3V9CA

Type-2 cu-depleted fungus laccase from trametes hirsuta at low dose of ionization radiation
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
499
structure length
499
Chain Sequence
AVGPVADLTITDAAVSPDGFSRQAVVVNGVTPGPLVAGNIGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQHGTNWADGPAFINQCPISPGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASRYDVDNDDTVITLADWYHTAAKLGPRFPGGADATLINGKGRAPSDSVAELSVIKVTKGKRYRFRLVSLSCNPNHTFSIDGHNLTIIEVDSVNSQPLEVDSIQIFAAQRYSFVLDANQAVDNYWIRANPNFGNVGFDGGINSAILRYDGAPAVEPTTNQTTSVKPLNEVDLHPLVSTPVPGSPSSGGVDKAINMAFNFNGSNFFINGASFVPPTVPVLLQILSGAQTAQDLLPSGSVYVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGSTVYNYDNPIFRDVVSTGTPAAGDNVTIRFDTNNPGPWFLHCHIDFHLEGGFAVVMAEDTPDVKAVNPVPQAWSDLCPTYDALDPNDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
publication title Crystal structure of T2-depleted fungal laccase from Trametes hirsuta 072 at low and high dose of ionization radiation
rcsb
molecule tags Oxidoreductase
total genus 145
structure length 499
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA03
2PPAA 5D4HA 2YAPA 5EHFA 2FQFA 1DZ0A 3QJUB 4AX3A 3IBOA 4E9YA 4A2DA 1PZBA 3H56A 1KV7A 3HEIB 1NDTA 1JXGA 2Q5BA 4GXFA 4A2GA 5AFAA 3WI9A 3T6VA 3ZX1A 2EILB 2PP9A 2TSAA 3GYRA 4YSEA 1L9SA 1ZV2A 3S8FB 3T6XA 1BXVA 1SF3A 3SQRA 4TXVB 2QPEB 1QNIA 1ET5A 2IDUA 4BXVA 3AZUA 3PAVA 1ASQA 5A7EA 5F7AA 4GY4A 3CZUB 3NJMA 1BEXA 1L9RA 1M9WA 2PLTA 3QQXA 2BZCA 3PAUA 2UXGA 4KO9A 1J9RA 1L9PA 3PLYA 2XX0A 3G5WA 2VSKB 1BYOA 1IBZA 4QKTA 3UABA 3DKHA 1OE1A 3NJIA 4F2FA 2LLNA 3QJTB 1NWOA 5I26A 2FT8A 1ET8A 1WS8A 2H3XC 1JZGA 2JXMA 4BWTA 1F56A 5B7EA 4M4RB 2WO2B 2GB2A 1CC3A 5FC9A 1EZLA 5B3SB 7PCYA 2ZXWB 3ABGA 2YAHA 3WNIA 1PMYA 1JERA 2XVBA 2N0MA 3NJJA 2IWEA 2HRGA 3JT2A 4W9ZA 1B3IA 3TBCA 1ZPUA 4HIPA 3FS9A 1PLCA 1UATA 1AZUA 2CJ3A 3QPKA 3NJKA 3X1BA 2OCCB 5I5IA 4A2HA 4DP6X 2IWKA 3CVBA 2UX7A 3UGEA 3WIAA 4A2FA 3T9WA 2R7EB 2HX8A 1WAEA 3H4FA 2PPFA 4X4KA 1JVOA 2ZWNA 4Q89A 2P80A 2VSMB 2E86A 1AS8A 1AANA 2FNWA 3EH5B 2YAFA 3EF4A 1GS7A 5PAZA 4W1TA 5I6MA 2PP8A 1EHKB 3NP4A 3NJLA 1NICA 2IWFA 3T6ZA 1XB8A 1J9SA 1HAUA 5I6OA 1PLAA 3NJFA 1PCSA 2BP8A 2DWSA 3DIVA 2VW4A 4WKXA 3ABKB 1ZDQA 5B7FA 3NSCA 2ZOOA 5I6KA 2Y1AA 2I7OA 3S3BB 5I6LA 2WO3B 2QDWA 4A67A 3CDZB 1NZRA 4E9XA 1PY0A 3FQYA 2J57A 4NB7A 3ERXA 1OCOB 1WA2X 3U25A 2AFNA 2FQDA 2DYSB 1SFHA 2YXVA 3EH3B 2PPDA 1BAWA 2DYRB 4AKQA 3FSVA 4CSPA 1YLBB 1SDDA 2MRYA 4M3HA 1T5KA 1VLXA 3NSDA 2GSMB 1ILSA 2PP7A 3CG8A 3EHBB 4JHUA 2BW5A 1JXDA 1V55B 3FU9A 4A66A 1ZDSA 1KGYE 3CDZA 5I6PA 1OCZB 3QJRB 4JKNA 2H5UA 1AS6A 1NIEA 2BWIA 2VW6A 3WG7B 1IBYA 3ZDWA 5B1KA 5I5MA 3V9EA 3N2JA 4HHWA 1A65A 2Y69B 1W8EA 2PPCA 1JZJA 1PZAA 1RZQA 1JZEA 4N8UA 1SJMA 2DV6A 1AIZA 2FWLB 3OQRA 3FSAA 1GR7A 3UAEA 2W88A 4YSCA 1JZHA 5B1JA 1KBWA 1IC0A 4N4YB 4DP8X 1AOZA 4G7SB 4DP2X 5AKRA 1AG6A 5PCYA 2Q9OA 4UF7C 1ADWA 1KCWA 1BQ5A 4HALA 1W6LA 2IDSA 2XU9A 2NRDA 4YSAA 3OM3B 3SBPA 5D4IA 2I7SA 1AACA 1IUZA 3PCYA 3NJHA 3KW7A 1AZCA 1JZFA 3FSZA 2AANA 3AG2B 4YSTA 4NERA 4KOCA 4HCGA 4YVUA 3KW8A 2YAEA 3FPYA 3HB3B 4Q8BA 1XB3A 2HLEB 1WS7A 2VM4A 2FTAA 4GP8B 4ZK8A 3OMNB 3T6WA 1IKOP 1X9RA 4KNSA 1ZIBA 2EIKB 4E9SA 3TASA 5ANHA 2YAOA 4P5RA 1KYAA 1A8ZA 4DPAX 1E67A 3BQVA 3NT0A 2BP8B 2FT7A 4F7KA 1BXAA 4G72B 5E9NA 2QPDB 1SFDA 1J5CA 4YSRA 1I53A 3CVCA 1KCBA 4F2EA 2J55A 1AQ8A 3EH4B 3TBBA 4BWWA 3QJVB 4YSQA 3V9CA 1OCCB 2QDVA 1NPNA 3PAZA 3X2QB 5B1JC 1MZZA 3FYIB 1SDDB 3S3DB 1DYZA 1ZIAA 3NJGA 4KNTA 1MZYA 3S3CB 1ID2A 3FYEB 2BHFA 2A3TA 4RH4A 4G7RB 2P80D 1A4CA 4AZUA 3AG3B 1XB6A 4WTQA 3FU7A 1J5DA 1GS8A 2GI0A 2YQBA 4G71B 1E5ZA 4BDVA 2BP0B 3TA4D 1BQRA 3SBRA 5F7BA 3FQ1A 1KDJA 4YSUA 1NIDA 3FSWA 2UXVA 2XXGA 4JHVA 2YAQA 5B1BB 3IEAA 1MDAA 1BXUA 1AG0A 1NIFA 5TK2A 5TK4A 2RACA 4E9VA 2B3IA 2PCYA 5B1AB 2EINB 2BP0A 1OF0A 3X1FA 1WA0X 2IH8A 1AZBA 1ASPA 2IAAC 1KDIA 1OCRB 1W6WA 1CYXA 1E5YA 2IDQA 4HCFA 1GYCA 1M56B 1OOWA 2FT6A 4HAKA 4YSSA 3IE9A 2EIJB 1CYWA 3UACA 1MG3C 1PZCA 1AZRA 2XXFA 3WNJA 2HX9A 2HXAA 1E65A 4E9WA 1SHWA 1ASOA 1BQKA 3AG4B 5D4JA 4EF3A 2BW4A 3DTUB 4A68A 1GY2A 1TEFA 1J9QA 2JFCA 3L45A 2XWZA 3ZIYA 2GC7C 1URIA 1JOIA 4MFHA 2HZHA 1JXFA 4E9RA 1OV8A 3UAAA 1A4AA 4NAJA 4A2EA 4CSZA 3AG1B 2HRHA 3MX0B 1XMEB 1L9QA 2IDFA 2YAMA 1N70A 4UAHA 3ZBMA 2YARA 4DP5X 3H4HA 4FA7B 3AW5A 3AY2A 2ZONA 3FT0A 4HCIA 1GY1A 2JKWA 4PAZA 1AS7A 3FU8A 3OMIB 1TEGA 4UANA 1ILUA 1E30A 4HHGA 1SHXA 2FQEA 3BVDB 3X1EA 1WA1X 1RZPA 4GP5B 2GIMA 3WKPA 2PCFA 2X88A 3FQ2A 2XLLA 1V54B 2W8CA 2AZAA 2YXWA 2UXFA 3PXLA 4BWUA 5I5JA 4DP0X 1HFUA 2CCWA 1RKRA 3C75A 1PNCA 2BZ7A 3GXUB 4AKPA 4DPCX 1CUOA 4DP7X 3OMAB 2J5WA 2CAKA 2B08A 1QLEB 3CVDA 4DPBX 2UX6A 3QJQB 4ENZA 5LDUA 2CALA 1AAJA 4YL4A 2PPEA 3TU6A 1TU2A 3X1GA 4BXSV 8PAZA 1JVLA 1TKWA 2XYBA 3SBQA 1ETJA 2I85A 2VMJA 2VN3A 2HX7A 2XV2A 3ABMB 5AZUA 3ASOB 1FA4A 3FPXA 2CBPA 3NSFA 1NWPA 1FFTB 1M57B 1SF5A 4KNUA 1OE3A 1RCYA 3T71A 3NP3A 2AZUA 1V10A 4K9JA 4P5SA 1GS6X 1NIBA 5B7MA 1A3ZA 1AR1B 4AI7A 2BWDA 1AZNA 1JZIA 4YVNA 3FU7B 2J56A 3JTBA 4GP4B 9PCYA 5I6NA 2FJSA 4BDVB 3IN0A 4BK5C 1SNRA 7PAZA 2MTAA 3MBWB 3GDCA 1NIAA 3ABLB 2XX1A 1N68A 1L9OA 1A4BA 4KO7A 1GSKA 2VW7A 4KO5A 2AVFA 4PCYA 4DP4X 2R7EA 4KO6A 1L9TA 4DP1X 3NYKA 2GBAA 4QLWA 2FQGA 2XV0A 3IN2A 4G7QB 4E9QA 4L0PB 3WKQA 1J9TA 2IH9A 1QHQA 4DP9X 3N55A 1PF3A 4GYBA 1GW0A 2IDTA 4AKOA 3D12B 3UADA 1NTDA 1R1CA 4G70B 2CUAA 4YSOA 2GC4C 6PAZA 1NINA 2EIMB 2UXTA 1HAWA 2X87A 3ASNB 3PPSA 1NPJA 1MG2C 6PCYA 3S8GB 4YSDA 1PAZA 2QT6A 2TSBA 3NSYA 3QJSB 1PLBA 3X1NA 2GHZA 4E9TA 2XV3A 1ET7A 3OD3A 2OV0A 1CURA 3RYMA 5I28A 2BO0A 3NJNA 1X9UA 2DY2A 2VM3A 1OE2A 2WSDA 2H47C 2OJ1A 1FWXA 1KBVA 4YSPA 4HZ1A 5IY5B 2DWTA 1PNDA 4FAAB 2XUWA 1BYPA 4KOBA
