1BZ9B

Crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Murine class i mhc/peptide complex
molecule keywords PROTEIN (CLASS I HISTOCOMPATIBILITY ANTIGEN)
publication title Structural evidence of T cell xeno-reactivity in the absence of molecular mimicry.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bz9B00
1NUDA 1LO4H 3MRRA 4W81A 4HFWB 5E2VL 5C07B 3RVUC 1V7NH 3UYPA 4LLUA 2GT9B 3NFPB 4TSBH 2Q8BH 2VKWA 1TZGL 2DM7A 1CDGA 1DBKH 1NCUA 3EYOB 3QFJD 1I4FB 4BQ9A 1A6TB 2R2BA 1SEBA 4KKLC 5FCSH 5IVZA 1MCHA 4P2RA 1KSRA 5FUZL 2E7CA 1EAJA 5GGTA 1GIGH 1I1RA 1T2QH 1CL7I 3ECBA 5EOCL 4MLSA 5IMLA 1T5WA 4W6YB 3O3EB 4GAYA 3GSNH 5D1XC 2KQMA 3MACH 5D8JL 5AYQA 4NN7B 3DIFA 4TNVF 1MJ7H 1LE5A 3DROA 2DBLL 4KTYA 5FHBH 1WK0A 4KVCH 4QWWC 2PYEA 1UH3A 4JANA 3HZVA 5ILTH 3SO5A 1S5IH 5F89B 1RIVL 4S1DD 4OT1L 4OZ4B 1A6WL 1UEMA 2NY1C 2HVJB 1G6VK 3DX9A 4RMQA 3RWGA 1JI2A 4ZG1A 2YEZA 4P3WA 2QR0B 3UJJH 1NMCB 4AL8H 4JFFB 3CVIH 3BPCA 2DQHH 1T6VN 1YNKL 4ZFOA 3KPPA 1W0VA 2P5WE 3UBXI 3RGVC 1MFCH 3MPCA 5KSAD 3FT2B 4UV4H 3ARUA 3GKWL 3LEYH 5EU6D 2A1WL 4YZFF 5J13B 4RGMB 5CZXD 5IVXA 2JJTC 3VG9B 3QQ4B 1VENA 2BSTA 3CCHA 3Q5YA 5TQ0H 5DA0B 4U3XA 3QEQA 1YEJL 2WBJD 4MAYB 2R0LL 2R69L 5FB8B 2JB6B 4IOSD 1Y6NR 3O2DL 1INQA 1EEZB 4NQUA 4H26B 4K3GA 2CKNA 4FNLL 5B3JF 3VFWB 3HHRB 1XR8B 2GAZB 3GRWH 3OXSA 3CFBA 2L0DA 3GSOB 5JR1L 2AJ3B 2JB5L 4HLZH 2NY0B 2N56A 4N68A 2EH7H 1P6FA 4OI8A 4EQ2A 4IEFB 1NEZA 1E6OH 4JY6A 5DMGD 1Z5LB 3RVTC 1ND0B 1FJ1A 4ZDHA 2H3NA 4BQBA 4X6BB 1NLBL 2AK4D 5CBEB 3EJZD 3BDYL 4Y88A 5ERWB 1JPST 5F88A 3WDIA 4C83A 3BAEL 1S9VA 4Y5XB 2WUCH 3S36X 4S0TD 4JFDA 3ZDXF 3PWJB 3EFFA 1QYGH 4FQLL 4MNQD 2X05A 4QYOA 4LPUA 2B39A 1Z9OA 4PJAF 2JCCF 3EYSL 1WAAE 3ULVH 5C9KA 5DSCB 2WLZA 3TO2B 4M3KB 4N8CH 3O11A 1J87A 4Z0BL 3OKEB 4R90L 1MJ8H 5DMKA 3FO9B 3C60A 3TCXA 3CLFL 4LNVA 2G5RA 5C7XL 3VD3A 3JWOL 4Q74A 4TVPE 1A21A 5T3ZD 2Q76B 1BWMA 5A2JH 1H15B 5MEQB 3MFGB 2ATKA 4U7MA 1UWXK 3Q6GL 1KJMB 3HE7A 4IRSA 5D2NC 5I17A 3P0VL 3L5IA 1QOKA 5GGVY 1KELH 4H5SA 2CDFA 1PKQB 4GQPH 4BZ1L 2Q20A 4OGXL 5AZ2L 1CICB 3HNTL 3OPZL 4LGPB 1FFPA 2DRUA 3LQZB 3ME0A 5DGRA 2D9QB 4N9GB 1JPFA 5KOVC 3TC9A 3UJIH 1LQSR 2PETA 2Y5EA 4FHBD 2P46B 1CG9B 3AM8A 1KJ2A 5E95B 4OZIA 1DQDH 2HN7B 1AO7B 1U3HB 4XGZB 4WW2A 1MLCB 2DLEA 1P4LB 3GHBL 4U2ZA 5DGQA 5EIVA 5FDWA 3LKQB 5IB5B 3ARQA 2B2XL 3QDMD 4HKBB 4UTBL 1PY9A 3QH3B 4BQCA 1BLNB 2WWMD 3QYCA 3TO4D 3QQ9C 2V5RA 2JLLA 4YR6A 1EMTL 3NCBB 4L8SB 1R3JB 1DQMH 1UA6L 5IFJB 3IKKA 1RPQA 3MREA 1OOAA 3BKMH 1PX4A 3MCLH 3C8HA 3OAZH 2V9TA 3X12A 3LAFA 2ZSVB 2YPLB 3UC0L 3WEXB 2H2PD 3W82A 4M6NL 1EGJL 2ZUUA 3MRRB 3QXVA 1IKNA 5KANG 2VH5H 4LLUB 2D0HA 3CUPA 5DUBA 4FFYH 1SY6L 1EEUA 5EZIH 5F9JB 5E8EA 3DTXA 3BP4A 1AKJB 4U49A 3WFCH 4NZUH 3VMNA 2V5TA 4Y1AA 4EKXA 2FBOJ 2WP3O 4P2RB 5SX4H 1XGYH 4M43L 3T0XA 4XWGH 1D7FA 1RZFL 2VXSH 3AXLA 5C09D 5IW1A 5E5MA 1WISA 4M5ZH 3HC4L 1H5BC 1EO7A 5J3HD 7CGTA 1BEYH 4NNYA 1RUQH 4KDTC 4RFNB 3DYOA 1VPOH 4P9HH 1MRFL 3HMXA 2DTML 3WO4C 4QXGL 5F7LB 3TJHD 4PTUB 2EH8L 1LE5B 1K6QH 2YPKB 2W92A 3STLA 1AXSA 3RU8H 2PYEB 1NC4A 3OF6D 1LDSA 2VMFA 2H8PB 2PXYD 3IFLH 1S7SB 1EFXB 4DUWA 4UOJA 1HQ4B 1YMMD 3D18B 3EYUH 4QHLB 3RWGB 1N59A 2VDPH 2YEZB 4FFWD 3DURB 1HNFA 1G9ML 3MCG1 2WW8A 5DD3L 4HQQH 5E70A 3U9PL 1Q72L 3PP4L 1WBXA 5L88H 4JG1H 1Q0XL 2DDQH 2XNAB 1L0YA 4XAKD 5IB1A 4LFHD 1KFAH 1M6OA 3BPOC 5DK3A 3AB0B 4UOW1 3C6LA 4G7YH 3K1KC 4QRPA 5IVXB 5HI5C 5FUCE 2IADA 2OP4H 4TTGA 5IBTL 3QEQB 3LZFL 4WVRA 4U6YA 4YDIH 4RSVA 1I8KB 4EVNB 4FQIL 3U7YL 1U8NB 2DI8A 3ZT6A 2OLDA 4JO3H 4JQVA 3W0WB 4CNIB 3MRFA 1KC5L 2ATPA 1YEEL 1JZ5A 4O58H 4Y2DB 4JFEE 2COQA 1CXKA 3V0VB 4XPFH 1W0YT 5I1HL 3W2DL 4X4XA 4WHDA 4DW2H 3FB7A 4P49A 1BIHA 3EOBA 5D72H 4HBCH 4HUMB 5CIPA 3LH2H 5EWIH 3VA6A 4R7DA 1FJ1B 2EDRA 4YBQC 3RVVD 4Z77B 2HRPL 4YO0A 3N06B 4LSQL 2ESVD 4UB0H 4XB7A 1IFHH 3GBLA 3RNKB 4B5EA 1TJIH 4PP1D 4OZGB 4PJBF 1YEGL 1FNHA 3H7LA 1KPRB 4YNYB 5JDSA 5BS0B 4ZO6A 3TZVA 3VFUA 3GUTA 4P2OC 1JNNH 3O2VH 5D6CB 3UYRH 4ELKA 4PJ5A 5AZEL 4HXBL 4MAUH 1KGCD 5DD6B 2IBZX 1HHHA 2CLRB 4PB0L 4QO1A 4TOYH 1VFMA 4PJHB 2PKDA 4WY7L 3RFZC 4K23H 3W11C 2DQCH 2FZ3A 4NQCE 1ZT7B 3MRKA 3BYYA 5MENB 5I8KH 3H6JA 5IV2A 4LSDA 3I2CL 1RV6X 2VN7A 2GKIA 3RWDB 3VWJC 4MSWA 4LQFH 3F12A 5L2JA 4OSUL 2L7UA 3CFEA 1K3IA 4R4BA 4MVBD 3VFMA 4H88H 4PJIE 4Z7VE 5F9OH 1S7TB 1M1SA 4OF0A 4KTEH 4OIIH 1FFPB 5DJ6A 2SEBA 5DHVA 1B4JH 3MLZH 5I1AB 5I8EB 2AAVA 4S1QH 5CZVH 4JM2C 1LK3L 5LXGL 3BZFA 1QNZH 2NTSP 4WW2B 2OTPA 4FQHA 4NKMB 1MIEH 3PQYA 4ZXBA 3VFGH 5IW6A 1BM3H 3CFIC 4XVTH 4D2NA 4XP6H 3OGOE 3MBXL 4PJ8D 1PG7W 4XNYL 4GW5B 4NZRH 5HY9B 2QQQA 1ZWIA 1QSEE 3B9KD 3P9MB 1T66D 2KQNA 1F90H 1HXMA 4DGVL 4F9PC 1TVHA 5TF1H 1C08A 1J8KA 4MJIE 3VXMD 3QA3B 2O5ZH 5C0BD 4QOKE 1OP9A 2XZAH 4JCLA 3KJ4B 3CDGB 4LDLB 4P59H 1WCQA 3ORJA 4C4KO 1J7VR 2UZIH 1GOHA 1T1XA 4XC1H 5E8EB 3BGFC 4I0CC 5B3NA 3QISA 4XNXH 1XGTB 1BF2A 3GFUA 3O45B 4Y19B 4GG6A 5I1EL 3VWKA 4HC1H 4H1LA 3QDGA 3T0DA 2ZWLT 3V4VL 4TQEL 3T04D 5I8CA 3MLUL 4ODVL 4H20H 4QHKI 4O51B 4PJ9D 4I0PA 4NNYB 5C9JB 5LJYH 4M9OA 2HYMA 4NFBA 2PUQT 5I1LB 5J6GA 