1PKQB

Myelin oligodendrocyte glycoprotein-(8-18c5) fab-complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
221
Chain Sequence
EVKLHESGAGLVKPGASVEISCKATGYTFSSFWIEWVKQRPGHGLEWIGEILPGRGRTNYNEKFKGKATFTAETSSNTAYMQLSSLTSEDSAVYYCATGNTMVNMPYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords (8-18C5) chimeric Fab, light chain
publication title Structural insights into the antigenicity of myelin oligodendrocyte glycoprotein
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 221
sequence length 221
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pkqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pkqB02
3ZKQD 1IEBB 1M7XA 1X7QB 3U0WH 1N5YH 3QA3A 1DLHA 5CEYA 4J3UA 5DD1L 4KXZI 4Q7DA 3V5HB 2P24B 4YIQB 2G5RA 1R5WA 3ESUF 4ZD3L 2ZOLA 3MA9L 5IB2B 2YBRA 1J88A 3QPQC 2ADJB 5A1AA 4CAGA 4I18B 2NNAB 1IL1B 4CKVX 1RMFH 4M93B 3HNVL 4HUXB 4NC2B 1DBAH 4JREB 1QSFD 3U4EA 4HAFA 4OM0H 4AL8L 4HS6A 4IRSB 1CDBA 3U2SB 1K4DA 2LV4A 1AGCA 1P2CB 5JOFA 4ZUTA 4HEME 5L8LB 1KV3A 2XFXB 3WIFA 3JWNC 1AGEA 3F7VA 5EIIA 5GS0C 1B4JH 4MS8D 1PZ5B 2ED8A 1TFHA 2VDPH 2DQTH 4FQXB 1NGPH 1CE6A 4RFOH 2VWEE 5CJOL 4P99A 2NY7H 1RUPL 5HHNA 4OCNC 4R4ND 5DRZA 4JFZL 5B8CB 2JCCB 2DRUA 1B0WA 3I85A 1QYGH 3ZTJG 5DWUH 4Y4HD 5HHVH 3MBXL 4R2GC 1JZ4A 4X7SH 4MNQA 4Q74A 5EOTB 1G7JA 2F74B 4O4YH 3DURB 3E0GA 2VXQL 4P2RA 3PWJA 5JOEA 1UM5L 4P9HH 1ZT1B 3B2VL 3GMLB 2UVEA 4PB0L 4PP1D 4NBYB 3MRFB 4X4YA 2CPCA 4HUUA 4ENED 4ONOA 1JZ6A 3A6OA 3FT4A 5I19H 1H15B 3FQUA 2AEWA 2FEDC 1C8PA 2D7PA 2F5AH 3O3DB 5E8NA 4O2EA 1F4XL 4AJ0A 3DUSB 2GAZB 4KTDH 5DQJA 1Q8MA 4JM2B 4KHXH 5D7KE 1Z0NA 3OZ9L 5CS7A 3QNYB 5DQDH 3BO8B 4QXTA 1QO3B 4JN2A 2VISB 4E41A 2XKNA 3K4AA 1QA9B 3UTTE 5FGSA 3AROA 4NKDB 3RL2B 4JVPA 4OQTL 1TENA 3I75B 1VPOL 3WCYA 2VKWA 1EZVX 1CICD 3VXUB 4ODSL 3IDIB 4GXVL 2IPKA 5T1DL 4BSVA 3SDCD 3GMPA 1EFXB 4XNXH 1S7TA 3O3BA 4HS8L 3DIFB 3KPPA 2Z9TA 3BKYH 3L9RB 4BELD 5JW4Q 4NT6A 4P3WA 1IAMA 1FZMA 4TTGA 1V7NH 3Q2CA 4NKOB 2W07A 2X1WL 4JB9L 5J3HD 2AXFB 4P4RB 5D2LF 2MSPA 2ITDA 1WISA 4MNGE 4NRZB 5GGSA 2YUVA 5IEKB 1U8HB 2D9QB 4OTXH 1CGXA 5JQ6L 3KJ6L 4NC0B 2WW8A 2NMSA 3EO0A 4HJ0C 2XACC 2HVJA 2F53E 3IKCA 4QHNB 1PBYA 3GSRB 1ZHKB 2F54A 2P5EE 2OM5A 1G7HB 3MREB 1KGCE 4XMPL 3O41A 2KZ1B 3VD9A 2BSSA 5GGVY 5HGHA 3V4VH 1RZGA 4PJHA 4WENB 4MXQD 1U6AH 4A6YL 1NC4B 4KK9D 2OJEB 5H94B 1IGJB 1E6OL 4UIKL 3UCRA 5IHBA 2DTML 4QRRB 3T4YA 4Y1AB 4YDLC 3V6FA 1BOGA 4TNVF 3CFCL 3ES6A 4PTUB 1YN7B 3DUHA 3QQ3B 3QWOB 3LPWA 1ZT7A 5F9JA 3UDWA 5KVMC 5DMGD 2UY6A 3FB8B 4UDTB 3EYQD 3VFVA 5BRZD 1T6VN 2OL3B 5SWZD 1RD6A 1LEGA 3RBGA 3IVKA 1A6WL 4MQXC 3MROA 2VLRB 4L8BA 2ZOKA 3LS4H 4ORGA 1RJCA 3JV6A 3S36L 5LQBL 3BW9B 4GRWF 2WINB 3GMMB 3PWPE 4R90L 4M1CC 2YEZA 4I48A 2XTJE 4JANB 3V6OE 1T83A 2VITB 4NUGL 3ZKSD 2DMBA 3Q1SL 1CD9B 3JWOH 2O5YH 1CDGA 3IJSA 4F15C 4X9GA 4NKMB 3WDJA 4NZUL 4MAYC 1IM9D 2IG2L 4LIQE 2YPVH 5GGUA 4O02H 4K3GA 4U3CA 2XA8L 1C5DB 5I8CB 3FRUB 3HMXH 5HHME 1ZA3B 2NYYD 4GQ9H 3H9YA 2Q86B 4X99A 5GGTH 1M4KA 1H5BC 2MHAA 3WNLA 3QHZH 5LBSL 4MNGA 5INCB 1WFTA 4NQDE 1CD1A 1KEMH 3C8DA 4QHKI 5I76B 2OXHA 1NCDL 2FWOB 5D8JH 1TETH 1HHIA 4MSWA 2AEPH 1ONQA 1J0IA 4WUKL 1AP2B 2IEPA 4I13B 5DJZB 1CZ8H 5KSAD 1UVQA 4R4BA 5D7LD 4P2OB 5FDYA 1FGVH 1WLHA 3G9VA 2Z91A 4XNQA 1DLHB 5CEYB 4YXHL 5T33L 4TTDD 3TBSA 5I6XC 4NQXA 3BD5A 3FAWA 4LPWA 1R5WB 3P0YH 1S5HB 5EA0H 3IAQA 2YBRB 2X2YA 5HYQA 3ALXA 4YDKL 4JVWA 5I18L 5L88L 4HS6B 1MAKA 3EOBB 5KSUA 1HQ4A 4QXUH 2OP4L 4YFDB 2JCCF 1WCBB 1X5HA 5KVEL 3QAZC 3L3DB 4TUJA 2LE9A 1NDGA 5KAQF 1AGEB 1I9EA 1J0YA 2D31B 3VFMB 4DGYH 1U93A 5JIKA 3VI3E 4UAOB 4UT6H 3KS0H 15C8L 4HZLB 1GL4B 4JJ5A 1FO0B 5KSBE 1YPZE 5BO1L 3MV9D 3WUWG 3TA3C 4POZC 5DJCA 3DHMA 3HRZB 3I50L 4M61A 2H2PC 4KQ4H 3NPSC 4JFHE 3PWPA 4PR5A 4XPAH 5DRZB 5FKAA 3L3GA 1C16B 4POYA 3U6RA 3X11A 3K74B 3OAUH 3LKSA 2AJSL 3QIWB 1MAML 3TVMC 1RHFA 2EECA 1G7JB 4XBGA 4Z78A 3ILQC 1JWMB 3I3DA 3PWJB 4ZFGH 4PJEB 1T20A 2Q3ZA 3T04D 3EAKA 4ZDHB 3OKNA 1PSKL 4JM2F 4X6FB 2OL3L 2C4XA 4LVHB 4EUPB 1X4ZA 2ICWB 2XG4A 5KTEH 4X4YB 4HUUB 4MB5A 3T3ME 1KEGL 2BY2A 1TTGA 1D6EA 2PO6D 4Y5VA 5TGBA 4FHBD 4PG2A 4FQQA 4O2EB 2FJHA 5AZ2H 3NTCL 3I6KB 2QV2A 4NQDA 1EEYB 2BJML 4MDIA 4LCUA 3TF7C 4ALAH 5CZKA 2FHFA 1XIWD 3BKMH 3U82B 1U3HA 1MIEH 1I1CA 4JN2B 5TFSL 2P7TA 4L4VA 1GZPB 2XKNB 1XF4B 4JHZA 4X8XA 2CK2A 2LU4A 4RNRA 1CLOL 3BD4A 2ZUQC 2B5IB 4CADA 2RCSH 4HWNA 1XF5A 4CW1B 1S7TB 3JTSA 4PBWD 4IMKC 3O3BB 3OB0K 3LMJH 4YJZL 1OP3H 1A7OL 4JKPL 3O2DA 2DL9A 4L8CA 1MFEL 2PTVA 1EGJA 3VXQA 3WJLC 1FZMB 4K3EL 5BV7H 5HJ3B 3RTQA 3JV5A 4J3OC 4XMKH 5EZLA 1NEZA 4I4WB 3U4BH 3V9FA 4YHML 5I9QC 4FG6D 1FFNA 1OWWA 4XPFH 2A73B 2GSIB 2OTPA 4YO0A 1LO0L 1HN1A 4BK5A 1YPZA 2YA0A 3NABH 3IKCB 4LSVH 3KG5A 3AREA 2D03H 3NCYS 5D72H 5TE6L 4Q6IC 4HUVB 5C0CD 4GW1A 1YEEL 3FN3A 3TN0C 4NN7C 1A8JH 1DQJA 2Q8BL 4NO2A 4Z95L 4PGEA 5DD0H 2EH7H 1EHAA 1OAUL 3X17A 3SJVD 3C2AL 3HG1D 3OKEA 5CWSA 2FL5A 3FO2A 1HKFA 5C9KA 1U8NA 1U9KA 3B9VA 4KDVA 2OS7A 3H9SA 3X14A 3KYOB 1S8DA 5HHXH 2VZ1A 3VXOB 1ZT7B 3Q6FA 3N85H 1HXYB 1FO0L 3VFVB 4HKZB 4XPHL 5F6HI 4IM8A 4ZXBD 3IDNA 3BPLC 2X6MA 5DJYB 2VZSA 5D6DA 1MJUL 