4NERA

Multicopper oxidase cueo (data1)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New insights into the catalytic active-site structure of multicopper oxidases
doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase CueO
total genus 136
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2013-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4nerA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4nerA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4nerA03
2BP8A 5D4JA 3EF4A 5B1JA 1OE1A 2PP9A 3QPKA 3IN0A 1L9QA 1OE2A 1ADWA 3L45A 1AS8A 5F7BA 4E9XA 4M4RB 3TU6A 1AZUA 1J9SA 3OMIB 1L9SA 2JKWA 3EHBB 2PPCA 3WKQA 2YAOA 2GHZA 2IWKA 3UAEA 2YAMA 1AACA 1AS6A 2XV3A 4CSZA 4Q89A 5B1KA 3UADA 3AZUA 2QPDB 1PCSA 1M56B 3QJSB 2JFCA 1GYCA 1J9RA 2HX9A 3S3BB 2IDSA 1JXFA 4JHUA 4DP2X 3OD3A 1HAWA 2WO3B 3MX0B 2OJ1A 1PLAA 3AG1B 2BWDA 1MG2C 2HRGA 2XV2A 1AG0A 2PCYA 3FT0A 1N68A 1OOWA 1WS8A 2J5WA 1OCRB 3HB3B 2XXFA 2DYRB 4YVNA 8PAZA 1MZZA 3GDCA 3C75A 4HCGA 1L9OA 2R7EA 3S3DB 1KGYE 2GB2A 2EIKB 3PCYA 1XMEB 1E65A 3H56A 5F7AA 2AFNA 1IUZA 3FPYA 2XUWA 3FS9A 2YAHA 1F56A 4HZ1A 2ZONA 4YL4A 2BZ7A 3EH3B 1KBWA 2WSDA 3WI9A 3S8FB 6PCYA 5B7EA 2MTAA 1CURA 1J9QA 4JKNA 1AZRA 4F7KA 4G70B 2YAQA 3UAAA 4Q8BA 1ZV2A 2EIJB 4PAZA 2IDFA 3N2JA 2FQDA 5ANHA 3PAVA 4GP5B 2EIMB 2QDWA 2W88A 1PZCA 4E9VA 4FA7B 1SF3A 4HALA 1JZJA 3OQRA 2W8CA 4DPAX 2VM4A 2HRHA 1L9TA 1JVOA 5I6KA 4P5RA 4N8UA 2X88A 4TXVB 5B7MA 4W9ZA 1X9UA 1AIZA 4KNSA 3T9WA 2IDQA 2E86A 2UXFA 3FQ2A 2XLLA 3V9CA 5AKRA 2YAFA 3NSDA 4YSDA 2HX8A 4NAJA 4A66A 3NJFA 3NP4A 9PCYA 4BK5C 2UX6A 1PNDA 1CC3A 4G7SB 1GS7A 1SHXA 3NJGA 1PMYA 1PLBA 4AKPA 5IY5B 4A2FA 1PZAA 1JZIA 2NRDA 1WA2X 4YSOA 2VW6A 3CDZA 1MZYA 3UGEA 4BWUA 3EH5B 4UF7C 1UATA 4KNUA 3EH4B 3ZBMA 2PP7A 4NB7A 5AZUA 2IWEA 5E9NA 3TA4D 2BW5A 3AG2B 2FWLB 1NPNA 2AVFA 3T6XA 1WAEA 3IBOA 2ZXWB 2CALA 4BDVB 1DYZA 3WKPA 3AW5A 3UABA 2HXAA 2VW4A 2BWIA 3FSWA 3PLYA 1NIFA 2YXWA 2YARA 1M9WA 3QJUB 5LDUA 2IAAC 2TSAA 3OMAB 1FA4A 2FTAA 2R7EB 5B1JC 5TK4A 3G5WA 3ZDWA 2DWSA 3SBPA 1SHWA 4DP5X 1FFTB 1OCZB 3TBBA 2EILB 2FJSA 3X2QB 2N0MA 4FAAB 2IDTA 4HAKA 5I5MA 5TK2A 3CVCA 1J9TA 1JZHA 2CCWA 4KO6A 3PAZA 1IBZA 4GP8B 3PXLA 3AG3B 4KO9A 1ILSA 4E9WA 4E9YA 1AS7A 2VM3A 3DKHA 3TBCA 1N70A 1JZGA 1SDDA 3H4HA 3NSYA 4N4YB 3CVBA 1NIDA 3UACA 3NJIA 3QJVB 1RCYA 3GYRA 4AKOA 1HFUA 3FSAA 3WNIA 3X1FA 1CYXA 1PNCA 2HZHA 3WG7B 4DPBX 2QT6A 4F2EA 5I6MA 2FQEA 3OM3B 4BWTA 4UANA 2OV0A 1I53A 3NP3A 4HIPA 2IDUA 1E5YA 3ASNB 1ET7A 3BQVA 1SF5A 4YSUA 3IN2A 1KDIA 3WIAA 1V54B 5PCYA 2DYSB 1SJMA 2PPDA 1BXUA 5EHFA 1M57B 1XB3A 1WA0X 2BW4A 1BEXA 4YSQA 1DZ0A 1GW0A 4AX3A 1AOZA 2IH9A 1ASQA 2Q5BA 2AANA 3ABLB 2PPEA 5I6OA 4PCYA 4YSSA 3S3CB 1NWPA 3NSCA 7PAZA 4YSCA 5I6PA 4YSPA 2B08A 1VLXA 1OCCB 2HX7A 1KBVA 3ASOB 1NIAA 3AG4B 2P80A 2I7OA 1GS8A 3QQXA 2PLTA 4F2FA 1L9PA 5FC9A 2BP8B 1IKOP 4DPCX 1RKRA 3QJRB 2YQBA 4QLWA 4ZK8A 4E9QA 3NJJA 1QHQA 3FQYA 1A4CA 4BDVA 4DP4X 5I6LA 1AANA 3CVDA 2GC7C 4KNTA 1W6WA 4YSRA 5B7FA 1NWOA 2YAEA 2UXTA 1ZIAA 2XWZA 1B3IA 2VSMB 2YXVA 4DP6X 4DP0X 1AZBA 4BWWA 4M3HA 1W8EA 4P5SA 3SBQA 3WNJA 3N55A 4GXFA 5B1AB 4DP8X 2A3TA 2HLEB 4L0PB 1T5KA 4YSTA 3BVDB 4E9RA 4WKXA 3FYEB 1PF3A 2FT8A 1JXDA 2VN3A 1R1CA 2J57A 1BAWA 1JXGA 1QNIA 2H5UA 3FSZA 4W1TA 1BYOA 1L9RA 3KW7A 4WTQA 1JZFA 4A2GA 3NYKA 3JT2A 1CYWA 1ZIBA 3FPXA 1SNRA 3FU7A 3TASA 3GXUB 1ZDSA 2QDVA 2ZOOA 3FU7B 1NDTA 2Q9OA 4A2DA 4DP9X 1A3ZA 1FWXA 2DWTA 1PLCA 1OCOB 2OCCB 1KV7A 1MDAA 3X1BA 1GR7A 1ASOA 3FYIB 2WO2B 2DY2A 2H3XC 1EZLA 3CZUB 2IWFA 3MBWB 3QJTB 4KO7A 4A67A 5B3SB 1AZNA 2FT7A 1XB8A 2GSMB 1SDDB 1BYPA 1GSKA 1YLBB 1NIBA 4YSEA 1ASPA 2RACA 1AG6A 2H47C 2FQFA 2MRYA 2CJ3A 5AFAA 4GYBA 3ABMB 1JERA 2Y69B 1ETJA 2I7SA 1GY1A 3NJHA 4G71B 6PAZA 3NJKA 3PPSA 1TKWA 2J56A 1W6LA 4HHGA 4MFHA 4A2EA 1ZDQA 1TEGA 1WA1X 2FNWA 1ZPUA 1TEFA 1BQ5A 2UXGA 4G7RB 2XVBA 4BXVA 1JOIA 3DIVA 4KOCA 1E5ZA 1AQ8A 3KW8A 2GBAA 4QKTA 2GIMA 7PCYA 1URIA 4A68A 1ET8A 1AR1B 4JHVA 1OF0A 2LLNA 3X1NA 3NJMA 2VSKB 1X9RA 2BP0B 1JZEA 3ERXA 2IH8A 2QPEB 3X1EA 3DTUB 1KDJA 4X4KA 1AAJA 3CDZB 4GY4A 3T6ZA 4KO5A 1SFHA 1JVLA 5I5IA 3ZIYA 3HEIB 2J55A 1NZRA 1E67A 1KCWA 3T71A 1RZPA 4AI7A 1ILUA 1OE3A 4HCIA 3X1GA 1NPJA 3IEAA 1E30A 1TU2A 1BXVA 1MG3C 3H4FA 4DP1X 1OV8A 2XX1A 1BQRA 3SQRA 1WS7A 4HCFA 2Y1AA 3FU9A 4E9TA 2UX7A 4RH4A 5I26A 5I28A 4E9SA 3T6VA 2AZAA 3AY2A 3FQ1A 1NIEA 2XX0A 1A65A 3ABKB 1IBYA 2P80D 3RYMA 2XXGA 2VW7A 4G7QB 3NJLA 1CUOA 2AZUA 2XV0A 2PPFA 4YSAA 2PPAA 4NERA 3NJNA 1RZQA 3ABGA 1BXAA 3PAUA 2FQGA 3V9EA 1BQKA 1EHKB 2GI0A 2GC4C 2BO0A 5D4IA 1ID2A 5A7EA 1NTDA 2ZWNA 2DV6A 5PAZA 3JTBA 2XU9A 4K9JA 1QLEB 4GP4B 4KOBA 1XB6A 4G72B 3CG8A 2JXMA 4UAHA 4EF3A 1KYAA 4AKQA 5I5JA 2XYBA 1GY2A 3D12B 2UXVA 1IC0A 1ET5A 4AZUA 3ZX1A 3NSFA 2B3IA 1A4AA 3QJQB 4A2HA 2FT6A 1PY0A 1GS6X 1AZCA 4DP7X 4YVUA 2BP0A 3T6WA 3U25A 3IE9A 2PCFA 4BXSV 2BZCA 1J5DA 2PP8A 1V55B 3S8GB 1A8ZA 2CUAA 2I85A 2CBPA 4ENZA 4CSPA 2X87A 3OMNB 1PAZA 2CAKA 1HAUA 2BHFA 3FSVA 2EINB 1NINA 5D4HA 4HHWA 1J5CA 3NT0A 5B1BB 2YAPA 2TSBA 2VMJA 1PZBA 1KCBA 1NICA 5I6NA 1A4BA 1V10A 1SFDA 3SBRA 3FU8A