4J4PD 2AV7A 3FMGH 1AQKL 1AXSB 4ZFZB 5LQBH 4ZOBA 1HIML 5DTFA 1Q94A 4L9LA 3EFDH 3GBNH 5F3HA 3RWFB 4MNGB 3DBXB 1BVKB 1OW0C 1G9NC 3HA0A 1RI8A 4MQSB 1IGIH 2QBWA 2Z8RA 5F3BA 3S3SA 3ILQC 2L4OA 3O8XA 3HPJB 4HHAA 2B5IC 1ZT4A 4RQQA 3E2HC 4EN3D 1NFDA 5HHVL 5CSGA 2CKBA 2ICCA 1YECL 1FE8L 3WIIL 4PB9H 2BJML 2IAND 2WSKA 4XP1L 3H9YA 3SHSA 1VFOA 1LEIB 1GSMA 3VFOA 1RY7B 1X6LA 1N3NA 4U6YB 2KZ1B 3PGFL 1MHEB 4YGVA 3V5DB 3C5ZC 4LSRH 1V3MA 4ETYA 5I2IA 3WNPA 5ICYB 4G8GA 3STBA 5TDOA 2CUHA 5HVHB 2A38A 1UB6A 2H6PA 1CGTA 3JV6B 3U4AA 1CK0H 2IJ0C 4X4XB 3V6ZB 4CN1A 1X9QA 4U0QB 3VRIA 3HI6L 3RL1B 3SQBA 5T1MA 5T3XH 2FR4A 4ZTOL 3HFMH 1KJ3H 3L7FA 4PGBB 3MXVL 2D7QA 1KXVC 2VDML 1IGFL 1UXSA 3CFCH 4R8WL 4F7TA 4YO0B 4M7LH 1KLUA 2BNQB 1LO2H 1NEZG 4EI6A 2Y7QA 3IF1A 4GBXC 4NQDD 3KPSE 3VFTA 1YQVH 4FRWA 4LSUH 1FH5H 1KOAA 5J7CC 1D9KB 3TBSA 2E7LC 5C0GA 3E1F1 4XX1G 2C3XA 1QLRA 4U1HB 2Z92A 5IFHL 3TFKD 3D2UB 5T5NF 4PJGE 3LHPL 4GRLD 3QHZH 1JHKL 2F19L 1F4AA 1TZGH 1P2CA 1E4WL 1FC1A 1QQDB 4NO0A 1HHHB 5KS9F 2B1HL 3DGGB 2D4DA 2NW3A 4YUEL 4ODSH 4ZUVB 3TBWA 4QXUH 4WUKL 2HFFA 3EOAA 1CGUA 4OGZA 3VXNB 2X4OA 3MRKB 4WU7B 1G7LB 4CUCA 1C16B 1O0VA 1DBML 1MCSA 5IV2B 1MVFA 2D31A 3QFJE 3UZVB 2R8SL 1A7PL 4EJ1C 3SBWC 2P8MB 2EE3A 1BBJA 5L2JB 3LCYA 5DI8B 3CFEB 3QUYC 2RFXB 4PLKD 5L8KB 3HN3A 3E6FA 4YBLB 3VFMB 3GMQB 3ARGD 3CK0L 5MEOA 3KPRA 2NXZD 5C0CB 3MLXH 5F72S 4I4WB 4XC3L 1KV3A 1CLZL 1YN6A 4RZCB 4XNZC 2GI7A 2AQ2A 2KKQA 3IDMA 3ZE0F 3O3AB 2BCKA 1MI5A 1KN4L 4QRUA 5JXAL 4FP8L 4R2GD 5BOPA 1U2HA 5C0AA 2AEPL 2IQ9L 3QCVL 3B9EA 5A2LH 3BZFB 4AH2A 1C12B 4Q97A 1KIQB 2NX5E 3DETC 4FQHB 5TPWL 1F97A 1K9TA 3GKWH 1NAKH 5HYIA 1S8DA 2A1WH 1NMBL 4JHZA 2FHCA 1RZKC 4TRPH 3GMNB 1HE7A 5CJBA 3DUHA 4F8QA 1A47A 1MWAH 1E4XI 3M8OL 2R0LH 4DKDC 4NBYB 4I18C 4DKEL 4KGJA 5D7LB 2W9DL 4WHCA 5C92A 3O3DA 2MQ0A 4IJ3B 1HXMB 3RZCB 3LMJL 4FNLH 5GQBA 3ZKXB 2I60L 5EU6E 4FQXA 4ZUSB 5BV7C 4OUUA 2YA1A 4JFPA 3DXAD 1VFAA 5CFHA 2GTZB 1CE6B 4PFEA 4OTXL 2J4WL 3QDAA 1A2YA 4L29A 2W91A 1P4BL 3V8OA 1QFUH 1YNTB 4Y4FA 5CBAB 2EE6A 5EG6C 3BMVA 2PO6A 5KJRL 1AHWC 3BKJL 3PGDA 1NLBH 5D5MA 5IF0A 5TDPA 3F7YB 2EDDA 3BDYH 4H1LB 3RPKA 3QDGB 4F80A 4RRPG 5I8CB 1T89A 5DMYA 1XF1A 4M62L 2DQIH 4WDIB 4X4YB 1RJYA 2X41A 1N0XL 3LKSB 1S9XB 1CGSL 2R2HA 4JPWL 4LHUB 4HV8A 4WV1A 2AK4E 3IFPA 3MBEC 3IAPA 1A4JB 2UWEA 1DQLL 2FX7L 2AV7B 1FGNL 3EYSH 5EPMA 1ITBB 3OB0K 5DTFB 5FO7A 1Q94B 3AS0A 4L9LB 5FGCE 5GJTH 5KSBF 3NH7L 5TE4L 1A3QA 4MNQE 5DJYB 4U1GC 1G7IB 2R23A 5DDHA 3REVA 5IOPA 5MI0B 3QDJB 4R90H 4JM2B 4P4RA 3MRQA 1X5AA 4JO2L 4QHKJ 3QG7H 3BIKA 4RQQB 1TJGL 5SV3A 4Z76A 4CL7A 4DFHA 2CKBB 5CJ8A 3CH1B 3Q6GH 2CUIA 5F93C 2YPVL 1GGBL 1BFTA 3C2AL 2DS4A 3K0WA 3O2DA 2I27N 2X4SA 1TIUA 1LNUA 4YHML 4XH2A 5AZ2H 3VW3H 2APBA 2Q87A 1TCRB 1FVEA 3OPZH 5T3ZE 3IU4L 4HXAL 2CIKB 3KPNA 4PLNC 2F53B 1HQRA 2CXGA 3S34L 3BT2L 1FBIH 5TDOB 2UV3A 3PGCA 1XZ0A 2A0LD 4FQ1H 4Q0XL 2HJFB 5SWSA 4NFCA 1WBYB 4IMKC 1HOCA 4KI5F 4UTBH 3R8QA 4U2YA 5DVKA 3L5WA 3BWUC 3T2QA 4NQTA 3I6GA 3U30B 2A6IA 2FJFB 3CMOL 3PWNA 3ZTJG 4D0BA 3P0GB 2NY0D 1AGDB 2GSGB 3ARFA 3BJLA 1JHLL 3UX9B 1IEBA 1KLUB 3BH9A 4XXDA 2R4SL 4HD9A 5TDNB 4DKFH 2Y7QB 1UM6H 2VC2L 3QDME 2HTKD 3VFTB 5DXWA 1U8LB 1QO3B 1FVCA 5B39A 3TBSB 4KRMB 1EGJH 5TFSL 5C0GB 5CCKL 4YZFE 1IZJA 2NY6B 5JUEL 5LGHL 2V7HB 3A0OA 4PJFA 1CU4L 3QUMB 1SY6H 1S7WA 3FRUB 4YC2B 1QRNA 4GUPA 3BZ4A 2WMPA 3MJ8A 4HH9A 1BPVA 1OVZA 4W6WB 1PG7L 4M43H 3I85A 3TBWB 5B3JE 1KBGH 1XGRA 5H35A 2VLRA 5GGVH 1KPUB 1UWXH 2ITDA 2IPKB 4MJ2A 4U0RC 4DOHE 4CVXA 1MRFH 3SCMC 4EXPX 5F7WC 3PV6B 1EJOH 3FL7A 1HWGB 3NAAH 3BP7A 3T0ED 3WL9A 3PL6D 1MCOL 4APQA 3ARWA 3E6FB 5L8LB 4M1GL 1BZ7B 2G75A 5H2BB 2IPUK 4NOFA 3ARTA 3BVNB 5MEOB 1IRAY 3KPRB 4P4KC 3C5ZB 2XQBL 4AMKH 2Z8SA 5EUOB 2LV4A 3RNQA 1Z9MA 2FJGA 4PY8J 3ZDXE 1U6AH 1OTTD 4E5XB 2V5YA 2BCKB 3U9PH 1MVUB 1Q72H 1YEIH 4PJAE 1NGQH 3LRSA 3LSOB 1R3HB 2FX9L 1G6RB 1DL7L 4XVSL 5TQ2L 4YDKH 2JCCE 1OM3L 3RBGA 3MYJA 5F96L 4PRIA 2FB4H 3C09C 3TIEA 4R3SA 3L5JA 3S88L 5EU5A 2HLAA 4ZOEA 3QZWB 1OSZA 1DVFD 4HJ0C 5BO1L 4XMKH 1TTFA 1GZPA 3NPSC 4HS3B 2E9WA 3OZ9H 3LZFH 1IT9H 4NN5B 1BVZA 1T5XA 5F9DC 4FQIH 5C08D 4XAKE 1J10A 3O3DB 5F7FA 4P23D 2YRLA 4OUUB 5GSRB 1HKLL 3MRHB 1QA9A 4HLJA 3I9GL 5E4EB 1VFAB 2BXZA 1G9NL 5DD0H 2CXKA 3MOAL 2ZPKH 2XXCB 2E27L 3HNVL 1HHIA 4WI4A 3BQUD 4BSWA 4NHCL 4HEME 1KCUL 5K9JH 4PJEA 1FP5A 1VSCA 3HLAA 2XY2A 3PGDB 4KI5D 2R0KL 3QHFH 2BFVL 2HRPH 3BH8A 2HFEA 3D85D 1IAIM 4D9RD 1PW3A 1OAUH 1FO0L 4AEIL 1J8HE 3GMOB 3ZT5A 5B8CB 1FYTA 1JV5A 1JPTH 1IAMA 4P2RD 5FOJA 3OG4B 4HV8B 2WM0A 4G6FD 2W9EL 1K4DB 1MY7A 4H1LG 3IDIB 4LF3A 2QV2A 1VACA 4U6XA 5MERA 1LILA 5FO7B 4YXKH 1LVEA 4F2MA 4OM0H 1X6NA 3BZDA 2DQEL 2H32A 1P7QB 2R2CA 5DJ8A 4AM0A 3P30H 5DJDB 5GS1A 1C5BL 4LHUG 4YFLI 5DJCB 5GGRA 3AROA 1CXIA 2PYED 2XTJD 5DR5L 3UTZB 5IOPB 2FECL 4P48A 1AGBB 5IHZA 4P4RB 5JW4Q 5T5FL 5IT2H 4PRNB 3BIKB 3T0VA 4K3EL 4TUJB 3QR2A 4L5FL 3I2CH 3Q5TA 3V6OA 5HI4D 1QHOA 1EXUB 2FHBA 3OHXA 1JL8A 3NBNA 1A02N 1HI6A 4XZUB 4MHHI 5CILL 3SE8L 4DQOL 2LAAA 5K9QI 3FZUC 2O5YH 1UJ3B 1RMFH 5I71B 5CSBA 3U7WH 1N4XH 3LKOA 1IEAB 2K1MA 