4P59L 3ULUD 1K9TA 4ORGB 4QRPA 3O6ML 3JV6B 2WSKA 2WNGA 3ARBC 3EOAA 2BFVL 2F15A 3PDGA 5ECJE 4LPYA 1QP1A 5GISL 4LSTL 1UJ3C 4KRNA 1AD0B 4KJQD 3CH8A 4HFUH 5CZVH 5E70A 1QLRA 3UTTB 3C5ZD 2EDRA 1VDGA 1ZWIA 3OJMB 3DO3A 3FTGA 1GZQA 5GJSL 3F12B 5J1TC 4LSQL 4PGJA 3D39A 1IAIM 1UJTA 3QCUL 5C08E 3C87A 3MACL 1KN2L 5GGUB 2BNRD 1GHFH 2CXGA 2E6QA 5I1HL 2RJMA 3CVHB 5DD5L 3WLBA 1CFSB 5BQ7A 2RIKA 4X99B 2AI0L 5JUEH 5KG9A 4LAJH 1IBGH 4PJ7E 3ARVA 2HP4A 5GS2H 2HJFA 4MNGB 1JL8A 5AG9A 2A83B 1CD1B 2VAAB 4XVUD 1N0LA 3O9WA 4KC3B 1RURH 1EJOL 1P4LB 1HHIB 2VMFA 4MSWB 4UU9A 3HUJB 3GI9L 2F53B 2Z4QA 1RULH 2J5LC 4WHTA 4FQHA 1S9KC 1KNOA 3JXAA 5HBBA 4FQ1L 4ODWA 1JPTL 2P5EB 3MNZB 3TO4C 4R4BB 3HCVA 4HGWB 1E27A 1W72A 1AY1H 1BIIA 2Z8WC 5KW9H 1QG3A 4G8IB 3BKCH 3GSVA 5E9DE 3A67L 3QIBA 5JXEC 4U1JA 1VESA 4M9PA 2Z35B 3OKDB 2AAVA 1M7IB 5IJVB 3BGFC 3NFSL 3FCTA 1ZXQA 4IOIA 1B0RB 1A64A 25C8H 2XN9A 1CCZA 2Q76A 4NZRL 2HLFD 3MUY1 4LVNB 3ZHLA 1ORQB 2UVFA 4WRLA 5KSVA 2JKXA 1NEUA 2PYFB 3VFTA 3QQ9C 5D7SL 3BIBX 4ZUWB 3WFEH 2FZ3A 3QDJE 3U36B 1NGQH 5D7JC 1IGIL 5IVZB 4PJEF 3VH8B 3MJ9H 2NY5H 4U1LB 5F97E 2NY2B 5F3HB 1MJJB 3KYNA 5DJCB 1LGVA 5BCAA 4M61B 1EO5A 1HZHH 3I02B 4UILH 3PWPB 5I8KL 4GT7A 3L3GB 5LCVH 2XTJB 4I1NB 3WNKA 3LKSB 1AXTH 4Z78B 4KHTH 1FNEA 3WO3B 3PGDB 3N1GC 3OTTA 3OKNB 1UCBH 1J11A 3VFWB 3BWAA 2E27H 2XZQL 4LQ1A 2HWZH 4W6YB 4WY7H 2GI7A 3KXFE 1CL7H 4CMHC 3DX9A 1VA9A 4PTTB 4EXKA 4G6AD 4POUB 3X3GL 1D6EB 3O6FC 3FQXA 4FQQB 4PJ7A 4OD1L 2UZIL 4NQDB 4NQCD 4JQVA 4RMQA 1NGWA 4KK8C 1WVZA 4LCUB 3WEXB 1ZMYA 3IJYA 1T0NB 2EKSA 4KKAC 2DBJA 4XH2B 1V3KA 3IFLH 4UDUA 2W0FB 3MRIA 4N5ED 3UZEA 4P46D 1YEKL 3RWIA 4Y4FB 3UAJC 2HJLA 4S1RL 4YUEH 2NXZD 5E9DA 4RNRB 2X4OB 2VB5A 2HLAA 3U46A 1LILA 3EKCA 4NNXA 3CVHL 4CADB 2A1WL 4S2SA 3KYMA 1XF5B 4ODTH 3JTSB 1G7IA 4B7LA 3PG2A 4D8PA 4L4JA 3IXAB 1JYXA 4RGNE 5CP7B 5C92A 2VH5H 4X5XA 3MLZH 3RI5F 4L8CB 2ZKHL 4IDJH 1DE4A 2R4SH 5F1SA 3VFOB 1S7UA 5EZLB 1NEZB 5HYJA 2YPLB 3TPUA 3GZKA 3QQ4B 2F58H 4YO0B 2NZ9D 1UC6A 5KSBB 3DUUA 1UKSA 4Y2DD 3FT2B 5C09E 1UACL 5E6YA 3CSPA 2XNAA 3WIHL 3FAXA 3EJZC 3AREB 3NH7H 4GUPB 1FPTH 2CO6B 4GW1B 4KAQH 2VN4A 5I30H 1FIGL 1DQJB 4XVJL 4OF5A 4TVPL 4XCNA 5D1ZD 5HYEA 4PGEB 1N0XH 4G9DA 2CIIA 5MEOA 4U05A 3V52H 5TF0A 1CXFA 2YMXH 3OKEB 3W11D 2DQDH 5DK3A 2I26N 1BECA 2HKFH 43C9B 1U8NB 3PJSB 5IT2H 4HPOH 3X14B 1S8DB 2VLJD 3KR3L 3MRKA 5HHOE 3Q6FB 5L8JB 1YC7A 3PNWA 5FYKH 4B5EA 2J2ZA 4BSJA 5B39A 4K71B 2VNCA 3RVXD 2DQUL 3MGTA 4TSAL 1DVFB 1A0QH 1MFCL 2RFXB 3RA7L 2EYRB 2E7BA 1CLYL 2VDQL 3PE9A 5E8PA 4LEXH 1Q0XH 1RVFH 3LKNB 3EOAB 2EDEA 3GGWA 4NO0A 4W6WB 1JK8B 2B39A 5IV2B 1L7IH 1MVUA 3QUMA 2P8LB 1H5BA 4ISVA 1QKZL 1NCAL 3TCLA 2C3GA 4QHLA 5J56B 1ZWIB 1IEAA 2HT2D 3FTGB 1A7BA 3LAFA 3IU3A 4LASL 3VXRD 2BNUB 3N9GH 3LDBC 3MNWA 3ULVL 4KJYB 1MJ7L 4WW1A 3HUJF 3K3QA 4LSSH 3ZE2F 3B8YA 1MHCA 3NA4A 1NC2B 2ZUWA 3WLBB 5BQ7B 4OI8A 5BVPL 3MV7D 5KG9B 5D1XA 3EHBC 4NOBA 2PXYB 4KUCF 2HJFB 3RDTB 4RX4D 4BH8A 5KVDL 1CIUA 2OBGA 4U6YA 3O9WB 5B21A 4LDEB 5ERWA 4UU9B 2E7MA 2RBLA 4JZJC 5MERA 4H0IA 4KRPB 2Y06H 4WHTB 1YYLH 3DRQB 1BP3B 1KNOB 1RZFL 4ODWB 1TVDA 3HCVB 3NCFB 5GZND 1W72B 3QISA 5DD3L 1BIIB 5MEND 3QRGH 3FO9A 1RQ5A 2JJSA 4PJ9C 2CJUL 4HKJA 4OCXH 5IBLC 5IM7B 1T21B 4XC3L 5DMIH 3ULSB 3T0EC 1TTFA 3STZA 2WMPA 3QIBB 5AYQA 2VZUA 2X4QA 3TA3A 4XNZC 3RIFK 2BVQA 1OAYL 2CR3A 4IOIB 5E00A 5FYJH 1C1EH 3RVUC 2ITCA 4WVRA 2Q76B 1EUUA 5HHOA 2V5RA 5C0IA 1NBZA 2QL1A 3H9ZA 5IMOA 2VUYA 1O5DT 5IJKC 4DVRH 3HS0A 3MLXH 2VDKH 4F37F 4ZTPL 1EDQA 2KQMA 3PHQA 4N9GB 5FUOL 5LG1A 3VU2A 2WLZA 1HYRC 1H8SA 4K94H 1IGYB 4ONGH 1OAQH 2OR9H 4HFWA 3BQUA 2O5XH 1BX2B 1FFPB 4LDLB 4NHCL 3CU1A 1UM4H 5DJAB 2YRZA 4UBDD 4EI5C 1TNMA 1IAII 3V79C 1IARB 1KULA 3MUZ1 3LQAC 4PRBB 4H1LA 3VA6A 4FXGA 4S10A 3VXPB 1NANH 2JJUA 3UTZA 2VLMD 5MP6L 4E42A 4PJ8C 1INQA 4L8DB 3TC9A 3WFBL 3DXAD 3VMOA 5C08B 1EO8L 3LEYL 2QQKL 1ES0A 4JO2H 3BWAB 4FQXD 1CFTA 3FB5B 4HF5H 1OTTD 1S5IH 3DX9B 2YD8A 5HPMA 1MRDH 4XHJC 4DUXA 1P7HL 3T2OA 5DUPL 3FQXB 4S1QH 1AXIB 4PJ7B 1XGTA 3TYFB 4F7PA 4GKSA 5CIPH 2E5EA 5C6WH 3I2CH 3V6BR 3ARTA 3DNKA 3PDOB 3LQZA 4LLVB 1UKQA 3GSUB 3MLWL 3IJYB 1AGFB 5EZJA 3MRGA 5GZOC 2WUBL 1MCNA 2J8UA 4UDUB 1HYSC 1RK1A 2AK4A 1R0AH 2YD6A 2HTKD 4KKCD 5BMFH 3RWIB 2APXA 5IVNA 1FH5L 1J8KA 4PRHE 2WIIA 1I3RB 4KJWD 3IRPX 4PLJD 5EU6E 3MCG1 3VI3F 4F7EA 5CD3A 2VDOH 3KYMB 5KSBF 3FONA 2IFFL 1YPZF 3QFDA 1BJMA 2X42A 4NFBA 4NO3A 5DJ2B 1G7IB 1U0QA 1C5BH 3FKUS 2H8PB 1EFQA 4LBEB 4DZ8B 5KVFH 4X5XB 1RIVL 4JM2D 5DLMH 4U1GC 3OXRB 4M03A 3DBXA 4LU5L 1YEJH 4F9LA 1NMBH 3AU1A 4QOKA 5A3IC 1CLCA 4FTVA 1OGTB 1S7UB 5T1KA 3TN0A 5CBAA 2J6EH 4E0RA 4KK5C 3QDJB 4QGYA 2WAHA 1W72L 2P5WE 3VDBA 3O8XA 1E4KC 2AS5M 1KLUB 1EFXD 4JDTL 3QDGA 3V8CA 1UEYA 1WT5C 2VJXA 3LVEA 2YN5A 2CKBA 1GH7A 2Q7YA 4Y8DC 2M1KA 3U9PH 4M6NH 1H3GA 1AO7E 3T2NH 3OG4B 4G9DB 4BUHA 2IANA 2NR6D 4JFOA 5FGRA 3QSKB 1AC6A 1XMWA 4HV8B 1TTUA 2L7UA 4XWOC 2K3TA 4IIQB 1BZQK 1DL7L 2MTPA 4J3TA 1JGVH 3VFPA 3ARBA 3MRKB 3DSFH 4WCYL 3KXFB 3L3JA 2BOCB 4OM1L 5EC1A 5E08H 4K7PH 1UJ3A 2YKLL 1KPVA 3I6LE 4TUOA 5HHPA 4J8RB 3HNSL 1T1WA 4GAJL 2IAMB 4GXUM 3MGTB 4QRQA 2XRAH 5IFJA 