3U4EB

Crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain cap45
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
212
structure length
212
Chain Sequence
b'SALTQPASVSGSPGQSITISCQGTSNDVGGYESVSWYQQHPGKAPKVVIYDVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEGDYYCKSLTSTRRRVFGTGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V1V2 region of HIV-1 on 1FD6 scaffold
publication title Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 36
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u4eB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u4eB02
4XPGL 2BVYA 4RGMC 3A67H 3TVMB 5HGHB 2VMFA 5IBTL 3X11A 4P3CH 1UGNA 2FIRT 3JWDC 4P2RD 1R5IA 5B22A 1R3KA 3KPLB 5F3HB 1G7PB 5T1MB 3GB7B 3HC3L 3HMWH 3NH7L 4HH8A 1ZS8B 2P5WA 1QO3B 2PUQT 1DLHB 1MJJB 3QDGD 4X0KB 1ITBB 3MMEB 2GJZB 3EGSB 4JM2A 2GUOB 2F53E 2PR4H 5DF0A 5L8KB 5ACZB 2G9HB 5J6GA 3VH8A 5HI4D 3RZCD 2BSTA 3BFOA 2YUXA 1Q9OB 1CVRA 5EUOE 1L7IH 1YQVH 5MHSD 1A2YB 4AENB 4P2OD 1H3UA 4JHAH 5CBAB 4KQ4L 2AEWA 1RUQH 1TENA 1PLGL 4LARH 5DHVH 3VXMA 4YX2H 1IAOA 2F15A 3UTZA 3QJFA 3MV8A 4MQXD 4Y5XA 4R96B 3GMLA 2C4FT 3ARZA 4I13B 4G7VL 1A6UL 3CH1A 4LCYB 3ALWA 5F9WC 1UADC 4LCUB 3FFDA 1UM5L 4RFEA 3FB5B 5GGTH 3QEHA 2VH5L 1S7XB 2V2WB 4OZ4A 4M62L 4YR6A 1U42A 2Y25A 3FFCA 1QRNB 1P1ZB 3S7GA 3UROR 5EN2B 2GY7B 2BRRL 3TA3C 4EN3C 1IGFL 2IPKB 3H7BA 1U92B 1AQDA 5JW4M 5FHAL 4N0RA 1UB6A 4NFBA 15C8L 5D7KD 1NMAL 4PRHD 1DL7H 1M7XA 4QWWD 4R4BA 3FT2A 3AUVA 4GJTB 4LQFH 1IGCL 1KIPB 4L8CA 4WFEE 4X98B 1CXHA 1I8MB 5AZEH 1K3ZA 1QLFA 4KY1L 5FM8A 3PWPB 4APQC 5LG1A 1N4XH 3IDMA 1T7VA 3ZE0F 1MAKA 2G2RA 3DIFB 2ESVB 4PJCF 2LABA 2DYPA 4X8JA 4HPYH 3H7LA 5I71B 3OKOA 4QTHB 4XC1L 2KZWA 3KG5A 4TNWK 5ILTH 1XIWC 1HI6B 5IKCB 3UP1A 4LKCB 4M4RA 5HHOB 2NNAA 5E03A 4D0BA 2NY6C 4R97C 5JR1H 4PR5B 4IRSA 1E6OH 3MRGB 4QHMB 4Y5VC 3K2UH 1S8DA 5I1KH 4HKJA 3GKZA 1OTTD 2BZDA 4FP8L 5JHDE 4R7DA 2CLVA 5DZLA 2EXYC 4ZFFB 3K4DA 4U1JB 4X7DC 2ZG1A 5GRJH 1SJXA 4ODSL 5D8JH 3VG9B 3I3BA 5E2TH 2Z4QA 4P9HC 3CJJA 3U9UA 4TTDC 1A1MA 2XWBA 2V7NA 5CAYB 3RIAF 1BGXL 2A83B 4N5ED 1R3JB 2NW3B 5DD3L 4DGIL 5HVHB 4JHBA 5LVEA 1CFQA 2ADJB 3BZFB 3JUZA 1TZGL 2DBJA 3TZVC 4U1MA 5IR1B 4QHUA 1IQWL 1MNUL 3HR5A 4AYFA 4WUUD 3L6FB 2PTTA 2NY0C 5IFHH 3U36B 4NUJB 1NGZA 3NCEB 3PV6A 3D5OF 3KXFE 4ZO7A 5A2FA 5TQ2H 3B6SA 3NABL 4WO4C 3EFDH 5GS0D 3FO9A 1CGYA 4K23L 1JZ5A 2D4DA 5MENE 5LXGH 3CIQA 1BQSA 4XWOD 5DK2B 2X1OA 4LCIL 5CJXC 5DXWA 2Y4SA 1NDGA 1X5KA 1FGNH 3VRJB 5F72S 2VQTA 5GS2H 5TE7L 2BOCA 1AGFB 3QR2A 3N1PC 3RWCA 2D0FA 1NH6A 2BSRA 4ONGL 1JYXA 3FB7B 4N90E 3BP5A 4NJAH 1E4KC 4N0CC 5ECJE 1X5JA 1YN7A 3F7YB 2Z31B 1ZEAL 3O11B 4PP1D 3V5KB 1EVUA 2I9TA 4NM4H 5GGVH 3S5LA 1RZ7L 2E3VA 4LEXL 5EB9A 4W81A 1IFHL 3UTTA 5D5MA 3QAZC 1RIUH 2GHWB 4YHIB 1QA9B 3VXPB 4KKBD 3VD5A 4LSQH 1LO3L 2YEZB 1XR8A 3B2VH 5EZLA 5E8EB 3HZVA 3HE7A 3IU3B 4FQXC 5DGQA 1AO7A 3WFCL 1E0OB 1LK3H 1NCCH 5HHVH 4RMWA 3REVA 4NQDA 2Q87A 4OI9A 1T66C 3UJTL 3IAQA 2XTJC 4QXWA 3IFOB 3JBG7 4LPYA 3X3FL 3QCVL 5IIEA 4WEMB 4Z76B 4O02L 3R8QA 3RVXD 2MKLC 4CW1B 1VADA 4LSRL 2BP3A 3MLRL 5FOBA 1P6AB 3Q5TA 5GRXG 1BLNB 2D31A 4NJ9L 1QVOB 3MLUL 3O3BA 4UNTA 1J05B 5T3ZE 3T3MF 1U8PA 5IVZA 3D18B 3PP4L 4LIQE 1OAQH 1VFAA 5D72H 5DHVB 4Y4HB 4FZ8L 1FYTA 1ORQA 2F53B 2H26A 1ETZA 1FNSL 3KYMB 3S35X 4UUJA 1ZA6A 4Z78A 2XPGA 1IVLA 2EE3A 4FRWA 3CK0H 1U8LA 3O3DA 4PGEB 3WO4C 4JY6B 2HJLB 3GGWB 1T7ZA 5EUOB 4LLUA 1FNHA 2YRZA 3RNKB 3SOBH 1Z3GL 5ID1A 4FQHA 4YHPA 4HWBA 3V9FA 2HT3D 3BHBA 1CDYA 5DC4B 5DK0B 5KS9A 1TTFA 4IMLA 5T3ZH 1HINL 2A9NH 5EU6E 3VFWA 4Q6YA 3H42L 5A3ID 5DJ0B 4JFDE 5E8PA 3QP3A 1JWSB 4Z7WE 4YHYC 1F4WH 4PJDA 1OSZA 5H37H 3IDGB 1VFBA 2E6QA 1IGMH 2EZ0C 4FXGA 3LEVL 3LN9A 4JVWA 2B1HH 1Z2KA 1EJOH 2XQYG 5DT1H 5EA0H 4V2BA 1AXIB 3LDBB 4IIQB 3ZMRA 5CFHA 1CIUA 3WLBB 5ANME 5D93C 3MJ8A 4J4PD 4GXUN 3K8LA 1XFPA 1NC2B 1E4XL 4U1NB 1BOYA 1OPGL 3W2DH 3QNXA 4KI5F 2NCMA 4PJIF 4XNUL 3E2HB 4QRUB 4PTUA 4HJ0C 2A9MH 2XN9B 5JW4Q 1T7YA 4RA0C 4KAQH 3EYQC 3SDYL 4MJ5B 4IS6B 1TQCB 1CFNA 1RULH 43C9B 5E08H 1JHLL 3T65B 3OKLB 3QO1B 5FO9A 3W9DB 3LS5H 3P77A 5GGRB 1MCFA 2QJDA 3SQOH 5JOPE 1S5IH 4OUUA 3B5TA 5EO1A 4PB9L 3NCCB 1JF6A 4WWKC 4XMLL 4FXLA 3G6DL 5T1LD 5I1JL 1HQRB 3N50A 4KJYB 3IS1X 5KJRH 1X7QB 3ZTNH 4L8SC 4BA8A 4XVUD 2VDKH 1FBIH 2APVA 3KPTA 2MPAH 2FJFB 3GSWB 4QGTA 4WFHE 1N8ZB 2ADIA 4OFYD 4OZFH 3PNWA 1UWEL 2FGZA 1WZLA 2NMSA 4MA8L 3ULVE 1A8JH 5IW1B 5J13C 1MCIA 3GK8L 5D7LE 4OD3L 1BJMA 4B0MM 5C0CD 4D0CB 4Z0XA 4WV1C 4YHOH 2ZWLT 1KLUA 2BCKB 2PYFB 4KK5D 4ZAKA 1HHJB 4G8GB 3GSQA 2BXZA 1S3KH 2E8ZA 2I27N 3TN0C 3GKWL 3BPCB 4MJ6B 4YGVA 5TJWK 3L9RB 3EO0B 1MCJA 4K94C 4XI5D 4LASH 4YIQA 4K2UH 5L6YH 3VRLF 4TTGA 3QQNA 1FORL 5EBMA 1KTLB 1WV7T 1J8HB 2OJEA 3S88L 3QUKB 4LLMA 4S1RH 3KPQA 2CLRB 4WVRA 3ZDZF 1DUYB 3KXFB 4C56E 4QY8B 1KCRL 2A6KA 2NX5E 3ULSB 1X4XA 3CFEB 4UT9H 3VXUB 3SN6N 5MENB 1INEL 2GITB 3AXLB 3LY6A 1WTLA 4R9HA 2ZUQC 1CL7H 4KKLD 3JV6B 5E99H 1A3LH 3RUGA 1R24B 1FL5A 3UTOA 5FGBC 3HZKA 4I18B 4ELKB 3QJHA 4HK3J 4PYHA 3ROLB 4H25A 1ZHKB 3CMOH 1V3LA 1UQSB 4KWUA 5AYUL 5ESQA 4DGYH 3RWDB 1YJDH 3C9NB 3LSOA 4GS7C 3KVQA 3WNOA 