1BZ9B

Crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CLASS I HISTOCOMPATIBILITY ANTIGEN)
publication title Structural evidence of T cell xeno-reactivity in the absence of molecular mimicry.
pubmed doi rcsb
source organism Mus musculus
molecule tags Murine class i mhc/peptide complex
total genus 15
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bz9B00
1T80A 1MFBL 4KKCD 4PUBH 3MLYL 4CUCA 1UH4A 1GOHA 3ZTNL 5EO1A 4IRSC 2MOVA 5IW1B 1ODAA 3QCVL 3RNKB 5DFWH 1MRCL 1K8IA 3TLRA 5GZOD 4J6RH 3KYNB 3ARFD 4F57H 1IC4L 2EEDA 2R0ZL 3BIBX 3GKZA 4QRPE 5B8CC 5KOVC 3LRSB 2VAJA 4NC1C 5TQ2L 3N9GL 1NLDH 4BZ1L 2IPTL 1G7IA 2W9DH 3RGHA 4PRDA 3CDYA 4K71C 5J06A 2VR4A 3GNML 1JHKL 5EZIL 4JQIH 4QHKJ 1P1ZA 3OL2A 2D9QB 1OAZL 2HLFD 3LZFL 1CYGA 1T5XB 1OD7A 2APFA 2VDKH 3MRFB 5IJVB 3OGCB 4QHKI 1MCOL 3M8OL 5C3TA 1VCAA 3FTGA 4CADA 1AY1H 3AMLA 3KXFB 1SEQH 3V0VB 4JZOB 4ZNEE 1BEYH 4YPGB 4LARL 3MRBA 2CXGA 5DD6A 5GSVA 1RZFL 5EG6C 1WZ1H 1AP2B 3DYPA 3UTSE 4PJFA 1OP3K 2F9BT 5KZCD 1EAJA 1JE6A 1FBIL 4HV8A 1RIUL 3S37H 5I18H 4ZXBA 5AZEL 4LDLB 3K2MC 3IXAA 3DRQA 5ANMA 4AEIL 4OQTA 4XMLL 5KW9H 3TVMC 4JDZB 5AG8A 5J13B 2BERA 4MNQB 4MD4A 3DROA 4RAVA 3MGAA 3PDOA 3P9LB 1NANH 3MROA 3IJSB 1MCBA 5IB2A 3FRUB 1T83C 4G9FB 4JANA 4ODSL 3WJJC 1OAQL 2W1NA 1G9EA 3CXHJ 2FH8A 2NZ9C 4UIMB 4MJ6A 5FV1L 3WKNA 1NUDA 3NTCL 4J8RA 4OZIE 2O5XL 7FABH 1I9EA 1A6TA 1S9KC 4N0YL 4GMSH 2CXKA 5L7XL 5IOPA 5I1DA 5CEXB 1HEZB 2WBWB 1AKJA 1XGPA 1TVBB 5AZ2H 3BD5A 1RIHL 4JHAL 1SBSH 5EUOE 4DKDC 4JKKA 5BRZD 3V6OC 3TA3C 3ILQD 3P77A 1EO8L 3DURB 5DA0B 4FQIH 3FKUS 4F15C 1GH7A 3KR3H 4DW2H 1PBYA 3PABA 1LO5A 2I5YL 1HWGB 4HULB 3DGGB 3HE6C 4YHML 1F00I 3QHZH 1B0WA 1KPUA 1S7XB 3FO0H 4LCWB 2OR8A 4C58B 2FR4A 2HN7B 1UJ3A 2AW2A 2YK1L 2OSLA 3NFPB 4WDIB 2CLZA 1PKOA 3HMWL 3EBAA 4BZYA 1KPVB 3QUXC 4JFEA 2UYLB 4MCYB 3VH8B 2WZPD 4X4MA 3QRFM 1OP5K 2NY6D 4JFFB 4OF5A 1JPSH 5GGVL 1G6RB 4JM2B 2P5EE 3O4LE 1AI1H 3J7HA 4BQ9A 2XZCH 3QIBD 4GLRH 4X6DB 3WDHA 4MXVE 1NUFA 4JDVA 4JKPH 5LKNA 4YHZL 2CDGA 1VFBB 2DYPD 4LSPL 5J57B 1KELL 1BZ9A 4LBEB 1E4KA 3JTTB 4LHQB 5LG1A 3VRIB 3JWDC 2GJ6B 3MLZL 4RZCA 4UIMA 5F97E 5EC2B 1S9YB 5D70H 2BOBA 2G5BB 3VRJA 1M7XA 3SBWC 1KCVH 1Y6NR 4XPTH 1T04A 4HWBH 5DK3A 1UCBH 3CMOL 1DN2A 3V7AG 1ZHKB 3CJJA 4DCQA 3S3PA 2EDBA 5MEOA 1FNFA 5CHNB 4NOFA 5D7SL 1QYGH 5DVKA 4XP5L 3L1OL 3R4DA 3T0DA 2ZNWA 4LSVL 4XBGA 3DURA 8FABA 4P2YA 1MCHA 2HJLB 2HVJA 1XF4A 3GM8A 1B0RB 3L7FA 5DDHB 5C0AE 3HZVA 4UOW1 3IVKB 3IGAA 3PWLB 5IWLC 1BD2B 3Q48A 3O9WA 4KUZL 2YEZA 1W0YT 3DGGA 5T3XE 1A7OH 3NZHH 1BFOA 4PJGE 1LP9F 1A14L 4LCCC 3IT8D 1JZ3A 3AAZA 2R2BB 2BVEA 4P3CL 3GFUA 1P4IH 5D2LE 1DBMH 2HVKB 2FIKA 5DI8A 5A43C 1AGCB 1X5GA 5EORL 5DVLA 4MNHB 1F90L 4G6KH 5E99L 3ZKSD 1FLRH 4ZFGH 4JM2A 2BRRL 4FTVB 2B4CC 5I74C 3EYSL 4K3DL 1CVSC 1DLHB 1QKZL 2XXCB 4OZHE 5CMAA 4Z7UF 1KJ2L 2B2XH 3REVB 1IKNA 2ITCB 4PGDB 5DJ8A 5LWYH 1EJ6A 4KV5F 1FE8H 1Q0YL 5DJAA 2AJ3B 4OCMC 1RUKH 32C2B 4P23A 2IBZY 4XVSL 3MGTA 2FEEL 4QXTB 3MNWA 3L5JA 4LMQE 2PN5A 1J0JA 1L0XA 4GQ9L 2HJFB 4R4BB 5H37H 1EJOH 1IARB 2WIIB 4OCSL 4RA0C 1U8LA 1AIFB 4M8VA 1GZPA 2QADB 1AHWC 1RV6X 4OKDA 2R2EA 3HMXL 3VXNB 1A7NH 4YBHA 5E2VL 2DQJL 5DJXB 1F4XL 2V7NB 3LHPL 1LWRA 4NQSB 2A2QT 4I3RH 1BGXH 3EOBA 4HFUH 3FAWA 2X9XA 4WI3A 1ZT4B 4I5BB 4EI5D 5C0FA 1MFBH 1U0QA 1U8HA 4JFPA 3MLYH 1B0RA 2WV3A 1H5BA 3ZTNH 4X6BB 1FFNA 2OTWA 1MELA 4ETYA 4XXDB 2RBLA 4MD0B 1ROWA 3QCVH 4C54A 3IDGB 1FLTX 4YDJB 3LEVL 1DQQA 4QTHB 1SVCP 1NKRA 3BHBA 4F7EB 5CS7A 1IC4H 3I6LE 3ZTJG 1DBBL 5DQ9B 2FB4L 2UVFA 4M5ZH 5IQ9B 2J7LA 1CFSB 2X4UB 2FHBA 1IBGL 3MRIA 3TYGL 3VWJA 3ZHKA 5TQ2H 1ITBB 3N9GH 2DM4A 2Y06L 4BZ1H 2IPTH 3T4AA 3DO3A 1SJVA 3IYLW 3BGMB 4DN3L 4DVBA 5E8NB 1JHKH 1MQKH 4ZUVB 4Z7OE 4P2QA 3ARFA 1ADQA 5C0DA 8CGTA 1EVUA 1YEHL 2VL5A 1VGKB 1FDLL 1OAZH 2AJXL 3LZFH 4FXKA 3KPMA 5ISZD 2G75A 3M07A 2QHRH 2VKWA 1MCOH 4NQTA 3VW3L 3SY0B 2MPAL 3M8OH 5INDA 2AEPL 3WO3B 4HS8L 5FAAA 4XWOC 3HB3C 4O02L 3MFFA 1RZFH 1H15B 4YHLL 4OKVA 1RIUH 1LEIB 4K7FB 5EO0B 3QUYC 1RZJL 1QO3A 5AZEH 1BIIA 4I18A 4WUKL 3EHBD 4AEIH 2FX7L 3VFTA 2OBGA 5EA0L 2OZ4L 1I7TB 1I1CA 3DMMB 1RMFL 4XCEA 2D7QA 1YEDA 3HNTL 5LVEA 5A16B 4ETQB 3BZEA 4BK5A 1VERA 3ZSTA 4ODSH 3KYOB 4EN3A 1OAQH 4RGND 3IETB 4YGVA 5D7IB 2NLJA 2QEJA 5DC9B 4K3EL 5SX5H 4DFHA 3NFNA 1MLBA 2H26A 1A9EA 4MD0A 3DO7A 3IDGA 3NTCH 6CGTA 2O5XH 4U6YB 4G6AD 1QPXA 5ICYB 4F37K 2NY2C 3QIWC 1WAAF 1WWCA 2V5YA 5T1MB 2DYPB 3EYOB 4N0YH 3VE0B 4YH6A 1G0DA 2VQUA 5L7XH 4XVUC 1KLUB 4GKZB 2A6DA 1LMKA 4JQXC 3CVHA 4AEEA 2DN7A 4HG4J 2OL3A 5DF0A 1U91A 4FQLL 4HKJA 1RIHH 3MZTA 4JHAH 4WTXA 4WHYG 5ANME 4S10A 2ZUWA 3CGTA 3GSVB 3P4OB 2BVYA 3WJLA 2EDKA 1A2YB 5MHSD 2C3HA 4X9FA 4OF6A 5BRZA 2OQJA 4NRZB 4N8CL 4YHOL 1T66D 2DTML 2YK1H 3NIGE 1JGLL 1WGOA 4BH7A 4J23A 3I75B 2EXWD 3LEYL 4PLNC 1FG2B 4HZAA 4XRCA 2Q6WB 1ZT7A 2AV1B 3QIUC 4CBPA 1AE6H 5GZND 1T4KB 1FSKC 5GGVH 4FRWA 4XC1H 3NA9L 2E8ZA 4W68A 3SGKA 2VLJB 4KI1A 3E1F1 3PP3K 4U2ZA 4ZYKA 3BEVA 3ZT5A 4YHZH 5SV3A 3MRRA 4DZ8B 4LSPH 2AK4D 5C0CD 1KELH 2JELL 2EDEA 1M7DB 4L5FL 4Y7MA 2IWGA 1IGIH 3MLZH 4E5XB 3WMSA 4PJBF 3QIBA 