2J4WH 5IHUL 3AM8C 4HC1A 3G6DH 1NC4D 4YGAB 4PIRF 5E8PB 2W65B 5E2VL 2YA2A 3TBWB 3TH4T 3NACL 3VDAA 1PG7H 4QRRD 2R1YA 1H3XA 4RAVB 4EN3C 4Y1AD 4AL8H 3QUMB 4L4TD 3TCLB 1I7TA 4PRHA 1FV1A 4YDVA 1LO3H 2V5MA 3MQIA 1FVDB 2A0LC 1IEAB 4QHMA 1U8KA 3MNWB 3RFZC 4QXGH 3V7AE 5IMLB 2VLRD 5F96H 4RGNB 1MHCB 1XGYH 3BP5B 4OSUH 1PX4A 1F4AA 2AEIT 3L3OB 5MHSD 5DD6A 4BM7A 4MD0A 1TCRB 5D1XB 1L7TH 3B9KB 1MHPH 4RWHA 3SDAB 1F11A 3ZHDA 5EORL 4BH8B 3INUL 4U6YB 2DQFB 4JRWA 5JXEA 2P5WA 3HZKB 1ZGLA 1T7YA 1BD2D 4PRDB 5C09B 5DA4A 5E6IB 4X6CE 5GRJH 3RWFB 3DYPA 4LQFH 4PB0H 3TJHD 3FO9B 3QWRA 3SO3C 2AK1L 4OIIH 5T3XL 3GHEH 3K1KC 5GGRB 4Y5YA 1KC5H 3RWCA 4KZEH 1AR2A 3BH8A 1AO7A 3STZB 3P4NB 2ID5A 1ADQL 2X4QB 3CFIC 2B0SL 5ACLA 3X12A 4EDWL 1PD6A 2P43B 3AS3A 3TO2B 5JORB 1D5XA 5FYLE 2BHYA 4Z77A 2VLKE 3VXSE 1D9KA 1SBSH 5E00B 3BN3B 2V2TA 4OLZL 5HHOB 5C0IB 3P4MA 4P2OD 3V4UH 5DI8B 3MYZA 4G42B 3D9AL 3C6SA 1X5KA 3HE6D 3KHOA 3U7WH 3PHQB 5SX5K 4PJCE 5MEPA 1NQBA 3NZHH 4G8FB 1DSFL 4FNLL 4GXVH 5T1DH 1J0HA 1QFOA 4FFZH 4D3CH 3BQUB 1S7SB 4KUZL 3BRDA 3SDDA 3TBTB 1CS6A 4E9LA 4GKZA 4H1LB 5CKAA 1FVEA 5E2WL 1H3UA 3O6FA 5A2KH 1JIBA 4PBXA 4PJ7F 5IB4A 4GAGL 5DRWA 1DUYB 2Y9RT 3U1SL 3GJFK 3IDYB 2VIRB 4JY5H 3K2UH 1DFBL 1H8OA 4QHUA 2XZAH 5ESVB 4I0KA 5DJ8A 5E2TH 3VGEA 3RGVB 4MCYB 3FN0H 3O0RL 1JN6B 5DVMA 3KJ6H 1CFTB 1YNKH 4J1UB 4LCCC 4MS8C 5JLZB 5HPMB 1UQSA 1K6QL 2PR4H 2X41A 1LNUB 5B4MD 1TVHB 1ZKAA 4HKBA 4NQUA 3WKML 1XGTB 3MOBL 3ZTJH 5DEFA 3QIWD 1XR9A 2VR4A 4Y4HC 2E3VA 4QCIB 5SX4H 4A6YH 1Y6NR 5EZJB 2UY7A 4DN4L 2IJ0C 4LGSB 4XAWL 2XYCA 4GKOA 4H20L 3STLA 1RK1B 5F6IC 2DLFH 4KTEH 1EHLH 3FJTA 2GT9A 4GKNA 1FLTX 3KWWA 3U48A 4XVSL 4PP1C 1BEYH 3CC5A 4KKLD 5E24E 4ENEC 3QXAA 2PYEA 4M43H 1R5VA 3MLVH 3QFDB 4Q97A 4Q9RH 2G9HA 4HGMA 2OQJB 4RBPH 3D87B 5F7NC 1KLFA 2VLKA 3HZMB 4KVNH 3VXSA 4GJTB 4KTYA 1K8DA 4EXPX 1UH4A 1E4XI 4PJIE 1W0VB 3TWCH 1E0OB 3OGCA 3GO1L 3AU1B 3SCMA 5IOPB 4X80H 1GC1H 5D2NE 4E0RB 3T0EE 5F1IA 1FAIL 4HW6A 4PJCA 3QRFM 1JPSL 3ESVF 2FYYB 1PZUB 3O8XB 4XP1L 2J88H 1S78D 3CPLA 1CICC 3S8WA 1KIQA 4ZAKD 1BVKA 4PS4L 2MMXA 4XMLL 3SDCC 5GJTL 2CKBB 4M4PA 3SGJA 5IMMB 2MQ3A 1KYOJ 5ACMA 5D5MA 1A4JB 4JFOB 2ADFL 4PJ5E 1F90L 4ZNEE 3PXJA 2MPAL 3QXVA 3GSQB 2DQJL 1A21A 4JPVH 4WV1C 3QIUB 4YC2C 2FATL 5I1AB 2HG5A 3FQNA 1A6TA 3NAAL 3VFPB 1AHWC 5D93C 3QJHA 3S4SB 4RCAA 3C8KA 1KPVB 3MLUL 4NGHL 4TUOB 5DT1L 2HFGL 4JFQB 1UXSA 5J4MA 4JAMB 4QRQB 3P11H 5IFJB 4WI8A 2AV7B 4LAQL 1L0XA 4UV7H 2AKRA 2M2DA 2ZWLT 3ORJA 3U7AA 4DGIH 3JTTA 3MLTB 4U6VL 4MXQC 4LLMB 4H26A 4LF3A 1F2XK 4P23D 5C9JA 2R1YB 1CF8L 1EH9A 5JMOC 4X5WA 3EYUL 1L0YA 4OF3A 2QSTA 4EQ2A 1FAKT 4PRHB 1F97A 3SKJL 4DUWA 4AZ8A 3RUGE 1J7VR 3PXHA 5EU6B 1S7XA 3S35X 4G8EA 5FB8B 1K3IA 4FQPA 5DMGC 4M5ZH 3EYQC 5KJRL 5D1QC 1YQVH 4LP5A 4XBEH 2OYPA 4XP6H 15C8H 4JZJA 4JQIL 1BZ9B 1JNLL 2ICES 5D7KD 1UA6H 1G7PA 3VRJB 3FB7A 1K4CA 4RWYH 5DD6B 3DMMD 5EO9A 1A7NL 2N1KA 3UTTD 1F11B 2JIXA 5GS1C 3Q3GA 2X4RA 4DW2H 3T0EA 1KFAL 1HI6B 2BHZA 2P5WB 3VRLE 1VERA 3DRTB 1AKJA 1FNLA 1T5XA 4OLXH 4JDZB 5ESQB 5KZCB 5SWSE 4PJBE 5SX5H 1RHHA 3QO1B 1GGCH 3FQTA 1JP5A 1QBLH 2Z8SA 5HDBE 2K7QA 2DJUA 2DKSA 1CBVL 2YD2A 4GRMB 4Y5YB 2HRPL 1I9JH 5CBEA 3BH8B 3WSQH 3WDIA 1MREL 2H1PL 1B3JA 3CUPB 2F19L 4OB5H 2L0DA 5DUBB 1CDCA 3FHAA 1FFRA 3GJFH 1M7DA 1Y0LA 3RX7A 1D9KB 4Z7NE 2UYLB 2F53D 5JHDD 2A38A 2P8PA 1K2DA 2P5ED 4YFLF 1F6FB 5GSRA 3WFDL 4XPGL 2AV1A 5KSAC 3C6SB 1ZHLA 3FFCD 4LCYB 5L0QB 4TULL 1D6VL 1X44A 3V2AR 4PUBH 4KUCD 4TTDC 4FFWC 3UYRH 5F1OB 4ODBD 3S37L 4JY6B 3RHWK 3MRRB 4P5MA 4FABL 1U58A 4TVPD 2ZCHH 4YXKL 2YK1L 4DQOH 2FX8L 1CGSL 5CUSL 4JKPH 1FVEB 1KELH 2FD6L 2EE2A 5DRWB 4P5TA 3RUGA 1A9BA 5BXFA 5ICXB 2NY0B 1DQDL 1FZOA 1T2QH 2HFEA 2X7LB 1MRCH 2Z31A 4NWUL 2CLRB 1D5IL 1ODAA 1DQML 1INDL 4GAFB 5TQ0L 2NY2D 5ITBH 1NCWH 3DV4A 4LCIL 4RA3A 4JFXB 1FFOA 1UQSB 3PWPD 5TE6H 2VSCA 3DWTA 3IS1X 5JPMB 2QHRL 1JYNA 2XTJD 1A9EA 4FQLL 5ETUA 3TNNA 1A6VH 3P40A 1Y18A 4JQXA 1OAUH 3OKOA 2QKIA 1G9MH 5C0JA 4UV4H 2XWTA 2FBJH 1CYGA 5I8EA 4X6CB 3GK8H 4FA8A 5D6CA 4GKNB 4YHKL 4YHYB 4Z8FL 1AGBA 4C83B 3MYJB 1QFWM 3ULVD 2D7TH 2P48B 5F6HJ 3D85A 1JE6A 2AJVL 3QXAB 1KCSL 4J12A 1R5VB 2CUMA 2PO6C 3TZVD 5FM8A 4R97C 1UYWL 1I7ZB 4NQDD 3OF6A 2FNBA 4P59H 1BQSA 1CQKA 2IH1A 3PABB 4EIGB 3Q48A 3VXSB 4U1NA 4JFFE 5FUCE 3GBML 4XCCH 3IDMB 2GJ6E 1IT9H 1KPUA 3O2WL 5F9WC 1KLGB 4GRLD 3MRMA 2Y5TA 5TE7H 3SCMB 4X9FA 3RL1B 4PBVC 3EDJA 7FABL 4Y4FD 4KROB 3B5TA 3K1DA 1JZ7A 1AGDA 2QQNL 3KPMA 3IB4A 5DJ0A 2ESVE 3ARGA 4PJCB 5EBGA 1IFHL 1G9NH 1NLBL 5C7XL 5DHVH 1UZ6F 2OLDA 5GJSH 1BQLL 1NCUA 4RQQA 3E3QE 3QCUH 4U1HA 4OZFB 4G3YL 3C08L 3DECA 1BVKB 1UM6L 2ICEB 2AJUL 4MD5B 3OKKA 5K9OB 2MOVA 1NCCH 3BP6B 3RVTD 4HLJA 1X5YA 2Y6SD 3L3HB 3QG6B 1DBJL 1DBML 3VW3H 1YEGH 3LKPB 1DUZA 4NC1C 5HSFA 2WUCH 1P7QB 2YPLD 4DKFL 4Y7MA 4M6AA 1ZLUH 3VGAC 3L6FA 2W59A 5DO2C 4RAUA 1A6TB 3VGBA 1RJLA 1JGDB 1FNSH 3D0LB 3R06A 2OR7A 4Y16A 3I9GL 3O81A 4JFHD 4PGDB 3DI3B 4LMQE 3K7UA 5CCKH 4MZ2A 3NGBC 1UXSB 1QSFE 1U36A 3EDKA 4PRIB 3EYFA 3G5XB 5EC2A 2EIZA 2H3NB 4FP8H 3GMQA 4FS0A 4OD2B 4H26B 4LF3B 3ALWA 1KCUL 3HMXA 3LEXB 3DVFA 5I2IB 1FYTA 1NGXB 2JB5L 3R4DA 4X5WB 