4NERA

Multicopper oxidase cueo (data1)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Blue copper oxidase CueO
publication title New insights into the catalytic active-site structure of multicopper oxidases
doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 136
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2013-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4nerA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4nerA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4nerA03
8PAZA 2EINB 3KW7A 2GB2A 3FS9A 4UF7C 1NZRA 2UX6A 2XYBA 4DP1X 1R1CA 1EHKB 2YAOA 3BVDB 3C75A 4YSQA 5TK2A 5AZUA 3IBOA 3UADA 1I53A 3GXUB 4KO6A 1A4BA 2X88A 1NTDA 1GW0A 3PXLA 1OE2A 5B3SB 1KBWA 3FQYA 1ZV2A 1KDIA 1ASPA 1AZCA 3NJFA 2YARA 1MZZA 2LLNA 2YAMA 7PCYA 1OE1A 3WNJA 3HB3B 2VSKB 2CAKA 3H56A 2FQEA 3FU7A 3IE9A 1HAWA 4NERA 4G71B 2CJ3A 4DPCX 1AS7A 2Y69B 1PZCA 1A3ZA 1JVLA 1OCOB 1N70A 3CVCA 3FSZA 2E86A 1BXUA 4BK5C 3TU6A 2IAAC 1AACA 2CBPA 1ILSA 2XLLA 2BO0A 1AOZA 1NIBA 2OV0A 1M9WA 1WS7A 1B3IA 5B1BB 3TA4D 4DP9X 1XB6A 2HLEB 2XWZA 3FSAA 3EH5B 1N68A 2FT7A 3WKPA 3RYMA 3AG2B 3D12B 4G7QB 4GP5B 1GS8A 4QKTA 3X1FA 1BQ5A 1YLBB 3SBPA 4HCIA 1BXVA 1JZJA 4CSPA 3TBCA 5IY5B 2DWTA 1BEXA 1AANA 2VSMB 3UAAA 4FAAB 3QJUB 3TASA 4DP5X 2XUWA 1AAJA 3JTBA 4PCYA 3NJJA 2BP8A 1NWOA 2HX7A 3G5WA 1NINA 4YSCA 1AG6A 1FFTB 2GBAA 4DPAX 4KNSA 7PAZA 1ADWA 2FQDA 1NIDA 4HHWA 3QJQB 3NJIA 1E5ZA 2HZHA 3X2QB 4GXFA 1KBVA 2YAEA 1L9OA 1ET7A 1URIA 2YAFA 2XVBA 3CVBA 4KO5A 1TKWA 4W1TA 1L9TA 2EILB 1WAEA 3EH4B 3SBQA 3FPYA 3FQ2A 1KCBA 5B7EA 3PCYA 2DYRB 1TEGA 1WA2X 1AS8A 3QJVB 2WO2B 4BDVB 1XB3A 1E65A 3NJKA 2J56A 5I6KA 2PCFA 3FSWA 1OCCB 4DP0X 1SFHA 2DV6A 1SHXA 2AANA 2TSAA 2H47C 1NDTA 1QLEB 2Q5BA 4W9ZA 3NJHA 3FYEB 1SNRA 3IEAA 1KV7A 2ZXWB 1SHWA 2J57A 1AG0A 1NIAA 3AY2A 1V10A 4HALA 3QJTB 4E9YA 2I85A 5ANHA 2CUAA 5AFAA 2BWIA 4YSAA 1L9RA 2QPDB 1VLXA 4AKQA 4HHGA 3GDCA 3NSYA 1IBYA 1ZIAA 2PP7A 4HAKA 4GY4A 2VN3A 2PPFA 2H3XC 1L9PA 4HIPA 4YSUA 2UXGA 1PNDA 4GP8B 1NPJA 3UAEA 1GSKA 2B08A 3CDZB 2AFNA 2P80A 3BQVA 1CC3A 2UX7A 1JXFA 3ZDWA 2YAPA 3WIAA 6PCYA 1W6LA 2X87A 1GS6X 2AZUA 3FU8A 1ETJA 2XXFA 1CUOA 1A65A 1EZLA 3NJNA 1TEFA 4BWUA 2Q9OA 1ASQA 3DIVA 9PCYA 5I6OA 3AG1B 1BQKA 1RZQA 4E9WA 2UXFA 3UACA 2BW4A 1SDDB 4YSOA 1J9RA 2I7SA 2JFCA 2WO3B 3S3CB 1BXAA 3H4FA 1RCYA 4G72B 3AW5A 1UATA 2HXAA 3X1GA 3DKHA 4NB7A 2MTAA 1PLAA 5FC9A 3MX0B 3S8FB 2PP9A 1OF0A 4P5RA 2XV0A 1PLBA 2N0MA 1A4AA 2IWFA 3ZIYA 1WA0X 1ILUA 2IDUA 2QDVA 3WI9A 3U25A 5F7BA 1J9SA 3PAZA 4YSRA 1GY2A 2GC4C 3FT0A 4A2DA 2A3TA 1AZUA 3PAVA 5B1AB 4KNTA 3JT2A 1PAZA 2WSDA 4DP7X 1AR1B 1ZDSA 1JZEA 3NSCA 3T6XA 1AZRA 3UABA 2XX0A 4E9RA 5I28A 1XMEB 3NJMA 2QPEB 4YSSA 1A8ZA 4N4YB 5B7MA 3NSDA 4BDVA 2CALA 2UXTA 5B1KA 2NRDA 5I5JA 2XXGA 2PPAA 4X4KA 1T5KA 1JOIA 2VM4A 2FJSA 2ZOOA 2FWLB 2IDSA 1W8EA 4AX3A 4YSTA 1JXDA 3V9EA 5LDUA 3ABGA 1NIEA 1CYXA 4PAZA 4KOBA 3N2JA 4N8UA 4QLWA 1RKRA 4DP6X 4E9TA 2EIKB 2MRYA 2H5UA 3EF4A 4P5SA 3T6ZA 3PLYA 2QDWA 2YAHA 1IUZA 3NP3A 3QJSB 2XV2A 2PPDA 2VMJA 3FQ1A 1JERA 4YSPA 2PPCA 1IKOP 4JHVA 1RZPA 1TU2A 2IDFA 3CDZA 4AZUA 1BQRA 2BP0B 1OCRB 1L9QA 1ZPUA 2DYSB 1FA4A 1PY0A 1CURA 2ZONA 2IH8A 5TK4A 2GC7C 1MDAA 1KYAA 4Q8BA 1J9QA 5E9NA 3QQXA 5I5MA 4MFHA 1JZGA 2PPEA 1AIZA 4M4RB 4E9QA 1SJMA 4YSDA 4A2EA 2J55A 3OQRA 1F56A 1E5YA 5B1JC 4HCGA 1BYPA 2PCYA 1HFUA 4DPBX 1SDDA 2PP8A 4KOCA 1MG3C 2YXWA 5D4IA 2VM3A 4A67A 4UAHA 3CZUB 5B7FA 2FNWA 1M56B 2BWDA 2IDQA 1KGYE 3FYIB 2OJ1A 2HRHA 1V54B 3ABKB 3WG7B 1HAUA 2XX1A 1JZFA 4BWTA 1OCZB 3DTUB 3FSVA 3OM3B 4GYBA 2P80D 4KO7A 1M57B 2R7EB 3S3BB 4NAJA 3X1EA 2W88A 3ZX1A 1NICA 2CCWA 1MG2C 3SBRA 4WKXA 1L9SA 1GY1A 1GS7A 2BZ7A 3WKQA 5F7AA 3NSFA 5D4HA 4E9VA 4TXVB 1WA1X 5B1JA 5AKRA 1BAWA 5I6NA 4BXSV 3T6VA 3IN0A 3T6WA 1PMYA 1SF3A 2YAQA 1X9UA 5PCYA 4YL4A 3OMNB 1PZAA 1GR7A 3NT0A 3PPSA 3N55A 1KDJA 2W8CA 2YQBA 2IH9A 3PAUA 1JXGA 4G7RB 1AQ8A 1J5DA 5I6PA 4DP4X 3IN2A 4E9XA 2JKWA 3X1BA 3EHBB 1AZNA 1OE3A 3CG8A 4A68A 4DP8X 2GHZA 2HRGA 1OOWA 3EH3B 2RACA 2VW4A 1GYCA 4CSZA 2HX9A 2GI0A 4E9SA 3ASOB 4G70B 2QT6A 2FTAA 4BWWA 1J5CA 3ABLB 3NJLA 3WNIA 1ZDQA 3L45A 3H4HA 2AZAA 3AZUA 4FA7B 5I26A 2PLTA 2I7OA 1BYOA 2J5WA 3FU7B 3OD3A 4G7SB 1A4CA 1J9TA 2BW5A 1CYWA 4BXVA 3T9WA 1SF5A 1PF3A 2XU9A 4AKPA 1JVOA 1DZ0A 2DWSA 2UXVA 5EHFA 2Y1AA 3S8GB 1IBZA 3X1NA 3TBBA 2BP0A 4JHUA 1QNIA 4GP4B 1NPNA 4Q89A 5I6LA 4F7KA 1X9RA 3KW8A 1NWPA 1V55B 1NIFA 2VW7A 2AVFA 1MZYA 3V9CA 2BZCA 3CVDA 4AI7A 1DYZA 1SFDA 3QPKA 1AZBA 2ZWNA 1E67A 3NJGA 1PCSA 4ENZA 4RH4A 3HEIB 4A66A 2IWEA 2VW6A 1KCWA 2FQGA 3FU9A 4HCFA 2YXVA 3ERXA 4YVUA 3NP4A 3OMAB 1ET5A 2GSMB 4YSEA 3QJRB 5PAZA 4KO9A 2IWKA 5I6MA 4HZ1A 2FT8A 1XB8A 2BHFA 2FT6A 1W6WA 2BP8B 2TSBA 5D4JA 1ZIBA 3T71A 4A2FA 2JXMA 3OMIB 2FQFA 2OCCB 2EIJB 1PZBA 3ZBMA 4F2FA 4AKOA 4YVNA 1JZHA 1WS8A 3AG3B 4EF3A 4M3HA 1AS6A 3FPXA 5I5IA 1QHQA 2EIMB 4F2EA 1IC0A 3ABMB 4A2HA 2XV3A 2HX8A 2B3IA 3ASNB 4A2GA 6PAZA 2R7EA 3NYKA 3UGEA 1ET8A 4JKNA 4KNUA 4UANA 3SQRA 1E30A 3AG4B 4WTQA 5A7EA 3MBWB 4K9JA 2DY2A 4ZK8A 1PNCA 1ASOA 1ID2A 2IDTA 4L0PB 3S3DB 1JZIA 3GYRA 1PLCA 1OV8A 4DP2X 1FWXA 2GIMA
