2F9BT

Discovery of novel heterocyclic factor viia inhibitors
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
200
structure length
149
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGDERTLVRRNNTFLSLRDVFGKDLIYTLSVQAVIPSRTVNRKSTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Discovery of novel heterocyclic factor VIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
total genus 33
structure length 149
sequence length 200
ec nomenclature
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f9bT00
1U8QB 2RHEA 3STZA 3VFTB 5IGXH 5IFJA 4ELME 3G08B 3S9DB 1FFRA 4HAGA 4JM2F 4A2LA 1J05B 2VABA 1NEZG 2PO6D 3EDFA 5T1LD 3SKNB 5DJ6B 5IW3A 1WIPA 2B2XL 5E08H 5D7JB 4I5BA 1BHGA 3LIZH 4ELMA 3SDAC 1WLHA 5JA8B 1BWMA 4XI5D 4QY8B 2J88L 1HOCA 4HKJA 4RFEB 5EULV 1D5IH 3VXSB 1LNUA 1N5AA 2G75B 1W0WA 2VH5L 4L3CB 4X6EB 2BDNH 5DWUL 1U3YA 3V2AR 5ETUA 4PS4L 1U8LB 2J6EA 5IKCA 3HNTH 2HN7B 5ID0B 2H45A 1T0MA 1RZKL 1NUDA 3C2AH 1GVIA 2AJSL 1DBJH 4X9IA 3TEUA 4J3XA 2Z31D 1A6WH 3IJHB 3IVKA 3UMTA 4AT6B 4K3JL 3MQIA 1TLKA 5F1IA 3WNNA 1OAKH 1F45A 2EE3A 3P4NA 3TCLA 5L88H 1R24A 3GI9L 2PXYB 1N0XH 4IIQB 5SWZE 1K5NA 5F3HA 5CP7A 1S7VA 3PWNA 4DGVL 3F12B 5FYLE 5HVHB 4LCIL 3D39E 3VG0L 2VDNH 3MFFB 4CW1B 1T20A 1BD2D 3QDGA 4E9LA 5SWZA 2Y5TB 3LEXB 1S7TB 5HI4D 3D39A 5C0AB 1W0VA 5ABDE 3O3BB 3QQ3B 3HZYB 3LZFH 5IJVB 3RKDC 4O51A 5IUSA 2H41A 5F6HI 4OV5B 1MEXH 2IAMD 2FJGB 4ZUUA 1UCBL 3RQ3A 1W72L 3AU1B 3RZCC 1T4KB 3I6GA 4D0CA 5E24E 2IFFH 3WSQL 5DJYB 4MA8H 2FATH 4ZUTA 2BVPA 3WIIL 3MLWL 1DZBA 3C60A 4Y4KB 1MAJA 3RA7H 1G6RL 3T77B 4OI7A 3NFPB 4JRYB 1U93B 3BZ4A 4WFED 1NANI 5CBEA 4EVNB 4IMLB 5IEKA 4XGZB 1FPTL 5E70A 3DRTB 1ORQB 1ZAGA 2D9QB 4NKQB 1BZ9B 2BVEA 2J7LA 3KPPB 3QFJB 3LY6A 4YGVA 1A4KB 1VESA 3BFOA 5JXED 3VI4E 1M7XA 4P46D 3IXTA 4OJFH 1VGEH 3TA3B 4AEHL 3U30B 2Q76B 2O5ZL 5FGBC 4LMQI 1D3CA 1FNGB 3ZO0A 4YDJB 2X4UA 1JNJA 3BHBA 4XRCB 2CDEA 4H26A 3EOAA 2EIZB 3LS4H 3ZT7A 2Y1VA 1IL1B 1LP9B 1P4IL 2BNQB 2Q87A 4JFXB 3HLAB 4D0BB 2ICWB 4XP1H 3NCMA 4OLXL 2R0KL 3NZ8A 4UQ2B 1Q38A 1HHKB 2VE6B 3F6IA 3WFEH 3T4AA 1R5WB 3IRPX 1CE6A 1HQ4B 5IROC 2BVUA 1GOGA 1IGFH 3NFNA 4OLYL 1LK2A 1S7QA 4XCCL 4Y5XB 1DSFH 3T0EE 2F58L 4DN4L 4POZC 4FZEH 4EKXA 1OAXH 1B2WH 1YC8A 1AD9A 1INDL 5JNYB 4M62H 2P5WB 4OUUA 4U6VH 5HHXH 3QH3A 2JCCB 1X5AA 3T0EA 4GKNB 3ESVF 3DVFA 3MJ7B 3VI3F 1MHEB 1R0AH 3VRIA 2Q7YA 4U6TA 1AGCB 3DWTA 5BVJB 3CSYB 4GXUN 1D5MA 3V52L 3BP6B 4HGWA 1N6QL 4P99A 4PJXB 1TJIL 1CVSC 4EUPB 2D4FA 3C09C 4C55A 3V8OA 5C0EA 1OQOA 4AL8L 4OZFG 1UKQA 1D9KA 4I0KA 4J23A 4KRPB 2NY7H 3H3BC 1J1OL 4PRAA 4RGOH 3HNVL 4W6XB 1W72A 4V1DB 4DKAA 5ENWA 4JZOB 4RBPH 5JUEL 5CEXA 3WO4C 4UOJA 2GFBA 5DLMH 1T1XB 1R5IB 4OFYA 4RISL 4HCRL 1H8OA 4N5ED 3TV3L 5JHDE 1G6RA 1N6UA 4EDWH 5CGMA 5F6HJ 4I8DA 1I3GL 2YPLA 4JG0L 4MS8D 2WIIA 1R3JA 3IF1B 1ZLUK 1HDMB 2L0DA 1T3FB 2AI0H 2XZCL 3BKJL 4QRSB 5C0BE 5FEBA 2X4RB 4OQTL 5JOPD 1YEFL 3C5ZB 1S5IH 2DJSA 3MO1A 3U0WH 4PP2A 1Q72L 5ALCH 3QIBA 4HUUA 3QWOB 4RNRB 4ZS6C 1LP9F 3PIQB 1RUPH 3P11H 2G60H 5C0BA 5F21B 5AUMB 4XWOD 5T1DL 1JWUB 1TJGL 1WIOA 3DYMA 1WISA 3VFVA 3U4AA 1KCRL 4NJ9L 4NUJA 4PJFE 2IJ0C 1S7UB 4R96B 4KXZH 3C2SA 3FN3A 4CU7A 3SE3C 4F7TA 1W8NA 3BSZL 5FUOH 2VDOL 1C12B 4ZODA 4NO5B 4D9LL 3RVXD 5IFAH 1G9EA 5I1LA 1A47A 3WE6B 4PJFA 3VFPA 5F7DB 2VXTL 4GBXB 4GQ9L 2IQ9H 2XKUA 1OAUL 3DUSA 1FFOB 2O5XL 3WFDH 1IC5L 3TPUB 2CK0L 3CK0H 4MA3A 3PWPE 4XMPH 4J1UB 3BKYH 5IHUH 4EN3A 1G9ML 1PG7H 5ILTH 5T3ZD 4X8JB 3QRGH 1IEHA 1MFCH 5HYSB 4KK6D 3MGOB 2Q6WA 3EJYC 3EYFB 1I1AC 3TJEH 4UV4L 1BQLH 5C0JA 2AXJA 4KQ4L 3RDTC 4EUPG 4LU5H 2UZYB 5C9KA 1GPOL 1FJ1A 1P9MA 3DVGA 4YPJA 1BM3H 1MLCA 3FOMB 3QULB 4XNMA 3IB4A 4KI5F 5GJTL 1DDHB 3E1F1 4L8DA 3FZUD 4HS3B 5J13C 4HKBB 3LHPL 1OTUC 4WI2A 3AREB 5CEZD 5DSCB 1AJ7L 3FO0L 3O2WL 5ID1A 1FV1A 3P77A 4OAWB 3CSPA 4YLQT 4N8CH 4HZLA 1EVTC 3GJEA 1F3DH 2IH1B 4N0FB 3EYQC 4MQSB 4ZQKB 4LASH 1N7MH 1YA5A 2EYRA 4HCRA 3EBAA 3TIEB 1YMHB 1KT2A 4GMTL 1JK8B 2IH3B 1U42A 5BRZE 3DECA 1FNHA 3QJHA 3HNSH 2FD6H 2VDPL 4RSVA 1CL7H 1U8NB 3WNOA 4JY6B 1UACL 2DL9A 4LSVH 4R7DB 4B7LA 1QSEE 4WHCA 4X5WA 5BQ7A 3DYPA 3QUYB 5DYOA 4OQTA 4PJ5E 4YC2B 5CZXD 1JF1B 1PY9A 1SEBA 1E4WH 5TF1H 3BDBA 2G9HB 1QSEA 4KDTA 4LNRA 3OKLA 4HIJB 2FH6A 1AGBB 2W91A 5GIRA 1EEZB 3PP3K 3W81A 4OCWH 1PKOA 4GRMB 3NA9H 4IS6B 2DDQH 4PJ5A 3TO2B 1DBBH 4K7FA 3WFZA 4MXVE 3EDJA 4KGLA 3NZHH 1BQSA 1H3UA 2M26A 5EIQA 4I0PC 3BH8A 2RAMA 3TBTA 3P4MA 4PGCA 5D70L 5I75B 4NQEB 4IJ3C 4PYGA 5HYSG 1NLBL 4V2BA 2ZOKA 1V3LA 3ES6B 3AY4C 1C1EH 3UJIL 3CX5K 1NEUA 3RWFA 2DQJH 5IW1A 5F44A 3C6SA 3MRBA 5MEOB 5SWSE 2NNAB 3F58L 5E8EB 3ZKMC 4XMKH 3TYFB 4Z76B 5C0IB 3WDJA 4DVRH 4JFDB 5IIEB 3MMEB 3FO2A 4A6YB 3OKOB 1EX0A 2WBJD 2R29H 2X70A 3TT3L 1FZMA 3ARGC 3JV5A 3C5SA 1QNZH 1T0NA 5HHME 4EEEA 4FXLA 3HE6D 5JDJA 2O26U 2H32H 3QWRA 2AEWA 2V2TA 2F54E 1C5BL 5F1OB 1IQDB 2YA2A 4OKDA 1ZS8A 4ETQA 1IGIL 3B9KB 4W4OA 5IB1B 1KN2L 2LVCA 4JZJA 1LEKB 5IM7A 4QCIA 5DGQA 1MUJA 3L9RB 4OBSA 3CLFL 1YEDB 4GS7C 4YDVB 2F54A 2X4SA 2XQBH 1UVQA 3SKOB 3MRQB 4FFWC 2YPKA 3O6ML 4TSAL 4F7CB 3DYOA 4L9DA 1NC2A 4NNYB 4M03A 3GMNA 4WFHE 1EUTA 4ZD3H 