4NERA

Multicopper oxidase cueo (data1)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Blue copper oxidase CueO
publication title New insights into the catalytic active-site structure of multicopper oxidases
doi rcsb
source organism Escherichia coli
total genus 136
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2013-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4nerA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4nerA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4nerA03
5EHFA 1AOZA 1ILSA 2IH9A 4N8UA 2HXAA 1OF0A 5ANHA 1W6LA 2UXTA 1NINA 3N55A 3FU9A 1E5ZA 1HAUA 3L45A 1GY1A 3IEAA 1OCCB 1BXUA 3UAAA 2UXVA 1AG6A 2CCWA 1PZBA 4HZ1A 4W9ZA 2CBPA 2UX7A 2XLLA 3CVCA 5I6MA 3NJHA 3QJUB 3UGEA 3TASA 1AACA 4PAZA 4A66A 3IE9A 3T6ZA 2BP0A 1MG2C 5I28A 4NERA 4KO9A 2UX6A 1JERA 2XUWA 3UACA 2FTAA 1F56A 2Q9OA 2X87A 3IN2A 3NSDA 2IH8A 3PPSA 3NJMA 2B3IA 5I26A 2QDVA 2XXGA 4DP8X 1SHWA 1GR7A 1KCBA 1V54B 3NJJA 1BXAA 1ASQA 2FNWA 2VM3A 2YAEA 2GC7C 1MZYA 3KW8A 1JZIA 1AR1B 2OCCB 1V10A 2NRDA 5IY5B 1XB6A 3AZUA 4HHWA 1PCSA 2CJ3A 3CDZB 1KDJA 3RYMA 2QT6A 1AQ8A 1V55B 3PAVA 2VN3A 3NJFA 2BHFA 1KGYE 3OMNB 1VLXA 2AZAA 3GDCA 3X1NA 3H56A 3FSVA 4DP9X 1NICA 1URIA 2XV0A 3OM3B 1PNCA 4E9VA 1W6WA 4BXSV 2JKWA 1WS8A 1L9RA 3CVBA 2VW6A 3WNIA 4GY4A 3NSYA 1X9RA 4A67A 1E5YA 2FQEA 1GS7A 1QNIA 1GYCA 2W88A 4BWUA 4ZK8A 1J9TA 2R7EB 1IKOP 1ZIBA 4E9WA 2WSDA 1DYZA 2AANA 1SFHA 1IUZA 1OE1A 3HB3B 2HX8A 1A4BA 3FYIB 1CUOA 4A2GA 1N70A 1ZV2A 1PY0A 1GS6X 2J55A 3ABGA 3NT0A 1A8ZA 4G7QB 3S3BB 3ZDWA 2GIMA 2BWDA 7PAZA 1RZPA 2IDSA 2FJSA 1PNDA 2VW4A 4KO7A 2IDFA 3EH4B 3T6XA 3FSZA 3QQXA 1J5DA 3AG2B 1KCWA 2QDWA 7PCYA 1CYWA 4TXVB 4FAAB 2XWZA 1OE3A 2P80A 2QPDB 1HFUA 2GI0A 4KNTA 4E9YA 4HCFA 1AZUA 4BK5C 4WTQA 1SDDA 1I53A 3ASOB 3S8FB 1WA0X 1GS8A 3TU6A 1BQ5A 4DP7X 2PCYA 4KNUA 1AIZA 1BQRA 2PPFA 3QJTB 1TEGA 2B08A 3QPKA 3CG8A 4G72B 3OQRA 3ABLB 5B7EA 4YSOA 3NJKA 1WA1X 3NJNA 1PLBA 1JZEA 3SBRA 3V9CA 4M3HA 2PCFA 2ZWNA 2W8CA 1CYXA 4A2DA 1NTDA 1W8EA 3GYRA 4GYBA 2VW7A 2IDUA 5I6LA 1JXFA 3BQVA 3TA4D 5I5MA 2PPEA 1OCOB 1SHXA 5I6PA 4GXFA 5F7BA 4A2FA 4YSDA 1NPNA 1NPJA 2ZXWB 4AKQA 4KO6A 2IWFA 2I7OA 4YSUA 2HRHA 4AKOA 2YAOA 2JFCA 4DP4X 2GSMB 2ZOOA 3DIVA 3IBOA 1JXDA 1PLAA 5FC9A 4F2EA 3NJIA 1L9PA 4YSTA 2BP8A 4N4YB 5AZUA 4YVNA 2DYRB 2PP7A 2BP0B 1T5KA 3DTUB 1RZQA 1NDTA 1JZHA 2FQFA 4A2EA 2H47C 2YAFA 3T71A 4YSCA 3AG1B 4JHUA 2VM4A 1OOWA 2LLNA 3NSCA 2P80D 1JXGA 3TBBA 2IWEA 2PPDA 5PCYA 1JZGA 2I7SA 3T6WA 1UATA 1PLCA 1RCYA 5TK2A 4E9SA 2YQBA 1M56B 4GP8B 1KBVA 2PPAA 2CALA 4UAHA 1MDAA 4HCGA 3U25A 5B7FA 4EF3A 2TSBA 3FPYA 5D4IA 1A4CA 1AG0A 4QKTA 3WKPA 2YAMA 3H4HA 2GBAA 1DZ0A 4E9TA 4UANA 1NZRA 3EH5B 3MBWB 2YAPA 3FYEB 3QJVB 4NAJA 2OV0A 2GB2A 1RKRA 1GSKA 1MG3C 3CDZA 4KOBA 4QLWA 3TBCA 4JKNA 1ILUA 1NIAA 2BW5A 2XVBA 3AY2A 4KOCA 6PAZA 2HX9A 3PLYA 4YSQA 1ZDSA 1NWPA 1NIBA 2WO3B 2DYSB 3WNJA 2VSMB 4JHVA 4AZUA 4CSPA 3FS9A 3ABKB 3DKHA 5AKRA 4F7KA 3QJRB 1OCRB 2BW4A 1TU2A 1ASOA 2VMJA 4BDVA 5I5IA 2GHZA 1CC3A 1WA2X 3ZX1A 3IN0A 6PCYA 5I6NA 1E30A 2R7EA 3FT0A 1BQKA 2H5UA 4WKXA 2YXVA 1L9TA 1PZAA 5E9NA 1WS7A 3X1BA 2A3TA 2X88A 1JVLA 4L0PB 5PAZA 1CURA 1AZRA 1E65A 2DWSA 1FA4A 2YAHA 1EZLA 3MX0B 1PAZA 4AKPA 8PAZA 4ENZA 4DP1X 4G71B 2J5WA 2Y1AA 1JVOA 4YL4A 1NIEA 3EHBB 1SNRA 2YAQA 5B3SB 4CSZA 2FT8A 4YVUA 1L9QA 4PCYA 1XMEB 2MTAA 1J5CA 1JOIA 3WI9A 1AZNA 1OE2A 3T9WA 4YSSA 2J57A 5I5JA 3X1FA 2IDQA 1M9WA 3X1GA 1AS8A 4AI7A 3G5WA 3CZUB 3ERXA 3FU7A 3CVDA 1QLEB 3UABA 2E86A 3V9EA 5AFAA 2VSKB 2WO2B 2XX0A 1FFTB 3UADA 2JXMA 4X4KA 5B7MA 2XX1A 5B1BB 1OV8A 3S8GB 2Y69B 1AS7A 2XV3A 3OMIB 3FQ1A 1SF3A 2EIJB 4HHGA 4A2HA 5TK4A 3AG4B 3JT2A 5F7AA 3OD3A 1IC0A 2IAAC 4DPBX 3ZIYA 3ABMB 1PZCA 4DP2X 3FSAA 2XYBA 2IWKA 2BP8B 2HLEB 2AVFA 3ZBMA 1ID2A 1ZDQA 4DP6X 1ET8A 1XB8A 4G7SB 4YSAA 2IDTA 3WKQA 2DV6A 2MRYA 1B3IA 1KBWA 1ET7A 1FWXA 2CUAA 3ASNB 3N2JA 4YSEA 5A7EA 1A4AA 1JZJA 4KNSA 4DPCX 1SFDA 1BYOA 3C75A 1R1CA 3FU8A 5I6KA 2OJ1A 1PF3A 1J9SA 2GC4C 3PCYA 4M4RB 3FPXA 1AZBA 3FQYA 4E9XA 1PMYA 2EIMB 3EF4A 2QPEB 1TEFA 4HIPA 1KYAA 4Q8BA 3T6VA 1EHKB 1ETJA 2DWTA 4G7RB 2FT6A 3HEIB 2PP9A 2BWIA 1J9RA 4DPAX 1M57B 1AANA 2BO0A 3H4FA 2XXFA 3S3DB 2ZONA 2BZ7A 5D4HA 3X2QB 3FQ2A 4E9QA 5I6OA 3D12B 2FQGA 4DP5X 1QHQA 1J9QA 3PXLA 2FQDA 5B1KA 2HX7A 1N68A 3AG3B 4MFHA 2BZCA 1GY2A 1XB3A 3EH3B 4UF7C 1JZFA 4E9RA 1BYPA 4F2FA 1AS6A 2FT7A 3SQRA 4RH4A 1HAWA 1E67A 2XV2A 4AX3A 3NYKA 1ADWA 1ZIAA 2H3XC 1KV7A 3UAEA 2XU9A 4BDVB 1A65A 2PPCA 4G70B 1ET5A 2PLTA 3NJLA 1MZZA 4DP0X 3NJGA 2UXFA 4HALA 9PCYA 2TSAA 2UXGA 3X1EA 1YLBB 4P5RA 1BAWA 1SJMA 3BVDB 1SDDB 3NP4A 2EILB 1SF5A 3WIAA 4P5SA 4BWWA 2I85A 1BEXA 2PP8A 4NB7A 2HRGA 2CAKA 1GW0A 4W1TA 2EINB 1NIDA 3WG7B 2HZHA 2YXWA 1IBZA 2YARA 1NIFA 5D4JA 4HCIA 4HAKA 4Q89A 4FA7B 3KW7A 1X9UA 3SBQA 1L9OA 4GP4B 4BWTA 5LDUA 1BXVA 2J56A 4BXVA 4YSPA 2FWLB 1IBYA 1ZPUA 1ASPA 2Q5BA 2AZUA 5B1JA 1A3ZA 4K9JA 3FSWA 3FU7B 1KDIA 3QJSB 2AFNA 1L9SA 4KO5A 4GP5B 1OCZB 3GXUB 4A68A 4YSRA 2RACA 3PAUA 3PAZA 1WAEA 3AW5A 3NSFA 5B1AB 2N0MA 3S3CB 2DY2A 1AAJA 1NWOA 3NP3A 1AZCA 3OMAB 3QJQB 2EIKB 3JTBA 1TKWA 3SBPA 5B1JC
