4G8GB 4NKIH 1FFPB 1YYML 1L6ZA 1I3GL 3GSWA 4ZMAT 2BY0A 1R24B 3NGBC 4MWFA 3BN9D 3VFNB 1ADQA 4FQ1H 3VXSE 4RFNB 5INDA 4LARL 4OCYH 3LKQB 2RQ8A 3TCLA 4LCWB 2A9NH 5TFSH 3L3OB 4GS7B 1PG7X 3BP4A 4MJ2A 1M4KA 5JPMB 4K8RD 4H0IA 5ACLA 3BP7B 3KXFE 3FTGB 5AZ2H 5HVFB 4L8BA 2QADB 2EDYA 1T5WA 4OFPA 2A1WL 4ISVB 1EA9C 2BZDA 4PRBB 3B6SA 4UZGA 3RIAK 5T1MB 3AMLA 1S7WA 3WXWL 4TOYH 5ACZB 4IIQC 5JDJA 5IWLA 3G6AB 5MHSD 4JM2C 5EUKB 5ANMA 3BQUC 4MB3A 2YPLD 3FRUA 1NEZB 1K8IA 4HEME 1QSED 4WUUE 5D9SA 4R8WL 3EGSA 2CR3A 1SEQL 5KANI 4ORGA 2A6IA 3AB0B 5B38A 1ROWA 1WIPA 5EULV 3ZE2E 5KJRL 3B8YA 5BVPL 5KSBA 3C2SA 4GAGH 4C59B 3QUZC 4X5LA 1MVUA 3H42L 4L3EA 4M62H 1CFVL 3HG1D 3FQXA 4MD4A 4TRPL 3X13B 4TUKL 1IFHH 2A9ML 3UPRB 2YD3A 1G84A 4ZUWA 2WUBH 5FCSH 3WLWD 4RMVA 4I3SH 4E42B 4YJZL 3FRPA 3V0WL 3WEXB 3Q1SL 5A2JH 4CJ1A 2R23B 3VRIB 4Z76A 2FWOB 4KDTC 2NY0C 3GI9H 4ODHL 2JB5H 1VERA 2H6PB 3MRPA 4BZ2L 2E27H 3QCVL 1NJ9B 2NZIA 4X99B 4QHUA 5JHDD 4HULB 4X4YA 4HGWB 4ETQB 4D9QD 5J9PA 2VLKE 4F8QA 3O2VL 3LN5B 5L0QB 4Y16A 1WBXB 2NY2C 1LDPH 4P3DB 1C08B 2FYYB 3ROLB 5HHPB 2ZJSL 4OZGF 2W07A 2ILLA 1OW0A 4PJ9B 3TPUB 1U3HD 4P2OB 1RIHH 5FYKU 2APWA 4LRNH 3K8LA 1XCQA 2JJVA 1WLHA 2NX5E 5FYJL 1VACA 1S7QA 5D7IE 3G6JE 4OM1L 4JZNA 3IDIA 5K9KA 2GT9B 2QQLH 4APQB 1OSPH 5IW1B 1YEHL 4WFHD 4MVBC 4HHAB 3VCLB 1T6VN 3W0WB 1CD0A 1QRNA 3QIWC 4JHWH 4JKPL 4K3DH 4DVBA 2X4OB 1J0JA 1VFAA 5FOBA 3BZEB 1HYSD 4AEHH 4MXQC 1KB5B 1NGXB 2P5ED 2Q76B 4C58B 2BVUA 2E8ZA 5CZKA 3VD7A 3KAAA 3K8KA 4I9WE 1T1ZA 2P24B 3JWDL 3DGGB 5ISZE 3TYGL 3V7AE 3CVHH 3DXAB 3BN9C 3HRPA 2X4RB 5C6TH 3VI3F 4EDXA 4MNQE 3SQOH 3WIIL 1JRHI 1R5WB 1TDQA 4HJGB 3UYRH 3L5XL 4Y2OA 1F6AA 1FNAA 3RA7H 4TVPD 4X80H 3KYNB 3RWHA 3MJ8B 3ULUL 4ZPTB 4U1KB 2G2RA 4K8RC 1NCCL 2ITDB 2IQAB 2DQCH 1JVKA 4XVSH 3QCUH 3WFHA 1KFAL 4M7LT 4ZFGH 4AEIL 1RUQL 1KIRA 4E41B 1M1SA 3HC3L 1I8LA 2AI0H 4BSVA 3CSYB 3VGAC 3GJFK 5E4IA 4QXGH 1UJ3B 3U0WH 2XQYK 4QRRE 4P2RA 3MRIA 2QSVA 3QIBB 4HUWA 1H5BC 1BFOA 3CJJA 2W65A 3PP4L 4YFLF 3MLSL 3E6FA 1MIEL 1URLA 3ZSTA 1X9QA 3QFDA 4WHCA 2AJXL 3R8QA 1HHHA 3UJIH 1X6NA 3QQ3A 3IDGB 4R3SB 3RL2B 1ZHBB 1G7HA 2B39A 2MHAB 5KN5A 1IKNA 3HZKB 2R1WB 5DO2D 3VWJB 4MQXC 2HJLB 1AXTH 1F42A 2ADFH 2B0SH 1QOKA 3C5SB 1JGEB 2VZSA 3P11H 4Z0BL 4QRPE 5DJXB 1T1XB 1QG3A 1IT9L 3VFWA 3BPLB 4WWKD 2B7DT 4RNRB 3WLWC 4JY4A 2EDOA 4PD4K 4ERSL 4X6CE 1DANU 5IQ9A 4AENB 1Q9WB 4NKDB 1FFRA 5E6IA 3G9AB 4DGVL 4JFHE 3BJLA 1FL3A 2CIKA 4YHKL 4C83A 4FS0A 1CZ8L 4NDMA 1VB9A 3U7WL 1J18A 3VFTA 3GSQB 4LDLB 4A6YA 1RJLB 4XBGA 5E2VL 5FM8A 4CU7A 1LO0L 5DFWH 4YQXL 3EYUL 5I18L 1HKLH 2PN5A 4ZFOL 5FKPA 4EJ1C 3D87B 2EH8L 1UVQB 1C12A 2IH3A 2AJYH 4L4VB 5DEZA 1XZ0A 2A6JB 5GIRB 5T1KA 4JFYB 1JGLL 2BP3A 1LVEA 2XWJB 1MRDL 5HYSB 5TPWL 3PG2A 4JKMA 3V6OA 3RVWD 2B4CL 4ODWA 5D70H 2WUCH 1U3HC 2YUWA 3MNZA 5DGRA 2RCSH 1HILB 3HI6L 4LCIL 2FNBA 3PWPE 3T77B 3MRHB 3RUGE 4CN4A 3L6FB 4XHJD 1B0RA 4JDTL 5HI5D 1FNGA 3VXNA 5DHXB 2I9LA 