4C58B 4W4NA 4GBXA 1OL0A 3L5WB 3DX6B 1NBVH 1KIPA 1TXKA 3IXTB 3IF1A 3AFLA 4JR9L 5FDWB 1N6QH 5EO0A 2D3VA 1DVFD 1N64L 2A74A 2JK5A 4DAGL 1JWSB 4P2QE 1KN4H 4YPGA 3ULUC 4N0FB 4PJIB 2A9NL 2GJ6A 1OAZH 3FMGL 3FB7B 3N50A 1IQWH 2BDNH 4AH2B 5I8KH 4K9EC 3BRFA 4P4KC 4DN3L 2XI9A 3BX7C 5D2NB 5FFLA 4U0RB 5C2UB 1TJHL 5FGCE 5JW3L 1GJIA 3V6ZA 2X4RB 1FZKB 1I7UA 4FQJL 2ESVA 1U3YA 2EIEA 3C5ZC 3OQ3B 1S7VA 4Z9KB 3J7HA 3QB7C 2X4PB 3MMEA 4PJDB 1Y6KR 2CUHA 3FQTB 3P0VL 1NC2D 2FX9H 3M17A 4JVUA 4WFGE 1NDMB 5CD5D 5C2BL 3VA2C 5E2UL 2HN7A 4AIXA 5DQ9B 4KPHH 3F5WB 1MNUH 5FYLL 3PWVA 5I1IL 5JHLL 3MBEC 4DFIA 3GSNH 1MHEA 4JEGB 5EWIH 2PXYD 3VG9C 5ITFA 4PJ5B 3KLHD 3RDTD 3RAJL 1JUFA 1SJVA 1MELA 1M7DB 4UB0H 4YZFE 1N6UA 2V5TA 3KYAA 4KRPD 4XVUC 1IGFH 3SKMA 3HC3L 1K2DB 3RIAF 3KAAA 3OPZH 5GRUL 3F62A 2BVPB 3U83A 4FQIH 2HT3D 3S96A 1QSFA 3GNMH 4OT1L 5F7KC 2VL5B 3NCCB 4JHAL 3MSPA 1MCQA 2DLGA 3LIZL 1U8IB 4UMGA 5IFAL 3R8QA 4QRSA 3CZFA 5K93A 3QBTB 3DETC 4P5MB 1U58B 1RZ7H 2E7CA 4PRAB 4AMKH 4I3RL 4QEGA 5M94B 3W82A 4KRMB 4YPJA 3JWDL 3THMH 3KPOB 1R3HA 2Q87A 1WIPA 3TEUA 3QDHA 4AEFA 3VGFA 5D96B 3MRNA 2GUOA 1TJGH 2MQ0A 4P5TB 2CXKA 4ZQKA 1OARL 5BXFB 1RJZA 1A3LL 3PIQA 5L9DL 2HLFC 4GH7B 2F8OA 4RDQG 1BZ7A 1FORL 3ZL4H 3P30L 3RRQA 2Z31B 2CQVA 1KJ2H 1ZGLM 2X70A 1JHKL 2VZVA 4NCDA 4X6CF 3OAYH 2ZZUT 3KJ4C 4JHWL 1HXMA 2DJ4A 3UMTA 3NCEB 2PNDA 1JRHI 3ARRA 2DLTA 1T66C 1XH3A 4OGAD 4YR6A 4WEMB 3TNNB 4O58H 5HVHB 1CFVH 1S9YA 3EJYD 4FXKB 1GGBH 1T22A 2QKIB 5ALBL 3HLAB 5C0JB 1NKOA 2XWTB 4TUKH 3VJ6A 5SWSB 5C08D 4MD4A 4PJBB 5SWZE 5D6CB 1RIUL 5DYOB 4B50A 3HI5H 4AT6A 3QZWB 3KR3H 4V1DE 2EC8A 5CHNA 3D85B 2F8VA 2EDDA 3MRJB 1C12B 1MCWM 3VE0A 1ZHBB 3VRIB 3GKZA 1MCLA 3U0WL 1N5YL 4PJCF 4NUJA 1UZ8A 1X4YA 3BE1H 1G7LA 4U1NB 3EFFA 3EGSA 4M9OA 1IKFH 3SDCA 2XKSA 2Y5TB 5C0RH 1RZJC 1DBAL 4HIIB 2XZZA 5AWNH 4N5EC 4OM0L 4P46C 5F7DA 1BWMA 1AGDB 3AAZA 3PWLA 3ARGB 5DJ0B 2LQRA 2YPKA 1CDUA 2NTFA 1WAAA 1U92A 4U3HA 2ZSWA 5T3XD 3ULVH 4U1HB 1MJ7H 4M7ZB 1C7TA 1B4JL 4XP4H 1AHWA 2DQTL 4MJ2A 1NGPL 3MV01 2UZXB 3K80A 4KJPD 4RFOL 2B1HH 4M8QB 1JHLH 2GYSA 1ZEAH 5A16A 1QBBA 2NY7L 4XCFL 1FRGL 5C8JB 2AVGA 4IRJB 3LY6A 1SEQH 1DUZB 3VI4E 3QDJD 2MCPH 1MCDA 4HGKC 5DWUL 3K46A 5HHVL 1Q9LA 5I74C 1KTDA 4X7SL 5EPMA 3ROOB 4O4YL 1RJLB 1KJMB 4Z7OE 4PREA 1DDHB 4LVOC 4Y16B 1NEZG 3BPNC 1RZFH 4Y2DC 3RIFF 4P9HL 4L3ED 5J12C 4PJFE 5IQ7H 3B5HA 3EYFB 2CJUH 3U7YH 1HKLH 2EIZB 4XC3H 4OFPA 5HYIA 4RA0C 4IJ3C 1ZHNA 3KPNA 4XXDA 1ND0A 1QFWI 3GMQB 1AIFA 3RWGA 2F5AL 2PKDA 2XICA 4IRZH 4Z7WE 5SWZA 2J8OA 4PJIF 3ZYJA 4KTDL 3CK0H 3MV9E 4GBXB 2XQYG 2Q8AL 5IHZA 2V9QA 3KXFD 2O26U 1ZANH 4BSWA 1NFDE 4JE4B 1KIPB 3MJ8A 3OR7A 4Q2ZA 3ZE0E 4JLRA 3IFOA 5DQDL 2X05A 5GS1A 2O61A 2IAMD 3KPTA 3CX5J 5EZOH 3BZFA 2VDMH 3RWEA 1TQCB 2A74B 3LKQA 2B4CH 3ARYA 3KPLA 3O3EA 4MWFB 2EDXA 2D7OA 4PJDF 3RVXC 3RWHA 1BLNA 4JFFB 1H0DA 2FO4A 4YPGB 3TP4A 4URTB 4BQ6A 4NDMA 2GJ6B 1WIOA 4G9FE 4N0UA 5EN2B 4M6OH 1EEZA 2DM2A 3TBVB 4CN6A 3V6ZB 3S88H 4N0YH 3WIIH 4K9EH 5E1AA 1I7UB 4AYFA 2ESVB 2BMKB 1Z5LB 1S7VB 1V7NL 2IALA 4CNIA 2HT2C 4ELMA 1LP9E 2NY1B 4UNVA 3LEYH 4RGND 5IWLA 1WWWX 3QFJB 1DEEB 3M17B 4OTXL 5A2JH 3KNBA 5AZEH 4HH9B 1KB5H 5HDLA 2XTLA 1MY7A 3LB6D 3PWVB 3TNMA 1WFNA 5D1XD 5DUPH 5D7LA 3B9KD 3IDXH 1Z2KA 3SDAD 3HR5B 4D0CB 5DTFB 1JUFB 1SM3L 4MA1B 1Z0MA 5FCSH 1TIUA 3V4VL 5C09D 5E6ID 1OM3L 3CIQA 2FIKB 3GSWB 5JDSA 4N90D 3VFNA 2LU3A 4PJFA 4WTXA 1QSFB 3AS0A 3RVWD 3BZEA 5GZNC 5F7WC 3BZDA 1CG9B 4BZ1H 3KPQA 1EO7A 3CZFB 4X4ZA 2OZ4H 2OMNA 4XP9H 5F71A 3TJEH 1RSFA 2NY4B 3PDDA 4Z7WA 5ICZA 5EG6C 3G5VA 1TPXC 3T0WA 1FE8L 3V0VA 2EO9A 3LN4A 3LS4L 3MV9A 1MHHB 5FYKE 2YZ8A 3C6LB 5IBTH 1U8QA 3KGRA 4NHUA 1NFDA 2GUOB 1NLDH 3C09B 5F1NA 5ID0A 2R69H 4TNVK 5C6TH 5C0CE 3VRLF 1J0ZA 1QNZH 3CH1B 4N8VB 3JWOL 2O5YL 4P2QB 4PJBF 4JG0H 5J11B 5KANI 3RY6C 5I1KL 3SJVE 1J1XH 2R2HB 5HDBF 2R0ZH 4I18C 3BT2H 4O02L 1XH3B 1SMOA 2ZUXA 3U0TA 4RFEB 3OXSA 5FGCB 1ZSDB 4JREC 3HMXL 2C5DC 4UBDC 9CGTA 1S9YB 3WD5L 4GQ9L 2AJZA 4IRSC 3NCBB 5GGTL 2PO6A 5CGTA 3QHZL 3VJ6B 1U8JA 1HOCB 4MMZC 4KMTH 4Z7NF 1KEML 1LP9A 3RGVD 3D0VB 1O0VA 5D8JL 4AT6B 1TETL 5BV7B 1ACYH 4JO1H 2AEPL 4NYLB 5F7LB 2BXZA 1IEHA 3H8NA 3QEUB 4FQXC 3CSGA 2YKLH 2ATKB 1CZ8L 4KZDH 1XIWA 1I1YB 3VE0B 1I3GH 1FGVL 3MV8E 3J8F7 4GAJH 4JZNA 3VWJB 1UZ8B 1L0QA 5B8CC 3MRPA 1J1PH 3P4OA 1MQKL 4N0CD 3DVNB 3CLFH 3P0YL 3CDGA 1DBBH 4MHHI 5EA0L 3WFZA 4N1HB 2I27N 5BOZG 1QSEE 1JPST 3GIVA 4U6TA 2I9TA 5EOCJ 4YX2H 1MVFA 3MJ6A 4R3SA 5CSBA 4DVBB 4P48A 5DZOA 5GHWH 2FB4H 4D9LH 4CU8A 3F7YB 3HTLX 3O4LD 2DQGH 2HTKC 4KKCC 4QXUL 2YPKB 1X5LA 4HXAH 1U92B 4KJWC 2OJZL 4PLJC 3IS0X 5BJTB 4OFDA 5FYJE 4HEPG 4DGYL 5EIQA 4UT6L 5F44A 1MFAH 5FO7A 4KI1A 2IADA 4ZPTA 5D9SA 5A16B 3WNPA 1DQQA 4JM2C 4KQ4L 2VQUA 4XPAL 3RKDD 1IC5H 2X4TA 5C0CA 4OBSA 3OAUL 5F93C 2W38A 3LQMA 2CRYA 1U8OB 1PYWB 2BRRH 1R3JB 3CCHB 1WWAX 5DZNA 4XP5H 1CFBA 4ZFGL 1HHGA 3SJVA 3ZKMD 3HG1A 4GG8B 4JM4L 3UROR 1OY3B 1QZ1A 3BUTA 1M6OA 2P49B 3OKMA 3UYPA 5KTEL 4X6BB 1LK2A 4YDJA 3KYKH 4XXDB 4FMFA 2YWYA 1ADQH 5CJBA 4ZXBA 1WFUA 5JOPE 5TDPB 5ENWA 5AZ2L 1AQKH 3QIUD 2V5SA 3U0PA 3C9NB 3S5LA 4LPCA 4V1DB 5DFVD 3SGEI 5JZ7D 3QJFA 