chains in the Genus database with same CATH superfamily
5HBBA 5EHFA 3GGWB 5DQJB 4OGAC 3BMWA 5E51A 5AW8B 3APNA 4KRPB 1QYGL 1N8ZA 4Z18A 1QW8A 4QHMA 1EVUA 1JSYA 1UH3A 2XQYK 3IU3A 5E2VH 5GSVB 3KPNB 2Y36H 5JLZA 1MREH 1M7DB 3A3YB 5C0IA 1IJNA 2AQPA 4M48L 4BXSV 2W07B 2RH0A 3K46A 5C7XL 3W39B 4OZFA 5AAPA 3QNFA 2BNQA 1KUMA 1R19A 3Q48A 3R7QA 4EI5A 1TZIB 5I23A 4R0LC 4S11A 3U4KA 2FTAA 4JPIB 3VRJA 1UGKA 3UMTA 3SE3C 1P5UB 5C0GB 4Q4IA 1CD1A 1DQLL 4DP8X 2O4EA 3WNNA 1NGYB 5J6SA 3WIFB 5G5DB 3B37A 5DFVD 4JNXA 2G75A 5ESVB 2WXGA 4LIQH 3D09A 4MJJA 4IRSC 1WG3A 4W9HC 2FO4B 3I50H 2IJ0C 4X8JB 3KYNB 3S37H 4L4TE 4PJ8B 4FQXD 1YEHH 4LVHB 4M7ZC 4MA1B 4GW1A 2YPLE 2OXHB 4OFDA 2ICES 5T3XD 3W37A 3N40F 4FTVB 4RZKA 3HN3A 3RL1A 3S88H 4IMLB 3JV4B 1GAFL 5H37G 2YSTA 3MPCA 1L7TL 2Z7ZA 2J6EA 3N42F 4HH9A 4ANXA 4UAOB 2BP5M 1ND0A 3P54A 5IQ7L 3FOMA 4DP9X 3H1ZA 1IT9L 5KVGL 3CN3A 3WJJC 3LXBA 3MRFB 3VDCA 3FT4B 1DLFL 4I4WB 4PJ9A 1JWMA 4IU3B 5CJBA 2YA0A 4YGAB 1BX2B 4R2GB 1X9RA 3G5YA 1IEAB 4ONGH 2PXYC 3GHEL 4HUXB 4ZMNA 1OF2A 5JW4N 1R5IA 2YPVA 1U2YA 1IKOP 3AM8A 4U3SA 3Q9PA 4CILA 2IXQA 4W9DC 3D39D 4B7LA 4U1MB 5ICXB 3QEQE 4HG4J 3UPRA 2CR3A 2FUQA 4I1PA 2XTJB 4TRPH 5B3JF 1LK2B 3QFGA 2EVFA 5KVDL 3MJ9A 5IJDC 3FB5A 3B6SA 4Q9QL 1UCBL 2BWDA 3IDXH 2F53E 4DESA 2EXWD 3MREB 5GGVY 5CR1A 5C97A 1T1YB 3C5ZB 4HAFA 3VG9B 4U6XA 4KO7A 4NI3A 5GGSA 2IDFA 5G2NA 4PP1D 4FADA 1ANUA 4XCCH 3RX9A 4G59C 2VRQA 3TPUA 2VLRA 2D9QB 3HZVB 4UTBA 4N8VA 1U4EA 2MOGA 2DYPA 3B2VH 5EPMA 4ICXA 5ILTH 5JR1H 3QDJD 1WA0X 2CGZA 3QEGL 4XP1L 5JOFB 3MA7B 4OZHB 1S5IH 3LMJL 2CO3A 3BW9B 1BQRA 5JO5A 1HQRB 2WBJB 3NPZB 5EORH 3WS6C 5JXAH 5IQMA 4PJDA 5JW5B 4XP4H 1XF5A 4XPAH 3V9CA 5LGJA 2EUXA 4LMQE 1XIWB 2DJMA 2UY6A 2W8CA 2YK1L 3EDKA 2DKUA 3ZTDC 2VLKE 1RZKL 5JYLA 3WNMA 5LXVA 1WIOA 1A6WH 4PJ7A 1U95B 2VW7A 3FRUB 5GRJH 5EV7A 2YGOA 1J18A 4P5KB 4IHOA 4UTAA 5DJ6B 3CFEB 2VSCA 3X13B 4ONGL 2PYFA 1HNGA 1HSBA 3GMRB 1R3IH 4JFUA 1NPNA 2BNRE 3ARSA 3CZSA 2PTVA 1SOQA 3V4VB 1VCAA 4PJGA 4PIBA 3GO1L 4F3FA 3MLVL 1JYVA 4AKOA 2OI9C 3HNSL 2AEQH 5DTFA 2Q3AA 3HG1E 3QEHA 4Z76A 5FO7A 4P9HH 4G7YL 2P5EA 3L1OH 3MBXL 3TOPA 1JPEA 5IFHH 1A3QA 3OZ9H 4Z5RA 2CHDA 1RIVL 4KHTH 4ES9A 5GISL 5KSAA 1G9HA 1NCCH 1RMFL 4TV3A 2H47C 1T6BX 4X6FB 4KUCD 3HN8A 3L7FB 3VQLA 4E41E 3VI4F 3K6SA 2GJ6A 4JX0A 1U4FA 5F7LB 1EEZB 3QUYD 1KXQE 3KWXA 1V05A 1KBVA 2YWYA 3RGVC 1W80A 4MJIE 2ADJA 2JE8A 1B4RA 1DVFC 1YJDH 1DUZB 1AZZC 4GBXC 2OMUB 3BPNC 3EHBD 3N0AA 4CC4C 2XQBL 2WLIB 1JPSH 4WJG3 1M7IB 4C56D 4LB8A 4HIQA 1QFOA 4F33B 2F0CA 2PF6A 2FVNA 4XX5A 1GTNA 3S2CA 1T4WA 4GXUN 1ZLUK 4XO3A 3VYPA 4PJBA 5IMMB 2OSXA 5AB2A 3OKEB 5C0RL 3PP4H 1TTBA 4HEMA 2FRGP 2HJKB 4J3SA 4LLMA 4GSDL 1UXWB 2VN4A 5FW7A 2MWCA 2C26A 1R3JB 4PH8A 4ZUTB 4MD5A 1HILA 3MUZ1 2H6UA 3UTQA 3FRPB 1TJIH 3KLQA 2RR3A 3JVGA 4HWZA 3ZVVA 1MHHA 2VR6A 5DF0A 5IUCA 3SCMB 1E2WA 2QJDA 5D5MF 1C7TA 2GUOA 4XO9A 3KM2A 3O6ML 4ZTPL 1C8PA 2EE0A 1F18A 2HG0A 3BGMA 4N5UA 2P8MB 5DK2B 3UO1H 3TCLA 4BEIA 3HHMA 4GUPB 3M1CA 4JFDB 3SDAB 3GXDA 2RHEA 2JVUA 1JGLL 3K0YA 4K9EH 5DCCA 1JXJA 3FT0A 4WNQB 3BQUA 1IC4L 3IGUA 2YKLL 5EFIA 1FAIH 4RMSA 4MDJA 1F58H 4EXPX 4AL8C 3C09C 2IIJA 4NC1C 4AE1A 2BNRB 3EOAA 4M03A 3H9SD 5DC4B 1B9KA 3WHXB 3PXHA 1T0NB 3FO9A 5JPNC 3ZHLA 4L4VD 1YEEH 3QDMD 2P3YA 1BFOA 1AZVA 2V0AA 3O6KH 4N9OB 4R97C 5DUML 4BCYA 1PVHA 4XZ4A 5C8JA 5GS1A 1EWHA 3H2WA 5DC2A 2Y6TE 1QBML 1JVOA 1KCRH 1E6OH 2YUWA 1LD9A 2W0KA 2YAQA 2AVGA 2BMKB 4S1QH 3LKQA 3N43F 3HZMA 1HHHA 1KG0B 1GYUA 2R0ZL 4IDJH 5D5ME 4EVNA 2F7QA 5KYXB 1IM3A 4TUKL 15C8H 1YYCA 3MUUA 3IAGC 2PCFB 3CLEH 4LGPB 5KG9A 1LLAA 3N04A 5ERWA 2BSSA 4L8DB 2ZNXA 4P5TC 5I5JA 4QNPF 5KVEH 3KLAB 3EO0B 3F12B 3L95A 3ZW3A 3HE6B 3SPCA 1YQVL 2HVJB 1L5GA 2F53D 5E08H 1HXMB 2NY6B 3K2IA 1OAQH 4MJIB 4ONFL 2BX5A 3AS3A 4FL4B 4R8WH 3UADA 4C47A 4I18C 2JXMA 2ZKYA 1RUPH 1E8WA 1IQWL 2PNDA 5D1ZI 2MPAL 4WENB 4RMRA 2QMJA 4W6XB 4NRXA 2K45A 3U4BH 3FQ1A 4G6ML 4Z7WB 5EZJA 4ZTEA 4J4PD 2VB5A 3UTPD 5BVJB 2HT2D 5LKNA 1DN0B 1IC0A 1RU9L 3BFWA 1Q38A 2FWOA 4JZJB 4Y19A 1M2OA 2JQZA 3IKCA 4L8SB 2AVFA 3FDWA 4WI7A 4Y4FA 4DP6X 3IE4A 4TN9A 3MA9H 3UG3A 1B3IA 1O7SA 1SEQL 2OYLA 4G9FD 1QA9A 5D1ZA 1UXSB 4KQ4L 3O2DH 4DJMA 2B16A 1V3KA 5EH1A 5FGBA 4KV5E 4AXWA 4R7NB 5CMAA 5FHBH 1J9SA 3V6FB 3QQDA 4EDXA 1A6TB 1EJ8A 2QTVA 5TDNB 3QZWG 5DQ9A 3WKYA 3NEXA 2MNJB 3IK2A 3JWDH 1RFDL 5A2AA 4LSQL 4Z3TA 1MJ7H 2CJTA 3BEVA 3JWNG 4HIEA 4UB0L 3LYRA 4G7VL 2KZ1B 2A6IA 3MODL 4A6YA 2BVQB 4G7RB 5LAPA 5SWSA 1I1FA 3GXIA 3DV4B 3BT2H 1OSPL 4AC4A 3HG1D 3PXJA 3GC3A 2YRLA 2ZONA 3OB0H 2DD8H 3FQ2A 3HC4L 2Z91A 3BISA 3U48A 4PBXA 5LBSL 1J9QA 1QLRB 4NRZA 1W8OA 3QEUA 1TF4A 1A6AB 1YAZA 2BZCA 4CDHA 1DFBL 2EIZB 2ZYHA 2VXQH 3J27A 1ZEAL 2ZCLL 3KXFA 2PWDA 3WY3A 1F4XL 1NBQA 1XD1A 2FJGA 1AS6A 2WQRA 3EJQA 3MRRB 4H26A 3S36X 3QRFM 3QXTA 3HMXH 4LAJH 3GNMH 5C0CE 3ZT6A 2CJUH 3OPZL 5BNXD 4MQTB 4PU2A 2B4CH 1YEJH 4LL4A 3V4VH 3QQ4B 4G1MB 2KZBA 1K5NB 5HY9A 5DSCA 1T1ZA 1A6VH 1E28A 4XOAA 5DZNA 5FHAH 1FP5A 2ZYSA 4ZDHA 1NOLA 1IO4C 3STZB 3ALXA 1XR8B 1BA9A 4FDWA 3NQKA 1HI6A 3IRZA 3BWAB 1ZKAA 1AIFA 1J10A 2XV6B 4MD4A 3V0AC 1CBVH 2ZKWA 1YLBB 4B9JA 3IBEA 4JM4L 4K55A 