chains in the Genus database with same CATH superfamily
2YRPA 3TEWA 2XWBA 5DJCB 4ZS6D 1FHGA 1Z5LB 2HH0H 5DD0H 5FB8B 3WL9A 3DLQR 4TSBH 1WPCA 3B9AA 1A7NL 1TU2B 4GEJA 3CXFA 1EZSA 2BMKA 1SEBA 5B1KA 1R3IH 5F7EL 3SE8L 4XNDA 2Z92A 3QJSB 5FO7B 1RPQA 3EGSB 3I6GB 3AROA 2FWOB 4BIKA 5C0BD 4MASA 1K4CA 4B9KC 4V11A 1BVLB 2PR9A 2F1AA 2CDEA 2VABA 4Z7NF 1ZLVH 1GHFH 4NNYA 1ND0A 2F54D 2WBJC 4FMKA 1P6WA 1RXLA 4PJAF 1LJMA 1H8LA 2QSTA 2BOBB 4AUUA 3U30B 3P0VH 2XZAL 3EF7A 4ZMAT 1RAMA 4G9FB 4NAQA 5BW7A 8FABB 3ARSA 1MI5A 2BCMA 2HVJA 3G04B 5FK9A 2ZG3A 4IBTA 1C1EH 1G9NH 4ILDA 3FPYA 3CPLA 2AXGB 1MDTA 1LMIA 3BT0A 4ZPTA 1Q0XH 1YRKA 4LSDA 1HWWA 3HBGA 4GEIA 3UL4A 4WWID 3FONA 5IB2B 1HH6A 1DQLH 4NKIH 5ADPL 2HJKB 3EH3B 4MCYA 3BSZL 1T89C 4WTWA 1YUHB 3VFRB 3AU0A 4L4VE 2DM7A 4MSWB 4OUUA 2F7PA 3VI4E 4F37K 2Q7AA 4R7DB 5IHWA 1MCRA 1PEWA 5HI4C 5C0DB 2XC8A 3SDXB 3D8MA 3EYFB 1FNSL 1UCBL 4L3FA 1K85A 3CX5J 2RQ8A 5JHAA 3PQYB 1AGDA 4LPWA 1G0DA 2D7NA 4XXDB 4MA1C 2QMKA 4U1LB 4ANKA 4PJDF 1KIRB 3MFGB 2RMNA 3ME0A 5LGYA 3CWGA 1KLUA 4OZIF 1TZ8A 4P2YA 4PJ8D 5CILH 1S9KC 1SVZA 5CXPA 4MHHI 4OFIA 5JPMB 5DU7A 4ERSH 1U3ZA 1F4YL 3QFDB 4HUCA 2DKMA 5IMOB 2HKFH 2EEAA 1XCQB 4PJGF 4YSDA 5E1IA 3P9MB 1WEJL 2ZYHA 3L2LA 3NP4A 2WZPD 2IANA 3IU4H 4IRJD 5J1TC 1HHGB 4BZ2A 5CJXC 4LLYB 3MR9B 4X5XB 4ODHH 3GSNH 1BDYA 1YN7A 4D9RE 3DURA 5I1EL 3LXCA 4KVCH 3HZMA 1WA2X 2AK4D 4PTTB 43CAB 3FUHA 1KJMA 4U3XA 1RFDL 2X9YA 3CJJA 3EH5B 5GRZA 1WITA 2VDPB 4FQCH 4HJ0D 4J8QA 4JHAL 1ANUA 4XX1E 2ADYA 4FI6A 4NQUA 4LCUB 4FP8H 1OGAB 4ZS6C 2VQTA 1YNLH 4GIOA 1JNLL 1OHZA 1SEQL 2ITFA 3IBOA 2D7OA 3J7HA 1F4AA 4HLZH 1VFMA 2ZCZA 3GI9L 5F1IB 1N5AB 1T04A 3S88H 4RSYA 1PZ5A 5LAXA 5GS0C 5DQ9A 1NGXA 1A0QH 3MV9E 4AQOA 1FYTB 2OL3H 5MEOA 1AO7D 1DSFL 2A74A 2QTEA 4KUZH 3F7PC 1AXTH 5LDUA 1FA4A 4BK8A 3BSHA 3BDYL 5ADOL 2DLFH 5SWSA 2EICA 4HQQH 1E8XA 4KK8C 1F0LA 3GK8H 3L3OC 3HLAA 4HV8B 3FT3B 1N2RA 2FJSA 2ZOWA 5JHBA 3I50L 2RJMA 3Q2CA 4FAAB 1OAYL 2YOAA 1A0QL 4NC2B 5TK2A 1SXBA 3MGTB 4KO6A 3L5WB 3EGSA 2VO5A 2YEZB 1T3FA 1EDHA 3VXPA 4E9YA 2ZX5A 2P24B 1NKOA 4MAYB 1IQWL 4G7VL 2RH0A 3EYQD 3RY5A 4J39A 2I25N 4ACTA 3QISA 5H4ZA 5GRUH 2Z1KA 1E2WA 1DBML 4O51B 4UI2A 3VW3L 4LP5A 4DPBX 1KC5L 3GIVA 2D3VA 1XZWA 2NSXA 3S5LA 3F83A 1MCCA 3O0RL 1PX3A 2HJKA 5DFTA 3WIAA 3APCA 4LSPH 4WFED 5KZCB 3BAXA 1L9MA 4NT6B 4OCMC 1OB1A 2IADB 5E0QA 2YS4A 5I15H 1CJYA 2PPDA 4HQQL 4R3SB 1PZUB 2EH7L 1CD9B 4EKJA 3WELA 1UZ6F 2BW4A 2F1EA 4N3UA 2J12B 1NFDA 5FHAL 3VG0H 4JFEE 4K9EH 5HDBF 3QGVA 5KVDE 4ZSOE 2PPEA 4B9YA 3DO7B 4DGVL 2QQKH 1NM9A 2DEXX 2CUMA 3B37A 3S88L 1XEUA 4QYOB 3B2MA 4LK4A 3HRZA 2R23B 1MLBB 5D1XC 5I6PA 2ZP0T 3B9KA 4A7QA 3TFKC 3MVSA 2HVKB 1XQ4A 2DQCL 5L88L 2OSXA 3NPSB 4YWGH 3QQXA 2FSDA 2EUWA 3RZCD 1NCDL 3EOYG 4YIQB 4R97C 1TQSA 1UURA 3LCYA 1TR7A 4M93B 1NCWL 3OR6B 5KVGL 1DQDL 1GZQA 1Q0YH 1XR8A 4OY9A 5DEFB 1ZKAA 2GPZA 1QD0A 2WINB 3MA7B 3OXRA 4G6JL 1FL6A 4OQ1A 3L1FA 2XV6B 4ZMYA 1SN5A 4H2CA 4YSRA 3VI3F 2WQSA 1DSYA 5EO0A 4OF8A 1UCTA 4L29B 2VN7A 1NCWH 3QPQD 4G3YH 2QLVB 3X3FL 4Z7NE 1KYFA 5BVPH 2EZ0C 2BIMA 1KJ2B 4NQCB 3OKLA 1LO0H 3X11A 3LY6A 2E9IA 4JPIB 3RDTC 1Q72L 1JZ5A 4WKXA 5E8DL 2GG1A 3LS5H 3A67L 2YRBA 4PB9H 3FULA 4NQCD 2KLRA 1DCEA 4HK0A 4XOCA 3VD0A 3KLLA 1LP9B 2P5WE 2XQBH 1ORQB 1LGVA 1TZIB 4Y2DD 3QUKB 1OGAA 3TASA 1T4KB 2ZOOA 2F58L 1NMCB 5E8DH 2J2ZA 2ENQA 5AVZB 3L4CA 4ACPA 4W9HC 4LQFH 5E7BA 4PJ5B 3IGUA 4U6HB 4TUUA 5F89B 4OF3A 3A6BH 2X7LB 1EO8H 2VDPH 2PO6B 3VRIB 3GB7A 4NP4H 4DKTA 3KLHC 1EAOA 3ATEA 2EDQA 3ZU8A 1KEMH 3QXVA 3ARGA 1W72B 2V3FA 2DLGA 1D5ZA 4HFWA 3BI9X 3K71A 3RVVD 3V4VA 4FMVA 3FB7A 1W0YT 1I8AA 4U6VL 4XP1H 5GISH 3RWDA 1K3IA 3K6OA 2EIBA 3AWFA 1G6RL 3IJHB 2DMHA 3SJVE 5KVGE 3NN8A 2BJMH 3RVXC 4XPGL 4M6OL 2CGRH 4RNRA 2J20A 2CO1A 2FUTA 4P9ML 4LKCA 1MAJA 1CBJA 4RZCB 4QXTB 4XCNA 2W07A 2YEQA 4QTHB 4OZFB 2ARJQ 2DD8L 1E8ZA 2GBVA 2Y4SA 3HNTL 5F7YC 4QHUB 4P2OC 1N10A 4A2EA 4YHOL 5HTSA 4XNQB 4LL9A 3QDMB 1FYTD 4NRXA 2CBQA 2CGRL 5D7IA 2BLFA 1MUJA 1Y6NR 1HEZA 4IGBD 1AQ8A 3EKCA 3QO1A 4GRLD 4HCRL 1MHHB 5L7XL 1S9XB 4JR9L 1A66A 2YWYA 5GPRA 3H9HA 5B8CA 1D9KB 3IJSA 4Y5YC 1I1AC 2J71A 1QUNB 1RVFH 4L37A 4WI8A 5DZ9A 4AC2A 3DDGA 3P3UA 5A2CA 4B97A 4UM9B 2J1WA 2IH8A 2OSLA 3UPRB 5AENA 3MX0A 3QFJD 1CYGA 1OPOA 2RCSH 1F3JB 1IC1A 1WBZA 1F11B 2ADFL 4NGHH 5B4MC 5AW6B 2D03L 1FSKC 1YEKH 2Z8RA 4H4NA 1M6OB 1I3RB 5T8IA 3U7YH 1J11A 3ZIYA 4GUOA 1XL4A 2NY6D 5AL8A 3SKMA 1VAHA 4I7ZC 1TJGH 5EU4A 5D7IF 1CL7L 5D7SL 1B3JA 4B41A 2NY4C 5FOJA 3E38A 4X6DF 2X6UA 4YXHH 3I9PA 3B1UA 3TN0C 5ANMB 4GO8A 1UA6H 4PCTA 1R3JA 3ZZ1A 5HSFA 4AMXA 4IBUA 5DJAB 3ARED 1WFTA 5E0FA 1UHVA 1XCXA 1WEJH 2X4RB 4N9GB 1HS6A 1AO7B 3QQ9D 3BP7A 5I26A 3X13A 5KS9F 2NR6D 2FATL 1INEH 4R5VA 4ZRGA 2NX5E 1IBYA 2P80D 2ED6A 3F01A 4C56A 1OQOA 2CQVA 3E6HB 1Z0NA 3ULUF 1Q9WA 3AQDA 1MJ8L 1TTRA 5ICXA 3VSQA 5CFAA 4HK3N 3OWRA 2Y7QB 2QSQA 3PAUA 3CVIL 4PRNB 4LEBA 4X5LA 5GGQL 2AXHA 3NCWA 1GKEA 2YD0A 1SUJA 3QIUD 5D4IA 3O11A 3IB4A 5H2BB 3F58L 1U95B 1SY6H 1UCBH 4JRYA 4F58H 5KYXA 1E9PB 3T8VA 3RUGF 1BJMA 1SEQH 1JTPA 4JFDB 2PTTB 3OB8A 1BGXL 4L05A 2IIJA 2OZNA 1R19A 3ILEA 4R9HA 4U0RB 3JVGC 3II3A 1EJFA 3WO4C 3W2DL 4FFYA 2JI3A 