4PG9A 3BKML 4BZ2H 1B0GA 1A6AA 1MIEL 4HWBA 2IWGA 3BKJL 3MV8A 3BZFB 3RWEB 4LSDA 3LKQB 3ARXA 5DJ6A 2FECL 1UWXH 4HZAA 3RWHB 1BLNB 1L6XA 1AJ7H 1JGEA 2FO4B 4NDMB 1DSFH 1FSKB 5B39G 4Y4KB 1A3QA 3MRCA 2RCSL 4UZGA 2EE6A 1QRNE 2VABB 3VFRA 5LXGH 3AXLB 1LO2H 2B7DT 1EEZB 2BNRA 2J1KA 2YUXA 2Q7NA 3LMJL 2DMKA 3LRSA 5AUMB 3F6IA 4PRHD 4MJ4A 4KK6D 5E8OA 5EU6D 5BV7L 4WI6A 1K5NB 4XMKL 1S9WB 3BIKA 4CNIB 3U4BL 1YJDC 3WS6A 3SKUD 4XPFL 3KDMB 2WWMD 4NQCE 4JZOA 1FG9C 4M7KH 3P2TA 4OF0A 1MJ8H 4YHOH 2R29H 3NABL 4Y19E 4LSVL 4R0LB 4U6HA 5C0DB 2D03L 5D72L 3TNMB 5L7XH 2Y4SA 1X5GA 3BHBB 3GMNA 1NCBH 5TH2A 4LRNH 2J8HA 4KU1A 5J8OA 1HK6A 1KBGL 3ALPA 1TZIB 3N1QC 2P5WD 5DD0L 1R3LB 2EH7L 5CSZA 3H0TA 4ZFOA 1YEFH 4WFHE 3NPSB 3O11B 1HHHB 1U3JA 1SQ2N 3SPVB 3X3FH 1A1MA 4R4FH 4P49A 7CGTA 3BZEB 3Q0HA 5DRNA 4FFVC 1DQLH 1WSST 1P9MA 5HHXL 1H3TA 4PP2A 4WI4A 3TJHC 3ARWA 4F3FB 3N85L 4LGPB 2W60B 2NZIA 4TOYH 1JMXA 4GRWH 3DGGA 4F58H 4KDTA 4Z7WB 4MA7H 5FKPA 5ICZB 4MJ6A 3PL6D 3V0VB 1QOKA 5IW6A 1D9KD 1FN4A 3H3BC 1F42A 2HFFA 3ELAT 3MV9B 3GB7A 4BH7B 4ETQB 1U8QB 3S36X 5CJXC 1NFDB 3DX8A 3S97C 2GTZA 3GO1H 5CIPA 4K3DL 1FL3A 4Z7UE 1S7QB 4HULB 2XZCH 4YHZH 32C2B 4HFUL 4P2OC 3MR9B 3WXVH 4WU7A 1I3VA 4OKVA 2CLZB 3AS2A 1IAOB 4O5LH 4UIMA 4G9FB 5C0AE 3ROLA 2WBJB 5I1EH 1GHFL 1MH5B 4MYWB 3BESR 2ZUQB 4NWTH 1N8ZA 4XNYH 1EBPA 5IB3A 5JUEL 1IBGL 1UG9A 3L5XL 2BSED 1NFIA 4JRYD 4YZFF 5JW5A 4D0DA 4H1LG 2BY3A 4NQCA 4UUJB 3BEVB 4JFPB 4XRCA 2NW3B 1HH9A 1IGTA 4UAOC 5F8QC 2IMNA 3G04B 1QEWA 1RULL 4KKNA 2VN7A 2QR0A 1G1YA 5GRVL 1XIWB 3CFKB 1AY1L 2AXGA 3QNZB 4MQ7B 4P46A 4PRNA 5L6YH 3OJ2C 4U7MA 1WITA 4HK0B 5KW9L 3OV6A 3BKCL 4H8WC 3MRPB 5GGQH 1RPQA 1Q94A 3BRGC 3QIWC 3CDGB 4XZUA 1YDPB 2MCG1 3DROA 5DEGA 3VXRE 4IHOA 2I9TB 5DFWH 5DJDB 3OAZK 1CF8H 2UUDH 1RZIA 5EBMA 3E8UH 3EYUH 4X4ME 5T1LB 4LVHC 4DGVH 25C8L 1HH6A 5DDHB 1EZVY 3RPIA 2X10A 4HLZH 1TNNA 4ZSOE 2KBGA 2FRGP 2VC2H 4CVUA 4KKBD 1RZ8B 4KQ3H 3FFDA 4KKLC 3WFEL 3ZO0A 3UYOD 1MOEA 1NGQL 5FYLD 12E8H 5EU4A 5FO7B 3LPGA 3MJ9L 1JNLH 2PUQT 4K07A 4ZPTB 4MAUH 1F00I 5D9SB 4J6RH 5IB5B 3WL9A 1QBAA 2EDKA 4UILL 1GYAA 5GRZA 2Y23A 5MENE 5LCVL 4KROD 3QXUA 5HDOA 5C0CB 4NQED 1Z3GH 5FCUH 1RU9H 4NO5A 1BVLA 1AXTL 1G1CA 5D1ZA 3CFJA 3WKNA 4I3GA 4KHTL 1HHGB 4OIAA 1CGWA 3OHXB 4EEEA 5I1LB 1UCBL 2B5IC 3MA7A 1M6OB 4I3SH 1VFBB 3QEGH 3OKMB 3UTPE 2E27L 4YHIA 1A02N 2R2BA 2HWZL 4PJGE 2VLJA 1CL7L 5JR1H 2IPUG 2DQHH 1CGYA 4YDJB 3ZTNH 1NMCB 2F19H 4R7DA 4ZXBB 3VXME 1V3JA 4W70A 1MPAH 1P7QD 3MLPA 2GQHA 1KOAA 5D2LA 5KANG 3EDEA 3BZ4B 5J6HA 2AQ3A 3EO1A 4HUKB 1JPFB 2EDNA 3IFLL 2EZ0D 2VWEC 1ED3B 2DM4A 1A6AB 4KI5D 3RY5A 3MV8B 3TIEB 1YY9D 4PRID 2HRLA 4YUEL 5DJ6B 5DHYA 3PP3H 1IGMH 3PQYE 2I5YH 3C8HA 3JVGA 2VZOA 4Q6YA 5JW4N 1QSEB 3TO4B 4FABH 3VFRB 3VXRA 3DXAE 4ODTL 4WWKD 5HVGB 4YXKH 3REVB 4HBCH 3O4OB 1A7PH 1SYSA 2GK0B 1D5BB 1AFVH 2VH5L 3LRSB 4HUWA 4X4MA 3MLZL 2FBOJ 4IDJL 3VI4F 1X5FA 3BP4B 1M05A 2GW5A 2R4SL 2H32A 3MV7A 1TLKA 4U49A 5F7MC 3DV6A 2DIAA 4RX4A 4Z7OF 3O6LL 2G60H 5HI5D 1INDH 2F58L 4MHHG 1REIA 2HH0H 3VXTB 4G7YH 4XCYB 1RUMH 3L3IA 1PW3A 2W0PA 1CIDA 1V7MH 1KJ3H 2JELH 3GMNB 3NH7L 1FPTL 2ARJQ 3K8LA 4QRUB 4OQTA 3MNVB 2Y25A 1JJUA 3RI5K 5MENA 1H9VA 5I30L 4X0KB 4FQLH 4HKXA 2UV3A 5FF6B 4JJHA 3DVIA 1MWAL 1OT2A 3LN5A 1N0XL 5DUMH 1U8MA 5CSZB 1YY8A 4Z7WF 3GJEB 4HD9A 1CE1H 5I66A 3V52L 2YMXL 2DQDL 5I16A 1JYVA 1P1ZB 2HKFL 1A1MB 4OV5A 1ERNA 1NFDF 4LFHG 3VWKB 5IT2L 4M7JH 4HPOL 1JNNH 3ZE0F 4DJMA 3BN9D 1B88A 2C1PA 4KWUA 4PP2B 5DVLA 5C0BE 5BW7A 2H9GA 2WBKA 3OJDB 5FYKL 1QFPA 1IEBA 4PJ5D 5FKPB 1A0QL 1OQXA 2MWCA 5KN5B 1F58H 5IW6B 2HFFB 3GB7B 2WZPD 5IB2A 2MKLC 1RUAH 1ZOXA 2ADJA 1LD9B 1Q0XL 1RVFL 4I18A 2NNAA 5I73B 5CIPB 4HUXA 3I3BA 1B2WH 4A6YA 3PV6A 3ZKXB 3U2SA 4D94A 3CZJA 1YQ2A 1PY9A 5J1SC 5C7XH 4XX1E 1OP9A 2BVUA 5LAXA 4AIZB 4RGOH 3N9GL 1MCCA 3W0WE 4YH6A 1BFVL 1QRNB 1RZKC 3ROLB 4G3YH 3DXAA 1YEHH 5C0EB 1LE9B 1PGRB 2V7NB 1PZ5A 4XBPB 1CGTA 4LSSL 4OCLC 2BVOB 4L3CB 3LZFL 2JJWA 3WV0A 4NNYA 1N8ZB 3S3SA 5IB3B 4HDIB 4LVNC 1NFIB 3RP1A 4OGYH 5T5NF 5JW5B 4X4XB 3NN8B 4D0DB 2VQTA 4NQCB 4XRCB 5EOTA 1JF1A 1ZLWK 1HH9B 1IGTB 2F74A 3DURA 4TQEH 3E2HB 1QEWB 5GGVL 4J2XA 2Y06L 2CLVA 1YYLL 2NY2C 4MXWH 4Y19B 2FJGA 5EOCH 1MCWW 5FOBA 5K9JH 5EO1A 3QRGL 4IDLA 4Y1AE 3A6CL 2OXGA 1CFQB 4PLKD 4OCXL 3V4PH 2XTJC 3V6OC 4L4TE 2NXZB 5E95B 5DMIL 1H15A 3OR6A 4XZUB 2EDBA 4RMSA 5SWSD 1PFCA 5DEGB 3MRQB 4IHOB 5F88B 3GBNH 2DS4A 3DUSA 2GAZA 5EBMB 2LTQB 2VLRE 3MXWH 5HY9A 4JM2A 5FYJL 1C1EL 4GG6E 1HH6B 5F9OH 1MEXL 3VFSA 3LEVH 3QNYA 5FA3A 3BO8A 4DVRL 1RUQH 2VISA 3MLXL 2VDKL 2YXFA 3FFDB 4JPKH 4JR9H 4PG2C 3OF6D 1QA9A 2DDQH 4DAGH 4NKDA 3BEWB 2R9HD 4D9RD 3RZCB 3I75A 1MCOH 2G5BB 1BD2E 1FG2B 4K94L 4ONGL 1OAQL 3FMGH 2OR9L 1JNHB 3WL9B 1EFXA 2O5XL 5K9QI 3ZSSA 4Z7UB 1HCVA 2XT1B 1UM4L 1U42A 4DN3H 1TCMA 4LLWA 3WN5B 1YMHB 3DIFA 1UB6B 1EBAA 3L9RA 2IBGA 4Y4FC 5D1ZB 4F37K 4HS3B 3MXVL 4NKOA 1MI5D 2AXFA 2HFTA 4P4RA 3RZWA 4UTBH 4CL7A 5DS8A 2FEEI 5C0AB 1VEOA 3CD4A 1OSZB 5IEKA 4JO2L 2R2BB 3QR2A 4HF5L 1YMMD 2CO7B 1S5IL 1MRDL 3GSRA 1ZHKA 2A6DA 3AMLA 3FO0H 1K85A 3RVTC 4IRJD 3LDBB 3MREA 4MXVE 3JUYA 2Y6SC 1NUFA 3RAJH 3RTQC 2OK0H 