3ROOA 4GAAA 1H0DB 1H3GA 2J88H 4OZFG 5CEZE 5I1LA 3MRJB 4P5SA 1NOFA 2F54B 3QJHB 1QFUL 1CI3M 4NUQA 4XCNA 5GS0H 3OHXA 1OANA 1NCBL 4JFYB 5CZRA 4MS6A 3LSOB 1QQDB 4PGBA 5EU4A 4IKKA 5TFSH 3UTSB 3V52H 2R23B 1TQBB 2IWGA 2UVEA 3O8XB 3O3EA 4EN3C 4QRTA 3NUKA 5DJ0B 5JIIA 4K7PH 3ECBA 3V6BR 4WGKA 4BIKA 5BV7B 1WZLA 4JM2B 4HCIA 2XG4A 2KS0A 4F9LA 4AMXA 4ZFGL 4FQXA 3DRTA 1YEDA 3NG5A 3TZVD 2MKLC 1UH4A 1IBYA 3DO3A 1ASPA 2O93L 4NZFA 4X6BB 3QNYA 1AGBB 5GJSL 2A74B 5E4AA 1UOKA 2WNWA 3O11A 1ONQA 4PWHA 2EDTA 4MCZA 1S3KH 3AW5A 2F1EA 1IBBA 3QQNA 5F9JB 2FWSA 4B9ZA 3NP3A 4B9GA 2OZ4L 2D7NA 2OL3B 1PAMA 4P3WA 3I2CH 2IDCA 3IMRA 3UYPB 1XXFC 1SHMA 2E7DA 1VFBB 1D5RA 3S8WA 2LU4A 2P42B 3VYNA 2OSWA 4NNPH 1JHKH 2JWYA 5D7HA 1G5GA 1NOAA 2X9ZA 3COOA 4NAQA 3DOIA 3IMVA 4JO2L 3UDWA 2HKHH 5JIPA 3UAAA 4XXDB 1UA3A 4KZ0A 4F80A 1GYVA 3D39A 1CDGA 3HBZA 4G6JL 2Y2TA 1KJ2B 2VDNL 4G11A 2BSED 3KPLA 4JN2B 2EVGA 1SJEA 3T6ZA 3F5WA 4CBZA 7TAAA 1AP2A 1UKQA 3CLFH 1IGJB 5C86A 4YDKL 1MFEH 5KS9A 2IH8A 1BZOA 1RY7B 2JF1A 3B43A 4KKNA 4XNAA 2CMRH 2RQEA 4B27A 1AGCB 3H9ZA 1GR7A 1KCBA 1YEKL 3CSYB 3NJJA 2EC9U 3ESOA 4X42A 4ODVH 5C07D 1ZT7A 3AAZA 3L5IA 4ERSH 4K7FB 4IBLT 1KB5B 4G9DB 1XF2A 4OV6F 2BRRL 1VFAA 3QDJA 4LLYB 4N8VG 5AB0A 2G60H 3VWKC 5C1MB 1ESOA 4KKLD 5HI3C 1PCSA 1Q9LB 3QW9A 4H8WH 1NFKA 2QT6A 4JHZA 1A47A 1R6VA 3BT0A 1KLFB 3PAYA 4KC3B 2CHNA 3DV6B 5E6ID 5HYSB 2HJFA 3MUY1 1IGMH 5F3BB 4QGYA 3T2PA 3MCKB 5C3IA 1GZHC 4LKCA 4RZCB 3WKML 5IJBC 3UMNA 1JMXA 1RUQH 4IM8A 3SKOB 4LLQB 2X5PA 4X99B 5FOBB 1KTDA 1F90H 3X14B 3LPFA 2O61B 3MRCA 2I26N 1TU2B 5C9KA 1RJLB 5HGHA 1GS7A 1E2ZA 2XRAL 3ARDB 3ESUF 4ZS6C 1YMMB 5FCUH 1LILA 3OPUA 5IMKB 5DRNB 5IB3B 5MEPB 3B5HA 1XGUB 3GSQA 3U0WL 2HX8A 4KI5C 3R0MA 3ECUA 4ZOAA 1PY0A 4G8EB 4H5SA 1J0HA 3QFDB 4GRWF 1VGEH 1ZS2A 3VMPA 3WO4B 4HWEH 5J6GA 3K2UL 4PV9B 4OQTL 4HJSA 2BSTB 5TE7L 2WYHA 4O9HH 5C2UB 5I8CA 1CICC 1NFDB 3PV6B 1J11A 1KPUA 4NWTH 4WFGD 5L4IA 3DYOA 2DICA 2UWEE 5K5YA 3QPXL 4UQ3A 1HFUA 3QUYA 2AKRB 2GAZB 5IB2A 4FFZL 2VIRB 2FYVA 1CPUA 4JG1L 3L3KA 3BUTA 3BUDA 2HG5B 5AVRB 4PV1C 2JB6B 1ZOXA 4DGWC 4L5FE 4Z7VE 4RA3A 3AFLA 5DZPA 1N18A 3D3VE 1OGAD 2B08A 3MLSH 4LSTL 1ZXQA 2M1KA 1ZS8A 4BSWB 1ZK5A 2GJPA 3DOSA 1D5MB 2ITEA 2Z7UA 3B3IA 3D1MC 3U30C 4C56A 1DE4B 5HHPA 1J05A 2ZXAA 3VDAA 1WK0A 2Z65C 4TF4A 3GQFA 3IFPB 4HD5A 4U1IA 2E7LA 3ZE1F 1KLGA 3BCDA 3DNKA 1EFQA 4M6NH 5I6LA 2HFFA 4NQDE 4ORGB 3W0WD 2ZZUT 5FO9B 3HI5L 3PABA 1E90A 1UM6L 1XTLA 3KYKH 5CR8A 2D73A 4PGJA 4IRJB 4M7JL 4U4IA 4XBPB 3U9PL 2O6PA 2YN5A 4Y9FA 4PV8B 1VFMA 4YC2B 4Z78B 5AAMA 5KYNA 5I1CL 3HFFA 1JUFB 4DOHE 4MAYD 2TRYA 2GSMB 5FC9A 3TX4A 1TVBA 3NJIA 5CWSB 3I9IA 4YSTA 5DT1H 1CF1A 1DQIA 4MKTA 3NZ8B 4HSAC 1E42A 3KPQB 4QKXB 5G4MA 3VTTA 1SYVA 3CZKA 4R26L 4R4NC 7FABH 1PW3A 1KNOA 2APTA 4XZUB 2VXVH 1E43A 2Q7AA 1DEDA 2PKDA 3RNQA 4AK1A 1MPAL 1IQDB 1UATA 4YDLB 3H9SA 5E8PA 5HHOB 4HMCA 5K9KA 4L4VA 3V8CA 3QDMA 4BJLA 4YNYA 1QNZL 4NIKB 3QUXB 4Q6IC 2BRQA 2QQNH 4WO4B 4N2CA 2L3BA 5ELIA 1NCAL 1A4CA 1FZMA 3WKPA 2CHZA 1IL1B 2NXYB 1FZOA 1KB9J 1OQOA 2XG5A 2FD6L 1XCWA 4XMKL 1CFSA 5BV7H 2VH5L 4FNLL 5IVZA 3C5SA 2D3VA 2DBLL 4MSWB 1JZ6A 4IU2B 4HS3A 1KELH 4JO4H 1Y1DA 1RJYA 1NAKL 4ODWB 3HIZA 3WJLA 3D4GA 5FPIA 3BFOA 1FVCB 1QSED 1VDGA 1DJSA 3IAPA 4GXVH 2F53A 2R0WL 1NAMH 3CN1A 5F3HB 4PLJD 1PJ9A 1OHQA 2JKRM 4TSBH 6PAZA 1J8RA 3T09A 2OL3H 3HR5B 1MIEH 4KJYB 3T0EC 5I16B 3D3VB 2YD8A 5DRWA 3EZJB 4PRPE 2DQJL 3Q6FA 3KBFA 1WISA 4WW2B 5D1QB 3RY4A 4YHNB 1XBRA 1EXUA 4J4PA 5JHLL 4P46C 5E7BA 1U8NA 4PY8I 5I75B 4G80A 1KN2L 1NSNL 5IGXL 1IE4A 1U8QA 5E70A 2CLRB 4GI8A 4Y4HC 3K71B 2CU9A 4K3GA 4BDVA 4WDIB 1JXKA 2FECL 1JZ7A 2VZVA 6PCYA 3RGBA 3ZKMC 2W9DL 5F44A 1X5ZA 1SVZA 3SODB 3OWRA 4F5CA 1KJ2H 4BFIB 4X80L 2XTSA 4FKHA 1LO5A 1XF3B 4G9FA 4RMTA 5I6XB 3RPIA 4OIIH 3TIEB 3DIFB 2FJHB 1OTSC 2A3TA 3Q1SL 4AIZB 1JV2A 3B5GA 5TE4H 4LSVL 3OKLA 1G1KA 4AIOA 4DOHB 1JFQL 1PAZA 2H2SD 1FFNB 3FUKA 3PFUA 1OSZB 4Q14A 2ZCHH 2EYRA 1FO0L 4CSTA 2CHWA 2VXSH 1BEYL 3EGXB 1V7NH 4D9RD 2A4EA 1HH9A 2KYIA 3NCWA 3WMSA 3LRLA 1UWEH 1KB5H 4P2CG 3W56A 2VL5A 4N20A 4X7FC 4R5XA 3GMLA 5C0BB 1OP4A 4AW4A 1XMEB 4H88L 3GLZA 4M5ZH 4NBYB 3D0LA 2IG2L 4UU9A 3HG1A 1FIGL 4DFIA 1YA5A 2Z0BA 3FQRB 5T3ZE 3L7EA 4LASL 4UM8B 4ZT1A 3QIBB 1MCDA 1Z6JT 4MA3B 2XHNA 2CSPA 4PG9A 4PVBA 1ERNA 2GK0B 5CN2A 3GB7B 4QY8B 1B2WL 4QO1B 3WE1A 5F96L 1VZIA 5ESAA 2K9FB 2JB5H 3QDHA 3QARA 4FOMA 1OV8A 2KPWA 4PJFF 5B1BB 4A7VA 2XV3A 3MU3A 1SYSA 3EOYG 4UIMB 3P4OA 2GJRA 3SDAD 1RURL 4XI5C 1UD2A 4U1NB 3OD3A 4H0HB 4DWHA 4HZLA 3FB6A 4M93C 1P4UA 4Z0XA 1UQSA 2Y23A 3SGDI 4QF1A 1J5OL 2K6YA 3P2DA 3VXOB 2YMXL 2EEXA 2XYBA 1W9XA 4XXCA 2A9MH 5GS2H 5IVXB 3U1SL 4RIRB 2GSGA 1MH5B 4G7SB 4KX7A 3MCLL 2R4RL 1ECZA 1FWXA 4K3DL 3K6OA 5K1NA 5J3HC 3TIDA 5DJCA 2GBVA 4PJIB 5E1QA 4MMZB 1XGTB 5EC2B 4MA7H 3V4UL 4LPYA 3NN8B 4NNYB 1I1AB 1TCRB 3PCYA 3RVVC 1UENA 5F1IA 5C2BL 3V5HB 1T3FA 1UM5H 5AVQB 1W72A 4FMKA 5DU7A 3NIDF 3L1GA 4QRFA 1BM7A 3EG9B 3VI4A 1W0VB 4B96A 2G4EA 4EI5C 4YJZL 2GSIB 5EO0A 1JI1A 3CBKB 3WLBB 3HJEA 5F1OB 5C0ND 1KPRB 1LEIB 3TZVA 2XWJA 3ESVF 1P7QB 4P2YA 4EBQL 1QSVA 3IFLL 4DAGH 3NABL 2GBTA 2Q76B 4DP5X 