1PJ9A 2CGRL 4L8SC 3E0GA 1YNKL 4P5KB 5DVNA 1NFDF 4YIQB 2FYYA 2YD6A 4NNXA 1CE6B 3CMOH 4JO4L 2X4OA 5EBLB 3NCYP 5JHDD 3IDYC 4JFEE 2ED8A 4X4ME 5D7SH 2A6KB 1J0IA 5HHPA 3GSWB 2DI7A 3CC5B 4PRHD 4XP5H 4RFNC 5JZ7C 5F71A 3I50L 4KMTL 4LSVH 1S78C 4OGYL 4HT1L 1IGJA 3JWOC 1UKTA 4G3YL 5HHOD 4MA3A 3JTSA 3FQRA 3QNXB 1QFHA 2HLAB 5TDOB 5MEPA 5TDPA 4KUZH 4ODWA 3V5DB 3QEUB 5FA4B 4YFDB 5I8EB 2B1HH 4G6FD 1QLFA 4ODBD 3DETC 1A14H 4YHYC 4PJ7B 5JO5A 3GSNB 4NO3B 4P3CH 5TQ0L 1LP9A 5EORH 3PGCA 5E99H 3CVIL 3EDDA 2QV2A 4UT7L 3TNMB 1AO7B 4AH2A 2UZYB 4JPIB 3MNZB 4M7ZC 2BRRH 3OJ2C 2YMXL 3EYSH 1B4JL 1BJ1J 4K3DH 4XNUH 3BH9B 2PR4L 4Q2ZA 1HQ4B 2YWZA 1VDGA 3VA6A 4NYLB 1FIGL 2Z0BA 4MNGA 4ZFZA 1QEWB 1KJ2H 3RWJB 4Z7UA 3B4NA 1N5AA 1N59B 1CDCA 4Y5YA 1N0LA 3LRHA 5SWQA 5BW7C 1YMMB 1Q0YH 3MCKA 5F7FA 4CVZB 3MJ7B 3Q5TA 2IFFL 3T2QA 3B43A 4XVSH 3U1SL 5I16B 2CRZA 3A6CL 3TO4D 1EEYA 3GZKA 4GQ9H 3W9EB 4JCLA 3ZKQD 4OCSH 2XPGB 1TZIA 2OK0H 3MBEB 4HMCA 3QDGD 3HMXH 3NIDF 2YA1A 1WCBB 5E2VH 2DQJH 1P5VA 1F4XH 4LQFL 4CU7A 1ZVSA 3O3BB 4NQUA 4Z7WB 3GSWA 4I0PA 4U6HA 4W4OC 1FZJA 4BFEA 4NN6B 4ZG1A 3UBXI 1X5AA 5IV2B 1GVIA 1G7LA 4F7TB 5TDOA 5TPWL 4R7NB 3RBGA 4OD1H 3B5TA 3V5DA 1JBJA 2VXQL 5FA4A 3PHSA 3BFOA 3UTQA 4PRNA 3RHWF 3PWPD 3LEVH 3ULVL 4EI5A 3RX5A 1JF6A 4I4WA 5C8JB 1ZANL 5DZOA 5KANI 2FB4H 5JW4N 5FB8A 2EDTA 5CIPA 1NCTA 2ZSVA 3TNMA 1IBGH 4OF3A 3TYGH 2XTJC 5CWSB 2Y06H 3RWDB 4PS4L 4WO4C 1TJIL 4YDVB 2LU7A 2PCPA 3RL2A 3ZT7A 1YEHH 4ZOBA 1FDLH 2AJXH 4U1LB 5CSBA 2J6EL 2BSSB 3ZKMC 4K9EL 1MAML 5GGRB 5IB5A 2Q7NA 3U7YL 3QI9C 1M4KA 2O5YL 3RWCB 5AD0A 2XA3A 5FKPB 3VW3H 3VFSA 3UAJC 9CGTA 5IUSA 4TNWF 3MJ7A 2P43B 4LQ1A 4HS8H 3SOBL 1TJHL 5E5MB 4AEFA 3EYUH 4YAQB 4O02H 1J86A 5C0ND 2DM7A 3W9EA 4WEUD 3FQNA 5ISZA 2DMBA 3MC0A 3IFPB 4OI7A 4XWGL 1JPTL 1KTKE 1R3HB 3HHRB 1DQMH 4YHLH 4HS6A 4PRID 1SY6H 4NC2B 2HH0L 1RZJH 5IEHB 5HI3C 1PG7X 4WUKH 1BLNB 2FX7H 4M02A 3TNNA 3SDAB 2OZ4H 4AJ0A 1F4YL 4KRPD 1RMFH 3GMMA 5DFVD 1CL7I 1KENL 3QNZB 1QHPA 3ARRA 1CDHA 2P45B 5D1XD 4X83A 3UBXG 4F9LC 1Q9OA 4XCCL 5IVXB 4HIIA 4F7TA 3D39D 2NPLX 5C09D 3UTTB 2GK0A 1NCNA 5E6IB 4K3EH 1DEEB 4Z78B 3HAEG 1RZGB 1T1XA 1RJYA 1XT5A 4KJYB 3BZDA 3RBSA 3WE6A 2AEWA 5C0CB 3JV6B 4P0DA 1DR9A 3L3DA 4KK5D 1WAAA 5KANG 1OTUD 3U4BL 3D69A 1NFDB 1GOFA 4OGAD 3O6FC 5C0EA 5B4MD 3LQAL 4D9QD 2BVQA 4FQLH 2AJUL 5TJWK 4S1SL 5IHZA 4ODXB 1BQLL 1Z2KA 3CDCA 1T7VA 1MVUA 4OB5L 4R2GB 2VXVH 1JUFA 2K3TA 3GRWA 2MHAB 5JHDB 1NGQL 3RI5K 1QVOA 4KPHL 4W70A 5IMKA 1OP9A 4N8CH 4MA1B 1KB9J 4YHOH 2DTMH 1FZMB 5T1KB 2BZDA 3S96B 4NWTH 5HHOB 2IMNA 4MXQD 3VFWA 1ZGLA 1TDQA 3MLUL 3RZCB 3V6BR 3CPLA 4EXKA 3LEYH 2W60A 2WQRA 3VMNA 1MFCL 1MF2L 2VN7A 2BNQD 5GJTL 5T1DL 3H9HB 3OAYK 1OAXL 5IEHA 4G6FB 3NA9H 2CLRA 3RDTC 3RWHA 5HYJB 4NJAL 1U8IB 2ADJB 5KG9B 4MDJB 2O5ZL 4WUUD 2XRAL 3C2AL 3FHQA 2YPVL 4FQXD 2JELH 3C6LD 4L5FH 1HXYB 2F54D 1K5NB 3T0VA 1JTTA 5IW3A 3WIFB 4LLYB 1U95B 5IG7A 1ERNA 2VAAB 1IAIM 3CDGA 5BRZE 2CGRH 4LIQE 4NO5A 4PJBA 1PY9A 1YNKH 1U8KA 2AK4A 4J1UA 5A2IH 4JO4H 1QBML 1NFDA 5EUKA 5JPNB 4Z8FL 4LPCA 3RY6A 5C9JB 1MFNA 4HGWA 1ORQB 1MNUL 4JO3L 5HVWA 2CKBL 4Y88A 1CE1L 5L8LB 2GI7A 2I07A 4D9RD 5DMYA 5I1HL 4ODXA 3T04D 3I50H 4KMTH 4HW6A 4HT1H 4G3YH 2NW3B 5F7KC 3CFKA 4RGOL 1RUAL 3W9DB 2AXGA 3QDGB 5JHDA 5F1KC 1J0YA 3RVUD 5E2JA 4PRHA 2W0FA 1LEGA 4UBDC 3KPRA 3GDBA 4CMHC 4PJXB 3U30B 3VXOB 3MBXH 4QHNA 4M1GL 5TQ0H 3MCG1 4ONOA 4TSBL 43CAA 4HCRL 3ELAT 5KVGL 1EX0A 3UPAA 1BIHA 3CVIH 3MA7B 4UT7H 1C5CL 2DDQL 3L7EB 4CMMB 2DM2A 3UYRL 2YMXH 1B4JH 2PR4H 4MDJA 5ITBL 4PJDF 1E6OL 1K85A 4JGUA 1FIGH 3L5HA 5I73C 2WK2A 2LFGA 1J8HD 4JG1L 4L1DA 3C5JB 3OZ9L 1OWRM 4I48B 2MKLC 1CDYA 4ODVL 3W11C 4PJ9B 4AIXA 4X6EB 1ZHNB 2IFFH 3IDXL 3TZVD 3U1SH 1I1AC 2IAMD 3A6CH 2IQAB 4R4NC 3NN8A 1HCVA 4BUHA 2EEAA 3QISA 4WNQA 5F9DC 3O4OB 3D18B 4OLWL 1RK0B 3V6ZB 3FAXA 1LP9E 3KLAB 1BPVA 4E9LA 3SGEH 4BFGA 4G42B 3B9KC 3QO1B 1INEL 3MUGA 2BOCB 4LQFH 4ZPTB 1SJXA 1YEJL 4Z76A 1CXFA 1XCQB 2UY6A 2C1PB 3TO4A 1Z3GL 4BQ6A 2VLMD 3T09A 3VXPA 1R5IA 1QPPA 3E8UL 4H1LG 2ED7A 3KPLB 3OKNB 1FGNL 4IRJB 5IGXL 1PZ5B 4O9HL 1WK0A 5KJRL 3F7VA 4MNGE 4M43L 1QBLH 5TPWH 4G43A 5CZXD 5I1LA 5BZWB 3VGAC 3PWVA 3QPXL 2D7NA 2UZIH 2ID5A 4Z7UE 4YDKL 4ZO7A 3ZZ1A 1Z0NA 5JMOC 1NCDL 4G8FA 3E6HB 4KV5E 3ULVH 4RMUA 5F9OL 1W8OA 4EDWL 4KKBC 5I8CB 3S9DB 5J1SC 2BJML 4DZBA 3RIAF 1GRWA 3K1KC 3RWFB 1BBJA 2HTLC 3S88L 1E4WL 3FB8A 1TJIH 3BQUC 5JTWA 3DECA 3PWPA 1KUMA 3QJHA 5L9DL 5E7FA 4KXZH 3VU2A 4J7RA 1IAOA 2W07A 4RWHA 1P7QD 1KFAL 4KK9D 3MUZ1 2J6EH 2F5AL 3B9EA 3MMEB 1T1YA 4K9EH 3PL6C 3D85B 4WJ5B 4NN7B 5EZLA 2O5YH 2AXJA 1S9XB 2KKQA 1TJHH 1UWGH 2NX5B 3GHEL 5HYQB 5J12B 4ZOEA 3MJ8B 2FHCA 2JIXB 1JPTH 4PJ7E 2DKSA 1ZLSL 4RNRA 4ERSL 1FAIL 4Y2DB 1PDKA 5JDSB 4HUKB 1FL5B 3DPBA 3LKQA 1F4YH 1JHTA 5DJ0A 2HG5A 1KENH 4JGMA 2ZJSH 4MSWA 4JRYD 4M7LL 2CIIA 4PD4K 4XCCH 5CAYB 5D96C 4PRIA 3WXVL 3QXVA 5IMMB 1ED3A 4HWBA 4PRPB 5H8DA 1F3JA 4AIZB 1HDMB 1UM5L 4JRXB 1V7NL 1IC1A 1I4FB 1NCAL 1NAML 4NFBA 5D1XA 3BXNB 5IBTL 3ZYIA 3K8MA 5I8CA 4CU8A 4LLDB 4GRLB 4NQXA 1DVFC 4WRLA 3C6LB 3D39A 2XICA 5C09A 3RWGB 2F54B 5ISZE 4X8JB 3QCTL 4Y4KC 