3ZSTA 4HXAL 1GY2A 4J3OH 5F7KC 4F57H 3T4AB 3QDME 4KKLD 2W1NA 3NOIA 3LKPA 1E3FA 1RIHL 3QPQC 3KPSE 1TOXA 4F7TB 4JN2B 2VLRD 2OW6A 1P6FA 4HZLB 3TESA 3G6JB 4ZODA 3T6WA 2OX5A 4J7RA 1EMTL 3C5JA 3KL3A 1G4RA 2VWEE 4P2OD 1IM3D 4MS6A 4NENA 2OMZB 5K69A 1A8ZA 3IU4L 3UTTA 3R7RA 4XHJC 3DVNB 5DFVD 3BZEA 4HSAC 4TUJA 3RIAK 1IE4A 4DIXA 2OKMA 5I75B 1XGYL 1LL1A 4YR6B 1NINA 3BVXA 4HC1A 5J5EA 2APTA 4MQTB 3CSTA 1T0MA 2XPYA 4YS4A 1DLHA 1S5HB 3K72A 2ZKXA 4L5FL 3PWPD 4POZD 4UV7H 4XRCA 3DOSB 2GCYA 3APMA 1AHMA 4NYLA 1N5AA 1T04B 3HJEA 2FATH 4KKCC 3GS7A 2V9RA 4N1HB 5IMLA 4AQZA 4ZW3A 1HEZB 2XACC 4Y2DB 5AB0A 4Q9QL 1A5FH 3WSQH 4ELMA 3EFFB 3HPJA 5IMMA 2ITDB 3KPRB 2XBTA 1L9SA 3WL9B 3ULAB 4GUCA 1NBYB 4BUQA 3T4YA 1GOFA 4UINH 3L3IB 1U30A 1XR9B 1TJIH 3OX8A 3VQ2C 3QFJE 4JG5A 2ARWA 2VISA 3TJEH 3SIKA 2YD6A 3POHA 2HJLB 1A02N 1A5FL 5T3ZE 1QFWI 2ZOKA 1XZ0B 3GBML 1JXFA 5BZDA 2HFEA 4KK5D 5CBEB 2QQKL 2WO3B 4IJTA 1QASA 3EOAB 1VADA 3FT2B 2FIKB 1KLFA 1SHMA 5I8KL 1CFVL 2YN3A 4JFDE 4HKZA 4FKKA 2ZJSL 1ORSB 4L8BB 4JFFE 4QKXB 3RB5A 3TV3H 4IU2A 3Q01A 4BA8A 5HD8D 1CTMA 4P4KA 4H40A 4EBQL 3MC0A 4F8TA 3TNMA 4EUPB 4LSQL 4N6RA 5F8QC 4IQHA 4AGNA 4Z6AT 2Q8BL 2DEWX 5JOFB 4JO3H 4G6FD 3SPHA 2DQTH 1F2QA 1ETZB 1USZA 1JD7A 4WU7A 3TBVA 3K0WA 5T3XE 1Q9WB 1DJHA 2FWSA 2MCPH 1UH2A 2A99A 2BVUA 4X5WA 4EZMA 4N9GA 2P7TB 4FQ1L 4Y19A 2D0GA 4PJ9A 2WSDA 4GKZA 5SWZE 4MCYB 2WXHA 3VFRA 6PCYA 1BD2E 5DC0A 3A6CH 3CLFL 3RZWA 4S1QH 4TULH 5FW7A 1YEIH 4MDIA 5E6IB 3MJ8A 4RFOH 2ICWB 1MRFL 5I1IL 1RJLB 5A6MA 4PRPD 4TNVF 1NC2D 3G7TA 1E9OA 3PAVA 1EGJA 3STZB 2I9LA 2QDWA 2W65A 3BJLA 3QXAB 2VDNH 3IU3A 3FTUA 4JQIA 3FQXB 3QDGB 5EUOE 1Z5LA 2Y25A 4QD2E 5FLUA 3C6LC 4Z7UB 5E1HB 4ODVL 5DMIL 3QI9D 1S7WA 3VVVA 3CFEB 2KZ1B 3SQOL 4A37A 5IMKA 4N2OA 4EI6A 3E9UA 4PQXA 3GXPA 3T4AA 3N9GL 5JMOC 1MJ7L 3L13A 3HNVH 2UY7B 4BQ9A 3V5DB 5D1ZA 1AFVH 3SBWA 2MMXA 2COVD 2WV3A 1KEML 4KXDA 1ZANH 4FFVC 4GLRI 2GSIB 1SDAB 5FYLL 1YMME 4TQEH 3HKZA 2F6AA 4LBEB 4GRWB 1R46A 4HPYH 1BZEA 5DWUH 4C58B 1RZ7L 3ARYA 4PV8B 2B39A 3BZEB 4PHZA 1LO2H 3FRPB 4HH8A 1IU1A 3S7GA 1F45A 1K6QH 2V2XB 3QW9A 3DGDA 3QIUC 1Q94B 3CVHL 2IQ9H 3H54A 1UACH 3S35H 4LCUA 5F7LB 3UG3A 2BW5A 2E7BA 2FWLB 2MQ0A 4OLWL 4OJAA 1A9BA 1WTLA 3HNSL 1GYAA 3KJ6H 3DOSA 4YZWA 2JVUA 1NBVL 2BWIA 3FSWA 3RPIB 3IMBA 3L9EA 4HCRH 1FRGL 2WZ6A 2Y3AA 1HT6A 5I73C 2K3TA 5JW4R 2VR8A 1GGTA 2ZIDA 3KPQA 4X7EC 3CCHA 5E8OA 5EIQA 2FTAA 3C5SB 2R7EB 4HKXA 3Q8CA 3BW9A 4PJXE 5IFJA 2D7TL 3L48A 1QBBA 4CVUA 1A4JA 3LKSB 5L88H 1XF2B 1MFNA 2XT1B 4MJHA 5DO2D 1P7QD 4OD2B 5DHYA 1RSYA 2DKSA 4U1KB 4UOJA 4K9EC 3UZEA 3ORJA 3PAZA 5D96B 4GP8B 5JIIA 4PLKD 1A7NH 3B43A 1LK3H 4AGQA 1EFXD 3RY6A 3G5YA 4R0LC 3BQUC 2ZOTA 1SDDA 1RUML 4JB9H 1QFWH 5EU3A 3UTTD 35C8H 4ZX5A 2DM3A 1P53A 1U36A 3DUUA 4R6UA 5KBMA 1N9PA 4XVUD 3VX0A 5I23A 5J9PB 5A6LA 1RHHB 1KB9K 3DJSA 3SPIA 3NIDB 2VKXA 3FB8B 4WFHE 2JKNA 3NIGF 1QSEE 2IDUA 3MNVB 3LIUA 3VFNB 3QJXA 2X9XA 4Y89A 3HMXA 3P11L 4LU5H 1CO1A 4IKNA 3WN5C 3ILPB 3PV6B 4BZ2L 2J6EA 4FQPA 3OKEB 4HFUH 4QLRA 2B1OA 1F3JA 3TBTB 4YXKH 1ZCRA 1WCBA 5IVXF 1NAMA 5FWRA 4NQEB 4BSWB 2NX5D 1HH9A 2Q5BA 3QG6B 3ABLB 4RMQA 3RWFB 1G1CA 4DN4L 4ZX3A 5FUOH 3MA9L 3ZY7A 2NY4B 1JD9A 2CKBH 4HUNB 1G9ML 1RZKL 2R2BA 2ZSWB 2B08A 4HHAA 4YSPA 5D9SA 1OCCB 4GMSH 5T1KB 3V5HA 3BUYA 3S8WA 2DOCA 1EUUA 1XGTB 2LV4A 1L0YA 4XXWA 4QY8A 3MRCB 1NCOA 1GS8A 4X8GA 5FYLD 2VGLM 1KUMA 1KZYA 4MA3B 3WXWL 4F2FA 2GJZB 5FC9A 2UY7A 2VSDA 1AQMA 1ZSHA 1MCOL 5L0QC 5CM1A 5GISL 4O00A 1MFEL 1T03L 1M2OA 3WEAA 1X4XA 3TPUA 2EKSA 3VD5A 2XKSA 3SBWC 3U2SA 1EEZB 4CN4A 1ZHNB 2VLKA 1KOAA 1S7SA 2FR4A 3IKKA 3O3UN 3GRGA 1JMXA 2A9ML 4QRSB 4OGXL 1T2JA 4QHLA 5D5MB 5I1LB 4MD5A 3RWJB 2CG9X 2M8XA 1JP5A 3UGXA 3BRFA 4WUUB 3DVGB 1ES0B 3MROB 1A21A 2Y6SD 3BMVA 3HIZA 1TTGA 2Y1VA 4W9LC 2MJWA 5E8EB 5L9DH 2Z7YA 1JPTL 1KY7A 1ZTXL 3GQFA 3CAFA 2X5PA 3HZYB 1G9NC 2CO7A 2AEPH 2E9BA 3CU1A 4B9ZA 3ATAA 1NBQA 4ZW6A 1JFQH 3LH2H 2BSSB 5D5ME 4RMUA 5ETUA 4DTGL 4JVWA 1DEDA 3VXMA 5I1AA 1SNRA 3EZ8A 4HJTA 2W9EL 5I66A 3LEXB 1FAIH 1CE6A 4JAMA 5DK3A 4N0UE 2JWYA 4HT1H 3D9AL 4NT6A 4WI7A 2G2NA 4P23C 4Q6KA 3TCLA 1UD4A 2V2WB 2VH5H 1RL1A 5EU7E 2PUQT 2G2RA 4JDTH 2ED8A 3L2NA 4Z18A 1IGFL 1HEHC 2VDMH 2UV3A 3DX8A 3ZRFC 3ARGB 4G2AA 3T0AA 4HJEA 2V5TA 4J3BA 4AH2B 4LNRB 1CE1H 1UB5A 1XB8A 4PGBB 2CM6A 2EQDA 3NTCH 3O6ML 4D0BA 1NFKA 2QVFB 4ONGH 5F9OH 3QCTL 5ITFB 3KHQA 1NGZA 5ALCL 3VFTA 3WKYA 5T5FA 1WWWX 1ZHKA 4HKJB 3B2VH 3HI1B 3FN9A 3O41B 4M4PA 5LBSA 4HEPA 4IRZL 1JPTH 3SE9L 2DIJA 2EEDA 3OR6A 5AAMA 1TVDA 1ZAGA 2K6ZA 4XPAH 3D2TA 3AITA 3RWEA 1XF4A 4KK9C 1FL3A 4P5TA 4I18C 4NJAH 1UD2A 4GOSA 2BOCA 1AY1L 4N6QA 1BLNB 2UXGA 1RIVL 5E9DD 2VR5A 2HT3C 3QQNA 2AJVH 1H6FA 2NPLX 3DK2A 1U8JB 4AGOA 4BSWA 2FHCA 4QXVA 4C57C 5C0RL 4K3GA 1DQLL 2WNWA 3RWFA 1DBBL 4HWEL 2Z4QA 3CFBA 4GAAA 3I3BA 3LKOA 3FBQA 3U9PL 4L3EB 1I7RA 1I8KB 2C34A 5D8JH 3F7VA 2VR4A 4NUJA 4W4OA 1YPZE 3T77A 3WY3A 3QC5X 4X4KA 3TN0A 4V2CB 3CHSA 3TZVD 3C60A 1NOLA 4MQ7A 5JR1H 4X0NA 4J3WA 4O02B 1CCZA 1SXSA 3GZOA 1G9EA 1I9IH 4U1LA 5C6TL 1TTFA 3CFTA 2D9QB 4HWEH 1KV3A 1AD0B 3I84A 3QAZC 3D39E 1RZPA 4FQQB 2R4SH 4JPWH 4K8RL 3T3ME 