1X5FA 4YUEH 2V9TA 2JB5L 3KL5A 1OAZL 1EHNA 2VN6A 3G5ZB 1LE9B 5M7QA 3NZUA 5F3FA 4E42B 1K2DB 5CGBA 3CN4A 1S5HA 4FERA 4YWGL 4F2FA 5IESH 4X4YA 1WGOA 1WH0A 2ENYA 3CE1A 3NTCL 2WQVA 4ZX3A 1ZT1A 2ZXDA 5LNGA 3PNWA 2BVPA 4L8CB 3IJYA 2R2HB 1AO7B 4AOFA 4W9FC 3LKPB 3NIDE 4OJFH 4Z7QF 1OAYH 2NSQA 2PLTA 3NJLA 4RSYA 4FI8A 2VZOA 1OQXA 4PJ9C 3BE1H 5KVGE 1T1XA 5G4NA 2BSEA 2Z31D 4M9PA 5D5MA 3A67H 4OZGE 4B50A 1MW0A 1T0MA 1UB6A 1SJMA 5GGTH 3W2DL 3NP4A 4F27A 1XF1A 4I5BB 2G4GA 3AM8C 2W0PA 5K9OB 2I85A 3US9A 3TN0B 2VRKA 5EBGA 1MJUL 2A4CA 2FLRT 2J72A 1CZ8L 2BXYA 1FL3A 3LV3B 4Q74A 5C07A 5EDSA 3T2NH 2QHRL 3DHJA 3BOVA 5CD3A 1ZGLM 1J87A 3KCWA 4FA7B 5KVDE 3HZKA 4UBDD 2NTSP 4GEJA 1X9UA 3ULUC 1A1OA 2BVTA 3OR7B 2JK5A 3H7BB 1V3LA 2X4PA 3EJSA 5E6IA 3B9AA 3QUZB 5DJXB 3QNZA 4O02L 4GP5B 1RK1B 1T7ZA 1DJXA 1WAEA 2NY0D 2ENQA 5KTEL 3I74A 5D71H 3OLEA 5CCHE 5I8EB 4MVBC 1KFAL 3BH8A 3QYNA 1E27B 3MLYL 3ZT7A 4JPWH 3HVDA 2OSLA 4OI8A 2BDNH 3Q8CA 3L9RB 3OVUB 2XOTA 3O0RL 1NM9A 1R3HB 4QYOB 4UYPA 3BP7B 5BQDA 4I87A 5BZZA 1TTGA 2QSTA 4JFFD 1V27A 4YMPA 1UACL 4DGYH 4JFZH 2A6KB 2UX7A 3N1MC 1NFIB 4WK2B 4NO3B 3K80A 5TPWL 2EEBA 1VPOL 2EDFA 5DWPA 5T5FA 2OMYA 3Q5OA 1NCUA 1L7IH 4QOKE 3B2UC 5AW1B 3IN2A 1WDAA 1JPTH 4MJHA 4UINL 2EDWA 5T3ZD 4N9GB 3BJLA 3MQIA 3P0YH 1GZQA 1M6OA 2XACC 1KJMB 3VVVA 1UGNA 2MOVA 3MYZA 5DURB 2W94A 4MKMA 3O4LB 4WCYH 3P77A 1CN4A 4XWOC 5AW3B 1UEYA 1ZHNA 1S7UB 5KSAC 3DROA 3FT2A 4B9IA 2XZAH 5E94A 2FYYB 2WUCL 1A4JB 3VFRB 5CLWA 4MGXA 4Q58C 2E59A 1O9ZA 5GGUB 2PYED 1OGAA 4FQLL 4XNDA 2QV4A 5KAQG 4L9LB 1DQTA 4LEXH 2WANA 4O5LH 2DW5A 1JIBA 1GHFL 2VITB 4N28A 1BSIA 5EBMA 5TF0A 3S36H 4CVUA 1ACZA 3D2TA 1HYSC 2EDOA 2X4TA 4WWKD 1S9WB 4TVUA 1WZMA 4NBXB 2NY2B 2Z93A 3VFSA 4XTRD 1BLIA 3W0WA 4U7SA 4QJ3B 4K2UL 3BPCB 5CFHA 5HYQA 3B9DA 3CVBA 4WV1B 4ZAKC 5CNHA 1NCWH 2HH0H 5IOPB 2R29L 3QC6X 3VXRD 1W0WA 2Y1VA 4OZIF 2X6UA 5I17A 1JZ5A 3M17A 3HS0B 1D5ZB 3WEAA 1Y18A 4R83A 1SUJA 3EYFA 1S7TB 4PTTB 4DKEL 3BKCH 1HH6B 4MAYA 2E5EA 5CF3A 3BP6B 1CL7I 5LGHL 4W9LC 4YXLH 3HB3B 5IBUB 2VDML 5IIEB 1CUOA 3KJ6H 3TESA 1GS6X 2J55A 3NT0A 1WD8A 5IHWA 1S7SA 4IGBD 3ZQWA 3ZDWA 3CXHJ 3JVGC 3QDGE 4QTHB 2IDSA 4X4ZA 2FJSA 1H8NA 1MLCA 1OCWH 3RWHA 2EECA 3EH4B 1SLXA 3MRBB 1J5DA 3MROA 2VDOB 5DLML 1UH2A 1E8XA 4IBTA 2ESVD 1LO3L 3IDMA 3Q8AA 4YXHL 1OE3A 1NLBL 4PSRA 5IM7B 4DN3H 2VQUA 3QYMA 3MUGA 1WPCA 3E3QE 2X38A 1U30A 5SX5H 1JN6B 4FLSA 4WTQA 4FQQA 1FGVL 3VU1A 2CWRA 2XN9E 3HE7D 1YYLL 3TU6A 4YX2L 5IW1B 3V4PL 3EYOA 1J48A 3BQUC 2X6BA 3QULA 1AIZA 4KU1A 1AXIB 1S7QA 3H3BC 5D1XB 3TBYB 3KLSA 1MVYA 1WCQA 4JQXA 4HLJA 4JK0D 4PGEA 4R96A 1JGUH 3LQAH 3OXRA 4WWPA 4ADGA 2XIBA 2HTLC 3KJ4B 1MLBB 4QRUA 1MFDL 2Q8BH 4LOFA 1PD0A 3L1EA 4HPOH 5GS1C 3RWFA 4GYBA 1NEZA 2JV6A 2AV7A 3GRWH 3NA9L 4Q7DA 1TKWB 2FAUA 32C2A 5I5MA 1QSEA 2X4NB 5E5RB 4QRPD 3VM5A 2UZYA 3D69A 4ODUB 1RJZA 1F1AA 1SN0A 3V7MA 2WXQA 1REIA 3B9KD 4TULH 4Z3JA 4YSDA 1MCPH 2RCSL 1OPGH 1F2XK 3BD5A 3N41B 4CRPA 4AKQA 1HOCA 2EEAA 4JFVA 5EEWA 4QXVA 2YJQA 1UYWH 1IAKB 5ICZB 4WUUD 1MFAL 4KZCA 3BHBA 3V4LA 4EIUA 3MFFB 1UASA 3HRZA 3QA3A 4W81A 4CN6A 2ZTBA 2BP0B 2G2PA 4XPHH 2WQXA 4NQVB 4KDWA 4X5XB 2ADFL 3EYUH 4XN2A 1R17A 3F7VB 4BFJA 3PWJA 1HSAA 4N6RB 1PG7W 1R4XA 3UTTB 4JHUA 4WWOA 3U2SB 4DKFH 1BQHA 2BERA 4OZ4B 3E6FA 2EDXA 5J6HB 4IHBA 4S1DD 3FU5A 5TDPA 3MV7E 4HWNA 1MDAA 1ZY9A 4V11A 4Y4FC 1FPTL 4DK3A 1ZT4B 3U6RB 2R2BA 1FH5L 5J4MA 4YHKL 2NY1B 2YEQA 3DX4A 4ZMVA 5I76A 1EHLL 5D1ZC 4HJJH 5DD1L 1TYJA 3ZL2A 3QORD 3BPLC 4M7LH 5CBEA 5DHXB 2AJVL 5EZOH 5FGBC 3CFMA 1DEEB 3T2QA 2V2TA 1HCYA 2WNXA 1CDCA 1QUNB 4CNIA 1I85C 4BQ9A 4XAKD 1QSFD 1T7YA 3WFBL 4CMHB 4M6AA 3MV8B 1FN4A 1P0SE 2R69L 4PWFA 3WXWH 3PWPB 4RAUB 4WGWB 1U8IA 2KKQA 3QB7C 3TEWA 4GG6B 2HX9A 4I2XE 4LBAA 4OLXL 1MFVA 4UT9L 4NGHL 2DYSB 2ZSWA 2CDEA 3EYVA 3L5WB 4LCCA 1FZKB 3GZKA 3SDAA 4JY4B 1M2VB 4HC1L 3DBXA 4AL8L 5IQ9A 3WFHA 3SZKC 3GSNL 5IR1B 5EUKB 1OT4A 2GCYB 3IDUA 4GKZB 4G6AC 2VUKA 1RLWA 2AXGA 4G82A 5EUOE 2D3NA 3IN0A 4JGNA 5F7HA 2XBDA 2Y7MA 2XZZA 4MX7B 5HJGA 3E6HA 4G5ZH 3Q8EA 1TO4A 4QHLA 2EC8A 4FG4A 4PJXF 1PDKB 3H3PH 3QIWB 1DO6A 4RWYL 1MW3A 2D31A 4OZHF 3A24A 3AJ7A 3VXME 4ELMF 1N59A 1RPKA 4PREA 4D9QD 4KMTL 2EQDA 2BLFA 5EZLB 4NQQA 3HG3A 1R5VB 4YHIA 1C5CL 4LESA 3AB0C 1R75A 1EAOA 5DMKA 2WXIA 4ABWA 4W4OA 5ENWA 4M61B 4Z9KB 4C4KT 3NESA 3CFCL 1NBYB 3P9MB 4JJOA 4EUPA 4KUZH 2HYMA 1EA9C 5D8JH 1KT2B 2P5WE 2Z8VC 5FO8B 1RUML 3CSBA 1GXEA 1PL3A 3NAAL 2EH7H 4YXKL 5MERB 3GTNA 2Y6SD 1WC7B 1NMAL 4HHAA 2A83A 1ITBB 1D2OA 3NZHL 4LVOB 5E5LA 3T9WA 5I1EH 4PWKA 5D70L 4H20H 3OHXC 4KVNH 5KZCB 3ZE2B 4P5MB 4QCIA 2FGZA 4L48A 3HN5A 3CVHL 4JO3H 4LCYA 5DFVC 4RFEB 5J9PA 1HCZA 3APDA 5ALBL 4PRAB 1RK0B 3F85A 3QFJB 3WIHL 2AC0A 4WKZB 1P4IL 5IREA 4PJXE 4F9LC 3KGUA 4ELME 2DMGA 2ZUSA 2CA4A 4YDIL 3PHQB 4MAUL 1HXYB 3FAWA 1BWMA 1XAUA 3OJ2C 5CSBA 2G5UA 2IWKA 5GZOD 3LS4L 3MLRH 1C12B 1IM9B 2CDFA 4KTDH 3KPTA 4OLWL 3F01A 3SKJH 4JHAL 4JVUA 3FZUD 4R7DA 5ETUB 3K5RA 3N2JA 3LKNB 4YSEA 1A6UH 1J1OL 2Z31A 3JWOC 1I8IA 4AH2A 4NZRH 4F93B 5AOKA 1BYOA 5CHNB 1UB5A 1QX1A 5DJYA 1FL6B 4W70A 1WHPA 1KN4H 1RVFL 1SM3H 4R4FL 4UQ2A 4YBLC 4Q9CA 2LHAA 1J5IA 