3MPCA 2BXYA 4M7LL 3ZLQC 2V5TA 3U6RA 2SEBB 1ZOXA 4X4XA 1U3HD 2V9RA 1ZHNA 4GXVH 3SJVB 1XR8B 4KXZI 4JM2C 4YHOL 1NCWH 4R4ND 2NY3D 3L3HB 1CVRA 3DX6A 2C7UB 1C7SA 3T8XB 4PJIE 5J6HA 2K7PA 3LN4B 4LVHB 4JZNB 4U1NA 3ZKXB 2WUCL 4AEFA 2NQCA 7FABH 3MA9L 2DI9A 4RMSA 4U4BA 3WLBB 4JFZH 1EGJL 4U7SA 4PJIA 1DEDA 4L8CA 1JPSH 4ZG1A 3IDNB 3IFNL 1B9ZA 3O0RL 4LIQH 4DEPC 4XXDB 4Y4HD 4CVXB 3C8HA 3OXRA 1L0QA 4G8EB 1IC1A 3JV4A 3O8XD 1NAKL 4OLVH 3GMPB 3V6ZB 3V7AG 2GJZB 4HGKC 5DR5H 4YR6A 5HY9A 3NA4A 2YHGA 2ZJSL 4I0CC 3RUGF 2QSVA 4M00A 4ZPVA 5IBTL 1GZPB 1IM9A 4ZPTB 4J3WA 3HZVB 4GAJL 3ROLB 5KBNC 3E6FB 4G6JL 5BXFA 2GITB 4HBQA 4ODXB 1XF5B 2A9NL 4QRRE 2AXGB 4BSWB 3GUTA 2EDXA 5F7EL 4IOFC 1K4CA 4X6DB 5E5UB 5I1CH 1II4E 1FBIL 2WWMD 3OGCB 2PYED 4PGEB 1TQCC 4QRRA 1P7HL 3OKEB 4P3DA 3LKNA 2VXSL 4C83B 2AXFB 2FH8A 4HV8A 3L6FA 1ROWA 2J5LB 3RI5K 1Q0YL 1A7RH 3N9GH 3HUJB 3ARYA 3PQYE 3F8UB 4LKXB 5EWIL 2ADIB 1JI1A 3AXLB 1RJZB 1FQ9C 4HWZB 2PR4L 2VLLB 3ZKNC 4HFWB 3O2VL 4AJ0A 4BH8A 4ZO9A 1B0RB 3MRFB 4HFUH 3EOBB 1OL0A 2A6IA 1REIA 3V95A 4NZTH 3RVUD 3RZCA 3SO5A 4HXAL 3PQYA 32C2B 4Q0XL 1KFAL 1U95B 1KB5L 4FQ1H 1TTGA 1LDPH 4D3CL 3THMH 1XGRB 3UO1H 4PRIE 1YQVL 4LEOA 3EJZD 2ZSWB 3MRGB 3UTSB 4HPYL 5E2WH 1C5CH 4MNHB 2NW3A 4H5SA 5CJQL 3S35X 1MWAL 2DQTL 5IVNA 4LPWA 1MCKA 1F4HA 4HQQL 4G6MH 4LHUB 5D7JC 4PRIA 3OG4B 2NZ9D 4W70A 1F58L 4MJ4A 1RV6X 1RUAL 3GSXA 3X14B 4EI5A 1QLEL 1F6FB 2CO6B 4G8IB 3IDXL 2EC9U 4LSRH 3PHOB 5DS8B 5FGBA 4XHJC 3QQ9C 3GSOB 3DETD 1S7RA 4YPGA 2LU3A 1F4WH 4GJTB 4LNVA 1OPGH 4P5TD 2VLKD 4I1NB 1EGJA 1GC1H 3GJFB 1GYAA 5LQBL 5D5ME 4BFGA 3OKNB 2ICEB 4WW1A 5HYJD 1Y18A 5HPOA 3PV6A 4LLAA 4UBDD 1YUHA 2E8ZA 4XPTL 2OCFD 2VMFA 1MFAL 5FYJE 4ZDHB 3TBWA 2E7LC 4WCYL 2G2RB 2D03L 3P9LB 5LBSL 5TE6L 5IROA 2PXYC 4PJ8D 5K9OA 1OF2B 2QQKL 5EOTB 1IAOB 3LKPA 1NJ9B 4Z0BL 1BAFH 5HVHC 3GSNB 3QDGD 1U92B 4X6DF 1ETZA 1RZ8B 2CR3A 1GRWA 1LWRA 4KU1A 1BBDH 1U8OB 4XPGL 2P47B 4M02A 1CD0A 4LVNC 1RUMH 2DQUH 2YKLH 2VOTA 5HYIA 3VFGH 3T4YA 3OKMB 5E8PB 4XVJH 1JVKA 2XY1A 3GJFK 1HZHL 5C7XH 3HUJF 1GGCL 1HKLH 2IALB 4XBGB 5ESVA 4IRSD 2VAJA 1O7SA 1X7QB 1S9YA 3U7YL 4M61A 4Y2OA 1GGIH 5FYKH 3UYPA 1FFNA 4UUJA 1Q8MA 1CBVH 3KPSD 1XZ0B 1RIVL 3C60D 4Z5RB 5AAWA 3IAPA 4ORGB 3QXTA 1TENA 3QO0A 1ADQH 3VFNA 4WNQA 3EO1B 3HZMB 4NRYB 2IAND 4NKIL 4TSBH 3E8UL 5A2IH 4Y4KC 1OSZA 4Z77A 4HUVA 2APXA 5GISL 2A6DB 4LHUG 3VFWA 2YD4A 4NWTH 1F3DJ 3JWOC 5DMJB 1BFSA 1KB5A 3BEVB 6FABH 3DRQB 2AABL 5F71A 1ZLWK 2F8VA 5I1HH 3VA6A 3L5WB 3BWAB 2X5PA 3B9DA 5DDHA 4XH2A 3CVHH 3T3MF 3IU3B 4JFPB 2HVKB 1VACB 2HRLA 2XWJB 2F8OA 5F89B 3EYOA 4K2UH 1MWAA 2Y72A 2E7CA 5HI3D 3U30C 4GRWE 3QEQE 1AI1L 4X99A 2XPGB 4C4KO 3QUMH 4YHIB 2XZQL 3VRLF 4F57L 1AR1C 2BMKB 1VFUA 3LV3A 1R3IH 4CADB 4MLIA 2YD5A 3MLYH 4FNLL 1KEGL 5CINL 1KJMB 5MERB 5MEPA 4OM1L 1OAZH 3S88H 2BOCB 2F19H 2XZAH 3SDDB 3K81A 3W11C 2ICES 1QBMH 4WO4D 2E27L 1INEL 3SE3A 1JN6A 1IGCL 1YEEL 3SKMA 4H1LB 2XA8L 5FGSA 4Y5XC 1WZ1L 1T80A 4KZDH 3KXFB 2V2WB 4OIIL 3MRIB 4NQDD 3O6FB 5E8NB 4YHKL 1UGNA 5DTFA 2X1QA 1A1MB 1AY1H 3V5KB 5TQ0H 1FNLA 5D1XB 3V4PH 4NM8L 5BCAA 4L8BB 2QKIB 2WLZA 2C3GA 5F9JB 1JF6A 4KHTH 3DVIA 4P3CL 4TUKL 4QTIL 1UH2A 4PBVC 2ERJB 4PR5B 3FJTA 4WI3A 1VGKA 2APFA 1LE5A 1CGYA 3D69B 1UB6B 1I1AA 2COQA 4MA7H 3QG7L 3RDTA 5TE4L 4R90L 4DTGL 2ZWLT 3CXHK 3VXUE 3U48A 4X5LA 5ALBL 1QQDA 4P2OB 4O58L 3IFPA 2UUDK 1KCSL 5T33L 4WU7B 2FIKA 3OPZL 4KI5C 4KRPC 3RKPA 3G9VA 1J5OH 3GBMH 4TRPL 3IDGB 3DV6A 1DLHB 1XF4A 4FQLH 1ORSA 4UT9L 1UM5L 2AEIT 3M8OL 4HXBL 1VENA 4WW2F 4PD4K 5BW7C 4PJGE 1WTGT 1I3RA 4G5ZL 4QT5A 1LK3L 2YPLD 4KMLB 5F6IB 3HR5A 4MAYB 2J3SA 3NPSB 5F96H 2N1KA 4M93B 1H3TA 2X4QB 4MCZA 4HBCH 3GMMA 2C3WA 4FQCL 2HLAA 3F7YB 3VFOA 2OTWA 3ULVH 2NX5E 2CUMA 4HPOL 5EZOL 3SGEH 3S5LA 4L1HA 4NQCE 4UIKL 1P7KA 1ACZA 3RWIA 1X4YA 1S9VA 3KLSA 5D2LB 3C5ZC 8FABA 5B21A 3RGVB 2AGJL 4KKLD 4IEFB 2NX5A 3OKDB 2H6PA 5C92A 3MUHL 2IBZX 4NQCA 5ADOH 4QNPE 3GSRB 5BS0D 3S37L 1CLYH 1LEGB 4MJ5A 2WIMA 4F3FB 2DBJA 4Z7NF 4PJCF 1CFQA 2GSIB 5EOQH 1IQWH 4Y5YB 2DMBA 1FGVH 3KR3L 3LKRA 3PDOA 3WUWA 1NDGB 4WI7A 1KJVA 5C0CA 1FHGA 2RQ8A 4O02L 4GBXC 1OWWA 2AEPL 3EO0A 4I0PA 3F62A 2F53D 1OTTC 2IPTH 1IFHL 5FA3A 4M6NH 1EXUA 4RMQA 4MDIB 1DQML 1OARH 1FFPA 3T2NH 1HNGA 3AY4A 2VR5A 3V0WH 4X5XB 1MVFA 4IRZH 5DUBB 4F7EB 1J18A 2AJUH 5HGDA 3B4NA 5IB2B 4HWBL 3W0WE 1XCTB 1I4FA 2QLVB 5GRUL 3RVVD 4L9LB 1ZLSL 2XWTB 3MXWH 4XBPB 2OP4H 5CJOL 4E41E 1O5DT 2CRMA 2DLEA 2FZ3B 1HQRA 3W0WA 4JFFB 5JR1L 5CCKL 4YIQA 4NYLA 3VGGA 5I8EA 5I73B 3ILQD 4FQIL 4E41A 5E99L 1U8MA 4MAUH 3AREC 4U0QB 5FYKD 2ZCHH 5SX5H 3BO8A 4XBEL 1RVFL 1WVZA 3OKYA 3SO3B 3H3PH 1TZHA 1M6OB 4L29B 4Y4FB 1KTRL 1A6TB 2FECL 4P2QB 5I2IA 3RHWK 5IT2H 5CSBA 1DBAH 4LOUD 2JJTC 4WUUD 5D72H 4OKVB 4OB5H 1G7QA 5GRJL 5FM5O 1IT9L 2R4SL 4DUWA 1DANU 5E2UL 4MWFB 4HIIA 4FA8A 2YWZA 4P9MH 4PY7A 3S35L 2R69L 3O3EB 1NGXA 1FG2A 3D5OF 3PNWB 1ZHKB 2JJSC 2W9DH 2W9LA 4JM2A 3MR9B 3QUYC 1W2KT 1QSED 2ZPKH 4FQXA 4H88H 1QBAA 3LMJL 3G5ZA 4ODSL 4YC2C 3JVGC 3GO1L 2I07A 1I1CA 1RJYA 4G6KH 2GT9B 3A67L 5GXBB 4L4TB 3BD5A 4X7TB 1I7RB 1KCKA 2NY2C 5HHPB 4YDKL 2DBLH 4M8QB 3OJ2C 1FZJB 3BZEB 1CDBA 