1JPSL 3OMZA 3WUZA 3KPNB 4PREA 4MMXC 4W4NA 4Y16D 4CN6A 1P6AB 1HQRB 3QEQD 1Y0LA 4LOUC 3HB3C 3H3PH 1LK3H 3HZMB 3L3DA 5LXGH 2OMBA 4UAOC 3UP1A 4XPBL 5F6IB 4J6RL 1CVRA 1VFBA 4HZLB 5SWSB 3EYQD 3G5XA 5HGBA 4JN1L 1I3GL 1NDMB 4NZJA 4J3OC 1PSKH 3IRPX 4GAGH 3TYGL 4AYFA 1UJTA 3ARFB 4XNYH 4CMHC 1VKXB 5FFLA 5D7JC 2ZCLH 4AY0A 3BH9B 1OD9A 5FGSA 5FYLH 3V0WH 4WWID 5FUOL 2NR6C 3TT1L 3T2PA 4RAUB 4WI6A 1YEFL 1S7XB 5IMMA 1BZ9A 4BFEA 1U92B 3MLSH 5B39B 2RGSA 1A3RH 4S1RH 1FC2D 1REIA 4DN4L 4NKIL 2FATL 1HSBA 4DK6A 1K2DA 4JFDD 1S7WB 1FSKC 3WIHA 1QRNB 3M1BB 1N5AA 4NWTH 3MJ8B 4HH9B 2P5WA 5EOCJ 4BSJA 3VXME 2DBJA 5HYEA 5SWZD 3P11L 2VZVA 2IPTH 1CFTA 32C2B 5C0BE 1W8OA 3V4PL 2EZ0D 2VB5A 1A5FH 4ODTH 1PQZB 4R0LC 2VLRB 3MRNA 3MLUH 1OP5K 2EE9A 4JY5H 1EX0A 4UUJA 5DZNA 1HDMA 2ITDB 3SDDC 4D9LH 1RZKL 3E8UH 3PWUB 3MR9B 2WK2A 3C60D 2BVPB 2E8YA 2EYTA 5D1ZA 5E6ZA 3BP7B 3FCTB 4OCXH 1K4CA 3RWCA 5FF6A 4APQB 1NLDL 4JGMA 4GAJL 3EDKA 5IQ9A 1LP9A 3CDFA 1IGTA 5BV7L 3HE7D 4IRSD 4UTAL 3ARZA 4PJBE 1U8QA 3H7BB 2BSED 3RNQB 2FJGB 4CMMA 2I9LA 3O6FC 3REWA 4X6EA 3QG6B 4BK4A 1ADQH 3GMMB 5T1KD 1X5HA 5E2WL 2IPUG 3LRSB 2X9YA 2Y6SD 4OCNC 5HHVH 1MFEH 2EDHA 1E28B 4NSKB 3MYJB 4PRIB 3ZHKA 3TIEB 4R3SB 4HUKB 1T20A 1KNOA 2C1PA 3S7GA 1I8IB 1J0HA 1GZPB 3MGTA 3RQ3A 5JIPA 2AQ1A 3TBTA 1T5XB 5JORB 4LARH 1WAAA 2OZ4L 4ELMF 5KBNC 2IANE 3QZWG 2BY2A 4FZEH 3WLWD 5A16A 5C2BL 1YDPA 1IAOA 4Z7WF 3MNZA 12E8L 3E6HA 1ONQA 4LKCB 1J86A 3NN8B 1M7DA 5J11C 5JNYA 1FV1A 4MQTB 4NC1C 3NCMA 5DZOA 5HVGB 3TP4A 2D3VA 4BSWB 3RGVA 3TPUB 2AV1A 2HH0H 3WHXA 4ERSL 3EJYC 5IB2B 3MXVH 3ET9F 3OKKA 1D6VL 3QI9C 5D93B 4GMSL 2IFFH 3FO0L 3VXQA 1RVFH 5IK3A 1IGFH 3D3VD 3BH8B 4FQQA 1H3TA 4YHZL 2HFEB 2JJTA 5C0ND 1ULVA 1I1AC 3RVXC 2EKJA 3MLYL 1A3LH 4Y1AD 5JO5B 4EQ3A 4UT7L 3OKMB 2C4XA 4NO3A 4J3SA 4L4TB 4JKPL 4QRRA 1INDL 3TESA 5IFHH 1CE1H 2K3TA 1YPZA 3LHPH 4XAWL 3ARBD 4RMVA 3LN4B 4ENEC 3O6KL 4NQDE 2H32B 1II4E 5DJ8B 3SJVE 5D70L 3GBMH 2J3SA 2L7JA 3MUJA 1EH9A 5GGRB 1NC4D 3LPGA 3V5KA 25C8L 5GGRY 1MFBH 5TE7L 1DBMH 4RFEA 5IB4A 1CXLA 1BOGB 4U6HA 4ZOCA 5IGXL 2VXTH 3HC3H 3KYOA 1A7PH 3AFLA 4Z7UB 3OHXB 4WENB 5C0IA 4HKZA 4XMPH 3QCTL 3NPSB 4QRSA 3QUZB 5FKAB 4CAGA 2W0KA 4X9IA 4X7TA 1TQBC 3CSYB 5EN2A 2X4NB 3MRJA 3KPOA 4OLZH 3N1PC 1A1OA 1RJLA 5K59F 3WLBA 4JDTH 1MOEA 5D71L 3U7AA 1XF4A 3LKOB 3C6LD 4XC3H 4JN2B 4HMDA 1A6AA 4QRPD 1CLZH 4L4JA 4XI5D 3VXRE 3MO1A 3HRZB 2MOVA 4G5ZH 2XKSA 2QEJA 4FP8H 2IQ9H 3QCVH 1DBAL 4KMQA 2WLYA 3X3FL 1OTSD 3JBG7 5ID1B 1RURH 4KXZH 4Z18A 1NBVL 3QO0B 3G5XB 2E7BA 2QSVA 5CP7A 1B4RA 3HS0B 2NY4B 1BFSA 3A67L 3IXAA 2RR3A 3OR6B 1FFRA 3P2TA 1FZMB 1H8NA 4K3DH 5D2NA 4ZPVA 4R7NB 4HG4K 4YE4L 1OD7A 2EDFA 5DRZB 2X6MA 2Q7YA 3MV01 2NZ9D 4GG6F 3C6SA 5DLML 3V5HB 2Z8VC 4OI7A 1OGTB 3IJHA 3N85H 4Y8AA 2I60H 4XP9H 2BRRL 3T3PE 1BZ9B 4R97C 4RX4D 4G80B 5JHDA 4F58L 3IJSA 3DNKA 1JP5A 5IR1B 3WUWA 2J4WH 4ZNCD 2EIZA 3SE3C 4D94A 1YJDH 4WTXA 1BIIA 1AI1L 2FX8H 2K9UA 2PTTA 4NUGL 5HYSA 3EO0B 4JDZA 5GZNC 2XA3A 3TZVD 3MLRH 5I73B 2E5EA 4HWZA 4Y5YC 5DS8B 3U36A 4MWFB 4Q6YA 2P5WB 5B39G 4MX7A 3T8XB 1FPTL 3DX6A 3IGAB 4QLRA 1MFAL 1L9MA 1CTOA 1BFOA 4PJ5D 5DJZB 5E8NA 4HJJH 1JPGA 1R5WA 3JV5A 1CFQA 4WCYL 1FIGL 4LSVH 4M62H 4UUJB 4LMQE 5EUKA 1HDMB 3G5ZB 1OB1B 5DRWB 2X1WL 5EORH 4CKVX 1KTLB 1X5YA 1PEWA 3P77A 4P5MB 1NFDF 4HWBA 4N90D 1DQLH 3BPNC 5CLWA 1K4CB 3VGEA 5FF6B 5ABDE 5I19L 1OSPL 2YBRA 2FBJL 2YHGA 5IQ9B 5TE4H 5BZWB 3FJTA 4KJQC 4L3EA 1ZSDB 1VEMA 3REWB 3QUXA 4X7SH 2M8XA 2MMXA 5CGMA 4NRZA 4OJFL 3HKFA 3BHBB 3RWEA 1TJGH 1KLFA 5HHPB 3B2VL 5ESQA 3BDXA 1H5BA 1HK6A 4BSVB 5D1QB 4YFDB 5JOFA 4JPIA 4OZFA 3NPZB 3BZEA 5KS9E 5EZJB 1KNOB 2C1PB 3K46A 4CMHB 3GJFB 2B4CC 4MCYA 3UPRA 1DCLA 4YHMH 3CFJA 3N0PB 3UTTA 1RIUL 3TT3H 3TBTB 3PQYD 5DYOB 4ZXBD 5BQ7A 1U3YA 1BFVH 2BSRA 3GJEA 5EB9A 4WJ5A 1A22B 4O2FA 5IBLC 3BT2H 3L95B 5CUSL 3SKNB 2IH1A 3MGOB 2C9AA 2VXQL 3LIZH 5JNYB 1FV1B 4M6ML 4Q0XH 3TN0C 1N7MH 1OHQA 5CEZE 4WO4B 5BVPL 2BDNH 1JGUL 2H2SC 3W9EA 2DQUL 3WHXB 4EDWL 4WFFD 5I66A 3QJHB 3CMOH 4L8CB 4HG4J 4K9EC 4OB5H 4FQQB 4LL9A 3ZE0E 3A6OA 3TA3C 1H3WM 4FXGB 1ZTXL 3H9ZA 2R4SH 2VABA 1J12A 1WLHA 3K8MA 1UKQA 4TTDD 3CVHA 3LQAH 4PJIA 3DVNB 3VWKD 1UQSA 3OAUL 1DBBL 3QDGD 7FABL 3CSPA 5ESVB 2J8HA 5HYJE 1NBZA 4O02H 3LEVH 4I0PD 1IZKA 2R4RL 4ZO9A 3KXFA 2YKLL 1DANT 1U8IB 2ARJA 1RZJH 1TCMA 1I7UB 1JWMA 4X5LA 1FNGB 5A2FA 4Z8FL 1Q8MA 1PG7H 4OQTA 4AQ1B 5CD5D 4TNWF 2NW2A 2DWDA 3PWLA 5I8OH 4KXZI 1TTUA 4LSSH 3QCUL 1GRWA 1FFOA 2G5BA 4V1DA 2VXVL 5JW5B 4ONGH 3SDAC 4U6HB 2DQFA 4JB9L 3EO9H 3KYOB 3ARED 1QSEA 4G6ML 2H41A 3O8XD 2P44B 4HKZB 4K7FB 4LVHC 4QRSB 4XXCC 1MCOH 2NY3C 5JA9A 4X7TB 1Q1JH 3DV6B 2XY1A 3FTGA 3RWJB 2VLKE 4OD2A 4MJIA 4UBDC 3ULUF 4M1GH 1X4ZA 1NUNB 4H8WC 3H0TA 3WLBB 4QOKA 3IDJB 4GT7A 4G6KL 2F15A 5L7XH 4JGJA 2V2WB 3G04B 3T0EE 1A0QL 3PHSA 3NGBC 2R1YB 4YXLL 1XMWA 3KYNA 4XBEH 5KZCB 4JQIL 2FX9H 4HKJA 5A3ID 5HYQA 3RTQC 1U9KA 1OM3H 2AJYH 5E08H 2EDJA 5KSBE 3K8LA 5DMJB 4G8GD 1FZKA 1KYOK 5TH2B 3IXAB 5BO1H 1QR4A 3VWJA 5DUPH 4HWNA 5DK2A 1I7TA 4ZPVB 3TNNA 4AENB 1XGQA 3QNXA 2CO6B 4XPHL 1NDGB 4GXVL 5D5MF 1QACA 4M6OL 4X6DA 2Q7YB 