2V2WB 4ZUUA 2J8OA 3LQAH 3RY4A 3SDYL 2AJUH 2MCG1 3MV9D 4YXLL 4S1SH 2XQBL 2Z35A 1UZ8A 4LLMA 5FUZL 4Z7WE 3QUMH 1BQLH 5J1AA 1D5XB 2NNAB 4RIRA 4Y8DC 3TCXA 1NGQH 1T5WA 1I9RL 4KPHH 5HVGB 1WIPA 4PP1D 3H6JA 4X7SL 5ACZB 3LMJL 1OTTC 1U2CA 3AGVA 4APQD 4L4JA 2HRPL 3WS6C 3M17B 3MO1B 1NGYA 4U1HB 1PSKL 2YUXA 3U46A 3MLUH 3RJQB 2VIRA 1F6AA 1NMCB 4LRIC 5GRJH 1S8DA 3EFFB 1MFCH 3FQUB 5I6XC 2GSIB 3KWWB 1WAAE 1OAXH 2NY5L 5CD5D 5HI4D 4RGNE 5DK0B 1S7SB 1JNHA 2O5ZH 4M9OA 4OJFH 2XRAH 3C2AH 4O2CA 5MENB 3EO1A 2YPVH 2FJFA 3HPJB 3TP4A 4I1NB 1FP5A 1RZ7L 2BNQA 4NM4H 3BP4A 3S97C 4LLVB 1DLFH 4NBYB 2V7HA 4TUKL 4JZNA 4EKXA 2D4DA 3ARGB 4WUUA 4F3FA 4RA3A 1IAIL 2DIJA 2P42B 3HE7D 1J8HB 2XXMB 4PJEF 2JJUA 4FQXA 2P4AB 4GFTB 2ZZUT 1QBMH 5KSVB 2Q86B 1KYOK 2AV7B 1OB1A 2DL2A 3V8OA 1NJ9B 3TZVB 1MNUH 4NCDA 4JO3H 5MHSE 2CKBH 1CE1H 5I1HH 5DQJB 5F8RC 4PLJD 4IOFD 5JIKA 1JN6B 1HHHB 2NXYC 2W9LA 4RGOH 2EYSA 3QXWA 4KH2A 4PRBB 3TJEL 3UYPA 4U1MB 3BUTA 3BO8A 4X5XB 2QHLA 4WIQA 1WCQA 5C6TL 5CZKA 5ACZA 3JBG7 1TPXB 4R7DA 1RHHB 4PJHF 3S35X 3TN0C 5BCAA 3PGFL 1TIUA 2DL9A 2F58L 5C0JB 1EEZA 3BH8B 4M1GH 1LNUB 5HPMA 4TSBH 5JQ6L 2F8VA 3ARDD 4HCRH 3LSOA 3DXAA 3QDJD 3EFFA 4PJBE 2F19L 5KVGH 2ZNXA 1M05B 1QP1A 3VD5A 5I76A 2AK4E 2GSIA 4JY4B 5DJZB 1WZLA 1C5CH 2DDQH 5GGTL 5HVHB 1NFDE 3GMLA 5E8OA 3HNVL 4WY7L 3UYRH 3D25A 3SDDC 5ITBH 1H0DB 1E6OH 5HBBA 1ETZB 1MFDH 4KDTC 3CX5J 4PJDA 5SWZD 2FO1A 1LQSR 1IRAY 2PO6D 3PUCA 4PGEB 4JG1H 3OZ9H 3HRPA 1XF2A 3HPJA 4I8DA 4BM7A 1RFDL 3QUZA 5EZOL 4LLVA 4ODVH 3AS3A 5JHDE 1CT8B 4MQSB 4PG2C 4X5WA 4N8VG 1GZQA 1W2KT 3IDXH 2R0LL 4DGIL 4K07A 3RVTC 1EHNA 4PRHE 1P7QB 3ARUA 2Z8RA 1IM3B 3VD7A 5HHOE 3QULB 5F9JB 4ZAKC 4OLWH 5GS2H 1XF3A 5DYOA 4Y4HB 3L3GA 4NQCB 4QOKD 3DX8A 1T2XA 1INEH 1NCBL 1OF2A 4ZD3L 4I13B 3RFZC 3LS5H 3BISA 2IAMA 1TQCC 3FJTA 3FB6B 1Z3GH 4UV7L 4HLZH 3EAKA 1AGBB 3E8UH 2CO7B 4TPRL 1FGNH 5IGXH 3ARTA 4O9HH 5KJRH 4M43H 4Z5RB 3VGBA 1YZZA 5J3HC 4O2EA 1S7RB 4CDGC 4YDKH 4WU7A 3G04A 4FQHA 2JJTC 1NCDH 4UNVA 5LJYH 1BVZA 2JK5A 2AKRA 2X1XR 4EDWH 1B0GA 4NHUB 3JV0A 2WUCL 1XF5A 3RL1B 5F7NC 3TBSA 1RJCA 4UV4H 3T65A 3S3JA 4NNYB 1C12A 1NGXA 2YD4A 5C0BB 4Q0XL 3U0PB 1E4WH 1OT2A 4H20L 4XNMA 5L9DH 1GSMA 3QEGL 3R06A 4ZFFA 3NIDE 4QY8A 4LPWA 1CFVL 4OCRL 3VFVB 4WWKB 4E42B 4KY1H 4KTYA 1KFAH 2B4CL 2MTPA 1HHJB 3ZKND 1YY8B 2NYYD 3V5KB 5DHVA 4BJLA 2DWEB 3ROLA 3TJHC 3QZWB 5I15L 1YUHB 2PXYD 1CT8A 1W72L 3FL7A 5ENWA 3HUJF 2FECI 3KLDA 3B9DA 1VEOA 2H8PA 3ARBC 5SX4H 1X9QA 3GHEH 3NCMA 4K8RC 1S7WB 3RA7H 3VXRD 2C1OA 5I8KL 1MCWW 4PREB 1BQHB 2DWDA 3MNVB 3BGFC 5F3BB 1KJ2B 3U9UB 1YN6B 2DJUA 5HGHB 4U49A 1FAIH 3V6FB 4R4FL 4APQB 3RTQD 4HFWA 5LBSL 3BW9B 5LGHL 1P2CA 3PWPE 1PX3A 1KPRB 4M7LH 3QQ3A 1YQVH 1UVQB 2FX8L 1MJJA 4Z5RA 1QA9B 1MCFA 1TVHB 3WXVH 3G6JF 3SKMA 4ZOAA 3TIEA 1KN4L 2ICEB 3QA3B 2Q8AH 4PTTB 5C70A 4L8DA 1V7NH 1DUZB 3N06B 3W0WB 4RGMB 5FK9A 5I66B 1NCAH 1NAMH 3NVQA 3BP7B 4PGCB 5IBTH 4JRYA 3LCYA 3OX8B 4K94C 5DJDB 1FYTD 2HFEA 4IMLB 1XGUA 4EBQL 5GGSA 3QCTH 3IFLL 5D6CB 3F8UB 3V95A 3I85A 1CFQA 3HN3A 2DQFB 4HJGB 4QTIL 1ZSDA 5HJ3A 3U0PA 4YXLH 2XTLA 1U8OB 2XQBH 4MVBD 5FUZH 5KSBB 2E5EA 5F1IB 3EOAB 3VFVA 2X44D 1YY8A 3CH1B 2LV4A 2D7MA 1JF1A 1F5WA 1HH9A 4JM4L 2HT4D 4LLWB 4PRIE 4X7SH 1UQSB 2D4FA 3LMJH 4Y5XB 1IVLA 3MV9A 3HRZB 1OTSC 4XHJD 3L9RB 4HUXA 2HRPH 3G5YB 5EU4B 3VCLB 3K4AA 1P7KA 1PSKH 4MS8D 4M5YL 2Y6SC 4K2UL 4M93C 1MWAA 1EIBA 1INDL 1T1WB 4JAMA 5F3BA 5E1HB 1ZA3B 3D39E 3O81A 5C09E 1KCRL 1KIRA 1FCCA 5FGCE 5MERB 5TGBB 3JVGA 3DX9A 3K46A 3FQWB 4HEPG 4MAYA 3WN5B 2ADFL 4CW1B 4J3WA 4ZFOL 2P8LB 1ZWIB 5HHQB 1WC7B 1YC8A 4QXGL 4EI6A 4Z9KB 1JWUA 4MDIB 1CGTA 5IT2L 4ONHA 4D9QE 1XIWC 1OAYH 3HMXA 3P40A 2PO6B 3TBYA 5FGBA 1YPZF 5DJ2A 3A6BL 2XA8L 4NSKA 3RX7A 2BMKA 4PJEA 2VDML 5H35B 3ULVD 4UILL 1IEBA 3E3QC 3VDCA 1NDMB 1PQZB 1CD1B 3RWIA 1QR1B 3TBTB 1YY9D 1LK2A 4OZGF 4YHKL 4LGSB 5IF0A 3IDYB 3HE7A 2R2HA 1X4ZA 3EOAA 3ULVF 4YO0A 5FUCC 2Z91B 3QP3A 2BC4A 1HHGA 4WFFD 5C6TH 3UC0L 2BNQE 1UQSA 4Y5XA 2WBJA 4L9LB 4ZTOL 1MJUL 3GBML 3SKUD 5HGDA 3PGFH 1F02I 3WFBL 2F58H 4L8CB 4P2RB 4KK8C 4WUUE 4PJHA 1YEKL 43C9A 5JQ6H 2BCKB 3DX7A 5F72S 2F19H 1YEIH 3WNMA 1T7WA 4L8BA 2FWOA 1J1OL 1AR1C 3QEQD 5JA8B 5GGTH 4HBQA 2XZAL 2A9NL 2F54E 4KDWA 3HNVH 4WY7H 4POYA 5CD3B 3BP5B 1G9MC 1FFOA 1G7JA 4WVRA 3OKYA 2CDFA 2VSDA 4MHHG 1SJEB 4TN9A 4U1SB 2GAZA 3ARDA 3SDXB 3WN5A 3QDJA 2VB5A 5DMKA 1YDPB 3MOBL 5CFHA 4WGVB 1RFDH 4MCZA 4KVNL 3EW3B 4GKNA 2BHZA 3CFEB 3UX9B 3VG9B 1SY6A 2R0LH 1C08A 1DANT 2JCCB 3OKEB 1HQRA 4D9RE 2W0PA 5ERWB 5SWZA 3QWRD 3T0XA 2OZ4A 1OSZB 3ESVF 5JUEL 2J88H 3V79C 1JHLL 1VKXA 3DXAE 4DUXA 3C60C 2PXYB 4G7YL 5E56A 4ZD3H 1EPFA 3BPLB 4U6XA 1IGML 3LPGA 3OAZH 5DEGA 4IIQA 3MRCA 4UV7H 5D1ZD 4TPRH 3VXRB 4P57A 4XP1L 4GRWB 2VZ1A 1DBKL 4PJDE 3DIFA 5ALCL 3JWOL 4QOKA 3RKDC 1R3JA 4OZ4A 1JK8B 5EBMA 1KGCD 3HA0A 5I17A 2PYFB 3G6JB 5IM7A 5CILL 1ZEAL 1JWSA 1JTOA 3SO3B 5HYSA 2WNGA 5DJCB 1B2WL 2E6JA 1UXSB 5L88L 1HKLL 1C5DA 1SJHA 2WUCH 1U36A 3MJ9L 4LSQL 2GSGB 5F8QC 1J8HE 1ZOXA 4WW2B 3VDBA 3X17A 3EJJX 4F80A 5AUMB 2R2CA 1PGRB 1QUNA 4Q0XH 3ZTJH 5IB4A 3QNYB 4H20H 2J8UB 4K7PH 1NCWL 