4OAWB 3QI9D 2A6IB 4OGXH 3I2CL 5E94B 2HMID 1JF5A 1I85A 4OCSH 4ZOBA 3EO1B 4Y16D 4ZO9A 4EDXA 4Q0XH 1IGJA 2DQIH 3T2QA 4QRRA 3AREC 1VFOA 3NVQA 4Y1AA 4N1EA 2C3HA 4L4TA 3B2UD 4PTUA 1YN7A 3QWOA 4FQCL 4XT1C 3FB8A 4R7NB 3HPJA 2OL3A 3W39B 5GPRA 2FX7H 2VDOL 1A4KB 1XR8A 3MOAL 4OF6A 2VLRA 1SYSB 3CDFA 4GBXD 4LPUA 3MJ7B 4HIEB 4W6XB 5KVFL 4QLRA 5DLML 4WEBH 2ZCKH 1YEJL 2WINA 1NMBL 2AQ1A 5GGRY 3TIDA 4ZSOB 3H3KA 5DJXB 2FECI 1C5CH 2J6EL 1E6JH 5LGKA 3GIZH 4JANA 4QYOB 2RQ8A 3D69B 2VITA 2OSLB 3P30H 1WTGT 4K71C 1INEH 1JHKH 3FQRB 4JFFD 4NKMA 5D6DC 1DVFC 3S3JA 4TSBH 2AGJH 4OLUH 1BD2A 2GJ6D 4PJEE 4K8RH 4JHWH 3MZGB 3V5DA 4CJ1A 1N6VA 2VLLA 1WWBX 4MB4A 4NSKB 1C5DA 4HKXB 4LPVA 3FRUA 3U9PL 4M6NL 1FP5A 3LN5B 1ZA3A 4NCC2 1G7MA 3EFDH 1TQBB 2DTSA 2XQYK 5I16B 5INCA 1JGLH 4K2UH 3SHSA 2NY1D 5JXAH 4EI5B 1R3IH 5I76A 2J12B 1RIUH 4OV5B 1E4XH 3QFJD 4FZ8H 2FWOA 5K33A 4GLRI 2HA1A 1JGVL 3O6KH 4OJFH 3DSFL 4PJGB 5BZWB 2ZP0T 1AP2A 5E08L 2A9MH 4K7PL 5CD5C 5DJZA 4P2OA 4BQ9A 4Z0XA 5FAAA 5GS0D 1FNHA 2COQA 4D9QE 3VXMB 1XGRA 4UQ2B 4JGMA 3HE6A 2XRAL 2J4WL 4IOSD 3RDTC 3WXWH 3KLHC 5C0ND 1S5HA 1X5JA 3G6DL 3TH3T 3O9WC 1KXVC 3AUVA 2XA3A 4WW2A 4KRPC 5ICYA 1PG7L 2WK2A 2FLBT 3RGHA 2OTUA 3F6LA 3PGFH 3PV6B 4A6YB 3EOBA 3QNXA 2HT3C 4RMRA 2MKWA 1WCBA 4I5BB 1LO3L 3L3DA 3PQYB 4LKXA 3WNMA 5LAXB 3QIBC 4G6MH 2NY4D 2D31A 3DXAB 3VFMA 4LARH 5DA0B 4QXGL 4RSVA 4HZLA 1BM3H 1J87A 5F96L 1FO0A 1RZKH 1XGYL 4XTRD 5CILL 4OSUL 3C6LD 2FEDD 3HRZA 4NNYB 4XC1L 1ETZA 4XCFH 1LHZA 5EIVA 1FRGH 1UGNA 1L7TL 1C16A 1MHPL 1VENA 1FGNL 5CSGA 2E9BA 3QIWA 4P2QD 1FC1A 4YEFA 1JF1B 4ZG1A 4AEEA 1JWMA 4OCMC 3P73B 4PJEA 2CLVB 1I1FA 1LE5A 2FJGB 4ZDHA 5GRJL 5FOBB 1TDQA 2DM7A 4LQFL 4X6FA 4WGWB 5CP3A 5EO1B 3V0WH 2C7UB 4EUPA 4OCRH 1T5WB 3T0DA 3HZVA 1TVBB 2ICWA 4OIIL 2BVTA 2ERJB 3GHEL 2ZG2A 5GS3A 6CGTA 1KC5L 4OGAC 4KZEL 3OR6B 1DEDA 5B22A 4PV8B 3C5JB 3EJYC 4XNMB 2D0HA 3I6KA 2VTFA 5IIEA 1RJYA 1EEYA 4WFGD 2RB8A 5HY9B 4LIQH 2Q8AH 4Z7UF 1FLRL 1SBSL 4K55A 5TDOA 4C55A 3DOSA 5IVXB 3VFSB 5F89A 2X5PA 5C0BB 3V4UL 5FA3B 3VWJD 1GZPA 1XF4A 1IC4H 4C56E 3U7WL 3CFDB 5HGAA 4JQVC 3NZHL 4U1KA 3FRPA 4D3CL 4FFZL 1T6WA 5MEQB 4CW1A 3WMSA 5FHAH 1OPGH 2HJKB 4S11A 4ZAKA 2PW2B 3EOYG 4LLWB 4HIHB 1L9MA 1HWHB 3ZLQC 5FA4B 1QSZA 5TF1H 5F7FA 4F7CA 4BYHA 2BSTB 4L5FH 5FUZL 3QCTL 2B2XH 4K3HA 5HJ3A 3FN9A 1L9NA 2BY1A 5DS8B 1NKRA 4JY5L 3W0WB 4I4WA 3K2UL 1CFNA 1QLEH 4ZS6D 2XZAL 2A73A 5E2TL 2GSIA 3FN0L 1YNKL 3HUJE 3SEPA 3ZE2E 3HNTH 5JHDE 2N56A 1YUHB 3NMEA 2A6DB 4ZUSB 1I8IB 4PRPE 4KJPC 2PR4L 3M45A 3F8UB 4HIJB 4HUVA 3TM6A 2W1NA 3O2DH 2ZUYA 3FFCE 1QQDB 2VAJA 1SM3H 4MQXD 4MCZA 2H2SD 3RQ3A 3MJGX 4Y89A 4YWGL 1AXSA 1OM3H 4EDXB 3O3UN 4UI2A 4TVPE 5AAWA 1WBZB 5ANME 3U30B 1AR1D 4P23A 2DLFL 1DN0B 2R8SH 1A5FH 4KTEL 1EHLL 5I15H 1ZS8B 3KYOA 2QQQA 1BEYL 1NCNA 4L4TB 3BDYL 4MAYD 5DZLA 3F7QA 5IW3A 3VXOA 5FXCH 2E8ZA 4XB8A 1HXYA 1MQ8A 4HKZA 3HPJB 3N1PC 4NP4H 2E7LC 4M43L 3MLVL 1MFDL 5DJYA 4Q9RL 3QUXB 1FE8H 1XR8B 2GHWB 3M1BB 4KVNL 4HG4K 1CGUA 4IIQC 4V1DD 4M62L 3TWCL 4GG6B 2APWA 5GS2D 4WI2A 3TIDB 4PD4K 4WEUD 1PLGH 3DMMA 4NIKB 1W8NA 4NCC1 1GC1L 4X80L 1KB9K 3H3PH 1AD0A 5DEZA 3T0VA 3UTTA 2X44D 3DI2B 4BQCA 2IAMC 3CMGA 2QSVA 3G6AA 4FZEH 1BD2B 3B8SA 4R96A 4Y4KD 5I1KH 1LEKB 5ELIA 2HTLD 4PGBB 3F12A 3AY4C 2J88L 3V5DB 1BMGA 1HHKB 3BWUC 4G8GE 2VLLB 1QACA 2AXHA 5FHBH 5KOMC 4PJGF 2EDTA 5E8EA 1ZE3C 1A6ZB 1CVSC 4X9IA 5IEHB 5FECB 3CVHA 3HI1B 1CFSA 3WD5H 3ULVE 3HB3D 3QUYA 4NNPH 1DR9A 1G7MB 2GY7B 2YZ1A 4M6MH 1IRAY 1HCFX 1OSPH 3CVIH 2Y1VA 4CN4A 2A83A 5E6ZA 4JPVL 2VAAA 1WZMA 3LOWA 5KOVC 1KCVH 1P4LA 5FOJA 1HE7A 3EYSH 3HUJA 4RGNC 4LCWE 4P9MH 2F53A 5JHDA 5K9QG 2EEBA 3SGDH 1KJ2A 2XXCB 2P5EA 3MNZA 4NM8L 3OKLB 1KTRL 4PRPA 5GRXG 4HGWA 3LB6C 4Z0XB 1J18A 2YR3A 5D1XC 1XGRB 3FFCA 4G8IA 3UJIH 3WIHA 3HE6B 3P11L 3SDAC 1MQKH 4XAKD 4O2CB 4UV7L 1T7XA 2H2PD 4DGIL 4WW2B 5E6IC 2Z35A 2Q20A 4RMUA 5ICYB 3OKDA 1N59A 1M7IA 2BNQE 2VL4A 5IJVA 5E99L 4N8CH 3FB6B 4YFEA 4UINL 2OTUB 4R26L 3UTOA 3O3AB 3MZTA 3TVMD 4XB7A 3WFCH 3QNXB 2JJSC 1B0RA 2Z92B 5JMRA 3QDMD 1ORQA 1I1AB 4P2CG 1F3JB 4LKXB 4EQ3A 4AG4H 2PYFA 2OJZH 4ZUWA 4MMXC 2XG5A 4M5ZL 2ARJB 3U36A 1QFUH 1YQVL 2YPLE 3QXDA 4XBEL 4XP6L 5IVZA 3VH8A 5GS0H 4U1LA 5F3HA 3LD8B 1MJJA 4JCMA 1UA6L 1CK0H 1VFMA 4DWHA 5HD8D 3I02A 1ETZB 4RWYL 1SEBB 1MCBA 5IROA 4YXLL 4MNHB 5C6PB 2ZUUA 3V6OA 4EIZC 2YD9A 4DW2L 4XI5D 5H8DA 2QJDA 2CUIA 3HPLA 1T0PB 4OLXL 3PGDA 1I1FB 1LE5B 4G9FD 4JM4H 2WBJD 2YHGA 4G8GA 1GGCL 4UT7H 3OSKA 1QBLL 2NY3C 4YHNA 3BQUC 1JYWA 3IDJB 5CJ8A 5IVXF 3VFWA 3HZVB 5DHVB 3EDDA 2EDFA 1I9JL 3CNKA 4PTTA 2N7AA 1W0YT 3WSQL 5I0DA 2QSCH 1QRKA 2W9LA 4OB5L 3C2SA 5SV3A 2Q6WB 1BFSA 2I07A 3TZVA 3IDYC 5IIEB 1RJYB 4JKKA 3RGVC 4LCWA 3WEXA 5TDOB 1T0NA 2ADIB 4XH2A 1KCKA 3IDGA 5F89B 4QNPE 4GRLA 4W81A 1A2YB 1Z9MA 1P5VA 2W0FA 3BKJH 5CGMA 4Y4FA 1VGKA 2BOBB 1OP5K 1UXWA 4LPTA 2AJYH 2OR8A 4PUBL 4U1IA 4J3XA 2X1QA 5HGAB 2AERT 2X4OA 2XKUA 1G6RL 1I7RA 4LLDB 3UYRL 4U1KB 4N0CC 5DMJB 1A7QL 1HDMB 1N26A 2VQ1B 2X1OA 2A77H 2ZCHL 3NCYP 4ZAKB 3IXAA 4DQOL 5CP7A 1HIML 1JFQH 1EMTH 4AEIH 5C07E 4EVNB 4WFEE 2WBWB 5T1LD 3L95B 1KELL 2V2XA 4F7CB 1I8MB 4K7FB 2EH8H 5E8DH 