4AEHH 4ICXA 2EDEA 3NACL 3UTSA 3K8MA 4NRYA 5F89A 4PY7B 2VLKB 5HHOE 2GT9B 2EKJA 3V0WH 1S7RB 3LRSB 2E7DA 1R0AL 2R2EB 1Y18B 4XPTH 3SDYL 4E36A 5C0EA 2BRRH 1BX2B 2LR4A 1MFDL 3KLKA 4OZHF 4KROD 4I4WB 2XWEA 4Y4FA 4Y8DC 2BC4B 4LL4A 3RZCA 4I3GA 4W9IC 4L1HA 4P23D 2EDDA 4WJ5A 4LEEA 4WGKA 3DX0A 1OP5K 3WIFB 5EIIA 1QSFA 1BQKA 5TE7L 5HGHA 5HPMA 1IEAA 3JWDC 3ZUNC 1KJVB 3EJPA 2ZUTA 4TULL 1YEWA 4L8CB 3ZR6A 3EG9B 4GAGH 5LWYH 3E2HB 3ML8A 1WAAE 3CE1A 4ODUA 3UYRL 3PDOB 1QLEB 4GUPB 1ZD6A 2L0DA 3CH1A 4KOBA 5JW3L 4OIFA 4LMQI 4N2GA 1WIPA 3QWQB 4XVUC 1CB4A 3CPUA 4A6YH 1GJIA 3GRBA 5HYSA 5JW4M 3WYRA 2ICWI 1T0PB 2A4CA 2BXZA 2CDGB 3QDHA 4XMPL 3SE3A 3TA3B 2X2JA 4OCYH 4WFFE 4G7YH 3N41B 4A2HA 4DN3H 1AZCA 1IC7L 5I1JH 1QZ1A 3SKJL 2APBA 3N06B 1ZJBA 4ZMXA 1J88A 3KBFA 4U1GB 1ZT4A 1KXTA 4OTXL 5E6ID 3DPBA 4BQ6A 5I0WA 5M95B 2VOTA 1AD9B 5C09A 3U4EB 2Z65C 4ENZA 3T0EC 1TG8A 2F54E 1PAZA 3MSPA 2FVNA 5IFHL 3SO3C 1NUFA 4GFTB 5C0CE 2WZ0A 2NX5B 3D2UD 3HE7A 3ARDA 4YH6A 2VMJA 2J8UE 4XAWH 1B4TA 4AE1A 1N59A 1PZBA 2NY4D 3MXWL 3Q6FA 5T33H 4N2MA 1E7VA 15C8H 2H3NB 4NLHA 3D0LA 1TIUA 1M6UA 4HBCH 1VKXB 4XCFH 3IDJB 1MRDL 3HS0A 3TZVB 4NKDA 4ZS7H 3CFNA 5SX4I 2FJHB 3ME0B 4LPTA 1SJEA 4RX4A 3IT8D 4OD3H 3U4BL 5JW4Q 3CZGA 3GMQA 5GGSY 2WZ5A 5DRZB 1YYCA 2F2HA 3MLYH 5D7LE 5CJ5A 3D34A 1A7OH 1QRND 1HWHB 3E0GA 1AACA 3FOMB 3KBHE 2WVVA 5KSBA 3UADA 4UOQA 4XN2A 3ZHLA 4HULB 3TEZA 3BP7B 2DLHA 4KGJA 4X98B 2H32A 4BFOA 3P02A 2ZQKA 5I8CA 3MA9H 4LPUA 2EZ0D 2C7UA 1EJOL 4ODVH 5DMIH 1JUFA 2LTQB 4C54A 2I5YH 5CMAA 3L3KA 3O3EA 2QKIC 2NZ9C 5EA0L 4E9LA 12E8H 1S7QB 2XV2A 4GMSL 4AW4A 1MWAL 4N25A 1XBRA 5C0BE 2PO6C 1N68A 4PJCF 3DBXB 4PMFA 3O9WC 4K4KA 1ERNA 2DYRB 3CNKA 3ZKND 3IWUA 1K3ZA 4FHBD 4JVPA 2XWRA 4NIKB 4NKMB 5GGRY 4BH8B 4YO0B 3BPNB 3S3DB 2CKBA 2CXKA 3GSNB 4UT6A 3EUUA 4V1DA 1JE6A 1IT9H 4LAQL 4XCEB 4WHYG 2AQSA 2ID5A 4PGCA 4R26H 4OGZA 4UNTA 3H6AA 3FO2A 5JW4N 1J10A 4AYSA 2H1XA 3LKPB 1F56A 5MEOB 4NQEA 1NFDF 2WTRA 4L4VD 2ZSVB 1W0WB 2CH8A 2ZOUA 4BINA 3QS2A 2JH2A 4TVUA 3UDWC 3PGCA 4WFGD 3ULUH 5C0CB 1X4YA 2AITA 1CICC 2Y36H 3BZFA 5CKGA 4TQPA 3FH5A 4YMPA 4YNYB 4NRZA 5F3HB 1JRHH 2VLJB 4KGLA 3UTTB 1QABA 5GHWL 3DJRA 1L0PA 2FGWL 3V8OA 1M1SA 3DX9B 2GJ6D 1DVTA 2Q2EB 4UQ9A 3OF6D 1Q1JL 2W8CA 2UWEE 1GKOA 2EC8A 3ARBC 4GG8B 4HPOL 4FZEH 1JYNA 2BDNH 5ACZB 3TFBA 1EX0A 4WNQA 1X9UA 4JFFB 4XCYB 4YBHA 32C2B 1YY8B 3STLB 2YD5A 4KFMA 1LO3L 1H15B 1TFPA 3NK3A 1OTTC 2N01B 1QZNA 2NR6A 2HJLA 1G87A 2H9GB 4OVVA 2LVEA 4W4OC 2IQ9L 3EDEA 3P73A 3NCFB 3ARDB 1WQVT 1PMYA 4I13B 1H3TA 1IGYA 2PYED 1QPPA 2BSEA 3QI9C 5F97E 2GTWB 4Z7VE 3MRNB 5KSUA 3ZMEA 4U3HA 4JUSA 4UMGA 1MZYA 1SYSB 1JK9A 4DVBA 4MNQB 4ZPVA 5AB2A 3ZBMA 3OKYA 2W07B 1VHPA 5EBLA 5A2KH 3FHAA 3SCMB 4C4KO 4NP4L 3OSVA 4AM0B 1A1NB 1RZJC 4AYDC 1VADB 2VRQA 3RQ3A 1FV1A 4RISH 1PD1A 2B59A 2CJUH 4G8GA 2XVLA 1M9SA 1A9BB 2ED7A 1SYVB 3AT8A 1HJBC 1XGYH 3GMQB 2NYYD 2HXAA 4B95C 5HVHC 4L1BA 5FOBB 4TSBL 1L0XA 3FONB 3JTTA 2Y72A 3D87B 3TIEB 1ML0A 2I27N 5DJXA 4ELKB 4CDGC 3Q06A 2W91A 3H85A 1WHOA 5DVMA 3BEWB 4IRJA 1ZSDA 2COQA 3GMNA 5IF0B 2NZ1A 4RA3A 4RFEA 2K9UA 3QIWC 2OFQA 2XPZA 3NIGB 5BRZA 3RGHA 1NGZB 3VFTB 1RJYB 5AZEL 1K8DB 1GGCL 1BCIA 4IRZA 3N04A 4K94H 2VR6A 4U6XB 5GS0H 2WMPA 5AAPA 2J88L 5DR5H 4KO9A 3WIHH 3IVKA 4FQXD 2C7UB 2E6PA 1HQRB 3WFDH 4LSSH 5KUKA 3LMJL 3DV4A 3BQUD 4FLQA 4JX0A 4F91B 1X5LA 2EIZB 3FL7A 4ENED 2XXCB 4IM8A 1NIDA 1IIKA 1UXSA 5ANMA 3WFCL 3GMOA 5CZXD 3UJIL 1YEJH 2ZCLH 4DW2L 2QFRA 3U0PA 4ZQKA 2Q8AH 1T7WA 2VLJD 1CTOA 1L4IA 4UANA 4WFEE 4XB3A 1KTJA 1KJ2H 3IU3B 1SF5A 3QUMA 2IF7A 1HEJC 3ARBD 2N0KA 3WAJA 3MKKA 5E8NB 5K9KB 2IH3A 1ZLUK 3GSOA 3L4WA 2DYSB 5DF0A 4YNYA 4JFPB 2ERJB 5E6YA 5DQJB 1FNLA 5MERB 5EU5B 1M57B 4IRSA 3K6SA 3DHJA 5E2WH 4KZDL 4Z7WE 4Z7VB 3TYFA 1KGUA 1JNHA 4FE9A 2QHRL 3QORD 2WKGA 5GGQH 3QZPA 4IMKC 2NY3B 4WEUD 1CF8L 1Z9LA 4PCYA 4XN1A 5E5UB 5KOMC 2A6DB 4DH2A 2CCLA 3K71B 1A6VH 3FTZA 1S3RA 2V0AA 4NHUB 1BJ1H 1KCKA 1OAQH 3R0NA 5IBTH 5C08A 1T66C 4G8EA 3WLWD 4B5ZA 4MDJB 3ASOB 4KQ3L 5JQ6L 3EJYD 1ZE3H 5KSVA 1X9QA 2X4TA 4MJIA 3S5LG 1I9RH 3D85A 3S0PA 1L9PA 1IL1B 1M2VA 2BVQB 4DPCX 3TP4A 3RKDD 5HVHB 1P4LA 1U4EA 2NQ3A 3P73B 4ZK8A 2CHDA 3NJJA 2G0LA 1A4CA 4FXGB 4J3OG 5IHBA 2AJSL 4G6KH 2IQAA 3CN1A 2XG5A 4W9FC 1CWVA 1PD6A 5A6IA 3BIBX 1GIGH 4ZFOL 1I7ZA 1MCFA 1ZIAA 1XAUA 4QHKI 4N20A 5AZ2H 5H94A 4NIYE 1KTKE 3MLVH 2DKUA 4IOFC 3N40F 4EAEA 1JYWA 3RWJA 1XH3B 4BH7B 1JVKA 1R47A 1XF5A 4WO0A 1CD1B 4YSTA 3QHFL 2RFXA 5IM7B 3KGSA 2A73A 5DVOA 1FYTE 2WLNA 2B15A 4UV7L 1BM3H 4L0YA 1QBAA 3BAKA 1UXMA 3DUSB 4JCWA 3QYMA 4ZFQA 3ARRA 1BSIA 4U3SB 5INCA 3NYKA 3RUGB 1GOGA 3BWSA 2XNAA 1G7HB 2F5BH 2Z64C 4Z0XB 4FFYH 2CIIA 5DYFA 3FB5B 1NDTA 2Q9OA 4A2DA 3OKEA 2DLTA 3SPVA 4EZLA 4PJBB 4LE8A 5ESVA 2F19L 5HDWA 5F9OL 4HIEB 4QHMB 1KMGA 1HL8A 2ITEA 2DQEL 4QRAA 4QAWA 3ULSA 1MELA 3KPNB 5LBGA 4D7BA 4BHUA 5AYUH 3GUTB 3O8XB 5FYKH 5F3BA 1KCSL 1MLBA 1OD9A 2FSEA 2FT7A 1P5UA 3BPCA 3F62A 2R1XA 4BFKA 2O6PA 4FLOA 3SKOA 3IDMB 5TQ2L 2EXWC 1DVZA 4HH9A 4XCCL 2O72A 1KLGB 3GGWA 4HGKC 3BKJL 4BE6A 3AWGA 4L9LB 4X4YB 2FO8A 1CFNB 1WFOA 1JFQL 3LH2L 5IB1B 5E70A 1N3NA 1N8OE 2GEQA 3Q0HA 