2XWJB 2NTFB 5CCKL 4OCRH 4Z77B 2YRLA 2B4CH 3G08A 3TPKA 4JLRA 1JZ5A 4OSUL 3DV6B 4JGJA 3T77A 4BFIB 1GHFL 4F8TA 5IROA 2FATL 1J05B 5GXBB 3WLWC 2F53D 4WHTB 3S6CA 1W72H 1R3IL 2EH7L 2F74B 2PETA 1T89A 2AK1H 1DQJB 3HUJA 4OFVA 5KSAC 5FKAB 4PP2A 1QFOA 5GPRA 2VLME 3G5ZB 1XGTB 4QF1B 5I8KH 5K59F 4XBPB 1PKQA 4PJIF 3FB7B 3VFNB 5FF6A 2PXYA 3KLSA 4R4FH 2IJ0C 5LGHH 5L6YL 3L3HA 4XPGL 1Q9LB 2MFNA 3ULUC 3VXRA 1QSFB 1A9BA 4YBLC 5A3IC 4AT6A 3WHXB 5GSRB 1IGFL 2H3NB 3AY4A 4DFIA 2HFGL 2HKHL 1KN4H 3QQ4B 1XZ0B 1Y0LB 3RTQA 4PG9A 5EIIA 3QG6B 2DQCL 2BXYA 3QG7L 3O6KH 4I3SL 5E5UB 3WNLA 4W6YB 2IGFL 3CK0L 4LP5A 4EBQH 2ZKHH 1QRNB 3IFLH 5C0GA 3ARED 1D7FA 4U1JA 3EJZC 4G9DB 4QTIH 4KGLA 5CZVH 2J12B 1L0YA 1FVDA 2RJMA 3GSXB 4IOIB 2H9GB 3MV8B 1YNTA 3PWUA 4YK4C 4A6YL 4N5EC 4D0CB 4H0HB 3WKML 1TJGL 1KXVC 1FYTA 2GTWA 5DMJB 2DBLH 4WHYH 2GTZB 4JM4H 1FO0H 4YHNB 5DSCA 3LEXA 5EU7C 4HJ0D 1WITA 3LN5A 3TCLA 5ID1A 4QHUA 2WWKO 4CNIA 2BP3A 1NKOA 4M5YH 2QKIA 4DOHE 1INDH 4HKBB 4JRYE 1A4KA 2P47B 3BVNA 3WO4C 3FMGL 1BM3H 1KCRH 3X13A 5GS2D 3KHQA 1JNJA 2EYRB 2DRUA 3BESR 4I9WD 4P46B 2OTUA 1XR9A 3CFBB 5E8EB 3TBWA 2PYEA 2ADFH 2YPKB 3LKOA 2A6JB 4RMSA 5MEQA 5GSRA 2H3NA 4X8XA 4FQQA 2FSEB 1CL7L 1KTDB 5IT2H 4FOMA 3MV9E 4HPOH 5EC1B 1WWBX 5SWSD 4Q6IB 3PJSB 5AYUH 1JP5A 4IJ3C 3DOSA 2XA8H 1AQDA 3AM8A 1YPZA 2ESVD 2VDMH 4KU1A 2L4OA 3PF2A 2BVUA 2IEPA 3CU7A 4YHIB 4UILH 3VFUA 1I8MA 4X4YA 1XR8B 2DIBA 4TVPL 3DTXB 4YHKH 3NH7H 3SCMC 4OZGA 4Z7VB 2ADGA 5AWNL 1JZ8A 3ZHDA 5GGQL 3UC0H 4Y4FC 1BP3B 4ZTOH 1MJUH 3GBMH 5DMIH 2J3SA 2WINA 2LVEA 3QFJB 1LO0L 3WFBH 4P2OB 1Q9KA 2QTEA 1BREA 1I8LA 5F3HA 1YEKH 2IALA 1H9VA 3CFIC 4RFEA 4LP4A 4ZS7L 1J1OH 3I02A 2J6EA 3KS0J 1MCEA 1HXMB 4PJEE 2X09A 4YHPA 2XZAH 4GAGL 4AQ1B 4DQOL 2A9NH 4M3KB 2AJSL 1PG7L 2CO6B 5F6IB 3GEWB 4RWYL 4KKAC 1BMGA 2YC1A 3SDCD 4Y16C 3KLHD 2X1WL 4Y19B 3BAEL 1I8IB 2ICCA 3QEQA 1MRFL 3WUWB 4KVNH 3U4EB 2OX5A 5K9KA 4Q74A 4BSVB 5EC1A 4ZQKA 1FG9C 2ATKB 4QRSA 4NP4L 5T3ZH 5DS8B 5DZLA 1QQDB 5JUEH 4PJHE 3MRDA 3HFML 4IRSD 3CFDB 1JHLH 1OSPL 3DVGA 2AERT 3TEUA 3LQZA 2YPLD 4G7YH 3HLAA 1A5FL 1IGMH 2A0LC 2DB8A 1RZKL 2IH1B 4IBLT 5BMFL 1JGUL 1ZLVK 2KZ1B 4JN2B 4ZSOB 1NBQA 4MQXC 1MVFA 4XP1H 4O2FA 1NEUA 4M8QA 1DBKH 5ALCH 3QDJE 4L3EB 3JWOH 2DKMA 1QSED 1AH1A 4LEXL 1KJVB 4DEPC 1M7IA 2ZWLT 2Z31C 3KAAA 1ZEAH 3QPQD 4Q9CA 3DX6B 3AB0C 5D1ZA 4LLAA 3S98A 1B2WH 2X05A 5IVNA 5L88H 5I19H 1HKLH 4HUWA 4LPYA 3MJ9H 4LSQH 5SWZE 3KPTA 3QUMA 3NPSC 3OKDB 1ZT1B 4F7CB 4B41A 5GS0L 4BK4A 3QHFL 1KT2A 2PW1A 1MOEA 1G7QA 1Z0MA 3FQXB 1RURH 3QEHA 2GJZB 2VXSH 3UTZB 1NC2D 3LD8C 2NY0B 2HP4A 2CQVA 4PJ5B 4OSUH 3REWA 1GHFH 1D9KB 3AREB 4XP4H 5DRZA 3C5SB 1GGYA 5GJSH 5E95B 5CBEA 3GMRA 4GSDL 3TVMD 4QOKE 1LE5B 3QFDA 2EH7H 1NMBL 5D7LD 5ESAA 3ISWA 5BJTB 1BJ1H 3IDIB 4WGWB 4OZFG 2ZG3A 3SE9H 2VXTL 5GIRB 2ATKA 4KC3B 1IGYB 3LN4B 5KN5A 2P49B 3L5WB 1OLLA 2R1YA 4WU5A 4YFLI 1P4LA 5HDQL 1V3LA 1S9VB 4MWFA 3SO5A 2F53A 2NZ9D 1AFVL 1L7IL 2CR3A 3CZFB 1LDSA 1GGCL 4PJIA 3S4SA 2BNUB 1SYVB 5AAWA 3IDUA 4LFHG 4XPGH 5E8DL 1MJ8L 4JN2A 3WNPA 1HOCA 1F45A 3VMOA 4KROC 1FHGA 5IR1A 1IGFH 4RFOH 3SDXE 4EUPG 2HT2C 1S9WA 2HFGH 3IS1X 3P9WB 3T08A 2HKHH 3MLPA 5E8PB 4PR5B 5KS9B 3F7YA 3TA3D 3K1DA 1JVKA 2OS7A 5CJBA 4RRPA 2DQCH 4HMEA 1ZS8B 3QG7H 2CKBA 1KOAA 4I3SH 3HUJE 1AD0A 2IGFH 3CK0H 3GMNA 3HAEH 1D5ZB 3I6GA 2OXGA 4X7CC 4LU5L 2QSTA 1PKQE 1S7QA 1TQBB 4GOSA 5JW4R 3C5ZB 3FFDB 1W0WB 4A6YH 5FO9B 5F21B 2YD7A 3WKMH 3VXQB 4YDLB 4TSCH 5F7DA 3ALPA 1MCDA 2EH8L 2W38A 3VXRE 4GRWE 4HCRA 4HUVA 3VFMA 3W81A 2NW2A 4FFZL 5D5MF 25C8L 3IDIA 4G8EB 3G6JE 3GM0A 1TLKA 2E27H 4QRRB 5DRXB 5J13C 4HKZB 4Y1AD 1N5YH 5I1AA 3GIVA 3RZWA 4NRXA 4H8WC 1MAJA 3BYYA 3FMGH 2AXFB 2EE3A 3S5LA 3G5XB 3OG6B 3WFEL 3H9SB 4C56B 4XB7A 1IFHL 3OR7A 4ZS6C 1DANU 1INQA 1FYTE 3TBVB 1S5HA 1CL7H 1VA9A 3ARSA 1LD9A 1TNMA 3UTPD 3GSRB 3FFCB 5ADOH 1T1ZB 3HZMA 3GGWA 3VFRA 3VFOA 4P4RB 3ROOA 3EYFA 4LDOB 4GG6F 5ETUB 4HK0A 1SEBA 4TVPH 2Y1VA 5SWSA 1S7VA 5FO9A 3WFDL 1UA6L 2MNUA 2XFXA 1UXWA 2ITDA 1I8KA 3LPFA 2VJXA 5D9SB 5D1QD 1OW0A 1F3RB 2ESVA 2PYEE 1A6UL 1UB6B 4NPYA 5AWNH 5KSUA 2BDNL 1EH9A 4KRLB 3WSQL 3CFJA 2YPLB 4FQPA 1EHXA 1DDHA 4JM2C 5F7WC 3O8XB 1K3IA 1J88A 4JVWA 2EZ0C 1C5BL 1A1NB 2ORBL 4Q7DA 1LO0H 3GJFH 1Y6KR 3QRGL 5DUPL 3MLTB 2C7UB 3IKCB 4U7KA 4PRAB 4R0LA 2OMNA 2EDFA 2YD3A 4TUOB 5EPMB 4ZS7H 3TN0B 1N4XL 1DL7L 1YPZE 1GYAA 1MIML 4GAGH 4WFGD 2WUBH 2AJSH 1PG7H 3STZA 4XH2A 1VADA 2A6IB 1LE9B 1RJZA 1GXEA 3BAEH 4P5MB 1JYXA 2ZUYA 4RAUA 1WLHA 4OZGE 3SGJA 1N0XH 1MRFH 4LSSL 3I3EA 1X6NA 5ABDE 3ULVE 3QAZB 1A1MB 4M62H 4J3VA 3IJYB 1JPFA 4JQVA 5CJXC 3SDCA 3BRFA 1EO7A 4NP4H 5A2FA 4OAWB 2GFBB 2HRLA 2JTDA 1ES0B 3HFMH 5INCA 1OSPH 1LEKA 4DKFH 4LKCB 3MR9A 4Q9QL 4WFFE 2XI9A 3VWKD 4CJ0A 1JGEB 2R56L 1FL3B 1WBXA 1U3YA 3O45B 3T2PA 3PDDA 4LAQL 4TUJB 3MRNA 5E9DD 1K4DB 1JGUH 1FZKA 1HHIA 4LSTH 3A67L 4NQVB 4U6VL 4IRSA 1NAMA 4ORGA 1FNHA 3BP6B 4KKCC 1ZLWK 2D03L 3VH8G 4LKXB 1VHPA 1JFQL 3QUKB 1YECH 3PQYB 1IL1B 1K8DA 3MLWL 1DN0A 2YPLA 4H1LH 3QEQE 5F7MC 2JLLA 5F6HJ 3PHOA 1XGRB 5B8CA 1MHEA 3JUZA 5GZOC 4WI8A 3QO0B 3BZ4A 5EZJB 1X7QA 5F6HI 4UT9L 1QSEA 1ZGLM 