3I6KA 3LCYA 4ODTL 5EFIB 3QI9D 5IR1B 1U8JB 5E2JA 2W1NA 1HYSC 5DMYA 2CRIA 2AV1B 2EDFA 2DQEL 4WO4A 3QSKB 1CYGA 3KR3L 3BIKB 4CVUA 5HVHC 4F7TA 2XWBA 4F57H 1OARL 2O61A 4DKEH 4F7PA 3NIFE 4JG1H 1BX2B 5HDOA 5CLWA 3P9LB 1XF1A 1ES0A 4JDZA 2EXYD 4OV6F 3O6FB 5FB8A 4KROC 1BBDL 3SGKC 4Z7UE 3BP5B 4ZO6A 5IIEB 1KIPB 1UM6L 4O02H 2IPUG 2QLVB 4Y19B 2WIIA 4JPVH 2NY6B 3FFCB 4UDTB 4YK4B 1ZK9A 2BY1A 1YQ2A 1SBBA 1DBKH 4GRLB 1GC1C 2F5BL 4HGKC 5JOEA 2DLFH 2D7OA 3GBNL 4I0PB 3RWFA 5JIIA 2ZUTA 5FEBA 1QBBA 2NY5H 3GMQB 2QSCH 5IW6A 3HC0A 1HCVA 3K3QA 4NPYA 1HXYB 4LPVA 4PV9A 5EBGA 3MRFA 2XG4A 4QY8A 3P9MB 3U1SH 5C07D 4GKZA 4NUGH 2DDQL 4UNTA 3QDGB 4Z7VA 4L9LC 5IVZB 1BIIB 3DUUA 4L8SA 1NAMA 1PW3A 4Z6AT 1XCTA 1PEZA 1R3LB 1QSVA 3DBXB 4P4RA 4DZBB 1ZGLM 2WSKA 3HNVH 3LRHA 1QSFA 1EIBA 3BUTA 2UZYB 4GJTB 5KSUB 3RI5K 1CXHA 3NFNB 1QACA 2YUVA 3L9RB 4HKBB 1MUJA 5C09B 1INEH 4WWKC 1G7MB 2GY7B 4IJ3C 3OKDB 4LSPL 1YEKH 3OKMA 3BWAB 3B9KA 4P46D 3D18B 2XNAA 4FQIH 3WSQH 1DDHA 1WF5A 2R69L 3U4EB 3JVGA 1JPGB 1WFTA 1JV5A 3TO4B 2E3VA 1VGEL 2DQFA 5MHSE 1JNLL 4D0CB 3UZVB 1DUYB 2EDBA 2EDTA 2HFGH 3LRSB 1NKRA 4BM7A 2YPLE 3BEVA 5ALBH 3JTSB 1QSEE 5B38G 5HHVH 3SBWC 4GXVL 4ZSOB 5I1LA 3RVWC 2PW1A 2IAMD 1I1YB 1U8NA 3VXRD 1NMCB 2GHWB 5I1DB 4JR9H 8FABA 5DD6B 4V1DD 4L4TA 1XGRA 4LCCA 5EZOH 4BFIB 4CW1B 4JFDD 2EXWD 1EO5A 4OZFA 2MQ3A 5HI5C 3AS1A 3TWCH 5DSCB 2DWEB 2OZ4H 1PKOA 2V17L 3DSFL 4HT1H 5C0DA 3RVTD 3SCMD 1MHEB 1OGAA 3Q6FA 5DS8A 1TETH 4WNQA 2DQJL 2IPTH 4MNGE 1UT9A 2F53A 1LDSA 3U9UA 4OF0A 2FO4B 1M7DB 3DX9A 5EU3A 4D9QE 4KHTL 2QSTA 3CVHB 4PJXA 3S96A 5MEQB 4LAQH 4PG2C 4Z7OF 1LP9A 4FG6D 2AJ3B 5F44A 4S10A 5I1CL 4DW2L 2EXYC 1KBGL 4Y4HB 3G5VB 5F96H 4M6NL 3KYKH 3TESA 4N1HB 4JKLA 4MJ6B 1IEBB 1MFCL 3AVEA 1NGQH 3TGXA 1KPRA 3ISWA 3U0PB 4BQ6A 3QRGH 4HUVA 2BXZA 4JN2A 4WFHE 2VLKB 1MJUL 3NBNA 1Q0YL 3MLUH 3INUH 4WTZA 3WFEH 4ZTPH 4JPWH 2UVFA 2DM3A 2P48B 2PYED 2ZSWA 5A3ID 2P5EE 5IF0A 3TIDA 3TBSB 1CXEA 1CGSH 2P8PA 1D5IL 2NX5B 1QZ1A 4ZG1A 1U8PB 1ZWIA 3KPSE 4YDLC 5D7IB 3D9AL 1UGNA 1BQHB 2VLRD 5MENA 3LHPL 2V9RA 4G9FB 3EO1B 2X42A 2YPVL 2IFFH 3H9HA 5SWQB 4NO0A 4YZFE 1CFNA 5ICXA 4XPFH 1JZ5A 5C7XL 1N8ZA 2ZCLL 4TVPE 1AO7A 4OFYA 5IK3B 15C8H 4LSRH 4BQ8A 4HUKB 2E6QA 4ZO9A 2D0HA 5IMLB 4X6BA 4IMLB 1N0XH 3IDNA 4P46C 2VABB 1H8SA 1T1WB 4JVUA 5DK0B 5FHAL 2DBLL 4UIKH 1EK3A 4UILL 1NCAL 1BJ8A 3QDJD 1YZZA 3CAFA 5EBMA 4Q9CA 1N4XH 4JY6B 1FL6B 1YNKH 4QOKB 3QT2A 1A1OB 1JUFB 4LK4A 1TFHA 5IBUB 4AT6A 4BSWA 3EO9H 3BVNB 5D5MA 1WVZA 1S9XA 4M6MH 3D6GA 4ZPVA 1KJ2B 2F8VA 3GEWB 1J8HA 2MOVA 5F9WC 3OKLA 2IAMC 3VGFA 1WJ3A 2ERJC 5FYKD 4OD1H 2BNQD 1QD0A 2WW8A 3VW3L 3OG6B 1P1ZB 4NQDA 5KW9L 4HUNB 2X9YA 2EXWC 3Q2CA 3D85A 43CAA 4YX2H 3QUXB 3SO5A 2GYSA 3N9GH 3UO1L 1ZHKB 4XCFH 2N7AA 5ADPH 1EEZA 3SN6N 3UTTD 4M7ZB 3QUKB 2BOBB 4OD2A 4XNMB 4J4PD 4XP5L 3RVTC 3SCMC 3CUPB 1W8NA 1N5AA 3IDYC 4GRMB 5DWUH 4OM0H 4DCQB 5L88L 3VDAA 3NGBB 1G7PB 4HF5L 3WLBA 5CUSL 4XGZA 5E94B 