3MLWH 3CHPA 2VDOH 3UDWC 2HLAB 3AQDA 5C9JB 5JW4R 4MJ4A 5FV1L 4N6QA 5E95B 6FABL 5E9DD 3ATFA 3GI9H 2Z0UA 3QZBA 4PUBH 4HCRA 5DHDA 2VXUH 3D18A 5FA4B 2J8OA 3I6KA 2EO9A 2EXWC 2P8LA 3A47A 3H53A 2N7SA 1G7IB 4H40A 3TNMB 4OLUH 5LQBH 2W91A 2J3SA 5CJQH 4PP1C 4P59L 3BX7C 3RDTB 2DQIL 4TNVK 3BAEH 1CB4A 2KI6A 3QS3A 1MFUA 1D9KD 1VRSA 1PSKH 2ADIB 2GJJA 3II2A 4FA6A 2F58L 2DQEL 2FX9H 4AQ8A 3F7LA 5MENE 3REVB 1E4XH 2HPOA 3ZZ1A 1D5XA 1D2PA 3EADA 4NQUA 2ATPB 3KWUA 1ETB1 2P5WB 3MUJA 2V17H 3EJTA 2YGPA 3I9PA 3LQZB 3MKGA 4GMSL 4HT1L 2AQ3A 3BP5B 5CBAB 1A7NH 4M1DH 5C09E 4Z7NE 1ZHKA 4KRPD 3MLRL 1A9EB 2XU9A 3MRDA 1WP6A 4QXTA 5CS7A 4BKSC 1SEBA 3FCTB 5A3ID 3PJLA 4PJCE 3BZ4B 4JFFA 2WAHA 1I4FA 1CXFA 3SO3B 3VQ2C 1H15A 2ZXQA 5DS2A 2JELH 2UXGA 2WKOF 4D8PB 4JFHD 5BZXA 5JUEH 1CLZH 4MMYA 4NM4H 3U83A 1UD8A 1IGCL 4A2MA 2BJML 2R9HD 3CSFA 4OUUA 1TXKA 1BWWA 1PG7X 3GIVB 4UIKH 2EADA 5CLTA 1MRCH 2MSPA 3Q0HA 2BS71 1O7VA 4XBEH 4Y16B 5J11C 3T77A 1J8HE 1HKLH 4HF5L 4PJ8D 4FRWA 3P30L 3CN0A 4MDIA 2NY5H 2DI9A 5L88L 4H8HA 4FTVD 4EJ1C 2PYEA 2YO3A 1ZTXH 2XN0A 1M6UA 1EGJH 4Z7WF 2IF7A 4A68A 3BZ5A 4LVNC 2GIYA 2ICEA 4NKMB 2CK0L 2F1AA 2ZSVA 4WWKA 4DQAA 5TGBB 2P24A 3JTBA 3ALWA 4KKZA 3OTTA 3GD1C 1XR9A 3HC0A 3ZSTA 2I9TB 3EHBC 1YYML 4ZMLA 4BCZA 4OKVA 4DETA 3MFGB 4JG0H 3QRBA 2IH9A 3L4VA 4YK4C 1KEGL 2ZP9A 1Q9KA 3LRMA 2EH8H 3VFOB 1W6LA 1NMBL 3VXRA 1HIML 3MRPB 2GHWB 4UILH 5K1VA 2E7LC 2EC9T 1AG6A 2Y07H 4YHZL 5AZ2H 4HZ1A 4HBQA 4BFGA 4FXKB 1W16A 4PJFA 5DUPL 4JZOB 4MYWB 3PGFL 3AWGA 1NCHA 4MCYA 3C8KA 5MENB 4IGBA 1BF8A 5F93C 5DJAB 1BECA 4N68A 4O2EA 4JFQA 5AAMC 1NLDH 4P4KB 3L2NA 1JTTA 3KHOA 4P2QE 3G6JF 1R0AH 4JB9H 3RLSA 1A1MB 5C09B 3BVNA 1F5WA 4OGXH 1A7RL 2ESVA 5F7EL 2WXHA 3ILEA 5J13C 3IDGA 1PZDA 2UYLA 1ZVSB 5ANMB 1CGVA 1FSKC 1MNUL 3MV9E 2KQMA 5DEFA 2AK4D 4OSUL 4J3WA 5JHDE 1CG9B 5D2LE 5DO2D 1X5JA 4NQEB 3E2HB 4ETQB 5E2UL 1BYNA 2YIHA 4H13C 2CJ3A 1Q1JL 4ZUUB 5IB5B 4FKKA 4D7BA 1L6XA 1FLRH 5I8KH 4JFPB 1OLZA 2DM4A 2BOCB 1XIWD 2Z4QB 3ARBB 1FG9C 2DN7A 2DQCL 4O2CB 5AOIA 1V3MA 5FKPB 4JUSA 4ZMPA 2CKBB 3AXHA 1U3ZA 5HDWA 1XCQA 2C3GA 4XAWH 4Y5YA 1TJHH 4I48A 3SE9L 3ZYIA 5I30H 1NEZG 4X4XB 1FLTX 3QDAA 4QRPA 4MS8D 1QPPA 3B9KA 3LZNA 4O58H 2BNUB 1HC1A 3G6JE 1L9NA 1QNIA 3KPSB 4X6DE 3S7GA 2VLJE 3FMGL 4JKPH 5F7WC 4K94C 5MI0B 4NDMB 2G2RA 2W0FB 3WJLC 2E27L 1LO2L 4KVCL 4S0SD 2O5YL 3CTTA 1JPFB 5HVFB 2X6MA 4WUUA 1CDBA 3QIUD 3SE4A 4TLUA 2GIMA 5ACLA 3V5KB 2K4AA 1DSWA 1ZSDB 1U21A 1I7UA 4WU7B 4JPSA 3S3PA 4X6EA 4HAGA 4J4PC 1XMWA 2Z35B 3O41B 5EEYA 1HNYA 5GS0D 2CLVA 1NC4B 5LCVL 3NEOA 3FFCE 4KNTA 4OCLC 3KR3H 3ASOB 2EO7A 1GS8A 1N7ML 2OP4L 3I3BA 2X40A 1ZVHA 1F8TL 2A9AA 3TJPA 1OZUA 3UP6A 2WTOA 1QR1B 3RWDB 3I75B 3VFPB 2DPKA 3ZKXB 3GBEA 2QQQA 4Y8AA 3QORA 1B0GA 1G87A 5DYOB 3MJGX 1LXMA 1TQCB 2QGBA 3F7KA 3O2WL 1AQHA 1KJ3L 4TNEA 4NHUA 1NBZA 2WHVA 3ZSSA 2A1WH 1QSFA 2ZJSH 2PCPA 3NBNA 3TTSA 2AQ1A 1I8UA 2IDUA 2XNAB 1J9CT 1M05A 3CFBA 3MO1B 3OL2A 4OTXH 4OIAA 4V1DB 4MJ6A 2ZUYA 2W80C 5JHDB 2GY7B 2VR3A 5LJYH 2FSEA 3GSWA 4L0ZA 1OZTG 3E1F1 4JMNA 3ZKND 3SCMD 3PF2A 3TF4A 1DCLA 3ARUA 2DDQL 2YJLA 3Q3GB 5DI8B 4XH2A 4BUGA 1INDL 1WBYB 2WZPD 1EHXA 2HRHA 3QJFB 3WO3B 4ZTOL 2CNZA 4AT6B 4J1UB 3RG1C 2V8MA 4UQCA 4WHDA 3SDYL 4B7IA 2MFNA 4P2AA 4JFDD 5EMYA 5KSVA 5I1DA 1J8HD 4G3YH 4BZ2H 5K93A 2JKNA 1MW1A 3S3JA 1HL8A 5EC1A 4FQ2H 2P49B 5BQ7B 4YSCA 2MNUA 4Z3IA 2K1MA 4LSPH 1BM3L 5HHQA 2CZNA 5IJVA 1C5BL 1OD7A 3UEZA 2ATAA 3FT3A 2LU3A 2VLMD 4X6DB 4Y9EA 2WM0A 3DURA 2CM6A 2PPAA 1U8JA 4XXCC 2Q86A 1VGKA 1EZVY 4NQXB 4P2OD 4M6ML 4JPKH 2AP2A 4R84A 2GUYA 2BHUA 3GBML 5CEYA 5D4IA 3MR9B 4ZW8A 1KYFA 1YCSA 3KH4A 3WXVH 2DLEA 2DIBA 3C6LD 2QKIB 3QO1B 4PJAB 2A6JA 4C58B 3QCVH 5HGBB 3VXQB 3GKWH 3BWUF 1NBVL 3QNXA 2ZAHA 4EUPG 3UERA 1U8HA 4J3OH 1NUGA 1R47A 4BUQA 3ATEA 2BXZA 4RDBA 3CFDB 1H9DA 1BJ1H 2IANB 4N0RA 1C5DA 5D4QA 3HE6D 4FXGA 2Q8AH 1BD2B 1XH1A 1UCTA 2A0LC 3AU1A 4YN3A 2HN7A 3GSUA 4AV5A 4MXVE 4DUXA 3REWA 1OARH 5FUCC 1MWOA 1YAIA 4GKNB 1ILUA 1NIAA 2XVBA 1I1CA 4UTCA 3APMA 3F84A 4GRMB 4JO5A 5GRUL 1CDYA 2JNZA 3I6GA 1S3RA 3WHE0 1BFVH 2Z92B 4FYRA 4DZBA 3TWYA 5ACZB 3TZVC 3V7AE 4D3CH 4CSPA 3D52A 1D6VL 4LLWB 5AKRA 3D48R 1JNLL 2BW4A 3WHE1 5DZAA 1DVZA 1JPST 3M1BA 4NJ9L 1NFDF 5HJ3A 2IV8A 4LBEA 5D6DA 4L3FA 2QVFB 3VO0A 1E30A 2OTPA 5K9JH 1QR4A 5L2JB 1F4YL 2UUDH 4OZIA 1FV1A 3F6JA 2B39A 2EUZA 3V0JA 4XR8C 4WRLA 2FX7H 4HWBL 4JGJA 2OR8A 3DGGA 4AQEA 1JGEB 5F7MC 1IGIL 2NQDA 3SKUD 5G4OA 3OC5A 2V7HB 1MIMH 1WHOA 1G0YR 1CIUA 1S8DA 4HX1B 5MP6L 4ENZA 1PLGH 3K6IA 2IEPA 4QRRE 4G71B 5E9DA 2DMBA 4KFZC 4XPFH 2V7NA 3NIGE 1NIEA 2OPCA 4XPTH 4Y9BA 1SXCA 4NN5B 3NACL 4L1LA 1G6RB 1EERB 3UJJL 4IBVA 2QEJA 3VNZA 4QXWA 4PCYA 5DQDH 4EIBA 2W95A 1J5CA 3RKDD 4DUWA 3DK2A 5CD5D 1I8KA 1IAMA 1ORQB 2QVKA 3MNDA 3OR6B 3R1GL 4LOEA 2AJUL 4G1EA 3B5TA 1LDPL 2IDQA 2XVGA 1S7WA 5F2FA 1G5AA 4OM1L 3ERXA 1I9RH 3FU7A 7CGTA 3CVDA 1QLEB 1RI8A 1OARL 3GJFK 1DJYA 3OKNA 4MJ5A 4PIRF 3X3GH 3L3HA 2Q3ZA 5INCB 2CKBH 3Q44A 4HIHA 2E9IA 3A23A 4KKLC 3FHAA 4GS7C 4LDOB 1AS7A 3OMIB 5AW2B 1FC1A 4J2QA 3VD7A 5BJTA 1GRWA 2HRPH 2HMID 5E6IC 3GGWA 4QT5B 1YUHA 4U3HA 4U1KA 1WRFA 1S9XB 2IO5A 