3V9CA

Type-2 cu-depleted fungus laccase from trametes hirsuta at low dose of ionization radiation
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
499
structure length
499
Chain Sequence
AVGPVADLTITDAAVSPDGFSRQAVVVNGVTPGPLVAGNIGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQHGTNWADGPAFINQCPISPGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASRYDVDNDDTVITLADWYHTAAKLGPRFPGGADATLINGKGRAPSDSVAELSVIKVTKGKRYRFRLVSLSCNPNHTFSIDGHNLTIIEVDSVNSQPLEVDSIQIFAAQRYSFVLDANQAVDNYWIRANPNFGNVGFDGGINSAILRYDGAPAVEPTTNQTTSVKPLNEVDLHPLVSTPVPGSPSSGGVDKAINMAFNFNGSNFFINGASFVPPTVPVLLQILSGAQTAQDLLPSGSVYVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGSTVYNYDNPIFRDVVSTGTPAAGDNVTIRFDTNNPGPWFLHCHIDFHLEGGFAVVMAEDTPDVKAVNPVPQAWSDLCPTYDALDPNDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of T2-depleted fungal laccase from Trametes hirsuta 072 at low and high dose of ionization radiation
rcsb
molecule tags Oxidoreductase
molecule keywords Laccase
total genus 145
structure length 499
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA03
1E65A 3QJQB 2I7SA 3KW7A 3OQRA 5D4IA 1EHKB 4ZK8A 3T71A 2QPDB 3ASOB 3FQ2A 4DPAX 1NIFA 5I6PA 1OE1A 1AZBA 2VSMB 2H3XC 5I6OA 1WAEA 4DP2X 2H5UA 7PCYA 1W8EA 3X1BA 2IDFA 2IDUA 4A2EA 1RZQA 1SFDA 1A8ZA 2DWTA 3NJHA 5AKRA 4DP4X 4QLWA 3PAVA 5I26A 1JVOA 3ABLB 2DV6A 2VM4A 3OMIB 2PPFA 3UAAA 2CUAA 1AG0A 4YSSA 4E9QA 4DP9X 2XV3A 1CYWA 3T6ZA 1SFHA 2AFNA 1OCOB 4YL4A 1PZCA 3WNJA 3AG3B 3ZDWA 1V55B 1KBVA 1KCBA 2HX9A 3OMNB 4M4RB 1WS7A 1OOWA 2WSDA 4HHWA 1JXGA 3S3CB 3N2JA 2PLTA 1GSKA 2ZXWB 3QJTB 4F7KA 1OCZB 2IAAC 2AVFA 2UXVA 3GXUB 3X1EA 1GYCA 3V9EA 3TU6A 2GC4C 4W1TA 4DP5X 3KW8A 1HAUA 5E9NA 4DP7X 1J9RA 1L9OA 3AG4B 1AS8A 3S8FB 4KO5A 1BQKA 1L9TA 1OE3A 1TU2A 5B3SB 1E30A 1IC0A 1L9RA 4AKQA 4DP1X 1J5CA 1JZHA 1MZZA 2XXGA 4DPCX 3FU7B 5F7AA 1FA4A 2E86A 4W9ZA 5AZUA 3CVCA 3D12B 2OCCB 1KV7A 2IDTA 2J56A 2PPAA 3GDCA 2VW6A 3SQRA 1NDTA 4L0PB 3CDZA 1QHQA 4HIPA 3UADA 3CVBA 1NIBA 2XX0A 4YSEA 2GSMB 1ID2A 1NWPA 2VN3A 1TEFA 2AZAA 3FQ1A 2UXFA 1ZPUA 2XYBA 2EIKB 3EH3B 5B7MA 4YSQA 2HZHA 1AOZA 3WNIA 2FTAA 2YAMA 2DYRB 2FQFA 1V10A 2EINB 1XB8A 1MDAA 4A66A 1A3ZA 1AS6A 3FU9A 1IBYA 1E5ZA 3HEIB 3WKQA 4DPBX 3FT0A 2BZ7A 4YSCA 2EILB 2UX6A 2TSAA 6PCYA 2JFCA 3IEAA 4A2GA 3CZUB 5B1JA 4TXVB 1WS8A 3DTUB 2R7EB 2EIMB 4G72B 4N4YB 5FC9A 3T6XA 2ZONA 1W6WA 2AANA 4GY4A 2PCFA 2QDWA 1XMEB 3FPXA 4G7RB 1NICA 1TEGA 2B08A 3SBQA 1V54B 1ET5A 2GI0A 3T6VA 1AAJA 3PAZA 1RZPA 1RKRA 4CSZA 1PZAA 1ET8A 1YLBB 5B7EA 3JTBA 4BWTA 4WTQA 3UGEA 2MRYA 3EHBB 1AZRA 1GY2A 2YAEA 2GC7C 2YAOA 2YXWA 3NJLA 5I6KA 3N55A 3S3BB 3ZBMA 3NSYA 2RACA 3H4FA 2IWFA 2PPDA 2GHZA 1NZRA 3UACA 2IH8A 1M9WA 1WA0X 3DIVA 4E9XA 3WG7B 5AFAA 3NJKA 1WA1X 5LDUA 1PMYA 3WI9A 2TSBA 5I5JA 1TKWA 2XX1A 1SDDB 1N70A 1BYOA 4Q8BA 2YQBA 3QJUB 3NJNA 4A2DA 3IBOA 3IE9A 4UF7C 1JXDA 3PCYA 4HCFA 2MTAA 4YSPA 3X2QB 2FWLB 4YSUA 8PAZA 1ASPA 2YARA 4A68A 2QDVA 1BYPA 3AZUA 1JXFA 1PY0A 3U25A 3NT0A 1WA2X 1CYXA 2IWKA 4DP6X 1URIA 1ASQA 2IWEA 1PLCA 1SHWA 1ILSA 1J9TA 2FQEA 1OCRB 1PZBA 2Y69B 3PAUA 1DYZA 3BVDB 3CG8A 4DP0X 1OCCB 2VM3A 2IH9A 1OF0A 1KYAA 1HFUA 1IBZA 3PXLA 3NYKA 2J57A 3CVDA 3NJIA 1AANA 2J55A 2XUWA 3FQYA 2PP8A 3ABGA 4HHGA 2XU9A 3T6WA 3TA4D 3MBWB 3JT2A 1JZGA 3NSCA 3OD3A 3ABKB 1AIZA 4BDVB 1SNRA 3X1NA 4E9TA 1BAWA 1ETJA 1A4BA 4BDVA 5F7BA 2A3TA 3QPKA 2HLEB 1E67A 2HXAA 4JKNA 4DP8X 2DYSB 1L9PA 2HX7A 3AG1B 2DWSA 3BQVA 3NJMA 3FS9A 5I6LA 1SF5A 2XV0A 2YAPA 1JOIA 4G71B 2X88A 2HX8A 5B1AB 1ASOA 1BXAA 1L9SA 1GW0A 2IDQA 3ABMB 3TASA 4F2FA 1W6LA 2UXTA 2VSKB 4A2FA 2CCWA 1KCWA 2BW4A 5B1BB 1A4CA 3CDZB 1ADWA 4Q89A 3WKPA 5D4HA 4A2HA 3IN2A 5B1KA 1BQRA 2BWDA 4KOCA 3HB3B 3C75A 3NSDA 4RH4A 1BEXA 4YSDA 4YSAA 1NPJA 4GP4B 3GYRA 2YXVA 5TK4A 1OE2A 4BK5C 4F2EA 2PP7A 2CBPA 2JXMA 1JVLA 3NP3A 4E9WA 1MZYA 3FSWA 4HAKA 2I85A 9PCYA 2JKWA 2WO3B 4X4KA 3UABA 5PCYA 3ZX1A 2BWIA 3NJGA 1N68A 2BO0A 3FPYA 3NJFA 4P5SA 3OM3B 4G70B 1GR7A 1GS6X 1SDDA 1CURA 1KGYE 1AZUA 2W8CA 2YAHA 2FT6A 4AX3A 4HCIA 1BXVA 5I6NA 2EIJB 1J9QA 2BP8B 3AG2B 2FT8A 3H56A 1AQ8A 2P80D 7PAZA 3IN0A 1L9QA 5B7FA 4KNTA 1NIEA 2PP9A 1AS7A 4P5RA 1JZJA 2BP0A 5I6MA 2PPCA 4HCGA 1NWOA 4KO9A 4WKXA 1AG6A 2BW5A 3QJVB 1NIDA 1AR1B 3TBBA 4AZUA 5EHFA 2B3IA 1UATA 4KO7A 4BXVA 2FNWA 2Q9OA 4G7QB 5PAZA 1JZFA 1ZIAA 2CALA 2HRHA 1F56A 4UAHA 4BXSV 1ZV2A 5IY5B 1ZDSA 2YAFA 3FSZA 4HALA 1EZLA 3X1GA 3SBPA 2XLLA 1J5DA 2DY2A 3FU8A 3MX0B 1SJMA 3EH5B 4KNSA 1SHXA 6PAZA 1QLEB 2XWZA 1SF3A 3ASNB 1NINA 3QJSB 4GYBA 2X87A 1X9RA 2W88A 3AW5A 4YSOA 4E9VA 1M57B 3L45A 4JHUA 4NB7A 1AZNA 1GY1A 2VW7A 2GB2A 3UAEA 