3CVHA 3B8YA 1GAFL 5DJCA 5DHYB 3QWQB 4S1SL 1S7UA 5DMGD 3UO1H 1NFDF 1MHHA 2EYSA 4Z7NF 2ICEA 4QF1B 1P4BH 5EORH 2Q8BL 3SY0A 5E9DD 3HCVB 3SDCB 3MNVB 4I3SL 4WHDA 2VLJE 1TCRB 4L1DA 4URTB 4OI8A 3F5WA 1G7HB 3BPLB 4JY5L 2WK2A 2W07A 3N06B 1S7TA 1DEEA 1NUFA 4JM4H 4QLRA 5D7IF 3VCLA 4YH6A 4U6HB 3P4NB 4KTDL 3VXSA 1P2CB 1IQDB 3QFJA 2CJUH 1U3ZA 1BJ1J 1MIMH 3BE1L 3BN9C 1KGCE 4GKSB 5GRYA 4DEPB 3F7VB 2NY2C 3RWGA 3LV3B 2ENSA 1FRGH 4PG2C 2OQJA 3FONA 1RZ8A 3MUZ1 1JNNL 4JGJA 4EBQL 1L0QA 3QHFL 5ADOH 2OYPA 3FO0H 2DLFL 3OGOE 4MAYA 4X5LA 3PWJA 5SWSD 5GZNC 1TETL 1KB5L 2J12B 2NXZD 2HTLD 5K9OB 4NWTH 2BJMH 2X42A 1VGKB 5E4EC 4L9LB 4UU9B 4Y19D 2FR4B 4PLKD 2FWOB 5INCA 4LGPB 3D85D 4ODXB 4NZDA 4Z7WB 1YEFH 1WBZB 3HFMH 3DMMD 3RDTA 4FQIL 4HQQL 1JF1B 1EEYA 1J9CT 1MQKH 3OJMB 4PP2B 4PREB 3HI5L 4HIJB 2B8OT 3C08L 5D1ZA 3T0ED 2JCCE 2BNQA 4X4XA 1FPTH 5MP6L 1KC5H 1OAZH 2Q6WB 4ODVL 1KELH 1R3LA 3QUZD 1IL1B 1JGEA 4UOJA 1EUTA 3GFUA 1YQ2A 5FDWA 1DFBL 3ME0A 1PFCA 3QXTA 3QWRD 3D0LA 2DQJL 2KQMA 5C0GA 1JBJA 3HNTH 5ICZB 2UY6A 4X6BA 1EJ6A 4P23C 3DROB 2F8XC 5DQ9B 4QRPA 4XP4H 2I5YH 3HE6B 4KDTC 3HLAB 4BZYA 3PDDA 3GJEB 4JO3H 3IFNH 2CRYA 2OSLA 3M17B 5BV7H 3WCYA 2HP4A 2PN5A 4F7TA 4NP4H 3SKMA 4YE4H 4WI6A 1FL6B 4OZFB 5JO5A 5F7DA 3IJSA 1IGYA 3MXWH 3IDJA 1A6TA 4WUKH 4EI5B 1RHHB 4OQTH 4FXKB 2QSCH 1G7QA 4IDJH 5DMIH 2F54A 3MYZA 5K93A 2DMBA 1CFVL 3QG6A 1BPVA 4QRTA 4LHUD 4D9RE 4U2ZA 1NL0H 3T08A 2IWGA 1UM6L 3U7WH 4JM2F 1JNJA 2W65B 3INUL 3LQZA 1FNGB 4HIEB 4BH8A 3VWJC 3O2WH 2DDQH 5L2JB 3AFLA 2FX9H 5J7CC 1SY6H 1AP2B 4XPHL 4DVBA 1IKNC 3P30H 4QXGL 5D6CB 3DGGA 1MLCB 1TDQA 3ARUA 2WINA 1NAML 3MV11 4WHTB 5D7LB 5IHZB 5KW9H 3BP6A 3G5YB 4F33A 2XA3A 1Y18A 2VL5B 1U0QA 5EIIA 1UWGL 1I3UA 3QIBB 1ZSDA 1H5BC 2W9LA 1DQLH 4W4NA 3PGFH 2HRPL 3REWB 4MXQD 1I7TA 3ARDA 1NDMB 5HDBE 4HLZH 2Z9TA 1NEZG 1R3HB 5DJYB 3PWUB 2D7MA 1IEBB 1NSNL 2XIDA 5C08E 4U31A 5J11B 4OM0L 4Z8FL 4ZPVA 3U2SA 1KG0A 4JFQB 1AY1H 5ID0A 2AGJL 4D9QD 5AD0A 3MA9H 1L9MA 5I30L 4ZFOA 3LEXB 3OKKA 1A7OL 3IFPB 1OP3H 3L95A 3TBTB 1DCLA 3MA7A 5E8OB 4DW2H 2P8LB 2EDJA 3PHQA 3B9KD 4C56B 1I7UA 3C60D 4M6ML 2NX5B 1QOKA 4OIBA 3ZL4H 4I1NB 3VD9A 4KZDL 4YBQD 3QUMH 1YNTB 3ZDXF 4NZTH 1Q1JL 4RDQG 4I0PD 5E00A 2O5XL 4R0LA 3D2UD 1CICB 2UZXB 3KS0J 4CBPA 4AIXA 3G6JB 2GJ6D 1UM4H 3AS0A 5KVGH 4R2GB 2OK0L 5EPMA 1KCSL 1KSRA 1QHPA 3WXVH 4ZOCA 3OKEA 1B2WL 2J2ZA 2RFXB 3I6KA 3Q1SH 5DJ8A 1P7QD 3ZKQD 1BBJB 5ESAB 5DO2D 5EO0A 1B0RA 2PKDA 2ZG3A 3N1FC 1RMFL 2N4IA 3I2CH 3MO1B 4MNHA 3BQUC 4ZUSA 1JPSH 1S9YA 4RGNE 5C9KA 1H9VA 3WHE0 4GKZB 4BKLA 2B7DT 1U8QB 5JORA 5KSBE 1RUAL 3R4DA 4V1DA 3W39B 2E7BA 2PETA 2CDFB 3S4SB 2YWZA 5E5MA 4Q9RH 5E6IB 3WEXA 1MRCH 3MJ9L 5FYLD 5CWSA 3UCRA 1XGYL 1HHGB 5DEFA 1T2JA 5IMMA 3X3GL 5CSGA 3OTTA 1EZVX 1F4XH 1I3GL 3DO7A 2DTMH 1U8OA 4M48H 1W0WB 5IF0B 4EVNB 2EE6A 5CP3H 2H2PD 4AL8L 4MJIA 2VDRL 2E7LC 2AABH 1I3RB 2FLBT 4M5YH 1I8IA 5ALBL 3U79A 4BZ2H 1U3HD 2ITCA 4MD0B 3MLVH 4X7FC 2ADFH 4JCMA 1EUUA 4NC1C 2VABA 4PJHF 4RWHA 3T0VA 3ORJA 1A1NA 4PP1C 4TULH 2E5EA 2VUOA 1K85A 1BD2D 3VDBA 5GJSL 2IBZX 4DQOH 5JPMB 5BZWA 4NFCA 1BJ1H 1NC4B 1QQDB 3WN5B 1M6OA 1U8MA 3V2AR 4QRQB 1WBYB 1G0XA 3TT3H 3WDJA 2H6PB 1DQDL 3BW9B 4HG4K 2EDXA 5I76B 5FCUL 1D9KD 3G6AA 1CLZH 3NFNB 1NCBL 3SDDD 3GMOB 3SE3C 1YPZA 1R0AH 4ENEC 1OP3K 4POZC 5F93C 2YPVH 3QUYC 1AXSB 3C2AH 3LAFA 2XKUA 4GUPB 4JRXA 3NCFB 5I6XB 3RVXC 3ILQC 2A77H 2CR3A 3OMZA 4Q0XH 2JCCB 2NXYD 1QLEH 3K0WA 5IB4B 1QSFD 1KEML 5H35A 1LDPH 1QLRB 1JPTL 1BP3B 5E2WH 3LKSB 4FQLH 5TF1H 1NGPL 5BV7B 1R3IH 4XP5L 3VGGA 4N9OB 3QRFM 4U6VH 5SWZD 1G7IA 2YPKB 2CUIA 1VESA 4JREB 4L3AA 3TJHD 2E9BA 5D5MF 1P84J 3N1QC 1WQVT 2VXSH 3GIVA 1YYML 3NCMA 4ORGA 1HHKA 4AM0A 2L0DA 2Z35B 5GS1C 5C0EA 1FDLL 3U4EA 2APWA 4XVTH 4JO1L 1E6JL 1LMKA 3RWJB 2HVKB 3ARPA 4PV9B 2P5WD 3O8XD 4JFZH 5K9JH 4PLJD 1UCBL 4O2CB 1N0XL 1QBLL 3FQRA 5IW6B 4MJ2A 3IJHA 1WT5C 4AEIL 4F7EB 1FZMB 1Y6KR 3QCTL 2IPUG 3ULUE 4JM2D 2DQCL 5C2BH 4J4PC 3Q6GL 3TM6A 3IS0X 3VGAC 1A4KA 1FQ9C 4GW4A 3MCKB 1IARB 4OGAC 5IEKB 2KZ1B 4NNPL 2HLAA 1ZTXH 4Q9QL 3NVQA 5L7XH 1J8KA 5EFIB 1MF2L 4G6JH 1GHFL 4XBEL 2FZ3B 4IOIA 4PJAE 4NN5B 4P5TB 4Q9CA 1TVDA 4JFHD 1U8HB 1T3FB 3ULUH 1KCVL 3VXMD 2XNAA 3MV8D 2KKQA 5JPNB 4OF7A 3TO4A 1I1AA 5GHWL 1Q8MA 2EKJA 3IDNA 4X99B 1XCTB 3IFLH 3HC4L 32C2B 4HIIA 4PJDF 4WJ5B 2OZ4L 2VYRE 5FK9A 2JELL 2CO6B 1HQ4B 3HN3A 1ITCA 5C7XH 3FFCD 1A3RH 5TPWH 4OUOA 3M1BB 4JFYB 4G6FD 5D7JC 5L8LB 1J88A 2YBRA 1LO5A 3D1MC 3C2SA 4XXDB 3MUY1 2V9QA 5C08B 3VMPA 1PYWA 3QUMB 4NNYA 5F21B 4IRZL 4LVOB 1DQJB 2OI9B 3UZEA 2ZUUA 3B3IB 1WFNA 3CFKB 3V4VH 1ZOXA 4KVNL 3A67L 5CGMA 1T83A 5H2BB 1P7KA 5HYJE 3VDCA 3BPOB 3SHSA 5E1AB 2DI8A 3CX5J 3OHXA 4XAWL 3T77B 3VWKC 1NGXA 3LPFA 2YZ1A 4ESKA 3E1F1 5HGDB 3MLWH 1PBYA 3CGTA 5EOQL 4S1DD 3TIDA 4KK5C 4CMMA 4PFEA 4OCSH 2DYPD 4W68A 3N0PB 1J0KA 3R8BB 2GAZA 1TVBA 1NUNB 4RRPG 1WCBB 1ZHNB 4EUPH 3GO1L 2GFBB 4WTXA 1XF5A 4QRRA 2NY1B 1NMCC 1JGUH 3QHZL 1L6ZA 4W6WB 4PG9A 4HWZB 1PKQE 4IRSD 3N9GL 3GSNB 2VDNL 3T8XB 3TPUB 1EHNA 3AU1A 1X5GA 3O9WA 4RGNB 4NQVB 4MDJB 4WHCA 4PJFA 1K8DA 3M07A 1C5DB 5DJ2B 5C0AE 5KSBB 1DTUA 5I2IB 2JJVA 4KMQA 3QCUL 3HUJF 4PJ8C 