1JMXA 4PGBA 2FZ3B 5BZDA 1U8PB 4JPKL 5T1LB 1I1RA 5B38B 3LVEA 4LGRB 1M71B 4XWOD 3OKLA 3MOAL 3UJTL 1BX2A 3HB3D 3MYJB 2A6IA 1HSAA 3EO0A 3FONB 5BS0B 2P46B 4NKDB 2BSRA 4X6CB 2QL1A 4YC2B 1A1OA 1X4YA 1HHKA 4QT5B 2QADC 4Z7VE 1SYSA 2VQ1B 3ORJA 2EKSA 2XG4A 3BIKA 1A1MA 3WFHB 1NMBH 3HG1D 3S34L 1HSBA 3IJYA 4JHWL 4PV8B 5ACLA 1TCRB 2VXTH 5D4QA 4JCMA 4KMLB 1LGVA 4UDUB 5EFIA 3D2UD 5TDNB 5J6HB 1IQWH 3QXDB 1NC2A 3O6ML 2IG2L 4HUUA 4JFQB 4PJ8B 5DJ6B 3T0WA 1I1FB 3N1MC 1N8ZB 4R96B 1ZLUH 3ARXA 5HDQH 2X4PB 4JPVL 4NCC1 1A6AB 1ZHLB 3TVMA 1Z5LA 1L7IH 2PTTB 3LS4L 1GGCH 2X70B 5D7LA 1KGCE 2BNRB 2NY2D 1CFNA 3QIWD 3D0VB 3BEWB 5E8DH 1T83A 2SEBA 1UB5B 1MJ8H 4XVUD 3WJJA 2MMXA 4OUUA 2E9BA 1QG3A 3GJEA 1URLA 3OXRA 3BWUC 4XVJL 3KYMA 2HWZL 1D3CA 2Q87A 2GW5A 3Q0HA 3SE4A 1WZMA 3RIFF 5E00A 4QHMA 3CD4A 4GW4B 3S35L 4QKXB 1T22A 3QYCA 2F8OA 5GRXG 4KRNA 4M1CC 4LU5H 5C08B 1Q0XL 3V6OA 3WXWL 3TA3A 3ZL4L 3FOMA 5BOPA 1M6OB 2F53E 3OB0H 5K59E 1WQVT 3BPCB 4PJIE 4Y0GA 4OLVH 4H25A 1MI5B 1U2HA 2ERJB 1R5VB 1HYSC 5LGJB 4WV1B 4JFXB 1ONQA 3HE6A 3NBNA 1AGEA 2EH8H 4FQJL 2IANB 2P8MB 2COQA 3MJ6A 3NOIA 1NL0L 1EMTL 5GGTA 1TCRA 4UQ2A 4S1QL 4H26B 5D1QB 5D5MA 3DMMC 4CGTA 1F8TL 3LQMA 1X5IA 3F62A 5IIEA 1XMWA 5JDJA 5DJ6A 2FECL 1B4RA 1UT9A 4FZ8L 1RUML 4PJCB 4ZODA 3RGVB 2V2XA 2QR0A 4F33B 2X5PA 3R1GH 1IEAB 5ICXB 3WFEH 2DLIA 2ADIA 15C8L 4YXHL 4GBXD 3BEWA 1QSVA 4HAGA 1IFHH 4PLKD 3SJVB 4Y1AA 3CSBA 4N0CC 3LRGA 4GW1A 3LKNB 1OCWL 1MUJB 2VITB 4XPHL 2E8YA 5JZ7D 2D7TL 5JORB 5IB3A 1NBZB 3SBWA 4MJIA 4E41B 2G60L 1N26A 3WEXB 5CGYD 2DJSA 3VJ6B 4MAUL 3MRPA 2DQEL 2MQCA 4FZEL 4NT6B 1TITA 5AAMA 5IW6B 1G7PA 3DETD 4ZPVA 4GG6A 3HPLA 3D9AL 1LK3L 1X5YA 5HHVL 3SGDI 3WFDH 2QQKL 4BH8B 2ZCHL 1UA6H 2P5WD 3U36A 5IWLA 5EO9A 1GAFH 2BDNH 4NGHL 3WSQH 3OKOA 3VWKB 3B3IA 3CX2A 2BVOB 4LCCA 4TTGA 3O3EB 4NO2A 4JHZA 4NUGL 1C5BH 2ORBH 4TYUA 5DUPH 4I9WE 3QRGH 5C0AD 4OV5B 2A73A 4H26A 4LVNB 3SE8H 4AM0B 3FT2A 1F97A 3IDJB 4C83B 3D3VA 1C7TA 5BV7C 2ZCKL 1N4XH 1RUQL 5HGBA 1DL7H 3ES6A 1HH6A 1MIMH 4F33A 1UG9A 3ZT6A 5E08H 3KJ4B 5DRNB 1W72A 5HDLA 2QQNH 3CSYB 5SWSE 1T2JA 1AXSA 5D93B 1PY4A 1WIOA 3BJLA 1MJ7L 1QLRA 5CP3H 3NMEA 2HFFB 4LSSH 4QWWC 2ESVE 2Z8VC 1MUJA 3GSUB 2UUDK 4XNQA 4MMXC 4QRPB 2GEEA 3TV3L 1NBZA 2ICWB 1W0VA 1D6EA 1JJUA 4IDJL 3WV0A 3K2UL 1AHWA 5HGAB 3RJDA 2RCSL 1ITCA 4NWUL 2R39A 2JB6A 3WNKA 2X4TA 3IXTB 4H5SB 1UH3A 2X1OA 4ZUTA 4ONGL 4ZFOB 4Q9QH 3I3BA 5SV4A 4HX1B 4YUEL 2R56H 5F7HA 4X9GA 3X12B 3D2UB 3OTTA 2H32H 4JJ5A 2DKUA 5BXFA 3BSZL 2AP2A 3A67H 4U6VH 3LKSB 2D03H 3KPPB 2AVGA 2XTJD 1RK1A 3SKNA 3T3PF 5E4EB 1EAPA 1JFQH 3P2TA 4WO4D 3MLWH 2ZG1A 3KPOB 3UTSB 5DGQA 3UZEA 4ELMF 4NM8L 1G7MA 1NBYB 5E9DA 1QFPA 1T0MB 4NJ9L 3ZKMD 3E6FA 4UT9H 1CQKA 5TH2B 2IPKB 1CLOL 4U0QB 4JPKH 2XZQH 3L3OB 4QRQA 1FO0A 3MOAH 4OTXL 3UJTH 1P84K 3RUGF 4AL8L 5LAXA 4B50A 2Z93B 2F15A 3SHSA 1KIPB 5IHLB 5IFJB 5A2LH 1Q38A 1G9ML 4PV9B 3LY6A 5KAQG 5HI3D 2R0KL 4PYHA 2E6PA 4RQQB 1FV1B 3MBEC 3F65A 3VGDA 4XNYL 1ULVA 1XFPA 4YNYB 2YPLE 5H94A 3WS3A 4JHWH 3DLQR 4DKAA 5FCUH 1BVKA 2IG2H 1BECA 2I60L 4NN6C 1A6ZA 1NLBH 3QUYA 5EUOB 2DQUL 2E7MA 2V2TA 2VLRD 5DK2B 5IK3B 1QSEE 3LS4H 1MLCA 5HVFB 3NCBB 5DTFA 3HG1A 3U83A 2R23A 3EHBC 4NRYA 4QNPF 2XWBB 3KNBB 3QDMA 3T3MF 4JKWA 4TVPD 5L2JA 1Q9WB 3O6FD 1IM9B 4UQ3B 4XVJH 1CICB 2HWZH 1BZ7A 3MGOA 3QIWA 4YR6B 3TT3H 4F57L 1AD9B 3MRGB 1YA5A 4JZJB 2E9WA 4JQXA 3O4LB 3QH3A 4NZUL 4UDTA 5CLTA 4KI5C 1R3LB 1Q0XH 3WXWH 1KTLB 3ZL4H 2OLDA 2VUYA 5IKCB 1FCGA 2C3VB 2Q3ZA 5EB9A 5D7LE 5C86A 2VDNH 2NTSP 1N2RB 1I3RA 1N64L 4XI5C 1EEUA 1CIUA 1HILB 4FQJH 3RDTD 1IC5L 4GRMA 1KF9B 5C1MB 3TO2B 5GGUA 3X14A 1UFUA 4ZUSA 3QQ9C 2K7PA 2DLFL 2HJKA 5B39B 1NL0H 3AXLA 1EMTH 1VEPA 3OJDA 1AXIB 4OLXL 3SDAC 3C2SA 4ODUB 3QIUA 3H3KA 2P7TB 4JFYB 1F8TH 4OCNC 3F12B 1YJDC 5ECJE 3HI5L 4IMKA 4H0IA 1OL0A 2V5MA 4K8RH 3V7AE 4FZ8H 1RUMH 3PWJB 5GZNC 5IK3A 5KW9L 3HC0A 2VRAA 2VQTA 4JO2L 3L3JB 5D7JB 3V6OE 15C8H 5CP7A 4LHUB 5E6IC 4DVRL 5IFHL 5C0AB 3V0WL 1KIQA 3KNBA 5IBUB 5IMOB 1WT5C 1U3HB 1R3KA 3MV11 4HS3B 2P8PB 4WW1B 4WEMB 4PJGB 3ULUL 4V1DD 1WBZA 2OJEB 4XPHH 3D0LB 2D7TH 5JOFB 5D2LB 4L8SA 4GBXA 4X6FB 5BQ7B 5EOTB 1N3NB 2G60H 5KVFL 4KJPD 4U1NB 2DBJA 4CDHA 2DQEH 3BUYB 5DUBA 2UWEF 5D5ME 4POZD 1RZIB 3IF1A 4R2GC 3ILPB 5E5RB 5KTEL 4UBDD 4K94H 2LAGB 5F7EH 3VFPA 3M1BB 4P4KB 5E94B 5ID0B 3GMOB 2G9HA 5F93C 3D9AH 5HHVH 1YN7A 4MA1C 5FOBB 3SKOB 2ZCHH 1EUTA 5GS0D 1I75A 1N2RA 3RZCC 3FN9A 1DQTA 4Y1AE 3QWOB 4P49A 1JGDB 1EFXA 5FO7B 5K9OA 3QBTB 4NGHH 3MJ9A 5GS1B 3N1FC 2ZPKL 3MRHA 2NY3B 3N85L 3FRPG 5CEYB 2P5WA 1MFAH 3G5VA 4JFDD 2XV6B 2AJVL 2R1XB 5EBWB 3C8KB 3W11D 4NBZB 1E28A 2ZCKH 1A21A 1RUQH 1KCKA 1I1AD 3FOLB 5C3LD 3MRMB 1UM6L 4LLUA 1OAKL 4JKPL 4BELD 5J0BA 2XKNA 5EU6D 1CLZH 4EDXB 4MX7A 4GG6E 3F5WB 5EU5B 3UTPE 4GW5B 3VXTB 1KEMH 4QCIB 5DEZA 5BW7A 2P8PA 1MJ7H 1FIEA 4NKIH 2XNAB 1ORSA 4MD5B 3HZYA 2XIDA 3DVNA 4Z7NF 1KCVL 3MRKB 1DQDH 3RWEB 4IDJH 1J1PL 1U8QA 2OM5A 3K2UH 3Q6FB 1NPUA 4HWBL 3BUYA 3OPZL 2RCSH 2C3XA 4HIJA 4NWUH 4QGYA 3QB7C 1RZIA 3GSQA 1CCZA 2Y25A 4W4OA 5LGKA 4ONGH 5I2IB 3HI1A 2R1WB 4OCWL 3RVXD 5ESQB 4BQBA 4YUEH 1TZHB 2XQYK 