4E9RA 4PAZA 4GP8B 4NERA 5D4JA 2OV0A 2QT6A 3DKHA 4YSTA 4A67A 4YVUA 1IUZA 1DZ0A 2ZOOA 3FYIB 4JHVA 1PNCA 1A65A 2WO2B 4KNUA 4GXFA 3FYEB 1GS7A 1ZDQA 2LLNA 3T9WA 2UXGA 4AI7A 2J5WA 3V9CA 1KBWA 2OJ1A 3H4HA 1NIAA 3QQXA 4BWWA 3WIAA 2R7EA 4FAAB 4PCYA 1ET7A 3RYMA 1PLBA 2PPEA 1T5KA 1PNDA 1CC3A 1CUOA 4AKPA 3S8GB 1KDJA 2UX7A 3QJRB 3NSFA 1JZIA 4FA7B 2N0MA 2XVBA 1M56B 1VLXA 1JZEA 2H47C 5A7EA 4MFHA 4YVNA 5TK2A 2ZWNA 4GP5B 4M3HA 2P80A 1B3IA 4G7SB 1AZCA 1BQ5A 1AACA 1XB3A 5I28A 2CAKA 1KDIA 2BP8A 1PF3A 2CJ3A 2VMJA 1JERA 1XB6A 4E9SA 5ANHA 4CSPA 4N8UA 4KOBA 3OMAB 1X9UA 4BWUA 2XXFA 2YAQA 1A4AA 3ZIYA 2FQDA 3PPSA 2BP0B 1ILUA 1PAZA 2BZCA 1RCYA 2HRGA 4NAJA 2VW4A 2XV2A 2AZUA 1I53A 5I5MA 3FU7A 1IKOP 2PCYA 5I5IA 3SBRA 2NRDA 3PLYA 3AY2A 4K9JA 1R1CA 1MG3C 3G5WA 1QNIA 3NP4A 1PCSA 1E5YA 3TBCA 2BHFA 4EF3A 2Q5BA 1BXUA 2FJSA 3EH4B 4AKOA 2IDSA 3FSAA 1FFTB 1NPNA 3S3DB 3EF4A 2GBAA 2Y1AA 1MG2C 3ERXA 4UANA 1ZIBA 1HAWA 1NTDA 1J9SA 4HZ1A 1FWXA 4QKTA 1PLAA 4KO6A 2FT7A 2FQGA 1OV8A 4E9YA 4ENZA 4YSRA 3FSVA 2QPEB 3X1FA 1GS8A 2I7OA 5B1JC 3NJJA 2GIMA
chains in the Genus database with same CATH superfamily
1RQ5A 2IOMA 2DEXX 1K8DB 1M3JA 3SE3A 4QHKI 3K91A 1AI1L 4CILA 4PP2B 5KYXA 5HJBA 2IBGA 3RVTC 1O7VA 5EU7C 1WEJH 4OF3A 1HSBB 4F58L 4GFXA 6CGTA 3UO1L 1ITCA 4W9HC 1EERB 3QUHA 2AKRA 1GJIA 4NZUH 5DVOA 3BN3B 1RP9A 5JPMA 4G83A 4IYKA 4XC1H 4DP4X 5KVEH 3BGFC 3KCPA 3LH9A 1TYRA 1OTSD 1Z2KA 2JB5H 1DFXA 1HI6B 1WAPA 3O41A 4P06A 4AQZA 3C5ZC 3PNWB 1M7IB 4XMZA 3IPEA 5J12B 1R3JA 1WWAX 3ECVA 3W56A 2B1AL 2GJPA 3AMKA 4R7LA 5EOTB 3ESMA 4CVWA 2UYLA 3AB0C 3WTWA 2WMPB 3NDZE 4NN7C 3KBHE 1WFTA 3ARBD 3E7JA 3GM8A 1KBVA 4AYGA 2ZUVA 3CCHB 2CBTA 4JAMB 4AENB 5KJRH 1A7RL 4MAUL 4PRNA 5IJKA 3N43B 4X98B 4WI6A 5IF0A 3ELAT 1W0WB 4HIHA 1KJ2H 2IAAC 3GSRB 4ZODA 3GXUB 5HJGA 3CFBB 3I3EA 5JIIA 3OF6A 2D2CC 3S4SB 1LO2L 3QR1A 2GC4C 1VFAB 4O5LL 4X6DF 3U6RB 1QBLH 3NSJA 2HT2C 1OSYA 5C8JB 2PF6A 2QVKA 3BQUA 5HHNB 1OB1B 4AKQA 1OZTG 1S5IL 3OKKA 4J3TA 1J0KA 2WIIA 4LEOA 3NABL 3P69A 4C58B 5C3IA 3FU7B 4YHZH 2DTML 4H20L 3KWTA 4JG1L 1EJ6A 3DX9B 1H3XA 3TEZA 4OCXL 5I9QC 4OLUH 3L5HA 3KHOA 1HQRB 1N4XL 3QXDA 3RY6A 4RISL 3L13A 4AM0Q 1SRDA 1BVLA 3KR3H 3CIAA 4WUUE 4YHIB 5HI3D 2JK5B 4KROD 4QTFA 5HYQB 4N9OB 3D8MA 5E6ID 4YGAB 3DYOA 2XZQH 4CNIB 4YDLC 5E94A 5FOBB 1H3VA 1DJGA 3IMSA 2OYPA 4K3DL 4MKMA 4LLDB 2WSPA 4G5ZH 5CS7A 2H32B 3S37H 1YEWA 3ZDXB 1A0QH 2R29H 4Y7MA 1Z5LA 3KXFE 3UAJA 5LBSH 3EFDL 1EXUB 5CEYB 5L2JA 4CGUB 3RWJA 2JCWA 4ELKA 4H0HB 4XBMA 2JB6A 5BQ7B 5C6WH 3RG1C 3VXSB 1BM3H 3PREA 1NBYA 3VUAA 1NGPL 4TNVK 1YN7B 1X9QA 2QGBA 4GUPB 2ITEA 3JV0A 2W9EH 4GIAA 2Z91B 4XR8C 2AP2A 3WD5L 1DUZB 2BHZA 3GF8A 2OL3B 2DQJL 3BLPX 4JMXA 4M6ML 3ZE0F 2VKWA 5DJ6A 4ZFGL 3VGFA 3GXDA 3UIZA 4G8GE 2BXZA 4DTGH 3HZYB 3Q6FA 4L5FE 1WAAE 1TEGA 2E3VA 4NIKB 4XO8A 4H0IA 1YEEH 1ET5A 4GW5A 1UASA 2YUXA 3QRGH 4N0CD 3TTYA 3HG4A 1UWYA 2R83A 1EBAA 1PZAA 1KPUB 2NY4C 3D2UD 4KH9A 1HEHC 4BQ8A 1J1OL 5L6YH 1SLXA 5H2BA 5J89A 2FNBA 1BW8A 3S3BB 1NCCL 3UG5A 5I1JL 5E8EA 4QRPD 3SDYH 4NZJA 1GZPA 1BVOA 4FYTA 4N2LA 2EH7L 5JIKA 1KN4H 1MJUL 2D7TL 2PTTA 5E00B 5F88B 3RVXC 2C3VB 3UG3A 2DPKA 5HGDB 3WO3B 5BJTA 3APMA 3VFTA 5KBKA 1R5VA 1UT1A 2IFGA 4GI6A 3IPBA 2J8OA 5E8DL 3MV7B 2XCMC 4N8CL 2Y24A 4A2DA 1KTLA 3O6ML 2XJLA 3SYOA 3HHMA 3MBXL 4NPYB 4GFTB 4KKPA 2J1ZA 3ZO0A 2LAGB 4H8PA 3BGMA 1EXUA 2NY7L 3L9BA 5I18L 1JXFA 3I6LD 1B0GB 3ESOA 1URIA 4L9LA 1INDL 3T0AA 5C3LD 1CE1H 4X9YA 1PLCA 4KGLA 4XTRC 1AD0B 3U4AA 1PZ2A 3BVDB 4NKQB 2YC1B 3TBSB 5DHYA 3AROA 2DWEB 4ESKA 4X0NA 4OBRA 3SDCD 3VD4A 1QUNB 4U1IA 5FUZH 3QEQE 3TO4C 5TDNB 5JPMB 3BUYB 2BY1A 5J1AB 5IUSA 1E3XA 3FOLA 4PJ5E 1DQTA 1L7IH 3TCLA 3II3A 1BF8A 3QPXL 3F7QA 3OKOA 3KJ4C 2Q7YA 4ZMTA 4A7SA 4IM8A 4RMUA 3NAAL 4YNYA 2L04A 3OGOE 3UTOA 5CN1A 3HTLX 2BIMA 3PG2A 1QTYT 1UM6H 2B14A 2X4RB 3QUZD 2HVKA 5D2NC 3VG9B 3VRIA 2ZOKB 1J0YA 3F58L 3D50A 3X13B 2C3HA 1FNLA 4P04A 1AQDA 2ARJQ 2XV0A 4QHUA 4DK6A 3N91A 4G71B 4HIHB 4AVHA 1KEMH 5C2BL 2XQYA 4OIFA 1A3QA 1GGCH 1CGUA 1GW0A 5I71B 1IM3A 3B3BA 4PJGA 1KCWA 2O5XL 4MJ5A 5CBAA 3DUUB 3WKPA 4Y88A 3SCMA 5I1IH 3LD8C 4BZ1A 5E08L 4G9FE 5DD0L 4RH4A 3RFZA 5FF6A 1VGEH 5KUMA 1R5IB 5CD5D 4I3RL 2P42B 5IV2A 5CUSH 1OGAB 4ETQA 1JYXA 1FUNA 4TUUA 1FFQA 3B37A 4TQEH 3UIYA 5IJBC 2AI0H 1KWGA 4FLQA 1FHNA 3Q5YA 1SBBA 3CDGB 3UABA 4F37K 3D0LB 5JHDB 1ACZA 1KY6A 1T0NB 3R06A 4FL4B 4JDEA 2G4EA 4PWEA 4P3DB 1KGYE 4PJDF 3DSNA 2PCXA 4IBVA 4AX3A 3C08H 4YK4B 1MEXH 5AWNH 2B2XH 1BVZA 1D5MB 3ZL1A 1T6VN 2R2BA 3KPQB 5B7FA 1F6AA 4XVJH 15C8H 4TSBH 2PP9A 1BV8A 5J57B 2GW5A 2C9UA 4LVHB 2VDLL 4HQQH 4TLKA 5HHQB 5I6MA 3WHE1 5C9KA 