3GMPA 3C6SB 3QIBB 5JW4R 3QWOA 1OF2B 2ADFH 2CQVA 5JZ7C 1I9IH 3NTCL 1NH6A 1VEOA 1WEJH 1LDPL 3UO1L 3MRIB 1SEQL 1FL5B 3QUMH 3WUWB 4LPCA 2GIYA 2EIZB 2VWEE 1A64A 5E6YA 1WTLA 3AAZA 3G5VA 4Y4HC 4DKAA 3Q3GB 5C08E 2PTTB 2UWEF 5KAQF 4NHCH 1LWRA 1AC0A 4HWZB 2P7TA 2QKIB 3U36B 1I9JL 2R0KH 4MX7B 3EJJX 1J5OL 1KCRL 2Z35B 3DX6B 3PWPA 5ECJE 1BWWA 3T09A 3BFOA 4MA1C 5E8NB 1JPGB 2UY7A 4F7EA 4NO0D 4JG0L 3B2UC 3OB8A 5EUKB 4MMZC 1D5ZB 3FO1A 5C86A 3LRHA 4R96B 2G9HB 3MV11 3TVMC 5LWYL 3P77B 1AD0B 4KI5E 3QXAB 1TQBB 4QHMB 1CGVA 5EC1B 2GFBA 4MS8C 5AD0B 4ONFL 1H8SA 3PIQA 4D9RE 3P73A 2YBRB 2YC1A 1WZ1H 3VD9A 2A77H 1HYRC 4JFEB 2DQEH 1WBZA 5IJKC 1C5BH 1F6AA 3WFHB 1NGXA 4QTHA 1CFVL 1GGIL 4ORZC 5T5FH 1JRHL 3QUXB 1G6RH 3UJTH 4UU9B 5J0BA 1FDLL 1UG9A 4NRZB 1AGEB 4HPOH 5CJOH 4HIIB 3KJ6L 4FQ2H 2XN9B 5J89A 3FONA 1MJUL 2HJLA 2JE8A 4Q6IA 3TYFA 4J23A 1MI5D 2FSEA 3GSUA 4JPIB 2XTJE 3EOTL 1JJUA 3KPSA 5C0AD 1XT5A 2ZUSA 5FYJH 3SE8H 3WJLA 1S7UB 3FQUB 1VDGA 1S7QB 4F33B 5F9AC 4LLAA 2J5LC 2GYSA 4BZYA 5LKNA 3ULUD 4U1LA 5GRWA 5IMOA 3QIWC 4PJGA 5BQ7B 2J7LA 3PHOA 1FRGL 3JUYA 3K8KA 4DZ8B 5F1NA 3IFOB 4WJ5B 1DN2A 5E6IB 1RJZA 3RVWD 3HG1A 3EYVB 1Z2KA 2IH1B 1IGMH 1FHGA 3L3OB 4LCCC 4MA8H 1U8MB 4FQXD 4NQCB 3CXDL 2C5DC 1OTUC 4PJFF 4MZ3A 3TYGH 5L9DL 1QBBA 3PABB 3QFJA 5D7IA 1QEWB 5DMGC 1F8TL 4Y4FD 1FYHB 2MFNA 4GMTH 2VABB 1YY8A 2PO6D 3BGMA 5DRXB 1XCTB 1YNLH 3ZO0A 3CVHB 3P4OB 1RZGA 5BVJA 4PJIB 3G6AB 1XCQB 4Z7VB 1DUYA 4NM8L 1MEXL 5ANME 3ZKNC 5GGUB 4X7CC 2VLLB 4DN4H 3F62A 5FGBC 2VAAA 4NKIH 1AP2B 3MA9H 2FATH 1MIMH 4YXHH 2DJ4A 1ZAGA 4X6FA 1E27B 1YMHA 4HIHA 5DD5H 15C8L 5JPNA 4AIOA 2XZQL 2NX5A 1EEYA 3V4PH 1J0KA 2NW2B 5J6HA 3PWLB 3KWWA 4YFLF 5L0QC 2BSSB 3PUCA 5EO0A 5I1GL 1FFOB 2G5BB 3V7AE 1J1PL 3OGCB 1BJ1H 2DQFB 3VXTB 5FA4A 4HWEL 1SYVA 1RZKH 3ULVC 2OMNA 1QSEB 1IBGL 1IKFH 1CFNB 4GBXA 5SWZE 2NZIA 4OCRL 3RIAK 5KSAA 1UCBL 5JHLL 3ARDA 2IMNA 2E7HA 1JWUA 1NLDH 3FOLB 4HGWA 1S7VB 3T77B 4OD2B 4MJIB 4GAJH 4OLXL 1CFSB 3MLWL 1OAZL 3H0TB 4UTAH 2IEPA 1QBML 2VISA 4QOKB 2GK2A 1UZ8A 1W2KT 4LPTA 5DD1H 1FFNB 1FNEB 2EECA 2K7PA 4MA7L 3SEPA 2X70B 3CLEL 3GGWA 2BY3A 1T7VA 5E2WH 4ZO8A 4HKJB 5HYQB 3OJVC 1PX3A 3NMEA 3TV3L 4TPRL 1BVLA 1MRDL 2QSCH 4JZNA 2MHAA 4HW6A 5J9PA 3ZTNH 3V52H 5D96B 4PLJD 2A83B 3BIAX 2EIEA 3SBWA 4YQXL 1MELA 5CSZA 5DHYB 4KHXH 4O5LL 4YPGB 3AY4C 1I7TB 1AR1D 1UB5A 1GL4B 1XGQB 3QUYA 5SWSD 2AK4A 4PJEF 2Z31B 1AJ7L 4M4PA 5KN5A 1OGAB 3QWOB 1S78D 2FEDD 2FRGP 2OZ4H 4JR9H 3X3GH 5JW4N 5DJ2A 1IL1B 2IF7A 3IS1X 12E8H 2MKLC 4OZHF 3MRMA 1SYSA 2IBGA 1TPXC 3O4LE 5E5RB 2EDEA 4P3DA 2OTWB 3AS3A 4LSPH 4JKMA 4BYHA 5MHSE 1KXQE 2C3VA 4NJAL 5K9KA 2P7TB 1JNHA 4GMSH 3FO0H 4TULL 1CXFA 3L9RB 4I3RH 1FZOB 4ZYKB 2YMXL 5F7UA 3JTSA 1F5WA 3WUWG 2DD8H 1U36A 3Q48A 3VXUD 4G7VL 1QRND 2DYPA 3S5LB 1U8PA 5HYSG 1J1XL 2DJSA 5FA3A 1KCVL 4LGRB 2B4CL 5DT1H 3S36H 4UNUA 5J3HC 3PG2A 1QLEL 4PRDA 3D3VE 4M7ZC 2GFBB 4JLRB 2OXHA 4RGND 1KXTB 2AQ3A 4XAWH 1A7RL 5E8DH 5J12C 5E7FA 5CGYC 2E7MA 1MCDA 3TJHC 3GIZL 3O6KH 4Q9RL 3EDDA 4Y1AE 2O26U 4R9HA 1X7QB 1ZHLA 5HHMD 1SBBA 1F6AB 3L1OL 4APQD 1TNNA 1E4JA 5HGGS 3S35L 1BGXL 1NCBL 1WT5A 1AHWA 4XBPA 3JVGC 4UQ3B 1RFDL 5IKCA 2XWBB 4P9HC 2OX5A 2P5EA 2VLMD 1INEL 4LKXB 5IVOA 4D9QD 5TE7H 1FL6A 1S9YB 2NY5H 3QQ3B 4FFWC 4K9EL 4L8DB 1N6UA 3VDAA 3FONB 2HJLB 5IFAH 4Q6IB 3GI8L 3QCTH 3RY4A 4U1IA 4XP4H 5BOZG 3GSUB 1ZHNA 4N0CC 3KPSB 5D2LF 3MBEA 1S7RB 3TO4A 4PRID 3O2WL 4ODXB 4X99A 5FV1L 5E00B 3UXFA 1KTRL 3MRLA 2F8XC 4E42A 1TITA 1XIWC 3RJQB 1KTDB 1LGVA 4PJGB 3RRQA 3PHOB 2E6PA 4NKOA 4OZFG 3LKRA 5F1NB 4QRTA 1A9BB 2AJUL 3L3KB 5DK0A 1RJZB 1OWWA 1HXYB 5EFIA 1U8JA 3X3FH 2ICWA 3C9NA 3ZYIA 5HGAA 2F5AL 1IE5A 3U0TB 1SJXA 1B88A 2BZDA 4LLYA 4QRPE 1E0OB 1CN4A 1JGEA 5F44A 3WN5C 1G84A 1R24B 1ZS8B 3ARPA 4KVNH 1ZLUK 5I9QC 3QFJB 2OJEA 4IS6B 1JHTB 3MUY1 4KUZL 5HJ3A 4PV8B 1UVQA 2I25N 4UILH 1KG0A 4F7CA 4E0RB 2ZJSL 3SDCA 3BGMB 4YHYB 3HTLX 4TUOA 4S1SL 4LLDA 2HT4D 2NXYD 2X4PA 4F58H 2I07A 2X4UA 3QJFB 4EBQL 2VAAB 4H8WL 4F9LC 4KTDH 1DQQA 1FYTD 4WWKC 5BW7C 3L7EB 1A7OH 2H32H 2HFGH 4NO5B 4IIQC 2NLJA 4I48A 1MNUL 1YMHB 3O3UN 5I6XB 3IDUA 3OL2A 3JTTA 5JPNB 2YSSA 1Z3GH 4IMKA 2ZCKL 4KMTL 1LP9F 3O3BA 1PEZA 4ELME 1EO8L 2BHYA 5J6HB 2HT3D 4Z7WE 4JZJA 1IAIL 4OFVA 1L0XA 1UZ6F 4ONHB 3MOBL 2XQYK 2BNRA 2XZZA 5FA4B 1SYVB 1WWAX 3MQIA 4P5TC 1KCSL 2NNAA 4LBEA 4NNPL 5KSAB 3ARDB 3C87A 1G1YA 4PJ5E 1TZIA 5EU6B 3G5YA 5I19H 1OSPH 2J5LB 2FBJH 3ES6A 4J12A 5I16A 2VDKH 1LEGA 3NCEB 4LPXA 3WJJA 3P4MB 1I9RL 3N1QC 3VGAC 1UZ8B 4MVBC 3VFPB 1A9EA 2WBJB 1N5YH 3VH8B 4XMLL 4AIZA 5EO9A 4N90E 4J3WA 4FA8A 5TF0A 1ZLSL 2VDRL 3ULSA 1E4KC 4W6XB 4KRPC 3B2VH 3DO7B 1WC7A 1T0PB 3RI5F 4KKCC 2PW2A 2J6EL 1UYWL 1J8HA 1CDHA 3MROA 5E2UL 1T4KA 5ESAB 4GRMA 1QKZL 1QVOA 3ALPA 2FO4B 4UIMA 3SCMA 1E6JL 5FO9B 3RDTC 1UKSA 4QT5A 1LO4L 1RZ7H 4PR5A 1JCKA 1RIUH 2AK4B 2Q8BL 2ZNXA 4TSBL 5KN5B 3SKUD 4M03A 1FORL 2EIBA 4HCRH 1HEZA 4Z5RB 2AJVH 5FGCB 2X7LB 1BQSA 5DJ2B 4PJCA 3RL2A 4G6JL 4LIQL 1SYSB 4MNQB 3IAGC 2MKWA 2EYSB 5IJVB 1GIGL 1SJEA 4P3DB 1HILA 4JRYE 4PP2A 2C3VB 4KAQL 2DQUH 5K59E 1YPZF 2C4FU 3RP1A 1UH2A 2IAMA 3MACL 3ILPA 