3W9DB 3WNPA 3HG1E 4W9KC 1MRDH 1CBVL 1X5YA 5CD5C 1ZPUA 3MQIA 5ESAA 1TEFA 4G7RB 5FECB 1E0OB 4QO1A 5FCSH 2BVTA 3F12A 2XWBB 3O3DA 2YGPA 1ET8A 3BP5A 3EYSH 4JFED 4J2XA 5E00A 2R83A 1SVBA 5ICUA 3RKDC 1VFUA 1JZEA 2X9ZA 4BA0A 3IFOB 4LSUH 4OFQA 1SJHB 2DYPB 1Q9KA 1VACA 3C2AH 1E5CA 2KS0A 4MRCA 3CFCL 1BQLH 2V9UA 1O6VA 2W80C 3KLDA 4PRIE 1J0ZA 4KKCD 4YDIL 4QDGA 1PPIA 4OTXH 1TCRA 3NIDF 4BSVA 5CEZH 4L4TE 3NK4A 1S5IH 4TTDD 1L3WA 4JRXE 3VXUB 2Q1EA 3I02A 2YQ2A 4G6FB 1F6FB 4PEEA 5FW6A 4EI5D 3FO1A 1NEZA 4AIZA 1HHJA 5KVMC 2V2WA 5FIEA 2YPLB 5E5LA 4HS6B 1SXCA 3WNOA 3D52A 1FFNB 1EPFA 4FS0A 5L8LB 3UXFA 3DX6A 3QEQE 3NFNB 2YPLD 4Y4HC 3PL6A 4B9GA 4M8VA 1CUOA 3MLTA 2E7LC 1YDPB 4N5EC 4O58L 4BUGA 4L8SC 1F41A 5JA9A 5F1NA 4EJ1C 3GNML 5J11C 4WI3A 1LP9E 2ADGB 5CR8A 3DUHA 1Q72H 2MIZA 2WYHA 4QNPE 2B8OT 2X6BA 5H94B 1GL4B 3UZQB 5FHAH 3UAFA 4Z7QB 1KJVA 1LNUA 3D0VB 4L3EE 4X6CE 5PAZA 1AE6H 2EJ1A 1RUQH 3OKOB 3HN3A 2E75C 4X7TA 3NRQA 3QR2A 4FFTA 3UYOD 4IBQA 3W0WA 2B0SL 3GSQA 4P3DA 3QIWD 1KYAA 5I5JA 2VZVA 1W15A 3NQKA 2GFBB 4W9JC 1FZJA 2TRHA 3B1TA 2APWA 4AZUA 5C2BL 3ZO9A 1TNNA 2XTJC 2WVTA 2GVYA 4JG9A 5KS9B 1QPKA 1JWSA 3GSXB 4JZOB 4D3CH 3ATBA 4EN3D 4KKPA 2WCPA 3FT1A 4HU2A 2PWHA 2YA0A 1U3NA 1CFSA 4YJZL 1NUDA 1UJTA 3OMNB 4PI0A 1EAQA 5JIHA 5T3ZH 1DDHB 4AYFA 5CSZA 1HHGA 1UD5A 1RLWA 1EH9A 3HMXH 3O3BB 3DYOA 3PNRB 1E6OL 4MZRA 2XSKA 4W6WB 4MJ5A 1X5MA 1GJUA 1M71A 5HHMD 2PYEA 4X4XB 4APXA 1ZHLA 3R18A 4GBXC 4N2BA 1YNTF 4FXTA 3TN0B 4LPXA 4P2RB 5DWPA 1YEJL 2VITA 3U0TA 1A4BA 1V10A 3WFCH 1RLBA 4IW4C 5B1JA 4TUOB 3PJLA 3VWKD 3GHPA 3IPFA 4ZO6A 3QPKA 2FX7H 4BCZA 1AS8A 2YKKA 4X0KA 4Z7VF 1QWUA 1UOVA 3CK0L 5I73B 4YFLF 4PBVC 3R4DA 3ARDD 5EEWA 4QMEA 3EHBB 4UT7L 2IDCA 3MOBH 5DMGC 3K2UH 3VWKA 2JELL 5IJVA 3HZVB 3RA7L 2BNUB 2IWKA 3BD3A 1MKFA 2R1YA 1ZMYA 4N2EA 3T3MF 5CJQL 1MXDA 4JN1H 4MVBD 4B7LA 4F93B 5K9QI 3NZSA 1KWKA 4KZDH 2WAQA 3TO4C 1VERA 2IDSA 3AM8C 1F86A 4GAFB 1DN0A 1NDGB 2BCKB 5F9WB 4FTVE 4P8QA 3S37X 5ANME 1YYLL 2V3EA 1PLAA 2P28B 4WEEA 2YR3A 5L2KA 2IOIA 3FT0A 3GXIA 4HMCA 3FRPA 3U0PB 5CNHA 3DI2B 2JCCE 4BK5A 4LBAA 5MHSE 1ZA6A 1JXKA 1RULL 1U2HA 2A77H 3ILQD 3JVFC 1HL9A 3RWIA 5BCAA 4NHCH 3FMGH 1ED3B 5EC1A 1FZOA 2QFPA 1KN4L 1MN4A 2VT0A 3ARTA 1NEUA 3M07A 4XC3H 3OJVC 1OSEA 3B7UX 2YIHA 4HUUB 3D07A 1N4XL 1P7QB 4YL4A 1BQSA 2CLVA 3MODL 3I6GA 5B21A 2ROYA 4I8DA 2GBUA 2YD4A 4RISL 4LCWB 1KWGA 1QA9A 4JKNA 3QEQD 5F88B 2UZYB 3WS6C 3H9SA 4P46A 2FX7L 2F18A 3GSUA 4MS8C 4S10A 4KKRA 2BOBA 3OB0H 4DZ8A 4CVWA 1QQDB 5GGVL 2PCXA 3CFQA 4Q58C 3W0WD 3RAJL 3RL1B 3CC5B 4W68A 1L9TA 1CVRA 3Q6FB 4GIPD 4QUOA 5I6KA 2Q10A 3TBYA 2KYIA 4TXVB 5L0QB 4W9ZA 4N0YL 1V05A 2WJ5A 1JZ2A 3QO0B 3T9WA 3VQ1C 5H8DA 4XXCC 4NQVB 1QEWB 5GJTL 3ULVC 2Z91B 3CSFA 3LD8C 1UGKA 4ZXBC 2L7QA 2DRUA 1XSIA 3ZL4L 1U8OA 5DT1H 1YJDH 3MKGA 5DD1H 4JO2L 1UB5B 3NAAL 3DJ9A 2C3VA 2JKSA 4Z7IA 2G3XA 3ARFD 2L7JA 4QGTA 4JCLA 5A2BA 4UZSA 5FKPA 1WYJA 5GSVA 3PQYA 1A1MA 1EANA 3MU3A 2YD9A 3QNFA 4UF7C 5IUSA 3K91A 4EOWL 1QSED 4XWOC 3RGVC 1DLFL 1VFAA 2AJYL 1DFBH 1RK7A 4RGMC 3N1GC 4MNGB 4NKIL 3MFFB 2WXIA 3HC4L 1ZEAL 4OJFH 2K3HA 4X42A 3ZKMC 4LDEB 4UT6L 2FO1A 5FS5A 4LIQH 4OT1H 5EZPA 2AP2A 3BPOC 1TVHA 4PRAB 3RIKA 1D5IH 1MW1A 2E27H 2IGFH 2JK5B 4U1HA 4JCMA 4WO4B 1YEFH 1IGIL 2AGJH 1XL6A 1UOLA 2YARA 4L3ED 2NY6C 4MZ2A 1TZGH 3QCTH 3KYKH 3FFCD 4ELKA 3MUHL 1OW0A 2DEYX 1DANU 3UBHA 2LLLA 1QRNB 4F9LA 3FQWB 1G7IB 1EDYA 3ARGC 3DURB 3JWNG 4ETYA 1UTDA 2OXHB 3AXHA 4A38A 4PJGE 4Y7MA 1IGIH 2AGJL 2HG5A 2HT3D 4N0RA 3P77B 1P5UC 4ALAL 1A3RL 1CE1L 2PMZA 3SYPA 5CEZL 3PE9A 1CLCA 1W91A 1SPDA 4KRPB 2XQ0A 2ARJB 2XVGA 3MBED 3FB7B 3QQDB 1RZJH 4AENA 4TKWA 5D2LE 5T5FH 2E47A 1WFNA 4G80A 1DTUA 4FOMA 3I9AA 1ZV5A 3LHPL 4ZAKA 3WG7B 3SO3B 5EUKB 3IDUA 3WSQL 5BUAA 2QPUA 1OLLA 3SKNA 3MV8B 3NP3A 3EFDL 5F6IB 2HH0L 1CFQA 1TETL 3Q1SH 5KSBE 4NWUH 3K8KA 4QJ3B 4M3KB 3LEXA 5HJDA 1O6TA 1U2YA 1V54B 2BC4A 3LD8B 4Q0XL 5D7EA 5JPNA 2UYLB 3GM8A 1MFCH 1SJMA 1YY8A 3F6IA 1CF1A 1L6PA 3VYOA 2NY1D 2G2PA 5EULV 3UEZA 1KENL 1V3LA 1JZ7A 4KZEH 1MRCL 3HR5A 1HH6B 2V7NA 4KKQA 2AABH 3H9SE 4PBDA 1QTPA 1I9JH 3DIDA 5AAMC 3SD2A 1ASQA 1AOZA 3TYFB 4P3CH 3SSGA 1P4IH 3K5SA 2P49B 4WU5A 5KJ7E 1E90A 3DRQA 3T2LA 2AXWA 3V0WL 3EG9A 1QQDA 4AXWB 4WSJA 3BWZA 1VZIA 3DGCR 3ZK0A 1OGSA 4NFCA 3OLIA 2JMRA 4X5RA 3X13B 4UQ2B 1AQDA 1NMBL 2EXTA 3MRNA 4FQJH 5KSUB 4X9IA 2W59A 2I7OA 3RVWC 2MNWA 1LK2A 4YHMH 5EIVA 5I8EB 3VRJB 1JF1A 2FEDC 1F2XK 3AVEA 4WHTB 4YHYB 1F90H 2QMJA 5EZJB 3VXSD 1YEIL 1U8HA 2WBJB 4ODWA 3D51A 1UXWB 3OHMB 4P5KB 5C09E 1WWAX 2BNRB 3SKJH 3NIDE 2B5IC 4NWUL 1A7QL 1NAKH 2PWEA 4MMYB 1YYML 3X3GH 5DS8B 4BCXA 2NOYA 2OMBA 3ML9A 2YMXL 1G7QA 3H6JA 5FKPB 1BPVA 2VSMB 4JFTA 4U1KA 5CEZE 5AAWA 4M3HA 5DDHA 1GGIH 2O6DA 2HLEB 3F7YA 5E6SB 5SX5K 5KVEH 4A04A 4CMMA 4HBQA 3FFDB 3P11H 2K45A 1X5IA 4LU5L 1T7YA 3UBXA 4E9RA 1PF3A 2YUZA 5AVQB 1XIWA 1JXDA 1X5FA 4NX0A 1DVFD 1WAAA 3CGTA 3E2HC 1ZLUH 5EZLA 1QNIA 2FUQA 2H5UA 4R4FL 3OXSA 5DHVB 2W92A 3CIAA 4ZUTA 3NABL 3OF6A 3PNWA 4KI5E 2Y07L 1XR8B 2IAMD 1HNGA 3HS8A 2GAZB 1PZDA 3VTTA 1A7RH 3Q9PA 5JTWA 1FJ1B 5F96H 3TIDB 2ROXA 4MMZA 4ONFL 5F6IC 3KJ4B 3H2PA 5IB4B 1BQLL 