3TWCH 4O2EB 4OI7A 4GRLB 4M5ZH 4P9ML 2EDHA 3RVUC 3FQUB 1J10A 5EOTA 3R06B 1PKOA 1EFXB 4LVNB 4WU5B 1ZHBA 2GSIB 4K9EL 3LKRB 4M93C 1RK1B 5FYKH 1XF2A 5E94A 3WFBH 3TLRA 3AAZA 3KPNB 4TQEH 2NTSP 3U0TA 5T1KA 5KSAA 2GCYB 2QSTA 4PY8I 4UT6L 2EDTA 2V6HA 4CDHA 3P0YL 2OJZL 5JDSA 1NFIB 3F58L 1JK8A 2NR6C 4PRIE 3TVMA 4NCC2 3RVTC 2YWYA 2VZOA 4NZRH 4UTAH 1Q0YH 4JHWH 5HVFB 1D5BA 1GIGL 1LO0H 5F3HA 3CXHJ 5T1MA 1CF8H 2LQRA 1J0JA 3K46A 5FO8B 1QO3A 5KBNC 1DLHA 2FH8A 3P0VH 2UVFA 4HV8A 1MJJA 5BS0A 4X0KA 2GJZA 1FIGL 2O5ZL 4YO0A 5DFWH 2GUOA 4OCYH 5F6IB 2Y7QB 5CCKL 4Y2DB 5ACZA 5KSVA 2G9HA 2R29H 4LLVB 2DIJA 1A3QA 3RUGF 2A1WH 4QHLA 4HAGA 5C0BA 1GJIA 1CZ8L 4MZ2A 1GZPB 2I60L 5CBAA 3MV9E 4F58H 1I85A 5ENWB 4FN0A 1JHTB 3U7AA 4X5WA 1FL3B 1CDHA 2YD2A 5I1GL 5F7YC 2VJXA 1XR9A 3RX8A 4R96A 3UTTD 4JB9L 5I1DA 2ED7A 1BAFL 3NCYP 3WS6A 4LCYA 4OGXL 2A38A 1U9KA 3I9GL 4JJHA 3FB5A 2GY5A 3V6ZB 2V2WA 2DWEB 3HE7D 3HTLX 5FO7B 5IROC 4ERSH 3VXQB 4D3CH 5EN2A 3HC0B 4YBLB 5C07E 2NYYC 3GI8H 2VSCA 2FGWL 5BVJA 4XB7A 3ISWA 1U92A 3MJ7B 2PO6B 1J86A 4WW2C 3T0EC 1MHPL 3BT2L 1RUMH 3GSVA 5MEPB 1L7TL 4NQEA 5C0FB 4WWID 3QUZC 5AZ2L 2E27L 3U46A 3SE9H 1I8MA 1FYTD 3U7YH 1Y0LB 3NACL 4JPVL 1N64H 2ESVA 4M4PA 5IUSA 4K71B 4FQ1L 2ATKA 5FV1L 4AMKH 3OJDA 3UTQB 4FQCL 3SE8H 3OXRA 3MLSH 3TBVA 1NLBL 3E8UH 4OJFH 3TC9A 1K4DB 5IKCA 4LKCA 4QTIH 2XKNB 4UDTA 5I17A 5HHOA 2MCG1 3U9PH 3WNMA 2Y06H 3ECBB 3HAEB 1OOAA 2O5YH 3O41B 2P49B 4PBXA 2H32H 4PR5A 5B8CA 4H1LH 3QUXD 5I8CB 3BD4A 3MRGA 4JN2A 1GGIH 2AK1H 5DJ6B 2YKLH 3X14A 4OF8A 3LHPH 3U4BH 3SCMA 5IK3B 4ZFFA 4JZOA 2B0SL 4K3GA 1C7SA 4WRLA 4U1JA 4IJ3B 4YNYB 5F7MC 4PJ9B 4HIHA 2X44D 3W11D 2QQLL 5DD0L 3WJLA 3S96B 4KMLB 1HEZB 2AK4B 5DD5H 4UIKH 4OLYL 4Y7MA 3MFFB 1F90H 5FYJL 3MBXH 4HUVA 4EUPB 2WQRA 3VFOB 1NGYA 1R3JA 3DX8B 4LCCA 2NW3A 2N1KA 2H8PB 1T1WB 1N5AA 3BZFA 1V7MH 1E28B 1BF2A 4HS8H 4XPTL 5L0QC 1X44A 3AM8A 3KWWA 3RJDA 3OG4B 3K1DA 2BY2A 1P7HL 2BVPB 1UXSB 3G5ZA 4NUJA 3U36A 1PEWA 1EEZB 3WHXB 2FB4L 2HLFD 1N5YL 3HNSH 3MROB 1NUGA 2VXUL 1INQB 5C6TL 4PJBF 4XPAL 1P84K 4PGBB 3IDXH 3LS4H 1QEWB 4IRJB 4KI5E 3VRJA 1R5WB 3IXTB 4RMVA 3MPCA 3CSGA 3ARSA 3L5WA 4HD9A 3HHRB 2CD0A 5BXFA 4JJ5B 3B9KC 3HNVL 3BVNB 3JWDH 3QG7L 3LH2L 2FEDD 3BSZL 1A6VH 4UNUA 3F7YA 3O11A 5EZOL 5DR5L 3C5ZD 4BM7A 3Q2CA 4ZAKD 4UT7H 5EOCJ 3OB8A 3JXAA 1VCAA 2XTLA 5IFJB 4KRPB 1KJVB 3VFMA 2W60A 4Q74A 2DQUH 1QA9A 4YHIA 4OV5B 4HC1H 1I9RH 1B88A 5E8EA 3IU3A 4A2MA 1NCTA 3QIUD 5DO2C 3BKMH 1K8IB 1TITA 1RUKL 1MEXL 4U1KA 1C16A 3TV3L 1ZHLB 3MLTB 3NZHL 2VZUA 3SKJH 2ZCLH 4Z76A 5DD1H 2R2HB 3P4MB 1AQKH 2IAMB 1CBVH 3O6FB 3BO8B 4LOUC 4NRYA 1J05A 1RZGB 5H37G 4OCXH 5EC1B 2IG2H 2CSPA 3IDYC 3QBTB 4XMPH 5DHVA 2K1MA 3EOBA 4Y4HA 2R1YB 5DLMH 5TFSH 5BOZG 4BK4A 2F53A 3SGDH 3GJFK 2IPTL 5HHXL 1D5XB 5JXAH 4NGHH 2HJLA 3NTCL 3GGWA 3RNKA 1QSEB 3ZT6A 4OCRL 1WZ1L 4LVEA 3DVNB 5GGRY 5DK0A 1FE8L 3MV9B 4O4YL 2R4SH 1CFTB 1JPGA 3GM0A 4WDIA 4JPWH 5DJ0A 2RIKA 5GJTH 4LPXA 2C4FU 3CX5K 5HVWA 3IDGA 4JPKH 3OSKA 1S7RA 4QOKA 2AJXL 1FVEB 1FSKB 4HEME 5F88A 2FX7H 5DD6B 2D0HA 4KI1A 4HS3B 4OCWH 4IIQA 3FRPA 4P2QE 4E41B 4Q2ZA 5JQHC 4PJ5E 4NO0B 5EO9A 4G6AD 1D9KC 2ZCHL 1FG9C 4RAUA 2JB5L 3SDDC 1MJUL 2XZAL 3TNNB 1UKTA 1YMHB 5C07B 4U1NA 4L4VE 5IJVB 5F1IA 5ADPL 1SVCP 3VXSD 4MXVF 4QRUA 4YQXL 3QFJD 5CZXD 4RCAA 4FTVA 4S1QH 1YEEL 4PRBB 5DS8B 4HJGB 1JPFA 4X6EB 3C6LC 1HKFA 2DICA 4KK6D 2YD6A 5HD8C 4IS6A 1MI5A 3V8OA 5C8JB 4DTGH 2VISA 3GBNH 3VFTA 4U6XB 43C9A 1AI1L 5EU3B 3OKLA 4N5UA 4RNRB 2VOTA 2ORBL 3W9DA 4BFEA 3BDBA 5GGRA 5JNYB 5I18L 2H32B 4M8QA 4H1LB 3L7FA 4F57L 1QD0A 4ACPA 4MAYD 4P9HH 1CDBA 5JMRA 5T3XH 3MACL 3DX7B 4OGYL 4X9BA 4J6RL 2HVJB 3C8KB 1HQRA 5LGHH 4KMTL 5E6ZA 1CE1H 3AREA 3GSOB 2MCPH 3RDTD 4RGOH 4Z7OE 1Z0MA 4NKOA 3RVVC 1N2RB 2BDNH 4G9DB 2HMID 5D1ZD 2DWDA 2FJFA 3GSWA 4AEHL 1YPZF 4X6CB 2BNUB 2BNQD 1NBZB 2H2SC 2V2XA 1U3YA 4M43H 5JHDA 3VFSA 4AEFA 5HY9B 2WBJA 1IC4L 5GGVY 4PRPB 2JJSA 3MGTB 1MFAL 1DBAH 4U4BA 3PXHA 2J88H 4WY7L 2QQNH 4DKEH 2BCKA 2PYFA 4BFIB 1MUJB 2E9JA 2X4TB 4PPTA 3BH9A 4KZEL 4QRPD 1MY5A 1NJ9B 3L9RA 3QPXH 5INDB 3EO0A 1KPRB 1UA6H 3WD5L 4G8EB 2BHUA 3ARTA 1IC5H 3R0MA 3JZ7A 4Y5XC 1KTLA 3EFFB 1U95B 4P48A 5EU7C 5HHQB 2I9LB 3T1FB 1R6VA 3TJEH 2CLRA 4GFTB 1TQBC 3O2VH 4NBZB 2W0LA 2XTJE 3P11L 4HH9A 4PLNC 1IC7L 4QRSB 4RGMB 2A6JB 1U8JB 2UWEE 1ZT1B 3EW3B 5MENA 2F54D 1LNUB 1H15B 3BWAA 4W70A 5E2VH 2VXTL 3U82B 3JV6A 1R24A 1BFSA 4JKKA 3H2WA 1I9JL 5L9DL 1QYGH 4I18A 4OF6A 1SMOA 1A14H 4ELKA 2F58L 1EO7A 2FO4A 2Q7NA 4GQ9L 4C59B 4LDEB 4ELMA 1S78D 4AIOA 2AJYH 2IMMA 1KEGL 4PY7A 1I1YA 4UAOC 4RMRA 5SV3A 1RFDH 4K07A 4F7PB 2J8HA 5L2KA 4NOFA 4JFXB 1NCUA 4NDMB 2HA1A 3HKFA 4FFWC 4F7CB 3O3EA 4QF1A 3S4SG 3ARDD 1IC1A 3MNWB 2R4RL 3MNVA 4P99A 5EOCH 1BQHB 1MCNA 1AKJB 5D7SL 2IH3A 5GGQL 2EECA 5J1TC 1T20B 5FA4B 1G7HA 4HIXH 1FLRL 3OB0H 3QIWC 5ALCL 1JFQH 3EO9L 4N8CL 1F58L 4U3CA 2JIXB 2LU7A 4PGCB 4U6HA 3OF6A 3TA3B 5GIRA 1LO4L 5I16A 4JKLA 1NMBH 4S2SB 4EN3B 2A6DB 3FRUB 4CGTA 2Q3ZA 2MHAB 2UY7A 3MUHL 4GKSA 1DBBL 3ABZA 1KN4H 3WNNA 3DURA 1EAPB 4JGUA 3RWHA 3DXAE 1I8LA 4XMKL 4X6DB 5KSUB 4QKXB 2J4WH 3BESR 3LRHA 2ZSWA 5JQ6H 4GAYB 4LSTH 5DJXB 