chains in the Genus database with same CATH superfamily
5FYKD 2ORBL 4P9MH 4X50A 4XBPB 1M2VA 4PRIE 4LGRB 1AHMA 1M6OA 1I3GL 3DETC 1WD8A 5DMKB 3K72B 2NY4C 4MNQB 1H6UA 4G3YH 5EMYA 1FNSL 1N6VA 3NCXA 4Q6IB 4YSQA 5TK2A 4WW2C 1AO7A 4MAYC 4Y1AB 3SPIA 3BVXA 1ZCRA 5CINL 3U6RB 1KG0A 5FKAB 3CIQA 3Q5TA 4X4XB 3UPCA 4WW2F 4APXA 2DIBA 1AXTH 2VXSH 4L2YA 3FFCD 1K8IB 5MEPA 1MZZA 3NCEB 4LF3A 3RWGA 2YAMA 2F8IA 3WNJA 2DICA 4XP5H 3I9GL 3E1F1 3HB3B 3WFEH 3FU7A 2ADYA 2GUOB 2XJLA 3RWHA 5CR8A 5DEZA 2EVHA 4TUJB 4X4MA 3P11H 5TE7L 1GYWA 1N70A 5EUKA 3ZDZB 3FSZA 4P57A 1YEJL 4YHYB 4EUPA 1OARH 3MPCA 3H0TB 3TONA 1PEWA 1KPVB 4OFVA 2GG1A 3ARFD 5GIRA 2R0LH 4AMKH 2IAAC 4NXKA 3QZLA 2XLLA 4P23D 3L7FA 4ISVB 1AOZA 4L05A 1TTRA 1HK6A 1A02N 4APQA 3WFDL 3TA4D 4DP9X 1XB6A 3L9BA 4I0PC 3REVA 2WVVB 4QUOA 3JWDC 3EOBB 3CLFH 3QRBA 4PJGB 2ARWA 3CC5A 3D8MA 4L1TA 1DLFH 1YUKB 2ZOKA 4AENB 3RNKB 1ZAGA 2VQ1B 3X1FA 4F91B 3CAFA 4XNQA 3TCLA 5TH2B 1AR2A 2GK0B 3K2KA 1T2QH 2WQ8A 5MI0B 2XPGB 5C6PB 2LVCA 4DP5X 2NLJA 4KC3B 3PREA 4ILDA 4I9WD 5SX4I 1EMTH 1MHPH 3EYQD 4NQDE 4XZUB 3W2DH 1KGXA 3O8XB 2FLBT 1PX4A 1NBQA 4U6TA 1A1OB 1JPTL 1RIHL 1XGPA 1BLNA 1L0XA 1YDPB 5D8JH 3VI4B 1IE4A 1Y6NR 2HZHA 2P8MA 4WRLA 2YOAA 2H2SD 3BCDA 5E6UB 1FL3B 4FJ6A 1JRHI 3EDDA 4WI0A 5FM8A 3NTCL 3VRLF 35C8H 3E2HC 4M5TA 1UD5A 5IB4A 5EWIH 2EILB 1GOHA 3FTVA 4LKXB 4B9ZA 5DD5L 5L88L 2BSBA 3ZE1F 3RUGB 2FL5A 2Q0ZX 4ZW7A 2DYRB 2I9LB 3BRGC 1XF2A 1VGKB 3K2IA 3MLPA 1FJ1B 1XXDC 4QRRE 1XEDA 5F7DA 4JM4L 5I1EH 2WLLA 2ZAGA 4WKZA 5TGBB 1SFHA 2NY1D 3KJ6H 5CZXC 4ONGH 4K4KA 4R7DA 1NAKH 1BQHB 4IQHA 3GS7A 3WLBB 1N2RB 5JORA 3HBZA 2X4QA 3KPSD 3LAFA 1A4KA 3ILPB 2CA3A 2Y1ZA 1QHOA 4OCSL 1R5IB 4F8NA 1LO4L 2XNAB 4N0FB 4E9YA 5L2KB 3OSVA 4PJ9B 4JFFE 4XO9A 1MFAL 1XH3A 1T2JA 2ZYHA 3D69B 8CGTA 2WANA 4J2XA 4G5ZL 2QPDB 3O3AA 1DBJH 1QQDA 2PR4H 2QSCL 3GDCA 3HI1B 1TYJA 1HXKA 1WLHA 1L5GB 3UYRL 4CJ1A 4UM8B 2VN3A 4YXHL 3QHZL 5BCAA 4QF1B 3L1OH 4JQXA 3PP3H 1EIBA 1WVZA 3QZMA 4OIAA 4KKBC 4L1HA 4RDBA 1QD0A 3F6JA 3KXFB 2ZXCA 5EA0L 1I1YA 2BHZA 1JXFA 5JQ6H 3CZKA 1TTFA 3ATAA 4L1SA 3BQUC 3SCMD 3V7AG 1H8LA 4HMEA 1DUZB 2CG9X 1DVFC 1OT4A 4KROB 4M00A 2QTEA 4X9IA 5KSBE 3SDAA 3HRZA 4X7EC 3W9DA 3L16A 4FP8L 2CHWA 1GYUA 1KCUH 1RXLA 2NY3D 2CE6A 3UZVA 2FUTA 4E9WA 5CEZL 3H9ZA 4AE1A 5JW4M 2YUVA 3EO0A 3GXNA 4NO0A 3MN8A 4FNQA 3UZEC 3AT8A 3FTXA 4KQ3H 4YDJB 4H0IA 3FUKA 3K8KA 4HOWA 5HYJA 3HI6L 5AD0B 4AYID 4UOW1 5FGRA 1PG7L 3OMZA 4DFHA 4KGJA 1JK9A 5E5LA 3BMWA 1IBGH 4H8VA 5AYUL 2NUPA 3V52H 1MCPL 2C7UB 1X5XA 1MWAH 1OGSA 3TBVA 3ABZA 4POYA 3AITA 4XNBA 2Q86B 3ET9F 5EZJB 4I18A 2H32A 1S2EA 2GTZB 1Z5YD 5E7FA 2WXOA 1A5FH 1SYVB 2I07A 3MLXL 3EFFB 3SHSA 3BLBA 2DDQL 4R90H 1RPQA 1TVBB 2XXMB 1IVLA 1DLHA 3VFUB 4K5NA 3BUIA 4NM4L 3X13B 1ZDSA 4JDZB 4LVOB 5K5YA 3F7VB 3KHQA 1KT2A 4QOKD 2YPLE 2VL5A 3RTQB 1JGLH 1RVFL 2H9GB 2BERA 1D7BA 4E9RA 5F7EH 4IBWA 1U8HA 3L3IA 1ZLDA 3CFNA 2OTWB 1USQA 3CSTA 5C0AA 5CJXA 2E8YA 1LP9E 4NLHA 4S2SA 5FUCE 4G1MA 1FFOB 1OANA 3TV3L 1HS6A 2VXQA 1PD6A 3MGOB 2ZOOA 4NFDA 4A6YL 2BHUA 5T1KA 3V9EA 1XGQA 3G5YA 1LEKA 2BPBA 1NGYA 4RA0C 1FBIH 5C07B 2AJXL 5EU6B 2ZWSA 3W5NA 3IFOB 1KEML 3VD1A 3WIFA 3EGDB 1I1AC 4LGSB 1KJMA 5EB9A 5H2BB 3GMQB 4JZNA 4LHUG 4U49A 1T83C 1O9VA 1EGJA 5IVXA 2JIXB 5T3XD 4Y8DC 3GXIA 1VCAA 1WWCA 5BV7C 5B21A 5BZDB 5C0RL 4N0UE 5E1AA 5I17A 2EP6A 2L04A 3UTSE 2J8UA 4D7PA 1WCBB 3QCTH 4JHVA 1Q94A 5HDWA 3QO0B 4BSWB 2B15A 2ZF9A 1NM9A 5M7QA 2BXYA 1MRFL 3NZHH 1J0YA 1ZGLB 1MLCB 1X5MA 4UT6A 3KPLA 4Z77A 4QRUA 1T66D 1PY0A 4I0CC 3IGLA 2W60B 3ETBJ 3LZPA 1HHGB 3HG1A 5E1IA 4LP8A 1AI1H 2P48B 2WIIB 5DUML 5ICUA 3EFDL 4IK6A 4AYBA 4WTZG 1QBMH 1XF5A 4OF5A 2X4UA 3EAKA 3VXMB 5JLZA 1TCRB 4DQOL 1LGVA 1CFQB 2OJEB 2W9DH 4G1EB 2BSTB 1QLEH 3DUUA 3C5SB 4Z7UE 5BZWB 1S7TA 4OKVB 4NO5B 2GFBB 3STLB 4GKNA 4P2QE 3BVNA 1Q9WB 1WBYB 1SDDA 4GUCA 4HMDA 2D7NA 4I3GA 4PV1C 4S1DD 5FFOA 3BE1H 5KS9E 2NZIA 3BUQA 3ISWA 5T5NF 2BWDA 2HMIC 3LPPA 3L3DB 3NQIA 1XCQA 3CHQA 3X12B 3IGKA 4L23A 3WO4C 1X5IA 2EXYC 2HRHA 4JGNA 2O5YL 2YJQA 3CH1A 2PABA 4JLRB 3WG7B 1HAUA 2F7IA 2WYZA 2DWDB 3FUFA 4KRMB 5E4OA 3H7LA 1INQA 4N2CA 3GMMA 2BCKA 1KYOK 1SEBA 1IV8A 5E8DH 2R9HC 4PRPD 4K9EL 4BYHA 3VXSD 4OCMC 1DN0A 1L9SA 3AQXA 1GS7A 2BZ7A 4XMPL 3CSYB 3L3OA 5D4HA 3HNSH 1A7OH 1AGBA 4JN1L 4DT2A 2AV7B 2A6DA 3KYOA 3WDJA 3EJSA 4MB1A 3ZYJA 4GG6A 3MBED 2QQQA 4N6QA 4BCZA 1B0IA 2VDQL 1U33A 1HEJC 2H6PB 1MH5A 1H5BC 1FAIL 4JZJA 5E03A 5CP7B 4DNLA 2VKWA 3NT0A 5DZLA 4GRWH 2W8CA 1JF1B 3VGFA 5HPMB 1KCKA 1H0DB 2KPWA 1JD7A 3BZ5A 4N90D 3U2SB 4IHOB 2XDHA 4JKPL 5FYKE 2WUCL 4NJ9L 4A7TA 1ZVNA 4XXWA 5DZNA 1EAJA 5SWZD 1F4YH 1HDMA 3H6JA 4FFZH 1TITA 5TDOA 1KTCA 2HJLB 5TTRA 3AWGA 1MCNA 3QA3B 3HR5A 3DOSB 3ASOB 4ZW6A 1FQ9C 4PW3A 2V9RA 3T0XA 5DJ8A 1GGBH 2FIKA 3LQAH 1MPAL 4NNPH 4Z18A 3HZKB 4PREB 3E6HA 3R0MA 1WAAE 3HMXL 3OD3A 3PGDA 4HS3A 3MLSL 2BW5A 5ACZA 2D9QB 2OL3A 3OXSB 5ALCH 1R6VA 1T0NB 4AKPA 5HGBA 4AGOA 2Y1AA 3GLEA 3KPPB 1A0QL 2SODB 4Z0XB 1ZKAA 3FTSA 4S0SD 3MKKA 5E1HB 1CI5A 4TSAL 4LSRH 1MIEH 1U8LA 2JI3A 3O4LA 2AVFA 3D08A 4QCIA 5E6ID 4S1SH 5JIHA 1A6ZB 2MCG1 3LV3A 1WZKA 4JFEB 2XN2A 2VRKA 5E9DD 5FWRA 1CLZL 4G9DB 