4XNZB 2J1KA 2JCCA 3MACL 4NSKB 3FXIC 2JELH 1NMAH 3HE6A 3P40A 2OCCB 2P46B 3QRBA 3FOMA 5JYLA 5CIPB 1UJ3A 4IHOA 5L2KE 4BZYA 4PUBH 1OT2A 4XT1C 1IFRA 1UG9A 5E24E 3ZVVA 4IRSD 1OAYH 2XTJD 5B3JF 5SWZB 2XRAH 3G9VA 1V5JA 2IWFA 5IIEA 3UC0L 5ACLA 3BAEH 1BYPA 4JK0D 1GSKA 4MNHA 4M1GL 2V17H 4OZ4B 2FJUB 5KVEE 2RACA 3SDAD 2CGYA 2JXMB 1JFHA 4J1UA 4NPKA 2KZWA 5FM4A 3U0TB 5CBAB 5IROD 2CO2A 1UKSA 3O9WD 4R4ND 2D7TH 5CO1A 2WOBA 5EU7C 5BXFA 6PAZA 2WXMA 1QLRA 3PPSA 1TKWA 4YE4L 4OGYL 4WW2A 5EPMB 3SEPA 1BEYL 3M45A 4ADIA 1Y1DA 1VGKA 4OD1L 5HYQB 1TEGA 3QEGL 4MA8L 4N87A 3S5YA 4AGMA 2EE2A 2BNRE 2E9JA 2OR9H 2BMKB 4BXVA 3V9FA 5J8OA 3I75B 5D7KD 4HFUL 5F2FA 4KH2A 5I17B 2DDQL 2GIMA 2WLIB 1URIA 4A68A 5JHLH 3VXTB 3FU0A 3V5DA 3FQNA 5F0MB 3NJMA 4XXCA 3VI4B 4X6CA 1LDPL 5EBGA 3NG5A 1IGCH 4ANUA 1DN0B 1NDGA 4K7FB 2I9TA 5AVXB 3GSVA 2WWNA 4NRZB 1ITCA 1ROWA 4PLJD 2VZ1A 4PREB 3FQTA 1AGBA 3NESA 1OCWL 2K6WA 4A6YB 1KJ2L 2IGLA 4N90D 4NO2B 1ZXKA 3DUSA 1CG9A 1C12A 1GYWA 5TDNB 2K4AA 5CCHE 2W81C 4DGWC 5GZOA 3D18B 2V6HA 2X89A 1BGXH 3SQBA 3WXWH 2VXVH 1NQBA 4CC4C 1X7SA 4P23B 1RMFL 3B4NA 3WDHA 1E30A 2CRYA 2VUKA 4JZJC 2P48B 4NRXB 3QORA 1SJVA 2BVOA 3IRZA 1NSNL 3AS3A 3GHBL 3MV8D 4X5PA 3QHZL 2DIEA 3O2WH 1KNOB 4P2QD 4TLSA 4G6MH 4RH4A 3V0DA 5LJYH 3K4ZA 4KKBC 1EHAA 2UZXA 2J25A 3HI5L 2JQMA 2VW7A 4LASH 5AW4B 2WKOF 4Y19D 4YXKL 4HJJL 4ENEC 4PRIA 4YSAA 1S9WA 5HJBA 1JGEA 4NERA 3H9ZA 4ATTA 4QXGL 1C8QA 4W9CC 2FQGA 2PO6D 3O9WA 1RUPL 5FO9A 5J7CC 1EHKB 3A0OA 3TEXA 1U8IA 2X4UA 4XXDA 5LGJB 1MFEH 1T03H 3KPOA 3TO4D 2HPOA 2ZWNA 1INEL 5LHDA 3QEUB 1ZS8A 1TSRA 1MCKA 1WLHA 1XF4B 2MCAA 3KPTA 2W0LA 3Q8AA 4NZJA 2OZ4L 4KI5D 5AKTA 3P4MB 3MV9B 4F33B 5ILTL 1HXKA 1AJ7H 4MAZA 1XHHA 3KPLA 2UXVA 1BFTA 1IC0A 1AQKH 4MMZC 1RK1B 3NSXA 4HP5A 1KPRB 3NRFA 3VXQB 2VMCA 2V33A 1RSFA 4XMUA 1YMHA 5E8PB 3NFPA 2EAEA 3MLSL 2VLKE 5J1AB 3HBZA 4I5BA 4L4TA 1XGPB 3ZXAC 4XBPB 4IIQA 4KTYA 1U3HC 4OCXL 4QO1B 4G9DB 1N26A 3RVXD 5JPNC 2QJDA 1ZWIB 4X83A 1PYWA 2FX9H 2V7HA 2VN6A 3X12A 3MI6A 4NM8H 1KFGA 4TF4A 3QUMH 4BSVB 3D4GA 2D0HA 1FRGH 2TSBA 3N91A 5D1ZB 4OJCA 1DQML 3V0HA 2E0PA 3P9LA 5IOKA 1FCCA 1A14H 1Z5HA 5EBWA 1IC4L 1IFHH 2IBZX 4EPSA 4FCHA 4WVRA 3F04A 5BO1H 3IDIB 2F15A 3WUZA 4NI6A 5T3XD 3KPMA 5F0LB 5LO7A 2YQGA 3MCYA 2PPCA 3TJHC 1UEMA 2FL5B 3KDMB 3U9UB 5D7IB 2I60H 1FYTA 4WAFA 4OI8A 1IAOB 2R2HA 4BELD 4CSZA 1I7TB 1S7SB 1S8DA 2OZ4H 3D39B 4YEFA 2EXYD 4ODTH 1D7FA 2DMKA 2EEXA 5D2LF 2O93L 3CBKB 2WO4A 1T3FB 3E8UL 4WUUE 5FF6A 4Y5YA 1DLHB 4CKVX 2HYMA 3ZDZE 3GJFB 3KVQA 3RJOA 1KGJA 2MQ3A 3BUTA 3EJYC 1HYSC 5E8EA 2X4TB 1JWUA 4C83B 4NBXB 3DO4A 3L4ZA 1I1RA 3HB3B 2XXFA 1UZ6E 1NOFA 3GDCA 2C5DC 2VDQL 4AJVA 1M7IB 2K9FB 2BM3A 4N22A 4F9LC 1PSKL 8FABA 1V7ML 2IBGA 5C97A 5ICZA 3P30L 5IHZA 3ZDZB 1KEGL 3OAZH 4DEPB 1IUZA 1QI5A 4RX4D 1WZ1H 4M6NL 3CSGA 3G08B 5KJ4A 4WV1B 3FS9A 2VMDA 3MTRA 5CUSL 1ECYA 5DFVC 3L3JB 5DGQA 4AEEA 1VEPA 3J27A 3KXFA 5DD3L 3ZKNC 4ESKA 2AMGA 4KMTL 4Z1PA 4UOW1 3EZJB 3APNA 3FQUB 3TS8A 2EP6A 1SQMA 4G1MA 4FNQA 2DAVA 4MJJA 5C0DA 3MLRH 2JKJA 4TTGA 1E5AA 4L1DA 4TL4A 4J5VA 4GP5B 1HINL 4UZUA 2OJEA 1J7VR 1RY7B 5IB5A 3GIZL 1PX4A 2R4RL 3PGFL 4DO5A 1FAKT 2OP4H 2W88A 2WBWB 4IOSA 1GAFH 5C0BB 1XGQA 3PFQA 2ZWZA 4X0KB 2CIIB 4AVHA 2KPNA 1M3IA 5CGMA 2YQ3A 2NTFB 3AB0B 4GW5A 1MLCB 4P5TB 3SPVB 3RTQC 4JE0A 3TBYB 2EE6A 2EDMA 3CSYA 4XBPA 2FECI 2X4QA 1HE7A 5IJDC 3QRGL 1M4KA 1ULVA 4PS8A 4YHLH 4B5EA 3L4VA 4JKMA 1DR9A 5EOCJ 4P4RA 4F2MA 5JXEA 4ZD3L 5TFSL 3T0BA 5C0GB 2G60H 1QKZL 5FAAA 1Y6KR 2B14A 2F8OA 1N67A 2J8UB 4G8FB 3BC9A 2NW3A 2V4LA 4UM8A 5C9JA 5DSCB 2P44B 3FB6B 3MBWA 4XO4A 1CC3A 4RIRA 4QHNB 2YLHA 4AKPA 2AJXL 1IBGH 1X7TA 2DWDA 2ZCLL 1PZAA 2C4FU 3QUYB 3UTPE 4DW2H 2VWEC 4OCYL 5BRZE 1T21A 5H35A 1R3HA 4P06A 5EBMA 4UDTA 1IVLA 4IKIA 3RVTC 3VD1A 3AREC 1K2DA 5L4JA 2QEJA 3TV8A 4KNUA 4KI5F 4PCKA 1KGIA 5JORB 5AZUA 4X4YA 5AUMA 5I74B 4ZDHA 2JJUA 2NXYD 3ET9F 1OP3K 5KYUB 1OAKL 2BY3A 2EDNA 3BKCH 2YMOA 5EFIA 1T1YB 1JCKA 4OLVH 1H5BA 1UWGL 2E7CA 5DVLA 1E40A 2P8PB 5I1GL 5D7LD 5CEXB 1FPTH 1BD2A 4OZHE 2SEBA 1P7KB 3UAJD 3AWEA 2YXWA 5H37G 4H20H 4KJYB 3ULUD 1WWCA 1GTNA 1I7TA 5D71L 5EORL 3WNKA 3OMAB 5GS1A 2VR3A 3LXBA 2XWTB 4G6AD 4MZIA 2ZYRA 5CIPH 1KTDB 1ZPLA 3GMRB 3Q44A 3T0VA 1MQKL 6CGTA 2QQNL 2ZUXA 4W6YB 1VB9A 5ID1A 3M1CA 1TZHA 2OL3L 2O6FA 5HHNA 2CLVB 1QFUL 1KPVB 4J8RA 4MTMA 4ZFOA 4FEIA 3L5WA 3WUWB 2O6CA 2V17L 2VDLH 4O4YH 5T5NG 4E41D 3DKHA 3M86A 1TPXB 2WIIB 4P3WA 1HL4A 4HJGB 3VCLB 1ZVYA 15C8L 1IBBA 1OOAA 2BZDA 5DK0B 2OI9B 3FNKA 3FSAA 3NEOA 1HTYA 4MDRA 4LRIA 5I2IB 1CYXA 1DE4B 2FDBP 3AB0C 3FAWA 5I82A 5IROC 2CJSA 1H8NA 5CGBA 1KIRA 4G8GE 1AR1D 5EUKA 1E3XA 1IQDB 1E5YA 1D6VH 1XGRB 2R69L 3BWAA 2UWEA 3FTGA 3LYRA 4X99B 3BW9B 3UYPA 5I1EH 3PRZA 1P9MC 2JJVA 3CFJA 4R0LA 4KVNL 3NIFE 3RVVC 4AW7A 3QI9B 3ALWA 5J13B 1F11A 4WV1A 4F15B 4GAJL 1LD9A 1YC7A 4RAHA 1AIFB 1WBYB 1QEWA 2WP3O 3GZPA 2OTWA 2DWXA 1J8KA 4J28A 2NY2D 4DFHA 1SXZA 5FDWB 5EC2B 1QUNA 4LLDB 5LN4A 2ZXAA 3MRFB 3B5HA 1E42A 3NSCA 2ICWJ 4F7CA 2I5YL 5IREA 3V0VB 4FZ8H 1C7SA 2JB6A 2X12A 2J6EL 1P0SE 3EYOA 3DIFB 4YHPA 5FOBA 3TEYA 3NCYP 3IMTA 5DJYB 4NJ9L 3WY1A 3QUYD 3KBEA 