3K1KC 4UV4L 1NGQH 1VGKA 4L9LA 4UU9A 2DQFB 3SBWA 1VPOH 2Z92B 4RDQF 4NQSB 1QPXA 4P3WA 1JWUB 1F8TH 2FWOA 5F7FA 5EU6A 1AGEB 4JFDA 4P5MB 1XIWB 1WBZA 1MJ8L 3O0RL 4JAMB 4UTBL 1KJ3H 3LKOB 1O5DT 1JF1A 1YECL 3UBXA 2NY6B 4R97B 1OB1B 1QNZL 4HIJA 2V9RA 4V1DD 3HI1A 2X4SA 1TJHL 4LSVH 4EIZC 2Q6WA 4Y5VB 3OL2A 4NWUH 4P2QB 5C0RL 4PJFF 1BZ7B 4KTEL 4PJ5B 5ANMA 5D1QA 4KXZH 5AYQA 5ACMA 3ZDXE 1ZT7A 2P4AB 3L3JB 4WNQB 1SEQH 3WFDL 1PGRB 1SJHA 1BF8A 4YAQB 4L4VB 3G9VA 4MJID 3SGKC 5ICZA 3KLHC 1G1CA 4DN4L 3DROA 1BVLB 1Q94B 3UTSE 2HJKA 5IBLD 5DQDL 5CLTA 2DQIL 2FX8L 3HLAA 4NBYB 3HRPA 2D7TH 3MRHB 3GJEA 4XNZC 1W0YT 5BRZB 2X4RB 4GAGL 1LEGA 2PNDA 2Y36H 3TYFB 1FFNA 4I0KA 1OAKH 4K9EC 1NPUA 4LAQH 3RY6A 4F3FB 3TZVB 4JVUA 4U1HA 4KPHH 4G3YL 1WEJH 1FL6A 2C4XA 4OZFA 3JTTA 3U0PB 2NY0B 1UH3A 2VB5A 3V8CA 1OGTA 1RHHA 4FXKA 5FUCC 4Z7UE 3OB0K 1CFBA 4K94H 1X5HA 2NY5L 4K3DL 4WO4B 3WO3B 3ZKMC 1YEKL 1KULA 5F9OH 1I4FB 2FD6H 5D4QA 2W65A 2EKSB 3TBSB 3OKMB 4HIEA 2R56H 4YHLH 3NAAL 1S7VA 3BGMB 1IT9L 2DI7A 2BHYA 5L2JA 2Z93B 1AP2A 2J8UE 3E0GA 4OLVL 2JKXA 4DVRH 1EEQA 3JUYA 1MLCA 5IOPA 4WHTA 5D7LA 4WU7B 5F7UA 1SM3L 3GI9L 1Q0XH 3G5YA 3KDMA 1MELA 3BIKB 2ATPB 4RA3A 2Q7YA 2VL5A 5EBWA 4MCYB 2VIRB 3GSNL 3QIBA 1F6LL 2OL3H 4OB5H 2Z8RA 4ZFGH 4JFEE 2YS4A 3REWA 4XXCA 4NCDA 1NDMA 4JR9L 1R3HA 5DJYA 4NZUH 3PWUA 5BO1H 3QAZB 3EJYC 4ZTOL 3TGXA 1F13A 1G1YA 4FQXB 3S8WA 1XF1A 5HYSB 1WK0A 3S35H 3IETB 3IFPA 1FYHB 4XPFL 5B39B 5E8OA 2R9HD 4L3EE 4YXLL 2XZQL 4ZD3H 4X7CC 5TGBB 2NX5A 3RHWK 3RPKA 2HH0L 2UWEB 3LD8C 5DJZB 4LKXB 4PTTB 3R1GH 3KPSE 1ZLSH 4QO1A 1YNTA 1O7SA 1RURH 2YSSA 4OD2B 1YEIH 1H8OA 5GRUL 1PSKH 1OD7A 2Y07L 3ALPA 1HNFA 4S0TD 1CICA 3ZKXC 5HYIA 2LVEA 2YHGA 1UZ8A 5HBBA 3VMNA 4P49A 2FBOJ 1IGJB 4POUB 4NKQB 3FN9A 2RFXA 3V7MA 5BW7C 1YY8B 2M26A 5ESAA 5DJDA 2XYCA 1YDPA 3WSQH 3TO4D 1I1AD 4XTRC 1T89A 4YFLI 2P43B 4NKIH 2F5BH 2NY4D 1CCZA 3MO1A 4ZO6A 5JW5B 4YHYB 5CD5C 2ERJC 1ZT4B 1UEYA 3V0VB 4HBCH 1W0VA 3AS2A 2CDFA 2C7UB 2VLJA 3EO1B 1Y6NR 3MOBH 1CDJA 3H9YA 4M6NL 3CFJB 4JRYE 1HHGA 2DJSA 4GRMB 2DKSA 3NZ8B 5D93B 1OAYH 1RU9L 2VQ1B 2BSSB 4NQCB 4EVNA 4AG4H 4JPIA 1JHKH 1TPXC 5I1HL 3BAEL 3CLEL 3QEGH 4H20L 3U6RA 1OCWL 1IEAA 4JZJC 3MRKB 4ZAKC 4U6TA 1F6AB 4MGXA 4LAJH 3DXAB 2JTDA 1JI1A 1QQDA 5E4IA 4Y4KC 2PW1B 5E2UL 3JVGC 4P4KC 3CXDL 4YLQT 4QRRD 2APBA 3BEWA 2H6PA 3MRBB 2P8PB 1CI5A 3DHMA 1KTRL 2XZCL 4GAJL 5I76A 4WWKB 1LP9E 2YD4A 3NFNA 4MS8C 1U8IB 1LEIA 1A7NL 4HWEL 1GGCH 2BSED 3QXAB 2PTUA 3KGRA 1W72B 2VDPH 4D94A 4YUEH 4L8SB 3MRPB 4U0RC 3VFUB 1A64A 2JCCA 3CH8A 4UINL 3RTQA 1FC2D 2J6EH 2EYRA 3ZYIA 5IB2A 4G42B 2WBKA 3LKSA 2X40A 2A74B 3EYSL 3QPQC 1A6WL 5J13B 2UUDH 4TNWF 1Z9MA 4HXAH 4U6YB 2YPKA 4WV1B 4XPGH 5DSCB 3TEUA 2FATL 5IBTH 1S9XB 1MCBA 2VXQH 5T1KD 3DGCR 3TN0B 3UTSB 4NNXB 3HC3H 3FOMB 5KSAD 3NH7H 3S34L 5F1OB 1HWHB 4OQTA 5HHMD 2WWKT 1PX3A 3B43A 4JRWA 3MBEA 3SE4A 5C09E 1NKOA 2Z35A 5I1CL 3L3HB 3TVMD 3LQAL 2DS4A 3DSFL 5F7EL 2HVKA 2E9WA 4PV9A 3K81A 4O2CA 5IW6A 3HUJE 1FZMA 1KNOA 4X4MA 5BS0D 5I8OL 1T03L 1HXMB 1EHLL 4YHZL 4EI6A 1PLGH 1AD9A 4I3GA 4QHNB 2B5IC 5C0BD 3ES6B 2OL3B 1N26A 2GK0B 1VACB 1A6UH 4G7VH 4TRPH 5F6HJ 3HAEG 1FFPB 2FIKB 2FZ3A 1UM5H 4P5TA 3VE0B 2J8UB 2VH5H 1FC1A 3NA4A 1U8HA 5EUOF 5CEYA 4M62H 2R69L 1FV1A 1RPQA 5MERB 4HS6B 4CJ0A 5I1LB 2EIBA 4IHOB 2PXYC 1IAIL 1XCTA 32C2A 3V5DB 5K9KB 1IGFH 4LP4A 4WJ5A 1BOGB 4JFEB 4A2LA 3P4OB 5FHAH 1HQ4A 3D6GA 43CAB 1NGWB 15C8H 1NMAH 4Z5RB 3WFBL 4JFYA 1QR1B 1VEMA 1IGCH 4M1CD 1BBDL 4XXDA 3RDTC 3ZSTA 5C08A 4JG0L 3QUMA 3B9DA 4KY1H 3FB6A 2YXFA 2YC1B 4HK0B 5D1ZC 3B3IA 3CFKA 2R2EB 3MLXL 3CZFB 2Y9RT 5TE6L 5CEZL 4YXKL 2JJTA 4X83A 4L3EB 4NQED 4XBGB 4XC1H 1KJMB 3WUZA 1XZ0A 3QI9B 4N1EA 3PWPD 1JL8A 2DAVA 4XNMB 3MR9A 3KPSB 2CK2A 2Y5TB 4NC1E 2E7CA 2ESVD 5E24E 1M71B 2NY2B 1ZVSB 2FSEB 5C9JB 4UBDC 3KHOA 4HGKC 5KTEL 4O51B 3BRFA 3MTRA 2GFBA 4N0UE 4LFHG 4FP8H 4K7PY 5HHOD 1T7XA 1T1ZB 4ODUB 3O4LE 1XAUA 4KKCD 1CQYA 3GMPB 5E7BA 3B2UC 5E70A 5J11C 3WE6B 1YUHB 2HN7A 3VGEA 4GXVL 4MX7B 4ODSH 5E4EB 4WCYL 4BUHA 5DURD 1M05B 4TPRL 1EGJL 5DUBB 3UPRA 5H94B 3O45B 1QR4A 4NQVA 5CP3A 5IM7B 3QO0B 1BGXH 2P5EE 5ISZE 3LRSB 3MCLL 2XICA 5LAXB 4OFDA 4GRLA 4P2RB 4HMCA 5DD3H 4DGIH 1KPUB 3DETD 4PJEA 4PBVC 2YN3A 5GSRA 3FQUA 3WIHL 4KVCL 1TZGH 4JRYB 3CDYA 3QDGB 3R06A 1IQWH 1MNUH 1EFXA 4XGZB 4WU5A 1CE6B 3LKRA 5C70A 1U91A 2ZUSA 4XVSL 1OQOA 5CJOL 4R3SB 1HHIB 3NABH 3F7PC 1U36A 3GBMH 4K23H 5HI3C 4P23B 4LU5L 2R0WL 3UJJL 1D6VL 1NFIA 4LCIH 2EIEA 1H0DB 2GTZA 3SJVA 4Z77B 1OLZA 25C8L 2FHCA 5TE7H 4GMTL 3RVWC 4DZBB 3LIZL 4OZIE 3JWOL 5GXBB 1G7MA 1T04A 3RBGA 3WLWD 2DQDL 5DI8B 4Q7DA 1LP9B 1ZEAH 1D3CA 4TSCL 4UDUB 3EHBC 2Y7QA 4Y2DA 3MJGX 3TCLB 3LB6D 2R23B 1RZ7H 4O00A 3N85L 5I8EA 4LEXH 4XCNB 4HDIB 1IFHH 1NCDL 3KNBB 5CEXA 1CDIA 2RB8A 3PP3H 2FBJL 2FHBA 5HJ3B 1A0QL 1GZPA 3WKNA 1F42A 1MFEL 2Z31D 4AH2B 5ENWA 1LO3H 3QQ9D 5JA8B 1B90A 3WFCH 4G7YL 2KDGA 5D6DC 1UWXH 5AUMB 4N68A 3B4NA 2DLEA 4MNQA 4R0LC 3PHOB 1JV5B 1DQTA 2C1PA 5IBUB 3X3FH 2KPNA 3QCVH 3V6ZA 3ZYJA 1OD9A 1T1YB 4O02H 1H5BB 5IJKC 3QXWA 4LSRH 3MLRH 5DMJB 5A2IH 3VXQA 4NJ9H 3MLUH 2IADB 3HC0A 1CLOL 3CSYB 4J3OC 1H3WM 4PJBE 