3VFOA 4ZUUB 3BVNB 4WUUD 1BOYA 1T2QL 4G6KH 1CFNB 5I1GH 1MRCL 1EVTC 2DI8A 2YPLA 3QQ4A 1RK0B 5KSBA 5ITBL 4Z0BH 5FYKD 1NCWL 3FT2A 5BZDB 5INDB 2AJ3A 3L7EB 3QPXH 1EEQA 4GUPA 3T2PA 3MLSH 4F9LC 1BAFH 1J9CT 3MODH 1KBGH 4MJIE 4I77H 1A6VL 3EYVA 4MCZB 3RKDC 2EDQA 4U3XA 1KJVA 3IRZA 5T5FH 4TSCH 3UPCA 1G9ML 1AXSB 4UV4L 2FBJL 4CBPA 3Q5OA 1IE5A 3O8XC 3GK8L 3ARUA 4P23B 2FCBA 43C9A 5C0GB 4GG6F 3PJSA 1G6VK 1NBYB 3D3VB 1A14H 3GI8H 2D7TL 1XF2A 2RAMA 1A47A 1KCRL 2MQCA 1Z6JT 4UQ3A 1KTKE 1DVFA 4M48H 1XEDA 2YWZA 4YLQT 3PP4L 2RFXA 3GSNB 3QIUC 2EYRA 4XCCL 2L4OA 3LKRA 1IT9L 1JRHH 1P84K 2FHCA 3LKNA 2BHUA 1KPRB 4K3DH 5TE7L 5DFVC 3DMMB 5JZ7C 3MV8D 5J6GB 1JK8A 3QXWA 4Z76B 5IV2A 1QBMH 1YEDA 3LH2H 2FGWH 4C56B 1FHGA 2P8LA 4RZCA 4HUMB 3G6AB 3RJQB 1G9NL 4R96B 5SV4A 1QSED 3UZVB 4LHUD 3TO4D 2BNUA 4EI6B 4KJYA 2IPUK 3MO1A 1NJ9B 5E8EB 1LO4H 2CRIA 1AI1L 1NC2A 5C07A 1WZ1H 3Q6GH 1VEPA 1OF2B 4MXVF 1NCCL 3QUYB 4KDWA 5T3ZH 2KDGA 3L5XH 1D7FA 3VW3L 3BXNB 1YEGL 1SY6H 3MFFB 3QUMH 2PXYA 5FYJD 2DWDB 5IG7A 1OAKH 2A6KB 2WUCL 3RDTA 4KY1H 3CXHK 2Y36H 4JO4H 4JKWA 4WW2F 1FFQA 2WWMC 1FNSL 4OZGE 5JHDB 3DRQA 3QG7H 4QWWD 3CFEB 1KJ2B 4PRPB 5GSVB 1J5OH 5CCKL 3QEQB 2HAZA 1F4YH 5D7JD 5E0QA 2GTWA 3FFCB 5LWYH 2P4AB 3VMPA 5IM7A 2P8MB 3KLDA 1T21A 2BC4B 3WUZA 3ULSA 4P2YA 2EXYD 3T09A 4FP8L 3BISA 5T3XE 1F8TH 3UPRA 4ZUVA 5ANMB 1N59B 3TESA 3VWKD 2Z8RA 1ZAGA 4LHQB 2EICA 2MNUA 1JVKA 1NBVL 5HI3D 4Y5YC 2VXVH 5JOPD 3MGOB 1N6QL 4NFDA 3WLWC 3B6SA 3ZYIA 3QXDB 1LWRA 2X1XR 4PLNC 4JFYB 4N9GA 1KN4L 3ILPA 5DGRA 4TVSa 1IGYA 2HT4C 1D9KC 1OAZL 4L3EE 1IQWL 1BX2A 1FFPA 2PTTB 2BDNL 5DJAA 3NIFE 4S1DC 3QYCA 4PRBA 1P4BH 2IQ9H 3G5ZB 5L0QC 1QFWH 1JMZA 3VXPA 3HPLB 4L8DA 1WWCA 1CI5A 1QRND 5ADOH 5C08A 4G8GB 3ARZA 4YHNB 1PJ9A 1EEUA 2FX9L 5I1CH 3DTXA 3SDDC 3FB5A 3KLSA 5FGBC 1X4XA 4BZYA 4KPHL 1MNUL 3OB0H 4C4KO 1C7SA 3FZUD 3GSNL 4X8JB 4ELKB 5EWIL 2BX5A 2Y5EA 3U9UA 3TYFA 4H1LH 2I07B 2NY0C 3TZVB 3OGOE 3SE4C 4UB0L 3PDOA 1I1RA 4G6FB 4S1SL 5D7IE 4LLVA 3GSUA 1IGFL 4LCWB 1EK3A 3FOMB 4U2YA 4OZGA 4Y19D 1AGFA 3IDGB 2D7QA 4H0HB 4GRLB 3OPZL 4PB9H 3BOVA 3WHXA 4FQIL 3GNML 1VGKB 4MA8H 1UXWB 1KTLA 4WIQA 4U1IB 1I3RA 4KGJA 1E4JA 1KF9B 5DURD 1I7RB 3S37X 1CVRA 4WFHD 1RI8A 1RZ7L 5DJ2A 5EUOE 2BSRA 1CTNA 4AMKL 2BNQB 2GKIA 2H8PA 3THML 4LBEA 4DZ8A 5HPOA 3RIAK 1WZLA 1ADQA 3OXRA 5B38A 2V2XB 4B53A 4YHYC 1TJGL 4J4PA 2EEDA 1OGTA 3ZL4L 1UFUA 3QDJA 4LKCA 1KJ2L 1L6ZA 1CDJA 3O6LH 5A2FA 1DZBA 4G7VH 4XPTH 1SYVA 3RZCD 4LEOB 1NGZB 4JPIB 2AJ3B 1BQHA 3EZ8A 4NN5B 1KLUA 4N90E 1BWWA 4L3EA 4L1HA 4L8SB 3SCMC 4O58L 3IJHA 3EYVB 1MWAH 4KROC 1CFVL 5DC0A 3LN9A 2W9EH 1KJVB 4ORZC 1A1OA 1HILA 3WHE1 2E7LA 1GGBL 2ZCLH 4TUKL 4HV8A 5C0AD 5HGBA 4WWID 4JO3H 4PYHA 2HVKA 4IIQA 3UP1A 3HI5L 1IZKA 3KXFA 2BOCA 1XF2B 1ZLVK 3SGJC 1G9EA 1LDPH 3D5OF 4J8RA 5DC9B 2K9UA 3MOQA 4UQ3B 4P0DA 2IAMA 1KB5B 3JWDC 1HSBA 3BE1L 2WM0A 1I75A 4H88H 5CEZH 5F3BA 2R1WA 5D7IA 3AY4A 3GSXB 3LKRB 4F57H 4HJJH 2W65A 3TBWA 5IK3A 1IKFL 4QXWA 1IQDB 5C0RL 1MCJA 4RAVA 4M1GH 4HQQH 3S5LG 5AWNL 2EZ0C 4F8QA 1YEDB 1WIUA 2UZYB 4R8WH 1URLA 1YY9C 2LVEA 4RZCB 4ESKA 4WNQB 4I0PB 4OFKA 2GFBB 1FVDA 3NBNA 3QCVH 1BFVH 3LSOA 5JA8B 2DLEA 3OX8B 2FSEA 3MO1B 5I17B 4HC1H 4PJ9D 5EOQH 5IMLA 4XP4L 1GGYA 3LZFH 4YDIH 3BP5A 5C07B 4LP4A 3H9HB 3GM0A 2B1HL 1JHLL 1ZEAL 5LKNA 2NX5B 2JB6A 3DARA 3L3OA 5HYFA 1TCRA 2XWJA 1NAML 2DQEH 3B9KA 1SEQL 3DSNA 3SDAA 2MCPL 5IG7B 2DQFA 5F9DC 3HZKA 1OD9A 4PRDA 2IH3A 4LPXA 2GK2A 5C09A 5HI5C 2WP3T 5GGVH 5E6IA 4NZTL 2APBA 5I8OH 2V17H 5E5RB 3RWFA 1MIMH 4C54A 3A6CH 2GTWB 4MJIB 5IQ7L 2CIKA 2CDEA 5D2NC 3U7YL 1HKLL 3AB0B 3O4LE 1MRFH 4U0RC 1R3KA 5GGRA 3CSYA 3VGDA 5ID1A 2G2RA 3FT3B 1FCGA 3P4NA 5JNYB 1UADC 3R8BB 3SOBH 3JV4B 3KLAA 5A40E 3UPRB 4IRZL 5JORA 4HK3J 5GRYA 3TO2A 4ZUVB 4EI5D 3BFOA 2Q1EA 1F4WH 1BHGA 1QHPA 1BFOA 3UTPD 3CK0L 3TCXA 3WS3B 1ZANL 1MEXH 2R23B 2R1XA 3BN9C 5DI8A 5H37H 1B6UA 1M71A 4LGRB 3VXMD 4G42A 1PKOA 5EZOL 2VDML 3B6SB 4WHDA 2B4CL 4HCRH 4XPBL 4ZYKA 3ILPB 1PY4A 3HHRB 4G8FA 4XHJD 1U95B 3SKOB 1S7SA 2PCPA 4OCWH 1MCFA 4M6OL 2OX5A 2AABH 3TBTA 3ULVF 1VCAA 2ENSA 3S88L 4N0YL 3TH2T 3WIIL 4K9EL 1XGUA 1NBQA 3S34H 4ZFZB 3W9DA 3CX2A 4ERSH 3PQYD 1DUYA 3MXVH 4P9HC 2VIRA 2NY6B 5CFHA 5ESVA 1UZ6E 4BFBD 5IUSA 1YN6B 3RGVA 2FJFA 2KH2B 2R15A 4MCYA 5E7FA 3DTXB 1JN6A 3SGEH 1G84A 4J1UA 4RMVA 4UOW0 5AZEL 1QD0A 5JLZA 1KB5L 4PLOB 1J0JA 35C8L 2ATPB 5D96C 4DTGL 4NM4H 2E9IA 3QH3A 4P5TC 5J1AB 1LNUA 1TVHA 3IDXL 5J0BA 3U9UB 3O45B 4WHYH 4APQB 1E28B 4MB3A 2CMRH 3KPSB 1T3FB 1VHPA 2Z31C 3H6JA 4HJGB 4QCIA 4OZGB 5A3ID 1GOFA 1AQDA 4ODVH 3WHXB 4OD3H 3SE9H 3SDYL 4JN1L 5IESL 1KTLB 1T7VA 3O4LA 4CN1A 5JPNB 2DIBA 4FQCH 3ZT5A 4BZ1L 1SJHA 5BS0E 4PLKC 5HVHC 4HHAA 4JQXC 2OZ4L 2R39A 4XP9L 3H42H 3TJEL 1JF6A 1Q9KB 2BSRB 2OQJA 3MOAH 5JO5B 3HZMA 1FVCB 3VG0H 5L2JB 1WBXA 4NPYB 1BVZA 4U1SA 5IBTL 2BY0A 5B38B 1W0VA 2CDGB 4V2BA 3UBXA 5I1DB 4DK3A 1NLDL 5C0BD 3RX5A 1FNGA 4Y8AA 5IOPA 2R69L 4Z5RB 3VFUB 5C6TL 1TZGH 4LKCB 1QNZL 1G7QB 2Z8VC 1CR9H 3WNNA 1SYVB 1J8HB 1EAPB 4JG0L 4L9LB 2FYYA 1BQHB 4DFHA 1J1XL 1FBIH 2R9HC 1I8KB 1RUKL 4TN9A 2R0ZL 4L3EB 4U31A 3RPKA 3BT2L 1OLLA 3ME0A 3IJHB 5IMMA 1A6PA 4P3CL 