4YBQD 5T1DL 4HV8A 3QEUA 2AJZA 2AV7B 4K7PX 4G8FA 5FYLH 4QRPB 1NSNL 3V2AR 3P4MA 3L95B 3OWEA 5JDSB 2I27N 5B21A 3OAYH 3T3PE 3ULVF 1XF4B 1AD9B 5DK2A 4M9PA 4FG6C 3KPPA 3MV7D 4OTXH 1RZIA 4M5ZL 1WT5C 3MV8D 4HLZG 1XIWA 2PCPA 2V2XA 2UY7A 1U3JA 1CICB 2Y07H 1KTLA 1K8DA 5GQBA 3TBYA 4HKZB 3T3MF 4P2QA 2R8SL 1P6AB 4OUOA 5T3XL 3DUHA 2A77L 1MHPL 1UWXK 4AEFA 3SDCA 1FCGA 4L3CA 1V3JA 4MXVE 3EFFB 4F37K 1JCKA 1TJIH 2F54D 5EO1A 4GKSB 5GGVL 4MNHA 1MREH 2JJSC 1M7IB 3HFML 4HFUL 2ITCB 5EZJA 3GBMH 3GDBA 4RGNB 1D9KD 1UZ8A 3RVXD 5A3IC 2UWEA 4GRWF 5EORH 2NW3B 3QUZB 1MCWW 3PWPB 2A74A 1FSKC 4ZUSA 1WEJL 3BKJL 4HZLA 5KVDL 4S1SH 1YN7A 5E2WL 4X6EB 2O5ZL 4IHOB 4CU8A 1Y6NR 2PTVA 4Z95H 4MA8H 3P30L 4JO1L 3HLAA 3AXLB 1NMAH 2R0KL 4GMTH 3G04B 4G6MH 5B3NA 2NY7H 1CFTA 1MJ8H 1F6FB 2JELL 1MFBH 2XTJD 4X9IA 4NT6A 1A1MA 4J3UA 2I9TB 4K3JH 2GK2A 3WD5H 2WANA 2NY2B 5C08B 1RQ5A 1HHJB 4HCRA 4DZ8A 3QHTC 5FK9A 3IYLW 4WUKH 4KMQA 1QRKA 1RIVL 3AREB 5FM5O 3S4SA 3KJ6H 5CSZB 1WCBA 3E6HB 1W0VB 3BN3B 3OSKA 2VR5A 4Z7UB 1WFOA 4LGPB 4L5FL 5CHNB 5CEZH 1MQ8A 2WWMD 2QQNL 3IVKB 3PWLA 4RGOL 5CWSB 1ZMYA 4HIEA 4JAMB 1S9KC 1HXMB 4YXKH 4PREA 5HPMB 4YXHH 4X83A 2DL9A 5I2IA 1ZLVH 1ONQB 2PXYD 5LCVH 1RIUH 1JF1A 3C5ZD 5E5RB 3QIWB 3OB0K 2YRPA 1FFQA 4WHYG 1BBJA 1IZKA 5DFVD 3L3KA 4BUGA 4HWBH 4O2FA 4P4KA 4LSQH 5C9KA 1T21B 3TA3B 1F3DJ 4Y5VB 1RUML 1S7SA 3MLXL 3U82B 1VHPA 3ARBB 2YEZA 4K9EC 4LU5H 4EZMA 2IQ9H 4J4PC 4Y1AD 4BKLB 4U1SA 2EYRB 3RKPA 3MPCA 4O4YH 1ADQH 2MNUA 3U7AA 1T83A 1YNTB 4I0CC 4KY1H 1B4JL 2DIAA 4YBQC 1QEWA 3SJVA 3FMGH 3GJFA 3V4PH 3MRKB 3S35H 3H3BC 4F15C 3MRNA 1YMMD 2D9CA 5C0CD 2VDQL 4MJ5A 1KLGB 1KPUB 3PIQA 4EVNB 5KVFH 5TH2A 3C09C 5BQ7A 1GOGA 2VISB 3DX7B 5IMKB 4OLZL 4X5XB 5GGRB 3RRQA 5J3HD 2OSLA 3PGDA 3DWTA 3CMOH 4V1DE 3ZZ1A 1D5BB 5ESVB 4JFFA 4P5TD 1RUAL 4CN1A 4KVNH 4KJWD 1J0YA 4JFDE 5CKGA 1I1FA 1EEYB 4OCSH 1MFAL 4BQ9A 4HK3N 4L3AA 3QULA 1QSEB 2FX9H 3L5WA 3S36X 4PJBE 1AFVL 4MSWB 1MIMH 1UZ6F 2DQHL 1A6PA 5D7JA 1BQSA 1LEGA 5GPRA 4PUBL 1FRGL 4NQSA 3QQ4A 2CLZA 2CKBL 2Y6SD 1V7ML 1N0LA 5JA8B 4PJFA 1D9KC 4OD3L 3RVXC 3ALXA 4GG6E 1MQKH 3U2SB 1QKZH 5EU7C 4XTRD 3AMKA 1A6WH 3EFDH 3VFOA 1N5YL 2VE6A 2IG2L 3HG1B 4OIIH 4RISH 3W11D 5IG7A 3GMMB 3ULVH 1OAKH 4JZJA 1KT2B 1N6QL 2X1OA 3TZVD 1RZ8A 1X44A 2MSPA 1I9IH 4OB5L 1WTGT 2GSGA 4DOHE 4ZO8A 3STZA 1NLDH 5I71B 3VFVA 3R0NA 3G6DL 5FO7B 4HLJA 2DM7A 5JQ6H 5GGTA 1XGYH 1UH4A 5JHDB 4MNGB 2DQDH 2XTJC 1U8LB 1Q9OB 1CLOL 2PW2B 3TNMB 3CXHJ 4WW2C 4ETYA 1FVCB 2YKLL 5FUZH 3FB8B 3PQYE 2R56H 2AABH 2AQ2A 5IB3B 1JWSB 1IEAB 3KYAA 4QNPE 1R3KA 5JXEA 2PYEE 1BFVL 5C2BH 1NC4D 4MDJA 1U3HB 3QNZA 4X6FA 1JN6A 3RX5A 5BRZA 2WWMC 2VSCA 4FQQB 4AL8L 4X7SH 1UKSA 4JRYA 1BFSA 4HFWA 3W81A 5FOJA 3ORJA 3C08H 4XRCB 5C0ND 2VLRE 3UJJH 2OJEB 5CINL 3K0WA 1H3UA 2PXYC 5C0AD 5L2KA 5E8DH 1BGXH 1VDGA 3C5ZC 1QTYT 1MHCA 2P43B 3FOMB 4WU5B 4BFEA 4L1HA 1WC7B 2Z31A 3NCBB 5T1LD 1YPZA 5DFVC 3S37L 4PJCA 5JHLH 4KAQL 1DEEA 