4KHXL 4Y0GA 3PP4H 5CIPH 5C09B 3A6CL 2ADGB 1E27A 4FZ8H 3I84A 5DVNA 2R0ZL 1FNSH 2PO6A 4ZS6D 2FECL 4HUKB 1DQQB 1XGUB 2HYMA 4WTZG 5MEPA 1XGPB 1MRDL 1Z3GH 3LQMA 1YEGL 2DM7A 4H1LG 2EIZA 4Y4HD 1HINH 4ZQKB 4YPGB 3O3AB 2F53D 3H42H 4RMQA 5C0CE 3SKOA 3ALXA 3MZTA 3MGAA 4OCLC 4YZFE 5IFAL 4F37K 2VLLB 4G80B 4QXTB 2EC9T 3LEVH 1G9NL 3DVIA 4PJAA 2CIKB 1AHWA 5I1IL 1JTTA 3ECBA 5IB5B 3CPLB 4AQ1B 5HDOA 1P4LB 5D70L 2DN7A 4YBHA 4QOKD 4HZLA 1E4XH 4Z7WF 4HFWB 1OPGH 2SEBB 3OXSB 4FQJH 1L0XA 3QA3B 3FB8B 2D7QA 2X7LA 4WUUB 4XNUH 3QXUA 4ZFZB 3AMLA 3BQUB 5D2NA 2WM0A 3SDYH 3T2OA 4JO4L 2MQ0A 2QTEA 4YNYA 1MVUB 3MQIA 5EU5B 4PJ9A 4FFYH 3QEQE 1JHLH 2C26A 4LPCA 4Z6AT 1BEYL 3S96A 1H8NA 4I2XE 4BFBD 2L7UA 3DHJA 3VFGL 3MFFA 3VFNA 4GBXC 4PB9H 2E8YA 3KAAA 2XFXB 4EUPA 5HYJA 1MI5D 3DX8A 3S3PA 4XMLH 5E0QA 2H8PA 4WFED 1UWXK 4M1DL 2CRMA 4OTXL 1E28A 3KPPB 3G6DH 3D0VB 5I1JH 3OX8B 5DRNA 4MQ7B 5BOPA 1CVSC 3UC0L 3ARFA 4ODHL 4WW1A 4YFDB 3RY4A 1EEZA 2W0PA 5E8NB 3VW3L 1CG9B 3PGDB 4N0UB 1UWEH 5TH2B 5FGRA 5EU4A 5E9DE 4MA8H 3DI2B 1INQA 3ARED 1TNMA 4F9PA 3GK8H 3T2NL 4OD3H 2ITDA 5F1NB 1BJ8A 1PKQA 3FOLB 4IRJA 3IKKA 4JLRB 3IXTA 4DUXA 4OKDA 1QFWM 4B41A 1FIEA 2OR9L 3ARBA 1MLBB 2R9HC 5DRWA 3GKWH 5EC2A 5JHDD 5CJ5A 1IAIM 2WBJD 1UVQA 3QUYB 4LSUL 5C0AA 2P5EB 5E56A 5ISZB 2NY5C 2OP4L 4XNQB 1IAMA 3I02B 1FZKB 5TDPB 1FORH 4TYUA 5AAWA 1BZQK 3OBAA 5GSVB 5IFJA 3MUJA 3S88H 4OV5A 1A4JB 3VU2A 3JV5A 1AFVL 3DBXB 3RGVC 1KCRH 2FCBA 5IMKB 2YD9A 4PUBL 1I1AC 1INEH 1JZ7A 3PHSA 2YUZA 2NY4C 3H9SE 1HH9B 4PRIA 4FZEL 1ZHLA 1OAUL 1ULVA 3PABB 3HG1E 1WBXB 3MRDB 2IAMA 3O6FA 4PRAB 1NCAL 3SDXB 4OZIB 3BO8A 5MEND 4OGZA 2EICA 5GGUB 5KN5A 3PIQB 1RZGA 3I3EA 5EC1A 3A6BL 1CFSA 3SGDI 5AYUH 5JZ7C 4LIQL 5TE4L 1TJGL 3CC5B 3CDGB 4JZNB 1T83C 5C0ND 1GAFH 1SYVB 4S1SH 1YNKL 12E8L 2PF6A 4MVBD 4HUNB 4N90D 3DVNA 4CVWA 4MD4B 4I3SH 3MV9A 1EHXA 1BZ9A 4JFFE 1CT8A 1SYSB 5L2KD 3O6KL 5CIPB 2AI0L 1KJ2L 5BJTA 7CGTA 4JY5H 1DBML 1FVEA 2BY1A 4O2FB 3PXJA 5IQ9B 5DD6A 3SDCD 4KTDH 4XHJD 1JP5A 3PGCB 1FJ1A 3BKYL 2BC4B 1P4IL 3BE1H 4FFVC 3VFPA 2P7TA 4U1IA 3K4ZA 4BZ1L 1QFUH 1MH5B 1U58B 4WFFE 3MV7E 3TNNA 1UJ3C 4HKZA 5C07A 2Q8AL 1AGBB 4LSPL 1OP9A 5IJVA 1JZ6A 3O9WC 4MCZA 5D7JB 2DTSA 3OF6D 2AKRA 3H3PL 1JNNH 3QHFH 4AK1A 2DLFH 4PRBA 3TP4A 4X6EA 4LQ1A 1HHHB 5IB3B 1DR9A 1KB5H 1TETH 5GZOD 3FT4A 4LLWB 5C8JA 3FKUS 3WKML 4U6XA 5EU3A 4HKXA 4MAUH 3DV6A 1IM3B 4RNRA 2CDEB 5CUSL 5JNYA 4TSAL 3VWKB 2H32A 3U83A 5C0CB 1ZA3B 2RHEA 4FQIH 4HQQH 3STZA 1QYGL 1F11B 3DX7A 4F8QA 3HI5H 3UDWC 3C08H 3OR7B 3C8KA 5MP6H 1D5IL 4RMSA 5EU6D 4GMSL 4JFDD 4ODVH 5I0DA 1F2XK 1B6UA 2ARJB 2CPCA 3U0WL 3DTXA 4RIRB 1N2RA 1DFBH 3EYOA 2YD1A 4ZTPL 2DQJH 4U1GC 5IVXE 3RX7A 5GRWA 1NBZA 1S7WB 4D9QE 4TVPL 3BXNB 1IKFL 4ONFL 2YZ8A 2DBLL 3D39E 2YA0A 3RAJL 3ULVL 1T80A 4R8WL 4L5FL 5D1QD 2VDLL 3OGCA 4ZXBA 2JCCF 1FZOA 1LK2B 3T09A 4KK8C 3QEQB 4PJ8B 4O58L 4BFIA 3SKNA 5IVNA 3ESUF 4M61B 2X4TA 1LO2L 4I2XB 2D03L 3PQYE 3R0NA 4LCWE 1AR1D 1EA9C 1NJ9A 4DWHA 1KPRA 5TDNB 4PGDB 3BP4A 5B4MD 2MKWA 1GOGA 1PZ5A 4M93B 5HYSG 2BOBB 3OPZL 1RI8A 5DK3A 1BVKB 5EUKA 1HYSD 1RJYA 1IILE 5JXEC 5FFLA 3ZO0A 1CFVH 2I9LA 5HHQA 5JOPD 1ZANL 3IKCB 5LGKA 3TYGL 1UM6H 1SHMA 3INUH 3AS3A 1U8JA 4EI5D 2MNUA 4Y8DC 5HHPB 1ZT1A 2V5SA 1T5WA 4XPHH 4F9LA 5E9DB 5GRZA 1HH6B 4QXGH 3QWOA 3LQAC 4IDLA 1NAMH 1UXWA 4ETYA 5IGXL 2X4QB 2XQBL 3FN0L 4WFHD 1UWGH 4X7EC 2HRPH 4HC1A 2A73A 4HF5L 3ULVD 4MSWA 4GW5B 4YEFA 5D7LD 1FNLA 4X7SL 1F3RB 4ZDHB 2GTWB 1EHAA 1N3NB 1NSNH 3NFSL 4G6ML 4KROC 2GJJA 4ZO9A 5MI0C 4F7PA 4OM0H 4NKDB 4Z7VE 3QIBD 4JFXA 3TIEB 4Z8FH 1BD2E 3MRJA 3DV4B 3CFDA 4F7CA 2IGFL 2F9BT 2AGJH 3C8DA 4PRDB 1W72L 3F8UB 3FL7A 3MNWA 5I30H 1A7OH 3GMRB 2VC2L 1BQHA 1AKJA 2WNGA 4M6MH 4UILL 2I24N 5B8CC 1T20A 5HDBF 4KZDH 4Y19B 4K55A 1L4IA 4X7TB 1G6RA 3H9SB 1BM3L 1Q1JH 4LSSL 3TA3A 3HPLA 1T1XA 5DTFB 3KLDA 3SCMC 2O5XH 5T5FL 2H9GB 3V5HB 4EN3A 1F3JA 2A6DA 2VITA 1WEJL 2NX5D 4UB0L 3QEUB 2XOTA 2OK0H 2MHAA 4LLQB 5A2JH 4V2CB 3P3YA 1KCSH 2EXWC 2DD8L 4WW2B 3T0EB 1B2WH 2W9EL 5D9SA 1CU4L 3EDKA 3MLZL 4NSKB 4TUJB 4EQ2A 2VDQL 1A6ZA 1I1CA 3MRRB 5KSUA 3QUZB 5KOMC 5LGJB 1CICD 4KRPC 1RMFH 4APQA 3QSKB 4R2GD 4GAYA 4LCCC 1ZWIA 3ZZ1A 3W5MA 1CD0A 4HGWB 4YFLF 1YN6A 6CGTA 4MLSA 1WZMA 1RUAH 1JWUA 5FGCB 3GRWL 3PL6A 2IFGA 1JNLL 1AGEA 4JFFB 4P5MA 1XIWA 3D3VE 1QRNE 4G8FA 3LKOA 3MJ9H 4ONOA 1XGYH 4LL9A 4OKVB 3X3GH 1I3GH 4MZ3A 1T4KA 5HYFA 2CDGB 2X4NB 4X9FA 4AL8H 2QBWA 1JYVA 2VDRH 2VLJD 4RBPH 1KB5B 1KXVC 4KXZI 5ALBH 1UJTA 2WLYA 2XRAL 4PJ5A 1JGVL 5E6ID 5BQ7B 5KSBF 3CFBB 3BEVB 4WNQA 1WWAX 4L29B 4ZSOE 1FAIL 1LE5A 4CAGA 4L4VA 2CLZB 5GJSH 2R2BA 4LHUB 3TT1L 4EDWL 3MGOB 4S11A 3V4UL 3V7AG 1J0ZA 1UACL 3HZMB 2XZZA 3MRHA 1KGCD 5ACLA 1DQDH 3HR6A 2Q20A 4W6XB 4QXUL 5FCUH 1V05A 2LFGA 4GO6B 3ILPA 5CBEB 3VXME 1NCBH 2DM2A 3TYFA 3MRFB 2HJFB 5BMFH 1P7QA 2BVQB 5L0QB 1NFDA 3L5XL 5EU7E 4DK6A 4R4NC 4TOYL 1U2CA 3HPJA 1PQZA 1KEMH 1F02I 1WWWX 3RU8L 1JPTH 4DAGL 4K3EL 1G7LB 1P9MC 1Z9SA 2IQAB 1I4FA 1T0PB 3L3KB 1NGPH 3H0TB 4XP5H 4K3HA 5GRVL 3JWOC 3MRCA 2LV4A 5CJXA 1NEZB 1FGVL 1GOFA 5IVXB 1KCUL 3RTQD 2AJ3A 2R2CA 2Z93A 2GI7A 1WUNT 3RL1A 3SPVB 3D39B 3IAGC 4WI9A 1EPFA 