chains in the Genus database with same CATH superfamily
3HNVH 3PQYD 5KTEH 5IJBC 1I3GH 3VG0L 5I19L 2AXGB 3H6AA 4TVPL 4AX3A 3GLAA 1W8OA 3P4NB 3U46B 3ZTJG 3KE0A 4HK0A 4LPXA 3D85D 4WI9A 1QBAA 3L2MA 4PRDB 3SKNB 5IQNA 1Q8MA 4KK8D 1QO3B 1OY3B 2PCFB 3UPRA 5GRZA 3RKDC 1MW1A 1YNKH 4N1HB 2WKGA 1ZV2A 4NQUA 2VZSA 5ECGA 5LAXB 1V3LA 2P5EE 1B0WA 3ZOAA 4MMZC 1E7UA 3PU7A 4NLHA 4Y9FA 1FDLL 4F7PB 5A43C 4F15B 4ZTOL 4ANUA 1ZLWK 5ITFB 1FL6B 3B2UC 4EIZC 1QBML 3ZW3A 3PLYA 1FIGL 5I1KH 3G5WA 4D0BB 5EUOB 1ONQB 3UDWA 1MHHA 1V7NL 4MTMA 2BNQE 4WFHD 1T2XA 3DKHA 3RIAF 2D4DA 3QIBD 2D9CA 5E6UB 4TOYH 3WY4A 1N5AA 3DLQR 3WDIA 3B9KD 4M8VA 4LMQI 5HJBA 3V4VA 3BZFB 2IO5A 2NLJB 3KPQB 4C56A 4WU5A 1MF2L 4XMTA 5HGHA 2WIIB 2YAHA 4GRMB 5DVLA 5MI0B 1UM4L 1Q1JL 4GW5B 5KVFL 2N0MA 3NJJA 2J21A 3JT2A 3QQDB 1KT2A 2EE9A 2P5PA 5J9PB 4PS8A 1KJMB 1UACL 3U2IA 4MKMA 3VYNA 2VDRL 4TUOA 5K69A 1CXHA 4U31A 2DH3A 5E7BA 4BH7B 3FQRA 4DP6X 2CSPA 4OZGE 4ZO6A 3X17A 4JL2A 4CNIB 5ICYA 4J3BA 4LFHG 1WAEA 1P7QD 2D8KA 2GJZA 3FTWA 3G6AB 4TUJA 5HGBB 1NOAA 3WGUB 3OZ9L 1AANA 1UD4A 1YMHB 4LSTH 3UJJH 4XBGB 5HY9B 3PABA 3E8VA 5AAWC 3QVAA 5DD6A 1XGQB 1CR9L 4LPWA 3R0NA 3NJLA 4J1UB 4NZRH 3ZUCA 2G2RB 1HCFX 1AIFB 3BWAB 4HIEB 2IAMB 2NXZB 5F1OB 2V3FA 4G59C 5K9OA 2LHAA 1O7DE 5T33H 1IVTA 1PCSA 1R4XA 3C5XA 5D1ZA 4BQ6A 2XPGB 4LKXA 4K94H 1BP3B 1IEAA 1FNEB 3MBEB 2OMVB 3MV7D 5KSAA 3H42L 4PCTA 5BS0B 5J3HD 2WNGA 5JQHC 3T4AC 2QSVA 1TPXC 4DAGL 2AS5M 1ZLEA 3KDPB 1OAYH 4OQTL 2WQWA 4GAGH 2VXQH 5FCUH 4XO5A 1V7ML 2WLNA 4APQA 5K9KA 3CMGA 1G7PA 4XPFH 4XNUL 2CO2A 2DYRB 1RK1A 3KM1A 1WZ1L 1JHKL 1YEFH 2J5LB 4FX5A 4A7SA 2Q3AA 1QR1B 1PZ5B 1U95A 2VTFA 2BC4A 3VSUA 1A7PL 3JWNE 1U6AL 1USQA 2OKMA 5F0MB 2DIEA 3E6FB 3LQMA 3O3DA 5JA8B 4AYID 4X9FA 1HH9B 2FGWL 4C4UA 3LEYL 3GBML 2YRPA 4BQCA 1JZJA 1D6VL 2A9NH 3QUZA 4G8FB 2DRUA 3VMNA 4H8WL 2DF3A 4NO0A 5MENA 5CHNA 3UERA 4ELDA 4B41A 3C6LB 1KELL 2ORBH 3RWJA 2O5XL 5FYLL 1OGSA 2WBWB 1O9WA 4Y2DD 3MJ6A 5CXPA 4KRPC 1VIWA 3CSBA 1LVEA 1IAIH 3V4VL 4HALA 4NZTH 1G7MA 3B3BA 4P5TD 3K6DA 4MYPA 3U4BL 5DDHA 3PS6A 4DUXA 3T4YA 2ADIB 1BG1A 3QDGE 1IBGH 1H0DA 4YDKL 3ZRCC 4O02B 4QJ4B 2QQLH 1FFNB 5E9DD 3QI9B 2QADC 3NG5A 2B14A 3NJHA 3TO2B 3TONA 4JO5A 2DQUL 4Z7OE 5IHZB 3QJHB 4GSQA 4J12A 3WNMA 1INQA 1BX2B 1RZKL 3UIYA 1LEKA 3MXWL 2R39A 4I87A 1ZHKB 5ENWB 1OM9A 2JJUA 5C08D 3TESA 3PG2A 1MRFH 4HCRA 4KKLC 5C9JA 4ES9A 1JD9A 2ZWYA 2OYLA 3TLRA 3T2QA 4WHDA 4PJ7B 1RIVL 3SO3B 1R0AL 2XG4A 3WYRA 4B9FA 1DVZA 2WZ6A 5FO9A 4R5TA 5EBLB 3EOBB 1SGKA 4GUPB 4JRXB 3SDAA 1WC7A 4M93B 2X4NB 2ZUTA 4CBZA 4HPYH 3IDMA 1FLRH 2KDYA 3PP4H 3TASA 4M6OL 5DD0L 2HUEA 1XX9C 3GSXA 2BSTB 3IVKA 3GZPA 4ZFZB 3BGMA 3CPUA 4XNQB 3WL9B 3C09B 5IK3B 2R23A 4RAVA 1MVUB 3NT0A 2F9BT 2VXSH 3HUJB 3S37X 3NQKA 4XVJH 2ICEA 3I3BA 3CFJA 3OJ2C 4LP4A 1UA7A 2AQ3A 1XSJA 3ESUF 2DMCA 4L8BB 4XR8C 4H8VA 2OMWB 5EIIA 4A7GF 3OVUB 4X6BB 5AVVB 2GT9A 5T3XL 3QIUB 4U1MB 4ZMPA 3WTXA 1YN7B 1PW3A 3D5OF 2W59A 3MNWA 3WN5A 2HLAA 4CILA 3RHWF 1K8DB 3LH9A 3QCVH 2ITEA 2P49B 4HKJA 5E8OB 1MI5A 3WJJC 3X2QB 5B1JC 5KYXB 2XKNB 5D7KE 4DO5A 3RFZC 1PKOA 2RMNA 3HAEB 3VB8A 4G42B 1DN0B 1SN2A 2MPAL 1LNUB 3U7AA 5AUMB 3PGFH 4NBZB 2X2JA 2JI3A 3QULA 1FL5B 4K3DH 5JLZA 4GI6A 3KG5A 1YEJH 4F7TA 2OTUB 5C1MB 4NPKA 4GRWH 4NBXB 1IM3B 5KVDH 1Q0YL 3FTGA 2JJWA 3OKOB 3P4OA 4JPIA 4K7FB 4L4TA 4UB0H 5FO2A 4BA8A 1VEOA 5CEZH 4N0UE 1ZKAA 2NY3B 2QGEA 2ZYRA 5BRQA 3ZQXA 2VDLL 3UOAB 4EN2A 2GJ6B 4OGXH 3BW9A 3GGWB 4Y4KC 4N24A 1MEXH 4WLCA 3Q6FB 4M56A 1UT2A 2G4EA 1S7XA 5FV2A 4UQBA 1AG0A 1E4XL 2VXUL 4HK3N 4I2XB 4CW1A 3QUXA 4EQ3A 2F8OA 4L0YA 1QLEH 4NKOA 4YE4L 2VLJE 5B1AB 3IDJA 1OF0A 4WEBL 1AZBA 4W9FC 1ASPA 1E7VA 4OZFH 3VSVA 1GZHA 2IDQA 5D9SA 4KI1A 2PR9A 5IB5B 2KL6A 2VXTL 2ZOKA 1GTNA 2W91A 2NXZD 1KLUA 4KQ3L 1HESA 4M6AA 1VZGA 3G6JF 4N85A 5E03A 3HG3A 4GSRA 1NGYA 1R3LA 3JUYA 5SWSB 3Q05A 2HXAA 2NX5E 1A3QA 4LK4A 1JN6A 1KIQA 2ZOWA 2DTSA 2A9CA 5CF3A 1CLOL 3MBED 4HCRL 2EXSA 3IPBA 5D70H 4XMKH 5C07B 3HE7C 5BS0D 2ZKMX 4PWJA 1ICTA 2ZSWA 4GNKB 4KDTC 1U58A 1Z9NA 4NBYB 1B2YA 4NXSA 2WMPB 3ATAA 2N56A 3NABH 1IT9L 5CBEB 2K78A 3BKCL 2VISA 4CSZA 1H5BA 2YRBA 4K23H 4TPRH 4L1BA 3T5WA 1NC2A 4JPVH 5FOBB 4L1LA 5C0BE 4OJAA 4GO9A 5DS8A 1QAWA 2YAMA 3GJFH 2G3NA 2FEDC 3L4YA 3QIWB 1FFRA 3O6LH 5D72H 2VXVH 3DDFA 4GSDL 1GGCL 3NRPA 1EFXB 3N0AA 5DD1L 3AW5A 2WXRA 1XGRA 2ZONA 5EO0A 5EU3B 3TO4C 3SJVB 3BAJA 3BKMH 3L4VA 2C4FU 1E5CA 4MCNA 4DN3L 1WHOA 1WA1X 2WCSA 1B4JL 1ZY9A 1JDDA 4Q9BA 4WHTA 3WKPA 3MHZA 1AGBA 5IROA 2XLLA 3U1SH 4BRJA 5HTSA 4TVSa 2IPKA 1S7TB 3BEVA 3C75A 4OAWB 1PNCA 2Q3ZA 2C26A 4AKPA 1K8IA 4PCSA 1JGVH 4NRXB 3DJTA 3JTSB 3C6LD 3DOSA 4FQJL 1E8YA 1J88A 3QUMB 4HUWA 4IBYA 4N2AA 4LQFL 1D5XA 2Y5TA 3KPSB 