5J1SC 2OJZL 3FB5A 4WFED 2FATL 3BP6B 3ESVF 2H7WA 2EABA 3QARA 2ENSA 5L4JA 4L8CB 1LLAA 4OGYH 2YXVA 2BVEA 4K94H 2GJZA 1UT1A 5H94B 1T21A 3QI9B 1W8NA 3PP4H 1BREA 5GXBB 1SYSA 2ERJB 3ARGC 2VRQA 5AKTA 4FLRA 1K3ZA 2PWHA 4UIKL 4XBGA 3IRZA 3T4AC 3DROA 2VDOH 5TF1L 4JEGB 4BA0A 1BBJA 4AKOA 3GD1C 4YVNA 2JK5B 1HIMH 4ETQA 4TTGA 4IRZL 3SQBB 3QORA 1W72A 4A04A 1OAUH 1SHMA 2LAGB 2QGBA 2C1PA 1O5PA 3TBWA 3HZ3A 4KZEH 4PLJD 5I5IA 1KIQB 1UZGA 5LNDA 4JE4B 3EF7A 3C9NB 4BBWA 3OTTA 1SGKA 2HP4A 1TKWB 5DRWB 1Q9KA 3PHQB 32C2B 3RWFA 5DMGD 4JVUA 4LAQL 2XWTB 4PJFA 1A21A 4P5MA 1BA9A 1KYOJ 1MCWW 1PYWB 4PLOB 5AVZB 1U8OA 4EIGB 1MCCA 4KK8C 4XXCC 1GMIA 3MTRA 1JZIA 1BZ8A 3SGKA 3MFFA 2OMBA 2WBKA 1FWXA 1G7QB 4I1PA 1UFUA 5FAAA 1TETH 2OMVA 4M61A 43CAB 1F58L 1KN2H 1EEUA 1KENL 1KELL 3HG5A 2J88H 2VISA 2VN7A 2V4LA 4HAFA 4KRPD 2APFA 4UZSA 4XB3A 3PWPD 4PLKD 4Q2ZA 3ARQA 1UM6H 4HK0B 1A2YA 1NTDA 5F2FA 2FWUA 5SWQA 5E94A 2DWYA 1J5IA 4UT7L 4XTRD 1GGIH 4AW4A 3HW7A 2X6VA 3FU3A 1D6VH 3QEHA 4FKEA 4LLMA 2ARJQ 4NN5B 5E8OB 3P2DA 3UAJC 4B7IA 5BW7A 4QJ5B 3KS0H 4IRJB 1BM3H 3HC3L 4UTBH 4YX2H 3FFDA 7PCYA 4FXGC 1KJ3L 2C4FT 2BZDA 5GGQL 5CEXA 1R5VB 1S7UA 3MRBB 3QDMB 3VCLA 4CVXA 2Y22A 1SUJA 5A7BA 5B8CB 4QRTB 3HS0B 1EH9A 3LX9A 2L8AA 3TXAA 1EXGA 1I7RA 4YXKL 4LOVA 1YNLH 2P5ED 4XN9A 3WXWH 4GSRA 5DK3A 1ILSA 4FHJA 1QTPA 3NJVA 4WW2A 4ZNCD 3EADA 4O00A 3V79C 4DN3H 4I7ZC 1BWMA 2AEQL 3NG5A 1B3IA 5E7BA 4F58L 2IPUG 1MELA 1AHWB 1CICB 5F1KC 2YPKB 5DTFB 5ECGA 4AGMA 1U8IB 2NZ9D 4NKOB 4PSPA 2OXGA 2ORBH 2LFEA 4JANB 5H37G 3ETBF 4ODVL 1KCRL 1YN7B 1OAZL 2G5RA 2WJ7A 3OPUA 1USZA 4Y2OA 4FG6D 4ODBD 1DANT 4ZFZA 3BGAA 1FNSH 5IY5B 4M6AA 1BVNT 4XX1G 4J23A 1DVSA 4XODA 3CMOL 2M8XA 5CMAA 5DS1A 1G94A 2KQMA 3D50A 4FYSA 1FNEB 2X4SA 3ATBA 2X3AA 2DTSA 3WFZA 4KNSA 4XVSH 2JTDA 2Y72A 4Q6IC 3MV8A 2YFOA 5C3IA 2E6QA 2WXGA 1W0YT 2FJGA 1TZIB 3JWDL 1WFOA 2I69A 2FGWL 2YZ1A 4N3UA 3L5WB 2EE2A 1DVZA 3O4OB 4WNJA 3T3PE 3FN0H 2CXGA 1XV8A 2X4RB 4EUPH 4JE0A 4AGQA 3QWRA 2BS8A 3EYSL 3OAZH 4I0PA 5H4YA 1DQVA 3N9GH 5F1IA 5IK3B 3FOMA 5FKPA 1WE5A 3GSWB 4M7JH 5J11B 3OBAA 1AS8A 1FDLH 2DBLL 4PEEA 4QY8A 4JHAH 3HB3C 1E65A 4JCWA 2EYTB 3TO4B 3G5XB 2NT1A 2FSEB 2AANA 1FZJB 3BUBA 4LKCA 1I9JL 2WXQA 2IOIA 4NYLB 3T0DA 4YHYC 3QUXB 4XAWL 1T20B 5INDB 4ACTA 4P2RB 4NKMB 1X4YA 3GRWL 5GRVL 3ZDZF 4M6OH 4GW1A 5GS1C 4JFTA 4IKLA 3ROLB 3NIGE 2GIYA 1XX9C 4WDIA 5E56A 3WIHA 3GEFA 3NSYA 1IBYA 3W0WD 3C08H 5DK2A 4P4RA 2VO5A 2Z8RA 1L9PA 3QNXB 2YBRA 4K7FB 2VR6A 4JBSA 2VABB 3VXPB 3QRGL 1WZMA 3R19A 1JPTH 4PJBE 3HE6B 4PJGF 1U2HA 1MCRA 5FCUL 5ES4B 3N85L 4R84A 4AIZB 4ALAC 1ZHLB 1W6LA 4AUYA 2HG0A 4NBXB 1R0AL 2CPUA 3O8XC 3GMNA 3B3IA 2VDKL 2OR7A 3CFUA 3I50L 4UQ3B 1EV2E 1CUOA 5H8DA 5L88H 1T0PB 4O02A 3LPFA 3QUGA 1S7VB 2ESVD 3ZTNH 3FSOA 3GFUA 1YSOA 2NNFA 1GA2A 3C5ZC 4JM4H 3VI4F 4FNRA 4M5ZH 1L4IA 4YLQT 3UBXI 4F33A 3KPRB 4OZGB 3EYOB 4PV9B 3RWIA 2P5PA 1C5DA 3VXRE 2QQNH 1S7WA 2HVKB 3ULUL 3D25B 3LIUA 4Z7VB 5DQ9A 2DLFL 3MNDA 3RUGF 2B14A 1UB5B 3V4VB 1LO4H 3VE0B 3BIKA 4NAQA 3A23A 3C6SA 4IEFA 5I8KH 1QFUL 4UQ2B 3V55A 1MFAH 3JWNC 4NUMA 4YBLC 3BQUA 1W0WB 4MA1C 5BPPA 3N1GC 2Q10A 2BNUA 2NY6B 2QSCH 3N44B 3W38A 1ZLUK 3RBSA 1PEZA 1WA0X 2P46B 4CILA 5KVFH 1MFDL 3PAZA 2A6KA 3IXTB 4HXBL 1DVFA 4DAGL 2GITA 2V33A 1FN4B 2HAZA 2WINB 3EJZD 1IEHA 4PJ9C 1BVZA 2DL2A 1LXMA 2HPOA 2PW2A 3JT2A 4L5FE 5EA0H 4X5XB 3D3VA 2DTMH 3AS3A 3MCKA 4P5TB 1KSRA 1AIFA 4R26H 2QQLL 4U1HA 2CRIA 1MVFA 4KAQL 4FYTA 5C0BA 4GAFB 3QJFB 1OEZW 5AOMA 3M1BA 3U4EA 3D06A 4XNAA 5B7MA 3AU1A 1EDHA 3KHOA 1U58A 4M1GL 4K8RH 1WZLA 1KBKA 2X2HA 4WENB 1OKEA 2H6OA 3HCVB 3UX9B 7FABL 5EV7A 1O9ZA 3U1SH 1CDBA 3V0GA 4XOAA 5BQ7B 2K6WA 2G2PA 4KROC 2FEJA 1MHHB 5C0JB 4N8UA 5AW8B 3UTPE 4N90E 3SSGA 1C08A 3QUYC 4NZ8A 4Y5VB 3HI6H 1T22A 2HT2D 2ROYA 1PG7H 2QDWA 2V3FA 2ZSWB 1IAIH 3Q48A 1U8PB 1TLKA 2H32H 4Z0BH 5SWZE 3UFIA 3RDTB 4BELD 2ADGA 1MCPH 4HXAL 4Y4HD 5DVLA 5T3ZH 1IKOP 5JMOC 2VWEC 3FW6A 4ERSL 4ANWA 3V6ZB 2FRGP 4OB5L 2AVGA 4N5EC 2VZ3A 2YJLA 3TT1H 1UTDA 1SPDA 2FIRT 3ZR6A 5JOPD 1H3TA 1L9QA 3MLXH 3QUZA 2QVTA 3UCQA 1BAFL 3D85D 2EUZA 1RIUH 5IB1A 2QV4A 4HBQA 7TAAA 2BMKA 3O2VL 4RX4D 3CFQA 2LLLA 4N2NA 1WPCA 1DSFH 1I1AA 1RVFH 2AJSL 5BV7L 4RWHA 3IDGB 1LEGA 4IJTA 2P52A 4TULH 3VH8A 3GMRB 1S46A 1SLUA 1QRND 2J55A 3MA7A 4MD0A 1OWRM 1F56A 1WJ3A 1T83A 3MRHB 3TT3L 2CK0H 5CGYD 4LVOC 5F0LB 2EECA 2JH2A 3RTQC 4A6YH 5E9DE 3RG1C 3ZU8A 2BIMA 1T4KA 2HN7B 4LHUB 1QA9A 2AJXH 4WV1B 1EGJH 4OR1A 5IQLA 4BH7A 3AC0A 3KYKL 4Q9RH 4NENB 4LVNC 1FCCA 2QR0B 5FYJL 5IHWA 5D1ZB 3O3UN 4B9IA 4E41B 3GM8A 4KBPA 1L9MA 1OCZB 3EH2A 5D1ZI 5IG7B 3QUKB 3PL6B 4PTUA 3P0YH 4AYDC 3TIDA 4UT6H 4WU5A 4NC2B 3BKCL 1H19A 1QSED 4QYOA 3RB7A 1G7PB 2P5WD 2VN5A 3DX7B 4P99A 1NEZA 2ZUTA 5F7AA 3A6BL 4LE8A 3B5GA 4E9VA 2ICWB 4PTTA 4TNVK 5DRZA 3QRFM 1G5AA 1UASA 3MV7A 4UOQA 5IBTL 5I6NA 2ICWI 1EHNA 2PCPA 3V6FB 1J05B 4OT1L 4W9DC 4Z3IA 4A39A 2XKNB 3G04A 2EXWD 3L3KB 3EFDH 4P2OB 3EBHA 3T08A 3ZDYB 1CDIA 5B4MC 4DGUA 1GR7A 1TNMA 1JK8A 4ZW3A 1A6PA 2DYPD 1JXGA 3EYFA 2DJUA 2IALA 2YPLB 1RZFL 4KFZC 5CSZB 3TWYA 3GO1L 5HVFB 4Z8FL 2V2WB 1HZHL 1F8TH 1OE3A 4ZMYA 3CG8A 4NGHL 1F18A 1IAOB 