5B4MD 3LS4L 3OAYH 3H3KA 5HHOD 1MJ7L 3JTSB 5FHBL 1AQDB 4ODWA 4KROC 4KVCL 1NAMB 4A6YB 1D5IL 1MCPL 2DYPB 5ILTL 4BKLB 3UTSA 1S5IL 5A2IH 2D9CA 4WFFE 2Y9RT 4YHPB 4M7JL 1DBBH 4QHNA 4R26L 2APXA 7FABH 3MOQA 4PJ9C 2VR5A 2HMIC 4PRDB 1DP0A 4N5ED 4UT6L 5ALBL 3MLTA 2NY2C 4ODUA 2R4RH 3UJJL 4AL8L 2APWA 2DQHL 4GXUN 3S5LG 1T7ZA 4IRJC 1T1YA 5I74C 4GG6E 4KY1H 5CJXA 5D1ZD 4UV4L 2Y25A 5EA0L 5EU3B 1FLRH 2ZUQC 3RVUD 3T1FB 4Q58C 1FL6B 2BC4A 2ERJC 3FO2A 1WZLA 3DMMC 5I75C 4I13B 3TBVB 5ALCL 4KKLD 4DZBA 3GJFH 3QDMB 6FABL 4X6CA 4F8TA 1IAKA 1P1ZB 4HDIB 3QIUC 4PGEA 3U1SL 4HUNB 4PJ8A 3TO4B 4YDLB 1KIPA 4MD5A 4F37K 2FIKB 4E42B 2JTDA 5I1IH 1E6OL 4JRWA 3D69A 3QEGH 3MJ9A 3LKRB 1A6PA 4QRTB 4YXLH 5DK0B 4GW1B 4QWWD 1NFDE 2I9TB 4JQIH 1TXKA 2G60H 5J56B 5EFIB 2ICWB 3SGEH 2WUCL 1TQCB 1H3XA 4OFKA 2NY1D 1AY1H 1A7BA 2OBGA 4GSDH 1Y6KR 4LVOC 4EUPH 1YN7A 4PBVC 4L4VA 2QLVB 4LNRA 2XWTA 1JGEB 4X98B 1HHGA 5KSVB 2ENSA 4QY8A 4NC2B 1QYGL 4X4ME 5BJTB 5FYKL 4DOHB 1MFNA 3HZKA 2JJSA 3WFBH 1UVQB 4XPHH 4CDGC 4F7CB 3RGVD 5C09B 3ULVL 3IETB 3OX8A 4TVPD 2H9GA 3B9DA 1VGEL 3P3YA 4TUOB 3NTCH 1T3FB 5HBBA 2X4PB 2OL3L 2Z93A 1NFKA 3F7QA 1Y6MR 2X4UB 3DUSB 2EDOA 3INUL 3IYLW 5J12B 4PJBA 1YUHA 1AD9A 1T80A 2ZUVA 4PJAB 3ROLA 2PCPA 3JTTB 4QRRD 3WNLA 4K71C 2F8OA 2PXYB 1O5DT 1I9JH 2JCCB 2YSSB 4GRLC 1CI5A 2FWOA 1KCRH 2CD0A 1T22A 3GHEH 5FYKU 3MGAA 3DO3A 4PV9B 4GKNA 2IQAB 1VFUA 4U1JA 5J8OA 1G7HA 4JZJB 3PJSB 3VMOA 4JG0H 3G9VA 3DLQR 4KUCF 5D7JA 2DLHA 1OAKH 3MA7B 3RVTD 4EN3A 5LWYH 1PYWB 5EZOL 4Y5VA 1QRKA 2BVYA 3LB6C 4LBEB 4QHUB 2B7DT 3PDDA 3FAXA 2YD5A 3UJIL 2IANA 2YA2A 2XQYG 4BH8B 1LEGB 3FQNA 4BJLA 1L7TH 1RZIB 5EU4A 4JM4L 4WFGD 5AAMA 3ARGC 1BJ8A 1GGIH 3BWAB 1J0YA 4AIZB 1RUML 4MJ6B 5IP4A 1FDLH 3KNBA 1T0NB 3F5WA 3O6ML 4UZGA 4GJTB 4R0LA 4FFZL 4ZUWB 5H37G 3BKML 1MJUH 3MCLL 2PW2B 3WN5B 1K85A 1NGYB 3AS2A 5D7SH 3MROB 3SDDA 3VH8G 1F4HA 1KIRB 4XP5L 1U58A 5FECB 1MREH 3SY0B 5DURB 4FFYL 1BX2B 5EZIL 2ESVB 3VGDA 1FRGH 1MI5E 4XCYB 3WFCL 4LU5L 4XTRC 3RL2B 5DC4B 5C0AE 1FVDA 1XGYL 3SJVA 1YYMH 2V7NA 2Z0BA 2XG5A 3O6FA 4XBGA 3U79A 2ICWJ 4M5ZL 4N8VB 3HAEA 2UVFA 3OXRB 4O2EB 3ULUE 4M1CC 1WV7T 3CXDH 5DQ9B 1RUQL 1IGJA 1RU9L 1FCCA 4PGDB 2Y07L 2Y23A 5GJSL 5JHDD 3MV7D 2GITB 4P9HL 3MJGX 5L9DH 2OSLB 4Y0GA 4Z78A 3BMWA 1F8TH 3DRTA 2PN5A 1NCAH 3RU8L 1OT2A 3CPLA 3FOMA 3CFKA 5HHQB 4NNXB 5C3LD 3IFLL 4YFEA 4CVWA 1MEXH 4HWBH 4GS7B 4WI2A 4QHNB 3QQ9D 3NFNB 3I75B 3VGBA 1P7KB 3QP3A 4HQQL 3VXRA 3GSXA 4ALAH 3IKCA 4HMEA 1DN0B 3VGAB 4PRPD 4PLOB 2W9LA 4JG1L 2DDQL 5D5ME 4UQ2A 4CW1A 1CIDA 5EOTA 3VRJB 2AJSH 4JHWH 4NN7C 4G7YL 5ICXB 3NIDF 4YBHA 3S96B 2OP4L 1W72L 1J1PH 4RA0C 4YDIL 2VLJA 3GMRB 1MCNA 3KPMB 2KH2B 4L3ED 3FQXA 2UWEE 1IBGH 4KUCD 4JO3L 4OCRH 3L6FB 1UCBH 2V9RA 3WHE0 5E1AB 4OM1H 3RWIA 3AVEA 1I8LC 1UWGL 2V9QA 4XPFL 1NMCC 4PJ8B 1QBMH 4MD0B 4DW2L 2VL4A 5D72L 3B9KB 4MA7H 3LH2L 4X6DF 4BA8A 2WUBH 2HT2C 1ZA6A 2YK1H 3UTTD 4RGMC 3UZQA 3VXMB 4POZC 1XR9B 3VG9C 1SM3H 4TPRH 2A6DA 5C0BB 4ZUTA 2OQJA 1TJIL 1MRDH 4M8VA 4MAYC 2YA0A 2QHLA 3QXDA 2A0LC 2Y06H 1IQWH 4JM2F 4O5LH 2ORBL 5E4IA 1JNNL 2VDLL 3O2VL 5D9SB 1VGKA 5DVLA 2Q86A 5C07E 5CKAA 3WNOA 1AJ7H 1K5NB 4PRBA 3CVHH 5K9OA 1D3CA 2AXGA 4JFHD 2NY0C 1K8DB 3OX8B 1ODAA 4GLRI 2QQNL 4HJGB 4MAUL 2H9GB 3WS3B 4DUVA 4HGMA 1F3RB 4PJ9B 3I3EA 2CDEB 1OAQH 4TOYL 3QO1A 5DJXB 5GIRA 2Z93B 1A4KB 2A74A 1PZ5A 4ISVA 4NHUB 4K23L 2HTKC 4G8EA 1AGFA 2DQCL 4NQSA 1PZUB 4XPGH 1YUHB 3KYKH 1JZ4A 4MJ5B 3K2UH 1XF5A 5HVFB 2CJUL 1RULH 5GS0D 4Y5XC 5I8KL 1HHKB 4NJAH 1JRHI 4GW4A 2EC9T 2UY6A 3VFSA 4O9HH 1C5DB 3F7RA 2XWJB 4LQFL 1F6LL 4GKNB 1F11A 3KXFD 4KRNA 4G7VH 5KS9A 4WEUD 4H88L 1G7MB 1UM4H 1CFBA 5IG7A 1B0RB 3D39A 3PV7A 4WUUD 1KCVH 5DRNB 4PG2C 3O9WA 4OIIL 4F3FA 4EN3B 3KVQA 1QLEH 1MCCA 4Y5VB 2BVOB 4YBQD 3RUGA 3N50A 3MLZL 4NRXA 4YIQA 3KLAA 3QFDA 4V1DD 3VXUE 2IANB 2C7UB 1AE6H 4S1QL 3WNNA 5CZVL 4RAVB 4XVJH 3GIZH 4ZFFA 5GGSB 3OKOA 3FQNB 1OQOA 3PL6C 3VFRA 1QNZL 2D7PA 5A2KH 3D0VB 4RNRB 3NZ8A 4W4OC 5GGSY 1MRCL 4ZD3L 4Y5YA 1AIFA 3L3IB 4MJID 1Y18B 1BM3L 1R6VA 2FYYB 4RGNE 3QEUA 4XVTL 4ODHH 4XP6L 2P43B 1INEH 5C8JA 3KNBB 3NABL 1R3KA 3PNWB 3FFCA 3SE4C 5T1LA 3CMGA 4YAQA 1CICC 2ZG2A 2JKXA 1I7RB 4QNPF 5HHME 5FOBB 3GI8H 2JJUA 4Y89A 5HGHA 2I5YL 5TF1L 3GSVA 3S4SA 4KC3B 3BE1H 1A8JH 3W11D 2Z4QB 3KPLA 2ITCA 1IM3A 2O5ZL 5INDA 4D9QE 3BRFA 1U58B 2LTQB 5HYJA 4OIAA 1U3HC 5D7IF 3L3JA 4P59L 3WNMA 1Q38A 2UZIL 1QFOA 5EU7C 4XC1L 5KSUA 3VWJD 4PUBL 4XNXL 3VE0B 2AJUH 3OV6A 4NQDB 1URLA 4LCYB 4EOWH 3SJVB 1FVDB 4QRQA 3S98A 4HC1L 2V7NB 4LGSB 4P23C 3O81A 4DJMA 4L8SC 4IMLB 5HGDA 4H20L 3CD4A 4RFOL 1F4YL 4MA3A 2YN5A 4Q2ZB 5K93A 5CAYB 1I3RA 3SPVB 4PJ7A 4K8RH 4OD3H 4KUZH 2J8UB 5IHBA 4P5KA 3FOMB 4BFIA 5JW4M 4U1NA 2VLKA 2EKSA 2ZNWA 2Y36L 2X1PA 3CNKA 1J05A 3PWPD 1P7HL 1ZVHA 1ZLVK 1GOFA 2VRAA 4JAMB 3RAJL 1N64L 1IM9A 4FOMA 3IU3B 1R3LB 1KLGB 3FN9A 4S11A 3JV4A 4PJEE 5DZLA 3TN0A 2HTLD 5DEGA 5KVFL 3VXSA 4G9FE 5E94A 1KJVA 3B3IB 4UNTA 2ZCKH 4KMTH 4RFNC 5EOTB 1Q9WA 4YDJA 2NXZB 3KDMB 5DC9B 3TIDB 5JDJA 3C8KA 3B6SB 4BM7A 3FQTB 5KSBA 1H0DB 1FYTE 1IAIH 1EJ6A 4OZHE 2WIIA 3IFNH 1TETH 5CEYA 3TA3A 1WFOA 