5F7UA 4IOIB 5F0LB 2OJEB 1IKNA 4ZPTB 4HPHA 1JFHA 4WKZB 4CSTA 2Q3XA 1XCQB 3EGXA 4Z3JA 3JSSA 2PTUA 2BRRH 2NXYD 3KXFB 1KJ3H 2HX7A 2VN3A 3W1ZA 2WBJC 4U6XA 1IFHL 3ASOB 3BKJH 4OFQA 4V1DE 4FA8A 2G30A 1TQVA 3LZLA 5EU5A 4EDXB 4LCWE 5EU6D 4ZX3A 2EDEA 1GS6X 3FAWA 4XGZB 1KCSL 3HS9A 4FMFA 2NY4D 2X3AA 3ZDZE 1JHLL 1ZLUK 3ZE0F 2H3NB 1CWVA 4U7SA 4QRFA 4E5XB 1RJCA 1S9KC 1A2YA 1OALA 4UOW1 3QO1A 2WQAA 1JZ5A 5EC2A 4ZUTB 2HFFB 2KMWA 1F86A 2PO6B 3OXRB 3PHOA 3PGDB 3SO5A 5IVNA 1CGSH 1FNAA 4PJ9B 5C0AB 2GK2A 3ARBC 2Q8AL 1J5IA 2VGLM 4M5YL 4F1ZA 2BDNH 4JG1H 1HKLL 3FQ4A 1AGCA 1R46A 5EO1B 3T2LA 3T0XA 5J8OA 2R0WL 1YMMB 4Z3TA 1MCJA 1QHQA 2RA1A 2YIHA 1NEZB 1MVFA 4MA8L 3FO1B 5GZOC 1IGIL 5KSBA 3V4LA 5GS1A 3NFNB 1IAII 1FFPA 1Q9LA 2FUTA 1BQSA 2JSFA 4FNPA 6PAZA 5GRWA 1YYMH 3ULUL 1X4XA 4QRRE 3A4EA 3MSPA 2J8UF 3BPCB 3IJSB 4N8PA 1DJWA 3H2QA 2K7PA 5JUEL 1YEWA 1AE6L 3TA3A 1XSKA 4WWKA 4GXUN 3B43A 3X1NA 3PJSB 3Q9QA 4OVUA 1BBJB 2BVOA 3VMOA 1OZUA 2OV0A 4N5UA 2IFFH 5LQBH 1UURA 4IRSB 3L4CA 2XWBB 2K1MA 1PVHA 1A14H 3F58L 2RCSL 3UP6A 2PXYB 1JWSB 1PX3A 2R59A 5C86A 5ALCL 3RNKB 3NZSA 3HCVA 4RIRA 4QGTA 5HHOD 1CFTB 1KEML 1KTBA 3MACL 5A7BA 3IBOA 4Q2ZB 2WQRA 5D2LB 4ZFFB 2O61B 5JR1H 2CUHA 3CVHB 2QFRA 1IM3D 2DQFB 4JFQA 5AOIA 5T8IA 1ED3B 1NC4D 3SDDC 5IVXF 2FGZA 4XWOC 2NY3D 1KBGH 2PP9A 2TSAA 1F0LA 43C9B 1BXVA 3DV4A 4BGLA 1MH5B 1QNIA 4WTXA 1QMUA 2AJUH 1TCMA 1UM6L 3WY1A 4IOFC 1I7TA 4I18B 4MJIE 4JM2B 3MA7B 1WFJA 2CJSA 4JBSA 3NJMA 4F24A 1CLCA 3VFMA 4MJJA 3C60B 5L7XH 3WUWB 3NZUA 1FCCA 5DVPA 1I8LA 1L9PA 1R3HB 3LH2L 5DYOB 2H3KA 4QCIB 5LDSA 4HF5H 4IYKA 4NNYA 4U1GB 3UXFA 4ELMB 5IBLD 3KS0H 2P5WE 3RUGA 1HWHB 1PY4A 5IEKA 3K1KC 1JGEB 2ADFH 4YNYA 3W5MA 4MNQA 1MCNA 2EXYC 3JYCA 5SWSD 5HVHB 3WXWH 3W3BA 1LP9A 5I23A 4AT6B 1DQKA 5B7EA 1BFOA 3OAUL 1MW2A 5CJOH 2ZXWB 5DU7A 5C07D 3CFIC 4RRPM 5BO1H 5LXVA 5FLVA 1WEJH 2X89D 1Q38A 3IFNL 2DQHL 4W9ZA 3GSQB 3G5ZB 1M05A 2VLRD 4ZXBB 4L23A 3K91A 4KI5D 3IDYB 5LGHL 4KZDL 1I1FB 3L2NA 3WIAA 3P69A 3BWSA 1NH6A 4G7VL 2VDRB 3QIWD 3FRPB 4P57B 1BIIA 4MGXA 4RMSA 4WFGD 2OMBA 3TIEB 4TSCH 4PJ5A 1EFXD 4QOKB 2GKIA 4JDZA 2Y2TA 5CGYC 3S98A 5F88B 3EJZC 5BZXA 1BQUA 3SJVD 4OCYL 3ZTNH 5ADOL 2JB6A 2F15A 4OD2B 4FI7A 5I6MA 3BVVA 2E75C 1UWXK 2D3LA 3P0YH 12E8H 4KXBA 1R3IH 2VR6A 1F3JA 3IKCB 4KX9A 1W8NA 3LRSB 4WI0A 4GS7B 1J9SA 1IGFL 4P5KA 4B96A 3EHBC 3UJTH 4KGLA 4LRNL 1UWYA 1YN6B 4K0OA 5I2IA 5T1KA 3TIDB 3RJQB 1CE1L 3V6OA 5B22A 1JPFB 4OD1L 3LD8C 3M7FB 1JF1A 3K8LA 3PWVA 3L54A 4M1CC 5EIVA 4ES8A 2NSMA 4M61B 1GTFA 1ZMYA 5DJDB 2ITDB 5D6DA 2Y72A 4LHUA 5DEFA 1AXSB 3U25A 1BFVH 5LJYH 3KXFD 4HUNB 4OF6A 1YPZA 2PPDA 3VFGL 4YHIB 2UVEA 4M7LH 5I1HH 1FAKT 5LVEA 3R19A 3F05A 2F7IA 5EOTA 4PLKD 2WJ7A 3BUIA 3TBYB 1XIWA 3NIDF 1GKOA 4U2ZA 4HK0B 1MVYA 1ZRUA 2VAJA 1OCZB 3TWCL 2BS71 3EDEA 3FAXA 3UPRB 3JV0A 5TDNB 1GOFA 4K5OA 3VD1A 1F8TH 4XC3H 4E41E 1UWEH 2OZ4H 3WLBA 2W0FA 2PO6D 1S9VA 1YEHH 4PJ9D 4NN7B 1X4YA 5GRUH 3MJWA 4H1LB 2ZPKL 4WQOA 1TZHA 1VCBC 3LAFA 3Q2CA 4F7CA 4YGVA 1G43A 2C9RA 3VYOA 3BUDA 4XXWA 5TTRA 4DP2X 1IBHA 5H35A 1Z1WA 3L9RA 5PCYA 2DEXX 1MHHB 1LO2H 2WAHA 3MA9H 1W0VB 5LBVA 4CMHB 2Y2WA 1YJDC 5GGVL 1N5AB 1KIRA 1RSYA 1FE8L 1R75A 1ZOXA 1T83A 3ZU8A 3FQUB 3FUEA 2I7SA 4N90E 1ES0B 2NZIA 3VXPB 1NA8A 5HGHB 4DW2L 3KW7A 2NNXA 1Q1PA 2NR6D 1YEKH 4ZBJA 2IPUK 1IGYA 5F1NB 3LPFA 3BKYL 3J27A 1JXJA 2A0LD 1LO3H 4YSTA 1KEGH 1CDGA 1KWGA 1I9JL 4IRSD 2L0DA 4QMEA 4XXCC 1EAOA 5CSZA 4ZMOA 1D2OA 3LNHA 5KBLA 3KEDA 2G60L 3KS0J 1P69B 2X28A 3ZZ1A 2F7RA 2IDCA 3BVNB 4TUJB 5FA3B 5E4EC 5I1GL 1BXXA 1IGCH 2NUPA 3PDOA 4Y5XC 4Q0XH 1ZTMA 3HC4L 3KM2A 1DVQA 3GM8A 3PABB 1DBML 2J7LA 4FTVA 5BW7C 1PG7H 2QKIC 5DD6B 4X6DE 3MOAL 5AW5B 1KN2L 5F71A 3SDXA 2H1PH 2ALAA 4PJCB 4U3SA 1F00I 5K9OB 2EDDA 2JI2A 5FYKH 3CZSA 4PYHA 5DURB 3OR6B 5CD3A 3O2WH 4JZOA 4D0CA 2WVUA 3CHXA 4LKXB 4QRSB 5IJDC 1IEAB 2QZ5A 3FT3A 1VRSA 3Q2LA 4JM2D 3T0BA 5KSAB 4ZTPL 1N6QL 4WO4A 3DHJA 1CIDA 3VI3F 1EVUA 2KUTA 1G7HB 1JS4A 2XN1A 1C8QA 4DKDC 1JDCA 2J44A 4JFEE 3RKPA 4APQB 3MROB 3MLTA 1M3JA 5H37A 2FHFA 4NRZB 15C8L 1G7PB 5I0WA 3O6KL 1RK1B 5I74B 1DYZA 4JLRA 3DYPA 2WUBH 2C9VA 2WAQA 1AGDA 4U4BA 4OM1H 4Z7WF 2FWOA 1U95B 2BC4B 2DW5A 3OGCA 4LCIL 4C58B 4L5FH 3FYEB 3J7HA 5ACMA 2ED6A 3SE9L 3O3DB 1TR7A 2FECL 4XNZB 1Q9KA 4X9YA 1MJ8L 2R0KH 4RDBA 4RMWA 4J39A 1NGQH 4IIQB 3QUZB 4Y4HD 3ESMA 2R56L 1IJNA 4NO0B 4UQAA 4Z7UE 5CHNB 3SYQA 4H44C 4XCFL 2VDLB 3M86A 1ZS2A 2LT9A 4KZEH 4U6YB 2YSSB 3AREA 4QOKD 2EKSA 2ZAGA 5DEGA 4LLWA 1SLUA 2F68X 2BP0A 4HXAH 3VXUA 5KW9H 1UZ6F 3QP3A 3S9DB 5JIIA 1XF3B 2FT6A 1S7WA 3ZPDA 3T4YB 1I1RA 1H0DB 5IT2L 5KS9B 3E2HC 4NN5C 1KWKA 4WV1A 1GSMA 1O9VA 1INQB 3WNLA 4U0RC 1LEKB 2ZUXA 3OB0H 4N0CC 5AKTA 4BSVB 4DZBA 5ANME 3BAEL 3CSTA 4LXFA 2XHNA 5IG7B 1CXKA 4MLSA 1U3HA 2A9AA 1IARB 3L4TA 1OANA 3MLUL 2BP3A 3POHA 4JY4A 5F44A 4GKOA 1CICC 2XG4B 2Q1EA 2ZCLL 2H41A 1I8IB 5D8JH 1L9QA 3QFJB 5FO9B 3MGTA 3WV0A 5JPNA 3EGSA 4GMSL 3QXAA 4LDLB 3SDAB 1N8OE 4P3CL 2DQEL 2NT0A 4DP5X 3IDMB 3J8F7 3Q01A 4CDGC 1DLHA 2IQ9H 3GSOB 4OF0A 4UZSA 3PWJA 3GSXB 5EZOL 4L37B 5DEZA 2AAAA 4R97B 1D5RA 4R7DA 5I1LA 3FCGA 3LKOB 4WJKB 3VE0A 5E6RB 4KHXL 1AC6A 1OTTD 1V54B 4OCSL 3NJVA 2YEVB 2NDFA 2PYEA 1YECH 5E99L 3PNRB 4N2NA 2XWCA 