4NRYA 4AQZA 3GJFK 2Z31A 2RACA 2V5MA 3DTXB 4H20H 4PN6A 4XVUD 4Y9BA 2DQFB 4RZCB 3IXAB 4H5SA 1QZ1A 2VDNB 5F7UA 3HE7C 4XPGL 4BWWA 1MFVA 5GRUL 2QZ5A 2FZ3A 2HFEB 2PYFB 5K59E 4P4KD 2E75C 2O5YH 3D4CA 3L45A 1FG2A 4ZSOE 2P49B 4X5WA 2BS71 1K9TA 4D9LH 5F88A 1QBLL 3VG0H 1XZ0B 5DGRA 1JZ5A 1F4HA 5ANMB 5EHFA 1H5BA 1LE9A 2ZG2A 4Q56A 1DQQB 4F9PC 2AJUH 2OMZB 3PY9A 4K9EH 4KKRA 2YUXA 3MJ9L 1NPNA 3PXHA 5T1MA 1M53A 2J1XA 4YHNA 2Q76B 1SDYA 4YDIH 1K85A 3JTSB 2MHAA 4JN1H 3UG4A 5A2BA 4EMZA 2VR7A 3HZYB 5DCCA 2F74B 4X7TA 5IEKB 2QADB 3QPQD 4TTDC 2FYYB 2P5EE 1FAIH 2YO3A 4QAWA 4KVNL 3T8VA 1T5WB 5FO9B 1M4KA 1R75A 3DVGB 3RHWK 1ANUA 2WXHA 1CQYA 3S48A 1HZLA 3MXVL 5HY9A 4RBPK 2IBZY 2EEDA 3RFZB 4NJ9H 4DW2L 5A2CA 3PWUA 4QHLA 4FG0A 4A2FA 5J6SA 3MQIA 5CJ8A 3IDYB 5GZNC 4R7VA 4D0BB 1G9NH 2HTLC 2OA9A 3LRKA 2LU3A 3O45B 3TJEH 3S35H 1RK1A 2FBOJ 2OL3H 3JTTA 4JUSA 4XN1A 3FQNA 3FPXA 2X05A 2MH4A 4Y16D 4F7MB 1QHQA 2QQKL 3THML 3BT0A 3HMXH 3TVMA 3Q6FB 2X70A 3CFJB 5AW7B 3MLSH 2Y2WA 3ZQXA 5KSUB 1WYJA 1GKEA 3RKDD 2NX5B 1ES0B 1JZ7A 1B2WH 1JMXA 2WYIA 1FFQA 5FFGA 5IMMA 4HT1L 1PFOA 1A0QH 1T0MA 1R3KA 3GHPA 2OBGA 3SYQA 4N22A 4JL2A 1HHIA 2HH0L 4PWFA 4ZD3L 1PNCA 2PTTB 2D0GA 4TSAH 1NDMB 1MSPA 4ZMOA 5GZOC 3ARGA 1TNNA 2JKRM 1U0QA 3QAZB 2Z0UA 8PAZA 4JL1A 1AQDB 1NFIA 1KEGL 3ZL4L 3FS9A 1MW1A 4YH6A 2UX6A 4A7VA 4BGDA 1N64H 1Z9OA 1UQSB 1CLZH 4U1NA 2OJZH 3BGFB 4PRDB 4ZX6A 2YD4A 1ZA3B 3BW9B 5JR1L 1IC5L 5DU7A 4TM9A 3EUDA 4JDVB 3GLZA 4XHQA 1Z6JT 3GI9H 4ICXA 3K6SA 1GW0A 4HKBA 4FCAA 3DX9A 5DZ9A 4M8VA 4C47A 3UJTL 2F0CA 2R2BB 3MRPA 5LGHL 1E8YA 1HXYA 1W72H 1KF9B 2JTYA 4R7LA 4LP5A 1OSEA 4NQCA 4RMQA 3S37X 4GQ9H 1J7VR 3V4PL 3BAYA 4GSDH 3WNNA 3QI9C 3RZWA 5DFAA 3VNYA 4BK8A 2WXRA 3NFPB 4X5LA 1J8HB 3ZZQA 2IWGA 4IRZH 1BD2A 4AQAA 3W0WE 4C4BA 4XXCA 2ERJC 5FGBC 2PO6D 1R5WB 2B16A 2OX5A 3F04A 3QG6A 2QGCA 1O7DC 4Z3HA 3GPSA 3F3HA 3RPIA 5CHNA 5F9OH 1KN4L 2VYRE 4L3EE 3E38A 2EKSB 3TH3T 3MRQB 1JHKL 5GGVY 1G9HA 1AACA 5CGTA 3LVTA 1MJJA 3PXJA 1BOGA 3LYRA 1IFRA 25C8L 2OLDA 4DKAA 3LHPH 2H8PB 2Q8BL 3HFMH 4LARL 4WUUB 5E95B 3S96B 1CTNA 3COOA 3IJSB 1B4JL 2V5YA 1SQMA 1KYFA 1ZHBA 1ZS2A 3I6KB 2B1HH 2XACC 2JKTM 5JA9A 4L3FA 5BUAA 3WHXB 2H1PL 4GW5A 4QHKJ 2ESVE 4K71B 3UAJA 1DBML 3PV7A 3V5DB 3J8F7 1KENH 3HLAB 4GMSH 3NSJA 3VFVA 1N10A 5GGRY 4QR7A 4V1DB 4Y2LA 4BZ2A 3TASA 2ZXGA 3KYMA 4AH2B 1G7HB 3DO7A 2FEDC 4KMQA 1NINA 3NZUA 1IT9L 1XIWD 2W9LA 4UBDC 1DE4A 2YEZB 2YN5A 3BT2L 4JFPA 1Y07A 1TPXB 3GSUA 1KBVA 1PAMA 4MCYA 2I9TA 3U36B 2J2ZB 1EXUB 2Y5QA 3GMLA 5JDSA 1UA7A 3IDIA 3F62A 1L9TA 3Q8EA 3VA2C 1N59B 2P9RA 1KCBA 3OWEA 3S6CA 3UMNA 3MBWA 4YXKH 4HC1L 4Y4FD 3L9RB 3VXQA 3E3QC 5E00A 4F2ME 3OKLA 3MU3A 2G0KA 4PS3A 2CR0A 5GRJH 2H47C 4UQCA 1EHAA 1MJ8L 1U3HA 1IZKA 1NDTA 1I8UA 2AEQH 3HS0C 4XBPA 4QRPE 4W9ZA 1PKOA 3K8MA 4ANXA 2YIHA 5ADOL 3T0EC 3IEAA 2ZXWB 5DMKA 3K72A 3Q8BA 3N50A 4MNQA 4H44C 1KV3A 3P3YA 4Q6IA 4JQIL 4C83B 4ODVH 1OAZH 2XN9D 5EEVA 2PCXA 4Y1AA 1WP6A 5DDHB 1AHWC 3U6RA 1CICC 4X4XA 5FKAA 2XSKA 3FRPG 4HAKA 5BOZG 2CLRB 1CDGA 3KPOB 3SJVB 1J1OL 1K8IA 2WTRB 3K4AA 4GP8B 4EKXA 2BX5A 2FR4B 3L4ZA 2L3BA 5KSAB 2Z8SA 2GUOA 2IPKB 2YAPA 2YR3A 3JWDH 4GLRH 2FGWH 3S4SG 4DCQB 4DZBB 4TUJA 3P0VL 2ZQKA 3ME0B 1E3ZA 3GSVB 3FU8A 3N1QC 3DX6B 1ZEAL 1A65A 3H0TA 1FRGL 1U92B 1KPVA 4O58H 5JOPE 1QLFB 2VERA 1DEEB 5K9KB 1K8DB 4ISVA 1ASQA 3O4OC 4HS8L 3TZVB 3FQUA 4DETA 4K3GA 1OP5K 3EFOB 4GSQA 3UACA 2X0WA 2M2DA 4HBCL 4OLVH 4WAFA 1M7UA 2WVVA 3DUSB 5IIEB 3EOBA 1I9JH 1ZXKA 1AO7D 4PJGA 4AENA 5J11C 4BE5A 3RNKA 2VQ1A 4MASA 1CFSB 5C08B 4XAWH 5TH2A 3WIHH 2GK0A 3TO4C 4LIQH 4LZKA 3S7GA 4A7GF 2XPGA 2C3WA 1J18A 1P6WA 4I2XE 2R1YB 4D8OA 3EYVB 4GS7B 5JZ7D 4XZUA 3SKOB 3WIIL 3QUXC 3O8XA 1NFAA 1OP9A 1A7BA 3BPLB 4FJYA 4XVJL 1A1OA 2I32A 3BAKA 1YDPA 2A3TA 4UILH 3S34L 1E7VA 1RJCA 3PAVA 3VI4A 5FUOL 4DEPB 4W9EC 3B3BA 3QRGH 1E9QB 2K0RA 2WSDA 1FL3A 3VYOA 3B7TA 1AR1B 2CR6A 1KJ2L 1KLUB 5EU3B 3T6XA 1QSEE 4LKXA 2F15A 2XX0A 3OGCB 3RUGA 5KG9B 3WD5L 4RGND 4XOCA 2IVFC 4ZRGA 3I50H 4APQD 3QIBB 4OD3H 1VGKA 1PFCA 1VAHA 1BSIA 1FJ1A 4WUKL 1XSJA 1U93A 4HGWB 3FL7A 4WWNA 4QXTB 5T1LB 1UT9A 2PPAA 2YKKA 4QHMB 5TGBA 9CGTA 1FGNL 1OY3B 4HK3N 4M1DL 1BQHA 1NCDL 3WLBA 4KZDL 1XF3B 1N2RA 3HS9A 5LDUA 5GS2H 1MCWM 1FI8C 4NJAL 1B0WA 4FG2A 4V2CB 3ILPA 5K1NA 4LLVB 1R5IA 2XNAA 4ETYA 2EIKB 4N0FA 5L2KA 3DLQR 1D5IL 4PJ9A 4AIOA 3D69A 2DLFH 1L5GA 3HI1A 5AB2A 2FJHB 1YJDL 2DM4A 5EO1B 1IIKA 4IM8A 1QFUH 4PD4K 4UM8A 3FQ4A 3FQ1A 1BV8A 4QF1A 3LKOB 2MCPL 2R2CA 5IWLC 5CUSL 3C6LB 3VYPA 2IBZX 1V3JA 1NEPA 4OZGF 5CFAA 3KXFA 4DAGH 5AALA 4GBXD 4LBAA 4H8WC 4UM9B 1ZPUA 2YUZA 1FA4A 2UUDK 4Z7VF 3DA0A 3O6FB 3TCTA 4XCYB 1AE6L 4HWBA 1L7IH 2NY6C 1RZKC 2LGNA 2WGNB 1M9SA 2NY5C 1NANH 1DUZA 3NAAL 1BG9A 3Q2WA 4D9RE 5C0IB 2VMCA 4CA4A 5DFWH 3W56A 3N44F 4KAQH 3B8SA 5CKAA 2WOBA 4OCWH 1WV7T 1A7RL 1P4LB 1EK3A 3LXBA 1CGUA 4P5TC 2C3HA 4KHTL 4HW6A 4KOCA 2A5UA 3ZXAC 1XVSA 4TSCL 3RE0A 4YDJA 1PTZA 4KITB 6TAAA 3P73B 4PBWD 2F54E 4Q14A 3MZTA 4ES9A 4RWYL 1OGTB 4PY7B 1RH8A 4L2LA 4PJ8B 2C7UA 3DTUB 4W9IC 5ADPL 3OM3B 2H26B 3H8NA 1G43A 2Q86A 4OCNC 4YPJA 1O6VA 5EZJA 4GKSB 2GTZA 2DL9A 1MREL 2J7LA 1SYVA 