3GMOA 4X9IA 4KKBD 4J3XA 3UBXA 4YX2L 3TIDA 3SKOA 3U30C 4E0RA 3EO9L 3PIQA 5E03A 5EO1B 4QRUA 4YBQC 5HHNA 1CLCA 4IEFB 3PV6A 3DVIA 1K8IB 3HAEA 3KGRA 4J3OC 1TVDA 2KL6A 4NKOA 4NM8H 4WFGE 5CKGA 3ECBA 3ZSSA 3DUSA 4XP9H 1V3KA 4NJ9H 4ELMA 3PL6D 5E6YA 1X5HA 3QXUA 5CLWA 2G5RA 4A6YA 2OR9L 3GK8L 4WO4A 1G7IB 1CLOH 1R6VA 4PRDB 3AB0B 4JREB 4WCYL 3ALXA 4OTXH 1P1ZB 3RAJL 4PJ9C 3RHWK 4AL8H 2XQYG 4ELKA 3L95A 3QI9A 3RUGA 1PVHA 4MGXA 2PW2A 1G9MH 4GLRI 3GJFB 3FTGB 1HWHB 3T0BA 5GGSY 4CADB 2R0KH 1N6VA 3O4OC 1I7RB 4HEME 4IHOA 3IJHA 3MRBB 4UOW0 2AEIT 4XNYH 2Q3AA 5DD6B 12E8L 5GSVB 4JVPA 3OF6A 3SPVA 1EJOL 2R4RH 5IP4A 4PJFB 4JPWL 4BA8A 5E9DE 4HV8B 5C0NC 2YSSA 2I60H 2VDOH 3GBLA 2DQUH 4IRJC 4ZXBB 1Q8MA 1A7NL 4AENA 3IXAB 3DRQB 5ANMB 1KCLA 3UJIL 1ND0A 4TULL 1J0ZA 1YQ2A 4JDTL 4TNWK 4MD4B 3DROB 5FYJU 4RAVB 1NFIA 2I25N 3PDOB 4F9LA 3MROB 5IB2B 3R8QA 1DVFD 3O2WL 1G6VK 1WSST 2ATPA 4JANB 2I9TA 1MCPH 4Y4KD 1H3XA 1I7UA 3VWJD 1FJ1A 2VLRA 1H3WM 3CXDL 5E2UL 4MJ6B 3IS0X 4J8RB 1V3JA 1MHCA 3BKMH 4DGVL 2X4SA 5MI0B 1A6TB 4KROB 4P2QD 1YYLH 5IOPB 5I1DB 5DC4B 4M5ZL 2BK8A 2FHFA 5BVPL 2D31A 2X10A 5D2NB 1G0YR 2YR3A 3O6FA 2M1KA 1AKJB 5IVZA 1XGPB 3X3GH 5JXED 1C16B 3GIZL 4FQCL 4NZUH 1OTTD 4NN7C 1TZGL 3P77B 1MQKL 4LEOA 3HG1E 4XNXH 1JWMA 3PABB 4GKOA 5ALBL 1LO5B 1S7TA 1N64H 2QHRL 4KJQC 1A0QL 5LCVL 3GJFA 4FG6C 5J12C 1KPUB 3VGHA 1IC5H 2FR4B 1I7RA 5F1NA 1UJ3B 1S5IL 2OSLB 2CLZB 4Y2DC 2DLFH 3ABZA 3ULSA 4OLXH 3WCYA 2AQ3A 2VDPL 3PXHA 4JFEB 4L29A 2GT9A 3THMH 4MXQC 1E6JL 5I1IL 3AC0A 3DWTA 5JA9A 4EN3D 3HI5H 3RDTA 2XT1B 2C3GA 4DAGH 5FXCH 3GBNH 4JO2H 3T1WA 1TXKA 4JDVB 4DVRH 5IFHH 4LVOB 3V0WH 4HIHA 2CDGB 4U0RB 4OIAA 1BZ9B 3BN9D 2JJVA 1L7TL 1I85C 4XCYA 4RZCB 4NUJA 4BKLA 3ULUH 4GRLC 3C6LC 3H7BA 2BOBB 3CCHA 2Q8BL 3WL9A 4DKEH 2MJWA 2Y36L 3CIQA 3VRJB 5EU6B 1MREH 5KVFH 2NXYD 1T04B 2VNCA 1K4CA 4L4TD 1BVLB 4DCQB 4LSUL 1ACZA 5D2NA 5MEOB 4RBPH 1EV2E 3LDBB 4V1DA 3WIHL 1C16A 3O3AA 5I1EL 3UCRA 2UWEA 4N9GA 3ZKXB 5KTEH 3UYOD 1CD9B 4U05A 4FFWC 4XBGB 2CKNA 4O4YL 3HNSL 8FABB 2HVJB 4H1LA 1XF4B 4X99A 3L7FB 1K2DA 3HR5A 3HZVB 1EGJL 3IGAB 5F89A 3TH3T 4P3DA 3O9WB 2YEZB 1NMCC 4S1DD 3MA9L 3WYRA 4ONFL 1AR2A 2XN9A 1BFOB 1U92A 5T3ZE 1NCCH 3SDDD 5DJYA 5M95B 1JIBA 2E7BA 3AAZB 2ZPKH 3VRLF 4D3CL 1CZ8L 2FIKB 5DI8B 3N85H 4MJ5A 1AE6L 2AJVH 4K23L 3N0PB 4GAFB 5ESVA 4XC1L 4K7PX 4PLOB 4MYWB 4QO1A 1ZA6B 4JVUA 1UM6H 1VENA 5CMAB 3V5HA 4TVSa 3QHTC 1OAKH 3BIAX 4RDQG 5T3XH 2J8HA 3QXTA 2I9LA 3ARGC 2VZ3A 2VDQL 5DJ8B 4JFDA 1BAFH 4HXAH 1Q94A 1U6AL 1NAKH 2FNBA 5DJAB 1IGIL 4P23B 3MGTB 1I1AA 1P69B 3MNWB 3LKPA 2C26A 5GRVL 5EU6A 1OAUL 3T4YA 3TZVC 5DA4A 1U8LB 1J1PH 1GZPB 1BVLA 3OPZH 5HY9A 2R2EB 1SHMA 4TNVF 2P5WE 3B9KA 2XG5A 2RFXA 2VISA 3OGOE 1IQDA 3EOBB 4OCWH 5IEKA 5C0FB 1U8HB 1R5WA 1TPXC 4JFPB 4YX2H 1H5BB 4KKNA 4WFEE 1J8KA 4X7FC 3EO9H 3AFLA 4PBVC 1FFNB 2OTWB 1TNNA 2LQRA 3UPCA 2B1HL 3IDNB 3B2UC 3C9NA 1DQQB 3BHBB 5SX5K 5HVHC 3IFNH 4EIGB 1QBAA 5JW5B 3KYKL 5CKAA 1KC5H 3P4LA 4D8PA 3BYTA 1P53A 3P0YH 3MRIB 3VWJB 2FH6A 2OR9H 5D6DC 2WW8A 3GK8H 1UCTA 3BQUA 3T4AB 4PY7A 4XNUL 1MWAL 3ARBD 4DVBB 3CUPA 3T0ED 1ZA6A 4P2QB 3ARFB 5C0DB 3RAJH 2VL5B 5DT1L 4X7EC 4FXKB 3FO1A 3KPMB 2WWKT 1MRDL 3PL6A 2JB5L 2G75B 1DUYA 2KZWA 3NA4A 4KK9C 4OBRA 3RIAK 1XGQA 4HDIA 5INDB 2DLGA 4JB9L 4L9DA 4Y4HC 3UTOA 3KS0H 3WFCL 4I0PD 1AGDA 12E8H 3MFFB 3T3PE 3V4PL 4EZMA 4JPWH 4P5TD 5CSGA 2OK0L 4OKVB 4X7TA 1JYNA 1FNEA 1Y6MR 4ELME 3TT1L 1QO3B 1BIIB 4I18B 4OZFH 5T33L 4W6XB 3VFTB 1MHHA 3UJIH 4CN1A 3ARYA 2XTJE 4TULH 2EDJA 4XCEB 3ZMRA 3GB7A 4JDTH 1YEDB 4U7MA 3BZEB 5KZCB 2VMFA 4M7JL 3C8DA 3O2WH 2NXZD 4EN3B 2FEDC 1CTNA 4I77H 3RUGE 3MRJB 1G7HB 4OD1L 4YGVB 2NLJB 5EOCJ 3CXDH 5E2UH 3NFNB 3MLRL 1MLBB 2G2RA 2H26B 1A9EB 3MV7D 4N8VB 3DO7B 3IDNA 1V7ML 2ILLA 4DGVH 2R69L 4HBCL 1LDPL 5FIEA 2WANA 4EUPH 5JW5A 1J1XL 1DVFA 2YA2A 5BVPH 2A6DB 2VLKA 4Y4KA 3CVHB 1GPOL 1FN4A 2EYTA 2OL3B 4WWKC 3TPUA 1U91B 2Z8SA 4HKJB 3GIZH 4FQCH 3KHOA 1OTSD 2GCYA 4RMRA 1TZGH 4ZO6A 5DD5L 5DEFA 4OI9A 4GS7B 4F7MA 5ALBH 2ZUTA 1OT1A 5LCVH 1A0QH 5JXEA 4QNPE 5BOZG 1KIUA 5BRZB 2OQJB 2VLRE 3OQ3B 3T3ME 3VXMD 3WS6A 5EU3A 3BN3B 5A1AA 1S5IH 4BH7B 3EYUL 4MB4A 4LRIA 3I6KB 4APQC 4OGXL 2W92A 4XRCB 2VDPH 1UM4L 1ZT7B 1I3VA 2VL4A 1DQML 1E6JH 2FEEI 5I1IH 3EIFA 1SY6L 2BY2A 4TVPE 4AIOA 2CUHA 1B6UA 1U41A 1XIWD 5EN2B 3EYQD 2X1QA 5HI4C 5CP3A 1CGSL 2VE6A 4ZYKB 3BEVB 3MRRB 2IADA 4RGMC 3MYZA 4NQDD 2NY6B 1L7TH 2H1PL 3RVWC 4D0DA 1VGEL 3MRJA 1G7HA 4L4VD 1A3QA 4L3CA 1U93A 1X3DA 1EERB 2W91A 4HZLA 4N8VA 3O3DA 3QIBB 4P3WA 2Q8BH 1HIML 3B5HA 1PZUB 4JHBA 2Y36H 2WWMC 1P4BL 2FYYB 4NNXB 2X4OB 4LSUH 4PJFE 1CIDA 2H32A 2BVPB 3L6FA 2DICA 3WIHH 5HHPB 5I1EH 3H3PL 1T21A 2FJGA 3QZWG 4PB9L 1IGJB 4Y5XC 5IB1B 1H8SA 2YWYA 4MA3B 2FJHA 4O4YH 4EEEA 3HNSH 3FQRB 3JTSB 3V0AC 2VXVL 4L4TA 1EGJH 4PLJC 3MTRA 5MEPB 4RX4D 5TDPB 1FVCA 5A40E 1AR1D 4ODWB 3MA9H 3O2VH 1BQHG 4ONFH 3BKYL 1QLFB 3T8XA 4IOSD 3STBA 1GC1L 4NWTL 3VGFA 5JO5B 5DHVH 4FQ2L 3I6KA 1LP9B 1RJLB 4R6UA 3E2HB 4D3CH 2NZIA 1CZ8H 1T0NA 3PGCB 3O0RH 5L8KB 1CWVA 1BOYA 3EGSA 3U2SA 4AH2B 4K23H 3WN5C 5D2NE 2EEBA 1OOAA 4V1DE 3SDDA 2ZSWA 