5ITBL 4X9IA 5EIIB 1ZT4A 2QQNH 4ONGL 1QHPA 1IBBA 4JY6A 2GT9B 4IRZA 3SD5A 1BPLB 4NPYA 3JV4A 3P4LA 1UD2A 2BIOA 1VA9A 1AAJA 5DMIL 4WFFE 5SV4A 4IRJB 3MNWB 3SDCA 3US0A 4M62H 3WN5B 2HLAB 1Z9LA 4BXSV 1RURL 1EEUA 3EO9H 4HKJB 4IBLT 4D8PB 1U8IA 1MI5B 4EXKA 4NQDE 2K70A 3SKOB 4Y1AA 2FJUB 3GSNA 4NCDA 1MHEA 3GHBH 3UTZA 1TIUA 3B5TA 2B1HH 3QULB 3KLAB 3K2KA 3SPGA 5JLZB 3QZPA 4F7TB 4PRAA 1Y07A 4GI8A 3NEEA 1AR1B 5ELIA 4LASH 4NQEA 1C1EL 4JPIB 4L4TB 4ERSH 3ARFB 4R0LC 1UB6A 4XOAA 2J56A 4H0LC 1MN4A 3SCMC 5CMAA 3KPMB 1HHJA 5GGTA 1XCTA 2DQJH 2OMYA 2KQMA 2XZQL 4NOFA 1N0XL 3I6KA 1PEZA 5F9OH 3VXRE 2UWEA 5E1AA 4V2CB 2V5YA 1WFNA 4D3CH 1DQJA 3GXPA 1QI4A 4B7LA 4RRPG 4W68A 4P2RE 3VA2C 4CW1B 3QUXB 4L0PB 2ZXEB 1BREA 5F3HB 4A04A 2XIBA 4XCCL 5J1SC 3IDJB 3ZTDC 1U2YA 2AABH 3HG1E 3VWJA 5D9SB 3EJSA 3WFBL 2EXTA 3BRGC 1JL8A 5JPMA 5IFAL 5DHMC 3AUVA 1KLUB 1SPDA 4OZHA 1OP5H 3QW9A 3PHSA 4PPTA 1NGYB 4HS8L 4FLHA 1JN6B 1JRHH 1A7OL 1KIQB 4PD4J 5AVTB 4GAAA 1DANU 2QLVB 3I2CL 4D7PA 4ICWA 5D5MF 5KSAD 4IMLA 1Z9SA 3ULAB 5AKVA 2FJFB 2ZSWB 4KKBC 1U58B 3HZVA 3ZGHA 1JF5A 2VISB 3P11H 1H5BB 4Y9BA 4FADA 2EDKA 4FQLL 4PVMA 5T3XD 5J7CC 3D4YA 2PWHA 3ZT6A 3WFCL 2WNWA 2GSGA 3ECVA 4K3EL 1CF8L 1ZT7A 3X14B 3MV01 2E7LC 3S36L 3ULSA 5EO0B 3FBQA 1DFXA 5CWSB 3BE1L 3ARVA 4H5SA 4HUCA 1OARL 3H56A 3P2TA 4HKBA 1EGJA 1NMAH 1WISA 4XCNA 3D0LA 3VFPA 3V4UH 3TT3H 2IPKB 2C4XA 3QUZD 5FHBH 1L9SA 4IRZL 3BEVB 1K8IB 4AYFA 3E1ZA 1RIHH 1W0WA 3MRMB 3V10A 4AENA 3DOSB 3SGJA 1BHGA 1FSKC 5T3ZH 2WXHA 2O4EA 2GYSA 5CILL 1MWOA 1D5XB 5L0QC 4BELD 4GKSA 5AW4B 3DMMC 3GSNL 4JCLA 4C83A 5GS0L 1MREL 4FNLH 2XVKA 1N19A 1RZIB 3EZJB 1JK9B 3GS4A 5AG8A 3W37A 3UABA 4ETQB 4R8WL 2HT4C 3KPOA 5EN2A 1VEMA 1DN2A 3FXIC 4TQEL 2ZOTA 4U6XB 3I3DA 5EU5B 2Y23A 1T3FA 3FT4B 4FYRA 5HYIA 3HBPA 2IQAA 3S3JA 5J6HB 3SPVB 4HH9B 3LIZA 2WWKT 5B3SB 3RZCC 4PJHF 2MIZA 5GGTL 1TJGL 4X98A 2F6AA 4LEXL 1PIGA 3N44F 7TAAA 4S1SL 3HAEG 4KXZH 1ZK5A 1A2YB 5FIEA 3GK8L 5EC2B 4CN6A 3MLWH 5EOCJ 3LHPL 4K8RL 4PREB 1YQ2A 4PMEA 4PLJC 4LL9A 4M4RA 1SM3H 3QFJD 2GHWB 3L3JA 1DO6A 5EUOE 3CHSA 3SDAD 2HP4A 1AGCB 1QLRA 4XO3A 1EBAA 3BSZH 1FL3A 1NSNL 3R0MA 4QPEA 5KSBB 5GS1B 2GQHA 1VFAB 2JNZA 3IFPB 4S1RL 2GTZA 3QG7L 4DKFL 2Y7OA 1NCUA 1QASA 3ZHKA 4FI8A 3L16A 4AGLA 4GXUM 2JKIS 2WCPA 4B9JA 1D5ZB 1GC1L 4AEHH 2JQZA 3AU1A 4DKTA 3Q8EA 2DWSA 3TA3B 4WWKB 2FWUA 5EEWA 4CVWA 1ACZA 4WY7H 2CRZA 1QP1A 3D06A 4GG8A 1E5AA 2WKOA 4NNPH 1AO7D 1XAUA 2NY2C 3OAWA 3A21A 4JKLA 4PN6A 3K6IA 5GGRA 4V2BA 4RMRA 4IRJD 5DTFA 1UASA 1IO4C 3SBWC 2BVPB 1PU0A 3LV3B 1BD2D 4Y2LA 2WZAA 3MBXH 2BVQB 5T5FH 1JGLH 4ZO9A 1S3RA 4P46A 4KPHH 1XGPA 2D3VA 3UYRL 3HCVB 3IS1X 4RIRB 1EGJL 1MCRA 2YPLB 2P28B 3FF8A 4W6XB 2JI1A 4YPGA 4G80A 4HJ1A 2A83B 5KJ4A 1S7UA 3OJDA 4A66A 1SLXA 4QNPF 2FK9A 4X7CC 1AR1D 2ZG1A 4JFQB 1XF2A 4R84A 3ARFD 4O51A 2XG5B 2EIDA 1AXTL 2CZNA 4LPVA 2V33A 1WBYA 4H26A 2X1PA 4IU2A 2NSQA 4TTDD 1CFNA 3DV4B 1WUNT 3MVSA 4MD0A 2XY1A 1OP3K 2FR4B 1AIZA 4PJGF 1I7TB 3BD3A 2WVVA 4N4YB 5B4MC 3QUXD 1QFWL 3B4NA 4ISVB 4UAOC 2Y24A 5DRNA 5MP6H 4AIOA 3CXDH 5D2NB 4YDLB 5IB1A 2BOLA 3RUGB 4KNQA 5IBTH 1RUPL 3M8OL 1NMBH 4XVSL 5AEAA 5IEKB 4M1GH 1QUNA 4YNYB 3LIZL 4MNQB 4MQXC 4HFWA 4QAWA 3RILA 5D4IA 2Y7NA 2Y25A 1LP9B 2YPVH 1NOLA 5ABAA 5E2UH 3JQOB 1BFOB 4KMTH 1NBYA 1JK8A 1GMIA 3QC5X 2YPKA 3GXMA 4JANA 4G8GB 1QR4A 1KPUA 1XQ4A 4XBPB 1KY7A 4QTIL 1M05B 4R90L 5HYEA 1SXSA 4FABH 4ZW6A 5FK9B 1PG7X 1O6TA 2HH0H 1HHIA 5IQ7L 2ETWA 1ZWIA 5DHXB 4AEIH 2AKRB 3F00A 5KOVC 1ZLVK 4QGYA 1K4CA 1ZANL 2B59A 3CHPA 3LNEA 5KYYA 4ZQKB 1J86A 5FHAH 2VLKE 3DXAD 4LPYA 3VFOA 4FQXA 2J1KA 2IH1A 2JB6B 4N2IA 4YC2C 1HYSC 5GRYA 1NCTA 1R34A 3ESPA 3UMTA 3LTVA 2ERJC 1F3JB 4F9PC 4XP4L 4OZGF 1YEIL 5B8CA 2EVFA 1KTDB 3HMXA 3W9EB 1NEZG 4P5KB 4QLRA 4K3JL 2F58L 4WIQA 4QHUB 1JRHI 4YDZA 5JO5A 4KH9A 1A7RH 5I2IB 4JJ5A 5T1KB 1P4IH 5DJ6A 4NT6B 4XMPL 5DO2D 3E80A 3ESNA 4JREB 4O2CA 1F4WH 1TZOA 5KVGE 1PDKA 1TYRA 2O5ZH 3PWVB 4O58L 1OSPH 4JRXE 4W9KC 1A6ZA 1QEWA 4FFYH 1O0VA 1KCKA 3HI5H 2Q7YB 3IMTA 5IMKA 4OLZH 1HCZA 4LHUB 5DEFB 3EYQC 4LLQA 1Y6MR 3VFSA 3GRWA 1KG0A 3FYIB 2FBJL 5DHYA 4X9GA 4J6RH 3ETTA 4BZ1H 2VUKA 1H3PH 5EOTB 1ITCA 2QPSA 1XIWB 3GB7A 4UV7H 4PP1D 4C4KT 5MEOB 1ZTXH 1DDHA 3AXHA 3HUJE 1DDTA 3QR2A 5CLYA 3E3QE 1QKZL 1X4ZA 1PZSA 5CIPA 3NAAH 4AQEB 2APWA 3JBG7 3NQIA 2BVTA 2OMXA 3QZWA 1XB6A 1VFUA 3KJ4B 3KR3L 4IKLA 2W0FB 1GZPB 5L9DL 1S9VB 1UJ3A 2C1OB 1Q72L 2F1BA 2ZWZA 4KV5E 2AJYH 3B8YA 1CZ8H 2CG9X 2HWZH 4I0CC 4JFWA 4F7CB 1TZHB 2FHBA 2XXGA 2C3GA 3GDBA 3O3AA 4YJZL 4DN4H 5IJVA 1S78D 5B1BB 3WSQH 1S8DB 1SDAB 4Y19E 2O6FA 1SOXA 2A6DB 2RAMA 4KKRA 4PD4K 5DFAA 5T5NF 5H35B 3L9RB 3R8BB 2DI8A 3NA9H 5L2KB 1MW0A 2OL3A 3JYBA 1PQZB 4QHNA 5C0CB 3RY6C 1KIRB 1Y18B 4PJBA 2ZJSH 1SEQL 3WUWG 4TSAL 4Q9CA 3MODH 3UACA 1PZCA 4UV4H 1G0DA 3T09A 4NHUA 3ROOB 2XXFA 3WUZA 5I1CH 2HX9A 1TTCA 3A47A 4E9WA 4YWGH 3N1MC 4L3ED 3AWFA 2GJ6E 3S37L 2VKWA 3V7MA 5DF0A 3MLVH 2HTKD 3ZIYA 3SPJA 2JJTA 1HL5A 1JOIA 1RUAH 3IDXL 3D33A 1EA9C 2DYPB 4KJWD 3HC2A 5CSZB 4E9RA 4PJ8C 2I60H 3AGWA 2IMNA 1W72H 1IC4H 4ZX4A 1MCFA 3L6FA 3SDYL 1TQBC 2AQTA 3EJUA 1TVHA 4PRPA 1RZFH 4ZUUA 3W5NA 3SEPA 4I7ZC 4Z7OF 1WFUA 5BJTA 3R1GL 2Z92A 2NUPB 3PDOB 4CSSA 1OW0A 2YPLD 2ENPA 