4Y5VC 3DBSA 4D7BA 4ERSH 4FQXB 1MNNA 3EFFA 2A9NL 3ATEA 1TVBA 2QLYA 4OB5H 3VFUA 3X13A 4YQXL 5C6WH 4YHZL 4DZ8B 4JDZA 1B90A 3F7VA 3LCYA 4Z7OB 3RTQA 2LLGA 1WFJA 2H9GA 2MQ0A 2EDKA 3GSOB 1GH7A 3N1MC 2OTWA 3U7WH 3O2VH 3T8XB 2WO4A 1ZHKB 1CGVA 1PZAA 4DKEH 4K8RD 2AJSH 1JPEA 2CO6B 1FFOA 2LQRA 3L3JB 4NO0D 5BV7H 3F65A 1S9VB 3APDA 3MGOA 4YDVB 5E4EC 4KTEH 2JKWA 2K1MA 2P24B 4QO1B 1WDAA 3ECQA 4WGKA 5HYJD 1UD2A 3TT3H 2CO3A 1OM3L 1EAQA 2GHZA 4BRVA 2HRGA 3QXUA 1UKQA 5CJQH 5DO2C 5EU6A 3IFOA 3CWGA 1GYCA 3NK3A 5C07A 2GEQA 3EGDA 4GRWE 1Q0XH 4BFRA 1LWHA 4K7PX 5H2BA 1ETZB 3GMQA 2DBJA 2X4NB 4KK5D 4YHKL 3ABLB 1ZMYA 3KYKH 2JIXA 2DQUL 1TUPA 4JO3H 3QCUL 1QASA 3AS0A 5FYJH 1S3RA 2I7OA 1T1YB 5BZDA 4LEBA 4ZS6C 3FT3B 5T3ZD 1QNZL 2XVGA 4IRSC 3T9WA 1WCBA 4NUJB 5AG8A 4U31A 2HT3D 4X2UA 3QO0A 4WV1C 3VI3B 3GTNA 3IU4L 5E2UL 2WY3B 4AV0A 3MNWB 2X5PA 3BSZL 4IMKC 4PD4J 1ZGLA 1MLCA 4OI8A 3B5HA 3LN4B 2W60A 1HHGA 3KW8A 3PL6C 5C0AD 4LDLB 2WIIA 2BZCA 1ITCA 2IFGA 1AGCB 4EI6B 3VXMA 4GRLB 4GFTB 1TCRA 2V17L 1UZ8B 4ZS7L 1CFQA 5T1KD 3D2TA 2XKUA 2OJEA 4EJ1C 3GM0A 4G1EA 2BSTA 4JFQB 2X0UA 3C5SA 5BZWA 3A4EA 2N7AA 5T33L 4OKVA 3H42L 3CZFB 4NO5A 2GFBA 3STLA 1Q9WA 1WBYA 1JZ3A 4Y89A 3QWQB 4GINA 5TE6H 2YS4A 4OVUA 5D93B 3QJRB 5IESL 4XNXL 3GO1H 1JPGB 2V8MA 2AK4B 1HZHH 1RP9A 2WC7A 4Z8FH 4QYAA 2EE9A 2R56H 4XNZB 5D4JA 4PJ5E 4Y19E 3L3DA 4DIXA 3X12A 1LILA 1S9XB 5KANG 2JKJA 2JE8A 4JLRA 3ZDYF 3APNA 1JZHA 3KLQA 1WS8A 2DWDA 5IOKA 2A6IB 2WW8A 5AYQA 3V5HB 5B39G 2HKHL 3UAFA 5FHBL 3S9DB 1OAQH 1KTLB 1PJWA 3HN8A 4TN9A 4U4BA 3ASNB 1QBLH 5EOCJ 2NR6D 4ADGA 3LKSB 1DQDL 3HG1D 3JV6B 4LCIL 4I48B 3SQRA 4GEIA 1UYWL 1AY1L 2IF7A 3V4UH 1BX2A 1E30A 2DQTL 2VR9A 4AJ0A 3PGCB 2AV7A 3TN0B 4GQRA 1ID2A 3A67H 4DP2X 4TUUA 5I0ZA 2H6PA 2EZ0D 2WBXA 3WE6B 2J3SA 2FO4B 1TZAA 3BZDA 5CP7A 4WI8A 4PP1D 3L08A 3RVTC 5H4ZA 1WTLA 1JF1A 2YPVA 5HPMA 1G0DA 3U2SA 1H0DA 1YMMB 1JDAA 1M6UA 4XPHL 3IBOA 4IHOA 1ZTMA 2GSIB 5LQBL 3M17B 1YY9C 3C8KB 3CBRA 1QTYT 2GJ6D 3MXVH 1N8ZB 5JYLA 5F1SA 2QADC 1NFDE 2HT4D 2HJLA 4FMFA 1KCVL 2WLIB 3FUIA 4DW2H 3QA3A 4N2BA 3DOSA 5J9PB 3ESMA 3IJHB 3OZKA 3E8UL 4H88L 4OCYH 5BOJA 3HZKA 4JY4B 4PREA 1OE1A 4XE5B 1IILE 3T3ME 1Z3RA 3G6AA 3OHXC 3ZKMC 3NRPA 4N2EA 3RFZC 3VWJD 3QIUB 2MNJB 2CR3A 5GZOA 3AFLA 4G71B 5C6TL 3OXSA 1CD1B 1DR9A 1T0NA 3THMH 1NEUA 3IDYC 5D2LB 3KPPA 2R29A 4X6EB 4CVZB 3K6DA 4Z0XA 1RP8A 4HKZB 5HHOD 1BXUA 3F84A 1CFBA 4XVTL 4HT1H 2BC4B 2ID5A 5SV4A 2HH0H 1JGEB 3L4XA 1R3LB 4IBVA 3MI6A 1A6ZA 3ORJA 3SGJC 2ATPB 4FZEL 4O9HH 1YAIA 3RAJL 4JFEA 5D72L 4G9DA 3BP6A 1KEGH 4L8CA 3OJMB 3ZL4H 4QKTA 4BUQA 1Y0LB 2JJSC 1JWUB 4X6CB 5FF6B 4JB9H 1WCQA 5H94A 3FH8A 3VXNB 1VFOA 3GIVB 2HKFL 3EJCA 3QI9A 3DWTA 1B3JA 1BEXA 4FAAB 4MJ6B 5JR1H 5FGBA 5EF1A 3QAQA 5AKVA 3QAZC 1J0IA 1AO7E 3VFTB 3MA9L 5FXCH 4NNXB 4G6AD 3E80A 4OZFG 1UD4A 5LGHH 2RFXB 1XSKA 2JK5A 3BGFC 1NFKA 3IKCB 2OP4H 2XPZA 3AUWB 3SQBA 1F42A 2R1WB 5AVWB 1ERNA 5DHEA 2Z92B 4PJDF 5E8PB 3V4PH 1KIQA 3L54A 3C9NA 4NQXB 4XCFL 1TKWA 5DRWA 3AB0B 3ENEA 3I2CL 3PHQA 1PG7W 32C2A 1YECH 4JPQA 4AYGA 3FHAA 2F58L 4G59C 3O4LD 4X4ME 3O6ML 3QJVB 1PYWA 4J1UB 5DQDH 4CNIB 1HH9B 4OZIB 3ARUA 2DI9A 5E6ZA 4RSVA 3QYCA 2B3RA 2Q8AH 25C8H 2TSAA 1G7QA 4YDKL 2VZSA 1S4IA 5AW3B 43CAA 1ZHNB 2NY0C 2Y5TB 2VLLB 1JMZA 2X4PB 3OJDB 4LPYA 4LL1A 2OSWA 3SYPA 3WKNA 2J57A 4JG9A 4BZ2H 2H1PH 1S9WB 4HALA 3BUTA 2CU9A 2R8SL 4MMZB 1ULVA 1O7VA 4JFVA 2F8XC 4HK0A 1RMFL 5DXWA 5JYMA 1NAML 3QORD 3TEUA 3CQQA 4K71C 2ENQA 4HIPA 3UEZA 1EEQA 5E8OA 3NBNA 4JG5A 4IRJA 1IT9H 3MCG1 3TFBA 3BT2H 2VZTA 3M1OA 4JQVC 1FNFA 1G9MC 1R5VA 3U4AA 3MRBA 3QDMA 4CUCA 4KI5C 4OLYH 2ED7A 2YQ3A 5B8CA 3HS0A 4Z78B 5IJCC 1GAFL 3MBXL 4PJEE 1Q4NX 4KI5F 1PD0A 5AOLA 3WTSA 1TPXC 4YFDB 2X9XA 1JTOA 1MJUL 4H0HB 2VDRL 1QFOA 1UD6A 3APCA 4HC1H 4AGNA 3FB8B 1AHWA 4MHHG 5TE4L 4A2LA 1CICA 4IDJH 2YPKA 5DTFA 4PB0L 1U8IA 4NKOA 2FVNA 5EOQL 4JY5L 4KKNA 3S3CB 3LNEA 4ANKA 4JANA 5ADOH 1YN7A 3WELA 3BN9C 2MTAA 4PGBB 3FRPB 3NA9L 4HYTB 4KZ0A 3MX0B 5T5FL 5LXGH 2R0WL 2EIBA 2XV0A 3MLTB 3DDFA 5LNEA 3RIFF 2CDFB 2C3XA 5C1MB 1UGNA 3CZLA 4IOSA 1JNJA 4HQQH 3SDXE 4J8QA 4BUGA 5TF0A 3N1PC 2XT1B 5HJ3B 1ZJAA 5CBEB 1XCTB 1DFBH 4NKQB 3I3DA 2X4OB 5D1QD 4E5XG 5IFHL 2R39A 3S4SB 1OLLA 2PUQT 1TZIA 2L7JA 2LR4A 3L5WA 4HEPG 4F57H 1PAZA 5ILTL 1BFTA 3DETD 5KVFE 3QXAB 2X4RA 4YL9A 1BZOA 1SM3H 4OIIH 3OB0K 2CGRH 5FO2A 4QTHB 4XWGH 4JM2B 3T5WA 1PKQA 2MNWA 3LMJL 5IK3A 3P0VH 4H8UA 4RQQB 1KFGA 4DSYA 2YUWA 3TEYA 3GSWA 4A7GA 4EDXB 1DP0A 2XTJE 3NSDA 3FBQA 1FRGH 1PY9A 2EYTA 3OZ9L 4LSPH 3TO4A 3L5XL 3G5XA 4JG0L 4AUUA 2FSEA 4Z1PA 4HS8H 1FZJA 5C92A 2G75B 4UNUA 4JFDA 4HJIA 4JJ5B 4WI3A 1QUPA 3LKRB 1NIEA 4HBCH 5IQNA 4NYLA 5IFAH 1KJVB 4XC3H 3QUXA 1T20A 2ARJB 4F2MB 5INDA 2IFFL 2UZPA 2KBGA 4IIQB 3MJWA 4NKMA 1RKRA 4P2RA 4DP6X 3S37L 3OKNB 1S7RB 3TZVC 4ALAH 3ROLA 3CCHB 5AVUB 5HYJE 1A6WL 4MNHB 3PLYA 1HCZA 5CSGA 5KBPA 3GPEA 4P3CH 3DRTB 4LQ1A 4HUVB 5AW9B 1E5UI 2IO5A 2GW5A 3MV8D 4G8GD 1W91A 4OJCA 3MRGB 3QNXA 4K7FA 4X4ZA 4OTXL 3U83A 5IVZB 2VABA 3WIIH 4HD9A 2KLRA 4HIIB 3L4YA 3VXPA 1QACA 2VR4A 4XVJH 3HE6A 3S34H 4OJFL 5FUOH 4RAVB 4A38A 3U0TB 4AIZA 4JPWH 1NC2B 1ZHLA 5T3ZE 