1DE4A 4OCXH 5HDBE 3IXTB 2IBZY 3CX5J 3ECBB 1X5GA 2K3TA 1KN2H 3FT4B 4PJIA 2FECI 3GMOB 3GUTA 1CFBA 3W9DB 5DEFB 1TCMA 1MWAA 2EYSB 4OLUL 4Z7WE 5HHQA 4HIJB 2Q7NA 1BECA 3B3IB 3QDJE 3CFBA 4NJ9L 4U33A 1CU4L 3LEVH 5GJTL 3KPLB 2YUZA 3ARPA 3SEPA 1OY3B 1HHKA 5DC9B 4KDVA 1FLTX 5JUEH 2VDRH 3L3DA 5DJ2B 3VXQB 5HGAB 2AK1H 4Q0XH 1T22A 4JJHA 4O9HL 2OTWA 4IMKA 5KSVA 5J3HC 4KUCF 5FYKE 2BNQE 4GLRI 1UM5H 4XX1G 1FZKB 3RY6A 4P5TC 3REVB 3WJJC 3PDDA 5T33L 3RJDA 4KJWC 5GGSY 5SX4I 5CFHA 3OBAA 4LEXL 2FGZA 3RTQB 3UTTE 1WGOA 3ZT7A 2X70A 2ADIA 4U7KA 4AJ0A 1AIFA 4LKCB 4G3YL 3OAZK 2NY4D 2Y6SC 2HH0L 4P9HH 1H3PH 1MCEA 4RQQA 1CFQA 2VH5H 1KEGH 4A2MA 1ZA6A 3W5MA 4X6DE 3NPSB 2XKNA 4XTRC 1E28A 5ETUB 1J05A 1QSZA 4P3CH 2JIXD 3W11C 2Y72A 1J8KA 3MGTB 4WWKB 5EPMB 3ME0A 2F5AL 2ZUUA 3T2QA 3TZVC 1ORSB 1F4HA 1IM9D 1I3RA 2DQIH 5K93A 2ZUSA 2B5IB 2D7PA 5D8JH 3MV8E 4MD0A 3I6LD 2VXUL 2H26B 4G9DB 4LIQE 3MV9B 4PV8B 1WFUA 3AROA 4G7VH 3CU7A 4A6YH 5BZWA 1JP5A 4NWUH 5B22A 5BZDB 4V2BA 3BUYA 3TT3H 4G8EB 4KMTL 4PJXF 2F54E 3PHOB 3GRWL 5DJ0A 3VG9C 4HIHA 4U6XA 5DD1L 1LP9F 2BVQB 2C4XA 2JKXA 3PV7A 4M9OA 1KIQA 3HB3D 4R90H 1J7VR 3WFZA 5DD0H 5I1IH 2FR4B 4HLZH 4ZUUA 5EU7E 4OT1H 4DGIH 3RZCA 4PRHD 2XT1B 4ELKB 1KCSH 2RR3A 2AEPH 2AXHA 3R06A 1A9BB 4JFZH 4LLUB 5C0NC 4M43H 1AQDB 1UWEL 3QI9B 3ZYZA 1U3YA 1ZLUH 3MYJB 1I7UA 2DKSA 2K7QA 4V2CB 4FFZH 1TIUA 2J1KA 5F1OB 2HLAA 1ZS8A 1I9JH 3P77A 4ZNEE 2A6KA 3CLFL 1RZKL 1BWMA 5FA3B 3FB6B 4WW1B 4G7YH 4N8CH 4PFEA 1P4BL 2BK8A 2QEJA 2XTJE 2O5XL 4BZYA 3UMTA 5DYOA 3GSWB 1FE8L 2PTTB 4RFOL 3RNKA 4PBWD 3CFKA 2VDKL 1C8PA 1BVKB 3CU1A 4JPIA 1MH5A 4FMKA 1B0GA 4I18A 4XXCC 3TN0C 2G9HA 5AG9A 3HI1B 3ZTJG 1FYTA 4NM8L 4NO3B 3NZHH 1LO3H 4GO6B 3HKFA 3QP3A 1MFEH 3S3JA 4XHQA 2CUHA 2XWTA 2FGWH 1GZQB 5E6ZA 2QHRL 2E7CA 2OQJA 4ODVH 4OLYL 1YJDH 5ANMB 1MCSA 1QYGH 1E4WH 4Y2DA 3MREB 1G7LB 4MQSB 5ELIA 1OD9A 2C3VA 3OX8B 3GHEH 5C07B 3P0YL 5A40E 4ORGB 5D5MF 3IKCB 4YDLB 3QWRA 5B38B 4Y1AE 3L5IA 1NAMH 1S7XB 3KLSA 4NO5A 2D4FA 3RDTA 4LLQA 5KSBB 1IJ9A 1QP1A 5GRUH 5JIPA 1EGJL 3MLVH 3F7PC 3FQXB 4MD4B 3KHOA 1Q9KA 2I5YL 4ALAH 5E2TH 5LKNA 3HPLA 3IT8D 4ZUWB 4Q6IA 4WDIB 4WHYH 4UOW1 2VXTH 3HMWH 5DRZA 1YMME 5E9DD 1YEFH 5J0BA 5C0CE 5EIVA 1OAUL 3CZJA 3VFMB 1RMFH 1ACYH 2WP3T 4P46B 4PGEB 3SDDD 3QO1A 5DDHA 3QJFA 1A21A 1NLBL 1IC7H 1S7VB 4YHPB 3DRTA 1A7QH 2B1AL 2DLTA 4JY5L 1H9VA 1OB1A 2B20A 3RIAF 3BXNA 2WBJD 5EUOF 4XCEA 3GSVA 2Q20A 1UXWB 2LQRA 1L7TH 1MCKA 1DBJL 5ESQB 2C9AA 4FNLH 2GK0B 1HWHB 3QG7L 5MP6L 3WFDL 5F9WB 1A7OH 4CBPA 4XP9H 4NHUA 2IAMB 4N8VA 3HB3C 4FTVD 3VXRB 3AU1A 4TVSa 1FL5A 1RU9L 1VACB 4M8QB 1KCRH 1S7QB 4L8CB 4JZNB 4V1DB 2R0WH 3WN5C 5F9DC 1K4CB 1U93A 4JFDB 3SKJL 5E1AB 1NGWA 3SGDI 4O58L 5DTFB 4CDHA 4PJBB 1MEXH 1QRNB 1ZT4A 3PHSA 1FGVL 2ZKHL 1DBBL 3SCMB 5IV2B 4PJGE 2G60L 5A16B 4FQCL 1HINH 4GG6B 3HNSL 4MHHI 1CD9B 5ABDE 3OTTA 5JZ7C 5HYIA 1J87A 4PGCB 4W4OA 3FQNA 5I1EH 4YAQB 1RY7B 3TNNB 4DOHB 4YPJA 4RAUB 3D69B 