5C07B 5E6ZA 2AJYL 3BQUB 2R0LH 3UP1A 4GG8B 1XCQA 4DKDC 3HG1D 5I75C 3G6DH 1ZHBB 1TITA 5GS2D 4FMFA 4OT1L 1FVDB 3AS0A 1X5ZA 5GGSA 3RHWF 3LKOB 3LQZB 4QHKI 3ULUF 1F11B 1FVCB 2WM0A 3VXOB 3MJ9L 1HIML 4P4KB 1BGXL 4ZUVB 1LD9A 3WBDA 5DJZB 3OB0K 4KUZL 3E6HB 2PTTA 4L4VD 1UXSB 4ZTPH 1MRFL 4HWBA 3KJ4C 1FSKB 1LO5A 1ACYL 5JXAL 3QWRD 2PO6B 5C08E 2P24B 1KXVC 2W59A 4BM7A 1MCPH 4NSKB 1MIEH 3PWVB 5CGYD 1HHGA 3B9KC 4RDQG 4G8FA 4NO2B 4JGUA 5DD3H 3QAZB 3S98A 1RFDH 5C08A 3M07A 2CD0A 2QBWA 1A21A 3SGEI 1KYOJ 3U1SH 5DFTA 1TZIB 1J1XL 4PP1D 2K7QA 4UMGA 3HB3C 2DM3A 2HP4A 3KWWA 5I16B 5LGHH 3JWOL 2ADJB 1CZ8H 3TESA 1P4BH 4D0DA 2YEZB 4GAYB 2Z31B 1U8QA 5GPRA 3V6OC 3VFTA 1CE1L 4PJDF 3G08A 3LSOB 5AZEL 1J05A 4UTBH 2I5YL 3SKNA 5DJ6A 4GAGL 3SDAD 3TBSB 4DCQB 5D7JA 5DK0B 2CSPA 2XYCA 4WVRA 5KVFL 4QY8A 5BVPL 4OZ4B 4RFEA 3NCYP 5F7UA 4MB5A 4HLJA 3VXSA 2G75A 3KPQA 3EYSL 4X6EA 4L3CA 1QRNB 2EE6A 3DNKA 2KBGA 4NJAL 4TN9A 1IAIM 2FDBP 1NUFA 2ITDB 1U8LA 3IKCB 4OM0L 2HN7A 3QWQB 2Q1EA 5ID0A 3GK8L 2H8PB 3H7LA 3U0TB 3QDJB 2EZ0D 3IJHA 1ZANH 4QXUH 4AT6A 4P0DA 4Z7UB 3SGJC 1OB1B 5I17B 4LSSL 5JPNB 2V5YA 2E7LA 4GXUM 2WUBH 2DYPB 2PXYA 1A7OH 3VDCA 5LWYH 4IIQA 3MJ9A 3QNXB 3GKZA 5CUSH 2EEBA 4FFZL 2HFGL 1KC5L 3F12A 3VI3E 4OCRL 5IVZB 1UZ8B 1CLCA 5HI5C 3MFFA 4CW1A 4NZDA 4LEXH 4XZUB 2EDNA 5BMFH 1I8IB 2Y5TA 3LEXA 4DZ8B 2J5LC 1L4IA 1S7TA 1DN2A 4CJ0A 2YZ8A 4P46B 3RKDD 5C0AA 2YZ1A 3MXVH 3O3BA 3QQ3A 4E0RB 4QHKJ 3HZYA 4Z8FH 5IJVA 4DAGL 1MCDA 3RZCD 1KIQB 4OV5A 4FG6C 1LO3L 2VLMD 2FJGA 2YPVL 4L4JA 2ZUTA 3JTTB 5C2UB 2R1XB 3AU1A 4K8RH 3AM8C 4B7IA 1T4KA 3QUZC 5EBWB 2P8MB 4JRYE 3TH3T 4RWYH 1T2JA 1D6EB 5DJYA 4R8WH 2HKHH 1VCAA 3PV7A 5DVOA 4AK1A 3O4LE 5EPMB 1Z2KA 1KENL 5F3BB 4Y4KA 5JIPA 1TJHL 5GGVL 1MCWM 3T77A 3S34H 3NFPA 1QFUL 4JRYA 1U93A 4Z0XB 1IGYB 3LRHA 2WV3A 1MSPA 3OAUL 3QEUB 4EVNA 4IMLA 3TNMB 4XGZA 1WIUA 2Z9TA 3U0PB 3DRTA 1ORQA 3WXVL 3QQNA 1BZ9A 3QFJA 3KPPA 1P4LB 2FEEI 3MV7D 2E7HA 3MRKB 4XAWL 3QUXB 1CQKA 5EZJB 1A4KA 3JZ7A 1BP3B 1ODAA 4APQC 4RGMC 2OL3B 5D71L 4JHWH 4AMKH 1SY6H 2GK0B 3TA3A 2Q76A 4PIRF 4NQSB 2D7QA 1M71B 1AE6L 1Q0XL 2EDYA 1EK3A 2IG2H 4NPYB 3CFCL 4R4FH 1FNGA 4YDJA 5E6ID 4MD5B 5F72S 4XRCA 3EZ8A 4NP4H 2EIZA 1IL1A 1LP9A 2BNQA 3UJJH 1IBGH 4PLKD 2OM5A 4JFXA 3HLAA 4D0BA 2ICWA 4YQXH 3CNKA 2EDFA 2PW1A 3L95B 4UQ2A 5CD3B 1I9IH 1HHKA 2VE6A 2VZ3A 1MJUH 3QYCA 4BFEA 1CU4L 1MHCB 5EBGA 4AQ1B 2EC9T 1R5WA 3ILPB 4Z7UF 2P5WE 3L3JB 1HQ4A 3KPOB 5C1MB 4HLZH 4POZD 3ZTNH 4BELD 3B9AA 3MRMB 4Y5XA 1KLFA 1PLGH 1QSFE 4FHBD 4KDWA 5JNYA 1RULH 2P5WA 3LN9A 4M1CD 2HG5B 3CFEA 2JCCA 4JPIB 1ZGLM 2XN9D 4JQVA 2C5DC 4GKNA 4JHAH 2W65B 3MJ7A 3HFMH 5I9QC 1MHEA 1SBSH 1V5JA 1A9EA 3BP7B 4K3DH 1AGCA 1BIIB 4PRPE 3A0OA 4XMLL 3IJSB 1YEKH 5BVJA 2H9GB 4OZIF 3CSYA 4JO2H 1A1NB 4M7KH 1E4JA 1XGPB 4KI5E 3BP6A 3VGFA 4V1DE 4PJXA 3KLDA 5C0GB 2ZUQB 3S96B 1BF8A 3MFGB 2E3VA 3DBXB 4Z18A 4M7ZB 2FJFB 3OAYK 4V1DA 4WFGE 4JZOA 4DUVA 4LLWB 4CMMB 2VUOA 3KYOB 4KMQA 1KLUB 2BY1A 3VDBA 1R5IA 5BW7A 1KBGH 2DWDB 5E4IA 1NLDH 5FO8B 5C0RH 3VJ6B 1IC7H 3D85B 1KN4H 2DOCA 4XC1H 2NZIA 1CK0L 1MFDH 3S4SB 4FP8L 3IF1A 5DFVD 1X6NA 3QP3A 1HDMA 1T3FA 5KZCD 4QRSA 2X4RA 2FX8L 3MOAL 1KTLB 3C5ZA 2IBZY 4YFLI 5KOMC 3K0WA 4MQ7B 3PP4H 3QWOA 4RNRA 1MQKH 3PIQA 1KSRA 5EU7C 4M5ZH 1RMFL 5AUMA 1JWUA 4XPFH 3P30L 4AIZB 5GZOC 4OCYL 3ARBD 3WO3B 3SDDC 1S7UA 4R96A 3FB8B 4IDJH 3BXNB 2VQ1B 4K3HA 4OTXH 3UROR 3LVEA 4BZ1H 1C12A 2E9IA 3BZFB 3FAWA 3Q3GB 3DJ9A 1NCAL 3WE6A 3O6FC 4NHCL 5F7DA 4PRNB 3GKWH 4GBXA 1FFOA 4UZGA 2E9WA 2YD8A 5D1XC 1QTYT 3TPUA 4JQIH 3MCG1 4J1UA 1GGBL 2F15A 5HHQB 1S7WB 5DD0H 5I30H 2B7DT 3EJYD 5K9JL 4HH9B 1JGUL 4X8JA 4X6FB 2ERJC 1OP3H 5HYSA 3MGOA 4JRWA 5KG9B 2EYSB 3EYFA 1QR1B 2X1PA 4NHUB 1J88A 2ZNXA 3STLB 4PV9B 4TSCH 1VB9A 3NFSH 4P2OC 2RGSA 4I3SH 4YXKL 1A6UH 4XNYL 3FOMA 3QULA 4JJ5B 1CT8B 2MJWA 1DDHA 4P2YA 4R4BB 1XIWD 1LO4L 4AIXA 4HS3A 4EIZC 4HKBA 5D96B 4LCYB 3ZE1F 3AREA 5DSCA 4K8RD 3LRGA 4WENB 5C0ND 3FMGH 2DTML 4N0YL 4OAWA 5F6IC 4MAYC 5FDYA 3EYQD 3NPSC 1QSVA 1L7IL 3HHRB 2DQGH 4M93C 4GSDH 4YAQB 4FQ2L 3MLZH 3QXUA 3S4SG 4C57C 4N0FA 5EORL 4J4PC 2Z92B 4QHLB 4ZQKA 2JJTA 1NGQH 1MCLA 2RIKA 4FS0A 3TIEA 1B4RA 3V6BR 1YMHA 1JK8A 3QNYB 8CGTA 3HC0B 2IH3A 3L5JA 3MLUL 4MNQD 2HH0L 3ALWA 1FIGH 1O0VA 3MUZ1 1NMBL 4MDJA 4NC1C 3RGVC 3DO7B 1U8NA 4JY6A 4R7DA 5FXCH 3K74B 1EJOH 4DGIL 3P9WB 5GS0H 2JJSA 3WFCL 1RZIB 1YN6B 5T1MB 2KZWA 3QUYA 1TETL 1UADC 1JF1A 4G3YL 1I75A 3JSSA 4JPKH 2G9HA 1RIUH 2DTSA 4KVCL 4Y5YC 5T5NF 4HIJA 1AGBA 3IRZA 4H25B 1EEZA 5C0CD 2LU4A 2EXYC 4O2FB 4GRMA 3RBSA 3FRUB 4IS6A 3TO2A 4I0PD 4LF3A 3UYRL 3K2UH 5DC0A 1BQUA 2BJMH 5DJCB 1KXTB 4KKAC 5FYLH 2AJXL 4ODVH 3RUGE 4NQEA 2WZPD 3PXJA 3V0VB 3SQOH 5B4MC 1A9BB 3V7AE 5CD5C 3BIKB 1KGCD 3ES6A 3K3QA 1TIUA 3G5VB 1XGTB 4GRLB 3KPNB 1UM4L 3RUGA 3WCYA 3ZKMD 4MA1C 2VDKL 2WBWB 4LQFL 1MF2L 4PG9B 5MEOA 4GKSB 4WV1B 2NNAA 5E8EA 3TYFA 1U3HB 4N1EA 3O6LH 4Z76A 4JFEB 4Z7OF 1QFWH 3ARGD 1Y6NR 4JFDA 3SQBA 5IIEA 5INDB 3MMEA 3OKOA 2WQRA 3WXWL 2NY3B 5I73C 1ZV5A 3IXAB 3T0AA 1IQDA 2OTUB 3B9KA 1CGSL 1JNLL 5IB1A 1LHZA 4GAFB 1LEKA 3N85L 3QO1B 3OQ3B 3ZHDA 1FAKT 2EEDA 1G9NH 3L9RA 4Y4FC 