4GS7C 3QHFL 3U0WL 3KEHA 4WZ9A 3N1FC 1MUJA 1J9QA 1ZS8B 2BCMA 2EXTA 3BPLC 4UQ3A 4FI8A 5E9AA 3M07A 5IROC 12E8L 1BQUA 1S7VA 4DEPC 4NC1E 3GUFA 2CH8A 3JWNH 3NPZB 2QKIB 3OQRA 3P3TA 3S5LB 5C0AE 4WJKB 1QUNB 4WUKH 1AR1C 3UBXA 2NQ3A 5G4MA 3TA3D 4R4BB 4TYUA 2VM3A 1C5CH 3KPRA 1VADB 2FD6H 3EYOA 4JO1H 4OZGA 4PV9A 5CJ5A 2ATAA 4AQEB 1PX3A 4NJAH 4XN5A 2XQYG 2HVKA 3QIBC 3D25A 3TPUA 4EIZC 5IWLA 2OAAA 4Z7VA 1RZKL 3EH1A 2EC8A 1UB5A 3V4VA 1HI6B 3VE0A 5I1CH 4G8FB 3WL9B 4UQ2A 2XX1A 2I26N 4NDMB 1LO3L 1W0WA 3IWUA 3Q8AA 2B1AL 4ZAKD 3VQLA 5BRQA 5IUCA 5IVXE 1E90A 2AJYL 2VDML 5HSFA 3L8QA 3CXDL 3IXTA 3G6JB 3ZR5A 4X8GA 4OFDA 1FN4A 2WINA 2Z91B 1NICA 2J8UE 4I2XB 2ZX7A 3VAEA 4HWBH 3R7QA 3NABL 5C0CD 1O5DT 4X5XA 3DPDA 5AKRA 4POZD 2YRLA 1NGPL 2B0SH 5A2FA 1SEQH 3HI5L 1JGVH 4XVOA 4P5TA 2ODHA 3BXNB 4BQCA 2IC2A 1ZLWK 2WP3T 4UNTA 2VN4A 1FHNA 1MOEA 3HG1E 5CWSB 3K6IA 2ADJB 3C6LC 1H3UA 3GT6A 3QJFA 4ORZC 4YL4A 3NAAH 5KYUB 3BRDA 3ZL2A 1U42A 4J39A 1FE8L 4X6DB 3VM5A 2IPTH 2G4GA 3IVKB 3L2MA 1KGWA 1YEHL 3HCVA 1RLWA 1CB4A 3WTVA 5I30H 3EHBB 1DQML 4KKBD 5IF0B 1A7RH 4OZHB 5HI5C 1TCMA 5BQ7A 4KHTH 3U1PA 3GK8L 5C2UB 2GI0A 1MHHA 5C0JA 1TZOA 2GTWB 4TSCH 4Y5VA 2XG5B 1A22B 1YPZF 3OSKA 1NGQH 2ZSWA 4HOZA 5T1JA 4GXUM 4CC4C 1G7IB 5I1DB 1U9KA 4PRAB 1U8PA 3GUTB 3BVUA 3RDTA 5I26A 2CUIA 1FZMB 1XAUA 4H7VA 1A4CA 2JSFA 3C6EA 4HOMA 1Y6MR 3GTVA 4J3UA 1CIDA 1C16B 4BFFA 1FZKB 5CN1A 2VXVL 3W37A 4JHUA 4GP4B 3V95A 1MCLA 2A9NH 4PJ8C 3ZOAA 4BFBD 1RLBA 2P4AB 1V55B 2DOCA 4YHZH 4AUJA 3K91A 4KMTL 2IADB 2OMTB 3OB8A 3HNVL 1UEMA 2WVUA 4FQJL 4GG6E 1MCEA 2UZIL 3IDGA 3LEVL 4FQXC 4X80L 3F58H 3LJ3A 4ENZA 3GMRA 4XOEA 1WBXB 2FQGA 5HYQB 2ZKHH 5CN2A 3MRHA 2E0PA 2VLJB 2ZCHH 2EDXA 4NI6A 4XO3A 1A1NB 1T1XB 4XH2B 2O6PA 3AQDA 4G5AA 2FT8A 2HN7A 2BP8B 2D3NA 2DMBA 4LHUA 3T71A 2H2PC 4N0YH 4WV1A 4Z7OF 3NCBB 1SZNA 1PY4A 4NENA 3K0WA 3R18A 4IMKA 3ZBMA 2XWRA 4V2BA 5JHDD 4WK0B 2QR0A 2WQVA 4B0MM 1IIIA 2X7LB 5D1ZA 2IMNA 4E41A 2G3MA 1AS6A 3NFNB 4OQTA 3QUKA 5IG7A 3PL6A 3QCUH 3K71B 3WXVH 2O61B 4MCNA 5HTSA 4CBPA 4J27A 4FYQA 1QNZH 1QTSA 3QUZD 3Q6GL 3IRPX 4M48L 3DX7A 2ZX9A 2G9KA 5L7XL 5FO8B 4JAMB 4LEXH 1WZ1L 1GHFL 5E2UH 4OI7A 5J89A 2ICWA 1CI3M 1DUYB 1RZJC 2EH7L 3W11C 3PP3K 4WTZA 1YEEL 1I1AD 4KPHL 2VTFA 2A9CA 4QRAA 3H3KA 1K6QL 3V6FA 1P69B 1EFXB 1J05A 5E8NB 3HBPA 2XKNA 3L3KA 4R5XA 4OFPA 4P2OA 4OU3A 3QNYB 4I4WA 3TF4A 1DTUA 3VI3F 1SMDA 5CS7A 4YNYB 5K9JH 4B27A 2YPLA 1W0VB 1P7KB 5JMRA 1U6AL 5CSZA 1DQKA 5D1XB 2V2WA 4U3SB 4JRYB 3H42H 3RY6C 3STBA 2IGFL 1IAOA 2P47B 2X53A 3DTXA 3WOVA 5IESH 3WAJA 1IVTA 2DQFA 1E4XL 3IXAA 4M6NH 1H15B 1VZIA 5TQ0H 3ARVA 4N0CC 3ZYIA 2HFEA 5B39B 2CBTA 2PYFA 2YXMA 4G8IB 3QEQB 5D93C 3DX8B 4GRWB 1V3MA 1CDUA 4BSJA 1F11B 1HAWA 1XZ0A 5C0FB 4XT1C 4XNZC 1X3DA 2CJ3A 2HKHH 3IDJB 3MOBH 2EDEA 5DUPL 5ANMA 1Q0YL 3JV4B 3TO2B 1DJSA 1OCOB 2A74B 2BSCA 3HKZA 1DQQA 2OKMA 3M88A 3MV7D 3N06B 4MAUH 5TFSL 3TNNB 1JNLL 2OMZA 1DQDH 1KXQA 2UZXB 3NCFB 4FQIL 4U0RB 4P04A 4ODWB 1F00I 5KYXB 2IH1B 1AY1H 3ZGIA 2Q76A 5SWSB 4PJFE 2DQTH 3JTSA 2X1OA 2HMID 3SPJA 1WS7A 1CCZA 3HZYA 3LEYL 2F74A 4XWOC 2ZYIA 5B1BB 2EXYD 3QQ9D 5IEKA 4ZUTB 2YPVH 2DQHL 2FYYA 2ZYRA 3AG2B 3QW9A 1T5WA 2YMTA 4TLKA 5FO9A 2Z31D 3TN0C 4NXSA 3DVGA 4FQPA 4WI6A 2KHAA 1N6QL 1IGCL 3FF8A 3PF2A 4LMQE 4XPHH 3I84A 2J43A 2R9HD 3RFZA 4H13C 5LQBH 1H8OA 4BRJA 1AYRA 2FX9H 4PCYA 5KBDA 3RWJB 1CO1A 4D0BA 2GBAA 4DPAX 1QFHA 3O45A 2XWCA 4WHYH 4WFHE 5KS9A 5D7LB 4PV8B 4XGZB 4F7MA 5G5DB 4Y19B 1R9FA 4UV7L 3Q6FA 3CFJA 3SGJA 5KSUA 5I0VA 2NNAB 2NX5A 4H0GA 4P9HC 1ES0A 1L0PA 2G3ZA 3WKYA 3NGBB 1EZSA 1ND0A 5IB5B 4EN3B 2HVJB 2JJSA 4Y2NA 3QDGD 4JRXD 1IJ9A 1E27B 2PTTA 4MMXB 4UB0L 4WEMB 1MCQA 4DP0X 4WQOA 1NDMA 3D5OF 3QIUC 4XVTH 3ZMNA 4EI5B 2K45A 2JKLA 2B20A 1AQDA 1N12A 2G5UA 1RK0B 3RAJH 4M7LT 4G8EB 4CVUA 1SHWA 5D72H 3SKUD 4Z23A 1PBYA 1UQSA 5AAMC 1J88A 1G7LB 1NIAA 4PRDA 1MCSA 1I85C 2BXZA 4K7PL 5D2LF 1AP2B 1X4ZA 1UFGA 1ZA3A 3BW9A 2CKBB 4FD0A 4JDVA 3UP1A 3LOWA 4I89A 2OK0H 4R6UA 2WK2A 4U0QB 4OZFB 2APTA 4G6KH 2G0LA 3GZKA 2ZG3A 2R2BA 5K9QI 3JVGC 2DD8L 4LLYB 4F8QA 1ODAA 2JVUA 4G11A 4BH8B 3TVMD 1A7PL 4AM0Q 4CJ0A 3MRMB 3NFPA 4YO0B 1J8HA 3D34A 3IDNB 1EJ8A 4X6CF 1THAA 3MV8E 1R5WA 1X5KA 1NLBL 3UTTD 4JCMA 3R4RA 1KB5L 1YEGL 2F5BL 3EOYG 3UH8A 1FPTL 2YZ8A 4CN1A 2EKSA 3ZKXB 1R3IL 3MRQA 2HFTA 2ZCLL 4NNYB 3DIVA 2H8PA 4WUUA 3S96A 3N41B 1FL5B 4J7RA 3IJSA 4UV4L 4YHOH 3AB0C 4ZUVB 2GABA 3I6KA 5JHBA 1AC6A 3WHXA 5BZXA 3SE8L 2DH3A 1IBBA 5ESVB 5DHYB 4YBQC 4DGYL 3B6SB 2ITEA 2XKSA 5HDOA 2HUHA 3V5DA 3MZGB 3HLAA 3IJ7A 4X9YA 1BJ1J 1FIGH 3KLAB 4JQVA 4V1DA 2Q3XA 5DMIL 4W6WB 1CS6A 3S8FB 3GHEL 3QJHB 1N6UA 4NQCD 3VRLE 4OZIF 4IKJA 4AH2A 4MXVF 1RMFH 1G7HA 1NAMH 2ICEB 1H8SA 3HFFA 1BMGA 3MV9B 5DSCB 3K8LA 4OFYA 3ZE1E 5CLZA 4KK8D 5F7BA 4LIQE 3C2AL 2YEZA 4MGXA 1Z3GL 3RP1A 4MMZC 1ZLUH 5J3HC 3H9YA 4F24A 4UQAA 3GBNH 2J6EL 1HTYA 3SZKC 4KTDL 3U36A 2VITB 1RUAL 1HHHB 2J2ZA 2XQ0A 1EXUA 5AZEL 1L6PA 1BEYL 4BSVB 1H8NA 3WSQL 1N59A 4NC0B 3FZUC 2WKOF 5J06A 4R9HA 4HJGB 1J0HA 4N4YB 3MBXH 4G7VL 3N40P 4P59H 4V33A 3L9RA 4YAQB 5B1KA 5F97E 3UAJD 2VDRH 2FWLB 1SBSH 4WY7L 1UACL 4ZX4A 4NQEB 5H37A 3GBEA 5KUMA 