3HMXH 2E9GA 4QHUB 4PJDA 3M7FB 2NXZD 3AWGA 2CQVA 2XPYA 2APXA 1P6AB 2YO3A 4J3WA 1G7LB 4QYOA 4I0PA 4QHLA 2G3NA 5M95B 1TTCA 2NMSA 1BIHA 1XD0A 2F8IA 4L8DB 4KJWC 4MJ5B 4DTGL 5ID0B 5C07A 1P5UC 3AXHA 2IAMB 3G04B 5DFWH 4WTWA 1B4RA 3FZUD 4DOHE 4K7PL 1IM3D 4OD1L 5DRWB 3VYOA 4PU2A 5JMRA 4JG0L 3SN6N 1I7ZA 1CXHA 2DQTL 4U6VL 4OLZH 4ZFFA 5L6YL 5CGYC 1FN4B 5KBNC 1LO4H 1ADQA 5F9OL 3LEYL 3ILQD 3NBNA 3FXIC 2Y6TE 5D1XA 2OTUB 1VADB 5F89B 3QNFA 2ZAHA 4HT1L 3ZYIA 4FTDA 1NBYB 3I6KA 2CO7B 3BO8A 4NQXA 3SOBH 5KSUB 1A4KB 4LCCB 4B9JA 4FNRA 5EUKB 3D52A 1KTDA 2ILLA 5C2BH 3WIFB 5I1IL 1RZFH 1YMMB 1XF5A 3FYEB 3HZMA 4AH2A 3QZMA 1PY4A 1FLTX 2UXGA 3F7RA 3FRPG 3DJ9A 1U8HA 2OJ1A 2O5XH 5KVEE 3HZKA 4Y4FA 5DZOA 3BDXA 3KJ6H 3QG7H 4P2OC 4YXKL 1A7QH 1S8DB 1HEZA 3EJYD 1ZTMA 3QQDA 5IMKA 4ACTA 2XVGA 5E1HB 25C8L 4PV1C 4AKPA 5C0FA 5DMKB 1Q94A 4YDKH 3FFOA 1DSYA 4PB9L 3O2DH 1CK0H 2E56A 2Y25A 3B5GA 4UIMB 3AY4A 2X4TB 3REVB 1VLXA 3RPKA 1S6NA 5IJKC 5KS9E 1I82A 1RSYA 4LVNB 1FDLL 1XFPA 3ECQA 1UOLA 1QBLL 2WKLA 3A67H 3MRCA 2OJEB 3IWVA 2CLRB 4U3XA 2B4CC 3D87B 4M3HA 5EF2A 1NCOA 5DJAB 3T0EB 4CU8A 3CD4A 3FDWA 4NC2B 4TRPH 2H2SD 4UQIM 3ZRCC 4JL2A 3B6SB 1A1OB 3ZTDC 1SJHA 4MD0A 2KQNA 1BMGA 3OSVA 1AO7D 2BNRE 2NDGA 3BH9B 3CVHB 3KPPB 2A7BA 4XNYH 1C5BL 1DDHB 4BWUA 4EBQL 1A9BA 4I77H 1H8NA 4DQOL 2XV2A 2L8AA 3JTTB 3BO8B 3R4RA 4NGHH 2UZXA 4X6DE 1MRFH 5LNDA 3FU7A 2DIEA 2MHAB 5TF0A 2NRDA 1R3KA 1QAWA 1GYVA 1HHIA 3KLLA 3PLYA 1GPOL 3UTQA 3FW6A 2FLRT 5I71C 4NP4H 1KXQE 5DJDA 3BPOB 2UWEB 1XBDA 2UYLB 3OZ9L 2EH7H 3EIFA 3SKUD 3I9AA 2C1PB 2HPOA 3A5VA 3QEGL 1GSMA 2GBAA 4LDOB 3VGEA 5E7BA 2P8LA 1TQVA 4L2LA 3IGLA 3IJYA 4G6KH 3HN8A 3KAAA 3QNYB 3M8OH 2LFGA 4WNSA 4QRFA 4DO5A 1F8TH 1RIHH 2R4RL 1HILB 3ZQWA 5EOCL 1MW0A 2V7NA 4EI5C 4S2SA 3WDHA 2QHRL 2YZ8A 3RY6C 4NM8L 3GSXA 5HGGS 4GSUA 3EXJA 1RZKL 1FNGA 4ADJA 3FSVA 4BFNA 4O4YH 3U0TB 3KPLB 3RWEB 2DM3A 2PR4L 4B9CA 1E65A 4P3DA 4M9OA 1OP5K 4XPBH 5FGBC 5GRXG 3UBXB 1JPSH 4ZX5A 3HBZA 1R19A 3FO2B 5FV2A 1PQZA 3HBPA 2AAVA 5CJ5A 5CJOH 4D7PA 3FB6A 1FYTE 1PG7W 4IMKA 1KIPA 4FNSA 3VVWA 5A6IA 1E7VA 4YHPB 3VD2A 1SYVA 2H5UA 1PYWB 1FF5A 3PWLB 5HHVH 1SFDA 2R29L 3P0VL 4I4WB 4QHNB 5CWSA 3RWFA 4B9ZA 2WQUA 4QLWA 4NM4H 4RMSA 1GKOA 4J4PA 1WBXB 5HHOA 4X4XA 2EKSB 4X5WB 3IDYC 4H26B 5GIRA 5KSBB 2B8OT 4L4VD 4QRRD 3T0DA 5TQ0H 3U4EA 3U0WH 4N8PA 1ZT1B 4LCIH 4TSCH 1X4XA 3M1BA 4PJIA 5CGYD 4YEEA 1KCBA 1YJDH 4WQOA 2B1HL 4WAFA 1OZUA 4N2BA 2DYPA 3ULVD 4LDLB 1YMHB 4N28A 3FU0A 3G5VA 2WN2A 4GXUM 3GJFB 4N90D 3MSPA 4PJFE 3TN0C 5B3JF 2VQTA 3QUZB 2XACC 2FHBA 4Z8FH 1EX0A 4XAWL 1RVFL 3Q5OA 3VRJB 4I5BA 1TZGH 4P46C 4PBWD 5FGCB 2DMHA 4JO5A 3VM5A 4HZLA 1MWAL 1I8IA 5DZAA 3T2NH 2R15A 4EVNB 3KR3L 5F97E 1KT2B 5FA3B 2A6JB 1CVSC 4AQ8A 5IROD 5F7AA 1FH5H 2KPWA 4IGBB 1OGTA 3CBRA 4I0CC 2UV3A 2NYYD 3EZ8A 5FA4B 1P5VA 5C97A 1XCQA 2NXZB 5JHBA 3DVFA 3GDCA 4OJCA 5DURB 4QHLB 1O0VA 1WWCA 2G75A 5TQ2L 2A0LD 1TQUA 5FLVA 3TVMC 4AT6B 3QEHA 5BO0D 2PO6D 2XX0A 4YE4H 2X70A 3IDIA 4FL4C 1DVFC 2C9XA 1H6UA 3DLQR 1PKOA 3IU3A 1T83A 1J05B 4G8GA 3SE9H 3PWJB 2YSSA 3SPVB 1FQ9C 3H8NA 4UT9H 4ECNA 2VZVA 3EH3B 3GI9L 5MP6L 3J07A 4XI5D 4IDLA 2C9RA 5HJDA 3K2KA 5EZPA 4ALAH 4NWUH 2F58L 4FG2A 5D93B 1FRGH 2YR3A 3EG9A 3HC3H 3LB6C 2FQFA 3FT1A 3GHEL 3C09B 2ZXBA 2QQKH 1I8AA 2VM9A 3SDAA 4BUGA 5GZNA 1U8IB 2XZCL 5E2TL 1QWHA 1NUDA 1KGJA 2WLMA 4ONFH 4FFYA 1IZKA 4KZEL 4NBXB 4ZW7A 1OM3L 1G1KA 3DK2A 5LGYA 4ISVB 3VWKB 4EAEA 1S7TB 3DA0A 4WV1B 4BSWA 2XTJD 3BW9A 4HKJA 4KMTL 2NY0C 2R7EB 2EIMB 5JHAA 2YD4A 5CINH 4N2EA 4Q0XH 4PV8A 5HDBE 4O58H 1TQSA 2CR3A 3SY0A 2PCFA 3X12B 1I8IB 4NZRL 1BG1A 4HC1A 3HI1B 4FJZA 2N7AA 3STBA 2GI0A 1LLAA 3ARQA 4JUTA 2QELA 2BM3A 5T1KD 4CSZA 3V4UL 1S7VB 3VXRD 4BKSC 2HFTA 3DRQA 3JBG7 3L9RA 4XNYL 4ZOCA 3VI4A 4EOWH 5E2WL 1MFUA 3LB6D 2A6KB 3QDGE 3L6FA 4N2MA 2IG2H 4XOEA 1N5YL 4JZJC 3RKPA 3TEWA 1IM9B 3SDAC 4WU7A 3E3QC 2IF7A 3LCYA 4F27A 1NEPA 2FIRT 2HUHA 4QOKA 4XAWH 2OQJB 3UACA 3VGAC 5IVNA 3MLSL 1WA0X 4JCWA 4E9XA 3W82A 2BNUB 4WJKB 3ISWA 5FEBA 4APQD 2E27L 3MLWL 2DQFA 1DJYA 2DEWX 3HUJF 4AYBA 4KPHH 2YQBA 3K0YA 3GWJA 3GXMA 4ZDHB 2AGJH 2WUBH 4QGTA 1XWVA 4ZW5A 2Y5EA 4PJFA 2VR9A 1OK0A 4YSPA 5GS1C 4JPVH 4HOZA 2WXMA 2MTPA 1T5WA 4MYPA 3OKLA 4U1KA 3SJVE 1BYPA 3KPNA 2ZUSA 3RB7A 5TQ0L 3ZK0A 3GMPB 3VA6A 3N1QC 1TETL 2Y69B 3IDXL 5KSBF 3PAUA 4J3SA 1AOHA 1JHTA 1T7ZA 1TZGL 4RDQF 1L0QA 2G60H 4GT0A 3U7YH 2DQUH 3FT2A 4WUKL 2MWCA 3U9UA 5EUOE 4WW2B 1RZFL 4FG4A 3MXVH 1IBZA 3ISRA 3PXLA 4LP5A 3CHSA 3TBVB 3KG5A 3ESPA 1XGPB 2V3DA 5GGVY 2Q86B 2M8XA 3P73A 4JFSA 1YMMD 3HS0C 2PTTB 1P0SE 2EEFA 3BWZA 4TSAL 5GGUA 2WLJA 3R1GL 4APQC 5IMMA 4QTHB 