1YEDA 1NUNB 1JZ2A 3H9YA 1N4XL 1SMOA 3EGSB 4YDVA 4U1JB 1YQ2A 2OMNA 4ZUSA 4M48L 5DUML 3SKOA 2PKDA 2QEJA 4ALAL 3MRQA 2BERA 4F7CA 2Z91B 4CVZB 3BGFB 5KSUB 4NNYA 3CPLB 4M5YL 1CDUA 1H15B 4P2RE 4X7FC 1OT2A 3GMOB 3J7HA 3V6OA 5DWUH 3SJVA 1LO0H 4PS4H 3BP5B 3BPCB 1TDQA 1IZJA 2QHLA 1EHLL 5I1GH 3L3HA 4P2RA 4OF5A 1DTUA 2C7UA 4KV5F 3BRDA 3T8XA 1X5JA 4BQCA 4XPAH 2D7OA 2HT3C 5JOEA 3LN4A 1DANT 4JZNA 5J06A 1N5YH 5J56B 4NNXA 4K3JH 3EHBC 3BAEH 2XFXB 3WLBA 4UILH 1T6WA 3EIFA 2PW2B 1IE5A 1B90A 2D7TL 2X4TB 5KTEH 3BQUC 3IDNA 4XXDA 2AXHA 4CVXA 3FTGB 5TE7L 4LCIH 2P5EB 4G8EA 1R3HA 3D9AL 4GLRH 3IFOB 25C8L 4HW6A 3SE4A 2XG4A 2QQQA 3GMPA 3V6ZA 2Q86B 3BH9B 1RZ7L 4P4KC 2XTJB 1J0HA 1GZPA 1LO2L 4ZPTA 5EIVA 3HZVA 3GSNL 4GT7A 1QUNA 4X6DE 3E6FA 1VPOH 3ROLA 3SGJA 4D9QD 2GITA 3DX7B 4ODXA 1XF5A 4IOFD 2AXGA 4Y1AD 4BSWA 1AC0A 5C6TH 1W72H 4LSPL 5MHSE 4QKXB 2PO6C 3RWCB 3SPVB 3UJTL 4X6DA 1KIRB 4WRLA 3HMWL 4OUOA 2ESVD 3OGCA 1Q9KB 3HUJE 4CU6A 4PGEA 2DQCH 1A6VL 3OKEA 2D4DA 4LQ1A 1MPAL 2C4FU 5I71C 4TVSa 4C83A 4XI5C 2AXFA 4OCNC 4QRPE 5EO9B 5BJTB 1JJUA 2CQVA 5I15L 4K94L 2W07A 1QBLH 3HUJA 4LKXA 2ADIA 1RJZA 3U4BL 4TNVK 4HWZA 2VLLA 4OF3A 5IESH 1A3RL 4XNZB 4HFWA 3W2DL 3HR6A 1B0RA 4P5TB 3MRFA 2VLKB 3EOBA 3LS5L 3AM8A 5HPMB 3UTSE 1JRHL 32C2A 5KOVC 1MAKA 4AEHH 5HYJB 1B4JL 2O5ZH 1U95A 2E6JA 1IKNA 1YECL 3OBAA 2NYYC 3SDCC 4KQ3L 5KVGH 1S5HB 1S3KL 1XGRA 1ZGLP 4OGAC 3TCXA 3FHAA 1E4KC 5F97E 2ZSWA 3HE7D 3MRGA 1WQVT 3UTSA 5I1KH 2QQLL 1ED3B 3GSQB 3T3ME 5D7JD 3QCUH 4MNHA 5D7SL 4PJ8B 1CXEA 4DQOH 3K4DA 5IF0B 4LHUA 3BKMH 1OW0C 2FRGP 4XPBL 3C6LD 3VFMB 3VXSD 2VZ1A 4LSTL 3DHMA 4ZOAA 3X14A 1GAFL 4XHJD 3QQ9D 3VRLE 1FP5A 5GS0D 3C9NB 4G8IA 5HI4C 3PHOA 5DS8A 2F58H 3NAAH 3GSOA 3KPRD 4CNIB 1A7QH 3GM8A 4ODHH 4OD1L 4QGYA 5FM8A 4LHJB 1KELH 4G7YL 4IRSB 4ZSOB 1CYGA 3GJFA 4JN1L 4X9GA 2BRRL 3OKNA 2ICEA 3UPRB 2WSKA 2RB8A 5DD5H 3D0LB 1QFWI 3WDHA 3BDYH 3KPSB 5E4EB 1IVLA 2XICA 4ZDHA 1CFVH 1UFUA 1Z9SA 3V4VH 2IANB 3OJVC 4XP4H 3KDMB 2G2RA 3P9LA 5JW4Q 2GI7A 3JWDC 1N59B 2CR6A 1MJ7H 1OF2A 2DKUA 5EOTA 1IAOA 1U8IB 2QSTA 5DRXB 1EHNA 1NJ9A 3A6CL 4DN3L 4X4YA 3GSNA 2DQIL 1U92A 3EDDA 1RZ8A 1JGVL 1WCBB 1U8OA 3TT1H 3EFFB 5C0AD 5DRWB 1MFBL 2CJUL 5JXEC 3I50L 2MKWA 3OKMA 2WAHA 4P46C 5E8PA 5IG7B 4HIEA 1PZUB 2IALA 4XBGA 3FONB 4RISH 4HCRH 2YMXH 1X7QA 1V3MA 3EKCA 5I18H 2VZTA 1S9XB 4UNVA 2HTLD 3GBNL 1AR2A 2Y06L 3NGBB 5L7XL 4JHZA 5FHBH 1B6DA 1TVDA 4R26L 4AYFA 4Y4KD 4ORGA 2VTFA 5HGGS 4CJ1A 5C0DB 3EO1A 1YJDH 3HZMA 4NRYA 4TOYH 2XZCH 3BKJH 4LCWD 4OQTH 1YEFH 2A6DA 4WO4B 3CVIH 2JE8A 5J11B 1KJ3L 1CF8H 2B0SL 3QFJD 4PJBE 5D6DC 1F02I 3BEVA 5DZLA 3DRQA 3VD7A 4DW2L 4ZO7A 3L5WA 5T1DH 4F9PC 2VXVL 3T0DA 4PJ9B 1QFPA 3BWAA 4NQDB 5GGQL 1KCRH 2V6HA 4AEEA 4NJ9H 3QUXC 3IU3A 4JFPA 5LXGL 2HVKA 5FUCC 1VACA 2XWJA 3WKML 1QLFB 1GJIA 5F89A 3V6FB 1KCVH 2NY5L 3G9AB 3LQAC 1FIEA 3MV8E 4MX7B 5EU4B 4NGHH 1HI6B 4I77H 4LLDB 4K7PX 2XPGA 2J12B 2BNQD 1AR1D 4YHIA 4CUCA 2IBBA 4WDIB 2R56H 1A1OB 4NQTA 3LH2H 4Z7NE 3I3EA 4PJCE 2BMKA 4CADA 4M4PA 3ZYZA 5E2VL 3QIWD 1B0GB 4UINL 4XNXH 5MERA 1KJMA 1CTOA 3W11D 3F7PC 4LAQL 2QSCL 4W68A 2AV1B 4FMKA 1ZEAL 4F58H 1HWGB 2BOCA 5EU6D 3SDDA 5FA4B 2F74B 2EXWD 2V9QA 1UC6A 3MSPA 5C8JB 4H1LA 1HH9B 3KXFA 2V2WA 4P9HC 3MRIA 5HHVL 1Q9LB 2VDRH 3O6FA 1GPOH 5E8NA 1I8MB 1A1MA 3V5KA 1KULA 2FYYB 2NY6B 5D1XA 3C08L 1FL3B 4L8BA 1FNEB 1RPQA 3N1GC 2QKIA 3FT3B 3O6KH 3LB6D 4QXGL 3DI2B 4NBZB 4YXHL 1K6QH 4HC1H 4ZAKD 5F9JA 1IGJB 4DK6A 4PR5A 1E4XH 3FFDB 3D69A 4TYUA 4BSJA 1UB6A 1DE4B 2VUYA 2XV6B 4XWGL 5SX4H 1ZT7B 1T7ZA 3PGFH 1HE7A 3Q1SL 2B1HL 4GQPH 4P2OA 2ZUQC 2BFVH 4UT7H 5ESQB 1F3JB 4OD2B 4WU7A 2X9XA 5BS0B 3IDGA 1DLHA 1JNNL 1EDQA 3IETB 4KTYA 2IMMA 1MCNA 2ENSA 2HYMA 2A74B 3QDHA 3VA2C 1CICB 1J0YA 5I19H 3VRJA 3T04D 5F88B 2AQ3A 3PXHA 3UPAA 2Z4QB 4UQ3B 3RVXC 4K3EL 1ITCA 4MAYA 4QO1A 4GOSA 4PV8B 2FBOJ 3K1KC 5HSFA 5E2JA 2F53B 1MI5D 4YUEL 4J4PA 4OGXH 1OQXA 2XKNA 3QPQC 3RNKB 3MCLH 3F7YA 3KLHD 4TTGA 4ONFL 5FECB 3C5ZD 4ODTL 3MV9B 1RZFL 2UYLB 1YYLL 4KK6C 1PKQB 3HI6H 4I9WD 5D2LA 5FV1L 2MQCA 3OV6A 3L3GB 3RGVA 1BOYA 3OKDA 1CLZL 3DGCR 5T3XL 4X7DC 1EJ6A 2QR0B 4KJWC 1TVBB 5DI8B 3CFIC 1UEYA 1LEGA 4F3FA 3SE8H 2R0ZH 4HJJL 1T2QL 2GSIA 3MZTA 4Y5YA 3FFCD 3FZUC 2H2PD 1NCTA 1L7TL 3BI9X 1NDGA 1OTTD 3HZKB 2X1WL 4OCSL 1U36A 3TWCL 3ULUE 3N1FC 2VISB 4AEIL 5E1AB 4MDIA 4G7VH 4WUUB 5D1QB 4X5XA 4M43L 4NNPL 2FX9H 3FB7B 4HK3J 3BT2L 2B1AL 3LD8B 5DUBA 4F7EA 2JJVA 2IQAB 1B3JA 4HUMB 4XB8A 5IB2A 4JFFE 2JB5H 1XCTA 5I8KL 3CLFH 4WTZG 4RMWA 2LV4A 3B8SA 4JCMA 4L9LA 1NCCH 2XWTA 1FAIH 4XBPA 2MTPA 3UC0H 5IFHL 2FZ3A 5EC1B 4JFFA 4RGNC 5MI0B 4I3RL 3ARED 4KI1A 5KJRL 4TQEL 1YEIH 4GKOA 2H1PL 1JZ7A 5D96C 1GHFL 1KYOK 3QUMB 1UG9A 3OG6B 3GI8H 5L8KB 4L29A 1M6OA 3RX5A 4Y4FA 3MRCB 1A6TA 4P2QA 3BMWA 3DURB 2DWEB 5HDQH 1GZQB 3HG1B 4L3ED 1J0IA 4OKVA 5J0BA 3H0TB 1AD0B 2Y25A 1HWHB 2R9HC 3MA9H 2A1WL 4PJDE 1P84J 4DKEL 1X6LA 4Z7QF 3E0GA 4MWFA 4OSUL 5D1ZC 3MRHB 5AZ2L 1Q9WB 3OF6A 5SWQB 3O3EA 3QUYD 3PNWA 1ZHKA 2YBRB 4D94A 1YEGH 1CGUA 3MR9A 4KJPD 5ICZB 2IPUG 4L4VB 1CLOH 4L8SB 1SEQL 2NY2D 1HNFA 1N8ZB 1UXWB 5EBLB 5C07E 3SDXB 4JKPL 2GT9A 5I1IL 5E9DD 4L4TA 