3BLBA 2NYZA 5B39G 5EUKA 1JG9A 1MLBA 3AY2A 4FTVB 1Q9OA 2OX5B 2UVFA 4M9OA 4LHQB 2XNAA 4PWIA 3HMXL 5FYJH 5SWSE 3UBFA 5E08H 5ESVA 3N85L 3TEXA 2Y0SA 4JUTA 3SDXB 3MX0A 2AEQL 5C0RL 3Q44A 5C07E 4X4MA 2VE6A 2YMOA 5CD3B 4NN6C 1LGVA 5I1IH 4JZOB 3NK4A 4D0CB 3QRGL 4JO4H 1TKWB 5LXGH 3RNQA 1ZE3H 3QRFM 1JBJA 4UOW0 2XTSA 4YXLH 2XWXA 5HYJA 3UZVA 3CNKA 3QNYA 4DPBX 2ZUSA 4KKPA 4XE5B 1U3NA 5FUCE 1J10A 1FC2D 2CUIA 2H8PA 4WGWB 4FKHA 3GRWL 3TVMC 3BDYH 3CSPA 4RGND 4HIJB 1S9WB 4TV3A 1UXSA 3AAZB 3BGFC 1E5UI 1GGBL 1I8KB 3T6QC 3N9GL 4FJZA 4MNQD 5ACZA 2P8MB 3SJVE 4BKTC 1TENA 1ND0A 3CDFA 4JLRB 1RJYA 5JXEC 1AGDB 4U1IA 2CBPA 1BAFH 2EH8H 5D7SL 2YGVA 4MX7A 1HEJC 3BP4A 3FFCA 3OGCB 5I8KH 4G8GD 3CN0A 3QQ9C 3GMMA 4MMZA 3ZKMC 1IC7H 4ZFGL 3ZGIA 1MFCL 1KLGA 1Q9KB 9PCYA 3JTBA 3QB7C 3SD2A 2J2ZA 3OZKA 2IPTH 4BK5C 5L8JB 2XWDA 8CGTA 1T2QL 4HQQL 3EFOB 4YN3A 3RU8L 1CGTA 3L3IA 3KPSE 4LIQH 4URTB 1TVBA 1KPVB 1A3RL 1ZSDA 2L7JA 2AVFA 2BNRA 4KO6A 3EBIA 2OL3L 3V0WL 1HHKA 3V6ZB 3CZGA 3TTYA 2Z31C 3AREB 3IN2A 2EC9U 2WXKA 3ZT7A 5DEGB 2D7NA 3KXFE 2Y1YA 1U2CA 4LLWB 3S34H 4YHML 4GYBA 4WSJA 4P9HL 25C8L 4Z7VB 1Q94A 4H1LG 3U83A 2D7OA 3B9VA 3L13A 1BVNP 2JVUA 1EVTC 2F53E 1QTPA 1S7WB 1NCWL 1IM9A 3F01A 4XPBL 5BUAA 4P59L 4HUKB 1R3JA 5HYQA 3CZKA 4IMKC 1LK2A 3OF6A 1Z9OA 1P7KB 2DOCA 3AXIA 3FUKA 1D6EB 4J3OC 4KFMA 4MXWH 4EJ1C 3IDUA 4WV1B 1FP5A 5DJZA 5EZJA 3FCBA 4HUUA 2E9JA 5HSFA 4DZBB 5FFLA 3HG4A 5C0AE 4Q9QL 2TAAA 1OAUH 1ZVNA 4JY4B 2R69H 4F7MA 4G1MB 4LOUD 1NAKL 1BBDL 5I15H 1YMME 4OIAA 5DHEA 2A1WH 2BJML 3N43F 2AJVL 2OJ1A 1FWXA 4YSPA 2KLRA 5JPNB 3EGSB 1NCBL 2ZUUA 1F2XK 2I9LB 5K9QG 3IPFA 3O8XD 2KZKA 4L4VA 4LPUA 1DLHB 2R1WA 1CXLA 4RMQA 3PWJB 4E9YA 2OCFD 3T3PE 4XPHH 1P1VA 4R7DB 4OF3A 3GMLA 2FEJA 4XOEA 3VE0B 5BRZA 3MJ7A 1EDQA 3NCWA 4GAJH 3O2VL 4LE8A 3T4AA 3PP3H 4ODUA 1E3FA 3VU1A 3PYCA 2PYEB 3HFML 1SF3A 2C9SA 3WEBA 4HA1A 4JGNA 2RFXB 3MTRA 1ET5A 4TLUA 4L3AA 3W56A 2G3MA 1ZT4B 2ED9A 5HHXL 2LLGA 4LCVA 4WUUB 4XE0A 4NPYB 1NAMA 4JAMA 3EYFA 2BXYA 4W9CC 1AMXA 3PAUA 4AVHA 5I71C 2UXGA 1J9RA 5E00A 5L2KD 5DUPH 3ZK0A 3E9TA 2PW1A 4AOFA 5CP3H 4HEME 5C0CD 1JPEA 3DSNA 5D2LE 2D03H 1LO0L 2J73A 2LLNA 4Y1AB 3K2UL 3IGUA 1KGUA 1MHEB 2FT8A 4YHOL 3UTZB 4FA6A 5C0NC 2ZUVA 3H9SA 4N2GA 2I9TA 1OB1B 3HA0A 1XGTA 4C57C 1PZ3A 2WO2B 5HYSA 4PRBA 4PRAB 5F9JA 5FC9A 2H0PA 2DI9A 3FN9A 4NQEB 5JOPD 2A6KA 1UB6B 1LQSR 3FUIA 2DYPD 3OL2A 1PLCA 4G43A 5DQDH 5KTEL 1XZWA 3HS0C 4I85A 2VXQA 2YZ1A 1I3GL 4PW9A 5E1GA 5E6ID 5EH1A 2UX7A 3GFUA 4GKLA 2UWEB 3KLKA 4N87A 1U8HA 1DQJB 2V17H 2X0WA 4JCWA 5F7NC 2HMID 1O6SA 5FM8A 4DK5A 3DHUA 3MTXA 1EHLL 1YNKL 3O9WC 5E8PB 1SHSA 4KAQH 1EJOH 2ZG2A 4ZNEE 2NSXA 5JW4Q 2CIKB 1PBYA 3A0OA 4OZIB 4UNTA 3QA3B 3ULVD 2V2XA 3PF2A 5JPMB 4X0NA 5GS2H 5JQ6H 5KJRH 1J1XH 4OZHB 3NACH 2WUCL 2R27A 2DB8A 4BZYA 2BX5A 2X1WL 4AE0A 5I1KL 3P2BA 4PWEA 2QFPA 5T1DL 2OYKA 2ZCHH 3QEQD 4RDQG 5AZ2L 2CJUH 5KVFE 4IMLB 5HI3C 3D8MA 1Z9SB 4O2EA 2BIIA 3VM5A 1SOSA 5L88H 4U3HA 4TOYL 3HZVB 5IKCB 2FLRT 1ZA6B 4XI5D 2X0VA 3K4AA 1L6ZA 1IX2A 2FH8A 1PFCA 4WNSA 1TSHA 2CNZA 3QJFA 2XKSA 4QOKE 3ERXA 2MCMA 2GBVA 4P2QD 1V8HA 2GSGB 1BVZA 3ZTEA 4IDJL 5KBNC 1CB4A 4JFFD 4PGCA 3UGUA 2M1KA 5JIQA 1M2VA 4XB3A 1OCWH 3WIIH 1RV6X 4S1DC 3APMA 2YWZA 3P2DA 3KCPA 4H5SB 3ZE1E 1T20A 4Z8FH 2KC0A 2X6VA 4XMLH 1EJFA 5MERB 4JR9L 4XCNB 3D0LB 5J1AA 1GGYA 1KLFA 3VFPB 4H0GA 1B0GA 4PV9B 4X99A 3DYOA 5IF0A 1YUHB 4ZO8A 2YO3A 1G7LA 2K8MA 1NAML 1D3CA 4MLIA 2GIYA 1HQ4A 4AYFB 1W0WB 2R29A 4TVUA 3UJJL 4AENB 2NNAA 2O6PA 2ZX5A 1VFMA 5KANG 4YSCA 4M5TA 1TQWA 3WJJA 5B1JA 2IV8A 3RFZA 4KUCD 4BCXA 4GKSB 4YAQA 1WDAA 3MJGX 4FXTA 5T33L 4FHBD 4C55A 4AK2A 2E74C 5EIIG 3KPOB 4MD5A 3QZNA 5EN2B 1SBSH 2CO7A 3M1BB 3RVXD 3DX2A 4YSAA 3IE4A 2AC0A 1K4DA 5D7IA 1T3FB 3IFLL 2J4WH 3H3KA 2IQAB 3B7YA 1USZA 5D7JC 1JZ8A 1F11A 3W11C 1AH1A 1OAYL 2ZXGA 2YBRB 4GAGL 4Y4KA 5EZPA 5J1TC 2FO4A 2VXQL 4X98B 4GAYA 1OEZW 5FCUL 1SMAA 2N4IA 3MRBB 3FSZA 1T1XA 4XPFL 5HHME 1A9EB 5I30H 2XSKA 1YEFL 3OLGA 4BK4A 2X9XA 2CK0H 3KW8A 4EZMA 1ZK9A 2RIKA 2OYPA 3TYGH 4RNRA 3ZMNA 2VAAA 3L3JB 2DI7A 2VM4A 3QJOA 1XXDC 3B5GA 2EUXA 5FYLE 3LRHA 1F1GA 3TM6A 2VR3A 1O7SA 3VRIB 1FL3B 1FG9C 4E0RA 4U1HA 5E8DH 1ORSA 2A9NL 3B34A 4C56E 2GTZB 1P4BH 4WI7A 2P44B 3MCKA 1QRNB 4JCMA 3U4EA 3ZKSD 1DUZA 2IPUG 3ZQ9A 3HE7A 2V0AA 5E4AA 5E4OA 4NLAA 1TJMA 1MLCA 2ORBL 4KDTA 5IHBA 1DVXA 2WIMA 4Y16B 4UU9A 3AU1B 1O9ZA 2COQA 2DLFH 1K2DB 1PJWA 4LEOA 2KKQA 3P4MA 4DOHE 3KLDA 2YXMA 1MCWW 3RX5A 2K4AA 3U36A 3B2VH 4WUUD 4GG8B 4NZTL 4F5CA 4QI3A 1UEMA 2XPYA 5GGRB 3VFTA 1HDMB 2BY3A 4LCUB 4DQOH 3MMEB 4NWTL 5DTFB 5IWLC 2BFGA 2WK2A 1U8MB 2MNWA 4X6EA 1IBGL 4D8OA 2QQLL 2YMTA 4U1SA 4YSQA 3TO4A 1HZHH 4G6AC 4NM4H 4P46B 1F4XH 3TZVC 2P1YA 4JFYB 1F3RB 3PAZA 4F9LC 2DJ4A 7CGTA 4RX4A 5DFTA 4IIZA 4YPGB 4N2BA 4MAZA 3RVVC 2XQYA 1MZYA 2DMKA 1KCUH 1S7UB 1MRFL 3OJDB 2K7QA 3EXJA 3MQIA 4I5BA 4QHPA 4O51B 1D5MA 2I69A 1U9KA 4NQTA 3INUH 2R29L 3NCBB 4IU2B 2YQBA 1CFNB 2IBBA 4BDVA 1CDCA 2W0LA 1I8UA 1S3KH 3QUYC 5F93C 2K3TA 3H6JA 1E2ZA 1MFBH 3PP4L 2DQGH 4MD0B 3MNZA 5CU5A 1QSFD 5J13B 3AC0A 4FKEA 2CKNA 3ARYA 3K72A 3LB6C 3FHQA 2K4WA 5T3XE 1DJZA 4KXDA 3PWLB 4ORZC 4GUQA 2WBJA 1WZMA 4I0PD 3Q2NA 5DRNB 4Z23A 2VXSL 4PM1A 5IB1B 2XZZA 