5FYJL 3WTVA 3MV7A 4IW4C 3FXIC 5GSVA 3OLDA 2O5NA 3NCJL 1M7DA 2FH6A 4XP5L 1S7XA 3KEHA 5FB8B 3BSHA 3KPPB 2NY4D 2W07A 4Q0XH 3ZUNC 3K6FA 6TAAA 3S96B 2MHAA 3HNVH 3W39A 4M1GH 3E80A 2KZKA 4OCNC 3O4OB 5IROD 2VSDA 1TZIA 2VJ8A 4N0YH 43CAB 1YEFH 3VFNB 4NUGL 1PF3A 5EOCH 2F54D 2F5BH 1UT2A 3K6NA 3ROLB 4TQEL 1GCFA 1FFOA 1AZBA 4TQ8A 5C0GA 3ZRCC 3IU4H 1NGYA 1JF1A 4CKVX 3UTSD 3V55A 3WIFA 5G5DA 3DX1A 3O8XD 2A73B 5ESVA 4I2XA 4LAQL 2K7QA 4WJ5B 2P26A 4AGMA 2FO4A 2WWKO 1BG1A 3T6VA 3V6ZB 4X8JA 1BVZA 3KYNA 2MMXA 4P4RB 3GSOB 4PJ8A 3R8QA 2Y9RT 2W1NA 4FTVA 3BUYB 1I9RL 1M57B 4HK3N 4IMLA 2R0LH 1MJJB 2ZUXA 1IKNA 2Y06H 4NFCA 1MQKL 4Y5VA 1YN6A 2FGWH 4MNGE 4WW2F 2GTWA 3S9DB 1SN5A 4KY2A 2FQGA 3WTYA 2HX7A 1AR2A 4JRYD 1N68A 4QGTA 4GQZA 4XHQA 4QRRB 3UROR 2FLMA 4ZMYA 5D9SB 3FT4A 4WHYG 4I4WA 2BP3A 2Q6WB 1BX2A 2ZICA 4JREC 5A2LH 4UNVA 2OQJB 1OK0A 5IQNA 5F0PB 4HUXA 2VN7A 2E9JA 2ARJQ 3BDYL 3S34L 3JUZA 4GFXA 4ADIA 1DBAL 2D03H 2PPCA 2YPVL 3S6CA 5I1IL 1FGNL 2JLPA 1DJHA 1ET5A 2ZUVA 4TM9A 3CDFA 3NCEB 1QFWM 1LK2A 4ALAL 2B3RA 2BM3A 1SOKA 2E47A 2AXWA 4M1GL 1G7MB 5EBLB 2NY7L 3QZNA 5BZDB 2JMRA 1N0LB 2F7OA 1BAWA 1P1VA 3O2DA 4TKWA 3P11H 5DHYB 4YEEA 5BRPA 1TVHB 2KLSA 1Z0NA 3MLUL 3ULUL 4MAYC 5IB1B 2QSCH 2V5MA 4UUJB 5DZ9A 4NB7A 1BVNT 1PZ5B 4O2FB 1NEPA 4N2OA 4UTBL 2EINB 3B7YA 2I32A 4POYA 4F15C 1KY7A 2AK4A 4PJXA 5JOFA 2Y72A 3MA7A 4HJ1A 4Q89A 1U93B 4OZHA 4ABQA 4AEIL 4ELMA 2E75C 2X9WA 3EJUA 2B1AH 3BW9A 1I7TB 2YD0A 2FWLB 1MCFA 4H1LA 5DUBA 4LEEA 1A8JH 4P48A 2QVIA 5B1JA 2WXMA 2YZ8A 3CH8A 3WBDA 4KZDL 4WSGA 2LFEA 5CGMA 4KO5A 1XIWA 3KGTA 4FYSA 5FUOL 2AJYH 4YHYB 1T4KA 1G94A 4R0LB 4LGSB 1NWOA 1U95A 1B0WA 1J8KA 1Q9OB 2EACA 4J6RH 4P5KA 3SBPA 5IVXF 4UTAL 3NPSB 3MRHB 3QG7L 3X13A 3O6FD 3CNKA 3HMXA 4JQXC 3D4YA 3GMRA 4XNBA 1A5FL 4WI4A 5LN4A 5F88A 3ARDD 4WFEE 1YMMD 2UXTA 3LH2L 4IRSB 3DTDA 3V4VA 3TA3B 1HAUA 1TJXA 4PJIF 1C8QA 5DD5L 4QRSA 5GS2D 3VD3A 2CA3A 2ZE0A 2OBGA 3C2SA 1FFPB 2CCWA 4JO1L 4N1HB 3X3FL 3GT6A 3FJTA 4PW9A 1IFHH 2ZCKL 4HXBH 4J2XA 2HKAA 1ZLEA 5E2TH 1OLLA 2C4FU 3QIUA 4L1HA 1BZ7B 4PLJC 4Y9GA 2IOIA 1JERA 4V33A 5ICUA 1I8MB 5FYLH 1CVRA 2XXGA 2VQ4A 1B3JA 5FW6A 1KBGH 1EEZA 4DT2A 1ASQA 3BLKA 3IDYC 3HRZC 2RMNA 2E7CA 3UC2A 1LL1A 2PXYB 1P4LB 4PJEF 1IEHA 4Q56A 3GRBA 4DGVL 5KYUB 5EDXA 3SQBB 3RYMA 1AQ8A 3AXLB 2WLIA 1G6RH 1CLOH 1J0ZA 1B0IA 1M7IA 1U36A 2ORBL 1N3NB 5E4EC 4F33A 2VDLL 3AROA 1HESA 3HAEB 4Y89A 5I9QC 2UY7A 4LMQI 3IAQA 4I3RL 4LF3A 1RHHB 3FSVA 2H2SC 5AUMA 3OKEA 1NA8A 2XV0A 5GGQL 1VAHA 1QLEH 4RFOL 2YRBA 4K3EH 5ALCH 1ZCRA 1NEUA 3WSQL 5ISZB 3DUSB 4ZUTA 1MVFA 3OXSB 5FM4A 5HDBB 3FRPA 4KRLB 1UJ3A 4AG4H 4J3UA 3SCMA 4TOYH 2FIKB 4I9XA 1XGYH 2YFOA 3KS0H 3OX8B 4U7KA 2IPTH 4N0FB 2WZPA 4CA4A 5HDQL 1UUNA 1DQJB 1B2YA 1CDJA 4HPYH 1X5MA 4XC1H 5CU9A 5DK2A 4G8IB 2W60B 2J12B 4H8UA 1BZDA 1ODAA 4GUPA 4JFDA 4PWGA 1J8HA 4U3XA 1RXLA 4CVWA 4TSAL 4AGNA 2CPCA 1PG7H 3DSNA 4PRNA 5EO1B 2VW4A 4KPHL 2ZPKH 4PCKA 1YSOA 4LCCC 3T6XA 4NC0B 3AG2B 2QDWA 5DK3A 2X1QA 3SDAC 2NX5E 1A0QL 3P4MB 2IVFC 4BZ1H 2FK9A 3WHXA 1GC1H 3MACL 3MI6A 3FUJA 4NC1E 2NNCA 1D5BA 3QUXD 3UFIA 1IKFL 4MZIA 4P2OA 4WO4D 2WKOA 4W6YB 4PPTA 1WUNT 2NXYD 3UJTH 4CVZA 4U49A 3WY2A 3C6LA 1JYNA 2BMKA 2VC2L 3E8VA 4KDTA 4YSOA 1NCGA 3LEVL 3ME0B 3NJNA 3TP4A 1MJ8L 1JK9B 2WLYA 2PCFA 2YQGA 2KMWA 2VZ3A 4W4OC 1FL5B 2C8NA 4L8DA 3V0HA 3KLAA 3F12A 4HKXB 1KGCD 3HE6A 1ZJAA 2HVJA 3CMOH 2J8UB 1HXMA 4ORZC 4RX4D 5F6HJ 2XPGB 4RBPK 1IILE 3OHMB 1JE6A 2F08A 2D7MA 1PKQE 5HI4D 3RGVB 2HVKA 5SWQB 1BV8A 5D1QD 3AU0A 1FNAA 5F8QC 4DW2H 4X6CE 4Z7WA 5C0NC 1DVFB 5BVJA 1I8AA 1DN0A 2ZF9A 3N1GC 2YAOA 2JFCA 5I19L 4GBXB 2AK1L 2ZOOA 3IBOA 3MV9A 4J3XA 4QRQA 2KQNA 2YOCA 3PE9A 1FFQA 4X0KA 4IBZA 4L8SA 4YVNA 1JWUB 3U9UB 5AYTA 3DTUB 3ULVH 1HHJB 3STBA 3CVIH 4X2UA 3T71A 5FECB 1IBHA 2Q1EA 4F8PA 1PEZA 4JAMB 5D7JB 2ZX5A 1K85A 1G84A 5D7SL 3OWEA 5T1KA 1UXSA 2IWEA 3TBBA 3A21A 2R1WB 5FV2A 1PLCA 2R8SH 3HCVB 2YQBA 2OK0L 3QHZH 4UT7H 3TCXA 1B4JL 2QLYA 3V6FA 4PB9H 3MLPA 4M00A 4FTDA 4TMPA 3DMMB 4FNRA 3GJFB 2BPBA 3KEDA 2XI9A 1ETZB 4Z7OB 2GEQA 1OGPA 2Z31C 3RU8L 4C8XA 5BO1H 3OKOA 3QQ3B 1EJOH 2OCFD 4Z3GA 2G9HB 2C7FA 3UG5A 1MCBA 3G6JA 3C9NB 4WFED 3EF7A 4XP6H 5B39B 1IGFL 5C0BD 3VMOA 2ZWYA 3O45A 3RTQB 2BVQA 4OLZH 4QHPA 5EF3A 3T5WA 5I0WA 1GPOH 2YRPA 3DV4A 5FDWB 1MCHA 1DL7H 2QADD 3GZOA 3MOBH 1OM9A 3QIBD 5K69A 4OQ1A 4JG5A 2XQYA 5GJTH 3ILPB 3C09B 2A9NL 3AS1A 1IGTA 4YZWA 3AT8A 5I0DA 5JPNB 2OX5A 3CFKB 1J1PL 3VGAC 1UXMA 4UBDC 3I9AA 2EIZA 1P7KB 3SOBH 3IXAB 5F9AC 3L4CA 5EN3A 3P4NB 4XNXL 1JDAA 3B2MA 2HLFD 4FQPA 1DVSA 3DHPA 2F19L 5TH2B 3DXAE 3RFZC 4HFUL 1LO4H 1E5CA 4LP4A 4G1MA 4AQ8C 1BZ9A 1WA2X 2HA1A 2NY0C 1K5NA 1TQUA 3CIQA 1JGIA 2R7EA 3ORJA 4MXWL 4AITA 3STZA 1XR8A 2DQDH 3BD3A 1J88A 3UP1A 5IT2H 1DUYB 3BWAA 1J5HA 1TG8A 3EJYD 3FUNA 1WS7A 4GMTL 4LCIH 5C08E 1A6ZA 2J71A 1IC7L 5IROA 1FJ1A 4BQBA 1A9BA 3INUL 4X98B 4J39A 3L5XH 3GSRB 2GW5A 4N2DA 1XEDA 2F54A 3F6IA 3Q13A 2AQSA 3HUJB 1A02N 1XGRB 4DP1X 4JFYA 3WFEL 3UTSA 1QQDA 1TPXC 1FO0A 4YBHA 4EOWH 1YDPB 3O8XA 5CP7B 2WB1A 1R3LB 2P44B 4Q52A 4GI6A 2ED9A 5EOCJ 4AUUA 1UTDA 2NNAA 3F7PC 1KCUL 5FFGA 1V8HA 3ZYZA 2XTLA 4GQ9H 1K4DB 