2FB4L 1JGUH 1XR9A 3EYOB 3AFLA 3RWHB 4NQXA 4BH7B 3RWGA 1QFWL 3FB7A 5DK3A 1KOAA 4N0FB 3J8F7 2Y7QB 4GW4A 3ZKXC 4XAWL 3ABZA 4NBZB 2EDHA 5C0AE 1PG7H 4Z7NE 4JRXA 2A73A 3SO3C 4GW1B 5KS9A 2F74B 2PYEB 5F1NB 1RVFL 1K5NB 5CJOH 5HXMA 3EHBD 3MLZH 4LPUA 4P2RB 3MRIB 3C60D 4HUWB 1BFOB 5DI8A 1JZ7A 1AGFB 3E6FB 5C6PB 3DV4A 5DUPH 5CD3A 4M02A 5HGBA 1FJ1A 1HI6A 4PRPA 1QFUL 4XP6H 2VIRB 1NAKH 1UA6L 1NDMB 5E8OA 3MRDB 2VITA 3SE8L 2BFVH 5CLTA 2RIKA 2UZIL 2C7UA 3FL7A 4WI4A 3VFWB 3LV3A 1I8KA 5I16B 1O5DT 3KGRA 3M8OH 5TQ2L 3HE6D 3VXUD 4OSUL 3ZDZF 3D48R 4OZGE 5J4MA 2FJHB 2DQGL 1FL3B 4NC0B 3AAZA 2HYMA 5T3ZL 4HGMA 3D3VD 3SDDC 1NGPL 1GJIA 2P42B 4N5UA 4B5EA 2CDEA 4ZXBD 3RGVD 1UM4L 1CDIA 4A6YB 1MHHB 5KVMC 1JPSH 5E6YA 3QDJB 3C8KA 1QFWM 1MFDL 1TZGL 1LHZA 5FIEA 2R2EB 2WBJC 5E08H 3WDHA 3MLRL 3R1GL 1Q0XL 2VL5B 3SGJC 2Q8AL 1XZ0B 2WV3A 4YDVB 4CL7A 1W8OA 4F7EB 1IAKA 1DVFD 4KTDL 3BE1H 1JHTA 4LVHC 1PGRB 3OQ3B 1S78D 1RZJH 4IRZH 4ODWB 3VA2C 4Q9BA 1MPAL 3CMGA 3B43A 5D7SH 2BNQB 5J13B 2VO5A 4YHZH 1B0RB 2GJJA 3V4VL 2LU7A 2XV6B 32C2A 3I6KB 5HHOD 4YDIL 3VI3E 1QLEL 3BH8B 3UTTB 1U8QA 4Q2ZB 5KAQF 6CGTA 3V5HA 5AZEH 3MRJA 2MKLC 5B8CC 2X5PA 4PJFF 2DLHA 4YPGA 4XMPH 3SE3C 3QDAA 3HC4L 2XWBB 4ZOEA 5L6YL 1DFBL 2JF1A 3ZDXE 2W91A 1KJVA 3LEYL 4QYOA 4DTGL 1S5IH 1BWWA 3KPOA 2DI8A 4OQTL 4W70A 5L2JB 3DURB 5E4EB 3VG0H 3MUGA 4KKBD 1ZXQA 4XPTH 3MV7B 4R96A 2Q6WB 4HPYL 4S0SD 5D1QA 5IVXA 5I8KH 2WIIB 1I8IB 3K4AA 4FP8L 3R8BB 4OIBA 1YN6A 4PRHE 4FXGA 4YNYA 3EW3B 1RJYA 5I8OH 1ACZA 4AH2B 5DXWA 5F7DA 3QISA 2OBGA 4JFEA 5T5FH 4KU1A 5JW4M 2CJUH 5GISH 1NMBH 4M7KH 4WCYL 1DBMH 1HE7A 1XGTA 3EHBC 3B4NA 3C60C 1J0KA 2ENYA 2DKMA 4Z7VB 5IHZB 3DUUB 3QXTA 3GI8L 3T1FB 1EVTC 2FD6H 4YIQA 2ORBL 3GSRA 1WSST 4HKXB 1EFQA 1Y18A 1FO0H 3NFSH 5I19L 1GIGL 5EZLA 1QSFB 1GRWA 1C1EH 3V7MA 3MRLB 1FDLH 1MUJB 2HT3D 5K9JH 2P8MB 5I15H 1IVLA 4K3HA 4PJCF 1QLFB 2QQKL 3HE6C 4PLKD 4LVEA 3ZTNH 1OGTA 1KCVH 5FCUL 3BPCA 3GHBH 2CMRL 2HWZL 4K23H 2XNAB 2XTJB 1CT8B 1DDHB 2AJVH 4PJIF 3LMJL 3UC0L 4NRXA 5I74B 1V7NH 1X5YA 1JV5B 1I9RH 3MBXH 4ZXBC 4HCRH 3RGVC 1EX0A 3RWIA 4KVCH 5ENWA 5BW7A 2FH8A 1QBML 3BEVB 4P48A 5C6WH 3DROB 3LEXA 1DVFC 5SX4H 4JFPA 1VPOL 3MOAL 1HZHL 1OPGL 1WFNA 3QNXA 2GFBB 2PW1B 1NUGA 1S78C 5IGXH 3MRQB 1U8NB 5KTEL 1R5VA 2APVA 3ZTJH 4XPAH 1LD9A 2PXYB 1ND0B 5IESH 2DTSA 2H3NB 4KGJA 3TBWA 4G80A 3C5ZB 3GMNA 3OXRA 4FFYH 3PP3K 3OR7B 1UB5A 1KULA 4YWGL 3RI5F 4FQLH 1KNOA 4U2YA 4ODUA 3T08A 3QHFL 5TE6H 3O6KL 1KCLA 2IANA 5E9DE 5C0BD 1MRFL 2J88H 1CLYL 5C0DB 3GMPA 3C6SB 3AM8A 3Q6FB 4Y1AB 1G7QA 1AE6H 3O6LH 2H2SD 4L29B 2VC2L 1CBVL 5F89A 1RUPH 2JK5B 1SEBA 3BSZH 3QH3B 1QHOA 4P5MA 5DUBA 5EU3B 1H3XA 5E70A 3TYFA 4JM4H 3X11B 3C6LA 3S96B 3GSUB 3HZMB 2MCPH 1YMMB 3GSXA 3LQMA 5C0CB 4UDUB 1D5XA 2UYLB 4KKBC 4F7MA 1RHFA 4CN6A 1NL0L 4FTVE 1FZOB 3EKCA 4OAWA 3SE9L 5K9QI 4QF1A 1KPRB 3ESVF 4XNYH 2BSRA 2SEBA 3KPRD 5FGBC 1JK8B 1V3MA 2X4QA 4ORZC 5E03A 5I66A 5CJ8A 4Y5YA 3EOTH 