2X3BA 3F85A 4XHJC 3L9YA 4YK4B 5A3IC 2JF1A 1P5UC 1QUNB 3EOAB 4NQCD 3X1FA 4PSRA 2HTLD 3HC0A 4TQPA 4F91B 4FULA 4HFWB 5DZPA 2CHWA 4Y2OA 2OI9B 1MG3C 3UTOA 1EXHA 1JZ6A 1J87A 1RQ5A 1NBYB 2YPKB 5DJ2A 2MEJB 3MJ9H 1KPUB 3ILQD 2BSBA 3QCVL 4XP1H 5D4JA 3ARBA 2ZCKH 4QT5A 5C2UB 5IMOB 2BS8A 2ZF9A 1A6AA 4XVUC 5GJSH 5BXFA 5MENE 2W9EH 2AW2A 3BVUA 4Y7OC 2ARJQ 1WBZA 3MRNA 3OKYA 1JYNA 3ISWA 3PGFL 1P7BA 5GZOA 4G6JH 1ZWIB 2DD8H 4K3DL 1YEJL 4F33B 2ZKXA 5C92A 4HLJA 1QLFA 5BV7H 5CLTA 5KVDL 2DQ6A 3UAJC 4OUUB 4UB0L 4L8CA 4X7DC 5CEZL 1G0XA 5KYYB 3VXMA 2OMNA 5E5RB 3LNDA 5I6XC 3VG9B 1N0LB 4FQXB 4J3WA 3Q1SH 2IH1B 4PAZA 4OGXL 2M8XA 1WBXA 2EDMA 1MEXL 4KFZC 4GQRA 3Q8FA 4PVNA 5B8CB 2GI7A 2I24N 4GP5B 2WN3A 1QA9A 2GIMA 3UZQA 4OI8A 4X8GA 3FUFA 1TQCC 2W8CA 3ZMEA 5JO5B 4HOXA 5C0FB 1QLEL 4K3HA 4FNTA 1YY9C 1XT5A 3ZDYE 4DVRH 4BQ9A 1T0MA 3OMAB 1J0YA 4XZUA 4RFNC 5CU9A 1NFAA 3QDMD 4O2CB 2UX6A 3MLSH 2ZYSA 1CFVH 3HR6A 2CALA 4W6YB 2FNBA 1FAIL 1QEWB 1DP0A 4C4BA 5IMKB 5DR5H 4KJQC 3VXQA 5BV7C 4LLQB 1PCXA 3BAXA 1A6UL 3D2TA 4F7EA 1CD1B 1KG0B 1UKQA 1TJHH 4XMKL 3UTTA 3SDDA 4DGVH 4X7SL 3VRJA 4O2FB 4K07A 1MCEA 3GB7B 3NSFA 1M57B 5F7MC 1DDHB 1R24B 5F0JB 1PLGH 2SEBB 4E9LA 3TT1H 4TNVK 3F7RA 3II1A 2CLVA 4TPRL 2LAAA 2MH4A 4CVZA 5GGSB 2OMXB 3CSYA 3D39A 3QZWB 3UTSD 2CR0A 5E2VH 4DKEH 3O6LL 4MS8D 4BV1A 3QNXA 2VXVL 1RXLA 3CHOA 5B1CA 2A4CA 2CKBB 3O3AB 2WGNB 4DP4X 4IBUA 3HE6B 2R7EA 1P2CA 4DP1X 4PP2A 4NP4L 1MI5E 1UCBL 5IB4B 2H0EA 2QVMA 2ENSA 2ISDA 5F7EH 1WAAA 2VZ3A 1WT5C 5HD8C 2OL3B 3CIAA 3OX8A 3FO0H 1GW0A 4AKOA 2DMHA 4QHNB 1QRND 4JFXA 3RIKA 4HD5A 1M2OA 3GF8A 4PJBB 1ZGLA 3ZZLA 3WFHA 2APXA 2WQ8A 3CC1A 4Z7UF 2WBXA 4L4TE 4NHUB 1CFQA 4Y16D 1HAWA 3RIFF 3ASNB 1UOLA 4EAEA 4R4BB 1W80A 4KROC 3CPLA 4FQIH 1CDJA 1RUQH 4PIRF 4A39A 5E5MA 4N6RB 1U8LB 3MRDA 5BCAA 5CD5D 2ADYA 3L3KB 4PS3A 3OD3A 2AEIT 2BRRL 4P5MA 3EFDL 1KJ3L 4HKXB 3BKJL 2IMMA 4EBQH 5F7HA 3H8NA 2WSDA 3MJ8A 3EFFA 1TVHB 4PRPB 4UM8A 2YJQA 2C9XA 5TE7H 3WHXA 4HZ1A 5E2WL 5DRXA 2DWTA 5BJTB 2Z92B 1YEGL 4LU5H 4TS6A 1JDAA 3H9YA 2KZBA 4J4PD 5EUKB 4PLOB 5DSCA 4YUEH 1IB5A 1MLBB 4MQ7A 1CDHA 1Q9OB 3MOBL 3NMEA 2XNAB 3QJUB 3V5KA 5ESVB 2YXFA 1CGSL 3ZKQD 5IB2B 1A22B 4MHHI 4UDTB 3DJSA 3O0RH 4UILH 5C0IA 3ULUE 2BDNL 4JG1L 3WEAA 4NHCL 4LSSH 3K8MA 4YHKH 5TQ2L 1TZIA 3GYRA 3B7UX 4XBEL 3T6XA 2PABA 2Z4QB 4TXVB 3WKNA 1OQXA 1A66A 3DRTA 3EYOA 1J9CT 3IETA 1BFSA 5HYJB 1BIHA 3UZVB 2VDOB 2WOBA 3QNYB 4FG6C 4GIOA 4X0KB 5I76A 4DGIH 1SJEA 5I1DA 1L9RA 1DBKH 2H8PB 4M6MH 3FB6A 5E56A 4OVVA 1YYML 4NM8H 2NY6C 3SOTA 2VDKH 1E9PA 5DJAA 5I66B 2P9RA 3OKNA 3ENEA 4KKAD 1QEXA 1ND0B 3T1FA 3W2DH 4U1IB 3KLHC 1WRFA 4MX7B 1S7SA 3BP4B 3FFCB 1UJTA 3NZ8A 5LQBL 3PUUA 3B2DC 3RTQB 2KS0A 4LHUG 4H7VA 3GMMB 3QNFA 4AL8H 3ABGA 1A14L 4FN0A 1EXUB 1KLGB 5CEXB 1HN1A 1U8PB 2FCBA 2P42B 4XXDA 2J2ZB 1OAQL 2CBTA 2NCMA 4LO9A 1XAKA 4NI6A 2CJ3A 4LL1A 1AY1L 3L3IB 2LGNA 4YE0A 3OG4B 4EVNA 2CDFA 4JFPA 4MDIA 1TVBB 1MCCA 1ZSDB 4YO0A 4A7GA 4HW6A 2HT2D 4K2UH 3KLLA 4L1SA 1N4XH 2DLTA 4WGVB 1XGYL 1CD8A 3IDIB 3BPOC 1KBGL 4S0TD 4NENA 4QF1B 2NTFA 4FQXD 2JCCF 4HT1L 1Q94B 4LGSB 2AJUL 2Z65C 1DTUA 1EV2E 5IQMA 1IM9B 1NICA 1R3JB 3EGDA 5HYQB 5EOQH 5L7XL 3VFWA 1G7JA 5F1IA 4XXCA 4AL8C 3ISYA 1ZVYA 3P0VH 3RVTD 1S9XA 4BHUA 2CR6A 5I1AA 1CIUA 1ZXQA 4XN5A 5L4FA 5EZJB 1FIEA 4HUUB 3BOVA 4ZMQA 2WYIA 4P2OD 2ADFL 4I3RH 2ZOUA 5FUZH 4NI3A 4GFXA 1MCLA 3WXWL 4Y5XA 4F7MB 5SWZA 2ZKHH 4FRWA 4Z3HA 1VGKB 1KTLA 1HSAA 3CDZB 1QSVA 3Q2VA 4E9XA 4DSYA 5JOEA 4L18A 5BW7A 5CJOL 1OCOB 1TTRA 4WWOA 3PHQB 3TV3L 4HIHA 5KSBE 2AFNA 4PJIA 4DERA 4I1NB 4R7VA 4L4VB 1T5KA 2R1WB 4KTEL 1AS6A 2F5BL 3I84A 1I3UA 1KNOA 4Y5YA 2AQNA 5BRZB 2BP5M 3M6DA 4PH8A 4ODUB 1NBVH 1TPXB 4AYGA 2FIKB 1IGJA 1DQTA 2QHRH 3BP5A 2DV6A 1OKEA 3HE6D 3FMGH 4Y4FC 5I8CB 1NAMB 1YQVH 5EFIB 3P0YL 3EYFB 4JAMB 4MNGA 3ZMRA 4YXHH 1DE4A 5E00B 3VXSD 2H2PC 4QRUB 3T0WA 2PW1B 5KG9B 2FWSA 2YOCA 3UJTL 3L1GA 1LEIB 4MASA 4MRCA 4Z0BH 4C47A 5AKSA 3DSNB 3ME0A 2QSQA 5BQ7A 3HRZC 4AW7A 3DVFA 3DETD 3H7LA 2PYFA 3SBPA 3BEWA 2I9TB 4UUJA 4URKA 2E27H 1QOKA 3EKCA 5ERWB 4TF4A 2MTPA 5H37G 2LAGB 4HU2A 5DT1H 4OQ1A 4CC4C 2CQVA 5ABDE 2B2XH 4MSWA 1QFOA 1BFVL 1N64L 1SXAA 4W93A 1N7MH 4G43B 3LKNB 1YJDL 1HWGB 1IFRA 2R4SH 3WY2A 3A6BH 4KRPB 1M7IA 1KFAL 4FYTA 3NN8A 3K6FA 5D1QB 5E1IA 3RUGE 2ATAA 1O6SB 1FQ9C 5ICXB 3VW3H 1CN4A 3HNSL 1WVZA 5MEQB 2LVCA 4ZK8A 1F8TL 1K6QH 3OMNB 4MNQE 3WJMA 2MOGA 4DJMA 3D18A 1X9RA 1UWEL 2X70B 1LP9E 2OSLA 2QADB 1PEWA 4M8RA 4E9SA 1KBBA 2V2XB 5E1QA 5J89A 1DSYA 4X4XA 1E67A 5EUOF 3QHFH 4LCYB 4U2YA 4ZJ9A 1BM7A 5DCCA 4JGJA 5IOKA 5B3JE 4N3UA 5D1XA 4LLVA 4ZOBA 2UYLA 3TEWA 4KK9D 1CICA 1LO2L 5E9NA 3VDBA 4HWZB 5DWPA 2VO8A 4RAHA 3ZR5A 2D0HA 5E4IA 3CFUA 3CHQA 3FB7A 2CK2A 1S7QA 4FXKB 4OJFH 1EX0A 4GPVA 4PJ5E 1ZV5A 1MIEL 3EF7A 1VENA 2YD6A 5LG1A 2FBOJ 2A9MH 1YEKL 3S35X 1I3VA 2K3HA 3ATFA 3SE3C 1YC8A 2XIDA 3R4DA 4PGCB 1XD1A 4JM4H 3QJZA 1M2VB 3S3DB 1LE5A 3FFCD 4G11A 4OB5H 2E6JA 3RTQD 3KCPB 3R18A 2IF7A 4AGOA 1T04A 3ARGC 3WIFA 2F1EA 5J1AB 1T7XA 2ZX8A 3B2UD 4MMYA 1G7QA 3ECQA 4ODVH 4X99B 2WXOA 5IF0B 3MRKB 3V6OE 2MJWA 1GS8A 1NM9A 5H4YA 1G7LB 4ZRGA 1IGCL 1MRCH 1HQ4B 2XICA 4Q0XL 3SBRA 3TN0B 1JNLH 5H8DA 1E4HA 5I73C 1OT1A 3F12A 1NIDA 1PG7L 