4X7TA 1I7RA 1IAIL 5IBTH 5HHPA 4YHNB 1JFQL 4GAJH 3PGDB 5FYJH 2R2BB 3JBG7 4M8QA 1OAQH 3BZEA 2VZUA 2EH8L 5C07A 4NQED 3RGHA 4GUPB 2D0HA 1YNLL 3BQUA 3P0VL 1BJMA 3QA3B 4GG8A 5I74B 1E4XI 1ZHBA 3P0YH 2MQ0A 1EERB 3O2DH 5CZVL 2X4PB 4PLJC 4PB0L 1AO7D 3IAQA 1FVDA 3HI1B 2DQEH 2X89A 4GRLC 3LKOA 1M4KA 3LQZA 2FSEB 4XP9L 1ZLWH 2YN5A 3JWDL 1ERNA 1F11A 1FVCA 1OP5H 3VXOA 2ZUUA 5L8LB 1JZ3A 1Q0YH 1WBXA 5D2NB 3PDGA 4P4KA 2ID5A 4WV1C 4JFDD 4QOKD 4ZUVA 4U0RC 3CC5B 4UIMB 1U3HC 4HJ0D 4JANB 1SBBA 1WBYB 5DJZA 2F5AL 5CLWA 2HMID 1UXSA 1M05B 4OBRA 5IV2B 1N64L 2XOTA 2NY3C 2PO6A 2APBA 5TDPB 2P24A 3B9KD 3SDAB 1IJ9A 5DMIL 1KB5H 1C08B 5CSZB 4FABL 4NSKA 2CGRL 4Q97A 1HCFX 1KNOB 3PWVA 5IB4B 3ECBB 4PUBH 4YDIH 4NO2A 4JO4L 1YQVH 4XCFH 5DEZA 4HPYH 3NPZB 3QNZB 3KYKL 3LOWA 1MWAH 1TZIA 3U9PH 4EXKA 1QO3B 2ENYA 3HB3D 2HFFB 3BGFC 5FGCE 4MD0B 3WL9B 3EO9L 1OM3H 5ERWB 5DD6B 2ATKB 4CBPA 5I16A 4CDGC 1IEAB 4GRWH 2ADJA 2A73B 4FOMA 3SJVD 1ZVSB 2MWCA 4WEUD 2ZUVA 2BNUB 2YEZA 3U2SB 4GAYA 2Z31A 5BO1H 3EAKA 1E4KA 2JIXD 2FX7L 3LSOA 4ETYA 4S1SL 1PG7X 2CRYA 5FHAL 2OL3L 3WS6C 3WIFB 3CFDB 2ZCLH 1BD2E 4NUGH 5EU5B 3TBSA 4DCQA 5DK0A 4AZ8A 2EC8A 2WWMC 4G6AC 2GJ6D 1KEML 3VXPB 4PJEB 1VEOA 2YXFA 4OZ4A 5TE6H 3HTLX 2QQKH 1NPUA 3U83A 1J1PH 1QRNA 3MODL 1OSPL 4PRBB 3PWUB 3REWB 2ITDA 3SHSA 3IKCA 1EEUA 4Z7UE 2YRLA 3BDXA 4XPGH 3QXAA 3RJQB 4ONGH 5CSGA 5T5FL 3RVUC 2H8PA 3MLRL 4JDVB 3U0TA 3QDJA 2XTJC 2M1KA 1KCUH 4XC3H 4WFEE 4JVWA 1GGCH 3L7EB 4Z7UA 1OB1A 3WFHB 4RRPG 5I17A 3B83A 4TULH 1F97A 1A14L 3FRPG 1Q9OB 5I1DB 3QNXA 5TDNB 3GNMH 5IVZA 5IGXL 1WFTA 3RJDA 1UZ8A 1FL5A 4UOW0 2NZ9C 4OZIE 4XZUA 4NKIH 3MV7B 4PGJA 1I8IA 4DZ8A 5E08L 5JXEA 2P1YA 4ZNCD 4P46A 4CGTA 4E0RA 4U1IB 1YY9C 1RD6A 2XRAH 2AABH 4OQ1A 1C5DB 2ORBH 4OZIA 3DETC 4XNZC 5TH2B 1KIQA 5E6IB 4P5TC 2FB4L 3QUZD 2VLJD 3JTTA 2ZP0T 2R1XA 3MREB 2BDNL 1DEEB 5EBWA 2C4FT 2P8MA 4J3OC 1RSFA 3HNTL 4K71B 1FYHB 1P7QD 3CSBA 1T5WB 1ULVA 5EPMA 5F3BA 3C2AL 1IKFL 4Z0XA 5JZ7C 4LHUD 1DBJL 5GRYA 1EUUA 1A6WL 1IGYA 1C7TA 4PJ8C 3QEUA 2EDLA 4U1LB 3TNMA 5J57B 1XH3B 1OAKL 1NL0L 1F00I 3B5HA 4F9PA 4KJYB 5L88L 4APQD 2AJZB 4OM1H 3C5JB 4PB9H 1U8HB 3MRKA 3ALXA 3QUXA 5EZJA 3K4AA 2OL3A 1CWVA 4YHZH 1H3PH 2GK0A 1FCCA 1YEEH 2XN9B 4K7PY 4NQSA 2VDNL 1WZ1H 4ZFFB 1FLRH 5ADPL 1M71A 4NPYA 1EH9A 3HC4H 4OIIH 5FB8B 4F7PB 1J8HB 4WY7H 2A77H 4HWUA 1R3LB 4MD5A 2QADD 5E8DH 3QIUD 4UTAH 4IRSC 3CFJA 3X3FH 1FDLH 1IARB 3EYVB 1F42A 2RBLA 1UCTA 4LPTA 3GHBH 2X7LB 1H8SA 3RIAK 3GZKA 3WEXB 4TUKH 3L95A 5CD3A 3O11B 5E4EC 1MHCA 2ITCB 5A3ID 2VNCA 1I7TB 3ILPA 3CLEH 1BFVH 2N56A 3L3JA 2QHRH 2IFFL 3KPOA 1OVZA 4DTGH 2CXGA 4MA8L 1CGTA 3MRMA 3EOYG 4LVEA 1OGAB 5ALBH 3ME0A 2CMRH 3RA7L 1KCSH 5C09D 3HRZB 5GS1B 2HG5A 5JHLL 4JPIA 4TRPH 4JKLA 4NM4H 5KANI 3U46B 5B38B 2W65A 1WZLA 5JOPE 5CJBA 1G7PB 5J6GB 2A38A 5HI3C 5J1AA 1JYXA 5EIIB 3BP7A 1BIIA 4WU5B 3IJSA 2DM7A 3PL6D 4QWWC 1SM3H 2H9GA 1A1NA 1LK3H 2EDRA 4M6OH 5KZCB 4OJFL 1VGEL 4HG4J 1XGPA 3TC9A 3B2UC 5HGHB 4FQPA 3NGBC 3HPJB 4NCDA 1DQLH 4HIXH 4FZ8H 5C0GA 3S96A 5TGBB 4M6MH 4JDZB 3LS4L 2XWBB 3DBXA 4UIKH 5CILH 2EDKA 3ARBB 2FJFA 4X4ZA 5I1JL 1MH5B 4WO4C 4DOHE 2AGJH 5J11C 4LLWA 4ZFZB 4CMMA 3KYOA 3TGXA 3WFEL 1KLUA 3MJ8B 4N0CD 3ARRA 4P49A 4PJ9C 3KPMB 3S37H 2DWDA 1F6AB 5T3ZE 3IAGC 3JWNC 4XB7A 5FO8A 1LILA 1X44A 1OLZA 1DSFL 3VJ6A 1G7JB 3IS1X 4FZEL 3D85A 1OAXL 1B2WL 3OB0H 4O5LL 3WN5B 3QXDB 2R39A 1DBMH 4K9EL 2ILLA 4XVTH 3KR3H 5D9SB 1XMWA 4U6VL 5HHXL 4GG6B 1RZJC 3SY0B 2AEPH 1KTLA 2QTEA 1ZHLB 4MQ7A 5E94B 5E1HB 1IFHH 4ERSH 1R0AL 2FBJH 4OI8A 2JJWA 4GW4B 3V8CA 1A6PA 1DQMH 3QDMD 3MLSH 3VWJD 2ZKHH 4AIZA 1QFHA 4K3GA 5CEZE 4MNGB 3SE9L 3FB8A 4JHBA 3KXFD 5DMGC 2LTQB 3BXNA 2VQ1A 3CDYA 1YDPB 2J8UB 5GRUH 1XIWB 1LVEA 5KVEL 5JOFB 4FXKB 3Q3GA 5CJOH 1S9KC 4YHLH 1CDIA 1NCDL 2PETA 3F7VB 4PRNA 1MCWW 2ZCKH 5B38G 4WWKD 5JR1H 5EC2B 2IADB 2NY6C 1JIBA 4N1CA 3WHE1 4OD3H 2HKFH 4O2CB 2UVFA 1S7WA 5HHQA 3VFUB 3V0AC 3DSFH 4HH9A 4R2GB 4X6FA 2Q3AA 4N8VG 4Z7OE 5KG9A 2EYSA 3ARUA 5GZNC 1QR1A 3SEPA 4NHUA 2NXZB 4MNQB 2CO7B 1X5XA 1BEYH 5J4MA 3STLA 4ONOA 3LKSB 4KKLC 4PV9A 2DIJA 3RWDB 2NY0D 1AGDB 2AI0L 1F13A 3OR6B 1S5IL 4U7MA 3U0WL 4JJ5A 5GRJH 1CT8A 5ALCL 1IT9H 1K3ZA 2R4SH 4NWUL 2D3VA 2ZUYA 5KW9H 3CFKB 1Q94B 4R4BA 3P11L 2OSLB 1CICC 4LCYA 3D6GA 3FQUB 5DT1L 1MCEA 3BIBX 1GC1C 4MAYD 1WF5A 3DXAB 3UDWC 1YC7A 5CMAB 2WK2A 1BZQK 5JW4N 5FUOL 3IGAB 1RZGB 4YAQA 3TBVB 5IFAL 3H8NA 3D18B 3A67H 1N0LA 1CFBA 2Z92A 5HYQB 2C9AA 4Q74A 1ZT4B 3G04A 3NIGF 2IQ9L 2I9LB 3WFDL 1K4DB 3QNYA 3HC0A 4XMPL 3BKYL 5IHUL 4GG6F 5EUOB 2AJYH 1PG7L 5ILTL 4G80B 5J7CC 4KV5E 1AHWB 3QRGL 3DO7A 1MFCL 1PX4A 4Q2ZB 1RZIA 1YN6A 5T1MA 4B50A 1BQLL 4OT1H 1WEJL 4LU5L 2A6JB 3CU7A 1AFVH 3L5XL 2FHBA 2EXYD 3MJ9H 3CSGA 2XT1B 2FL5B 4H25A 4ZO8A 2J8UF 1BM3L 1RQ5A 2VL5B 4O2FA 5F9DC 3FRUA 3SGKA 2I60H 2OR8A 3QEGH 5DJCA 1MRFH 3VH8G 5JXAH 1JHKL 3WD5H 4CAGA 5L2KB 1T83C 4TNWF 5DD1H 3ZT6A 3V0VA 5DA0B 1A9BA 3RTQD 3BIKA 4LOUC 4A2MA 2XIDA 4N8CL 5D1QC 3G5VA 1TNMA 1XGTA 4P5MA 2NCMA 4GRLA 3KPNA 1BOGB 2HAZA 4JY5H 5FK9B 5ESAB 4FFVD 3SBWC 1BREA 4J6RH 1D7FA 4LASL 3WNPA 1N7ML 4P5KB 3PE9A 4PG9A 4GKSA 4WV1A 4MGXA 1U3HA 3TM6A 