3C09C 4TNWF 1SNRA 3B9DA 2HFEA 3HLAB 3NIGB 3MCLH 2DQIH 3S4SA 1K85A 5F9WC 3VXRE 1AC0A 2RCSH 2ZKYA 1TOXA 2XRAH 2FB4H 5CLZA 1X5IA 3LRKA 4RGNB 3MV8A 3BT2L 3MXWH 4XMPL 2OPCA 1D6EB 4RGOL 2EDKA 3US0A 2ZUWA 2APBA 2RQEA 1EVUA 1SJHB 3QFDA 4RWYL 5D55A 4MXVE 5IVZA 4ZW3A 4JFED 1ASOA 4PRHA 4TNGA 2HKAA 1W6LA 3C5ZD 3NZ8B 4HFUH 5DC4B 2OMTA 4F37F 2IANE 5AKTA 4DESA 5GGQH 3ULVF 3CDZB 5T1JA 3C6LD 1A1MA 3J8F7 2NT0A 1QBBA 4NZTL 5FYJD 3KDMA 1ZLSL 4KKAC 1KCVH 1QLRB 3AABA 3ALXA 4G6KL 4KK9C 5F8QC 2K0RA 3DV4A 3FQXB 3U82B 1BZ9A 2F7OA 3CXHJ 4M93C 1DVYA 1E4WH 4WTXA 4XPGH 3SJVD 4P2RD 3VWKD 3TVMD 4N2DA 4KDTC 4JDTL 5INDA 2XVKA 4BK5C 2K9FB 4K71B 4UZSA 3RTLA 4DEUA 4HAKA 3MOAH 1U30A 2CJUL 4FG6D 3S88L 1TT6A 5JYMA 2OJZH 3ESUF 4X4KA 2DB8A 3EOBB 5I1EL 3JVGC 4N3TA 3QEGH 4HBQA 1N68A 1EIBA 4YGVB 3DVNB 2LOEA 1RURL 5L4FA 1AZUA 3SPVA 3ZQ9A 3RX9A 5ERWB 4X42A 4RGNE 4W70A 1AI1H 4F20A 4I77L 1DBBH 3WIFA 5IW6B 2WAHA 3ZL2A 4I9WE 2VL5B 4XN7A 4IOIB 3PABA 2E9IA 1KXHA 5F7KC 1FDLH 4ZO7A 4K3HA 1YEGL 3OAYK 2H3NA 4KH2A 1BEYH 2WGXA 1K8DA 4DGIL 4KXAA 4KKQA 5JHLA 4MNQD 2Y72A 4CVZA 3HN5A 4PJAE 2E47A 1KT2A 1LO3H 1YY9D 3GZQA 2YRBA 4JB9H 3REVA 5FO2A 1E9PA 2Z8SA 4XHJD 1P2CA 2VZOA 2WUCH 3ARGC 4IRSA 5EEWA 3DRTB 3GPEA 1U8MA 2ORBL 5SX4I 1MLBA 2O30A 2RHEA 4YC2B 2HSIA 4F3FA 4JFPA 3LN5A 1AKJD 5CBEB 4FF9A 1C12B 3WUZA 4HC1H 1I1YB 3U7YL 3OKNA 4CN4A 4BSVA 2VDRB 1F0LA 3GZOA 2F54E 3GMOA 3LNDA 4K73A 4ES8A 2L7UA 2GVYA 2WWKO 1L9MA 4XCFH 3RBGA 3U7WH 3BMWA 4U1JA 3GSUA 3RAJL 1F3RB 3U0WL 2OQJA 4JKPL 4NERA 4N5EC 3TNNA 5KZCB 2OV0A 4EQ3A 3K81A 4GW1B 2E4FA 4KKCD 4NQCE 2ZOOA 2CHDA 4Q6YA 1U0QA 5ALCH 5C71A 1H5BB 2DTSA 5IB4A 4XVSH 1SXZA 1QTPA 2JLPA 3KEHA 1S7RA 4XOBA 4UQ9A 5ABDE 3EYQC 2X2HA 4C83B 1VPOH 4UT9A 2DM2A 2IPKB 3WEBA 4HZLB 3ZXAC 1ANUA 1QVOB 1LNUB 3GBEA 1RK1B 3OR7B 3U36A 1G7JB 3PP4H 3C5JB 4P5MA 3QJRB 1QZ1A 2W95A 3UEQA 1KXVC 1GGTA 1F4AA 1JP5A 5GXBB 5DRXB 5IOKA 4F8LA 3CSFA 5FB8A 1MI5E 1OW0A 1G6RH 5DYOA 4FULA 1DCLA 5C09A 5TK2A 3UJTH 3ARUA 5FYKH 3WY1A 4LFHD 1C5CL 1G9ML 1RD6A 1IAIL 1RIVH 4FEIA 4Y1AA 1FI8C 3CJJA 1UH3A 3TO2A 3VH8G 1BPLB 1MIMH 5J3HC 3UMNA 5KS9A 4B27A 4LCYA 3WIIH 4MGXA 1NEUA 1PQZB 4UMSA 3FUJA 5FIEA 1R5WB 1Z32X 4XTRD 4X4YA 7CGTA 2H8PB 1VESA 4DN3L 4H8WL 2BIOA 4IIQB 1RUQH 3KPTA 3PPSA 3MUHL 5B3JE 3QDJE 4IRZL 4NAJA 1HE8A 1W72H 4UUJB 4DHLA 5HHPA 1TJHH 3JWDH 1O9ZA 4OKVA 4D8OA 4DFHA 1AHWC 2Y7SA 1XMWA 5IFAH 4PRPB 4NHCH 2NDFA 4U3SB 4YHNA 4NN6C 1A6WH 3BC9A 3BP5B 3ES6B 4G6FB 2Z7ZA 5DURD 4HPOL 5T1DH 5E70A 5JZ7D 3GLAA 4JX0A 4UINL 2IPKA 3TZVD 4GAYB 3US1A 1ZEAL 5LNGA 2G2RB 4PJIB 1NSNL 7FABL 4Y2LA 5JIMA 1MG2C 1U6AL 5K9JL 1NFAA 1LXMA 2BNRA 2ZOTA 3C6LB 3V0JA 4Z3TA 3RB5A 1CDJA 3JWNG 1LWHA 4M8QB 3KS0J 3GSNA 1IAIM 5GZNC 3EJYC 2Y5TA 1KIQB 2DQCL 5GJSL 1NCWH 4PGEB 5E9DD 5D96C 3AT8A 4WO4D 2IQAA 2VDPH 3BVNB 3GO1H 2CIKB 4X5LA 1HS6A 5HGBB 2QADB 5CIPH 1RVFH 3I3BA 4JFFB 4NKOB 3UGXA 2EXTA 4JR9H 2W94A 5BW7C 2WUCL 2X4NA 4HETA 2ZCZA 3EKCA 3FO2A 4PRBB 4EDXB 1F1GA 2DH2A 1JNNH 1N9PA 3MR9A 1UM5L 3BISA 4DOHB 2VQUA 1TPXB 3RVWD 3VD1A 1IGTA 1IEAB 2DQMA 1EZVY 4I4WA 1XTLA 4ZUVA 4YBLB 3LQZA 4B5ZA 2HG5A 2YRZA 1D6VH 4KMLB 2WXNA 2DWTA 1ZLVH 3HB3D 1L0YA 2ADJA 4HEME 3MBEC 2MPVA 4H88L 3QPXH 1FNEB 4JRYA 3S34L 2C7UA 4MNQB 3WKYA 3C8DA 3MLVH 3I9IA 2X3BA 4EXPX 4JO4L 5E5LA 1LYQA 5F3BB 1NL0L 3GMRB 2XT1B 4FI7A 4JHZA 1MREH 3K1DA 3V7AG 5AALA 5L4MA 3T77A 3H6JA 1PZCA 5C2UB 2R2CA 2OTUA 5FYJU 3TT1L 2D03L 4Q9RL 4YHIA 1MAKA 4D94A 5EZLA 1F1DA 1P4BL 3ZE2F 5T1MA 4YX2L 2Q8AL 5GRYA 2NZ1A 2WLZA 3VSVA 1CDBA 4YHKL 3IRZA 4AQ1C 1JS4A 3GXFA 1BQLL 4WWNA 5TF1H 3ILPB 1RJLB 3NESA 1C5DB 1HKLH 3TU6A 1T22B 2K8QA 2BS71 2WXPA 3HFFA 4MAYC 3WXWH 4S10A 4KK8C 5IFAL 3MRFA 2WTRA 1HAUA 4Q9BA 5EU6A 1G0YR 2ZX8A 4OLZL 5AAWA 1RUPL 2ZOUA 3DHJA 4KO5A 1RK7A 4UNVA 3WFBL 5T1LB 1L9RA 4DN4H 3UP1A 5EU3A 3GXTA 1J10A 4MJIA 5BV7L 4AYMC 4N0UE 4ZAKB 5FECB 5DD3L 4ZX4A 4O9HH 4HIJA 4O2EA 2AK4E 2F54D 4WJ5B 1XXDC 2ZSVA 4Z7VF 3DARA 3IGAB 1HVXA 2P48B 2FEDC 1VFBB 2ITCB 3CDZA 3HE7A 3KNBA 4WW2A 4HKZB 1A4JA 3N1PC 1KV3A 2FL5B 3MRGB 4PGCB 4Y4KD 1KB5L 1NIBA 2KLTA 1T7XA 2D7OA 1N3NB 4BD4A 4HUWB 1G0DA 2VLKB 3P9MA 1RUKH 3EJUA 2VDLH 4HQQL 1FORL 2V2XB 4ZOAA 4Z3EA 2J88H 1KCUL 3MCLL 4JO3L 5HVGB 1V5JA 1FSKC 1IQDA 2RIKA 4R0LB 5ESAA 3T3ME 4P05A 2V9UA 1Q9KB 3MLTB 3T3PB 3T77B 3QRFM 5MI0B 4ZTPH 5GGSY 1AOZA 4PJFB 4XODA 1R24A 3K74B 3U7WL 4AUJA 4QIRA 1XB8A 3UG4A 3PJSA 5DHVA 3VGHA 1QZNA 1M7XA 1BD2D 5DSCB 2VT0A 3VFOB 3DJTA 4ZFGH 3UZQA 3QFJB 1KEML 1NMCC 4HG4K 4BZ1L 3ULVE 4R8WH 3O3BA 3DGGA 2XHNA 1YEIL 4R7XA 1Q9OA 2QBWA 4HUVB 2HTKC 3FRUA 1HZLA 2EDQA 2CCLA 2BNQB 4JE0A 4MXVF 2BSDA 1TETH 1CFQA 