3FSWA 4TNFA 4KMQA 4LZKA 4TUUA 3WJLC 1IGTA 2ATKB 1I7RA 5D71H 3WMPA 3DX6A 1YPZE 4YAQB 3W38A 1IAMA 5FYKL 4PV8A 3MUY1 1ZHNA 3AY4C 3O2WL 1VFOA 3N1GC 1AKJA 3ATEA 4MD5B 4J7RA 2WXNA 2CO7B 1Q0XL 3CUPA 2QZQA 1XHHA 3L5HA 4R0LA 5IFHL 1I31A 4LARL 3SCMA 1CYWA 3IMWA 5E6YA 2CDGB 5JXAH 4KDVA 4DO6A 4Y4KB 2Y36H 2FO4B 3QCUH 4WNQB 5IVXA 1X5GA 2X9ZA 1T1XB 4MA1C 4XMWA 1WTLA 3OAYH 4MBOA 3D52A 3QWQB 1H15A 3HTLX 2WXPA 5AW2B 3VNYA 3QWRD 1HJBC 4RNRB 1IKNC 2VAAB 1EAPB 2MKWA 4L5FL 3KBPA 3II3A 1UM5H 1AC0A 3ARPA 4CDHA 3HVNA 2EEFA 5H94A 3ZBMA 1HIMH 2BIMA 4GT7A 4E0RB 1NGQL 1A9BA 1N2RA 1MNUH 1RULL 2MNUA 2NY5H 3ISRA 5C0DA 3A67H 1R6VA 2JKWA 3MCKB 2MOQA 3U4EB 1DUZB 2H6PB 1AP2A 2Y3NA 1C8PA 3VGEA 1VGEH 4HWEH 1SMOA 4KZEL 4F37K 4JN2B 1Z7JA 1II4E 3PXLA 4LEOB 5E94A 3W0WA 3P4MB 4A2MA 2YJLA 4PTUA 3U36B 2YZ8A 2ZNWA 2E6PA 5KW9L 1K5NA 1BZ7A 2PWGA 4WW2C 5EEUA 1UVQB 4KGJA 2J5WA 3VFTB 1QLEB 3VH8B 3F7QA 4JG0L 4GB9A 3S48A 1M71A 4J2XA 1A21A 2E7LA 4X6EB 1RI8A 3KDMB 4U1SB 4BM7A 3LZNA 3TJHD 3D0VA 4L1TA 3TO4B 5ABZA 1UHVA 3FN3A 2X4UA 3I74A 5CZXD 4FTVE 1HNYA 4MNHA 1HE7A 2VMDA 3QRBA 2XV2A 5IBUB 2NY5C 2EE6A 2HFGL 5LCVH 2CHDA 3SDXE 2UZIH 4PJ7F 3WTWA 2ITCB 4KK8C 3Q8CA 4I5BB 4G5ZH 2X6CA 2AZUA 5DWUH 1E27A 5D8JL 4UIKL 4LGRB 3DX8B 4FQ1H 4YVNA 5I6NA 5AW7B 1N12A 4BDVB 3QPXL 1N18A 2LTQC 1B0IA 4TULH 2MTAA 3RDTB 3DMMA 5KVEH 1NIAA 3MNZB 2IQ9L 1N68A 3WLWD 4OLVH 2JKXA 3K72B 4Z3EA 4QRQA 5D1QD 2CBQA 5DD3H 3GXNA 2DIBA 3FDWA 2NUTB 2GIXA 3HUJF 2PCPA 2BIHA 2EXWD 3BFQG 4QLWA 3GBEA 3QH3A 4HFUL 4M7KH 2IH9A 4OV5B 3RBSA 3ZO9A 2MCPH 1JV5B 1HCVA 1YECL 3B9KC 3RZCA 3HC0B 4JEGB 4UQ9A 1D5BA 2XACC 2Y7SA 1FHNA 1P4UA 1RZJH 3VI4A 4OI7A 5FUOL 3JXAA 4G2AA 3LKRB 3O81A 2F54A 4AQAA 1NPJA 5AG9A 4FGMA 3OQ3B 1YA5A 2QT6A 2RHEA 1KB5H 3TCTA 2MQGA 4JRYA 1KBKA 4WI6A 4G1EA 3ARBB 1PLBA 4AMWA 3MLPA 5BXFB 2Y3AA 3APNA 4D2NA 2VDQH 5MHSE 3BFWA 5IW1A 3GHBL 1SUHA 1YNTB 3LZFH 1J0IA 2E7CA 3ZE2B 4N8CH 2B1HL 3H85A 2FSEA 1ID5I 5CLWA 1A6TA 3HZ3A 3ZIMA 4DUWA 3VXUE 1LDPH 4EIUA 3QDGB 2C1PB 2GFBB 1PNDA 2FB4L 1VADA 4JPSA 3FW6A 3I50H 1SYSA 1G6RH 2LW3A 3K5RA 3VXMB 5F7DB 1UCTA 3FCUB 4S0HA 1DZ0A 3GBNH 1GYAA 1WBXB 4DK3A 3STBA 1RZJC 1U36A 2NZ9D 5HYFA 4UOQA 2HKFH 3UZQB 4D3CL 3HJEA 3MRRA 5AFAA 3VXOA 4WWID 3O3UN 2EILB 4ZUWA 4XNXL 4A6YB 2J6WA 4EOWH 3TN0D 3SBWA 1FZMB 1AHWC 3IMSA 4PI2A 5J3HC 1EWHA 3ILDA 1U2HA 4XZUB 5A7EA 3VNZA 3QXUA 5HPOA 3BSZA 3ARUA 3QQXA 2YD3A 2DM4A 4BCZA 3KPRA 3BAYA 5DZ9A 1MCOL 1Z6JT 3P3YA 1IIIA 3VXQB 2GK0B 2O6CA 4F7EB 3DUUA 3T3ME 1MRDH 1TETH 2WQUA 1UG9A 3HZMB 3QR0A 2OMZA 3UTTB 5DS1A 2WLKA 4S0SD 3VRJB 4K9EH 5KJ7E 4WHYG 5I8EA 1ESOA 2NW3B 4AQOA 4TNGA 3P11L 1YNLH 3DHMA 4Y4KD 3T2NL 5I16A 1A3LH 2DBLH 2GTWA 2PYEE 5EZIL 4CVZB 3KVDD 3LPGA 3CSYB 2ENQA 2IGFH 1E2WA 1M1XB 4KWUA 1NUNB 1F3DJ 1QD0A 2B5IC 2BSEA 2BSSB 1LWJA 3QNXB 4G6MH 4NC1C 5EIQA 1ADQH 2MKLC 1T4WA 1KXVC 3NJKA 3NCEB 5T5FA 1QG3A 5F97E 5I5IA 2JQAA 4QHKJ 4GEJA 4CJ0A 3ETBF 4Y2DC 4ONFL 2R7EB 3HW7A 5C6TH 1J8HA 1NMAL 2MQCA 3G9VA 4M03A 3DO3A 3WEMA 3KYNA 3EOYG 3SHSA 4Y1AE 3TT3L 1E4JA 1GPOH 3EO0A 1W91A 4P5TC 3HRPA 4U1LA 1AS8A 3OX8B 2EE0A 4JFXB 3WFEH 3S97C 5EC1B 1MCPL 4GI9A 4EIGB 1ZGLB 4K9EC 2FATH 2GY7B 5T1LA 5DJXA 3V0FA 3WFHB 4NQEE 4OLEA 3LQAH 1PSKH 1IU1A 3JV6A 1XB8A 5ETUB 4WNJA 4JQXC 1QQDA 2QV4A 4NJAH 5HJDA 1YSOA 3CPLB 5DJYB 2MPVA 3MUGA 5E5MB 3DIVA 4FNLL 2X1OA 4Y88A 4UDUB 2WN2A 4D94A 5B7FA 3LKPA 3MXVH 1YY8B 1NBZA 2UWEE 3BPNC 4P5MB 1C7TA 2NPLX 2CHNA 3P77B 1MQKH 4BA0A 3P40A 3W9DA 4I9WE 3TO4D 5E0QA 4Q52A 2DJMA 3MJ8B 3EFFB 3TF4A 3PXJA 4UM8B 3N40P 5IW6A 2UZYA 3G5VA 5DRXB 4RX4D 1OSYA 1BZ8A 4HGKC 5IMMA 4WI3A 4F9PA 3N5AA 4OZHE 4L8SC 5EBMA 1RJLB 1WQVT 2J25A 5DSCB 2XKUA 3EHBB 3KNBA 4MQ7B 2O1AA 2L04A 3MLWL 4MWFA 3V5KB 3LEVH 3II2A 3MV9A 2DLIA 2Q0ZX 1SM3L 3MV8A 1MKFA 1X7TA 2VW6A 5C0IB 2ITFA 4P4RB 1EO5A 3PGCA 4PHXA 3HPLB 5CFHA 1TZIB 3RDTD 3DO7A 4WEUD 3DRTB 2HRPL 2WVTA 3BSZL 3RVUD 4ICXA 4CADA 2UV3A 2DQIL 3CJJA 1SJEB 3CN2A 5L2JA 1A9VA 1XR8A 1UT9A 2XT1B 3LXCA 2MOVA 3OB0K 4UOJA 3TL5A 3QWOA 2MQ0A 1E9PB 5DJAB 4AEHL 4UQEA 4QHKI 3OKDA 3E8UH 3RWHA 4WY7L 5CR8A 2IDSA 3PWNA 5FWQA 2NRDA 3T1FB 5HGAA 4NNPL 5KYNA 5CUSH 1BV8A 5F72S 5AZEL 1S7SB 3Q8AA 1UZGA 2L7UA 2WZPA 2X38A 3K1DA 1PD1A 3TYFA 4PB0L 3GMPA 4PB9H 3SGDH 4H8PA 3ARQA 3GNMH 4WUKH 4ZAKD 1NCDH 4Z3FA 2WB7A 1JE6A 3ARBD 4MAUL 4WCYH 2ROYA 3MBXL 5FO8B 5T5FL 1JGLL 2MHAB 2F19H 4GQ9L 2R8SL 3MDJA 4KPHL 5EU7C 4B9CA 1K9TA 4FFYA 1TSRA 5D2LF 4NERA 1R3KB 4ODSH 3KL5A 1IC1A 2CDFB 4JFPB 4MDIB 1FGVH 1UYWH 3RWEB 3BDXA 4ODXA 3HB3B 4YX2H 1RSFA 4KRNA 3B5HA 3RY6A 3QZWG 1I3RA 3FU5A 3QDGD 3S0PA 4BZ1A 5CINL 3RI5K 5DFWH 2H26A 5I8OL 5IR1B 4WI2A 3RWCA 1QWUA 2I26N 5HDQH 3AMKA 4NENB 2NTFB 4KNSA 4AM0A 2LQRA 3ZDZB 4TRPL 3SE4C 4JM2F 1YEEH 4U6VH 2PN5A 2JJSC 4OFYD 4JO3L 1RZGA 5JDSB 4N3TA 5HHPB 3EGDB 4DPAX 3KL3A 4H25A 4WK4B 3BQVA 1WO2A 1RZ7H 1G7JB 3GJEA 3MBEC 5F1IB 3VFWB 4ELMF 5JNYB 1CBJA 3DO4A 4PJ8A 4PS4H 5I1AB 1S9XB 3FZUD 3CXDL 1CU4H 5IBTL 1NMBL 2QPDB 5D7EA 1LK3H 4ODBD 3OHXC 4KQ4L 1GZQA 1LDSA 1T2JA 1X5IA 2Z8VC 5E4EB 2P8PB 4B9KC 5I75C 4LVNC 1CQKA 3MRFA 3N3EA 1RK0A 4Y5XB 2ED8A 5SWZB 2C3XA 4Y7MA 3TBBA 5E2UL 1BJ1H 5FKAA 2EDQA 5HHNA 1TZAA 4KMTL 2J5LC 3E7JA 2QKIB 4PJIB 4JVUA 5F9DC 4QRRB 2A9DA 