1B2WL 4NO2A 2XZCH 5IEKB 1FH5H 5BMFL 3I75A 5DJDA 3MODH 5FHBL 3SKNB 1CQKA 1DQJB 3HRZA 5EZIH 5BO1L 2OYPA 2XXCB 4HS8H 1NFDA 4JCLA 5DVOA 1U42A 2X1WL 4AYFA 3WIHL 2P8PB 5JNYA 1H0DA 4KV5F 4WIQA 1ZWIB 1FIGH 5HYJA 3DLQR 4HS3B 3PL6A 2BVOB 4PB9H 3BZ4B 2CUIA 5I1AB 3ARGD 4NKMB 3KWWA 4XAKD 3HN3A 4R0LC 1GXEA 3H9HB 4X4XB 1NCBL 1TQCC 1OTTD 3ARFD 4EN3D 2ZPKL 3FCTA 1N8ZB 1YQVL 4PJAF 4U1MA 4PJGB 3WBDA 2HT3C 1KLUA 1XMWA 2ZUQC 5EBLA 1MNUL 1PG7W 5GGTH 2EIEA 4PLKC 3WUZA 1R0AL 1Q38A 4KKLD 4LAJH 4ZFOA 5IB4A 4J3WA 4H8WH 4XMKH 3GJEA 2BY3A 3FT2A 2BOCB 1BAFL 1TZHA 3IFPA 4MAUL 2XRAH 1ZHNA 2IGFL 1MAML 3E2HC 3T0EA 2VAAA 2EDDA 1SY6A 3P2TA 3H3KA 2Z93A 1S5HB 4NZDA 3EOBB 4XT1C 4Y16C 3IB4A 3WDJA 2YUXA 4X8JB 4ZPVB 1TLKA 2IMNA 5EIQA 4YDKL 2NLJA 3T0VA 2MWCA 1U8KA 4ZUVB 1U8IA 4I2XA 5AAMA 5CKAA 2EYTA 3L3HA 3G5YA 4DWHA 1PQZA 3UJTH 3O3BA 2LTQC 1P5UA 5IBTH 4G8GA 4YFDB 1FFPA 3FQWB 3E3QC 4DVRH 1R24A 3CH8A 5T1LB 3VFNA 2DRUA 4CMHC 12E8H 2H45A 3LKQA 1LILA 3VXUE 4XPBL 3LQAC 4LCWA 2VNCA 5EWIH 3UTPD 1N5AB 1U91A 3L3OA 2E6JA 3D3VE 5JPMA 3V5KA 5AWNL 1U36A 2H2SC 4JZOB 2GAZA 3O9WD 3STLA 3FTGA 1M6OB 3DO7B 1LK3H 3OJMB 4NJAL 4N0CD 4NIKB 2XZZA 2PO6D 4OCYL 4PRBA 1NC2D 2CLVA 4LIQL 3G6AA 1BZ9B 5DK2B 1LQSR 3BX7C 5EUKA 1RZIB 3UBXA 2R39A 3JUYA 4G6AD 5AZ2L 1KXVC 1PKQA 2WIMA 2D7NA 4UTBH 1KTLB 3W2DH 4H5SA 3BOVA 5HDQL 5BV7C 2AXJA 4TULL 4L3CB 2DTML 1XF3A 5HHOE 1WQVT 4U0RB 4MNHB 2HFTA 1P4IH 2EDWA 3X13A 3I6GB 3UPRA 3MJ7A 2VB5A 2IBGA 2NY4B 2YD4A 1UZ8B 3WEXA 4C4KT 3QG6A 1IGJA 2UWEB 1OAQH 1YEJH 2B2XH 3D25A 2A74B 4NQCD 5F7MC 3VRIA 2FWOA 4GAGL 5D2NB 4ZUSB 3BMWA 4YHIB 1A5FH 2JIXB 4M62L 2R2CA 1FO0B 3ARGC 1EFXD 1PX4A 3BH9A 2CGRH 5A1AA 4X9BA 4HGWA 4JGMA 4I3SL 5ERWB 1OTTC 3ARFC 4OFDA 4EN3C 2BVTA 4YHML 1WBXA 2E7LA 1XF5B 1V3KA 5K59F 1C08A 1CFTB 3ROLA 1QFWI 2XA3A 2XZAL 5GJSH 4AM0B 5MI0C 2HN7B 2JB5L 3TPUA 4PJ9A 4KKLC 4J3XA 4R9HA 4U0QB 2E27L 2HFFA 1NCNA 3S34L 4P2OA 3VFSA 1A1MB 1NANI 5E6IC 1GL4B 1DZBA 3S37X 4F37F 2GT9A 1F45A 2W59A 5C0FA 4APQA 1LDPL 1R5IA 5IW1A 1RV6X 2QSQA 4X9HA 5F6IC 3NABH 4HHAA 4EBQH 3W0WA 1DLHB 3MOQA 1BJMA 3CFCL 4ZAKD 3BZEA 1CIDA 4DJMA 2ZP0T 1KB5A 1RZ7H 3K2UH 1NGXA 4PRHB 3WN5B 4URTB 2DN7A 2FBJH 2AQ1A 3MV01 4KTEH 3V6OC 5ICYA 1X7QA 2VDMH 4WHTB 5GRZA 5TDPA 1MCQA 1OSPL 1DQML 3HPJA 2P24A 1JF1B 4G6JL 4IOIB 3DGGA 1QFPA 4MMXC 4K3DL 2NR6D 2W0PA 3L3KB 5KS9F 4XPHH 3DXAA 3HR5A 1T1YB 4WU7B 4ELME 3TO2B 2WWKO 2X4RA 4AEHL 1S7SB 1IGTB 3U7YH 4M3KB 4FZEH 1EEUA 2X6MA 5EA0H 4MS8D 3KYNA 4X98B 1WZMA 3MJ8A 4PBVC 4U1KA 2HTLD 2VDNH 3S3SA 2ICWJ 3NH7L 4LQFH 2EIDA 3CVHL 5AD0B 4N0CC 2DM4A 2PO6C 4MJID 3HA0A 4E41A 3UYRL 1P84K 2W0KA 1C5BH 5FDYA 3RA7L 1UXSA 5SX5K 3ARZA 3CSYA 1SYSB 1NPUA 4F80A 4MJ5B 1AP2B 2VZUA 3B2UC 2R4RL 3PIQB 2AJUH 1UJ3A 2DQCL 4K7PH 4G6AC 3BWUC 4X4ZA 3GK8H 4F9PA 4ZFGL 3PGDB 3QEQD 1JNJA 4PGBB 4WV1B 3KS0J 4JFFB 3IDGA 4DN3L 2MHAA 4LSSL 1DBAH 3E3QE 1AXIB 1A8JH 4KQ3L 4UNVA 3VWJA 3MMEA 4NRZA 1CGXA 3DHMA 7FABL 