2B08A 3EF7A 5MEOA 2FE0A 2VXSH 2GJ6A 4H88H 2MNWA 3QCUH 1CR9L 1DEDA 1LNUA 2X5PA 1T6BX 2Z34A 1IZJA 1P53A 4QLRA 1E5UI 3UGEA 1EAJA 3HHSB 4N85A 1M7IA 2NSXA 5C0AA 5DGRA 4BK8A 2PW2B 4FZ8H 4U6YA 4WU7B 5IQ9B 2O5ZH 3WS6A 3IJ7A 5DYOB 1BPVA 3FAXA 2C9SA 5KSAD 1VZIA 3MACH 1EEYB 3NAAH 1J5IA 1EWHA 4FTVA 1I9IL 3B7RL 1DBBL 2ORBH 2VDNB 4BIKA 4F9LA 4ZMXA 5AFAA 2NY2C 4R4BB 2N0KA 1SBSL 1IIKA 5DHDA 3MCYA 1RZKC 1VFUA 2I26N 5CKAA 1I75A 1T89C 1HKFA 2P43B 1MCFA 1NPUA 2OAAA 4ZMQA 1OCWH 3QUKA 3JUZA 2KLRA 1CF8H 1QSFE 3E8VA 1XH3A 1R5WA 4HGKC 2MTAA 3MOAL 8PAZA 2NPLX 4DGIH 5FYJH 2QDVA 3A6OA 3TIEB 5CEXB 4LCWE 4XNAA 3LY6A 1WA2X 1UXMA 2XBZA 1D7CA 2FSEB 3FUDA 1DEEB 1ILSA 3I6GA 4UUJA 4G6FD 4X5XB 1K3ZA 1WBXA 2VLME 4FMVA 4N8CH 4N1CA 3IXTB 1AD0A 3HB3C 5L7XL 2P9RA 4GQPH 4NKIH 1CTMA 1N0XL 3SKMA 1OF0A 3T0XA 1S9VB 3UTTA 1HFUA 3OKEA 1A6WL 1YMME 1KN4L 1AYRA 3QDJD 3MBXH 4XBGA 3S36X 3SZ6A 1ODUA 3SEPA 4PJ9B 1BWMA 2M26A 4LRNL 3H3KA 4G8IA 1KIUB 2J55A 1E4WL 4RNRA 4XPGL 1G7JA 1INDH 4O2CB 1T89A 2EDLA 3L3JA 1KTRL 3LEVL 2NY2D 2DLTA 5C70A 1J11A 2Y07H 3RFZB 1HH9B 2XWDA 5F7EH 5I2IA 4TF4A 4MMXA 3QWOA 2O26U 5JQ6L 4DN4L 1BBJB 3EO1A 5AVZB 2ZAGA 5IW6A 4KK6D 3FTYA 1E67A 6TAAA 3K71A 5A16B 4G2AA 4TQHA 3N3EA 5E8DH 5BQDA 4K94L 2ZX6A 2DWSA 4GRWH 1SF5A 1EAOA 4FFWD 2B2XL 3KPRD 4KK8D 2NNFA 3AU0A 3FN3A 2J25A 3MGAA 4OV5A 1YQVL 3VFRA 3ZKMD 1QLFB 5I1AB 1UADC 5AB1A 2IAND 4HUCA 4L1DA 2YC1A 1F3DH 3DURB 1CQKA 1L9SA 1ZWIB 2Y22A 3GXIA 1HHHA 2CCWA 2A6DB 1E4XH 2WBJC 5I8EA 2QSCL 3FU6A 5D71H 3SCMB 3MNZA 4YK4C 2ZUYA 1ADWA 4PB0L 5EEYA 1ZD6A 3DPDA 5EA0L 2EDRA 4PSPA 5I8CA 3HG1B 5JW5B 1R3KB 3QC5X 3Q13A 3NEXA 4UIKL 3MRRA 3ZT7A 3OR6A 3DPBA 2NY6D 1MAML 3AREB 5L2KD 4RMWA 2PP7A 5D7KD 2NQ3A 4FNQA 4GBXC 4MXWH 5J1AA 5E00A 5F88A 2WZPA 3VRIB 3ZKMC 4LOUD 5IHUL 5CZKA 1I8LA 3JWNC 4HUWA 2BOBA 4L8SB 2FO1A 5H35B 4WWKB 4FFWC 4M4RA 1DVFA 3LZOA 3VCLB 1VRSA 4RX4A 1QP1A 1ZMYA 2FZ3A 4R0LA 2R0ZH 3QDMA 5DMYA 5IW1A 4H7VA 1MUJB 1AHWA 5LXGL 5C0CB 1EDQA 4IS6A 5A7BA 5HYJB 2P80D 4UDTB 3IN0A 2XA3A 3NZ8A 5MENB 3B3IB 3E80A 1J8HE 1E43A 3POHA 5DEFB 4BH7B 4XO5A 1F4YH 3K6DA 2QVTA 3U30B 2Z6FA 3BKCH 4UB0H 3D25A 4BE6A 8FABA 1GMEA 3ZDZB 1JG9A 5HHMB 5D5MF 5KYWB 3SGJC 1UTDA 4HGMA 4PWIA 2WQ8A 3H53A 4L9LC 5IY5B 3MRKA 2LU3A 4Y8AA 5DUPH 4OQTL 4G7YH 3L95A 3ZUNC 4XP4H 5E2VL 4KJQC 4CVXB 4PGCA 2XLLA 3SGDH 1XGYH 4NPKA 4I3GA 4PJ7F 1SF3A 3QJSB 3PDGA 3MV9B 5DEGA 1XCTB 4G7VL 3U1SH 4W9KC 4O5LH 5TE6H 2Z35A 3GBNH 3L7FB 4XWGH 3OAUL 4LLWA 3GBML 1XQ4A 3C2AL 3L2MA 5KJ7E 2NYKA 5C8JA 1IAMA 5ILTL 1QRNE 4QO1B 3PY9A 4FYSA 4GUQA 4TUKL 4OJAA 5E8PA 5J13C 3IU4H 2MEJB 3NJXA 5GS2H 1KTCA 2JKTM 3V0WL 2BJML 1FAKT 2H0FA 3I02B 1ECYA 4JHVA 3SCMC 1XSIA 2NNAA 2R29A 3G6AB 5DGQA 3V5KA 2XBDA 1TQBC 4UOW0 3CNKA 2AJSL 5JR1H 5SWSD 1CTNA 5L0QC 1E2VA 3F01A 4PJAB 3GI9H 5MP6H 3CH1B 1OD9A 3GBDA 1LDPH 1E2ZA 2VUKA 1R3HB 1INEH 2DRUA 2WP3O 4K9EC 2NW2B 4XP9H 2HMID 3UPRB 1CLCA 3LQZB 3S8GB 4PM1A 4TM9A 4G8FA 3KVPA 2F6AA 3B2UD 4DVBB 4ZS7L 1Q94B 1LP9E 1OAYH 3NSFA 1ZVHA 4CMHC 3CUPB 2N0MA 2EDDA 2DL9A 3WDJA 4AEHH 1UH4A 1XR8B 5D70H 2FVNA 2XY1A 2JIXD 5C0RL 3SKJH 3MRCB 3SKNB 5T33H 2UZIH 2DQEL 2QVMA 1PZ5B 3LS5L 4PI2A 1CBJA 1KCRL 3VG0L 2AS5M 1QQDA 4N8VB 1C7SA 3D3VB 3G7TA 3ATAA 3EUDA 3Q6GL 1YA5A 2MOGA 2CO7A 3RPIB 1MWAH 2DMKA 4YH6A 4MMXB 1F58L 2ERJC 5KBDA 1JK8A 4AC2A 3OMAB 2JV6A 1CXFA 2H45A 2X1WL 5F7WC 2EECA 4NRZA 1PSKH 1KJ2A 1TU2B 2F2HA 4LLQB 3FFDA 5D1ZC 3JXAA 3VI3A 4F2MA 5AB2A 4YDKL 3O6FD 1ZHBB 3EJRA 4OKVB 4GSQA 3CHOA 1I53A 5I5MA 1H3UA 5EUKA 5JOPE 3QUMA 1EAPA 3UX9B 1N0LB 5GS0C 2OYKA 5CLWA 2AQSA 3HN3A 4B7IA 1QNIA 4Z8FL 2WWMD 3MRIA 1SQ2N 2BVPA 3O8XD 2BHFA 5BOZG 4Y9GA 1UXSB 4N68A 2G3XA 1D7FA 4U31A 1E0OB 4OCRH 3ROLB 3C6SB 2VABB 1NOFA 3S3DB 2EADA 2FUQA 4E5XB 5IIEA 4HWEH 3MQIA 1XHHA 1J5HA 4Y1AB 5KVGL 4I0PC 4P2QD 4RRPG 1R47A 4GMSH 4LCIL 4TSCL 1C16B 1OAZL 3T2PA 2XN1A 3UYRL 1A2YB 4LOUC 4HZ1A 3IF1B 2PR4H 4N2CA 4UT6L 1OAXL 4FCHA 5AOKA 2CU9A 1MJ7H 3B2MA 4QRBA 3WE6A 1TVBA 4WW1B 5LQBH 1MNUL 2K7QA 3X1FA 3ZOAA 2CO1A 3U0PA 2LFEA 2AJYL 1YPZA 1QPXA 2GABA 4Y4FC 2FHCA 5FYLE 2ZIDA 5D7LB 5ABAA 5F9DC 4B95C 2YPKA 3NIFE 4B97A 3DURA 3JV6B 2HRPL 2F53A 1UXWB 2AABL 1Z9SA 2QVFB 4QXGL 1JNLH 1W8EA 5BZDB 4PJ9C 2AJ3B 5DQ9B 4OD2A 5E6ZA 3RPBA 1MI5A 4P2QA 1A8ZA 2DBLL 2K70A 5AKRA 1I8MB 4P23A 4M5TA 3OXSB 1GC1L 4XWGL 1KBGL 15C8L 4TSBL 1T7VA 5CU5A 4W9IC 3K80A 4AM0A 1SYSA 5ACZA 2HJKA 1RJYB 3M1BB 1CYWA 5KVEL 1G9HA 4EZJA 3WO4B 1SY6A 5DRNB 2WXGA 4ZUSB 4NKIL 5TJWK 1C5BH 5TDPB 2VABA 4G7YL 4XNQB 3Q8CA 3ZDWA 5I1LB 1E6OL 4JO8A 4NQCB 1V55B 1SLWA 4HP5A 2E4TA 2M83A 2OR9H 4X2UA 4CMMA 5CCJA 3EJZD 1CD1B 3AY4C 2A2QT 