1J5OH 1B0RA 4O02H 2Z35B 1BLNB 5DMKA 5FPIA 3CU7A 1COBA 1DVFD 1NFIB 1WFMA 4FABL 3LY6A 3MRQA 1BVOA 4JFOA 3RWDA 2HAZA 2HH0L 4QXGL 1R33A 2HJFB 2A3TA 4GEIA 1KNOB 4AEIL 2ICCA 1JV2A 4DFHA 2M2DA 2B9AA 3O0LA 5BNXD 4PV1C 3C6LC 3TVMA 1JD7A 2JB5H 5D5MA 5KVGH 5D7KD 5G5DA 1CDBA 4ORGB 3DSFL 4BK8A 4LDEB 4IOSA 2IANA 2YAQA 4IEFA 3V52H 5JYMA 3LOWA 4MNGB 4CA4A 2EXYD 2OXGB 5EPMA 5JXEA 3IJYB 4MXQD 4AH2A 2K9UA 4Y8AA 3IAGC 2NXYC 2F08A 3QT2A 2O6EA 1U4EA 1T21A 5TF1H 5JHMA 3BCFA 3IBEA 1YYLH 1WA0X 1A7RL 1NUDA 2IH8A 3JVGC 1RZ8A 3GTTA 2B8OT 3ME0B 4HGWA 4MB1A 4Q58C 4RFOH 2PYFB 1OPOA 4HAKA 1O7VA 2BM3A 4HPOL 1E8ZA 4UUJB 2NY4C 4BK5A 1AZRA 5CN1A 2O5ZL 2K9FB 4OFPA 1OSPL 1E65A 4FFYL 1X5XA 3OJMB 4OLZL 4WTZA 1NCCL 3KWVA 4C54A 4MBRA 3VYPA 5DZAA 5K39B 1WV7T 2JFCA 3BH9A 4OLWH 2Z31A 3VX1A 4FCAA 1SQMA 4GKNA 2P5WB 4J6RL 4N2LA 4BZ1L 5EBGA 5FW8A 4M93C 5JIDA 2VDPH 1EAJA 3WEXA 3NN8B 4FP8H 3LYRA 4LFHD 3HAEH 2NX5D 3NAAL 1HOCA 2LU7A 1ZLWH 1UGKA 4LAQH 5K59E 4IMKA 1BEYL 3MLXH 5FCSH 3EHBD 4HBCH 5C3TA 2OSLB 3PV6A 3E2HB 4NN5B 2EAEA 1TZGH 1GY1A 2F74B 3KH4A 4UM9A 5C0JB 1FCGA 4F57H 3CWGA 1CZ8L 2HWZL 4U0RB 4UYQA 4DGUA 2Q2EB 3F7VA 4DN4L 4UT7L 2EABA 4LSUH 2Z7ZA 3NA9L 5CKAA 1CICB 35C8H 1J8RA 2CO4A 4CBPA 1RKRA 4PS7A 4YDVB 3VGGA 3GXUB 1OAZH 1B4LA 1FO0B 5FX3A 3RRQA 3K74B 4PBWD 3DYMA 4ZODA 2F1AA 1S7QB 3UTQB 2BMKA 4PUBH 3GHEH 4UV4L 3CD4A 2YLKA 3ESOA 4RLDA 3MREA 3VWKB 1L7IL 4Z78A 4YWGL 1E0OB 2XZAH 5I0YA 2E7DA 2NY0D 5DZVA 4WU7A 2XYBA 4X7TA 3EO1B 5TQ0H 2CBMA 1A4JA 4ZS6D 1CFMA 1T1WA 3FTVA 3I6LD 3DOIA 1LE5B 3ARTA 4YLQT 1Z0NA 1RUAL 4RBPK 4BRVA 4Y5VB 3X3GH 1XSOA 2I60L 3LPPA 1ODAA 1NM4A 4KNUA 3DIDA 4WVRA 2WD0A 2NY3C 2WWKO 3CQFA 3Q43A 4Z95H 2JLPA 1NIBA 4QTHB 1QFUH 3KGRA 5B7MA 1I8MB 4XX1G 1C5BH 1ZVSA 4AI7A 3LN5A 1RZFL 1AZZC 2BCMA 3KBEA 2XN2A 3IN0A 4LLUB 1U92A 4QO1B 5AW3B 2CRIA 3PHAA 4H2CA 1EDHA 3U0WH 3HB3D 3EYUL 4WHCA 5FYJL 2AEOA 2C4FT 3BD5A 4PJCF 4V1DD 2GSIB 2ZSVA 3MO1A 5IHUL 1IGTB 3KWTA 1I7RB 5BMFL 1KJ2B 2Y7QA 3CMOH 3DX6B 1H3UA 2IG2L 2XV0A 1P0SE 4JDEA 4OSUH 5E51A 3U9WA 4OCWL 5BOPA 2EDBA 2WO4A 1ZHNB 3A6CL 3P9LB 5I1IL 5TGBA 1AKJB 3OMZA 5LXGL 3VQMA 2VJXA 3UADA 3CUPB 1NTDA 4E41B 2G75B 4KQ0A 3QUKA 2H45A 3SCMB 1U8JA 4JZNB 4FG4A 3E6HA 1A64A 5I1EL 3WTUA 2AEWA 3HS0A 2OXHB 4HS6B 4GJTB 3BDYL 3HI1A 4XP6H 3T8XA 1F18A 3CXFA 5EO9A 3QUMH 5DD5H 1CXEA 2GHZA 4AIZA 4KI5C 5BO0D 1CG9A 1QSEA 4YFEA 1Y6KR 2WNXA 3W39A 5SWZD 2E8ZA 2X05A 3O9WA 5HYSG 3QIWC 1BAFL 2EH8L 4PJGA 4JFDA 4OT1L 5I8KL 3NJNA 2DY2A 1KYOJ 1KXTA 1ODUA 3L3OC 2M83A 4G8EA 4JFHE 4QRRD 4X6CA 2F5AH 4BJLA 1E40A 1IC7L 5IY5B 2ZAHA 5H94B 4PJBE 1XBRA 5IUSA 1DBAH 1A9BB 1N2RB 2YQGA 1UB5A 5FV1L 4HIIA 2WZ0A 1ZGLM 1DHKA 1ZSHA 2YMXH 1PZBA 3IGAA 4LLDA 3T0DA 4NGHH 1DSWA 4EI5D 3IMBA 3VU2A 2EYRA 1NDTA 1JXGA 3FKUS 4KITB 3M88A 1N5YL 4JFUA 5K93A 4RDQF 3S34L 1UD8A 5D96B 1BZ7B 3PDDA 3L1OH 2AK4A 3H0TA 3RWGB 3BO8A 3NCCB 4PRPE 4DKAA 5KS9F 2PLTA 4EE2A 2WYHA 4X6DB 3GSWB 9CGTA 5F96L 2OJZH 4KK6D 5ID0A 3WFDL 1N8ZA 4MNHB 4PLKC 3VSTA 1GGUA 4EUPB 4D0DA 1KCVL 1HZKA 1G9MH 1ZPLA 3SQBA 1NWOA 2Z8SA 4H20H 2XWJA 1S5HA 3N40F 3FQWB 1OAUL 4BWTA 4ZFQA 4JZJB 2QQKH 4X4ME 4XRCB 4RMUA 3CBRA 4ABWA 4RWYL 1DLFH 1E27B 1KPRB 2A1WL 3IPEA 4AZ8A 2D0GA 3IAQA 4B97A 2MCG1 2PO6C 4BZ2H 1OSZB 1P53A 3VTMA 4PJ9C 2MNJB 3SKJL 5HYJE 1BVKA 2P5WD 3X13A 2Z8WC 1UATA 4JFEB 5L0QB 2DWDA 2P26A 3DMMB 3MFFA 1HU8A 3L3GA 4HLZG 2D9QB 3Q1EA 4QRQB 3L5WB 1NCNA 2RQEA 5CS7A 2X4OB 3GO1H 4XPHL 2APBA 2PCPB 3QH3B 3U2SA 4CGUB 4G6KH 4HISA 5JW3L 4GAJL 3LDBC 4Y0GA 3MYZA 4AGPA 3FRUA 3CVHH 1BF5A 5C0EA 1QNZH 2QL1A 3RZCB 4FHKA 2Y4SA 3FFCE 3U30B 4OZ4B 2E4FA 4MD4A 3EH1A 1X5JA 3VGFA 4R96A 2F8XC 4IGBC 1D5BB 2AHIA 1BZQK 1JF6A 4ZO7A 3VI4B 2NR6C 1I7ZA 4QRAA 2YN5A 3FOLA 4QY8B 1HXYA 1CICD 1PLAA 2A0LC 2FSDA 1TO5A 4JRYB 5DUPL 2EKJA 4G1EB 2VW4A 3L95A 4EEEA 3GEFA 2BNRE 4JO1L 4ODHH 5I6KA 5IW1B 1X9QA 1YDPA 3STLA 4D9QE 3S3BB 1QYGL 3UEZA 3DJ9A 1QBMH 3VGHA 3VWKD 4A67A 1A6TB 4NB7A 1IILE 3ETBJ 3RGVB 4J28A 1VADB 4NS0A 2GEEA 2X10A 3C5ZD 5DQDL 1ZV9A 1MJUH 5C7XH 4KBPA 5HGDA 2YUXA 1EZSA 3TNMA 4C4KO 4W9JC 2ZQKA 3N06B 1KGYE 5AVRB 4MZ3A 3QEUA 1KCLA 3WS6C 3WAJA 3MRRB 2Q10A 3BIKB 4PBDA 5KVFH 4EI6A 4HHWA 1MFAL 5IWLA 3RWFB 1UACH 4KAQL 4OCRH 1QPKA 2MFNA 2VDRH 4KKNA 1TMQA 4OFVA 1C12A 2Z8RA 1G9HA 4GUCA 4R5VA 4U1GC 3CBJB 1NLBH 3TZVA 3K4DA 3VUAA 4ZT1A 5JQ6L 1J1XL 5KJRL 3NACL 4F9LA 2PWDA 3CN4A 5FAAA 2J1ZA 3WS3B 1G94A 1SXZA 5JHLA 3CFBA 5HI4D 2Q76A 5AKRA 3V5DA 3HHSA 3ULUF 4L4VE 5HVHC 3OZ9H 2P24B 3VFUB 3DUUB 1FVEA 2ZCHL 4ZUTA 3ORJA 4E41D 1XVSA 4EI0A 2OMZB 2DEYX 1F1DA 3ETSA 4JHAH 3UX9B 4Z7NE 5L88L 5ALBL 3GSRB 5I8EB 4YLCA 5BRZE 3GHPA 1G4MA 1YEDA 3QUYA 3Q06A 5I16B 2GTWB 3DA0A 4XP9H 4HZLA 4N2CA 3HG2A 4RGMC 2X4RB 2YKKA 4Y4HC 4MAYB 4I4WA 4FFVD 2DICA 2XQYG 4PFEA 1UA6H 3H42H 1OCWL 3WIIL 4BFBD 3O11B 5BZDA 1S2EA 4CC0A 1DQLL 4X42A 4Z8FL 1P5UA 2Z7YA 4XMLL 4U3XA 2HUHA 4XP5H 4N90D 3AQYA 4RCAA 1ZT1A 4XNUH 4NYLA 4U1LB 1WZ1H 4ENEC 1E6OH 3H9SE 3GPSA 2RALA 4FZ8H 4GS7C 1KENH 5EWIL 2YAOA 2YN3A 4PRNB 5E6SB 5FS5A 4OF7A 3BN9D 4KK5D 1XL4A 4TQHA 4BD4A 2KT6A 3JV6B 3EYVA 2FGWH 4AYEC 1QQDB 4NO2A 3THMH 3GBMH 4XN7A 3WE1A 3ZQWA 1SVBA 1O5DT 3MUGB 1A4KA 4H1LH 2ZCZA 2FT7A 1DSFH 1D6VH 2ZNXA 4J27A 4G72B </