2J8UF 2YMXH 3L5WB 4KJPD 4NCC1 2FL5A 3UDWA 4EOWH 2C3XA 5C0BE 1A7NH 5JMOC 5DJXA 1GOFA 3M1BA 4LRIC 1IQDA 1T1XA 4NQSB 5GHWH 2GKIA 4RNRA 3BGAA 5D1ZD 3UJIL 1CIUA 1H15B 5GZND 3BI9X 5ALCL 4AENA 4NKDA 5LG1A 4F3FA 4KI5D 2XOTA 4PRNB 2ATPA 4KUZH 3VFOB 1AXTL 4LBEA 3K7UA 1DQDH 2ADFL 2B0SL 1RJZB 2BHUA 2VE6B 5IG7B 1FHGA 4OQ1A 4JZJB 2ZCHH 3U4BH 5E99H 5CP7B 1G9MC 3GIZH 2GSGB 5E9DB 1E27A 5HHXH 4HC1H 5EU5A 2QHLA 3EYSH 1T5XB 1R3IH 3ZKNC 4MGXA 3STZB 1KB9J 3SDDB 2A6JA 5GIRA 2EDJA 5ILTL 1UEMA 4U4BA 5DD5H 4JFYA 3U4AA 4EIGB 2XWJA 3H7BB 5HYSA 2LVCA 3S97C 2Y5EA 3KPRE 1YEGH 1JWUA 5BOZG 1SVZA 4JQXC 2WBJB 1ZGLP 1HILA 3DVGB 1HKLL 2N7BA 3NCJH 1CL7I 2VTFA 1FZJA 2L7UA 3T77A 3MRHA 5DEGB 2AJYL 4JGUA 4QHMB 3JVGC 3L6FA 3R4DA 1YDPA 4LVHB 2ZUWA 1R3KB 3VWKD 3RWDA 3GKWH 5IQ7L 2NY3B 1T66D 5TGBA 1MRCL 5JTWA 4K94H 3QNZB 4NC1C 5D70L 5IR1A 2DOCA 2WUCL 1I8MA 1CTOA 4J1UA 4ZAKC 4RZCA 2RCSL 4NKQB 4EIZC 2VYRE 4HFWB 4AG4L 5IJVB 1DJSA 2VDOL 4ZD3L 5DRXA 2C1OA 3WE6B 4R6UA 4UI2A 4XAKE 3X12B 3S9DB 1BOGB 3TVMA 2XZQH 3WFBH 3SDYL 4BZ1H 1YEDB 4EKXA 4S1QL 1KLFA 5KSAA 2NR6C 1YPZB 4KZDH 4YHLL 3P9LA 3B9DA 3MBED 3JWDC 5IHLB 5B8CB 3RU8L 2L4OA 4N9GB 2NZ9C 4NCC2 3O6FA 1BZQK 4HWNA 2APXA 5HD8D 3GM8A 2GJZB 4MS8C 2YD6A 3BP5A 5IIEA 3QIUD 5E95B 3GUTB 5CD5C 4F57L 2HTLC 3BAEH 4MCZB 4OZIA 4DKEL 5DJ6B 4JG1L 3CFBB 1AGDA 3QNYB 4UDTA 4K2UH 4D9LH 1TQBC 1I1AD 2EH7L 4XNXH 4OLXH 2ZG2A 3QHZL 4UNUA 3DMMD 3UCRA 1UZ6E 2YK1H 1IZJA 1ZHLA 3L3DB 1UWGL 1L9MA 3T4AB 1LE5A 1HIMH 4FZ8H 1Q72L 4J12A 1HXYA 2HRLA 1U0QA 2JJWA 4O02L 2BHZA 4P9MH 3V6OE 1IGIL 3VXMA 3P9MA 3FAXA 2OTWB 3QDGA 4TNWK 5IVZA 1DBKL 4NRYB 5HSFA 2DLFL 3ARTA 1M05B 1PD6A 3QFJA 3WS6A 3BW9A 1IKFH 2NY5L 3DBXA 4DZBA 4HWZB 1N6UA 4O5LH 3ARDD 4NYLA 2X70B 2ADIB 1A3LH 2CDGB 3U1SL 5I17A 1AIFB 3LIZL 3ARXA 4YBHA 3NFNA 1Q94B 4NUGL 3UTZB 2BHYA 3UTPE 5C09A 1G7MA 5D1ZC 5F1KC 3EDJA 1T2XA 4RQQB 2EEDA 3OKDA 1CFQB 5KG9B 3QEGL 5E00A 4G6FD 5GZNC 2Y5TB 2NW2A 5F1IB 3F5WA 3S36H 3D18A 5BS0D 5F7EH 3VGHA 3VU2A 5IUSA 1J05B 3HNVL 4IRJD 3U4EA 5DVNA 1JPGA 4ZNCD 3TO4A 4HXAH 3FOLB 2XKUA 3UBXG 3UEZA 4YO0B 3VXSA 3GO1H 1G9NH 3HE6B 4PY8I 3VXUB 1YUHA 5SWZD 3LRSA 3QDMD 1YEKL 2X09A 3JTSA 3SDXE 4HZAA 3N1FC 3WSQL 4ZXBB 3KXFA 5BZWB 3RGVB 4OFIA 3ZDYF 3OB0H 2YBRB 1I1YA 5I1DA 3BIAX 5DHYB 2HFGL 5DD6A 2UY6A 1LE9B 2B4CC 4FA8A 4UT9L 4HIHB 4U6XB 4BFIA 1F2XK 4S1RH 3DGCR 4DEPB 2W0FB 3VWKC 4LPXA 5DSCA 2DWEA 2IH1A 1T66C 2Y36H 4AZ8A 4LHUD 3TH2T 3K1DA 1LK2A 1FLRL 4LMQE 1MHEA 4NQCE 3RZCB 4JR9L 1IAII 4UU9A 3DYOA 5EZOL 5F6HJ 3L7EA 3HI5L 5HHOB 2FO4A 1P7KB 1M7DA 2IPUK 1I3GH 3QXAA 1KYOK 4RMQA 1ZLVK 4HT1L 4TN9A 4H0GA 3CCHA 2HLAB 4LARH 2IF7A 1NFDF 4P4KD 4X7TA 1GHFL 1ZS8B 3P77B 1TETL 8CGTA 4Y4HA 3G5VA 4YH6A 5HD8C 1BP3B 2IPTL 1KTRL 2JCCE 5DYOB 1ORQB 1J0IA 1IEBA 5JPNB 3RNKB 3Q48A 3CFKB 1FZMB 4CJ0A 3GSNL 2VLKA 1I85A 3SJVD 3NZ8B 5J06A 4KRPD 3WXWH 4JPIB 4NC1E 1MH5B 1Z9OA 3DMMC 4RDQG 5F96L 1UB6B 1W72L 4I18B 3KYKL 2G9HB 