1OOWA 2D31A 3IT8D 3MMEB 1HQ4B 2VLRE 5DJCB 1QR4A 2FK9A 3OLIA 2BS9A 5IB4B 3O3DB 2OX5B 2CDEA 9CGTA 2VDMH 2WBJB 3JWNH 1TVBB 2W81C 3IMWA 4WW1A 2FB4L 4PJGB 2ZSWB 2ZUXA 3GKWL 1U8LB 3QORB 1AKJA 4OI8A 4ONHA 3GK8L 2OSXA 4F57L 4YDVA 1CFSB 2MPAL 1YEHH 4U1HA 1MZZA 5EO1A 1ETZA 5JYLA 1TNNA 5L8LB 1TXKA 3TV3H 2AEIT 5KJ4A 4N25A 2D3LA 3GSWA 4B9GA 3DUSB 5KYYA 1BAGA 3GMNB 2FJHB 5AB0A 2ZICA 2YPVA 1YJDL 3O4OB 1QHQA 3I3DA 3QUYD 4GS7C 4TTDD 3T2OA 5JW4R 1YEFL 4MDRA 4L4TD 4PTTB 5DC0A 3F58H 1MELA 5MEPA 2OMUA 3I9GL 3FQ1A 3O11A 2XETA 3EO0A 4HF5L 1B4JH 2P8LB 2G60L 4J3BA 1IE4A 2IPUK 3Q9QA 5LGKA 3ZRSA 3EBHA 1E27B 3AFLA 4RGND 3Q8EA 3FFCA 4OTXL 2IPTL 4IDJL 4IMLA 3TYFA 3VSTA 1CK0L 2VRAA 3QZWA 1IAOA 5LGHH 1A6TA 1NCUA 2J8UB 2YAMA 3FO1B 4ZUUB 1V10A 1R24B 3P9LA 4MNGB 4N87A 3BH8A 4OI9A 4PRPE 1A3ZA 4FQCH 3STLB 5BVPL 3LKQB 4MMXC 5I82A 4U1SB 1E5ZA 2AITA 1JD9A 4DPBX 3FN0H 3GUTB 1BQHG 2DWYA 1F2QA 2E27H 5EO0A 1QFOA 3IEAA 4OCWH 5D1QE 2DM7A 1I4FA 2ESVE 2Y1YA 4EI6B 2I07B 4Y4HD 3VI3B 3ZGHA 2HJLB 4A39A 4XB3A 2PWDA 3CFCH 2XPGB 3V52H 5EU5A 3GMQA 4G11A 1MFDL 1T0MB 3SPGA 2Z31A 3D0VB 4U1NB 5IK3B 1QSFA 3WBDA 3MJ9L 3UEZA 3OPZH 2X42A 3CUPA 3FT3A 3WFDH 1HYRC 1J8SA 2O6DA 2VDOH 2R2EA 2ZXDA 5D7HA 1D5ZA 5F9OH 3BFWA 3V6ZA 3HG0A 3KH3A 2LABA 4H5SA 4G9DB 1EZVX 5I0DA 4QWWC 4S2SB 4BGDA 2V5TA 5FO7B 4UT6H 4WJG3 1EUTA 2PPDA 1L0PA 3GS7A 1V3KA 3AS3A 3UDWC 3EO0B 3WI9A 5KYUA 3K8MA 2K4AA 4PRNB 2LGNA 1AGEB 3TBYB 1JGEB 1K5WA 5BRPA 4WWKC 1JK9A 3UBXG 5AKSA 3U2SB 2XZCH 1NQBA 4UF7C 5E2TH 4ZZKA 5KTEL 3OAWA 5DJXA 4UMGA 3PGCA 4KI5E 5DEFA 2A6DA 5I8EB 1F8TL 4PG2C 3HMXL 4C47A 5CUSL 4C4KT 4N2KA 5MENA 4RMBA 4Y7OC 1U3HB 2MHAA 1AHKA 5IQ7L 2IWEA 4B9IA 1SHWA 1TTRA 1QA9A 3VXTA 2HLAA 3VGGA 3LNHA 4ZFOL 3RTQC 3QNXB 1DYZA 3CG8A 3MRRB 3U9UB 3QQ3A 2EJ1A 5I1GL 1T83C 4PGBB 4EI6A 3T65B 3F7YA 1MI5D 3CLFH 1D7DA 4UTBH 3H0TB 5DVLA 2AQQA 2WTPA 2NY3B 4XH2A 1NJ9B 3V6OA 1SXCA 2L4OA 4N2FA 4GG8B 4ZMYA 5JOPD 3CN0A 4Z7OE 2BNUA 4FLRA 5K39A 3PNWA 3MV9A 5DEGB 5H35A 5CSZB 4PJXE 1D5IH 3C5ZB 1JBJA 2O61A 3BDBA 4X7EC 5DK2B 4E9TA 3A0OA 5F6IC 4PB9H 5DRNA 4ZUSA 4BQBA 1ONQA 1DQDH 1OT2A 2IH3B 3K7UA 3OJ2C 4HUXA 4NT6B 3SKJL 3MGTA 2X6UA 2QEJA 1NBZB 3SO3C 1I3VA 3WE1A 3PUUA 4GKLA 1DQQB 1S7QB 4DGVH 4B50A 3I6GB 1RK0B 3HKFA 4LCWB 4OCXH 1G9MC 3TO4A 2VRKA 3MNZB 1RUMH 4MX7A 4BSWB 2X2YA 3GXNA 2FLMA 1KACB 1X7SA 2WTOA 4G5AA 4HA1A 1FZMB 3CX5J 4DF9A 1HHHB 2AERT 2HJFB 3I84A 5JIHA 1XR9B 1K3IA 4XVUD 4G43A 5A2AA 3LVTA 3WJMB 2B20A 1AY1H 3EYVB 4PYGA 3DPBB 4K4KA 5I19L 4NQDE 2AK1H 2W38A 1L7IL 5FW8A 4URKA 3IRCA 4U3SA 2Z93A 2B4CH 4BYHA 3VSUA 3VTAA 3S5LG 1HDMA 1AXTH 5SWZA 4CMHB 4R96A 4GPVA 1Q0YL 1N12A 1TQCC 1TTGA 2R9HC 4LLVB 4Q4IA 5F9AC 3QYCA 2C9QA 1V7NL 1UD4A 4M1CC 4WEBL 5E23A 1K6QH 2HWZL 5EOCJ 3THMH 3O6FB 1GR7A 4OGZA 5CJOL 2EYSA 2FBRA 4UBDC 4KUCF 4JRYE 1MW2A 3BUBA 2BIPA 5HVHB 1PFOA 4CU6A 5DJ8B 3WE6B 3T8VA 1R17A 3ZKNC 4MMZC 3ECBA 4M62L 1NIEA 1KCUH 4XMWA 4HWNA 2W0PA 4P3CH 4YN3A 3MRLA 1KB3A 2QHRH 1NOAA 4WKXA 3HVNA 3W9DB 5ES4B 3BRGC 3QYMA 4HFWA 4JPWL 4NZFA 3KLHC 2ATKB 2X4QA 1I7UB 3BZFA 1KGXA 1EEUA 4Y4KC 1OL0A 2KHAA 3M8OL 4JJ5B 2P45B 5DVPA 3HS0A 4YHML 3SDYL 1ZVYA 1QNZL 3TO4B 3DHPA 1AXIB 5I1JH 3LEXB 4R7NA 2EEBA 5L9DH 1HCVA 4KJQD 2AQTA 2Y7OA 4N0FA 2F9BT 2X1QA 4A7GF 3DRTA 3B34A 4YL9A 4J3OD 3OPZL 1NM4A 4HCRA 1F4WL 2BXYA 5F1IB 1YEEL 1K72A 4XNMA 1KCLA 3LYRA 3MLVL 3PIQB 5I1DB 4YPGA 5DRXA 3MI6A 3ELQA 1B4LA 4M9PA 1OAKH 2A99A 2VLRD 5B38B 1EBPA 2W88A 4X80L 1UFUA 3EFFB 3VI4E 2XWJB 4GS7B 2BIIA 2X0VA 4PRHE 3APDA 3DKHA 2V2WB 3MYJB 5C6PB 3B2VL 4FFZL 2I9TA 4YIQB 1PY9A 1X4YA 2KC0A 4KNUA 4CC4A 3U2SA 1A7BA 1U8PA 1UJ3B 3KPSD 4NO0D 5D1QC 4BFJA 4R7DA 3D51A 2CPCA 4YC2C 2NCMA 3WIAA 1G7HB 3RZCC 4JFEA 4HIXL 3RWGA 2B3RA 3U9PH 3TEYA 1IC7L 4HIJB 4O51B 5F7LB 1D2OA 3DV6A 2D0FA 1BZ7B 4ETYA 1F3JB 1WRFA 4MNGE 4HXBL 4AQ1B 3H6AA 1JWMB 5D1XC 3V6ZB 1CDYA 3B9KC 4NO2A 4OLWH 3WN5B 4X7TA 4ELMA 3C5SA 4OFYD 1T7YA 4HWBA 2IIJA 1CIUA 3V4LA 2EICA 4W9GC 4BK5A 4MTMA 4Z5RB 5I73B 2E9JA 2F18A 3BUQA 3IDMA 4Z6AT 2YGQA 3RU8H 5J6GA 5D7JA 4LHQB 2J2ZB 3QFDB 2WLHA 3DIDA 5HYSB 5HDQL 2E7LC 1A7PL 5DLMH 4UTBA 4OT1H 5E6IA 1MHEB 1CBVL 1OY3B 1RCYA 3CFDA 2OMWA 2A9CA 4PLNC 1KUMA 3C8KB 1S9YB 1IKOP 1YPZF 3QFJA 2Q10A 4RFNC 5DA0B 2B0SL 2XWTA 1K8IB 3NH7L 2O6FA 1ZTXE 4RIRA 1JHTB 4XC1L 3ROOA 3G6JF 3L1OH 2WQAA 1FAIH 3LZFH 2QQQA 2N59A 2X6CA 1H8SA 3FUFA 1WEJL 1OCWL 1CVRA 2R1XB 5B39A 2W59A 4EIZC 3HNSH 1O7SA 2R9HD 1NGXA 1UGKA 1WE5A 5BJTB 1JTPA 2IANA 2VAAB 5HYJE 3W0WB 4HJUA 4QRTB 4WVRA 4GQRA 3MBWA 4EN2A 4F9PC 2Q8BH 2ZF9A 3QWRD 4QDGA 3SY6A 1SMOA 3QIWA 5ACLA 1BJ8A 2ED8A 2G4GA 3O2VH 4JVUA 4I9XA 4W9DC 