3DJZA 4YSSA 4UOZA 2WKGA 3QCTH 1NKOA 3FB8B 1AGBA 3N41F 1XCXA 3S2AA 3HAEH 2O5XL 5IHZB 2A74A 3V0EA 2OR7A 1B4TA 5KSBE 1NAMA 4LSRH 2GI7A 1DJGA 2AGJH 4JRYA 5F9JA 2R2EB 2B1OA 4LRIA 1MWAH 2OL3A 4XVTH 2NXZB 2EIJB 1NPUA 1KULA 1HU8A 4K3JL 3JWOL 3V5DB 5KJRH 2XCMC 4F37K 4LCWB 4AQOA 2ICEC 4YHPB 2ZG2A 1AO7D 4WWKC 3T1FA 2A99A 2O6CA 4HGKC 1FH2A 4UOW1 4XXDA 3TBSB 4CJ1A 4XTRC 35C8H 2K3TA 3VYOA 3VX1A 2IADA 1KJ2A 2MRYA 4NFDA 4UOJA 3BZDA 4JN2A 5KANI 2LAAA 4FD0A 1F11A 2IQAB 2HFGH 3C75A 1E9QA 5F21B 1IGJA 2GC4C 5BXFB 1K6QH 1Z5HA 4TLSA 3ZYOA 4BH7B 1LP9F 3EFOB 2FX8H 4ZNEE 2DQGH 1AGCA 5EWIL 2R1YA 2W9LA 3CSYA 3RNKB 3WEXB 1ROCA 3PJSB 4NKOB 1JI2A 1TEFA 3E9TA 2VUOA 4IGBC 4NUJA 1KB5A 4G9DA 4B0MB 4I9WE 3VG0H 1EEYA 2XXMB 4KX8A 3SY6A 1MHCB 1H3PH 1Q9LA 2J1KA 2WYIA 2ZOKB 4KI5F 2DB8A 3UC0L 4D7PA 4GG6F 3DV6A 5HYSA 2XXFA 3QUZD 4RESB 5D2NA 5F3BA 3DX6A 4H1LG 3MCKA 5I6OA 2N3JA 2BOBB 4QPEA 1AQDB 3HE7C 2ADGB 3SKOA 5HJBA 4X99A 4NKIL 4KK5D 4Z95L 4DGIL 4ZFOL 3X14A 1JZFA 4JLRB 2O61A 3TEUA 2X09A 1SLVA 1FRGL 4XXWA 3O6FA 3RA7L 4APXA 1ADWA 1UZGA 2IH3A 1IRAY 4X9HA 3ARDA 1YMMA 4TNFA 5AYQA 3GBNL 5D93C 5IMOA 3QJOA 1WD9A 5DRNA 4Y5YC 5MEPA 4DP0X 1XGUA 3NJGA 4MNHB 2AI0H 4WEUD 5LXGH 2HB0A 4LPXA 5E0FA 4OD3L 2E6JA 2TSAA 3B9KC 2DH2A 4KI5E 3D0VB 3WFDH 3QS2A 5BMFH 5BOPA 4IS6B 4G43B 4YQXL 1T04B 3BVDB 4P3DB 2X4UB 4PV9A 3EBHA 1DN2A 5LBVA 1XH3B 4LP5A 5HXMA 1NFDA 2P4AB 3VFUB 1M53A 2QR0B 2VABA 3TJEL 2WINA 2AJSH 1M71B 2AKRA 2GAZA 1W8NA 2YMOA 2N4IA 3SE4C 1Z66A 2VIRA 3U82B 1UEMA 4FZEL 4FQIL 1HDMA 2JB6A 4XMZA 4BFOA 4P9MH 3GJFH 3P3SA 4AW7A 4JHWH 1T21B 4YSPA 4CN1A 4K5PA 1JGDB 4L0YA 3VTMA 4HW6A 5GGRB 4BSWA 3L4ZA 1R24B 1EDYA 1DE4A 1TETH 4AMKH 1KDIA 4S1DC 2XZQH 3W5MA 1JTOA 2R0KH 2RACA 2Y5QA 1I7ZA 5CGYD 3IFPA 3NSFA 3BSZL 1GJUA 4JZNA 5CUSL 5B1AB 1U6AH 2NY2D 3B2XA 2CRYA 2DQ6A 3MJ8B 3MHZA 1U8PB 2EIKB 5I73B 5E5UB 1WYJA 3EFDH 3QCUH 3GK8L 2DKMA 5GRYA 3LVTA 4XBPA 3D05A 3QORC 3ET9F 4XMPH 2BC4A 3CDGB 2HUHA 4OFKA 4PV8A 4N0UE 3ZDYB 4Z78A 2PW1A 1A7OH 3FRPG 4Q2ZB 1OTUD 3IFOB 1T2QH 3PP3K 4HBCH 4JY5L 4GUQA 3ELAT 4HJGA 1N4XH 3VFWB 5A16A 4OB5H 1J86A 3HB3D 4IJTA 3OJDA 4U1HB 5J0BA 2R51A 4KXBA 3PWUB 2OTWB 4HIJA 3NZ8A 3AQZA 5GGTA 2C7UB 4KO9A 4IBSA 4UM9B 4L1BA 4OCSH 2X87A 3AACA 4XZUA 3NSDA 1WJ3A 2FEDD 2Z34A 4PRIE 4MNGA 2FL5A 3CQPA 4MNQB 3BWSA 3SPIA 4GLRH 1G7LA 2VMDA 1JK8B 4HJUA 2CCLA 3OZLA 1BF5A 1HWWA 3BSGA 2VL4A 5EU3A 1VERA 1MCIA 4WO4A 4JPVL 3BYYA 3ZO9A 4FYTA 2OZNA 3H6JA 1IL1A 3C60B 4XGZA 2X6AA 4JCMA 5HGDB 4RNRA 2I60L 3LN5B 2WN2A 4KKAD 1S9VB 2WB7A 2OYMA 3GMMA 3FQXB 1BVKB 1DQMH 2EE6A 4MSWA 1F45A 4IU2A 4UV7H 1J0YA 2OMVA 4HLEA 1R33A 4K94L 3F04A 4P23B 4FFWC 3BZEB 1EXHA 2KBGA 2ZAGA 1GJWA 1CICB 3FQUB 2H41A 2JKTM 1F86A 2IFFL 3SDDD 5SWZE 4RX4A 4WEMB 2ED8A 2OJEB 1TQSA 2VE6A 3HR5A 3HNTH 4KJYA 2Y6SC 4IKNA 1WWWX 1I3UA 5D1QA 1O6TA 4WW2A 5JQIB 4JG9A 1BPVA 4WWID 1BVNP 1CIDA 3T0EE 2ITFA 1DYZA 4FXGC 1IUZA 1OE1A 4WJKB 2EDKA 1K8DB 4DGUA 2CLRA 3K71A 2BSBA 3RAJL 5I8OH 2D7TH 3G5XA 4FFYH 3D85B 1QO3B 2CO7A 5F9WB 2ZOTA 1KTLA 3FSZA 1FIEA 5I5RA 4JY6B 3UTTD 1F00I 5H2BA 2XN1A 5HI3D 3F58L 1XF3A 1QWNA 3US1A 3TIEA 3DIFA 1I7RB 4N0UB 4P9HC 4AIZA 3MRNA 5GS3A 5GZOC 5D6DC 3FT9A 5TE6H 5J1TC 1FFNA 5EU6E 1MRDH 4YDJB 4DP7X 4K4KA 3FZUC 1PY9A 2R4SL 3Q43A 4PBWD 2NY1D 3FQTB 3HI6H 3LDBB 5E8OB 2AS5M 3O2VH 1FYTD 5DUJA 2ENJA 3MCYA 1EX0A 1E7UA 3OQRA 1N0XH 4Y2LA 3VD1A 2YD3A 5B21A 8FABA 1RP8A 5C0BA 4XPGH 1I3GH 2VN5A 3LIZL 2OW7A 2RIKA 4TS6A 1E3ZA 5BS0B 1D7DA 1NFAA 4PRHE 5IEKB 1SY6H 4N2NA 3WENA 3MV8D 1YJDC 5E8NB 3AWFA 4D0DA 4KVPA 3PWPD 2OR9H 1MFCH 3QIBA 5DEGA 3UYRL 1T22B 3MNZB 1TIUA 4U7MA 4JCLA 3U9WA 5J57B 2XQYG 4HJEA 2P1YA 2IPUK 1WVZA 2K6WA 5FR3A 2DLHA 3W3BA 2BFVH 3SSGA 3D9AH 4UIMA 3SPVA 2VZSA 3FN0L 4JDEB 4BSVB 3VXOA 1N9PA 1D9KC 3UH8A 3QRGH 3ZK0A 3TV3H 1L9PA 1OGSA 1THCA 4FN0A 4RGOL 3EGDA 1KBBA 2WQSA 5IVXA 4RIRA 3NJXA 1MH5A 4K23H 5HSFA 3GHBH 3MTXA 3RIAK 1JCVA 1KCVH 2N56A 1I1RA 5SWZB 1GIGH 4H2AA 3QIWD 3V0DA 3NCYS 4PJIA 4MMZA 3ZN6A 5EC2A 4BFRA 2I7SA 1RULH 3NN8A 4KRPC 1YG9A 4GIOA 5TK2A 5C3TA 3GPEA 4OCXH 4NNYA 4IOFD 1DJZA 1TCRA 5A3IC 2FHCA 5B3NA 2PETA 4Y7MA 5FYJE 5H37H 3V5HA 2AEPL 2YAMA 4LU5H 4WTWA 1WIUA 5IMLB 5JOEA 3KHQA 4P46B 1BBJB 4RFNB 1U92B 1W0VA 5G55A 1U58B 4D8OA 3O0LA 4NQTA 4TVPL 4ZMWA 4AJWA 2WMPA 4PGDB 1XWVA 3IXTB 1AMXA 1KPRA 1FNSL 2BNQE 4OJDH 1LEIA 1HX0A 3A6CH 4B5EA 5E6UB 2ZUQB 3FTGB 2LLGA 4XBMA 2R9HC 5KZCD 5DFAA 3GRWA 1IC5H 4LSSL 4PJEA 1XZ0A 3KD4A 2YPKB 4JRLA 2GTQA 3K4AA 1WAAE 3QFJD 4TLTA 5EU6B 3WYRA 4ELKA 3O3DA 1MCJA 1WBZA 3G5ZA 1U0QA 4LPTA 4PJ8C 3G6DL 4LVHC 4E42A 5DJ2A 2J20A 3MNVA 3DI2B 2ARJB 4XCYA 1RZJH 2DQFB 3KLKA 1EMTH 1TNNA 4R4ND 4X50A 4ZX4A 1N6VA 3OAYK 1THAA 1OCRB 4XRCA 4Y5VC 3WTSA 2EVHA 2WLLB 1UT9A 4HC1A 1N5YH 1F3DH 3DECA 4M7LT 1PFCA 3WE6B 1AO7A 1CGUA 1FNGB 3K5SA 3M8OL 4XNQB 4NO5B 3QZWB 1ZLVK 1VJSA 2H5UA 1JWSB 5JIKA 2NR6D 3T3MB 3QWRD 1SLUA 4PHZA 3O3BB 3H85A 1HHIA 1G7PB 5F7KC 2WQWA 4R2GC 4W9JC 4I13B 4S2SA 3X12B 3J8F7 2HJLB 1BJ8A 4F57L 4L29B 4D9LL 1JZ8A 1NGQL 4WI8A 3OC8A 3THML 4PJHE 4GW4B 3BO8A 3JTSB 1VACB 4HDIB 1XH0A 2XTJC 4HUVB 2F6AA 2SEBA 4X7CC 3OLGA 4TPRL 1KLUA 1NUFA 