4JFEA 5INDA 4NRZB 3HNSL 4JVUA 5JORB 5MI0C 2FD6L 5ISZD 1CL7L 5DHYB 4LSVL 1NEZB 3DX8B 3IXAA 2O61B 1QHPA 4NQXA 1ZKAA 2OTUA 3H9ZA 3D3VD 1JZ5A 1E4WL 1FFQA 2A6KB 4P2QD 3QO1A 4H8WH 3ARSA 4X7SL 1MCSA 3EGSA 4CL7A 4U1JA 1HN1A 3NA9L 2DDQL 1DBBL 5GSVB 4HLZG 3C87A 3OZ9L 5DXWA 3CJJA 2F8XC 4FFYH 3NZHL 3C8KB 2Z91A 5IVXB 4CVZA 5KSUA 3U7AA 1F5WA 4LLQB 4WHYH 4OCMC 2V7NB 3OF6D 3CPLA 2NLJB 5EUOF 1H15A 1C16B 3RNQB 5LGKA 2IEPA 1C1EL 1HEZB 3GMOA 1NGPH 4LP4A 1T89C 4EQ3A 1T7VA 2Z35B 4J12A 1G0DA 2DQJL 4F37F 3BP5A 3NH7L 3BPCA 2PYEE 1S8DB 2R23B 3UTOA 4Y1AB 4L4TD 5F7MC 4L8SC 3WS6A 4KC3B 5T3XD 4XMKL 5DMKB 1NFDB 3GK8H 2VITB 1WV7T 1A3LH 2ESVB 3L3DB 2R29L 1E6OL 4ZUWB 2XFXA 3ZHLA 1OY3B 1XGQB 4LSSH 1QNZL 2PW2A 2IFGA 4NKMB 2X4TA 1EEQA 4H0HB 5A2JH 4LRIC 1JHLH 3FTGA 4S10A 5I74C 1KC5H 2P5EA 3INUL 3OAYH 4GFTB 1JZ6A 3IFOA 3SDYH 4O9HH 1CXIA 3RIFF 2Q86A 4R0LA 4P4KD 2XQBL 3M17B 2OZ4H 4M3KB 1NFKA 3BH9A 1S7SB 4I5BB 5D2NC 3FO1B 1Z5LB 4DAGH 5IQ7H 4ZD3L 4HK0A 4Y16C 1BLNB 3DX7A 2VYRE 1N5AB 2K3TA 4Y19D 1OP3K 4AM0B 3HE7B 5EH1A 2CKBH 3MOBL 3SPVA 3RWCA 3ULVC 1KIRA 2AEQH 3RFZC 1NCWL 3RAJH 1Q9KA 43C9B 4ZXBC 2QV2A 1HKFA 1KENH 3C6LB 1TJHH 5EO9A 5BJTA 2VLKE 3HAEG 1B88A 2IBGA 3IYLW 3ZDXF 3I6KB 7FABL 4M1GH 4JFZL 3V9FA 1MJ8L 3KPRB 5HYJE 1G7LB 1GGUA 5J8OA 1JPSL 2BSRB 2AK4D 4P5TA 1ES0B 2VLKA 5C3LD 5IVXF 5BZDB 4XAWH 1I9RH 3T1FB 4E42B 2KKQA 5HPMA 2NYYD 2OR7A 1LDSA 3SDCD 4OGAD 5HYJA 4P2CG 4JRXD 4MHHG 5CEYB 1S5HA 2EZ0C 5DR5L 4WTXA 5F7WC 3TF7C 3H9HB 3QDGE 4IRJB 4JG1H 1ED3A 3GSQA 3AROA 4X6BB 2CRIA 4JGMA 4PJ8A 2VR4A 5IF0A 5F7NC 1NFDF 1P53A 2CIKB 4LVNB 5FF6B 1RZJL 3VFMA 1YMMD 4QLRA 5ELIA 1QRND 5I1CL 4ZSOE 2N7AA 4JFHD 3WV0A 4ZS7H 3WFBL 3C9NA 2V2XB 2CDGB 1RUQH 4EZMA 4CNIA 4XT1C 2P44B 3KPSE 4IRSA 4ZSOA 3MA7B 3W9DB 1EAPB 1A7RL 4F15B 5JMRA 3QDJD 1YY8B 3UPRA 4U1HB 2IANE 3D0LA 3Q6GH 5BV7H 2V5SA 3BN9C 4PGDB 5JIHA 3KPSA 5C2BL 2GYSA 4XMLH 2Q3ZA 2DYPD 4NZTL 2BHUA 4OZFB 2IANA 3KDMA 2YS4A 3CMGA 4LCWB 1N59A 4EXPX 3EDEA 1U8IA 3AVEA 3VXRD 5DRXA 3THML 4UB0L 3R1GL 3UO1L 4JAMB 2EICA 3QXWA 4OGYH 4D9RD 4BYHA 3NIFF 1WCBA 5E2WL 1T03H 3VXNB 3D0VB 3EFFA 3FQXB 5DRWA 1HINH 5IG7A 5H2BB 5IEHB 2IGFH 5GHWH 3X11B 4N9GB 3FONA 3WJJA 2BHZA 5E6IC 3BPLB 1S9XA 4LSRL 2ICWI 2ARWA 3QR2A 1F4WL 4PLKC 1OPGL 5D6CB 3QIWB 2OYPA 1BFOB 4K71C 1GC1L 5C0DA 3MACH 2VQUA 3ARTA 4TPRH 5IMLB 3O41B 2FX8H 3MOAH 4NQDE 5EU6B 5B3NA 3EYUL 4WO4A 5H8DA 1OP9A 5DK2B 1A6AB 3FQWB 4JM4H 5EA0H 1AH1A 3QUXD 4D8PB 4PFEA 4PJ9A 4NQDA 5DJ2B 4OCYH 1XR9B 3OHXB 4M1CC 1FCGA 1ZTXL 1BAFL 2UZXB 1QLFA 3V6FA 2YD7A 1F4XL 1I7UB 3KHQA 4WGWB 3I02B 4XCYB 4MX7A 3N06B 2BSED 4ZAKB 5EU4A 1BBDL 4ENED 1HI6A 1FYTD 4LLDA 4DKFH 1CD1B 5D7LD 4JFQB 3GHEH 4WDIA 4XVJL 1EFXD 1A1OA 4KPHH 2B4CH 5C7XL 1HKLL 3FAXA 4F8QA 3UZQA 1B0GA 1JGUH 3IKKA 3H42H 2EIBA 4DJMA 1GGIL 5DK3A 5FYKL 2NTFB 4PPTA 35C8H 4XAKD 5FA4A 2F74A 4PY8I 1QHOA 2VN4A 4KRLB 5C8JA 2YPLE 5IMMB 1FNSH 3KYNB 1EBPA 2BY3A 5JHDB 1HH9A 4ODWB 4TSBL 1GOFA 1Q9LA 2OMBA 3ARVA 2Y07L 5GS1C 1I8MA 3QIBB 1WSST 2FYYA 2HWZH 4PJHB 2G5RA 3W5MA 6FABL 3T1WA 1WUNT 3B5GA 5JTWA 1MHPL 1FL3A 1FNEA 1MI5B 3FT3A 1GIGL 2YA1A 5CFHA 4ZOCA 1T6VN 1IGJA 3FL7A 4ORZC 5DFVC 3FFDA 4K2UL 1XGYH 1DE4A 5GRXG 1JTOA 1L7IH 5BS0E 1X3DA 2CH8A 1ZT7A 4C58B 4FQ2H 5EORH 1KTKE 2ZUSA 3LQMA 4WTZA 3LPFA 3QUML 1UJTA 3DUSB 1F3JA 4OD2A 4HMCA 5BS0A 3ZL4H 4MA3B 4YE4H 1R3IL 3ARBC 4LCCA 5HJ3B 4U1KB 5FYJU 3IETA 3MLYL 1NMBH 2A74A 3GSUB 1CICA 5E0QA 3FFCB 2F53E 4XPHH 1OAZL 5JQ6H 3S88L 4DGIH 2F19L 2XZAL 5F88A 3MRPB 2Z4QA 4UQ3A 3PWPB 1QBML 1FRGH 2MPAH 3OSKA 3DX9B 2AJ3B 3T2PA 3D85D 1TETH 3VGBA 4PV8A 2JCCF 2R2HB 4P48A 4Z7QE 3QPQD 1P84K 2P48B 4KZDL 5KVMC 2F53A 3WN5C 4MJ6B 3TJHD 3RNKA 3ZSSA 2WWKT 3T2QA 1AY1L 4QXTB 4DGYH 5FECA 1JYNA 5TQ0L 5IJKA 2IPKB 3MV9A 2UYLA 4JY4B 3V4PL 4WI4A 1PKQA 1A3QA 4M9PA 2MCPH 3L3GA 5DF0A 4KHTL 3GGWB 4C56D 1YEHH 4KJWD 4PJXF 1CFSB 5FM4A 4HSQA 2QR0A 1JPGB 3GIZL 1TVBA 5DI8A 4MA7L 2PYFB 4JPVL 2B5IB 5FYKE 3GFUA 2ZG2A 1ZE3C 5GGRY 2LTQC 4TTDC 1XIWC 1DL7H 1EVUA 1J5OL 4QHNB 2J1KA 3HZKA 4K8RC 4WUUE 2WP3T 2O93L 4WEBL 5C0NC 5DJXB 4HD9A 4FQLL 2EIEA 3ARFD 1GXEA 1T83A 1OGTB 2AV7B 4I13B 4G8GD 3BPNB 4PJHF 3UPCA 4JKMA 3Q48A 2VISA 5BRZB 5E1AA 4WUUA 4R2GC 4L3EB 5D1QA 3FB7A 5F96L 1QD0A 1JNLH 4PJ7B 1UM6H 2IQAA 3VCLB 5JW3H 2BNRD 3SBWA 2APWA 4OF7A 2NXZC 1DFBL 5DGRA 4AG4H 1N4XH 2Y23A 1XF2B 5HDBF 4M48H 5GQBA 4PY8J 4RGND 2BXZA 3K8MA 5EC1A 2UV3A 4YHYB 4JO1H 1DQQB 5ITBL 2NY2B 5ADOL 3I3BA 1CDYA 5E9DB 3E3QC 1CLYL 3QB7C 9CGTA 3QUMA 1DQDL 3HG1E 3IDYB 4KRNA 2FEDC 4P57B 3NACH 5CIPH 1IQWL 4L1DA 1EHLH 4G9FD 3MRCA 1DBKL 3DURA 2DWEA 1GZQA 2R9HD 3HG1A 3U82B 4OLZH 3H0TA 1AD0A 1AO7B 5D1ZD 2IPTL 5SWSB 5LJYH 3H7BB 1MCRA 5AD0B 1UWEH 1EIBA 2DQHH 4XX1E 1OARL 2Q8BH 1AHWC 3EW3B 3MRHA 4L4VE 5JW5B 1Q9WA 3V0WL 1TVHB 5SWQA 4XP6H 1FC1A 1TCRB 3BKCL 2CLRB 4QOKB 1T89A 2EDQA 1R6VA 2W0LA 2YBRA 5HHMB 3RU8H 4MSWB 1ZVYA 4JQXC 1CG9B 1PYWB 3KJ4B 3FN0H 5JDSB 1YYMH 5ICZA 4L4VA 4L8SA 4U3XA 2I24N 5CBAB 4Y88A 1N8ZA 5EBLA 3SDXA 1FNFA 5CKAA 1AXSB 1LO2H 2CUIA 2YK1H 4LDEB 3BEWB 4YHNA 2WW8A 3PGDA 3BRGC 3KPTA 2R2BA 1YEJH 1UWGH 3DSNA 4R6UA 1WGOA 3TZVB 4OIBA 4X9BA 