4YSRA 1PW3A 1AY1L 5F7MC 2GHWB 1WZ1L 2QPEB 3B9EA 1MCOH 1JV2B 4GW4A 3RJQB 1DQMH 4P4KC 3BKMH 4FP8L 4A2MA 1N64L 2JMRA 2WO4A 4MRCA 4PV9B 1I8LC 2ITFA 4X6BA 1NMAL 4TQ8A 3OB0K 4I89A 4PRBA 4MBRA 5AKVA 3CLWA 4Y2DD 3WHXB 5IHBA 1AZBA 4EMZA 5KG9B 1JGLL 3GSWB 5SX5K 3ARPA 3S97C 5ESVA 5IVXB 1Q0EA 4WI8A 3BKJH 4WFGE 3MHZA 1QSFB 3TA3D 2F54B 5L88H 1HEZB 4TSAH 2DJSA 3GMQB 2RFXA 3AS1A 2HT2D 1DBKH 2FYYA 3PQYB 4P9HL 2VM4A 1ECZA 1BFOA 2R2HA 4APXB 2CUAA 4LSVH 2CUMA 2VMDA 1D5BA 1MCIA 1RJZA 4NOFA 2NR6C 4Y19B 4CUCA 1G9NL 2HB0A 1AIFB 4BGLA 4LHUB 2Z31C 1VSCA 3OGCA 4F8PA 3FRPA 3GJFH 3AG3B 1NGQH 5A2LH 1EZSA 1YO4A 3MLUH 2UZPA 3FB5A 1T04A 4XBPA 3CDGA 3LAFA 1W72A 3PAYA 3QHTC 1TKWB 2C9AA 3MRHA 3TT3L 2HKHH 4PJGE 4H1LB 2ZXWB 5LBSL 5T3XD 1SDYA 4YHZL 1T1WA 2XN9E 4NI3A 1D5MA 2MSPA 4U0RB 4ONOA 5T5NF 2F5BH 2WBJA 1H3PH 1XGRB 1YNLH 3P30H 3VWKC 1CG9A 3VFMA 5GHWH 3K71B 4N90E 3L1EA 2I9LA 3DSFL 2YPVH 4C83A 1IGTB 3S8FB 2VISA 4XAKD 4ZX3A 3WIHA 1LMIA 3QZBA 2CBOA 1QFUL 1LE5A 4S11A 4L29A 1I8MA 5DD6B 1JGUL 1J5CA 1JZHA 5CP7A 1G6RB 2JKRM 2BSCA 2FGZA 5AZUA 3HNSL 2OCCB 2JKLA 4W81A 3CFCL 3HS8A 3QXWA 1NC4D 5GGVL 3MRMA 4JQVC 5AOJA 4N0UB 1JPSL 3QI9C 4PG9A 3BAEL 5EFIA 4ZPVB 5DRWA 4OZGA 3S9DB 2W07B 3E1F1 2JELH 1NUGA 4PIRF 2BDNH 4ZW6A 2UXFA 3PF2A 5D7JD 1YYCA 1XD1A 2FUTA 3K6FA 2XYBA 1OP3K 4ZJ9A 1JDDA 4XP9L 1BFVH 4G1MA 4M7KL 1F00I 1P84J 1RP8A 3ARYA 4AEEA 5I1DA 4AJWA 5C09E 5IM7A 4Q9RH 5AYUH 4JCMA 1FN4A 4PJ8B 3FTXA 3CC5A 1CT8B 4ZMPA 3DROA 3FSOA 2OS7A 3UMTA 5F6IB 3ULUC 2Y7QA 2EINB 2DS4A 3V4VB 3BXNA 4IK6A 3TX4A 1ZHBA 1MVYA 3Q1SH 2JSFA 3VMNA 3KXFA 1FFPB 3T0BA 2A9DA 4JANA 5L2KB 4CVZB 4Y9EA 1FRGL 4K71C 5MERA 4NRXB 4NWUL 2W92A 4LSUH 1BF2A 1AD9A 2WZ5A 3CZUB 4KX7A 3OL2A 5IESH 3QI9A 3DGGB 2P8PA 3RDTD 4FS0A 1XCWA 3WJMA 4TVPE 1NM9A 1ZV5A 1VHPA 1DL7L 2EDEA 3POCA 3PAZA 2A83A 5IIEB 5IHZA 3FK3A 4YHOL 4GO8A 2XFXB 3W39B 1J12A 1QRNA 1Z9NA 5L8JB 2AAAA 1ET8A 3QNZB 2I27N 3CWGA 1MN4A 4GIOA 4ETQB 4V33A 1KJVB 3U9PL 4GAAA 5EU6E 4X9BA 3WLBA 1PJWA 2P5EA 2HPTA 2WXJA 5FF6B 1HH6B 1TYEB 5AVXB 4A7TA 2YAOA 4DZBB 3ZBMA 4LSSL 4YXHL 5KWYC 4RAUA 5I1HH 4PHZA 3QEHB 4N20A 5A2KH 5C09B 2IH8A 2A38A 1FFRA 1UCBL 1TQCB 2BSSB 3WG7B 2ZPKL 3HG3A 1OLLA 4NAQA 1FBIL 2DQDH 2VE6A 4ODWA 3QCVH 1XZ0B 3W0WD 2WW8A 2ICEA 1FIGL 3ARWA 1NBVH 2GJ6E 1KB9K 4GOSA 4HKBB 2AEQL 5JDSB 4OI7A 2WKOA 4KX8A 2X4PB 1PEWA 1SEQL 3B56A 3DC0A 5DJYB 4UOZA 3Q06A 3T8XA 5FK9A 2P7TB 1XAUA 1Y1UA 2GJJA 5CZXC 5HHOE 4OD3H 1DBJL 3Q5TA 2BX5A 1FGVH 1HHJA 1MIEL 3DGCR 1OPGL 2GJ6B 4KTDL 2EDJA 3LPWA 2J6EA 3N9GH 4MCZA 4OQTA 4K5OA 4KPHL 3WMQA 4DWHA 1LEGB 3AS2A 4DP0X 4GQZA 1HHIB 4BELD 4QT5A 3ARSA 4OZHF 5DZJA 1ZANL 2IH9A 2VLMD 1EANA 3GNMH 3LMJH 4HKZA 4CADB 1KB9J 2EVIA 1A66A 4G6JL 1NCGA 5BZWB 3EDDA 5ABZA 1XGZA 1CU4L 3NJIA 3WS3B 3IDXH 1TQTA 3MFFB 4G8FB 5JPMC 4TV3A 2FDBP 4UWQB 3H54A 3NZHH 2WLYA 5FO8A 5MHSE 1BFOB 4NM4L 3AT0A 3MBWB 4EN3C 5AAMC 1J1PL 1UZGA 1EHAA 2CK2A 3MRPB 4Y4FD 2VAAA 1DFBH 4X50A 5G5DA 3C5ZA 3X1NA 1TZ8A 1EGJL 4N5UA 4RBPH 2PCPB 1TUPA 4XNZB 3MV7E 2H0PA 4N2IA 4KMQA 3MUUA 1BZ8A 3NN8A 4NUJB 4PGZA 4Z7WA 4WO4A 1S78D 1IM9D 3BQVA 4ALAC 4CL7A 3QIUD 5DWUL 5SX5H 4P0DA 1TVHB 2WOBA 3EGXB 1FG2B 4P2YA 4PMEA 2YAPA 2ZXAA 1YZZA 2OXGB 1T1WB 4OZFH 5DF0A 3FB6B 4K94H 4X6BB 3W38A 1RU9L 1OTTD 1E9QB 3U6XA 5CKGA 3TASA 3QJFA 4G9FB 2ZE0A 3HRZB 4P57A 2ZOLB 5E6RB 2MNUA 5CMAA 5ESVB 5IVXA 1CE6A 3DX7B 1S8DA 4V1DA 2GAZA 1BQRA 1W0YT 4ACPA 4G3YH 1BEXA 4LRIA 3FH7A 4LRNH 2ERJB 3O6KH 2NXZC 2J3SA 1EDYA 1N6VA 3VFPB 2IEPA 4RFOL 2HTLD 3C5SB 4OZIE 9PCYA 1U91B 4JDVB 4OFKA 3K3QA 2XV6B 5I8OL 4GH7B 2H41A 3B9KB 2YQ3A 1VIWA 4B6ZA 3Q01A 1ZHNB 4AMXA 4UBDD 1YAIA 4DETA 3OJDB 4P5SA 3UOAB 2WCSA 1SDDA 4GMTL 3QO1B 4X6CF 3X3GH 2EE6A 2ESVB 3IFOB 1KLGB 4HCIA 3QQNA 2EIJB 1YMMA 5DJZA 5ADPH 1HZKA 4PHXA 1AQ8A 3VFSB 3T2QA 1IX2A 1MHEA 1MUJA 4K23L 1DBKL 1JV2A 4R6UA 1MFEH 4L0YA 4JB9L 1OOAA 1NC2B 4FYQA 2AQRA 4QMEA 1UT9A 4JPIA 5LWYH 4LVHC 3HR5A 4FQIL 4HPYL 2EKJA 4I0PB 1DJWA 6FABL 3OB0H 1Z9LA 2E0PA 1JDAA 4JQIA 3IMVA 3MNWA 4IHOB 4MA8L 1ROWA 1ZIAA 2NX5E 1FBIH 2DQDL 1ZV2A 3L3GA 1MH5B 4ZMLA 2YAFA 4JFEE 1T5XA 4M1GH 3F12B 3X1GA 2OJEA 3ATDA 2FWOA 1R75A 2AK4A 3EGSB 1KIUA 2XFXA 3K5SA 3EH5B 1LWRA 2YSSB 2UZIL 3LS5H 4JRXB 1P69B 4KZCA 2B9AA 3IDMB 3HPJB 5GQBA 4GYBA 1FZOB 2F8OA 1ACYH 1W80A 5ILTH 4ZS6C 1IM9A 4M8RA 4QOKD 4FZEL 1MCSA 1XT5A 3DNKA 4IKKA 5BRQA 4KK5C 3VE0A 4U1MB 3V7AE 4ORZC 3TN0D 4Z0XA 3EFFA 2BOBB 1HYSD 2Z92A 2Y36H 2FEEI 1F4XH 4JANB 5L2KA 2E6QA 4X0KA 4YVUA 5J5EA 1IUZA 1XH0A 2DQFB 4NC1E 1XGTA 4FABH 5LBGA 1UWFA 2X4QB 1CFVL 4FI8A 1Z9PA 1G1CA 3BGAA 1REIA 4XPHL 1O5PA 2BJMH 2PWGA 3DMMB 1GTFA 3ZDYB 