4G9FD 4BK4A 1IAKB 2Y36L 2WYZA 4M1GH 4GG6B 1J1OH 5GGUB 3MRGB 5F9WC 4EDWH 4OCRH 1U3HA 5DR5L 3DV6B 2G0KA 1MXGA 2VH5L 1L5GB 3O2WL 1MLCA 1TQVA 3P4NA 4OV6F 4F9PA 1AANA 2IJ0C 3BP4A 5AVRB 2O5ZL 3CVDA 3FT4B 3K6FA 5ABAA 4XXWC 2CLRA 2CXGA 2F74B 3D09A 1LE9A 5C0IA 1EXGA 5EBMB 3L1OL 4KKAD 5KSBB 1F4HA 1O7SA 4WFFD 3T3PB 2CK0H 3WLBA 3Q05A 4DGUA 1DVYA 1FVCB 1WAAF 2R0WL 2VE6A 5HHVH 4TNWK 1OAXH 5GZOD 4LARH 2NSMA 4C47A 4LBEA 3VFVA 3Q48A 1XGTA 4PV8A 2VXSH 4IIZA 1M05B 2WUBH 4EKXA 2AC0A 1JNNL 2QBWA 1BD2B 3FSZA 4IK6A 1WFJA 4ZQKB 4GUQA 2NY1B 3ZLQC 3FUDA 1S6NA 4AL8C 5AL0A 2OI9C 1XD0A 3PQYE 2P3YA 4HWNA 3HC3L 3QQDA 3WFEH 4WK0B 3TO2B 5BO1L 4BKLB 3ILQC 3IGLA 3CH1B 4KV5E 4XPHH 5ITBH 4K7PL 2G75A 2GSGA 4KFZC 3JZYA 4C56E 4I89A 4HUWA 3VXRB 1A3ZA 1KJ3H 1RI8A 2DMBA 1Z2KA 1Z7JA 2DZEA 3CHPA 3VFOA 1HYSD 4PGEB 4TUJB 2H6OA 4Z7UE 4TQ8A 3GB7B 3WFHB 1BZ9A 1NUNB 1CDGA 1M53A 3JV6A 4OLYH 3S96B 3VXNA 1FN4A 2DY2A 1EZLA 4KO7A 1KTDA 2DQUH 3BGFB 5C0CA 1AZNA 1J05B 1OPGL 1NCDH 1KACB 1T83C 3PU7A 2QR0A 4ANVA 3UO1H 4UT9A 1ND0B 2V7NB 2MRYA 4FFWD 2CJ3A 2VM9A 3PWUA 2NCMA 2BSED 1P4BL 3INUH 3NJHA 4P4KD 4AM0Q 2UWEB 3FTGB 1ZTMA 4MB3A 3T2PA 4IKLA 1EXUB 3B9KB 4JFSA 1UT1A 4NHCL 1MEXH 1OAZH 4PJ8B 1MCWM 1AGCB 5LB1A 2H6UA 3WEXB 2X4SA 1JOIA 1T20B 2M2DA 4XWGL 5DJZA 3TT3H 2R9HC 5EV7A 1KFAL 4UYQA 2P9RA 5DUJA 3QAZB 3BN9C 5IMMB 2SODB 1N4XH 3UCRA 3MV7B 3C9NA 2F7RA 4OV5B 5KUMA 3MRFA 3AS1A 1AQKL 4JZOA 1FL6B 5FF6B 3M17B 2N3JA 5SWQB 1KB3A 3B2XA 4IU3B 5EEVA 3KGRA 2YWZA 4D0BB 4HWZA 5EDSA 3V5KA 2LU5A 4ZO8A 3VX1A 1KN2H 2OCFD 3T3PF 5GS2H 1WBYA 2WVVB 1Z66A 1B6UA 1K8IB 2P5WD 3Q9QA 4KHTH 4LP8A 4PY8J 4ZUVB 2HPTA 3GUFA 3DBSA 2UY6B 4PD4J 2H32B 4YPGB 5IVOA 4PRBA 3MBEA 4JJHA 5I0XA 2J55A 3MJ7A 3HKFA 1H6UA 1EJ6A 2A9DA 1FH5H 3K4DA 3QQ9C 3D18A 2Z3FA 4Y1AB 5HGAA 4X7CC 3UBXB 5JOFA 4NQDE 1PVHA 3B3IA 5DA0B 5IHLB 4W70A 5HHOA 4NSKA 1FGVH 1BLNA 3MLXH 4I85A 2VDQH 1B0GA 1BQRA 3UTSE 1UWXH 1FBIL 3GI8L 1SMAA 2N59A 4GMTH 4TUOA 5ALCH 4BCYA 4GO6B 3ALXA 1BREA 2OMYA 1N8ZB 3T6VA 1ZY9A 3MRMA 2Y6SC 3TXAA 5F3BB 2JLLA 4JHZA 1L3NA 3DX7B 2X4NB 4J3VA 1OGAE 4PJEF 3ZZSA 2Z8SA 3RUGE 3I74A 4ORGA 1YPZA 1BMGA 2EE9A 5I71B 4MAUH 2D4DA 2Y06L 2I9LB 4WEMB 5DS1A 4NKQB 4ZUSB 3KCPB 1U95A 2Q3XA 3B34A 3JTBA 1HNYA 4WW2B 3V8CA 1S7TB 1MCNA 2PYEE 3LIZH 2ICWA 3MJ6A 4AVIA 5E03A 2JXMA 4J1UB 5TE6H 3QBTB 4JLRA 3HR6A 3VXUE 1GGUA 4JJ5A 3GTVA 3NIFF 3F85A 5E2UL 2DQGH 2DWEA 1RU9H 2NXZD 2UZIH 3KHOA 1A4AA 1BXXA 1O6SB 2XN0A 3QJQB 1RZ8B 1WTGT 4NGHL 4DF9A 2BIHA 4TQIA 3U25A 3IE9A 3IFOA 3MRJA 3LKRB 4P2RD 3SGKA 5JUEL 4G43A 2W0FA 5CLWA 1U58B 1FZOB 3U83A 2OXHA 2WLKA 4YFDB 3AREB 5H35B 2X87A 4IDLA 2CAKA 3BLPX 4AMWA 4YHYC 2AF2A 1OANA 2F68X 1C12B 3MJGX 3NPZB 4LEOA 1JNHB 1ACXA 3BD5A 1FGVL 3MLXL 3QEHA 3VXOB 1J5CA 3T09A 3OKDA 2P24A 4XCCH 5T1KD 5DHMC 1E4XL 4G80B 1FLTX 4HU8A 3LOWA 4FC3E 3HG1D 5DJDB 3GXMA 5E6IC 2VLRA 4XHJD 2VXTL 5JIKA 2JCCF 4FP8L 2AW2A 1OE1A 1CFQB 1AJ7L 4JMXA 3G6AB 1NFDE 1L9QA 3VXME 4KV5F 5I1CH 1CGSH 1FPTL 1QATA 2BHYA 1XTLA 4Q4IA 5IFJB 3SDAA 3WJMA 1J8HE 2AJ3B 2M1KA 2CA4A 3ES6B 3RTQD 5IV2A 1I82A 4L2LA 4PJ8A 2DW5A 4PRIB 1QSVA 2GHZA 3DPBB 3ZHNA 4NO0A 5D2NB 1E7UA 2AK4B 1FG2B 3OGCA 4I48B 4JDTL 3C08L 5DZAA 1DBKL 3VG0L 3LNGA 4AQ8C 3SE3C 1GYCA 4Z95H 2ZXEB 2VXUH 3HHSB 2XZAH 2EYTB 1I1FA 3OD3A 4U2YA 3CTTA 1HXMA 1I1AA 4KDTC 1B0WA 3GLZA 2HRGA 2P42B 4YC2B 5KANG 1GZHC 5GJTH 4H8QA 4P3DB 4OIBA 5MHSD 2OTUA 1BFVL 3KPLB 5LQBL 2AEOA 4DT2A 1IJNA 4XPAL 5DD1L 4S0TD 3GBNL 2YHGA 4JM0A 4KBPA 3RFZA 4Z3GA 3C75A 3LV3A 5AQ0A 2GI7A 1M7IA 4PGZA 3L17A 4Z7UF 2EIKB 1T1WA 1F02I 5J1AA 1R5WA 4UQBA 5KG9A 3JWOH 2PXYB 1YYMH 5MEND 2XUWA 3O6LH 5CSBA 5EO0B 2QL1A 3NDYE 4G3YL 3MV7D 3KXFB 2Q86B 3Q6GL 3SDDD 1QBMH 2OMYB 3WMSA 1N7ML 4UTAA 3KCPA 3Q7JA 4UTBH 3HG1A 1ZV2A 1ZHLB 2XWJA 2VL4A 3IDMA 5ANHA 2J8UF 1B0IA 3MRCA 4K0OA 3X12B 4D8OA 3APFA 1KT2B 3T8MA 1VZHA 4M5SA 4NO5A 2Q76B 1J48A 4HALA 4M62L 4NHUA 1KGWA 4M9PA 2P8LB 3N42B 3DV6A 1DDTA 5FW8A 1A2YA 5D6CB 4P5RA 1N3NB 2JCCB 2X88A 4G43B 4LF3B 2EDYA 1DJSA 1V7MH 3RVWD 4G82A 4QOKB 4YLBA 3GLEA 4TQHA 1YA5A 1HKLL 3O3DB 5J6GA 1DO5A 2D31A 4NUGH 2DBLH 4Y2NA 1VPOH 2ZX8A 3S34L 2DQUL 2ATAA 5FYJH 3MROA 4Y4HD 2K1MA 3O4LB 5LNGA 3DHPA 5F3HA 5IY5B 2E4TA 3NRPA 4POZC 1KY6A 3MYZA 1TQCB 4PMEA 1MJ7H 4HGWB 3UGEA 4RFOL 4CADB 1SOKA 3MJ9L 4MD5B 4D8PA 2ZF8A 2NXYC 5BXFB 4GNKB 1JDDA 3O6LL 3E6FA 4I0KA 5K1JA 4PJIA 2BK8A 4F1ZA 1TKWB 1AE6L 1BOYA 2QGCA 4PM1A 3ZRSA 1QUPA 3V10A 2J3SA 3FHQA 1TVBA 2GEEA 5CU5A 1FFOA 3C09C 4CRPA 3VACA 2CKBL 3WV0A 2OR9L 3BVTA 2RD0A 5IW3A 1DVQA 5A2JH 2DQDH 2TSAA 2WLMA 3AQXA 4PP2A 3K6IA 2IPKB 4OZIE 1INDL 3JV4B 4I1NB 4HKXB 4TOYL 3ZDWA 4L8SA 1WJ3A 4KK5C 3T65B 5TH2A 2JLPA 1HHIA 2XZZA 4XVTH 4I87A 5FWQA 4CN1A 4E42B 1OCZB 4KI5C 4MMYA 4LSTH 3X2QB 1DO6A 2VDNL 4LQ1A 2LHAA 2IDTA 4LRIC 4OLYL 4P5TD 1MIEH 5I0YA 3W11D 3W38A 3V4VH 1K4DA 2C9RA 4X98A 2ZZUT 2WWMC 4BQCA 1S7VA 1E6OH 1VDGA 5HHQB 4F5CE 4MJIE 3QXUA 4XBGA 1ILSA 1I1FB 1WD8A 2VRAA 4ZUWB 1AS7A 4ZFGH 4A7TA 5TQ0L 4OZIB 1A7QH 1NAKL 2VC2L 2B1AH 3TBCA 1JZGA 1L9NA 4FHKA 5CAYB 1TJGL 3CVBA 1DBAH 2PW1B 1KTLA 3UACA 4AV4A 1SY6A 1XD1A 5IFAL 1WFUA 5C7ZA 5I1DB 4BKSC 