3MRDB 4J2XA 1O7VA 4GUPA 2YUWA 4NO3B 5JPMB 1MY7A 4LSPH 4MAUL 3WNKA 3QA3A 5MP6H 4LRIA 4PLJD 3UJTH 4Z7WB 3HI5H 3I85A 5B39B 4R3SB 1PZ5B 4GRLD 2ZCHL 3ZYIA 1AKJD 4KDVA 5D2NE 3F5WB 3V5DB 2X4PA 2IF7A 1CQYA 3KVQA 4PG2A 1Z3GH 2CK2A 3HI1A 5EB9A 5IT2L 2FSEA 2B39A 4PJ7F 3NBNA 1DBAL 3R06B 5IB3B 5D72L 1GSMA 5D2NA 3KYAA 4JFED 4K94H 4OB5L 3MLVH 2DI7A 3BGMB 2F5BH 3CC5A 4UIMA 3VU2A 2E9BA 4JANA 1WBYA 1A3RH 2A0LC 3MLTB 4OZHB 3W2DH 2JIXB 2LVEA 4P9ML 1M05A 3LS5H 2P4AB 1Y6MR 1J87A 3K4ZA 5IV2A 5M95B 3GSWB 5INCB 5TDPA 5A1AA 3SDAA 4MZ2A 4BFBD 1C08A 5CSZA 1YECH 3FRPA 1HCVA 1KNOA 4H88L 3ECBA 5IB4A 1SYVB 5BOZG 2GJ6B 3WJLC 4QRTB 4G6KL 1J12A 2QQLH 3QNZA 1E6JL 2DBLL 2YUVA 2DAVA 3O4OB 2ZSVB 2VWEC 1X5YA 1QO3A 2BCKB 5E00B 4OLEA 1X4ZA 2HFFA 2J4WH 3QEHB 4FQQB 2R0LL 2ZNWA 4MD0A 3WL9A 5ERWA 3IDJA 1PSKL 5DD6A 1CDJA 3N0PB 1GAFH 2ATKA 3G6DL 1QRKA 3IU4H 3DGGA 1IEAA 4NT6B 2A73A 3V7MA 1ZVSA 3TVMD 2BNUA 2W1NA 1H8NA 4LDLB 3U2SA 4OD1H 3L6FB 4NIKB 5K59F 4UU9B 3I9GL 3AS1A 3MGTB 3WIFA 3CFDA 3IT8D 1CXFA 4YBQD 4JJHA 5EU5A 4G6AD 2OQJB 1R5VB 3QCTH 3NABL 5DVLA 4NBXB 4ZTPL 4NZRL 3VXPA 1V7MH 4PJEA 4F33B 2R1WB 3TFKD 5B39G 4JR9H 3ISWA 5DEFB 3I2CL 1MCPL 2P5ED 4P4RB 4BUHA 2VLME 1MIEL 2APTA 3MUGB 5DD3L 3RVTC 3ZDZF 1U41A 4DN3H 4Z7WF 4PRBA 3PWUA 1RFDL 3REWA 1N3NB 4OLWL 2Q8AL 4N0RA 3QUZB 2VLJB 2XTJD 4BJLA 1MFBH 3U1SL 1ZA3B 3I50H 1KIUA 1ND0B 4JDVA 1CIDA 1FO0H 1CTNA 2OI9B 4KZEH 1SJHB 5CWSB 4JREB 3L7EA 1HH6B 3WFHA 1P7QB 3P0GB 5LGHL 4KROD 3VXMD 4OZHF 1CCZA 3HE7C 5J1TC 1CZ8L 3GBNH 3MV7E 5L7XH 1Q9OA 3B6SB 5I1DA 4YPGB 5TDNA 3OXSB 2YUZA 2LQRA 5HGBB 1JP5A 1MCJA 4APQB 4RGMB 3C6LC 3MV7A 4WW1B 1AQKH 1Z9MA 2C1OB 1BX2B 5TPWH 1Y18B 1YY9D 2VAAB 1I8KB 5F1SA 4HG4K 4U49A 5GS0C 3F7QA 2R4RH 4U1IA 4K55A 5D5MB 1C5DA 3RI5F 2HVJB 4EBQH 5F8RC 5TH2A 3F65A 3BP4B 3J8F7 5E6IA 2QADB 3QIUB 4YHPB 3BOVA 4JPWL 3MREA 4PGBB 1KXQE 1DEEA 4NC0B 5J9PB 2NY5H 1V7NL 3CDGB 3IJYB 5ECJE 5I1EL 2Z8WC 2WANA 4RMUA 3OJMB 5FIEA 1T5WA 2MKLC 2AKRB 5JZ7D 1MCQA 2JB6B 1ONQB 3T4YB 4IRJC 1MJJB 1TNNA 4FTVD 2YXMA 5GRVL 1ZANL 4YXLL 4U1LA 2XN9E 1XH3A 4KJYA 1YNKL 1SQ2N 2WUBL 2AJZA 3C5JA 2MNUA 1A7OL 4R7NB 2J2ZA 5C09B 1U8HA 3RVWC 3HA0A 5CUSL 2UZIH 4WUKH 5I9QB 3UBXB 4KWUA 3TN0B 2XN9A 3KJ6L 3GRWL 5EOCH 4ZFFA 2W9EH 4MCYB 3HRPA 4LEXL 5FB8A 4F7PA 2E5EA 1R3LA 5BMFL 3PL6B 4Y5VB 3ULUH 3EYVA 1RHFA 1IEBB 4F15C 4IDLA 3MXVL 2X7LA 2HTLC 5A2FA 4LPCA 5L6YH 4JLRB 1X5IA 1X5LA 1UKSA 3WEXA 2EDEA 2GJJA 1I9JL 4ZFGH 4ZYKB 3O11A 2N7BA 1G9NC 3MNWB 4K8RL 1I7TA 1JRHI 4LCUB 4RWYL 4XWGH 12E8H 2NY4C 4R8WL 3PWJB 2HKHL 1A4JB 3QHFH 4HHAB 1OP5K 3Q1SH 1MIMH 5IHZB 4Z6AT 2B1HH 1OGAA 2MFNA 5F9OL 4BSVB 2XTLA 3S34L 5JW4R 3HRZA 1KTDB 5GS1A 1F8TH 4GRWB 3QEQB 2DLFH 1MCOH 1JNNH 3U46A 5B38A 3O3UN 1NGYB 1T04B 5HYFA 1P2CB 4S1QH 5J6GA 1G7PA 1WAAA 4QWWD 5EIIA 2EIDA 4WU5A 3W9EB 3B2UD 1SY6L 3BPLC 4YX2H 2O5YL 5JW4M 5HGHA 2IG2L 3HPJA 3CAFA 4R4FL 2DIBA 5JLZB 2EEAA 3QIWC 5TGBA 4KK8D 1IAMA 4NP4L 3QDMB 3L7FB 4JDZA 1EPFA 3VWJB 3MLXL 1A0QL 1RZFH 2XWBA 3UJJL 3FKUS 1IBGL 3ARBA 2Y36H 1MH5A 1WCQA 2BVQB 2EXWC 1D5ZB 4HZAA 4ZFZA 5IBUG 5DQJB 1I9IL 4PJ9D 5E2TL 1MJUL 1MELA 3MJ8A 3EFDL 2DL2A 3NIGE 4K23L 4Q9CA 3KPMA 3FB6B 1M7DA 1F6AA 4NN7B 3UBXG 5LAXB 5T1KB 4GW5B 1UH3A 4WWKB 5D7IB 3SGDH 3QHTC 4GG6E 3L5IA 1T2QH 1G7JA 2H26B 1QYGH 2OK0H 3WN5A 1PLGL 3QXDA 2RJMA 3LB6C 5D9SA 4ZAKC 1D9KC 2CRZA 3A6BH 3T0VA 2C3XA 2WQ8A 4GG6A 1KPUB 3VXUB 5IB5B 3DV6B 3SY0A 4OCSH 4JHAL 3FO9B 4LDOB 1VERA 1WT5C 1ZHLA 3HFML 5E94A 4GW4A 3TNNB 1YEKL 2GCYB 3GRWA 4AEIH 5HGAB 4BQ8A 2J8UE 1D5XB 4JO2L 4M7KL 2NY0B 1F3RB 1L6ZA 5DMGD 5HHNB 4MNGA 4TVPH 5EUKB 5DA4A 1CXHA 3SCMB 5E5MB 1YDPA 2J8UA 1KUMA 4PJGB 1XIWA 5JOFA 5I8CB 4U05A 4FXKA 5CJXC 1VA9A 1DQJA 2NY6D 3ZMRA 3F7VA 3UX9B 3VDAA 5DHVH 2V17L 3GMQB 3QIBC 1WITA 5EC2A 4LSDA 2IADA 4M7LT 1SMAA 5DZOA 3IFLH 5KJRH 4LLVB 4MNQE 4O2CA 1RU9H 5FUZH 1KBGL 4P3WA 3VFUA 2Y6SC 5GZND 1UEMA 1UQSB 5MEND 3KLHC 4M7JH 3ROOB 4DFHA 5C0RL 5L8JB 1IC7L 2VDQL 2MSPA 1KN4L 4XC1L 4MNQA 3PJSB 1UYWH 3LKRB 4ZTOH 1ZWIB 1MFDL 2R0WH 3LKSA 2R8SH 5J12B 1L0YA 1T1ZB 1EMTH 3RWDA 4NN6C 1AGDA 2CDFB 4NO0D 3OR6A 5C0CE 1SY6A 1EXUB 3UTPD 4D2NA 1CICD 4EN3C 4MYWB 1MQKL 1AQDB 3CFKA 1Q94A 4M5ZL 1WFNA 3D2UB 2OSLA 3UTTD 4XPFL 4LGPB 3FQUA 3HC3L 1BFTA 2H2PC 3DXAA 3DOSA 3IDUA 4X7CC 5GRZA 5CMAA 2X44D 4IDJL 4OTXL 3V5HB 1KGCE 4LSUH 4O4YL 3IGAA 3VFRB 1RZGA 3TBVA 5D7IF 5HHOD 5EUOE 3D18A 5I1IH 1F6LL 2FNBA 3MV9D 5HYQA 1VFAB 1IAIH 1P9MC 1ZT4A 3GKWL 5KN5B 4XNUL 2I9LA 3RTQB 1K4DA 4MA1B 4JQIL 4U31A 2EH8H 4YWGH 5EUOA 4WGVB 4BZ2H 5DD0L 1YNLH 4G80A 5I30L 1AHWA 4XCNB 4NC2B 3R4DA 4MXWL 4Q2ZA 4UT6H 4Z9KB 4JQXA 4U2ZA 4OF8A 2YC1B 3ARGA 4JO3L 2A6JA 3VXQB 2B5IC 1ZA6B 4XP9H 5ISZB 4KHXL 3NFSL 1YPZB 4I3SL 1A6UL 2FL5A 5ACLA 2VL5A 4J8RB 3D3VB 5I8OH 2MOVA 3MUY1 1PBYA 4JDTH 1N64H 4I18B 5L2KA 2I9TB 5D1QD 2NR6D 3BPNC 2Y7QB 3FMGL 1MAML 1YJDC 4S2SB 4FABH 2CGRH 4MZ3A 1FC2D 1BOGA 4GSDL 3DUHA 5D2LF 3WIHH 3MLZL 5FK9A 3WUWG 5ESAA 1BVKB 4XP5H 5C3TA 4MQXC 4P5KA 1NGQL 4KVNH 3QFDB 4MVBC 1H9VA 3LEVL 2EKJA 1DVFB 1ZMYA 4KKCD 3PGCB 5DC4B 2D9CA 43CAB 1FIGL 1FLTX 4NRZA 3H2WA 4YHYC 5JORA 1GOHA 4KJPC 2PNDA 2AJVH 5DHYA 