5I75B 1EXUB 1NGQL 3B5TA 2EKJA 4R8WH 1BQLH 5HDLA 4BJLA 3QRGL 1A2YB 2NX5A 1U8PA 4P23D 2XWTB 3MUHL 5D7IA 2W38A 1Y0LB 3G6JA 3THML 3V0VA 2DYPA 1BQHA 3MLUL 1CDGA 3IRPX 3FT3A 3DJ9A 5BVPH 2VMFA 2ZUYA 1LEIB 1CGVA 2Y1VA 3EO1A 1Q1JH 2HT2D 1I7ZB 4J3VA 1CFVH 3ARDC 4IRSD 4TRPH 4TUKH 3FN0L 4NQED 4LPYA 3ARWA 3V0WH 5LGJA 3K4DA 5IK3A 2OLDA 2APFA 1NKOA 3SDAD 4R0LB 3BDBA 5C9JB 5IMLA 2PF6A 1AHWC 2AEQL 1TQCB 2VABA 4ODHH 2ED8A 5ISZA 2IFFL 1WWAX 4GBXA 4MJIE 4IRJC 1KXQE 3QCVH 3C8DA 3D2UD 3HPLB 2HAZA 4ELMB 5E8PB 1A6UH 3OJVC 4N0UE 4U1IA 5SV4A 4JY6A 1FL6A 3O2VH 15C8L 1JUFA 2Y06H 3VI4F 3BVNA 3QJFB 2YSSB 3QEQE 1A6AA 3QWOB 1KJ2A 3JUZA 4UIKL 4AIZB 2Q7YB 3QR2A 3FKUS 3G5XA 5CJXA 1VEMA 5FYJH 2JTDA 3MRGB 1YNKL 4OJFH 2D31B 5L7XL 4KRMB 1YEHH 3EO9L 1CXLA 3QUXA 1U6AL 4PJEE 3I2CH 2CKNA 4NHUB 4M6ML 3K81A 3RPKA 1WZLA 4QRRA 1HK6A 4JKPH 4HKJA 2NY1D 2BOBA 4XNMA 4WENB 2LTQB 3CUPA 1KIUA 4KK9D 4OD1L 1U93B 4DCQA 4ZFZA 2GTWB 1MAKA 4M6OH 2AV7A 5C0BB 4Z78B 4QRPA 3T8XB 3OAUH 3L95A 1A0QH 5ADPL 3PDOB 5JDSA 1G6RB 1AKJD 4KQ4L 2X9XA 3H2WA 1AO7E 3VDBA 3WIIH 4P4KC 4LPTA 4X6CA 4LPCA 3L5XH 3GMLB 3U6RB 2MCG1 2VLLB 3GSOB 2ZSVA 3CFJB 1JZ2A 3ULUH 3FONB 3O11B 5FYLL 5JA9A 4N9OB 4YXLL 3N1PC 4IIQA 3F7VB 1NANH 1GSMA 1KFAH 3A6CH 1T83C 3BQUA 4M93B 3OAZH 5K33A 4NQXB 3EFFA 3HC3H 1D6EB 4OTXL 5C1MB 4KRPC 3RWGB 2V5TA 1HH6A 4YBLC 4DK6A 3TH3T 1P4LB 2EECA 3FB7B 4XVTH 4YHNB 1BM3L 3NIGF 1OP5K 1M7IA 5T3XD 3KPRB 2FATL 2FSEB 2ID5A 1FN4A 4GW4B 2ITCA 4Q58C 5INCA 5FF6B 1U3ZA 2Y25A 3DECA 4U3HA 3MUZ1 1MIEH 2NW3A 2AJXH 1K4DB 1SMOA 3QUZA 3PWPA 4P23C 1IGML 4JRXB 3RUGA 1PYWA 4PJHE 3VRLE 4ZOAA 1HWGB 4KGLA 3IJHB 2VXVH 5C0GB 1MREL 3JV5A 4N68A 3V95A 2MTPA 5DI8B 4Z0BH 2ESVD 2HT2C 1WWBX 4FOMA 4IRSC 4ZS6D 4ZDHB 3F7QA 3AXLA 5A2IH 1A02N 1FJ1B 4RBPH 4KDTA 2QKIB 5D7JC 5BXFA 3LD8C 1RK0B 1A3RH 4Y5XC 4KWUA 4P99A 4ERSH 1IE5A 5TQ0H 3ARGB 5E8OB 3DVFA 4NN7B 4S1SL 4LQ1A 1TPXB 3MJ6A 4PRID 3SDAC 4DGVH 4QRTB 3HZVB 4YHKH 4XCYB 3EDDA 1CZ8H 5F97E 5EUOE 3ZE1E 4BSJA 4LFHD 4Z95L 4O2CB 1I8KB 5C08A 2G5BA 1NMAL 4GMTL 1LO2L 1JRHL 5MI0B 5GSRA 4KK5D 3IGAA 5F7NC 2I07B 3AREA 1MJ8L 4PY7B 5CSZA 3E6HA 3AAZB 1BD2D 3PNWA 4Z7UA 5CHNA 3OGOE 5F93C 5CWSA 4DKDC 2CDEB 1MRDH 4JAMA 3LH2L 1HXMA 3WD5L 4J6RH 5HPMA 2ED7A 1SY6H 5F6IB 3HI6H 3RWCB 3WHXB 3S6CA 5JW5B 3QIWA 4IDJH 4JDTH 2VLMD 3QUML 4PJDE 4NZRH 4I1NB 4WUUD 3DVIA 1EBPA 4YXKL 4PGJA 4W6YB 4Y5VA 4YXHL 1OLZA 1Q9LB 2IALB 2NY1C 4CRPA 2R1XA 3ARBA 1NQBA 4U31A 3VXPA 4NNXB 4BKLA 4AIXA 2DQEH 2EYRA 4KK9C 1IC4H 4GKOA 3QAZB 3CNKA 1DCLA 3ELAT 1YYLL 1UYWL 4G5ZH 4KTYA 4HWBL 3LDBB 4ONHA 4OKDA 4LSQL 2C4FU 1U8QB 5FGCB 2XA8L 4NWTH 3MRKA 1BVZA 3QDME 3V5DA 4LU5L 2DAVA 1RFDH 2Z31C 4ODXB 2F19L 4FFWD 1TZIB 1KLGA 3O9WB 5ECJE 1KPUA 4YPGB 4S0TD 4EVNA 1ADQL 3L3IA 2OK0L 2VISA 3DX7A 5IMKA 5LAXB 4KY1L 1BJ1J 4QYOB 3BYYA 1NC2B 2AGJH 3V4PL 1D5BA 5ESVA 1EERB 1GPOL 3FN3A 5CEXB 4U6VH 4R96B 3KLHD 1JWMB 2YPLA 4YEFA 3VE0B 3GBNH 1QSEA 3SDXB 5CS7A <