4R2GB 3GSRB 3C5SB 1U93B 4PPTA 1ZT1A 4NNPH 4LSRL 2YS4A 4EXKA 4OCWL 3DX7A 3RWIB 2A9NL 1H3PL 5ELIA 3ROOB 3FB5A 2X4TB 3UBXA 2VQ1B 2MPAL 5T3XL 4P2QA 2X4RA 1B0WA 1B0GA 4XMLH 3G08A 1KJ3L 2W0LA 3AB0C 2ADIA 3ARVA 2YWZA 43C9A 1NFIB 3E3QE 3QAZB 4X5XA 3BW9A 2VDRH 4DVRH 4LHJB 5IIEA 3MV9A 3LN9A 3DXAB 4M7LL 4IOFC 4J3TA 2CSPA 2EDKA 5IB3A 1LO2L 1ZHBB 4NUJA 1J0IA 1VADA 3SDAA 2P8LA 1QKZH 1YQVL 2EC8A 3TCLB 1FH5L 3HG1D 5F6HI 1E6JH 1X5FA 4WGVB 3ILQD 4NIKB 3FQWA 3WKNA 4JY4A 4XXCA 1Q9LA 1CDJA 2HG5B 3N9GH 3ESVF 3RPIA 3MTRA 4Y2DC 4PRBB 5K9OB 1HNGA 2AXGB 3QHZL 3O41A 3D85A 2BRQA 1FORH 2FLBT 5FKPA 3WE6A 3EOYG 3UYOD 1C1EL 4G6JH 4LIQH 3P9LA 4ODSL 2A74B 1PZ5B 1FG2B 4QXUL 2JF1A 5ICZB 4G8EB 5D2LE 4OF3A 4NQSB 2NTFA 2Z91A 2OR8A 1CT8B 1FNSL 1KB5L 1XF5B 4KAQH 4WFHE 5I1CH 5HPMA 2CR3A 2DQTH 1J11A 3ARXA 4P57A 3RWHB 3VFSB 2HFTA 3LS4H 4QGYA 1T04B 3DECA 4GKZA 4PY7A 1EAPA 1F11B 2IALA 4RIRA 4FZ8H 5KS9B 3FT3A 1D5IH 1MCPH 4NO2B 1KT2A 3PDGA 5DVMA 1FG9C 1JYWA 3V6BR 3MLXL 2NX5D 4M7JH 4ZS6C 4R26H 5FAAA 1R5VB 4OLUH 1J9CT 4U1SA 3KPQB 5HHOE 4UT6H 5ALBH 3KLAB 4S2SA 5KTEH 2CLZA 1EVUA 3C60C 3QUKA 4ZFFB 3OKOB 3DRQB 4MCZB 3VFRB 2Q6WA 4GBXD 4MZ2A 3LV3A 4X7FC 4F37F 3ARDD 1R5IB 4RMWA 1NAKL 5EA0H 4M93B 2ZOKA 2MQCA 2ICEB 2O61B 3HE7C 5FK9B 1ZA3A 4HF5H 3QEUB 4TRPL 1NBYB 2J6EA 2Y72A 4Y16A 5C8JB 4AT6B 1DE4B 1EHLH 1X44A 1OARH 1JGDB 1MWAL 1ES0B 4YAQB 3LEXA 5ALCH 5I1KL 2WIMA 4PS4L 5A1AA 5HGHB 2GJ6E 3S4SB 1A6ZB 2FL5A 3CFDB 5DA4A 4XNUH 1F3JA 4P2CG 1LP9E 1QBAA 6FABH 5ANMA 4JO4H 3VJ6B 4JRXD 3U1SH 4HS6B 2G2RA 1LEKB 5HYJB 4LLVA 1QFUL 1MCJA 1UZ6E 4WW2C 3IDXH 2ADJA 2BX5A 4BH7A 1HSAB 2EXYD 5IJKA 2W1NA 3STZA 2XFXA 1CDIA 3QUYD 4TYUA 5I1DB 2DTSA 2GW5A 4ONOA 4L1HA 4GRWF 3ZE2F 3GSNA 3CIQA 1I3UA 1JGVL 1UWEL 3BD3A 2DQIL 1FN4B 2CIIB 4Q7DA 5CD3B 4RDQF 1ZGLB 2HVKA 1IAII 4IOIB 4PYHA 1U42A 1NAMH 1N2RA 5FYKH 3CU7A 3I02A 4A6YH 4HK0A 5SWZA 4D8PA 4DCQA 1HH6A 3HAEG 4LCWA 5SWQA 4OF7A 3GSWA 1UACH 1IKNC 4OV5A 1B6DA 5GJTL 4UT9L 1V3JA 5F7HA 5T3ZH 3DETD 3KJ4C 4PTTA 3OR7B 4E41A 1VGEH 5HDBF 4HIJA 4ORGA 2OL3H 4JVUA 3UEZA 3K4DA 1NKRA 4KV5F 3QXTA 4MYWB 4J3UA 3INUH 1TENA 1A7QL 1DTUA 1KPVA 2DYPD 1FZJA 2R9HC 2DL9A 4X4ZA 4YLQT 4N0FA 3C8DA 43CAA 4XHQA 3T0EB 3GB7B 3PL6B 1KCKA 3QG7L 2VXUH 2WINA 1YEDA 1RK1A 1N8ZA 5E94B 1TVBA 4K7PY 4YDJB 5HPOA 3C8KB 3W39A 5SX5K 5KSBB 3ZKMC 3I6KB 4UV7H 1YZZA 4JPKL 5CEYB 2BMKA 3GRWA 1ZVYA 4KWUA 3VW3L 5T1KA 4HUXA 3UTQA 1UM5L 4EI5A 3PXHA 4QRRE 3QEHB 4JVWA 5EZOH 1YPZE 2P5ED 3DX7B 2W65A 3MRPA 3WIFA 2EYRB 1FBIL 5FGBA 1DVFB 5FGRA 3BKCH 1KF9B 1S9WA 1QBLH 4FQ1L 3G6DL 4H25A 3UBXB 3ZL4H 3VFNA 1A6VL 4M8QB 1KIUA 4PD4K 4JM4H 3O4LA 1KEGH 2VN4A 2X4RB 5C08B 1RUMH 3MBED 1CDCA 3V9FA 43C9B 3FRPA 4P23B 4RAHA 4A2LA 4YHLH 3BW9B 3HPLB 3O6MH 4NQXA 5GRJH 4U3HA 4PJCF 3BD4A 4FFZH 1M71A 2BOBB 5IB3B 3BP5A 1PBYA 4DKFL 4NT6B 4WFGE 4WU5A 3CZFA 1UM6L 1NKOA 2P8LB 2VL5B 4YHKL 1OTSC 3BQUB 1EFQA 4KPHH 5EIIA 3FQWB 3QSKB 4XP5H 2VITA 4D0DA 2AEQH 5HVHC 3D3VA 5L6YH 5JIIA 1BQHA 4AK1A 2XXMB 4XCNA 5FXCH 1G7JA 3O41B 3D85B 1PKOA 5C0FA 5FKPB 1RHHA 1HHJA 4LRIC 5CP3H 4LU5H 4PGCA 5JQ6H 2R2BB 1SEBB 2NZ9C 5IVZB 1ZLWK 3PF2A 3P9LB 1MH5A 3ZMRA 5HD8D 5GRYA 1KBGL 2APVA 3SDCD 4G6FB 2X4QA 2WZPD 1MQ8A 2NTFB 3ECBB 2DLFH 5GGVL 5IMLB 4HWUA 1BQUA 1RU9H 1T5WB 3ARBA 2YUZA 2Y07H 5GJSH 5ITBH 4GAYB 5HPMB 5D2NE 3O0RL 5GS2D 1GZQA 3DIFB 1EJOL 1ORQA 3D25A 3DROB 3NAAL 4PY7B 1D9KC 1EAPB 5KOMC 2ZG1A 4WTZA 4OFDA 1MQKL 2XTJB 5AWNH 3AY4A 3FT3B 4TSAH 4DGIH 4JANB 1U8KA 3HZVB 1DZBA 1CLCA 4MNGE 1HN1A 2Q3ZA 1U3JA 5JHDE 3IB4A 1YJDC 3MV7E 3PP3K 1OAYH 4AMKL 3DX9B 4C57C 5T5NG 4Z95H 4OQ1A 1QLFA 2W60A 2C26A 1U6AL 4S2SB 2QQKH 2BNRD 2WWKT 1YEIL 3BPCB 1NGQL 3QUKB 4ZFOB 3KPPB 1W0VB 2QADD 4ACPA 4YDKL 4X6CF 3T1WA 2FB4L 4TN9A 3R0NA 1UENA 1QD0A 1Q0YH 3LD8B 2C3GA 1V7MH 4XMKL 3BPLB 1ZA3B 4IDLA 4Y16B 2BSTB 3CCHB 1W72H 3OZ9L 4NYLA 1JZ6A 3VXOA 1RUAL 1IT9L 4PRPE 4YBLC 3WNKA 1JI1A 4GKSA 3BRGC 4FXKA 1INQB 2RCSH 4URTB 2R15A 3OXSB 3CFBB 2FL5B 1UWGH 1F3JB 1UC6A 4JDVA 3S37X 4ZAKA 3QNZA 5DD0L 2FGWH 1J8HD 2ZPKL 4KH2A 1JBJA 4L3EE 1NEZB 3SKMA 4JY6B 3SCMD 1WQVT 1JK8A 4BH7B 3T65A 3MRGA 5K9JL 3I6LE 4ZDHB 3S4SG 5CJ5A 2H3NB 2KL6A 3Q6FA 3QHFL 5DURD 2YUVA 5EIQA 4RX4A 3JVGA 5F88B 4ELMA 4XPTH 4C83B 4KDWA 1S9VB 1L4IA 1OAUL 1DSFH 4Z7WA 3ZT7A 1JPTL 1KENL 5F7NC 4XCCH 3FQRA 4JFDB 4J1UA 1U41A 2HVKB 4IJ3C 2YXMA 3EFFB 3RZCC 2FJHA 3SGKC 2VIRA 4QYOB 3ZKXC 3L3GA 3UTTE 3U4BL 1N2RB 2ORBH 3I02B 2VDLH 3TF7C 2A6KA 4HK0B 3NA4A 5SWZB 5BCAA 4D8PB 4HAFA 2KZWA 4LHQB 3MUZ1 5SWQB 5INCA 1OL0A 4RCAA 2IAMD 4YXKL 4OV5B 4MQXC 4OM0L 2QQNH 5EC2A 2F58H 2R0WH 3P30L 3FB8A 1FNAA 4HJ0D 3ZKQD 3DV4A 3O11B 4JREB 2NPLX 5DMKB 1FZJB 3C60B 3UTSD 4N0FB 4NJ9L 3ELAT 5IT2L 1JMZA 1OAXH 4JFHE 2CJUH 3DVFA 3RX8A 4NP4H 2AABH 2WINB 2WQRA 2XKNA 1G0XA 3IVKA 1YEDB 4LLWA 2ATKB 4PJDF 5E8OA 3HE7B 4IRSB 4M1DH 5I17B 3KHOA 3LQAC 4KK9D 4H5SB 1JNLL 2CDFB 2F5BH 2J8OA 1QSFA 3EBAA 3DHJA 5T1KB 2O5YL 4L9LC 1RMFL 3UTPE 1GGCL 5C0CE 3UTQB 3U7WL 2ADGA 4EI5B 1N4XL 1JPFB 4M9PA 5E8PA 3B9VA 1RZJC 1NC2A 5F9WB 3KXFE 3BXNA 3ZYOA 2OXGA 4OLVH 3WD5H 2W65B 4Y2OA 3WIFB 5MI0C 3ZHLA 