2YOCA 3WEXB 1W16A 4O5LL 2BRRH 1UOVA 1CYXA 5E8EB 5F6HI 3F05A 3VG9B 4MB3A 3MLVH 3S88L 4JY5H 3M7FB 3WN5B 2EDWA 4C83A 4BFGA 3AACA 1M05B 4J4PC 4XP4L 4MBOA 3AADB 2IANB 3LIZA 2ZOUA 3A6OA 1PU0A 2YAHA 5DDHA 4ZFFA 1VPOH 3PWNB 4RZKA 1U8CB 5EOCL 2R0WH 1CTOA 4GJTB 3L2LA 2PPDA 4E5XB 4EZMA 2YD3A 5I1AB 3SJVA 2WTRA 1QSFB 1FAKT 2FR4A 5JO5A 1EO8L 5KSAA 4LPTA 4KTYA 2CO2A 1RZGB 3Q44A 2O1AA 1JUFB 2AMGA 2GSGB 1E6OL 4BE6A 4MS8D 2DYSB 4DCQA 4DZBA 5D2NB 2ZOWA 3FONB 4R8WL 3RVXC 4TL4A 4G2AA 4JFXB 4LCWD 3TYGL 3BAEH 3OAWA 4DGIL 3GSVA 4XBMA 4FFYA 5ITBL 3QQDB 2EXSA 3DX6A 3D3VE 3LMJH 2VR5A 3FO9B 5IW3A 1U92A 3PE9A 1QLFA 4WEEA 1DEEA 1U3HD 2D8KA 5K9KA 1K8DA 3TZVA 5C0BE 2Y2TA 4M3KB 4OLWH 1IM3B 3EFOA 4XCNB 5F9DC 2PCYA 4MNQD 4JM2C 5FW7A 1AJ7H 2NDGA 2WBJD 3DUSA 4L8SB 5IIEA 2F8OA 1BVKB 3OC8A 5ALBH 4Y1AD 4XMTA 1S9YB 4GSXA 4JM2F 1CFSA 2DWXA 3B7YA 1C8PA 5C08A 1KGYE 2E7HA 1OB1B 3VX0A 1V54B 3B4NA 2AQRA 1E9OB 4IOIB 1QW9A 3DJSA 1FVDB 4HCRA 3T8XA 2R1YA 1KXVC 3EYVA 4GYBA 4RGOL 3BEVB 3SKOA 2NXZC 3HB3D 1SUHA 4FQLH 4W6YB 1XGTB 1ZANH 1BBDL 4IIQC 5EEUA 4NAJA 2O5ZL 5IROA 3VQMA 2BVQB 1MG2C 2ICES 4L4VE 4J6IA 1OXYA 2FAUA 5EU4B 5C0NC 3QJZA 3SDXB 1E9QA 4IOFC 1TJIL 1V05A 3T2OA 4N5UA 1KLUA 1VSCA 4YZWA 2WQXA 5EU3A 1NGWB 3VU2A 3UMTA 4PVBA 1T7WA 3OGCA 3AREB 3U0WH 5KG9A 2AMUA 3FFCB 4I1NB 5EEWA 2UYLB 4N8CL 1FIEA 4CSTA 3QIBA 3BFQG 5T1LA 4HGWA 1CL7L 4QXTA 2YD1A 4C4UA 4Q4EA 2OZNA 4QHMA 3MLUH 1J5DA 1J86A 1IAIM 5LAXA 3X1BA 1XF3A 4HGKC 3V5KB 6FABL 4K3HA 1D5BB 5JIQA 2G4EA 4GQPH 5F3HB 1HINH 4JVWA 3GSQB 3V4VH 4CVWA 4H8WH 4LLVA 5FO7B 5HGHB 1GPOH 4KDVA 1P9MA 3ARFB 2QKIC 1JTPA 4NPYB 5H35B 5C9JB 5DHVH 4P23B 4U3XA 1RZKH 4LU5H 1LQBC 3G5ZB 4W68A 2NY5H 2FJHA 4PB9L 5EO1A 4JFYB 2MQCA 3CZNA 1OQXA 1J9TA 1LO3H 3LKOA 2HA1A 4Z7WB 2OMWB 2VN6A 2I24N 2AJYH 3C6LA 5AENA 3V0EA 1W9XA 1A66A 4EEEA 5BMFL 2F5AH 1MKFA 4QGYA 5FYJE 4UM9A 5L2JB 2EYRB 2GCYB 3O6FA 4XCYA 5FECB 4AMWA 4IGBB 3L4UA 4L4TB 3HI5H 2RR3A 3MV7E 4JJOA 2NYYD 2O5XH 4R4ND 5C0IA 5KYNA 4YC2C 1IAII 1MCFA 5D70L 4XP6L 5HDQL 5HHMB 2YFNA 4GKLA 1XO8A 4QEGA 3RTLA 3G6JF 8FABB 3P9LB 5FYLH 4KUCF 4HCFA 4CC4A 1OCWL 5IB2B 1P4LA 4PVNA 2GSMB 4U1GC 1DBAL 1YEHH 1SXZA 1ZE3C 5L2KD 1LWJA 3L17A 4RVBA 1DQMH 3KJ4B 1Z5HA 3O6KL 3ELQA 4PG2C 4RBPH 4ZFGL 3P73A 4PR5B 2ISDA 5HJDA 3ILQC 1N7ML 4Z3FA 4Y9GA 3JWOC 3RVVC 4LLUB 5KJ4A 4FXKB 5BO1H 1JXKA 2K7PA 1OGTA 2C9UA 4PY7A 2C26A 2XYCA 1YN6B 2NY1B 4PJ8A 1GYAA 4X6DF 3EHBC 2PTUA 3MREB 2H26A 2EDOA 3KXFD 3ABMB 4B97A 2AKRB 4GKSA 6PAZA 1UM4H 3KPSB 4QNPF 1XHHA 4MJID 3VD2A 4JKWA 1NCWL 4OZHF 4A6YB 4FQXA 1KCLA 3BKML 5DVNA 3UBGA 5DZOA 1V3LA 1H3WM 4J3OD 4KROD 4DZ8A 2CHDA 1CF8L 1M2OA 4YLCA 2AJZB 2ZXEB 4M9OA 1VERA 2CCVA 1EBPA 3OKKB 3GSOA 2EE3A 1N5YH 1INDH 4NOBA 4YUEL 5DYOB 3HNVH 1PLGH 2Z64C 1ZHKA 3LH9A 4UF7C 1QVOB 3U9UB 2XYBA 1Q90A 1R1CA 3TWCL 2CO6A 5DUJA 3L3JA 1S9VA 4YDVA 2FECI 2P24A 4QO1A 5SX5K 4U1LB 3UPAA 4JDTH 4QXGH 1A4BA 4N24A 1HE7A 4ZYKB 4IBYA 1MF2L 3VFRB 4ZO9A 4XNDA 1XDTT 4LASH 1E0OB 3X17A 3KL3A 1AZCA 4OQTH 2QVMA 2G60H 2WNKA 4FFTA 1BJMA 1ZT1B 1JRHL 2NY3B 3KPMB 1T1YA 2FQEA 3QUHA 5AZ2H 2X2YA 3FT3A 3NA4A 4NERA 1FLTX 4NUJA 4S0TD 4P46B 2EDHA 2Y69B 3VI3A 2AXJA 2WLYA 5KBLA 3HVNA 3MNWA 1EERB 3Q3GB 2BIPA 1OD9A 3O81A 3LN4A 2UVFA 3H7BB 2WJ5A 3RTQD 5L7XH 4R83A 1BGXH 1FFNB 4HEMA 2ED9A 4Q0XL 4Z7AA 1X5YA 1WEJH 1OAKH 1SJHB 2AGJL 1AGCA 4KPHH 4X9FA 4EI6A 4GRLA 3WFBL 1UZ8A 2XQYK 5IT2H 4L3CB 4P3WA 2WQUA 4JFQA 1OTUD 3CZFA 1YEDB 2WQAA 1GGTA 3M8OL 1EZVX 4S10A 2E4FA 1NKOA 5AVSB 3ML8A 3UZQB 3UAAA 1JPGA 2AK4A 3O9WC 4QOKB 1NWOA 3D51A 5A2LH 4KHXL 4DVRH 4FI6A 5JW5B 4YSCA 1S9XA 1E4XH 1Q72L 2XBZA 3TFKD 1I3VA 2VDQB 1KULA 3QJQB 1IL1B 5D1XC 4JG1L 4N68A 3N04A 2A6IA 4NQCE 3TEXA 3V5HA 3HJ0A 4HF5L 4HFWB 3QJXA 3T04D 1FFPB 1S3KL 1KTLA 3O2DL 3T4YB 1BD2E 5FX3A 2FO1A 2QSQA 1LJMA 3LKSA 3JV6A 2E6JA 5CIPH 1CK0H 4K5MA 5EN2B 5I9QB 2NSXA 3UYPB 1D7FA 3UGUA 5TFSH 3PGCA 1RHHB 4N2FA 2XXCB 3TN0A 2PWDA 3S2CA 3WKML 5CLXA 4LCVA 4OSUH 3FT4B 3ALPA 2CRMA 1LTXA 1UXMA 4WU7B 5JHAA 2A74C 2X89D 3WE6A 4AIXA 3NJHA 2CM6A 2FO4A 3KD4A 2CO1A 2X6BA 3AT0A 2DQHH 1UH3A 5D7KD 3ALWA 1YMMA 1I7ZB 1A64A 1JNHB 3HN3A 2W9EH 2GSIA 2WZAA 3QFJE 4Q7DA 3M17A 5DI8B 2I85A 1Q9LB 1TMCB 3C8KA 1L9RA 1GKOA 1X9QA 3AY4A 4I1RA 1N6QH 4HJEA 1N8ZA 3EXJA 2PP7A 2KQNA 2BIHA 4K07A 2WLIA 5J9PA 3IJHA 3AMKA 5EIVA 3VFGH 1FNAA 1TU2B 3Q8CA 1JNNL 1B6DA 4JY4A 4HPOL 2C9AA 2E56A 4LSUL 4XP1H 4LSDA 1UA3A 3KDPB 3ZDWA 2Y24A 3VXOB 3QIUA 3TGXA 4JHWL 4PGDB 3WMQA 1CD1A 3CZGA 5I19H 2FX7L 5D2LA 4X6EA 4CVZA 4NWUL 5TJWK 4XPFH 3MRNB 4X6FB 4WEBH 1FVEB 1EZLA 3ES6B 2IAMC 4X8CA 4YLBA 2BC4A 4MKMA 2BNQB 1HCVA 1JGEA 4OJAA 5A16B 1R3LA 3GXFA 1QR1B 2EDFA 2WNWA 2ATPA 2ZXDA 4YHLH 3DSFH 5DJYB 2EACA 3HUJB 5DJZB 3UO8B 1F1GA 4KH2A 1H6FA 1OP5H 3NH7L 3NGBC 4RETB 5I8OH 1J0ZA 4WK4B 4PRPB 5GGVH 4I3RH 4ZTPL 3VXSB 2HLFC 2CBQA 4EN3C 1JWUA 4X6CA 3U4KA 5FF6A 1RZ7L 2R4SL 1E5AA 3VXNA 3VXTB 3GIVA 1O0VA 1RUKL 4MMXC 3ZTJH 2Y7QB 4MNQE 4EI5C 3L9YA 4MJ6A 3A3YB 2COVD 3V0WH 4P5RA 1JBJA 3VFTA 4K2UL 4Z3JA 4Y1AE 5D55A 5LGYA 4NNXA 3KBHE 5JXED 2JWYA 3R8QA 3KR3H 1MDTA 1QATA 5LG1A 1J9SA 2RFXA 1YNKL 2YC1B 5HGGS 1GZPB 4NQSB 2CRYA 