3OZ9H 2NY2C 4WIQA 5FYLH 1JHTB 3CFCH 3GIVB 3GTTA 1G6RB 4G5AA 3FB8A 5KBNC 2AKRA 3L3OB 5EUOA 4D0DA 3K80A 5IQLA 1L6XA 4WK4B 5IB1A 3MR9A 3TIDA 4MJ6B 1H3GA 2P5PA 5GGTH 2X0WA 3MRRB 3UTQA 3F05A 2O5YH 3KPRE 5D70L 1M7DB 1UD8A 4X80L 5EHFA 4MQ7B 5DHVH 5HDRA 4JPVL 5GZND 3CLWA 3LQZA 4YDJA 1K2DB 3U36A 1LTXA 2IMMA 4GI9A 3QDJA 4Z3TA 5I6OA 4TTDC 5SWZA 2ZAIA 3LKOB 4YSSA 5EO1B 3S3CB 2UVFA 3L3HA 5GJSH 4FXGC 4L4JA 3JVGA 1X5HA 4TVPL 3JUZA 4AQAB 4U1JB 5F7DA 3W82A 5ISZA 3NDZE 3HI5H 5HI3D 5AOMA 5EF0A 2FEEI 4B6ZA 2AXJA 2BHUA 2XI9A 3BMWA 4LCIH 4FFZA 4WGWB 1OTUD 2A74B 3D4ZA 3L08A 4NN6C 4AITA 2A77L 3TVMB 3UJJL 1FZMB 1A6PA 3JV0A 4GG8A 3BKML 4LPYA 2X41A 5D6CA 1CDCA 4JFFA 4DK3A 4RESB 4LLQB 3S6CA 4KNTA 5MERA 1Q9LB 1QI4A 3T2NL 2WUBL 4XNMA 3MRDB 3VNYA 3HB3C 4P9HL 5D93B 3CN0A 2VQ1A 5T5NF 4DP6X 1LO5A 4Z3HA 2OL3A 5EOQH 5C3TA 5FO7A 4U4IA 3FUJA 4WW2C 3LZPA 2F58H 1KFAH 5MENE 4Y19E 4EXPX 2H32H 2TRYA 3AAZB 3A4AA 3CSBA 2CZNA 3T2QA 1QBLH 4MDJA 3VFVB 3WBDA 3QFJA 3IMWA 5TFSH 4ZD3H 5J6HA 2VABB 5BRQA 5C1MB 3ZDXE 5BO0D 1I8MB 4KC3B 4ZAKB 1DZBA 5FO8B 1P1VA 5EZOH 1F1DA 4J8RB 4ZFOB 4A2GA 2F8VA 3WEBA 4P2QB 4XP5H 3FU7A 4DGYH 4X80H 4MD4A 3QYNA 2ZNWA 4EQ3A 2BDNL 4TNGA 1NCAH 2LU7A 1Z9NA 3MXVL 4LB8A 1R17A 1WUNT 2D8KA 3JV5A 4N2NA 1DE4A 2DWTA 4UINL 1OCOB 3U4EA 1IEBA 4I0PC 1WIUA 5F7EH 1HE8A 4YXHL 3TIEA 3II1A 3DWTA 4OZGF 1ICTA 1CL7H 5D7SH 1GPOL 5I9QC 2WUCH 5C2UB 1NLDH 3BT2H 4NO3A 2PN5A 1JAEA 2DJUA 1SM3L 2PR4L 4NNYB 4HC1H 3SDXA 5IG7A 3FDWA 4PSPA 3R4RA 1NAMH 4BSJA 4R2GC 1MQ8A 5C0AA 3H42L 4KX7A 5LQBH 5LGKA 1MJ8H 1ETJA 2I7SA 4Y4HA 5C0JA 3P0VL 1RVFL 3B7YA 3QJFB 3U7WH 4JFFD 4NUPA 1WA1X 4QRTA 4TNFA 5CCKH 3ZDZF 5I1DA 1AGCA 4KOCA 2DTML 3D2UB 2IGFL 3VNZA 4HOMA 2DL2A 2EYRA 2LLNA 3WLBB 5MP6L 4JRYE 5IEKA 4KKBD 1KSRA 3HCVA 1QO3A 3NZ8A 5GRJL 3U7WL 1CLOL 5HBBA 3EADA 6FABL 4HD5A 3O3EB 2YN5A 2OSLB 5D1XE 4UNVA 4NUJB 3AS0A 1RZIA 4U1GC 4J6IA 3GPEA 1WBZB 4QRPD 1IMHC 4FYRA 2A83A 3VRLE 4L5FE 1G6RH 3T0EB 3UZVB 3VG9C 4EI5A 5BW7C 5IKCB 3MBXH 4AJWA 1USQA 4HIJB 2X0VA 4K7PY 1U8CB 5C0BA 3NJXA 3PUUA 2E4FA 4OW6A 1BV8A 2FLBT 4U1JA 5F7DB 5D1XB 3RY6C 3WXVH 1IM9A 4UYPA 4WI9A 5ERWB 4DSYA 5DFAA 5KSVB 5DTFA 1NL0L 1TVHB 3DX4A 2XX1A 4Y4KA 1Q9LA 2ZXDA 1OGTA 2Z8VC 1UKTA 2BSSA 1X5KA 5GGTA 1NGPL 1Q8MA 2RIKA 3EGXB 3L9BA 2DS4A 2P8MA 3FCSA 3TH2T 5DMKB 5GZOC 3VH8B 4HC1L 3ZHFA 1N5YL 5D7LA 1E9QA 2G75B 2GSGB 4NZRH 2DYPA 1BF8A 4PJFE 5DMGD 4G8IB 3AJ7A 2V9TA 3MGOA 4UIMB 5CZXC 3SE9H 4AUJA 3PUCA 3NJNA 5E2WL 5JO5B 3W39B 2BS9A 1BXAA 3HZKB 4KKLC 1CFBA 4YDZA 1RP9A 2XETA 4XNBA 4YOKA 4GAYB 3NVQA 2ERJC 4UBDD 1KBKA 3CVHH 3MAWA 2XVKA 4N68A 5FGCE 2A6JB 1IFGA 4KROC 4JO5A 1MCQA 4J2QA 2GUOB 1MCEA 4QHUA 5GRWA 4YXLH 1BZQK 3PIQB 1J1PH 3EDJA 4L4VB 1D5XB 3NN8B 3HS9A 4M5TA 5DO8A 1P7KA 4GSDH 3V0JA 4ZI8A 4LKCB 4LSUL 1XTMA 2K4WA 2ZXCA 4HS6A 3NSFA 1ZTXE 5EU6E 1CGXA 3NCMA 3O2DL 4XOBA 2A2QT 5DYOB 4UILL 2PCFA 3REVA 4XVTL 1A4JB 3LKSA 5EN3A 2VLMD 4WNQB 1DP0A 1DFXA 3N41F 2Y1ZA 1T6VN 1HSAB 1MUJB 2VLLB 3AMKA 2XQBL 3E9TA 1HL5A 3VI3B 4CSPA 4JUTA 5D5MF 1CLYH 3X14A 2AQ3A 5BS0D 4GQPH 5C7XL 3RG1C 4X6FA 2YUVA 3ZR5A 2YEZA 1CDIA 1UWXK 3NT0A 4M61A 2YAPA 12E8L 5B1BB 3FQUA 3FKUS 3KEHA 3UOAB 3FC8A 1IM3B 4AXWA 5HDLA 3QXWA 4HJGA 3VCLA 2WXGA 1BIIB 2IG2L 2CPCA 2QSVA 5CUSH 4QRUA 4XPBH 2M26A 1M6OA 1FFOB 2YBGA 1KYOJ 3A6CL 4ZMZA 3FU8A 4N8VG 4RMWA 5DEGB 1VFAB 1OF2B 4WNJA 3HBQA 4DVRL 4QRRE 4ECNA 1HESA 5JHDA 3DSNB 1Z9PA 5GS2D 3LQAL 4NRYB 4FJZA 4AIEA 3RP1A 3UAEA 2X4NA 1PBYA 1NGWA 4F7PB 4N90E 2IWGA 4Q89A 5JDSB 3VGAB 4JL1A 3H1ZA 3KLQA 3BUBA 3PXHA 2J4WH 4EBQH 3S3BB 4QAMB 3ZDXF 3HHRB 1SLVA 2X89D 2JE8A 1CT8B 5FUOL 2V8MA 2F53A 3RZCB 2X6MA 2OJ1A 4AT6B 2Q8BH 4EI5C 3AG1B 3LPPA 5AWNL 1U92A 4U1SB 4KPHL 2Y1YA 4KROB 3KR3H 1WS8A 5BOPA 4WY7L 1F3DH 1G4MA 5HHMB 3KWUA 3B2UC 2EH7H 4YVNA 4CDHA 8PAZA 1U8CA 1F6AB 4XN7A 4OGYH 4PJCB 4NM8L 4QJ5B 3BGFC 3EO1A 2PYFA 1WZKA 1DL7L 3FUKA 5EU6B 1MFAH 3CHQA 3PCYA 4KZCA 1A6UL 2P5WA 5KAQF 1XGPA 4CGUB 4DKFH 1EEZA 3WS3A 5JDJA 5DQJA 3CMOH 2FR4B 1ZVSB 1OAUH 3LQZB 1FL5A 4YDJB 5KYYB 3VFMA 2BZ7A 3L5XH 4H5SA 4TSCL 3V6BR 1SN0A 3H0TA 1KBWA 1ZT1A 2W9DH 3GLDA 3QEHB 5I30H 2AK1H 5CCGE 2MTAA 3O6FB 1IGCL 4Z7WF 3V4VB 1IV8A 1REIA 1MI5D 3GO1L 5ICYA 3LHAA 1HN1A 4Z5RA 2HP4A 3CHXA 3HZKA 3ULUE 4JRYD 5E56A 3TVMC 4H26B 1T4WA 4HISA 3ZTNL 1HSBB 4FA7B 3CXHJ 3HPJB 1W8NA 4ZBJA 5BV7C 4NCC2 2DICA 3ATDA 4CMHC 3N1FC 4N8UA 3HG5A 4I0PA 4UDUA 3HFFA 1FGNL 5HI3C 2BIPA 3E7JA 4FQHA 3LQAC 3QZOA 2BOLA 1FZJB 3QXTA 1PKQB 5IOPA 5BMFH 1AXSB 3RVUC 1LILA 5EA0H 1IAIH 3ISWA 4NS0A 1XDTT 4X6FB 4XO5A 1D9KA 3TNNB 4URKA 1X7QA 4JDEA 3C6LA 1AGFB 3OAYH 3EJZC 2LU3A 5IM7A 4I0CC 2BXYA 3VWJC 1YEDB 1NUGA 3OPUA 3RURA 1C1EL 4CBPA 1K5NA 4W9GC 3RZCC 2CSPA 4RMVA 4XVSH 3WTWA 1H3PL 5F1KC 1NCJA 3EJSA 1CG9B 1JDAA 1RUAH 4OZFA 1MHEA 4ZMVA 4UAOC 2OXGB 1G7HA 5I8OH 5E9NA 2CR6A 5GGRB 1LXMA 4JFHE 2NNAB 1JWMB 1OQXA 1R6VA 3CXDH 5DJZB 1FP5A 2VDRH 2C3XA 1MCSA 4Z7OF 2G5BB 1UEYA 4NKMA 3S5LB 4Y2DC 5GJSL 4Y4KC 3WHXB 1EAJA 1GYVA 4IBWA 4A39A 4Z8FH 1GCFA 1A7PL 4IEFB 3DO3A 2DWSA 2QSCL 3JYBA 3PWVB 2XTJB 5C92A 3FT4A 4BJLA 4GW1B 1I9JL 3AM8A 1MY5A 5KS9E 4U1SA 4OLUL 1J9TA 1CGUA 1BQHB