2YD6A 3H3PL 1KJ2B 4F9LA 4NQEE 1S9WB 1TMCB 4OZIB 5BW7A 1DQJA 4WUUE 3V6FA 3VFNB 5SX4I 3R1GL 5BXFA 5FDWB 3U4EA 4WW1A 1X4XA 1MRCH 4JRYA 4ZD3H 6CGTA 1P9MA 2WNGA 4V1DE 1PSKL 3ZLQC 2Q1EA 2YN3A 3I50H 4GAGL 3J8F7 1U2CA 4YR6B 3NABH 4NQXB 1TZHA 2WQ8A 2ZCLL 3UBXG 5FYLL 3V0WL 3MREB 1F45A 3DVGA 4U31A 4WU5B 1K3ZA 3X12B 2I5YH 2QHRL 3QULA 2O93L 3MLSL 1A3RL 4P5TA 4S1RL 4RBPH 2VOTA 2VITB 1ZV5A 2XZCH 3NIDE 2WANA 3T2OA 1F3DJ 5LAXA 3D3VB 3CUPB 5DUBB 4L4VD 1A7NH 4XCNB 4QTIH 1G7JB 3GMLA 3DTXB 3BP4B 2ZUYA 4NWTL 4LRNH 1HHJB 2P47B 4PUBH 1MJJA 4PGCB 2OR7A 4Y1AB 4P46A 2X09A 5FHAH 1MH5B 2IPTL 1CGWA 4XCEA 3U30C 3AXLB 4NOBA 5IW1B 1A5FL 5E5MB 3HMWH 4YHIA 5GISL 4ODTL 2UYLA 1RJCA 4JY5L 1E4KA 3VGHA 4RFOH 1F4YH 4WHTA 2E8ZA 4GQ9L 3ARBB 4O2CA 4D9LL 3QRFM 3E8UL 4QF1A 3BEVA 1GZQB 3T3MF 4WI8A 3VCLA 3D25B 4X6DE 3SDXA 3IDNA 3STLB 4OCXL 1SJVA 1NC4B 1J0ZA 2NY6C 3V8CA 4M61A 2UZXB 8FABA 2N4IA 2Y36H 4YC2C 4K07A 4LDOB 2HLFC 1XF2A 1N59B 3AREA 3RAJH 3QDJE 3DYMA 1QLFB 1N64H 3RY6A 1SBSH 5D7JD 4Z9KB 4QCIA 1I8MA 1ADQL 3CC5A 3GO1H 3OKLA 1WBXB 4KQ4H 4JFYA 4PIRF 3ZE1F 5KG9A 1WWCA 5KVFH 2EDNA 1MFEL 1YY9D 3H9HA 3T3PF 5D7KD 5IB1B 3PWPE 4OGAC 1M6OB 1IEHA 4EEEA 4XWOC 3C6LB 4QRPB 4ZSOA 5IQ7H 4LQ1A 1ED3A 2IADB 2WBKA 4NYLB 2BY0A 4X4MA 4CRPA 3OAZK 3VXOB 1X3DA 3UPAA 4R4FH 1RUPL 3BEWA 4F15B 2ED7A 4FXKB 1WZMA 4LARL 3JXAA 1BECA 1MPAH 5ADPH 2HKFH 3MRFB 4FZEL 1ZXQA 2ATPB 4OCWH 4KFZC 1YC7A 2A9NH 4RWYL 5JMRA 1H3PH 2IBBA 4GG8A 4X5WA 4FMKA 3BN3B 3MJ6A 4OCYL 4N0YH 4MXQC 3IJYA 4DFIA 2MPAH 3FB7B 3EOBB 3SDDD 4HC1A 3RHWF 4HGKC 1U95A 5CIPB 4IRJA 5CJQH 2HH0L 4R7DB 3MRGB 2X89D 3S9DB 2IFFL 5IEHA 1CD9B 2GJJA 1RVFL 3Q1SH 1QFWH 5JXEC 3O6LH 4P0DA 4LDEB 3MODH 4Y4KA 3SKJH 4C56A 4ELMB 4KHTL 2M2DA 1U0QA 4Z7WB 4NN5C 1CZ8L 1A3LL 3MRCA 2VYRE 3HMXL 2YD4A 3SJVD 3DMMA 5M94B 4BQ8A 5JDSB 3M17A 3TZVB 3VFUB 2VIRB 3O6FD 1MCRA 2BNUA 3GUTB 3MCKA 4J3XA 1CE1L 4ELKB 5E4EC 1JTTA 5DFVD 1IARB 1IC7H 4PJ5B 1ACYH 3SO3B 2BVTA 3DVIA 3V7AG 3RX5A 1FL3A 3GBML 1W0WA 1C1EH 3HG1E 4QNPE 1UGNA 2EO9A 3ESUF 2VUOA 2EDQA 3DV4B 1WF5A 2ZP0T 2C3HA 1X5XA 1ZANH 2FZ3B 1FNSH 1KB5H 1MFBL 3RUGF 4NGHH 4I9WD 5B8CC 1T89C 4LLWB 2VXTL 2J88H 3HC3L 5D7IE 4U33A 2DAVA 2Y4SA 5E8OB 4MSWB 4JQXC 4XMPL 4DEPB 3F12B 3VXRD 1GJIA 2C1OA 1SMOA 1JYVA 5MEPA 4R4BB 3MMEA 3P4NA 2D7MA 4JFOA 5I0ZA 3KR3H 1V3KA 4OLZL 2F54A 3OQ3B 4JDTL 1MHCA 1PLGH 3EJYD 5DJ6B 2ADGB 4ZUUA 4UDTA 3DARA 9CGTA 2SEBB 5E8PB 2BVUA 4FMFA 5DHVB 1ZHKA 4I3SH 2ZUWA 2LVEA 1T1ZA 1RSFA 4G5ZL 2VLJD 1MAML 2QL1A 3SGDH 3RVXD 5LGJA 4OD1L 1RURL 4GOSA 4HLZG 5ISZA 3PQYB 4J8RA 4JRYB 4ZXBB 3W81A 1JGLH 5IW6B 3VGFA 1NUGA 1FCGA 4X8JA 4K3DL 4IDJH 5I30H 4BQ6A 1JE6A 3HRPA 1ZWIB 2MCPH 4ENED 5GRVK 5I1KH 3O4OB 4PS4H 5I71C 1UJ3C 2LABA 3BN9C 3N85L 1TVHB 4XP9L 1C08B 4JEGB 4ZTPH 3SN6N 2GJZA 3BI9X 4PJ7F 1YJDL 5DVNA 3U0PA 2FX8L 1ETZA 5F6IC 5MP6L 3GMLB 1AR1C 1T1XB 1DLHA 3MLRL 3HE6A 4MDJA 1EK3A 3CX2A 4OCMC 4P46B 3HZYA 4GG6B 3VWKB 3UCRA 4JRXE 2FEDC 5ID0A 2OI9B 1JGVH 4G3YL 1JMXA 1WFTA 4HJJL 3ARFC 1CDUA 1UWEH 4LSVL 5LBSL 4I0PB 4HUWA 4KJWC 3U2SA 4L9DA 4MDIA 5EORL 4S10A 1BAFH 3BEVB 5J6GB 1PGRB 5I76A 4OF8A 2EC9U 3IDNB 3MZGB 4MQ7A 1NCNA 4UT9H 3SOBH 1C5CH 5F3HB 4Q9BA 5F7DA 8FABB 2AXFA 4Z0XA 2BVEA 3FT4A 5IM7A 4DVBA 3ARRA 3G6JF 1H8OA 1A7QH 5F3BB 3AREB 4B7LA 2VSCA 4LVNB 3O8XB 5TJWK 4HHAB 3D39D 2N7BA 4WTZG 4X7SL 4QCIB 1ZT4B 5F71A 3O9WD 5C0EA 4JFYB 3EO1A 1NFDB 5CKGA 4G42A 4EDXA 1N6VA 1CR9H 1EHNA 3RA7L 1BP3B 3EYFA 3MRBA 3NIFF 1BD2A 1ED3B 4JPKH 3VFOB 4APQC 1N3NB 1QZ1A 5GZND 3TT3L 5CEZD 1UM5H 5C07A 3BEWB 3UMTA 4YGVB 1U3ZA 3NFPA 1LO0L 5I2IB 1BFVL 2DM3A 4GH7B 4G8GB 3EYOA 3ALXA 1A6TA 1CVSC 3FFCD 4GG8B 5T1LD 1UB6B 2H6PB 2IWGA 4OUOA 2Y1VA 3LIZL 3G6DH 3IJYB 2DOCA 1N7ML 1A6VH 2APFA 2BDNL 3VRIB 4J2XA 5T1MB 2FR4B 4U3CA 1B2WH 2NY5C 3L7FB 4P9MH 2P5EE 4YWGH 4C58B 3O3EA 5JPMA 1CS6A 4OB5L 5HYJD 4F7TB 1UXSB 3LQMA 5HI3C 4Y4KB 5DQDH 4LSTH 4NN6B 4EI6B 5JW3H 3IF1B 3LQAL 4KJQD 4YHKH 3M17B 3GZKA 4DN3H 4OZ4A 1NL0L 4OGYH 2HVJA 2IH3A 3L5HA 3NACH 1QLRB 3BUYA 2AEWA 2Z92B 4O02L 1I8LA 3LEVL 3VXUA 2QR0A 4Q9QL 1P2CB 4DWHA 2XOTA 1RZJL 4JFFA 5EOQH 1DDHA 2B1AL 4NO0B 1FL3B 1W0WB 3KLHC 2NW3B 2VZOA 5CMAA 5D93C 1CL7H 2HFFB 3EOAB 3A6BL 1I1CA 4K7PH 5I8OL 4LSSL 4FQJH 2HT4C 1NMAL 2B0SL 2NXYC 2VLKD 2X4OB 2XI9A 4XT1C 3WXWH 2CKBL 3QQ4A 1KEML 4ONGL 3SDYL 3O0RH 2D31B 4QXWA 5KANI 3EO9L 4MAYA 2EO1A 5FB8A 1H3VA 2JB6A 5IBLD 1IM9D 1BBJB 3MXWL 1EEZA 3SE9L 2YD9A 4H26A 2C1OB 3VFWA 1MQKH 1XR8A 1Q1JL 2GAZA 5MEPB 4GO6B 4CADA 3TN0D 3GSOA 2AJ3A 3VXSD 1JYXA 2H2SD 4ETQA 4GRWE 3DYPA 3ZE2E 3M07A 3WSQH 4TNWK 2F8VA 1EZVX 2VDOL 4UDTB 2MWCA 2D7OA 5L7XL 5BRZD 3ZYJA 1ZHKB 1YN6B 3IDMB 4O4YL 1MI5B 3TA3D 2JELL 1ND0A 4QRUB 4XBEL 5C0AB 3TNMA 5CBEA 3JWDH 2AJYL 5ERWA 4AH2B 5E08L 5DC0A 1CF8H 2VZ1A 4Y5XA 3V6OC 4J8RB 4UINH 1S8DB 1UH4A 5HDBE 5E9DD 4X8JB 5DUPL 3QUZC 4KV5E 4EZMA 2BNRE 3KAAA 1RUAH 2BK8A 1CD8A 1NGZA 4P2QD 1CDBA 1EGJA 1Z9SA 2ADFL 1VERA 1I9IL 5DSCA 4FQXB 2XPGA 1SY6A 1WEJL 3MV9D 4JFPB 4KKAC 5D6DC 1MCWW 3TO2A 2GJZB 3QUML 5KVDH 3C5JA 1IC5L 1A2YB 4L29B 3ZDZF 3WFZA 3FO9A 4Y4FB 3SDAD 2EXWC 2PO6B 1V5JA 4MDJB 3IDYB 