1JJUA 3B9KB 4GAFB 1U8NB 2HT4D 5CJBA 1YYMH 1E4KA 3BIKA 5FF6A 4MCYA 2RQ8A 1PJ9A 2VIRA 2X70B 2WMPA 2VXVL 1FDLH 5LWYL 3PQYB 3GMMB 1LD9B 4QYOB 4JO1H 3IYLW 1E6JH 3DX6B 1N6VA 1VFUA 3L3DB 1T6VN 1UCBH 2GJ6B 1BWWA 1N0XH 1QBLH 2BNRE 2EH7L 3I50L 3QZWA 3VG0H 4AEIH 3MBED 3SDAC 3FHQA 3QCTH 4HCRL 2F8OA 2DQCH 4F2MB 3Q6GH 4MA1C 2QR0A 1NAMB 2E9IA 1DN2A 4KGLA 1EK3A 5HYSA 5JLZB 1C12A 2LAAA 4NNPH 1G9ML 1ES0A 3Q6FB 5B39A 4Q9QH 4RBPK 4XCCL 5IV2B 3MRQB 1MF2H 3Q0HA 3T4YA 1GHFH 4XBEH 5DJZA 5DFVD 2JK5B 2OLDA 1AD0B 1LEKA 3NBNA 1KCVH 4NO2A 1JF5A 4X6FB 3ULUF 2G5RA 1TZIB 3Q3GB 5GHWH 1RY7B 3IDYB 4RWYL 2DF3A 4Z95L 4XC3L 5CINL 5HYQB 2FJGB 1RJZB 3HC4H 1T7WA 2O93L 4P5TD 2OZ4H 4YUEL 2JELH 2PYEE 1DE4B 1MHEB 3H9HB 1YY8A 1B0GB 4FS0A 4BJLA 3IDIB 2HT2D 1U3HB 4I5BB 3AROA 4PJAF 1Q9WB 3VXTB 1WTGT 3H3KA 2G5BB 3GIZL 2CIIB 3OR6B 2QL1A 2VAJA 4ODBD 5HYEA 1GGBL 5JW5A 2VDML 3C6SB 4IRZH 2E7HA 2DJUA 4KJQD 1BD2B 3WJJC 4YWGL 2VWEE 2LVCA 1SBSL 1G9NC 1ZT4A 3PDGA 4P57B 4Y16C 4KVNH 3RNQB 2F74A 2VXQL 1MSPA 3AREC 4XAWH 1TIUA 4HUWB 5C08D 3O8XA 3CFJA 1MCPL 2ED8A 4GRMA 5EOQH 1D9KB 3AB0C 2VQ1A 2DMCA 3JTSA 4PJXE 3SDDB 4OLWL 5EZJB 5HPMB 2NLJA 1J7VR 4M7LL 2WBJC 4LHJB 3MJ6A 2JJSC 3GO1H 5DMKA 1GRWA 4YDKH 4TSBL 3C6LB 2BVUA 4K7PL 3QHZH 5E1HB 3DXAA 4AY0A 3N9GH 3OJ2C 2LU3A 4MNGE 1MOEA 2VDNH 4EDXB 4FG6D 1RZJL 2VKWA 4X5XB 4KJWC 5DJAB 5E7FA 5D1XC 4TRPL 1X5AA 1IBGL 2F19L 1D5ZB 4UOW1 4JFPB 3QCUH 4DN3L 4WGWB 4WWKA 3MLPA 4J3VA 1U8IA 1AO7E 4P9MH 3MNZB 1CDCA 3D3VB 1BFOB 4NQDE 3DARA 5A16A 4GSDL 4J3WA 4RGND 3FQXB 2CKBL 5CHNA 4CN6A 4ZUWA 1BIHA 1YMMA 2VLRE 4L8SA 3C5JB 3QULA 3MRPA 3VFUA 2V5TA 2LU4A 3X11B 4K9EH 1CGSL 4F15C 1FCCA 3OG6B 4GRLD 2XN9E 3SGJC 4HJJL 2X5PA 4OLXL 5CLWA 3T0WA 2P5WB 3BPNC 1U8KA 2B4CL 3T3PF 2A74A 3C09C 2FLRT 2IFFL 5IBUG 4UT6H 1EFXD 3GHEL 3P0YH 2OJZH 4U6YA 4ZSOB 5TQ0L 3F58H 4WV1A 3G9AB 4CADA 5DSCA 1MJ7L 5DEZA 1S9XA 5J6GB 1MCLA 2BSTB 2Q86A 3MOAL 1GIGH 1X6LA 3UTSA 3RWIA 4NNXA 5DRZB 1IGIL 3KYNB 1EFQA 5FV2A 1MQ8A 5M95B 5KS9E 3K8KA 2VZ1A 1MCOL 5HGBB 1S5HA 5FA3A 5GS0L 4J8RA 1FIGH 2O5ZH 3VXMB 1B0WA 1IAOB 1YNLL 3UTZB 3LN4B 4Y5XB 3MV8B 3SJVD 5CCKH 3DYOA 3GSUA 3D9AL 3WS3B 4TUOB 1TJIL 3X13B 1FH5L 1CZ8H 1TQBB 3WFHB 2EYTA 1DDHA 2I60H 3SQBA 2P8MA 3S36L 4YR6B 1YYLL 5JHLL 4J1UB 1HXMA 4Z7UA 4MYWB 4XAKE 4Y2DD 1HSAB 4D2NA 5I1GH 4QHNA 1N6QL 4M7KL 4JB9H 3ES6A 2I25N 5C3TA 3HI6L 1BAFH 2FL5B 4G8GE 4OGXH 3I9GH 3QXDB 4PS4L 1AQDB 5GZOC 3VE0A 2J8UA 4L3CB 5AAMA 3UZQA 3BJ91 4PJHA 2P24A 4L8CB 5MERA 1I7RB 4MNQD 4HS6A 3IGAB 5DC0A 5I1LA 4IHOA 4MLIA 2R15A 3IDMB 3V5DA 2FGWH 1YA5A 2ZKHL 4OM1L 3BWUC 1I8KB 1J8HE 2X41A 4UAOB 3UYOD 4JFEA 3P4OA 4X8JB 4H88L 43CAA 1MHPH 1NGWA 3BT2H 4OFKA 3MREB 4Z7QE 4Z5RA 5HSFA 5DWUL 1QR1A 1L7TH 2BNRB 7FABL 5AZ2H 4P2CG 1CD9B 1F5WA 2E27H 3GBML 3VXUE 4XVJL 4Y5YC 5M94B 4D0BB 3NACH 4JPVH 2PO6D 2APTA 3FQTA 4N1CA 1OGAE 3NIDE 4FQ1H 4IRSB 3LKPB 4A6YA 3QIWB 4N8VA 5EH1A 4FQCH 5F7NC 4L3EA 4XBGA 1NLBH 1MFDL 3F12A 5DZNA 4QCIB 4WI7A 5D1QC 1KJMA 3T0DA 1KYOJ 2CLVB 3ULUD 1CK0L 4X9GA 1J1PL 3U1SL 3KPSA 2Y5TA 5LBSL 1M71A 1OHQA 2MSPA 1WFTA 4ODWB 5C9JA 2V7NB 4DGVL 3O81A 4OQ1A 2HTKD 4O51A 3UAJD 3B5GA 4ETQB 8FABB 4UZGA 1REIA 5FYJE 2V17L 5B4MC 1OTSD 1MCWW 1T1ZA 2PYEB 4ODUA 5E5UB 1T5XA 2B0SH 3PWNB 2CUHA 1YUHA 2F5AL 4ZPTB 3RY6C 2QQLH 5DD0H 1M05A 3CDCA 4U1MB 4N8PA 5DUBA 5H94A 3HR5B 3O45A 4NKMA 2PTTB 4CMHC 2ZOKA 1NGZB 2ZCKL 3JV4B 4OLYH 4NO3A 3LRSA 5FYJH 4W4OC 1L9NA 5FUOL 5LAXA 3B6SB 5EBLB 4PJ9D 5KG9B 1KPUA 4RFOL 3LVEA 1WITA 1XGRA 3B5HA 5CILL 3E3QC 3EAKA 4JRYA 4XPTH 1MFCL 2KUTA 2F8VA 4XGZA 1S9KC 4PJXB 4CNIA 5HYJD 1B4RA 3KPRA 3ULVC 3OZ9L 2FB4H 1J11A 5L88L 2BSRB 1N5YH 3BP5B 4P23A 3L1OL 3GZKA 3QH3A 2VXUH 1YN7B 5C6TH 4KDTA 35C8L 1Q9LB 1ZVYA 3ARFD 4XPAH 2X10A 2Q76A 4KK9C 4XNZB 1H0DA 4XXCC 4M9PA 3MYJB 1QBBA 5FIEA 4MNGB 2LTQB 2EEBA 4MDIA 4D8PB 3F7RA 3QFDB 3QUXA 5CGYC 3V6FB 1A47A 3HNVH 4LFHD 3QG7H 4LRIA 3LH2H 3BSZH 1XR8B 3GDBA 1LP9A 4N1HB 3HZVB 5DA4A 5EZOH 3HRZA 1AO7B 4IRJD 3OKDB 5DR5H 4UV7L 4NQDB 3VXNB 3JV0A 2WW8A 3ARBD 3MV01 2VLRB 5DYOB 5C0AD 4ONHA 4NUGL 4FQJL 4B50A 4HHAB 2EH8L 2ZUWA 4AH2A 1VADB 3BRGC 1SJEB 2ZPKL 3VWJA 1IGTA 5FOBB 4CVXB 3T4AA 1FNEB 3O3BB 2V7HB 3C5SB 5AUMA 1U8PB 4Y89A 5IVZB 4UQ2B 4FFYL 2AV7B 2NZ9D 1VFAB 1JV5A 1T2QL 2AERT 4TNVK 2QADC 1ORQB 1RUKH 1MEXH 3VJ6B 1HWGB 4XNXL 1ETZB 3TV3H 3PDOA 2A0LD 1RSFA 3BN3B 3NZHH 3GMNB 1T1YA 1NFKA 1U8LB 3O3DB 1H5BA 5K59E 4LLUB 4JANB 1OT2A 5IQ7L 2IADA 2X09A 1KIQB 5DC9B 3CSYA 5KS9B 4IMLB 4XP6L 5C09A 1Z9LA 4PRID 3NCJL 1ACYL 4FQPA 1KT2B 1A02N 1N59A 1VFBB 1EAJA 2IAMD 2IPTH 1XGUA 3O6FD 5JUEL 5HHXH 3NTCH 4QT5A 1XGPA 3HUJA 4OCRH 1WZ1H 4HX1B 4H26A 1FE8H 3BD3A 4O4YH 3QNZB 1B4JL 3WIFB 1X9QA 3LKQA 3LD8B 2YPLE 5ELIA 3TNMB 3ARGC 3DUUB 3EKCA 2VLLA 4QXTA 4X6DF 2QHRL 3QNXB 4NM8L 2AJXH 3C5ZA 4BUGA 5E8DL 3P9LA 5SX4H 5JOFB 2GKIA 4U1SB 5J0BA 2RAMA 1HKLL 3MV9D 4BYHA 4HG4J 2CIKA 3ZKXB 3VXRE 5CKAA 1L6XA 5F6HI 1J1OL 3DECA 1P4LA 2ZCHH 4P5KB 1CFNB 1E4XI 5IB1A 4XBPB 2JB5H 3ARYA 4HBQA 3TCXA 1MJUH 4F8TA 4I0CC 2XZAH 5FO9B 4G9FE 1VSCA 3P77B 3QIUA 2SEBA 4P46C 4QNPE 5ADPH 4E42A 4YQXH 2D9QB 5EO1B 3OAYH 1P5VA 1JTPA 3BQUA 1YEEH 1RZKL 