2XXMB 2HT4D 2JELH 4U3CA 1EJOL 1NEZA 3ZDXE 2CUHA 5BZWB 5GS0L 2IMNA 5EU3B 3DX8A 5EDXA 3BJ91 2O61A 2XNAB 3SGDI 4RFOH 3IDYC 2A6KA 4IBLT 3DV4B 5IBLC 1QVOB 3GBLA 4JPKL 2L7JA 4S1SH 3WJLA 3EJJX 5IVXE 1JTPA 1RIUL 4HUNB 3G5YB 4XHQA 1ZVHA 3VWKB 2OLDA 1RIHH 1U8KB 3B9VA 1RHHB 5GSVA 3K2UL 2V9TA 3C8KA 5IVXA 2CPCA 5FGRA 1K8DB 4LLQA 4QYOB 5FYLL 4ODVL 4D9QE 2V7NA 5F7FA 3VD5A 2NLJA 4HMDA 3SQOL 3CDFA 4U1MB 2OR9L 1JGLH 4Y1AE 1C16A 3RNQA 5IHBA 1HEZA 1HHGB 1NFDE 2EKSB 2Z35A 1QEWB 1U0QA 4HJ0C 4MMZC 3LDBC 2ESVE 1PAMA 2HMIC 1S8DA 2R23A 4Y1AA 4Y19B 1INQB 4AENB 5CHNB 3VD4A 5FO9B 1UA6L 5DMKA 1NFDA 3FB5B 2L7UA 3OAZH 3K8LA 3O6LL 2VITA 1LEIB 1QFWL 4PJAB 1YPZF 4I4WB 5EOCJ 5DJDB 1LE9B 5I71B 2ESVA 3L3DA 2AK1H 1WWAX 4ZUWA 2VZOA 3TZVC 1XGQA 3KWWB 3VW3H 5FKPB 4L5FH 1CS6A 1NCBH 4RDQF 4NKMA 4R97B 3CMOH 4AY0A 4M4RA 2RFXB 4TVPD 5HVGB 2EYTB 4FQHB 1G9NL 4LGSB 3HCVB 5I6XC 2AK4B 4KGJA 3M17A 1KB9J 3QJFB 1RURH 3GSVB 5H37H 3RRQA 1S7SA 5F1NB 3SDCB 4Y16D 3BUTA 5L2JB 3FO1A 2X05A 4JRXB 1Z5LA 2EH7L 2ADFH 1ZT1B 1BLNA 3NIFE 4LK4A 3JV0A 2FB4H 3ULVD 4AM0A 3HE7A 1JGEB 4KK5C 3KPQB 3VXSE 3W39B 3CDCA 4HDIB 4ZXBD 3OWEA 2X2YA 1LO0L 4YBHA 2RCSH 1DLFH 3QCVH 4I3GA 43C9A 4WHTB 5I1GL 1CR9H 4OCXH 4U6HB 1JUFB 3C6LA 3KPRE 3RWHB 3E2HB 4XPAL 1IKFH 1U8JB 1YMMB 5IW6B 1IAII 1XF3B 3I6KA 1N5YL 3O4OC 5KS9B 3BAEL 4FQJH 1ZSDB 4UV7L 1NL0H 4UILL 3RX8A 3KPRA 1G7LA 5T3ZH 3S3JA 2BSRA 5KTEL 1ES0A 4JCLA 5BZDA 3T1FA 4E42A 4WEMB 1RJLB 1K2DB 5ADPH 2XG5A 5CEYA 3JUZA 1D6VH 3H9HA 3BD4A 2DQDH 3BZDA 3QPXL 4IRJA 5D7KD 2EECA 4DVBB 3FN9A 1JHTB 4X6BA 5TQ2L 3F6LA 4IMKC 1VPOL 3O9WD 5C0AE 3VXRB 1JPFB 3T3PF 1K9TA 1BQHB 3QI9D 3K46A 5ITFB 2CIKA 4PJAF 5CEZH 1LQSR 4ODBD 5C6TL 4DUXA 5FF6A 1RJCA 4LRNL 5KSVB 3QSKB 1U3ZA 5HDOA 3MBED 5CP3A 3B8YA 4BK5A 4LSQH 2V2XA 3S36H 5EN2B 2DQCL 2H2SC 2CDGA 4PREB 2HA1A 2X1OA 1L9MA 4N5UA 5DRNB 5I1AB 4HEME 3MA7A 3W9DA 1I1RA 3ZYOA 1EAPA 3STBA 3Q5YA 1QBLL 5JHLH 1FE8H 1YY8A 3BN9D 4H0IA 4U1HA 3O4LB 4LCWE 5IESL 4PGDA 2OI9C 5J3HD 3CZFB 1PGRB 4JREC 3QFJE 1F4YH 4EI5C 3NN8B 4OZFA 1NAMH 2W0PA 4HEPG 4U1SB 4YJZL 2CIIB 4LCWA 1JWMB 5ICYB 3KAAA 5KVGL 1A6ZB 1KJ2H 4JAMA 1TQBB 4N90D 5A43C 5I1KL 4P23D 3QCUL 3VFSB 2ZG1A 3VXNA 3CCHB 3D0VA 3FQXA 4DQOL 5I1JH 4HS8H 1LP9E 2BNQE 2X1XR 3BKML 2PW1B 3OX8B 3D1MC 5H2BA 4RFNB 4BQBA 5IEHA 1D5BB 4NKDB 3X11A 3NIDF 5KS9F 4N9GA 5KSBB 1FYTB 1JWSB 3BW9B 5D7LB 2QADC 3QIUC 4KY1H 1EFXB 5B3JF 3NAAL 1BWWA 5EU6E 4O5LH 1A7QL 4ODHL 4I2XB 1KELL 5D6CA 4K9EH 3QIWA 4IHOB 1BFOA 2P7TB 3I6LD 3FQNB 3CFEB 3IDIB 3U9UB 5IMLA 5A3IC 1S9WB 3O41A 4PLOB 5EU6A 5DD5L 1MVUB 2JCCE 1QSFB 1BQHG 3BDYL 1WC7B 1A9EB 5E56A 3GIVB 3P40A 5HDLA 5DK2A 5EBMB 1A6AA 1CFVL 1FVEB 3FQWA 4CN1A 3V4VL 4NDMB 4XP4L 3NTCH 4D8PA 3CH8A 5DJ2A 4QF1B 1XR9A 1IILE 1MJ7L 3W5NA 3OHXA 3SE9H 1PD6A 4PRPB 2D31B 1IM3B 3TN0C 1I7UA 1J8HD 3BPOB 4PJXE 3I02A 5KVEH 4XCYA 5AWNL 3DO3A 3I75B 4ZAKA 1YZZA 3TH2T 3TT1L 1U8PB 3BUYB 1CD1A 1NCDH 2CKBB 2DD8H 4JFQA 3PL6C 4Y5VC 1FG9C 1KF9B 1WT5A 4HT1H 1W0YT 3BJLA 2GUOB 4EUPA 1MFEH 2HFEB 3VGAB 2YMXL 5CKGA 1JV5B 5I18L 3CH1B 2NTFA 2A83B 4ELKB 4MD4B 1A2YB 2DS4A 5D8JL 3B5TA 1BVLB 5FHBL 1OGAD 4WHYG 5IMMA 1JPTH 3KYNA 4PJHE 1T1XA 3WKNA 5JHDA 2FO4B 1YJDL 4ODWA 4TOYL 1MI5E 5CJXA 3F7RA 1L9NA 4N0CC 3KS0J 1T66C 3AMLA 3QHZH 3CVIL 4M3JA 1CF8L 1A5FH 1SVZA 4LLMB 1CFNB 4NWUH 3MYZA 4PJHA 4Q9QH 4I9WE 1MI5A 2EDBA 1NBZB 5HDBE 1U2CA 1VDGA 2X4OB 1T22B 1TZGL 5DT1H 2E8YA 5KSBF 5FKAB 3TO4D 1KCVL 1IGMH 2E6PA 4KFZC 3OKKB 4C56B 3BGAA 2VLRD 4NGHL 5EZIH 4I77L 1M7IB 2DN7A 3RPIB 4Z78B 3HAEH 4WFFD 5I66B 5LCVL 3VMNA 3FFCE 2R56L 3RP1A 3VWJC 2QQNH 3LH2L 5C0FB 3N50A 5HJ3A 4U1KA 3UAJC 4PRHD 1AXTH 5ICXB 3GSUA 4XNXL 4NO5A 5IHLB 3HMXH 1FNAA 3FFCA 5TFSL 4F58L 5MEQB 1T7XA 1U58B 1XGUB 1FH5H 1K8IB 3MRPA 4QHMB 3PWPA 5FAAA 1PDKA 1T21B 3DX9A 4NN7C 1WEJH 2AJ3A 1NBVH 2R2HA 4IOIB 15C8H 3L5XH 4WWKC 5BV7B 1L0XA 3CZJA 1MY5A 1X9QA 1NMAH 3ARFB 1QKZH 2VDRL 4MJ6A 4G8GB 3QBTB 4HF5H 4A6YL 4QXTA 1U6AH 5FCUH 2IPKA 3WMSA 1MRCH 4JY4A 3EOTH 1RUKH 3O6KL 2BNRB 1K6QL 4HC1L 4HWEH 1JHKH 1QACA 3GGWA 4OLUH 1OTSC 1SJEB 1CFSA 2VJXA 1E4XL 3NCJL 4HX1B 3QG6B 4RGNB 1JPGA 2NY0C 1Q1JH 4JE4B 4JB9H 4TTDD 4KTEH 2PYFA 3PGFL 1UJ3B 1QBBA 1DUYB 4LAJH 3SCMC 4MB3A 2BFVL 3NCFB 4UT7L 1NSNH 5DFWH 2A9MH 2FGWH 2M2DA 4QHNA 1P5UA 1QP1A 4L3EE 4MDJB 2IH1A 5DJXA 3TLRA 4PJ7E 1T5XB 4HMEA 5I19L 4G9FB 3M45A 1OGTA 2AV7A 4R2GD 2YRZA 1MREH 1E0OB 3WDIA 5BRZA 5KAQG 4HWNA 1GGTA 5AYUH 1AGFB 2J6EH 5IK3B 4L3EA 3KGRA 2NXZD 3WNMA 4PJ7A 4P59H 5FV2A 1J11A 3SKJH 1NDMB 5D1ZB 3VCLA 5KAQF 4OGXL 2R2EB 5GGTL 4LLYB 3MCLL 4KTDH 1DCLA 4X7SH 1XF2A 1OHQA 1H0DB 5J12C 4LF3B 4DWHA 1ZXQA 3MRLB 3OZ9H 4NFDA 4Z95H 2VL4A 3HI6L 5TDOB 3K80A 5E9DE 4GH7B 5GJSH 2XACC 3JVGA 4S0TD 2YOCA 3Q2CA 1OCWH 1DQQA 3LEYH 1C8PA 1V8HA 1X5FA 3DXAD 4NQEE 3CX2A 5E9DA 2GY5A 2FEDD 2D7MA 3QDAA 4X9HA 3SE8L 2R0ZL 3RUGB 3NH7H 1OAYH 4P57A 3LN5B 3RL2B 1AO7E 4YHMH 4YO0B 2VN7A 2UVEA 4MJID 2VDMH 4KUCD 2EDOA 2VXUH 4WI9A 1AKJB 5H35B 3RTQC 1E6OH 4JFDE 4IM8A 4QOKE 1AO7A 4PRDB 5B8CB 5SWSA 4AH2B 3H7BA 5K59E 5AD0A 1F90H 4AIOA 4WI5A 2VC2H 4FFVC 3BD3A 5E6YA 4U0RB 4G7VL 4RCAA 5JW5A 1A8JH 4GMSL 4NBYB <