3IKCA 5CCHE 2H1LM 3AGVA 1NCIA 2R1WA 3MLWL 5I75B 2Z92A 4LMQI 5E8PA 3APMA 5D71L 4NQXA 4X8JB 1GW6A 1NLBH 1T89C 2VDLL 2PXYC 3CD4A 4YHMH 2XZQH 3UABA 3DVIA 4UWQB 4AQ1A 5I28A 3NIDB 1UCTA 1KB5H 3ZN6A 2FB4L 1TYRA 1FPTH 5DRXB 1CGSL 2FH8A 4J1UA 3ZDZE 4CNIA 5DD3L 1HH9A 4OZIA 5A2KH 2CALA 1E50A 2NRDA 1KFAL 3L48A 3EBAA 1T5KA 4PM1A 3VSQA 5BVJB 2FJSA 4Z3EA 1V7NH 3SKNB 1G4MA 1TIUA 1ZHNA 2Y5TA 3QI9D 2VLLA 2X4PA 3OJDA 5HHVH 1YC7A 2O30A 2ZX5A 3UCRA 3QDHA 1G7MB 4Z95L 3SE8H 3PJLA 1S9WA 4DGYH 4E9TA 5GGTL 4MMZA 1PZDA 1NH6A 2H5UA 2JKNA 1R3JB 4PJGE 3EF4A 5E5MB 1EAOA 4MAYB 2W81C 4U33A 3T6ZA 5IJKC 1HWWA 1QMUA 5E6IB 4AL8C 4KMLB 3GHEH 3FUJA 2W0FB 3N41F 5GS0D 3SBWC 2WYHA 5IP4A 1BLIA 4JMXA 3IAPA 5LBGA 2G2RB 5IJDC 2GAZB 4NZRL 3IMSA 1WF5A 3C2AH 1MJ7H 5CR1A 1JPSL 1KB3A 3B56A 5EFIB 2Y06L 3SY0B 1TR7A 4OCXL 4HH9B 3VI4E 2J6EH 4K5LA 4TUKL 5TK4A 4Y5XB 3FCBA 2ICEC 2K4WA 1MDAA 1RUAH 1SHSA 4QI3A 3GS0A 4Z78A 1BEYH 3D0LB 4P3DA 3OKMB 4IIZA 3WSQH 3RILA 1IC4H 3S36X 3FHEA 5LXVA 4M4RB 5I15H 3RUGE 5J57B 1UA6L 5H37H 4J4PA 5I1JL 1DVYA 2ITCB 2C9VA 2C34A 2ZUSA 3R1GH 4HCGA 3FB8A 1NMCB 5FOBB 3TM6A 1BFVL 1S7SB 4FFVD 5D4IA 4WY7H 4UAHA 4M5YL 4C55A 5FM4A 1X5LA 1TG8A 3JWNE 2J1WA 4ABWA 1I3UA 1M7IB 1S78D 3GDBA 3LIZH 1WICA 1AD9B 2JXMB 3KYNB 1A7NL 3FYIB 4OLEA 3VW3L 5DD1L 4PGBA 5FLUA 3FRPA 1N5AB 2Z3FA 1CF1A 3MX0A 3RVWD 2VC2L 3MLTA 5IBUG 5L2KE 1X5JA 2B4CL 2CDFA 5IHUL 5HDLA 4IRJD 3F01A 5TDPB 4NT6B 6CGTA 1K5NB 1HNGA 5DVKA 5HJ3A 3VG9C 5CBEA 1XCTA 1YYLL 3LVEA 3PYCA 2X4OA 3WN5C 4ELKB 1ZT7B 4NX0A 2ZWYA 3B2UC 1EO8H 4GAJH 4JFZH 4OGQC 3PWPB 5HDBB 4O2EB 3BO8B 2QMKA 3NSFA 4PIBA 1E6OH 1KLGB 3KXFE 3QXAA 2ZXQA 4YMPA 2HLAB 1WFUA 1S6NA 4FZ8H 4ZX5A 2CRZA 4QTHA 5AOKA 2FH6A 4JM2A 3IN0A 5BRZB 2CJUL 1UWEH 2HCZX 4RQQA 2ITFA 3ULVC 1SJVA 3WEBA 1VB9A 2AI0L 4LQFL 3H2WA 4EDXA 3K2MC 2FLRT 4JPVL 1YAZA 1PJ9A 3ULVF 3N55A 1MEXL 1F4XL 4QJ3B 3C60C 5D2NC 3ROOB 4CC0A 2G75A 4EAEA 1FL6B 4NO2B 4BZYA 4MX7B 4NUGH 4FQCH 2K7QA 4NUQA 1KXVA 2NQDA 3VSTA 3LKRA 5K33A 3F7YB 1KJVA 2WXIA 3M7OA 2CGYA 2ARJA 2VXUL 2ZKWA 4F2MA 2JB6B 4IIQA 1OGAB 2CKNA 2C9PA 3OKNA 1S7RA 4HCRH 1E2WA 4IOSD 1TENA 2VWEE 4NZUL 4PRHD 4U1IB 4YJZL 3CCHA 3LRGA 3KVDD 4MNHA 5GS0L 2VDKB 3D39B 3DRTA 4HUVA 2EDYA 4LOUD 5DQJB 3H4HA 1CBJA 3DPBB 3MRRB 4L8SC 5BJTA 2A77H 5IMKB 3LZQA 3SD5A 4L1DA 3MRGA 2NCMA 4RGOH 5JDJA 3B2DC 3QEGL 1A3LH 3W39B 5IVZA 1EA9C 1E9PB 2R0KL 1IBZA 4HIIA 1BBDH 3RJDA 3NK4A 3CFDB 4MA7L 4P06A 4QTIL 5IM7B 2O26U 3V0DA 4RAVA 3D9AL 3U0TA 1NC2A 1TZ8A 3RZCC 4PJAF 1QKZL 1TJIH 3CVDA 1TXKA 1ZS8A 4XNMB 3TO4D 5E2WL 1AZBA 1T7ZA 4FLSA 3G3LA 2CJSA 4PJ6A 2ILLA 4JFDD 3N91A 3U82B 4A63A 2VW6A 2QKIA 3S5LA 1QUNA 2ZTBA 1HKLL 7CGTA 4YVUA 5GGUB 1UJ3B 2X4TB 4R4BA 3OMAB 1A6AB 3ARDD 4P2RD 3SDXF 3IDUA 1G0YR 4W9HC 1DL7H 1VADA 6FABH 1BCIA 2X2JA 2VMDA 4PRID 1AQ8A 3TC9A 4AQEA 2ZUXA 1DJIA 1J0KA 2PKDA 4JPKL 5EU6E 5C07E 1RQ5A 1RL1A 5HI4C 4J28A 1HI6A 4N8VG 4G8FA 3WL9A 3EJQA 4XNYH 2FLMA 4NDMA 4BJLA 2ZPKH 4YHPB 4YFEA 5IQOA 2OCFD 1VGEH 1NPUA 4PB9H 2AEPH 1ADQL 3HE6D 2JLLA 5L4MA 4A2GA 3G7TA 3G6JA 1WD9A 5CJOH 1XF4B 3CPUA 2B2XL 2Z91A 3ARFC 4I2XA 2GIXA 1LWRA 4KVCH 3TIEB 4UANA 4AG4L 5KVDL 4GO6B 3MMEB 4P23C 4EXPX 3CXFA 1XH2A 4BFIB 5T1DH 4GIPD 1U8JB 2WSKA 4MJ5B 1ASOA 1U4FA 1D3CA 1P7QB 3BXNA 1N4XH 3GYRA 3SDDD 3BFWA 2H0EA 3EDJA 5CWSA 5AUMB 3QE5A 3KLHD 2X09A 2ADJA 3LNGA 4L4VB 5JPMB 4P8QA 3P30L 2EINB 4F93B 4PG2A 3EKCA 1HHJA 5KYUA 1W2KT 2AQSA 4MVBD 2OM5A 3KVPA 2JI1A 4Z7WF 4WTXA 4X6DA 5D70H 3VXME 2BSED 3ZKND 4ACPA 2NW2B 3IVKA 1FC1A 2XCMC 3CDYA 1RURL 1U8NB 4ATTA 2EC9U 4M3JA 4IGBC 5IF0A 1UWYA 4OZHA 1XGYL 4TQEH 1TJMA 3DHUA 4UQEA 1QFWL 3BAJA 2GTWA 2K9UA 1ZLSL 3O6KH 3HNTL 2EIEA 2XG5A 2WQRA 2OSLB 1N7MH 2H2SC 5I1DA 5HHNB 4PRAA 2Z8WC 3F8UB 3GUTA 2N0KA 2VSKB 3B1TA 1YQVH 4AVIA 4OM1L 3T0AA 1LO5B 1JHLL 5GRVK 5FM5M 5I1IL 3N6YA 4KQ4L 5I2IB 1C16A 1FZKA 1NCWH 3LS5L 1KY7A 2NY1C 2BNRB 1HH6B 3FUHA 5DWUL 5F1OB 5HI3D 2BO0A 1KIRB 4WWKB 1XT5A 4JRWA 4OW6A 2IADA 2OMTA 3CLEL 3UJJH 3EOTL 4Z7NF 4F3FB 1CF8H 1QR4A 1SOKA 4M93C 1MN4A 3FB7B 3FSAA 4OJEH 4POUB 5KSVB 1X5ZA 1WBXA 5FYLD 2CCLA 3FULA 2KPNA 5HYQA 4QHNB 3TWCH 3NFSL 2VLJA 3SBPA 2DPKA 5SV3A 2J1KA 1A1NA 1AANA 1T1XA 3HZMB 3QJUB 4XH2A 5CKGA 1AAJA 1HN1A 1T5XB 2VH5H 3GB7B 2BP8A 3JVFC 2DMKA 1AXSB 1RZJH 5G4OA 3RDTD 3UEQA 1I8KB 4R3SB 1ZVSA 4LSSL 3OG4B 5GJSL 2DQJH 2X7LA 2NQCA 2EDMA 2CGZA 1VF5C 3NIFB 3X2QB 4PRNB 3NFNA 3QT2A 3HMWL 3MJ7B 3LEXB 3K71A 1XSOA 2NXYD 1CR9L 2O61A 5I0WA 1CQKA 1MW0A 3Q5OA 1G4RA 4LEOB 2OR9L 2XC8A 2BOBB 1GJIA 3EH4B 3VTAA 5FO8A 3FPYA 4JAMA 5D7JD 1TEGA 1JZ6A 1HOCB 1NBZB 1UD3A 2NY3C 3WTYA 1DUYA 4L37B 3FSWA 4RFOH 1HNFA 1Z7JA 4YDLC 4ZMPA 3ZO9A 1AQKL 5FR3A 2BH0A 3P4MA 4P46C 5E8NA 4Y4HB 3D09A 4FNTA 3DURB 3SOTA 1IKNC 1E4KA 1CLOL 1HXMB 2DS4A 3QNYA 4J5VA 5IQ9B 4G9FB 1A6TB 4KU1A 4FABL 4JFEE 4KY1L 3ESPA 4KXBA 4YNYA 1MW3A 1W0VA 1P7KA 3QJTB 4H8HA 5D1XA 2E9IA 4U3SA 4JRYA 2XPYA 2N56A 4FA6A 2BWIA 4N26A 2QBWA 1AH1A 3D0AA 1X44A 1NCAL 3A6CH 4ZTOH 3KCPB 3FKUS 1HCFX 5D1ZD 1H15A 5C3LD 4F5CA 1P5VB 1O7DE 1GSKA 1XL6A 3HS8A 3JQOB 5B39A 2J12B 4P2CG 3DRQB 1QRNB 4G8IA 4AYFB 4ZOCA 3VTTA 3QEQA 3DX8A 2UX7A 1F11A 3CFBB