3HKZA 1JGVL 3VQ1C 1IGYB 5D7IB 2Z1KA 3C5ZC 3IFNL 4PVNA 2E7MA 4WQOA 3VG9C 3FU6A 3RY5A 5D7LD 3P9LB 5KUMA 3OR7A 4RBPH 4X8GA 3VXPA 1MHEB 1EHAA 3G5WA 3I9GH 3IJEB 3MZTA 3QUZA 5KANG 4KY1H 3NEEA 3JWDC 3ULUE 1WUZA 4LLVA 1NDGA 2GK2A 1YNLL 1PJWA 4LOUC 4Z23A 5F7YC 2VLRE 3TT1H 1YEGH 1OP3K 3MJ6A 3SGJA 3TV8A 1N8ZB 4JDZB 3ZDZB 3IU3B 2XX1A 5DO2C 4YFLF 1BOYA 5I8EA 5I18L 3HPLB 3RZCD 5JLZB 5C0IB 5C6TL 1E27A 5KW9H 4LO9A 5HGAA 4DZ8B 4U6VL 5DD3H 4OZFB 1XIWC 1PZCA 5CFAA 3BP7A 1QPKA 2XWTA 2Y4SA 5HJDA 5K9QI 4PJDE 4KRNA 4ZS7L 4FQCL 4KJWD 4OV5A 1XAKA 1QKZH 2AF2A 3MTRA 2HT3D 1SLWA 3TF7C 1IAIH 1INEH 4ONHB 2XKNA 2IDTA 1T03H 1UD6A 3GSXB 1CD1B 1NFIA 4EPSA 4NO3A 5A7EA 1ACYH 2W0LA 4PJ7E 4MS8C 3H9YA 4Z7AA 2VERN 2IOOA 3KWWB 3N06B 2G75B 5T5FL 2DQTH 4RDQF 1MW2A 1BW8A 2B4CC 2X4RB 4OT1L 4PJAF 2NNFA 1ZMYA 5ADOL 4Y9CA 1ETA1 3C6EA 3LZLA 2BK8A 5DMGD 4PN6A 1ZA6B 1QVOB 1KJMA 3RL1B 4PJGE 3C2AL 3WNOA 4P0DA 1U3NA 3QIUC 2DQHH 3MJ7B 3N44B 4Y16D 4HH9B 3PFQA 1KCSH 2DZEA 4NZUH 1SMAA 3GLAA 4J3OD 2FYYA 1QRND 2P5EE 5A1AA 5IEHB 1L3WA 4LRNL 3KPMA 43C9A 1W15A 3QISA 5EF0A 4TL5A 3NRPA 4P07A 1EJFA 4L9LA 5GS0C 2RFXB 4JN1H 1MFBH 3L3DB 4XOEA 1MEXH 2NMSA 5ID0B 2GJ6E 4J7RA 2LABA 4Z8FH 1S9WA 2L7UA 1G9MH 1OF2B 1AYRA 2HFTA 1JJUA 3TT3L 4OGZA 1WT5A 4OCMC 5FA3A 4JDTL 1A7QL 3BPCA 2WBXA 3CSPA 4E9RA 4WV1A 4ZBJA 1PIGA 2Z7WA 1KC5H 4XOCA 3U4EB 5J3HD 3MUHL 4J8RB 5BCAA 5DZVA 3B6SB 4WI3A 1SRDA 4M62H 4U05A 1J8SA 1NGPH 5FYJD 4Y5XB 4PTTA 3T8VA 4U6XB 5TQ0H 4HU2A 1HH6A 4M4PA 5GGSB 2JCCF 2G9KA 1UZ6F 3DGDA 3BP6A 4RGND 5I1HH 4L8BA 4OLYL 3SO5A 4ACPA 2KZWA 3FT1A 5IIEA 1HINH 3TPUB 4TNVF 4HEME 3U79A 2E9WA 2WOYA 4A7SA 4NOBA 4N8VB 2CJSA 5DHEA 4P5RA 3VXUB 1UJ3C 2DYPB 5EPMB 3ZKNC 1CGXA 3SCMC 4P4KD 2RALA 1SF5A 2C9RA 1DVUA 3MRBA 2E0PA 4FQHB 1EZSA 4M43L 4YE4H 4EZJA 1F6LL 1E4XI 1Z3RA 1YQ2A 5JO5B 1EUUA 2ZIDA 1AE6L 1EDQA 1JN6A 2HZHA 4PJDB 1UKTA 2CGRH 2JQAA 1AC6A 5LGJB 3LVEA 3NH7H 1CL7L 4JDVB 2UY6B 5F0JB 5IW1A 4A7UA 2AV1A 3RUGB 3MVSA 4BWTA 2I9LA 4PJ7B 3FO0H 5DZOA 5EZIL 2ICWB 4K15A 5CLZA 1GL4B 4IHOB 3FSWA 1JF6A 2PYFB 4IYKA 1YECH 4Z8FL 1HSBB 1UZ6E 1MLBA 1FDLH 2VDPL 4KXDA 4P2OC 4PY8J 5HI5D 2FR4B 5I15L 3SGKA 3LZFL 4AYEC 1G0XA 2EIDA 1TKWA 4F3FB 4N2HA 4H8WC 2C4FT 3C6LC 2X4NA 3CSTA 5EB9A 3RBGA 1S4IA 3NSXA 4LPWA 4ODUA 5IVOA 4QLRA 4XPBL 3SDDA 3VXSB 3BPOB 4KDTC 3WOVA 1MHPL 5HHMB 3AITA 1K8IB 3KPSD 5ANHA 4F7PB 2VMFA 4R5VA 1E5ZA 5MHSD 5KSAB 1GY1A 4ZNEA 2FSDA 5LWYH 4NSKB 1TTRA 1BXUA 1VFOA 4O4YH 4G8AC 4KKCD 1LTXA 4ZYKB 2V37A 2EYSA 3HE6C 3GI8H 12E8L 3TYGH 4F8LA 4HYTB 5ICZA 4WVRA 5A43C 3TONA 2MQ0A 4F9PA 3TASA 4AMWA 1ZANL 4A66A 2BP0A 1IC1A 5FFOA 4NERA 4N8CH 4D0CA 4NQVA 3WELA 1J0IA 3O3UN 3PIQA 1F56A 4M5TA 3JWNH 1BQUA 2DI8A 1TFHA 1NC4D 2PR4H 4RAVB 1V54B 3OF6D 5J6HA 4JZJC 1GJIA 5F71A 3S48A 4L8SC 5F9OH 2QPSA 5IY5B 1PYWB 3BN9C 4PJBB 4Y19E 1ZT4A 3TPKA 4HHWA 1H8LA 1KTBA 2WGXA 1QFWH 2YLKA 1DBJL 3QZMA 5JW3H 1FYTA 4X5QA 3TS8A 3N9GL 1LP9A 4JQIH 2AERT 4HKJA 1DEEA 1FDLL 5K59E 1EGJA 2AZAA 3UTQB 1UC6A 3P3YA 1ODUA 4HWZB 3DVIA 1QUNA 1MHHB 3K72A 4WW1A 3X1NA 4KQ3L 5C92A 4AENA 5EOQL 3MV8A 5E5MA 1OAXH 2UZIH 2GUOB 4XMVA 2AQQA 3PWPA 3MXWH 4YLBA 1VEOA 1G4RA 4M7KL 1KCLA 1MQ8A 1AI1H 2LQRA 4PJ5B 3ULVF 3CZGA 2ZUTA 3LKSB 4GG6A 5AW5B 5JHMA 3M45A 3RKDC 3SE8H 1NMCB 4HSQA 4ZK8A 5CD5C 3L5WA 4G2AA 4L2LA 3OB0K 4PI0A 3I6LE 3FOLA 3BQUB 4JY4A 1M2VA 5SWSE 5LGKA 4MDJB 5IR1A 2D0GA 4OZFH 5EUKA 2WIIB 2GCYA 4OGYL 4QMEA 5I1KL 4CW1A 5HPMA 4FYQA 1AKPA 3S3BB 3FO9B 4KAQL 4MRBA 4X7SH 2DL2A 4NZJA 1PNDA 1BFOB 5C8JB 2X2YA 2YUXA 3TBVA 2W9EH 4YOKA 3CAFA 2HMIC 1CYWA 1YN7A 3QIWA 4TXVB 4A55A 4KZEH 2C9XA 1AGEA 1ZXKA 3MC0A 5ECJE 5ITFA 4IIZA 2GITB 4MB5A 4XWGH 2DLFH 1R5VA 3HZMB 1HHHB 1AZUA 4EVNB 1IM3B 4ZSOB 5KBMA 4HJIA 1BQ5A 1CU4L 2MTPA 3DPDA 1NBYA 2PCYA 2NCEA 1I9JL 3P9MA 5ERWB 1NCDL 2BSSB 1WV7T 2NY4C 2Y7LA 1BBDL 5CZVH 4CC0A 5EF1A 1EO8L 4AYFB 5FO8A 2ISDA 1T66D 2J6EH 1KEML 3NIFF 5IROC 3QUML 5TDOA 5MERA 4XMUA 3C08L 2FEEI 4X9GA 5IHBA 3SBRA 5F1KC 1BIHA 4PTUB 1FORH 2JXMB 3WN5A 3ZTEA 5ADPH 4ZOEA 4NKDA 2H0EA 3QK0A 3TJHD 1DQKA 4NRXB 4RVBA 1VSCA 2IAND 2MCMA 1Z5LB 3D87B 4JVPA 5EZJB 1UVQB 1BD2D 4DPRA 1Y0LA 1TQBC 2QVTA 3O8XC 4HD9A 2EYTB 1QTPA 3IPBA 3ZMRA 3A4AA 4GAGH 4PRAA 1NJ9A 1RK0A 4Z0BL 3QFJA 1PZ2A 5BV7C 2FWOB 4WKZA 3IKCB 3TWCH 4DN4L 3ZTNH 5CP3A 1LMKA 2B5IB 2XZCL 3CU1A 5AL8A 4Y4FB 4KO6A 1SUHA 4M6OH 2D3LA 3EJPA 4XNYL 3ZDXE 1N2RB 3D4CA 3RX8A 3MJ9H 1I75A 1K4CB 2OFQA 1UA6L 2X4OB 2A74C 3D5OF 3ECWA 4N4YB 5AZUA 2Y7NA 4PD4J 3KNBA 4B9YA 4LRIC 2I24N 4QRBA 1IV8A 1IZKA 5CMAB 3FUHA 2ZX7A 4AXWB 2WBWB 4N90D 2J5LB 4AC2A 1KENL 4EDXB 4IBUA 3A6BH 5ETUA 5FYLD 2NR6A 4PS4L 4YLQT 3LKNA 3QWRA 1E4KA 4I77L 4N26A 5DQ9B 3MOAH 4HUNB 5T8IA 5CHNA 1FL6A 1XF4B 4NZTH 4PLKD 4MRCA 1GW6A 2NQCA 4LEOA 2A6IB 4A6YB 5E1IA 2HLAA 2F61A 5SWSB 3FPYA 3DVGA 5HHNB 3VGFA 4LARL 4Y1AB 3C5JA 4HCRL 1KIPB 3IJSA 4GUOA 3D39E 5FA4A 3BVVA 2Z91B 2DM2A 3CZJA 1G7IA 1RZ7H 5GGSY 3TNMA 3B34A 5FGSA 5D7LA 2Q2LA 5F7NC 4YDVA 1Y07A 5HDBF 3STLB 1H19A 4GKOA 3KXFB 4QLWA 2AXJA 1V7ML 5KS9E 3W57A 5DMYA 1GGCL 3EOTL 2ADIA 3NMEA 5L4JA 2IQ9L 3ZTNL 1MVUA 2BY2A 3EGSB 3REVA 3RWGA 4YSQA 4B97A 3O3AA 2XWDA