2CRMA 4Q2ZB 5EN2A 2UWEE 4KDTA 4ZFZB 4MNGB 3U9PH 4BQCA 5BV7B 2VDQH 4Z7UB 1N5AB 4D0BA 1QSZA 4Y5YB 3ZDYF 1U6AH 5JNYA 3RRQA 3C60D 5SWQB 2PO6C 3LIZL 3MCKB 1NC4D 3AS1A 4PG2A 1AQKL 3T0EB 2AJZA 1EEYB 1NQBA 2YHGA 4G80A 1OAUH 4XCNA 2BSTA 1TZIB 4ZAKA 4KGJA 4OM0L 3HR6A 1KLGA 3WLBA 1A7QL 3GUTA 2BVPA 1ZVSB 4I0PB 4U6HB 1FZJB 3KPRD 3ZYZA 2HT3D 5JPMA 5IB1A 1JYWA 2DQGL 1G7LB 4L9LC 4X9HA 2MSPA 5B3JF 2ZUXA 1AJ7L 3GMPB 4K3GA 4JFDE 5E1AB 4AEHL 2JJTA 1CFTA 1CQYA 3UTQB 4PRNB 1MHPH 4LCIH 3NCJL 3GKWL 3MBXL 5C07D 4EI5B 1PAMA 1DQLH 1AC0A 3HCVA 1RJLA 3KYKH 4I4WB 2NXZB 4QHLA 5IFAL 4NO0D 5GRUH 4OD3L 2X4RB 5EU6E 5FB8B 4HWZA 4LLQA 2WIMA 5CIPB 2J2ZA 2ZSVB 2B1AH 4Z7NE 2YD2A 4OZIF 4CVUA 2NY4D 3MV7B 4XVTL 1C7SA 1WBYA 2X4NA 2HTKC 2O61A 1MWAH 5IROC 4M61A 2PCPB 3RL2B 2VZUA 5DT1H 3VG9C 2FCBA 3I9GL 5IB5B 1MRDH 2H2SD 2JB5H 3PG2A 3BKJL 1KG0A 2WMPA 4CVXA 5AD0B 4DK3A 3VFSB 4JB9H 3ARBA 4XX1G 5J9PA 3T0EA 3WFCH 5CUSL 3RNQA 2PXYC 1DFBL 4DTGL 3ULUD 3V4PH 2AGJL 3FQNB 3H0TA 5C0IA 5ISZB 3BPLC 5I9QB 1ZLWH 5A3ID 1CGWA 3ZHLA 4HS6B 5DMGC 4W6WB 3TT1H 3UPRA 5T33H 3TNNB 3ULUF 3AY4C 3GMMB 3KDMB 3RU8L 4HC1L 2GITA 2J5LB 4KAQL 5HHMD 4TQEL 1IC7L 3QJFA 4P5TA 1Q9OB 4M7JH 5J11B 1A02N 1MEXH 4HIIB 1QBLL 3SO3C 2GK0B 3MREA 4Y5VB 3GMPA 4AZ8A 2UZIL 4Y2OA 1EXUA 5E1AA 2RIKA 3MLRH 3BPOB 1XH3A 2DQDL 4WW2C 1V7MH 5ICZA 3GSNL 1T1XB 2R69H 1RJYB 4HBCH 4R26L 4N5ED 1LDPH 4J4PC 1BHGA 3WE6B 4GG8A 2W65A 2EECA 4BSWA 1J1XH 4JE4B 3L3DB 3D5OF 2X4RA 3D69B 4JFHE 2I24N 4RGNB 1GPOH 1H3TA 5C0EB 4R3SB 2BVQB 3MV7A 5C6PB 5IHZB 2NY1D 4ODTL 5EDXA 3VI4F 2I27N 1FPTL 1HE7A 5DD5H 4AK1A 4HJJH 1AGFA 5DC0A 1MVUB 1FRGL 2DD8H 1JUFB 3DV4A 4MVBC 1LILA 1SQ2N 4B53A 1QVOB 5ILTL 5L0QB 4TSAH 2HT4C 3TM6A 5IMKB 3VGEA 5FECA 3SN6N 1UWGL 1F4AA 2CRYA 4KK6C 3VFWB 1ZGLB 3CPLB 4OGXH 4PJAF 2RR3A 3B8YA 4IS6A 1NDGA 4KJWD 2W60B 1CLYL 1UM4H 1A7RH 2MCPL 4U1GB 4CN6A 3U6RA 4BFBD 1QZ1A 3FCTA 2KQNA 1JNLL 3OHXA 2CLRB 3RWHB 1HNFA 4XZUA 1CD0A 3VXMA 3PNWA 2IC2A 2WAHA 3KDMA 1CGSH 1I3GL 4A2LA 2ZJSL 1V5JA 4P2QE 4XGZA 2DI8A 1HKFA 3P4MA 2H1PH 4Y5VA 1VGEH 4NC0B 5DHXB 4OZHF 2JJSC 5IG7B 1XIWA 3W39B 3KG5A 4X98B 3CDGB 2HYMA 1HIMH 4NO5B 4PJBB 3WNOA 1U8KB 2AK4B 1P4BH 4J1UB 3RVVC 1AXTL 3B6SA 3FO2B 5JQHC 4NQDA 5EUKB 3C6SA 4L4VA 1U8NA 4R3SA 4HGWB 4Y4FD 4D2NA 1WFUA 3H3PH 2DLHA 1KB5L 2I07B 3Q1SL 1SM3H 1CXIA 4PB9H 2YD5A 3QUML 4LVEA 4U1KA 3CFKB 2ZUUA 1PYWA 1B3JA 1YY9C 2CDEA 4HXBL 2AXGB 1CI5A 4NQED 4UB0L 4LCYA 3H2WA 4PRHB 2W0FB 1LEGB 3BKYH 3KPRB 4I2XA 3OR6A 4OCXL 1GC1H 1RUPL 4LDEB 4KKAD 4F7PA 4K9EC 4QHNB 4FQ2H 3RQ3A 2X4QA 5GRJL 43CAB 2EDRA 4O5LL 2EE2A 4P46C 4RX4A 5HDOA 4WTZG 3U7WL 1P9MC 4FFVC 4UU9B 3DI2B 1C8PA 3DYOA 4WHDA 4OJFL 1EBPA 3DUUA 1T2QL 5FYJL 2VZVA 4ZDHA 4LCUA 4JFOA 3OB8A 1MPAL 4G8GD 4NM4L 1MH5A 4L4TE 1DLFL 2NY4B 3LIZH 4Q6IC 4U1IA 1AQKH 1T3FA 5ACMA 3W39A 1YEEL 2GYSA 4X98A 3NN8B 4RISH 5L8JB 3MODL 3H9YA 4LFHD 4MQXD 3FO2A 4WNQB 4OM0H 4NN5B 1FVEA 1CS6A 3C60A 2GY5A 1A7QH 1D5BB 3VRLE 4ZNEA 1NC4A 3MUGB 2D2OA 2Z31D 1UZ6F 4Z76B 3TWCL 3TO4B 1V8HA 4K55A 4GKSA 5K9QI 3VXPB 1R5IB 1WJ3A 4HIEA 2DQGH 4QGTA 3F7VB 3DXAD 4G43B 5I1LB 4P2OC 5I1CH 1AJ7H 3PWVB 4HH9A 1FAKT 3MRLA 4AEHH 1YEGL 1WWWX 1D5MA 4MA8H 2IF7A 2IH3A 2IPUK 4N0UB 2ARJA 3SGDH 1U8JB 4G8FB 3NCJH 4JJHA 3GKWH 1U9KA 4G8IA 3FQTA 1BJ8A 1E27A 5IFAH 1ZVHA 4I0KA 1JV5A 4DZBB 5F6IC 3PXJA 4OD3H 1BOGA 5A2JH 4MLIA 1BBJB 2VABA 2FD6L 4HWNA 4Z95L 3QUZD 4UU9A 4XVTH 3FB8B 4OZIA 3QJHB 3PWPB 1R24A 3J8F7 1IAOB 2YUWA 1NGWB 2YD9A 5C07A 5FO8A 3B8SA 3BJ91 1MFDL 3VXSD 3IRPX 2EDOA 4NO0A 3I9GH 2L7UA 2E9IA 1T1YB 3BKJH 1FFPA 4HGMA 5EZLB 2A83A 2Q76A 4DUVA 2NY1B 4PFEA 3RX8A 5CUSH 2WLZA 5KSAA 4HAFA 1DFBH 1SMAA 4WI6A 4DTGH 2CH8A 4O58H 3HTLX 5EWIL 2AGJH 5KOMC 3HZKA 4UZGA 3KPQA 1ACYH 3BMWA 4YFLF 1T20A 2HT2D 2CK2A 4RNRB 5HD8C 1D5BA 5E2TL 3NIGF 2FL5A 4WEBH 1GL4B 2H6PA 2DMCA 3LS5L 3LKQB 2XKUA 1CU4L 1JHTB 3RU8H 3P4NA 2YBRA 4HC1H 5DJ0B 2HG5B 1RHFA 4KAQH 5K9QG 3ARWA 2ED9A 3Q3GA 4TQEH 4MSWB 1IC7H 3LKRB 3SKJL 2CIIB 3ZLQC 2JJWA 5J89A 4PRIB 3MZGB 4CL7A 1X5ZA 3F7RA 5CSZA 2MWCA 1ED3B 5JLZA 1F3JB 3NAAL 4HKXA 4LF3A 3OKMA 3G6AA 4KRPB 2DQDH 4N0UA 3KXFD 1U8JA 1WTGT 2N7AA 3GSNH 4R26H 4NKMA 5D1XB 3T0EE 1JRHL 3TC9A 4NQXB 3D39B 5C09B 4UV4L 1GJIA 3PGDA 3O41A 3TYFA 5FGCB 3P3YA 1U3JA 4ZUUB 1NGPL 2AAVA 4J12A 2NY0C 2OMBA 3BWAA 3WUWG 1D9KC 3AREC 2Z35B 3WFZA 4ODTH 1UZ8B 4LLMB 1FPTH 4PD4J 1NGWA 3MCLH 4RAHA 5EBGA 5J1AB 4KY1L 1FRGH 4RIRB 4MNQD 1JPGA 3S3SA 1T5WB 3DRTA 5ILTH 1MAKA 2Z92A 4G9FD 3MRQA 3P9MA 4JG0L 3TFKD 5DHYA 1VFAA 1NUNB 4DWHA 1NGYB 1ZHBA 3U46B 3MPCA 2VIRB 1F6AB 2VWEC 1S8DB 3RA7L 1WZKA 1CLYH 2MCPH 4PJAA 1JNLH 3RKPA 1PD6A 1J11A 4RMWA 4EVNA 1JNHB 3W5MA 3MV7E 4S2SA 1NEZG 1I3GH 4N0RA 4O2CB 3FN3A 3EO1B 4MA7L 3LKRA 2FJFB 1YQVL 4K7PY 2BNQB 4AY0A 3BP4B 2V7HB 4GAYA 4PYGA 4P9HC 2Q8AL 4JZNB 4WUUB 4F3FB 3OXSA 4OZHA 4XB8A 2A74A 4LCWD 2YKLL 4BZ2L 3A6OA 2AJYL 1IT9H 1TQBC 1PFCA 4IRZL 4FQXB 1CDUA 3DSNA 1AXTH 3C5ZC 1OB1B 1OW0C 1HI6A 4YDLC 1E4XI 2ICES 4JFFD 1KB5H 3Q1SH 2EZ0D 4LNRA 3SCMA 3RPIA 3VXME 3NABL 5F44A 2CIKA 3ZDXF 2EYSB 3MJGX 3DARA 4HXBH 5HI5C 3BO8B 1RVFL 2FO4A 3P73A 4UB0H 3ESUF 