5T33H 2Q76A 4W4OA 1YC8A 5D5MB 5GGTH 5IF0B 2NY4C 1H15A 2NY3D 3HZYB 4G9FA 5EO1A 5TDPB 5MEQA 5ID0B 4UBDD 1KJMA 4OLWL 4LASH 3AC0A 4KQ3H 3CSBA 1PKQA 1KENH 4OZHA 1RJYB 3U2SB 4XRCA 1CICA 2R2HB 4MDIB 4XHJC 4G6AD 4WV1B 3OTTA 5GHWH 3U4BH 2IGFH 3IFPB 4FTVD 4N9GA 2UWEB 5I76B 3LDBB 2V17H 4L3AA 5EPMB 1WZ1L 2A77L 2FH6A 2OTUA 4PJCE 1CG9A 2AXFB 2HN7A 1AO7A 1MFDH 1U3HA 3EHBC 5I73C 1MLCA 3PHQA 1L0QA 1NQBA 5IM7B 4DVBB 3THMH 2R23B 5DDHB 3LKQA 5EZLA 3REVB 5IB5A 2MSPA 4HKBA 4NJ9H 3MRQB 3QH3A 1G6RL 3UJTL 1BLNA 4HPOL 5CJOL 4KDVA 1P4IH 3FN0L 3U9UA 4Z76B 4J7RA 4FQ2L 4L8SA 5JZ7D 2R39A 1X5KA 4G42B 4JO1H 5IFJA 4EDXB 2VDNH 2A2QT 4NM4L 1WIOA 1JNLH 1OPGH 2LU4A 3MRBB 3UTSE 2X4SB 2I26N 5FYJL 1LNUB 3WEXA 4XH2B 3TM6A 1FVEB 1GGCH 1NCWL 3EZ8A 5F9JA 1AKJA 3IRZA 4OF6A 4BFBD 3BP6A 3PGCB 5FCUH 1F3DH 3ARSA 1XZ0B 5GZOC 5HYFA 3B2UD 1IGML 3ULVF 2Z9TA 3R1GH 4MA8L 5D2LA 1HOCB 3TVMD 4M48H 4B41A 3L5WB 5D1QC 3I6GB 4MS8D 5JPMB 2A6IB 3PWNB 1CGYA 4D0BB 4R4NC 5FYJU 3U83A 1IEBB 4PTUA 4XXDB 4GMTL 2YPKA 2YOCA 1T03L 2DQJL 4LP4A 1G0YR 1YNLL 1BF8A 2H8PA 4QXTA 3RIFK 2QHRH 2YZ1A 4X6CE 1S7SA 1FVCB 3TH3T 1EFXA 3WO3B 2IH3B 4Y7MA 1HQ4A 3D18A 3BUYB 3MA9L 1MIML 4UMGA 4QHLA 2KUTA 4PJFB 5HHOA 2C4FT 4YXHL 3DURA 5AYUH 3VXUB 2ED8A 5C6TH 4GUPB 3BZ4B 4WO4C 5DD5L 1DDHB 4UIKL 1YA5A 3V4UL 2XNAA 5CMAB 1HINH 4LCWD 5GISH 3KS0J 1XGRB 3CX5K 3W9DA 5H35B 3FHQA 1XEDA 1WVZA 4E41D 4L4VE 4RGNB 4HX1A 4ODBD 3VDCA 3QIWD 4GQ9H 2M26A 1AH1A 1F6FB 4KZDL 2JIXA 1CD0A 5C71A 4CVXB 1I8KA 4PYGA 1IKFL 4EVNA 4AIXA 1U8NA 3S3PA 3WL9B 5HHMB 3W0WA 1JIBA 2GJ6A 1I7ZA 4CNIA 2Z8WC 4CADB 4I77L 4Y2DA 4ETQB 2G75B 4KKBC 2P42B 4PGZA 3V0VA 1HYSC 3WV0A 1OTUD 5DD1L 2BVQA 1V05A 3DSFH 1P53A 1KJ2H 1R0AL 3N1GC 1A14H 2PW1A 4YHOH 4EI5D 3TNMB 2X40A 2HWZH 1HZHL 4F7MA 4Z77A 4JKLA 1M7IA 2QSCL 3WCYA 3ZKND 5DHXB 2HLAB 5EU5B 3RNKA 3ZTNL 3V52L 4P3CL 4OZGA 5D1XA 1U8OA 1OSZB 1NGWA 2APTA 2HAZA 5F1KC 1KPRA 4YNYA 5BS0A 2DQDH 4KHXL 3O4LD 1RUPH 5I0DA 1KUMA 1NGZB 2H1PH 5D6CA 1BBDH 3S3JA 5D7KE 5MHSD 2P45B 4OAWA 4UI2A 2DMCA 3WFEH 3MV8D 3W5MA 4JR9L 3X3GL 3LRGA 2XPGB 5DD6A 4RWYH 4PJDE 2CLRA 1QA9B 4PJHA 4LEXH 4OCYH 3C5JB 3QPXH 5FYKD 5FDYA 5B38A 2ZKHL 4LSPL 2AK1L 1HHIB 3LN5A 1A6UL 2NCMA 1ZT7A 3MNWA 4TSCH 3ULVD 1UT9A 2NYYC 5MENA 1IC4H 4PJEB 4ZOAA 3HLAB 5EO1B 4G9FB 4I3RL 2NXYB 4MGXA 3RWDA 4Z7QF 3UAJC 2DD8L 1NCCH 4KHTH 3F8UB 1GC1C 1FYTB 1L9NA 1CZ8H 1JV5B 4OZHB 3HMXH 3QIBC 1S7TA 4XRCB 5DT1L 3S36L 2BY1A 3HUJF 1X5ZA 1PFCA 4LF3B 1VACB 4CBPA 4U6XB 5MERB 5E8DL 5I1AA 5I8EA 3VI3E 4OLEA 4F2MB 2OTUB 3UZEA 3JV0A 4HSQA 2OJZL 4AM0B 5GS1B 1ADQA 1GPOH 3PHQB 5SV4A 3P0YH 4XVUC 3CX5J 4FG6C 5EZLB 1QP1A 4NKMA 5KAQG 3EZJB 5IHZB 3GK8H 4YEFA 3QBTB 1LO5A 2NY5L 3U9UB 1G7QA 3N1MC 4GW5A 4YK4B 5HY9A 5FUCC 5IFAL 3P9MA 4XP4L 3P9WB 2AI0L 3F6LA 1HI6B 3QA3A 2GSIA 4B53A 4I9WE 5ADOH 4RRPA 2CRMA 2EDLA 3NZHL 3ZTJH 2A6JA 2YD3A 4QKXB 3CDGA 4PREB 3H8NA 3DI2B 1Y0LB 1OT1A 4JFZL 4HK3N 3T3ME 4NC1E 3BP6B 1XGTA 3T2NH 4Y19A 3O45A 3L3DB 1MAMH 3GNMH 3QUXC 1HKFA 3C08H 2VTFA 4OD1H 5CIPH 1VFBB 5D2LB 4JFQA 4K2UL 3OJMB 5HGBB 5GXBB 4O51A 3HR6A 1CTNA 4I5BA 5C9JA 4NKDA 4KVNL 2PNDA 4ZAKD 4XB8A 5EBWA 2VLJE 3DJ9A 5L2KD 5CGYD 5I1LA 3RKDD 3BD5A 3G9AB 4UILL 4IRZH 1N6QH 4WEMB 4ZFZA 4UNVA 3ZE1E 3VDBA 4G9DA 1WSST 4QXTB 1EBAA 4RISH 3RWFA 3NFSL 5IMMB 4MNGA 3DBXA 1BVKA 3MV7A 2I24N 1YYLH 5E6IC 4KTDL 1UADC 1HSBB 5HHOB 1A7OL 4JHBA 1K2DB 4LCIH 5MP6H 3HPJA 3SDXF 2HFGL 2Q7NA 1N5AB 3CJJA 4YX2L 3RX7A 1S9KC 1Z3GL 2DI9A 4N0CD 4KK6D 1CFTB 5EBMA 4N1EA 4G3YH 3WHE1 3W9DB 2X1XR 4JGUA 3MRNB 2GCYA 4HX1B 5LBSH 1XIWD 1LEIA 5KVEH 2JIXB 4HPYL 3MRDA 4PRPA 2R56H 2VZ3A 1MHEA 2VSDA 1DQTA 5GS0C 3V5DA 2EYTB 5D1ZB 1D5XA 3T08A 4QEGA 3RWCB 2GJ6B 1I7ZB 2XA8H 5ICYA 2H26A 1M7XA 2VDKL 1LP9B 4X9BA 2VDQH 4KZEL 1IGTB 3JV6A 5DHVH 4AG4H 4PJXF 3V6ZA 1N5YL 1U8QB 2BVQB 1AGCA 4LRIA 3MFFA 3RL1A 4CMMB 1OQXA 2I9LB 2ZSWA 1QSFD 4I2XE 4X6EB 2DLTA 4PGBA 2A73A 1X5JA 5ACLA 5JA8B 4OI9A 4NWUH 2PW1B 4OBSA 4LAQL 4F7MB 2XN9E 4PRHD 1M7IB 1NC2D 2BNQA 4KDTA 3RA7H 1T20B 3EDJA 4KJPC 4U7KA 5D1XB 1U8OB 4N0UE 2HJKA 2XT1B 1RD6A 1NGWB 4WWKD 3MGTB 4HS8H 3D39E 5F8QC 3BJ91 1RZ7L 1D9KA 5JOPD 1J1OL 1NCTA 4JRYD 4U1HA 2FD6H 1IGCL 3D2UA 1CQYA 3RUGE 1LO0H 4OAWB 4K94H 4HCRL 4IM8A 2AJVL 2NY1B 5A16B 1YDPB 3ISWA 1IAOB 1QQDA 1X5GA 3MNZB 3H9SD 5LCVH 3E6HB 1CLYH 3DGGA 3MSPA 4MHHG 1ONQB 1SJHA 3RI5K 3LS5H 1M7DB 5K9QG 4ZUVA 3GKZA 5B38B 2FH8A 3WIHL 3R4DA 3VXNA 5K33A 4UDUA 3LN5B 3MNWB 4POYA 2VR4A 4WU7A 1G7LA 2B20A 2AV1B 3RGVB 1C16A 4P5TD 5ACZA 3S37L 3OKKB 4H1LH 3VXQB 5D96C 1JZ3A 5IK3B 3FFCE 1PY4A 2P8MA 3A6CL 5T1DL 1ZKAA 4C54A 3TJEH 1T7XA 5DI8A 2RFXA 2Z31C 3GMQA 2VZUA 4P46D 2IG2L 1R3IL 4LAJH 4KK5C 4NKQB 5FM5M 4HFUH 1NL0H 4NO3B 3SQOH 3OKNA 5C0CA 3OB0H 4IHOA 1D5MA 4QRRB 1JF6A 4BK5A 4I4WA 1YPZB 4RZCA 4KRPD 4YH6A 1T7YA 3O3AA 3AMKA 4Q9QH 4KKCD 4OKVA 2B1AH 4NQEA 2DM2A 4I3GA 4KY1L 5F1SA 2D7TH 4WUUA 5DO2C 1C12A 1CCZA 3RDTD 1KIQA 1FLRL 3A6BH 4M6AA 1NGPH 3V5KB 1NMAH 2B0SH 3QRGL 1VHPA 4K8RC 2CKBH 4YEEA 1KEMH 3GMNA 1B9ZA 2FNBA 1X4YA 4PJ7E 1LO5B 4RFEB 3D9AH 3SDYH 5IB4B 1G7QB 2AVGA 2AS5M 5FM8A 1OLLA 1JUFA 2EICA 3BSZH