2O61A 2ERJB 5F89A 5B21A 1MVUA 2EE2A 2ZSVB 5C07D 1ADQA 1AI1H 4O5LL 4YDJA 5C6WH 2ORBH 5FHBL 5HI5D 2AXFB 1FAKT 5I18H 4F57H 1NUDA 1P5UA 5H8DA 1OGAB 3RTQC 4RQQB 3WNPA 2ADIB 3MACH 4IOFC 3G6JE 4OGYH 1A7PL 1TPXB 2UZIL 4J6RH 4GRWE 3PWVA 5KZCD 3AMKA 3KPPA 3D0VA 4KMTH 4QHKJ 4Z0XB 3P9MA 5GS3A 1XF3A 4JZJB 1V7NL 4ZAKB 4R26L 3GSQB 4AEHH 4WI4A 5E8NA 1CG9A 4N0UA 1TLKA 3IAPA 2Y6SD 4Y4KB 4FNLL 1F4HA 4P4KB 3W0WE 2H3NA 1ZE3C 3MBEC 1IC4H 4GRWH 3O4LA 4YIQB 1X5XA 1M4KA 5JIIA 3HZYA 5C0DB 1MFAH 4GW1A 4IOSD 3CU1A 1KLGB 4WY7H 1N7ML 1BQUA 5CKGA 4FQQA 4HKBB 4JLRA 3BZEB 5F9JA 2DQHL 3P4LA 3UJIL 1MLBA 4Z7OF 2ICWI 3CVIL 3BGFC 1DP0A 4YDVB 2B2XL 4KZEH 3QUYA 4LSDA 2P5EA 1KIRB 5ISZA 3BKJL 4ZXBD 3OKNA 4CN1A 1A1OA 3QI9C 3WD5H 4AZ8A 2A6KB 4U0RB 2W91A 3I02A 2K7PA 2NW2B 1DBJH 4LVHB 1QACA 3NIFE 1QFUL 1V3JA 2A6IB 1FL5B 4JDZA 4UI2A 3HZKB 1KCLA 3P11H 4PYGA 2MQCA 3QJHB 1IC7H 5CZKA 5IMKA 3ARVA 1AJ7L 2HT2C 4D9LL 5HDQL 3BZ4B 4MAUL 4Y4FA 2VXTH 1G6RL 1HH9A 2HFFA 5C1MB 3LSOB 4KJQC 3STBA 3OAYK 1I9JH 1WBXA 5L9DH 3HS0B 1QFHA 5DJCB 5GS1A 1S7UB 2F58H 1MHHB 2EYSB 4PRAA 4OZIA 1FFOB 4GQ9H 2HWZL 1RK0B 4MXWL 5DEGB 3HMXL 1IAKB 2UWEF 2X05A 5CZVL 1JE6A 3CC5A 4HUXB 2AV1B 3CDGA 3F5WB 4OFIA 3ZT5A 5A40E 1KEGH 1G9MC 4KI5D 3VD3A 1RIHL 3OQ3B 1PZUB 3FMGL 1SYVA 1JZ8A 4WHYH 3LMJL 4E9LA 5HI4C 5D2LE 3RZCC 2B5IB 2R4RH 3I6GA 3QFJB 1A7QL 5IMOB 5JTWA 3VD4A 3MRLB 4G8IA 4HAFA 4P2OC 1EZVY 1SYSA 2YMXL 5LQBL 4Z0BL 5D7SH 5GGQH 5HTSA 5FKPA 1KYOK 4ZUVB 1FLRH 3F6IA 3UTPE 5ALCH 3EDFA 3EO9H 4N8CH 1F58H 2J1KA 4O2FA 5IQ9A 4MQXC 3TH4T 2PXYB 1GVIA 1HXYA 1LO4H 3PGCA 1AKJD 2X6MA 2BC4A 4OD1L 4Z9KB 1JGDB 2IBZY 1TTGA 1DBBH 4LHUG 4PJBA 3LKNA 4NRZB 4EZMA 1H3XA 2VN7A 5D7JA 3TA3D 4XMKH 3KLAA 4CVUA 3RDTB 5DGRA 2IQ9L 4EN3D 1EEYB 3IDUA 4JRXE 2H45A 4Y1AE 1JCKA 1QFPA 5D1ZB 3WNLA 3ZHKA 4UV4H 3EYFA 4J2XA 2Z8SA 4QWWC 3SGEH 2CDEA 1S9VB 3STLA 4NN6C 3VWKA 3MODL 1T2XA 2DL9A 4CJ1A 1C08A 2YPLB 4APQD 2EC9U 3NPSC 1MJ8H 3O0RH 4JQXC 4UTBH 2FO1A 3D0LB 4JFOB 1OAXL 1YECH 2EE9A 3DPBA 1QNZH 2P1YA 1ACZA 1BREA 4X6BB 3OR7A 2DKMA 2YD3A 3ARQA 1TJHH 3PL6D 3VXRB 4U2YA 2APXA 1XIWD 3ROOB 5C0RH 4P3DA 5C3LD 2ARJA 4KTEH 1CXFA 1OM3H 2NY6D 3RHWF 4G9FB 3WFDH 5C2UB 1RZJC 4F7TB 4KQ3L 4XT1C 5FYLL 1LILA 3BXNA 5JW4N 4P2QD 5I19L 4DN4H 4PJ5D 1OTTC 5JO5B 5F7DB 3IJSB 5DQDH 2DQIH 2FX8H 3IDJB 2EXYD 4I4WA 1A6TB 2NTFA 3QEQA 4PJ8A 2XT1B 4GAGH 4L4VD 2F54B 3RX5A 3QG6B 5JIKA 4I2XA 4TTDD 1RZIB 2Y1VA 4G3YH 2IBGA 1UYWL 5J1SC 3QNYB 3MUGA 4BH8B 2B4CC 1RIVL 2BOBA 1QBML 1OWRM 4N5EC 1BVKA 4GRWB 2IANE 3DGGB 5KVDL 2NY5H 4K3DH 1GPOL 2P47B 3TZVD 2CGRL 4F33B 1CQKA 1YEKH 4ZNEE 2GQHA 2OMBA 4JDVA 2NY0D 2HKFL 1XT5A 1UFUA 2VAAB 3NAAH 2NY7L 1IT9H 2Z91A 4OLVH 1DVFA 1HIML 4UIMA 3V52L 3W0WB 4HWNA 5SV4A 4B7IA 2JE8A 5GS0C 1JYWA 2CUMA 4M3JA 1SM3H 3GI9H 4Z7UF 1QSVA 3O6LL 1V3MA 4XWOC 3KLSA 4ZPVB 2YN5A 3U2SB 1KG0B 3FO1B 3N1MC 3GSNH 4QGYA 5ID0B 5AD0B 1VDGA 2LAGB 5F1KC 2AJSL 2R0LL 4WI2A 4OF0A 3ZE1E 4E5XB 4JR9H 1F4YL 1OY3B 1UB5B 4N0CD 5HXMA 1ED3A 2J8UF 1N3NA 4ZTOH 5IEHB 3L3IA 3THML 5EWIL 4NKDA 3RIFK 3TIEA 2DKUA 1AE6L 5I73C 4YJZL 4N9GA 4PRDA 4R0LB 4NCC1 4XPFH 1AHWC 3T2PA 4YXLH 3QDHA 3GEWB 4OBSA 2XZQH 1RVFL 2G60L 1LHZA 4KKBC 3I75B 2JB6B 2HH0H 3OKEB 3I6KB 5DJ8B 1QKZL 1JGLL 1BQLL 1P69B 5IROA 4MQSB 4X7TA 4YHML 2YA2A 1B0RB 4XPBL 3H9SA 4LLDB 2V5YA 1CXKA 4ODTL 4I3RL 3I3DA 4OAWB 5GRUH 5BMFL 3TBWB 2Y07H 1DANT 1T66D 3HG1A 1W2KT 2XTJD 4ZUSB 2H9GA 4MA3B 4NHUA 2XI9A 5D2NC 3I6LE 3V6OC 3QEUA 4BKLB 4WW2A 5JORB 4RFNC 2D9CA 4ISVA 4NSKA 4TUJA 5ETUA 2AEQL 3MRRA 4K3JL 4GOSA 3DVFA 5CWSB 1ZV5A 5DEFB 3DX9A 4HSQA 1M7DB 1UENA 5IMMB 5I15L 1E4WL 4HGWA 4DCQA 5E2JA 5D2LB 1SQ2N 3KPOB 1I8IB 3AY4C 2ITCB 2R0KL 2C3WA 4JFFA 2UZYB 2HT3C 2VABB 4LPVA 1LWRA 1ZGLA 3QDME 4M6NH 4C83B 1RJLB 5A3IC 3B8SA 4LLAA 4OKVA 2B39A 5ERWA 5HHNA 4WI8A 2EZ0D 1RU9H 2V2TB 5BZWB 3AGVA 1M6OB 4L8BB 4NQUA 4J3UA 1KB5A 1T21A 3DRTB 4F9PC 5I1HH 3BAEH 3CLEH 5BQ7A 1VFMA 2AJZB 4H20H 4TUKL 3CFBA 1OCWH 4OZHE 1UC6A 2VZVA 3VG0L 3MV7A 1FO0A 3VH8G 3G6AB 1RJCA 4EOWL 5TF0A 3WDHA 1WIPA 3FTGB 3UYRL 3ARBC 4LP5A 2R1XA 2HKHL 3TESA 5E2UH 5C0BE 4BSJA 5T33L 4JRXB 3CXDH 1JUFB 4HJ0D 3HZMA 3X12B 4Y1AB 4XZUB 4I48A 4GBXB 3EYQD 2XZCH 4GAJH 5FB8A 1TMCB 5H35B 2EEDA 3OAUL 3UPAA 3DXAD 4XH2B 3VA6A 1KPVA 1HOCB 2HJFA 1A7NH 4HWEH 2CO7B 3CSPA 2BVQA 2BXYA 4HK3N 1K4CB 3V0WL 4JKPL 1DLFL 2BMKB 3ZE2E 3ZHDA 2CMRL 2OTWA 5ITFB 4WWKD 4UINH 4OLZL 1FNAA 1OVZA 1MAML 2D3VA 2P44B 3J8F7 1G7LA 1HHKB 3EYSH 3HAEH 3VRIB 4AM0B 1A6WH 1LP9F 2QQQA 3L3KA 3H0TA 1YMMD 4ZOEA 2EDDA 2W92A 5GGSB 1KN2L 4XVUC 1NEZA 4J3SA 2AK4E 5IVXA 2Q1EA 4H8WL 5DQJB 5JMOC 2FATH 3BD5A 1XGQA 4LBEA 1I3VA 3FQRB 5JW3L 3S34H 1JPST 1U8NA 1A6AA 3DUSB 5TDOA 3ZTJG 5I1CH 4KDVA 1A4KB 2X70A 3WIIL 2X2YA 3LQAH 4LCWA 3DSFH 3PQYA 1U93B 5IHUL 2B20A 4QYOA 5F7EH 1B3JA 3UTSD 5J06A 3UMTA 3G04A 1V8HA 1UEMA 3WE6A 4JY4B 1WC7A 4HW6A 4IOIB 1EIBA 5I8OH 1VA9A 1T03H 4XI5C 4YDKL 1NAMA 3RGVB 1WGOA 2IANB 2XNAB 1EHLH 4YHZH 4KKAD 5JLZA 1I1AB 2DQEL 3IDNB 2NY4B 1NCNA 3F65A 1Z5LA 3NGBC 2OBGA 1FG2B 3GSXA 1U2HA 2D0GA 5FYKE 3T3PE 2R69H 2AEPL 1LO5B 2AVGA 1J0HA 3NPZB 2OX5A 1HSBB 1TZIA 1OL0A 3Q3GA 1ND0B 5F3BB 