4Y4FA 2AEQL 2GY7B 4R7DB 3PWNA 2GJ6D 4V2CB 1OM3L 5B21A 3EDJA 4OCXH 4FXGA 1RUPH 4X6DF 5J6GA 3PHQA 3U4AA 1EEZB 3LPWA 4R97B 5HPMB 4MAYD 1KYOJ 3LSOB 1CDGA 3DXAB 1LO4L 2ZOLA 4O5LH 5SX4I 2E7LC 4NQEA 5I76B 4HWUA 1CGUA 1OWWA 4NQDE 3U7WH 4Z0XA 1A3LL 2ZUVA 3VI3F 3GMLB 4XPAL 5E8OB 3D25B 4L4VE 3QDAA 1A4JA 1YJDH 3E3QE 5BVJA 4Y16A 5HYFA 1T2QH 1VFUA 3FT3B 5FYJH 4PJDB 2ZUQB 1XF2B 3PE9A 1MPAH 1KJMA 3QUZB 5IVOA 2UV3A 1XF1A 5FM8A 3FO9A 4Q9BA 1KJ3L 1BD2D 4X5WB 3ZE2F 1GZQB 1OAYL 1YEEH 2PNDA 3H8NA 4OZFA 1FL6A 3MODH 4I2XE 1NMAL 1OGTA 1IAKA 4BUGA 4G8GA 3EJYD 1XF3B 5DURD 5DYOB 1YMHA 3L3GB 3DX8B 3NGBB 1OGAD 2DQHL 2QSQA 1OF2B 1IZJA 2WBJD 3TWCH 4ENEC 2IAMB 3L3IA 1XCTA 4FTVD 5J8OA 3O8XC 1VB9A 4OD2A 5F88A 4O2EB 4ZUWA 4EUPA 2WP3O 4K3JL 3FHAA 2Z31A 4ALAL 1YEGH 3DBXA 4WU7B 3G04B 4FQHB 3ZDYE 4X0KA 2JK5B 2AKRB 1T03H 1B0GB 3V2AR 1F11A 2Z4QA 4K3HA 3KJ6L 1XF5B 3QPQC 1YEIL 3TBSB 1F3DJ 3T65B 1C12B 2DM3A 2FD6H 5DFTA 4Z95H 1NGXB 2J1KA 3CDFA 2QADD 1RZ8A 5CJOL 5LXGL 4F9PC 4F2MA 1O7VA 4XNMB 3T1FA 1UJTA 3R06B 4ZFFB 4QY8B 3QAZC 4OQ1A 1UWXH 3RY5A 2A9ML 3FT3A 3JV4A 1NH6A 4QRTA 2NY5C 5DHVB 4PGZA 5IMLA 3BD4A 5TE4L 3ROLB 1DE4A 2A1WL 4I3GA 5ENWB 3D48R 4MQ7A 2H8PB 5B3JE 4JKLA 3FB5A 3JWDL 1ZGLP 3VXSA 3KPRE 1S7UA 5EWIH 5D72H 2C1OB 1CDIA 2DWDB 2J88L 3O2DL 1IAII 5E2TH 2KUTA 2CSPA 4HFWB 2F5BL 5F70A 5IW1A 1CU4H 1QTYT 3RNKA 1P2CB 3SE3C 1HCFX 5FYKU 5C07E 3SE4C 3KYNA 3SKJH 3QQ3B 1WEJH 1OARL 1MJJB 4LVHB 4M1CD 1GCFA 3SKMB 3LRSA 3TIEB 4ESKA 4L8DB 3NAAH 2IQ9L 5FK9B 4DOHB 3WIHA 1KV3A 5FDYA 4JRYB 4M6AA 1HYSD 2Z8WC 1JRHH 2NY7H 1JI1A 4Z6AT 2HFEB 1XGUB 5GGSB 1T5XA 2OXHA 3MOQA 3MRFA 1CFQB 1NGPH 3OGCA 4YC2C 2OP4L 1ZSDB 5IJVA 5HJ3B 5J4MA 1EGJA 3KXFA 3V0VA 4JZOA 1MCSA 4K7PL 2APBA 4NFCA 4YPGA 3CXHK 1MQ8A 3MX0A 3DMMD 3ULUE 1JF1B 5JR1L 1AP2A 1HH9B 3W82A 3HI6H 4PJ8C 2DF3A 3MV9B 2BY3A 2CMRL 4HUXB 4JG0H 2AK1L 1QLEL 3B9VA 4JDZA 1P7KB 4C59B 4N0UE 4C57C 5TE6L 1MWAB 4MNQA 2R29L 5HHME 3P9LA 4RCAA 4N0CD 3IJSA 4JAMB 3FRUA 3PP4L 4WWID 4G9FA 5D7IF 2R9HC 1KIRB 2JE8A 3VD3A 3BDXA 4DJMA 3DX9B 3CLFL 4MAYB 5E4IA 4MA7H 1KXTB 3VI4E 4TRPL 3QT2A 4EI6B 5CEXA 4NZDA 1WTLA 1JWUB 4IDLA 1HEZA 2P1YA 5EU7E 4ONHB 1TVBA 4YLQT 2WBKA 5B38G 2YKLH 4BZ2H 1MCJA 3O6KL 2AJYH 3TBYB 4IRZH 1F4WH 5DJ2B 2DLTA 3F7QA 4NSKB 4F8QA 4N90D 2BMKB 4PJEB 2ZKHL 2ERJC 4D94A 2NQCA 4PJAE 4H88L 4WV1C 5CZVL 5EOCL 2LE9A 1HZHL 1IEBB 3F58L 3X11B 3G6DL 3NIFF 3RWIB 1S7XA 2QQLH 2V9QA 4LCWA 1LK2B 1WUNT 5IF0B 2HN7A 1OP3H 3HE7B 2R2HB 3NABH 2VLJD 3NFPA 4WDIA 4YO0B 3OAZK 5DURB 2BC4B 1KPVA 2DBLL 5AG9A 5I75B 2JF1A 2UYLA 1RVFH 1FO0L 1HHGB 1OGAB 4MCYA 5D1QC 3IAPA 3VH8A 4GXVH 4JFFA 2WBJB 1WFOA 2AEQH 1KEGL 5J56B 5EH1A 1G6RA 1OM3H 1X4XA 5HGDB 3RGVC 4M3JA 4UNUA 4PJHB 4OIIL 3U0TB 4X6DA 43C9B 2PYED 3EDKA 3DX7B 5J7CC 1LO4H 1VFBA 2X89D 4L8BB 2FWOB 4LBEA 4QWWD 3BZFB 1BM3L 3JTTA 1A3LH 4N0FB 4XPAH 3VRIA 1A7PL 2GJ6A 1RAMA 4YXKL 1A8JH 1FFOB 1G7JB 2CDFB 5EC2A 1S9YA 1OVZA 2GAZB 3ARDB 2G5BA 3QDJB 5DMKB 5KAQF 1EEQA 2X2YA 5FM5M 4MCZB 4GKNB 1ZHKA 5BO1L 3MUY1 1KJ3H 5CHNA 1FH5L 5T5FL 1GGBL 1GGUA 1C08B 3MLVL 5CJXA 4P9ML 4HPOL 3GO1L 1HQRB 2FRGP 5SWZB 4TTDC 3FZUD 1NMAH 4Z7QF 5AYUL 1EO5A 1L9NA 2HJLA 1VKXB 5DDHA 4M6NL 3IVKA 4O00A 4NQEE 5GS3A 1NUGA 3PWLA 2DQHH 1BD2A 1AO7D 2H2PD 5L2KD 4U6XB 3X11A 5TFSL 5DEGB 2CUIA 4IIQB 4XHQA 3MRCB 4PJ7F 3NH7L 3VWKC 1MRCH 2VH5L 3GMQB 4P57B 1PEWA 2R2BA 1OP5H 2R0ZH 2EO1A 3DIFB 2HVKA 4UI2A 4QOKB 1AGCA 1R3JB 2OI9C 1OLZA 1OGAA 2DS4A 4LVNC 4LL9A 4MNHA 4OZ4B 4K3JH 2GUOB 5EBMB 1F6LL 5I17B 4ALAH 2DQTL 5IM7B 1YMMD 1JWSB 1ZKAA 4FTVA 4UMGA 5DMIL 3GNMH 5HYSB 1DLHA 1BWMA 5EZIH 1BQUA 2YZ1A 2LABA 2YA0A 3U0TA 1RQ5A 1C5DB 1SJHB 3B5GA 3KJ6H 5JIHA 3KJ4C 4HQQL 3REVA 2N7BA 2ITCA 1ZMYA 2VR9A 3AS2A 4PGDA 4U31A 4G8GE 5CJOH 3MBED 3BZFA 5LXGH 2ICWJ 5D93C 4N0FA 5IB4B 2AJ3A 2APWA 4KWUA 32C2A 3EYVB 1T0PB 4LARH 4QXTA 2ICWI 2A9MH 2MQ3A 1UZ6E 3CLEL 3G08B 1P5UA 5C7XL 2HJFA 4R4BA 1QR4A 4JLRB 2WIIA 3T77B 1AIFA 4C4KO 5TE4H 1FBIH 4KQ3L 3WIIL 2A1WH 4Z7WF 4RMTA 3U7AA 3VXNA 5DJXA 2V7NA 4HMDA 4LPTA 4NQSA 4XMLH 3HUJB 3JWDH 4PP2B 3AMKA 5T3ZL 2VZTA 2HA1A 1DSFL 5FFLA 4NDMB 1ZT4A 4I5BA 1PKQB 4MB5A 2FIRT 3O2DH 5FF6B 3BDBA 4X6BA 2V17L 3QR2A 2F5BH 4XXDA 1KNOB 4UINL 5E4EC 1PLGL 3L3HB 4J2XA 4YDJA 2WSKA 3GMQA 4QTHA 1A9BB 4F7EA 1OARH 4AT6B 5DQ9A 4XAKD 1A6VL 5IQ9A 1CFSA 4KI5D 2X7LB 4OLUL 2X4UA 3K81A 2GUOA 3RTQB 4PG9B 2IQ9H 5EIIB 1Z9OA 4PBWD 3ARQA 1QFWI 2N56A 1Y18B 3BGMA 4S11A 5E8NA 4ZUVA 1EO8H 5I19L 4KI5F 3VXSE 2CUMA 1VGKA 5I71B 4XI5D 4UT6L 4G6JL 5C0GB 4U1JB 4N1EA 2OP4H 3GHBL 2I5YH 3SY0A 4LPUA 4YHMH 2QSCL 5TE7L 1FVDB 3QQ9D 4OF8A 3EYVA 1YNTB 3PWUB 5C2BL 3SDAD 1RURL 3RIFK 2VXSL 4U4BA 3HMWH 1FYTB 1BWWA 2GTWB 5JR1H 4XP4L 1H15A 3LEXB 5FYJD 5DSCB 1UEMA 5GJSL 1LEIA 4K7FA 1RULL 3UTTD 3LN5B 5EO0A 4IMKC 4XTRC 3TCLB 4XBEL 2CMRH 5ID1B 5E6ID 4QHUB 3SE9L 1QLEH 4CNIB 4HG4K 1TETL 1I7TA 3DMMA 1GGTA 4OF7A 5TE6H 2QKIB 2R29H 5IVXF 2GHWB 4ETQA 4NDMA 5A16A 1A4KB 5MP6L 3BVNB 3PP4H 3KYOA 3X13B 5F9WB 2B5IB 3IETA 4FNLL 4NZJA 5D7IA 1KNOA 1CICC 2OTUB 5EIVA 4KTEL 3CLFH 3KXFE 1XR9B 3PV7A 3TBWB 2PYEB 3OSKA 4U6YA 5ICYA 3LKOB 4GBXC 5T1MA