4G43A 1A1OB 1HILB 5M95B 3BPOB 1A4JA 2ENYA 3ARGC 5CGYD 3WE6B 3SY0A 3W0WD 5HGBB 1GOGA 4KMTL 3GSQA 1W8OA 3D2UB 3LRGA 2HVKB 3QIUA 1PEZA 1XCQA 5I1AA 4QNPF 4ONFH 1ACYL 3RU8H 4JO1L 2QADB 3HRPA 3S4SA 2EO1A 2A0LD 3NFNA 1I4FA 4KZDL 4PY7A 2BK8A 4NN6B 1I3GL 4JFQA 3ARFA 4BFIA 4JAMA 2IF7A 4IRJC 4ZO8A 1VSCA 1HSBB 5T1MB 2WIMA 1J1PL 3LV3B 5F3BB 4DEPB 2R1WB 2AV7A 3MLYH 3RWJB 1D5MA 2V7HA 3BMWA 3CLFL 5D7IB 1DBBL 1EUTA 2HMIC 4M02A 2VXSH 2X4NA 4P5KB 3MLTA 5IK3B 4LLMA 2YSSB 4YX2L 4Y16C 1TJIH 4YE4L 5GHWL 2ADGA 1PG7W 2FB4L 4D9LL 2C4FU 3B83A 5I75B 2DQGL 4AEHH 4MNQE 4JRXE 5BS0A 2H26B 4HXAL 5EU6A 3B2UC 4GW4B 4OLWH 4P2RE 1PDKA 5FB8A 4JRYE 3LSOB 5DK2A 2FSEB 4JFEB 5EUOB 3QUXD 1FL5B 5K9KB 1MFAL 1VKXB 5ACZB 1BZ9A 5CILH 4GRWB 1V3LA 1DLFH 4GBXC 3ARDA 2K7PA 4XC1H 3VRJA 2JB6B 3RBSA 2DYPA 2XWJB 4YNYB 5DFTA 1IC5L 1FGNH 2ICWI 1T04B 2V5YA 1HI6A 1TQCC 2BRRL 2QEJA 3FO1B 2WQRA 4XP5L 2IH3B 3DRTA 1MFBH 4JDZA 5ESQA 5DRXB 5FUCC 3PWNB 4PY8I 3NA9L 3QO1A 3LHPH 2VE6A 4Z7VE 4E41E 3GBLA 2X4SB 2CIKB 2CDEB 4PJAB 4GRMA 1R3KB 3CSYB 5ID1B 2G2RB 3KYKL 4ONHA 3CUPA 3IDUA 3KLAB 5DUBA 2SEBB 1IILE 4MQSB 5IGXH 1AQKL 1DBKH 4LOUD 4JFDD 5JW4M 3PL6A 2NXYB 3E3QC 1BFOB 2XPGB 1CU4H 2VO5A 3WNOA 1IGCH 2NY1C 1V5JA 1FLRH 2UYLA 1BBJB 2DQCL 5SWQB 4GMTH 3WHE0 2R1XB 5EU3B 4BZ2L 1M71B 3ZDXE 1J10A 4LCYA 4XWGL 4NQEE 3O2VH 3REWB 4HH8A 3BAEH 3C60B 4ZYKB 4MA1C 1UB5A 1AJ7L 1CXIA 1GGUA 5CZXD 4JY6A 3HE7B 5C0NC 4I8DA 3BYYA 3MRRA 4QT5A 5LXGL 2F54E 2PCPB 4ODHH 1LO2L 5FGBA 1ZK9A 1XZ0A 3JZ7A 1XGUB 3LQAH 1I1AD 3W9DB 4JRXA 5FUZH 3QCTH 4RFNB 4PJHE 5CMAB 5ICXA 2Y07L 1VEMA 4JRYA 2X7LA 2XY1A 3SE4A 2CLRA 1T2JA 2IPTH 4XGZB 2FJFB 4OZGF 4AM0B 4M7KL 2NY4C 2HYMA 1A7RH 1MJ8L 4YHOL 2R29L 2JJTC 4XTRC 4JFXA 3C6LC 5L7XL 1AE6H 1NCBL 4F7MB 3ISWA 4LRNL 3QH3B 5JPMA 3C09C 4KI5E 2EYSB 5I1JH 4CJ0A 3IU4H 1BBDH 3LKOB 4PRIE 4R4NC 1B9ZA 2CH8A 1MY5A 1EERB 4H5SB 2YC1A 2P44B 1X3DA 4YWGH 4OUUA 3PGCB 1YEFL 4AQ1B 5J11C 4NFCA 2EE9A 3W9EB 4X6CA 2X9WA 1BREA 5AAMA 1AQDB 1VFAB 2O5ZH 5KAQG 3X3FL 3T0BA 3MV11 4R4FL 4F8TA 4Z7VA 1G0XA 2XWBA 1B6DA 4C83A 3MYJA 1DQLL 3O4LB 1HSAB 3BDYH 5CEXA 1SJHB 3MX0A 3UJTH 4TOYL 4HHAB 1ITCA 4F58L 1MFDH 1I7ZA 4MA7L 2H6PA 1QVOB 4RIRB 2BZDA 2CK0H 3PABA 5E5UB 1OT1A 5FK9A 5C86A 1E4WH 1EJ6A 3E6FB 1WBXB 3IDMA 4U1SB 3MRDB 4M62H 3UBXB 3VD5A 5BV7C 3NIFF 1KLGA 4GS7B 1FNGB 3RL1A 4F33B 4D9QD 2XZCL 1OCWH 1ZT4A 4X7DC 4YHZL 1JCKA 5HHQB 4NQEA 3WXVL 4AK1A 3VWJC 3HC4H 1I9IH 3IFNH 3P9WB 4O5LL 4R9HA 4PJDE 4QF1B 3AS1A 3VD3A 4OZFA 4U7KA 3BUYB 5I1EL 3QO0A 1KXQE 2ICEA 5HI4D 3BIAX 3W2DH 4MD5A 5K9OA 3BP6A 3M8OL 4G43B 3L3HA 4NWTL 4XNYL 4D0BA 5ALCH 3QG6A 5BVJB 4MZ3A 2EKJA 3P9LA 3LKPA 3SBWA 3SY0B 4QHKJ 5CINH 1IKNA 4Z18A 1OP3K 1P7QA 5D7IF 5J3HC 1N7MH 1XCQB 5DK0A 4ZS6C 4XX1G 5K59E 1JGDA 3D0LA 5BOPA 1Q9WB 2QHLA 3NFNB 1I4FB 4NM8H 4PGDA 4PY7B 4F9PA 1U2CA 5D1QD 5L6YL 3ARFB 4LLQB 4BFIB 4PRIA 4WI9A 3G5XA 5GGQL 4IS6B 1CGVA 2H3NA 1T4KA 1D5MB 1GPOH 1YNTB 2V7HB 1OQOA 5E2JA 5EUOF 4MQTB 2H2SC 4ZOAA 2X4NB 3GHBH 5IQ9B 4OD2A 3OL2A 3CFBB 3OJVC 3HAEA 3LEXA 4KK9C 4WWKA 5I2IA 5E99H 4UT9H 1NGXA 2ADGB 4UINH 3E8UL 4R26H 1AR1C 3D3VD 3NZ8B 3L5WA 4TNWF 3UEZA 3DX6A 4WI5A 4DGVL 4DOHE 3L1OH 2DF3A 1CD8A 2RR3A 3ZYZA 5BS0B 5AD0A 3IXTA 2VC2L 4KQ3L 5DK2B 5FDWA 4MX7B 12E8L 1JWSA 1CD0A 3QUZB 3CU7A 4QRTB 2Y7QB 4WTZA 5H2BA 4N0FA 4PJIA 3MLRH 4MAUL 5C0FA 4J6RL 3ARDB 1EHXA 3CXDL 2DYPB 3T3PE 4PJAF 5EZIH 4YXLH 3UTQA 4AH2A 4K3JH 4NJAH 5D2NA 4WO4B 4HXBH 5FCUL 1Z3GL 4C56D 1RU9L 1FZKA 3ARSA 3HN3A 3TV3H 1YC8A 1T03L 4MDJB 2VDRH 2X4PA 4PJDA 1PEWA 4HSQA 1KT2A 1FSKC 4Y4KC 4PGCB 2VE6B 2HTLC 5LGHH 5H35A 3IAGC 4I3SL 3QEGL 3QA3B 4L4VE 1NDMA 1FDLH 2F9BT 4LVEA 3QUYD 5DQ9A 1ULVA 1JGUH 4FFWD 2B1AH 3F5WA 2DQHL 5JR1L 2R0KH 3ZTNL 1YA5A 4ONHB 2GCYA 2NYYC 2ZOLB 3HB3C 4V2CB 1NSNH 1RIHH 4YBQD 4PJ5A 1MPAL 1T1YA 4ZNEA 3PL6B 3U4EB 1S3KH 4D9RE 5IWLC 1NUNB 2A2QT 1K4DB 1AGCB 5JOFB 1T89C 4PRPD 4ZUTB 1IAIL 1XGPA 5IFHL 4R0LC 3WIFB 3QEQD 2BVPA 2VYRE 3S35H 3F7VB 2VL5A 5EIIB 2NY5C 1LEIA 2X89D 1U8IA 1UB5B 5GRVK 1IGML 1G6RH 2I5YL 4LLYA 4GQPH 5TPWL 1MI5E 1CE6B 1A7QH 2EDOA 4QT5B 1BJ1J 4PRAA 4UNTA 5EU7E 5HHNB 4HBCL 3WBDA 5I71B 2YD3A 1A7PL 1HIMH 1XZ0B 3CLEH 3KPOA 4L1DA 1AFVL 4Y5XA 1YMME 1PKQE 1SHMA 4JRXB 4MNQB 2AQ2A 4P2RB 2AEQH 4JRYB 3EW3B 5IKCA 5KVGH 2JTDA 2G60L 4XVTH 5GQBA 1T1XA 1JZ8A 2HH0L 1ZLSH 1YJDL 1WC7A 4G7YL 3H9SE 1T2XA 1RUML 4GMSH 1HHJA 2J7LA 3HZYA 4I9WE 3FT4B 5C1MB 1V7ML 1KJ3L 2JELL 3FQUB 4X9HA 3UZQA 4N8PA 2APFA 5HD8C 1I9RH 4AIOA 5E8NB 4O00A 4CU7A 3BDBA 3DYOA 4YHPA 4U7SA 4FXKA 2YC1B 5DUML 5J57B 1J86A 1IC7H 4OUUB 3HLAA 5DQJB 4K7PY 4QRPE 1CE1L 4XI5C 5A2LH 1UWGH 5SWSA 4PJBA 4G8GD 1H3WM 1U2HA 3WO4B 5AYUH 1V05A 5DYOA 1IAKA 1X5AA 4QXTB 1T1ZA 2WBJC 4Z7VB 3V7MA 4E41B 3QZWA 4M7JL 2XWBB 3T8XA 1MAJA 1JNNL 5CEXB 3GRWL 3MRJA 1KCRH 1C12A 1ZHBA 3VRIA 4EUPG 2IPKB 1X6LA 4BSVB 3GMPB 3D39E 2H6PB 3TYGL 4X5LA 4ETYA 3L7FA 3PP4H 5FK9B 4N68A 1F58L 4G6FD 4Z7QE 3KPPB 4LCWD 4YBHA 1RUAL 1F3RB 4MGXA 4NT6B 1NMAH 4Z6AT 3AC0A 1FNAA 3QT2A 4NOFA 1II4E 1MCIA 5GRWA 4KGLA 1ZT4B 1MF2H 4HIIA 1XIWC 1UWEH 1B2WL 2ITDB 1OW0C 4NQEB 5DO2D 5GGSB 2ZG1A 3VGHA 3EO0B 4P57A 4PFEA 1MI5A 2HVJB