4KKLC 5HYQA 2FJGA 1IAIH 5LCVL 4NT6A 5CEZE 4K8RL 1XGTB 4I9WE 5C0JB 1P7KB 2XWJA 4R6UA 1QPPA 1MHEA 4HUUA 1B0GA 1MWAA 3VI3E 3ZYOA 3IDIA 4I5BA 2JLLA 3VXTA 1BBDH 1S9WB 2CIIA 4JG0H 3OR6A 1M7IA 4YK4C 4Z7VA 3TIDB 4CMMB 4JFED 4X80L 1KENL 1KOAA 4BFGA 3FAWA 3MLXH 3S37L 5CEZH 5DMGC 5HGHA 2AQ1A 5TE6H 4YXKH 2Y6SC 2ZJSL 4EJ1C 2GYSA 4M7JL 1HZHL 3ELAT 3KPLA 1J12A 1G7PA 1QP1A 4HT1L 4HUWA 3GB7A 4G5ZL 1ZS8A 2PCPB 5D71L 3QDJE 1K6QL 5BZDB 4PB0L 3MMEA 3EGSA 4ZOBA 3BRDA 1DSFL 5J89A 5EZJA 1UJ3B 5HPMA 3BUYB 4L3ED 1RZKC 4HFUL 3O9WB 5KTEH 1KF9B 1Q9OA 1K8DB 2MQ3A 1QSEE 2WUBL 3KPSD 4Y8AA 3NA9L 1A2YA 4G6KL 3C6LA 5F7WC 4AENA 4HWBL 2VDOL 4JO2L 3BN9D 2NY2D 2RCSL 2VZ3A 4GXVH 4RISL 2VR5A 4WCYH 4TPRH 5EOTB 1EGJH 4PBWD 5EDXA 3LCYA 4K8RD 4EQ3A 5DJAA 4KGJA 5GZND 1XF2B 1A9EB 2IH1B 5E94B 4LCUA 2NXZC 1AC6A 4JFPA 1I9IL 2HTLC 3MCLH 5KAQG 3KYOB 4E41E 3U0TB 5T1KB 1S7XA 1VKXB 3PJSB 1JVKA 4L4JA 5KSAB 3D3VA 2W0FB 1QRNA 2C3HA 1BFOA 1P1ZA 4PLKC 3QDMB 3WIHH 4KVCH 3FQXA 1X5LA 3C5JA 3DMMC 2IPKA 1D5BB 4F9LC 4XVSH 4U1GB 4LEOB 5CJOH 4IMKC 4F37F 2BVEA 4HV8B 4OZHB 1KIPA 4JRYD 5BS0B 4X98A 4KI5C 1IEHA 1LVEA 4KRNA 4YO0B 4ZSOA 4LU5H 2R0WH 2C9AA 1D6VH 3DWTA 3UJJH 3PWPA 1K5NB 1OARL 3KPRD 5K33A 3T04D 5KSVB 2JJWA 3DIFA 3CD4A 4NYLB 25C8H 3ZKSD 4GMTH 4QHLB 5C0BB 3LIZH 5DRZA 3JWOH 3QRGL 3KYNA 4NO5B 4P23D 4QTHA 2DB8A 2FRGP 1OWWA 1WCQA 5HGBA 1HI6A 3IJYB 1ZMYA 1BWMA 2DQDH 4X5WB 4TSCH 1BMGA 3LN4A 4LF3B 4X9HA 1XR9B 1EO5A 1J1XL 4QOKE 5I1DB 3WS3A 4TUOA 3N85H 5KOVC 3O2DA 1AIFB 1NCDH 3X13A 4QHMA 1YEHL 2FBJH 3K3QA 4X6CE 1A0QH 3WFHA 2WP3T 3RKDD 5IESL 4J1UA 1MFEH 1OF2B 3SDXF 4OZIF 1HSAA 5ITBL 4PRPE 1WVZA 4G7YH 1EXUB 3MLYL 1C1EL 5BVJB 1AC0A 1T22B 2FL5A 3PG2A 3QXDA 2IEPA 4FTVE 1G9EA 4Q6IC 4L3CA 3GSVB 3VWJD 2A83A 3GJFH 4YDIL 1MI5E 4WEUD 4NQEB 5E95B 4HXBH 1I7RA 3U46B 3IGAA 2GT9B 5IWLA 1CLOH 5A43C 4KHXH 2ADJA 4WFGD 4KHTL 3A6CH 4OIIL 1I8KA 1JMZA 4RMUA 5IR1A 4KROB 5MI0B 2WBWB 2ATKB 2R0ZH 3OJDB 3L6FA 3OXRB 4ZOAA 5GPRA 1Q38A 3TBVB 3MREA 3RI5F 4GKOA 3PL6C 1EO8L 1DQML 4MXQC 1MRDH 2BNRA 3SEPA 1YEGH 1ADQL 4UDTB 5C09D 5I17B 4CRPA 1CIDA 2KL6A 3DRQB 3RA7L 4RRPA 1CYGA 5B8CB 2EO1A 5DK2A 3T0AA 3LKPA 2AJVL 3QIWA 5DURB 4JN2B 5IFAH 2O26U 3X14B 2OZ4A 1AGFA 4QCIA 1G9NH 3SCMB 2EDLA 3MCG1 5ESVB 4LRNL 1CGTA 4JZOB 2VLKE 3FB7A 5I1IH 3B9EA 3C60C 4KTYA 4HIHB 1VENA 2Z31A 4ODWA 4YBQC 2AW2A 5D70H 3V5KA 1RHFA 1TXKA 2GEEA 3CVHL 4XP9L 4ETQA 4I0PC 8FABA 6FABL 2XA8L 4YZFF 2PYEA 3K8MA 4HUVB 2OS7A 1NGYB 1PY4A 4LCCB 3PWNA 3VXPA 1N5AB 1INDL 1MRFL 2YEZA 4JO4H 4ZPTA 1XF4B 2VLME 3IU4L 1MCEA 4R90L 1BEYH 3KWWB 2IF7A 4DFHA 5A2LH 2EDQA 5BVPL 4UOW0 5GISL 3VGFA 3G5ZB 3BQUD 3JV4A 3IFOA 5B38B 3VFGH 1GGYA 5CMAB 2WZPD 5ICXB 4OSUL 5EBLA 5KG9A 2VR4A 4CW1A 3L3GB 4M1DH 4OTXH 1BLNA 4OFVA 1QVOA 1CTOA 3VFRB 3QDJB 1II4E 5CP7B 3D18A 5DUML 1A21A 3UC0H 2X89A 3NCBB 4PJXA 4X6DE 4ODHH 3KYMA 3L5IA 5LJYH 3S3JA 3L5WB 2X4OB 5BXFB 3SGKA 2H2PC 4PGEA 3VW3H 4JY6A 2ZUVA 5EUOA 4ELME 2PTVA 4PV8B 5GGTA 1U3HC 1ZK9A 1LQSR 5E5RB 1JZ2A 3HA0A 1DBKL 1Q9LA 3T2NH 3V79C 2VUYA 3RZWA 2WSKA 4XCYB 1JWSA 5L2KE 3MYJA 4MNGA 4D8PA 2CXGA 2P46B 3VFMB 3QFDA 2W60B 2OR9H 3P2TA 4M02A 1ZVHA 3V6FA 4OBRA 1MHCB 3O4LD 4LSUH 4JN1L 3JWNC 1C5CL 1FVDB 1YY9D 3FHAA 5J6HB 2OP4H 3WLBA 3OKDA 4NBXB 3MRIB 3VXNA 4L9DA 3NCYS 4OZGE 4ENED 1NC2A 3FN3A 4U1KB 1C16B 1JRHH 4KFZC 2VLRA 4POZD 3QUYD 5DYOA 5J12C 1DZBA 2P5ED 5ISZD 4HHAA 1AFVH 2XN9A 3ILQD 1SJEA 5T3XE 1NKRA 1EBPA 4CVXA 4AEEA 1FNEA 2NXYC 4NRYB 4MJ5A 2V7HA 3C5SA 4PUBH 4UQ2A 3A6OA 2AV7A 3U30C 5BRZE 3EOBB 3T65A 3QO1A 2EDEA 1HYRC 4GQPH 3VJ6A 4FZEH 1OAUH 3GMNA 1JWMB 3LEYL 4JANA 1NCAH 2GW5A 3TJHC 1KIQA 4Y4FD 3A6BH 4WDIB 1JPGB 3SO3C 4LIQH 3CCHB 3IVKB 4KJYA 3S6CA 4Y88A 5TE4H 1TJGH 1X7QA 3MSPA 1KT2A 3SDAB 4MA1B 5F7HA 5B3NA 1S7RB 4QOKB 3D87B 4R4FL 3VI4E 1YNKH 12E8H 5F88B 1A5FL 1N8ZA 4HX1A 2WQ8A 5FUZL 3O8XC 4HMEA 3GJFB 4H0GA 4PLJC 4Q2ZB 3QNZA 5EO9B 3WIFA 4WW2F 5IW1A 1CTNA 1Q9KB 4RAUB 3TNMA 4JM2C 4LGSB 3DUUA 2GK2A 4ZG1A 4D0CA 3O6KH 4OGAD 2DQGL 2AI0H 5SX4I 1KJ2H 1B9ZA 1DBMH 5F1IB 3VGHA 1HHJA 4G8GA 5JOFA 4U1SA 4FTVB 3BPCA 1FHGA 4MJ6A 1JPFB 3BKYH 1MI5B 1P4IH 2VISB 4P5KA 1MIEL 3VFTB 1ODAA 4XBPA 4E0RB 5BW7A 4BZ1H 1DBJL 4KH2A 2Q8AH 4LSPH 1NLDL 3WFEL 4L4TE 4M8QB 3L7FB 4LGRB 1J8HA 3H3PH 5DUPL 1WAAF 1VGEL 1IE5A 3QUKA 4PGJA 3S37X 4ZFOL 3BX7C 3CAFA 5I8KL 2W59A 3FQWB 1AXTL 1GC1L 4Y16B 1DUYA 3KXFA 4QY8A 5FDYA 2ZSVA 3WKMH 3ULSA 3CFEA 2BFVL 3EDEA 3VXUA 5D7JD 5CUSH 2MJWA 2DJ4A 2AXFA 2GITA 3AREB 3AXLA 3RPIB 4TSAH 3E3QE 5DA0B 2N7BA 4NKOB 3CZJA 1OGAA 5I74C 1NBYB 2AJUL 4RQQA 2DWDB 3IT8D 3AB0B 2V2XB 4TVPE 2K3TA 3RBSA 4PD4J 4GLRH 5JHDB 4R7NB 3C8HA 3VFSB 1KFAL 1ZKAA 2WBJB 3ROLA 1D5IH 3VWKD 4GMSH 4EKXA 2VLKB 1ZHKA 4DZ8B 2NY3D 3IRPX 1UQSA 3GM8A 3U0WH 4JZJA 4LK4A 3RWDA 1MVFA 3C9NA 4JDTH 4S1DC 4OFPA 2AP2A 2QV2A 4ZTPH 3KYKL 4N0FB 1MPAL 5DHYA 3BH9B 4Y4KA 1LGVA 3BZDA 4TVPH 3JVGA 3MOQA 4P4KA 1IKFH 3FAXA 4ONFH 2DBLH 2I07B 3BKCL 4GG6E 3RAJH 3ULVH 3HCVA 2WWKO 2BK8A 2DLTA 4L5FH 2VDLH 4R8WH 3SDCA 5C0DA 1B6DA 5D1XB 4O9HL 4YHKL 1KLGA 1RUPL 1TCRA 4HKBA 4KKAC 3BZEA 4O58H 4JG1L 4IRSC 1KIUA 2NZIA 4MJ4A 1LO2H 2D03H 2IALB 4YDVA 4NQCE