4LIQE 4RGMC 3QI9B 1AKJB 2AJXH 1DJXA 2FJFA 2I5YL 3UTTD 1UD5A 3HG2A 4GBXA 1SJVA 3KLAB 3AC0A 1HCFX 2HRLA 4RGOH 1E5AA 1YCSA 2RJMA 2V0AA 3QUYA 2NTFA 5D2LF 3GBNL 5AYUL 1YUHB 5EULV 4JFZH 1SMDA 4BZ2H 2L0DA 1COBA 3MRMB 5A7EA 2QKIA 4U3CA 1G6VK 1HXYA 1LP9B 4K5PA 5IROA 4GP5B 4UQ2B 2IH1B 3IJHA 3VACA 4P46A 4Z3IA 2FO4B 1F45A 5JPNA 1M7DB 1MJUH 1IEBA 3GLEA 1MCJA 1TJXA 1OP4A 2Q7AA 1HYSC 3VU2A 1RI8A 3K6OA 4O4YL 4ZZFA 1GPOH 5ECGA 1J86A 4KVCL 5ANHA 5KBMA 2VDQH 3W2DH 1XF1A 1CU4H 2WWNA 2XXFA 3SD2A 5I0YA 3APNA 4UV7H 3BAJA 3EG9B 4UOW1 1JGUH 1NKOA 1M2VA 2CBQA 2CA4A 4Q58C 4YHPA 5FM8A 3WGUB 3WEMA 1PAZA 3QR0A 2VW4A 3T0WA 4KXDA 3O3EB 2IJ0C 1QUPA 4X0KB 5E1QA 4XCNA 3TIEA 5I16A 1KCKA 4Q2ZA 3NCJH 4ISVA 3VWKA 3JV6A 2EKSA 4X5WA 4NUGL 2YMTA 3GJEA 3EYUL 3GLDA 3KPOB 4X4ZA 3SKMB 5CILH 2LU4A 4HIEB 3N85L 1ZA3A 2GJ6D 3DMMA 3K4AA 1BXUA 3N6YA 2P8PB 5ISZA 5C0AB 4ZO6A 1MXDA 3VXOA 1AIFA 3SB3A 2WV3A 3GZPA 2FJSA 4OFQA 4C4KO 2NTSP 3P3TA 3OV6A 3KWWA 1KPRB 4HLZG 3IAGC 3L3JB 4UANA 2EXYC 2H2PD 1EEYA 4D9RE 3VWJC 3PWVA 1N8OE 1U58A 2Y1VA 1SOKA 2WJ5A 3WJLA 3SSGA 4KKRA 1FWXA 2HLFC 4KVPA 4AYEC 2D73A 4FKKA 4WDIA 2I7OA 3JSSA 3NRPA 2X4UB 4U6XB 3HC0A 4OLEA 3STZB 5MHSD 1S7SA 1UKTA 4JFUA 4LKXB 4NPJA 3FQWA 3I6LE 3B9KD 1S46A 4N9GB 3V6OE 4FGMA 4RGMB 2C7FA 2M1KA 3GRGA 3D33A 5HHXL 5GSVB 3WHE0 2X09A 3HZ3A 2NNAB 2VXVL 4HXAL 3ZDZF 1A7NH 3JV5A 1EZUA 3DX8A 4HT1H 4KV5F 5E24E 3RWIA 4FQPA 2IDFA 3VO0A 3RVTD 3HC2A 3N41B 1NC4A 4LDCA 1JYWA 1I9JL 1JVOA 1S5HA 3OKMA 3RQ3A 5AENA 3TBSA 3SD5A 3UAAA 2ZP9A 2FECI 3QNYA 5FKAB 3CXFA 2QADC 4HS8L 1GC1H 1CLYH 5D6DC 3ALPA 5D2NA 4HLEA 1HZHH 2GK2A 3GSXB 4NQVA 3UAJD 5I0WA 3G5ZB 1YC8A 4FNLL 1JNLL 4LEBA 3HE7C 3A21A 1DE4B 3THML 3ZKND 4KKBD 2DI7A 3CSYA 4UT7L 4Z7QB 4LQFH 1RU9H 1F90H 2O72A 4MA7L 5GJTL 2PO6C 1X5GA 3BIKA 2RMNA 4F7KA 3AJ7A 1T0OA 2YUZA 4NQDA 3GTNA 3N1FC 3PABB 4FQXD 3V7MA 2D9QB 5ANMB 5CLTA 3KW8A 1Q0XL 4NXKA 3R8BB 1KC5L 5AOMA 2ICWI 5AOLA 3QFJE 4XVJL 3Q8BA 2VWEC 3AGVA 3PL6C 3JTSB 3V0HA 4DSYA 1ZVSB 1H3PL 1YNLL 3LRMA 3RFZC 3GMPA 5F7UA 5AAPA 4JRLA 1OAZH 4Y5VA 8FABB 4Q74A 1A02N 1QLEL 1WYJA 1KENL 4Y9BA 2MCPL 4ANVA 4ZYKA 1M1XA 1V7ML 2AJZB 2PPAA 2Q3AA 3BSHA 4IGBC 4KKBC 4F8QA 2P28B 4JL1A 2VTFA 5DUMH 5EU5B 1J1OH 4HHAA 5KVFE 5B7MA 4LK4A 3WTUA 3CFEB 4WWPA 3SO3B 2R2EB 3ARFD 1WHOA 1LE9A 5ICXB 1ZPUA 1Z3GH 2MQGA 3OZKA 5TGBA 4AMKH 4PJHA 1RULL 1CPUA 1W0WA 2VZUA 4JM4L 4B53A 3L3HB 2G9KA 5A40E 4MNGA 3RGHA 2FTAA 4A63A 5I23A 1JWSA 3CHRA 3FU5A 2ISDA 5FOJA 1A6TB 4OH2A 2C1OB 4XNUH 4Z78A 4YUEL 4LLAA 4FJ6A 2J88L 4YFEA 4XNXL 5H37H 2AXGA 5HGBA 1KFAL 5KSVB 1KTBA 1TF4A 2KZ1B 3TBYA 4HV8B 4AIOA 3PDOB 2CGRH 1HXKA 2DD8L 3DX6B 5T3XH 1KELH 3HMWH 1WPCA 5E1AA 4DKEH 3BCDA 3Q6GH 2UWEF 4WW2C 4OLVL 1WS8A 4TXVB 4OB5L 1M9SA 2HN7B 2RALA 4LPTA 1IGYB 4J8RB 2QL1A 2XKNB 4G7RB 4OQ1A 5IHZB 2AKRB 5I66B 2KLSA 3AQZA 3NEOA 2FAUA 2NLJA 3MODH 1WUNT 4I8DA 1RZPA 1RKRA 2D4DA 4V2CB 1E8WA 3WV0A 3O11B 4HU2A 4JHWH 5B7EA 3F3HA 1UB5A 2Q6WB 2EABA 2P5EB 4Z7OB 3AMLA 5A6MA 4NM8H 2Y6SD 3EHBC 3WNLA 3G04A 4FFVD 1IC4H 1I3RB 3QHZH 4LAQH 3LZFL 4AK2A 2BY2A 1YECH 2BVOB 2ITDB 2P5EE 3RGVD 1AHMA 2QHLA 4PI0A 1BVKA 1FFNB 3I9PA 3N43F 3MV8E 4L4JA 3HAEA 4FNLH 1AD9B 2ZSWA 2XWBB 4HCFA 1IIIA 1U4EA 4TPRH 3F83A 4FHKA 1UOKA 1VAHA 4HAFA 4RX4D 3RI5F 3HC0B 3STZA 5BZDA 1F90L 5C0BB 2ATPA 4JO4H 5EUOB 4YJZL 3ARGA 4IRSC 4NKMA 4YS4A 4ERSH 1IFHL 2FECL 3BH4A 4QR7A 4PJDB 1MRFL 5F21B 4U1HB 3EOYG 2G2NA 4AM0B 5MEQB 3IDNB 5FYJL 1P7BA 2QR0B 3QG6A 1MRCH 3MYZA 2X4SA 4Z3JA 4N0RA 2GY7B 1JFHA 4JCLA 4W4OC 1P4BH 4GBXB 1FCCA 3HA0A 3B1TA 4D2NA 1AR1D 1JDCA 1KXTB 3A4AA 2X89A 2XN9B 5AW7B 2VN4A 1KCVL 5FGCE 3IVKB 3ZL4L 1C16A 4OZIA 5F96H 4LNRA 1IB5A 2XG4B 5I5RA 1JMZA 1MCEA 4N2AA 1O6TA 3IJEA 3LN4B 2FRGP 1XGUB 3EYFB 3ZDXF 4U3HA 1LMKA 2H9GA 2WZ0A 4LKXA 1A6VL 4BZ2A 4LSRL 1LVEA 3FS9A 5DDHA 2GK0B 5BOJA 3B2PA 3QAZC 3RA7L 3VB9A 4U33A 3TNNB 3FCUB 5FO9B 1DQQA 4U1LB 2VLKD 1NLDH 3T0VA 3WFEL 3ARBB 2X88A 3JZ7A 1EAPB 3MFGB 4M8UA 4U6HA 4JW3A 3WIHL 1ZHKB 3ULUD 4O02A 1DSFH 1U95A 5C9JA 5HHXH 5E99L 4OD2B 4HXBH 3MA9H 1XV8A 5TTRA 4A7VA 4ZQTA 5CEXA 4J28A 3GTTA 5B39G 3ZIMA 3O3EA 3OR7A 4LVEA 2YN5A 4A2HA 4JFPB 4XPTH 4ZMZA 5CD5C 4KWUA 1BHGA 1UG9A 2EXSA 4I7ZC 3MRDA 5IFJA 3HE6C 4JFXA 2W0KA 4LLVA 3NG5A 2JI3A 2MOQA 5KANG 1M6UA 4ZUTB 4OJDH 3LKSB 2EVFA 5A6LA 1OAKL 3DVNA 4PJBE 2IH1A 3IJHB 4OLUL 4XNDA 1IFRA 5CSZA 4HJGB 1HJCA 1GH7A 1B9ZA 4PJHB 2GJRA 4R90H 5DJZB 5I6NA 5ESAB 1UZ8A 1HINL 2IFFL 5I30H 2OXHB 1FO0H 5FW7A 4PRHB 3C87A 1WP6A 2FT8A 4AGQA 2ID5A 5JPNC 1M71A 4M00A 4KNTA 5IMOB 2C3XA 2J72A 2VLJA 5CBAB 4JPIB 3BGMB 3MLWH 4HCGA 4IOFC 3NA9L 3D4ZA 3UTZA 1AG6A 1QLRA 3DXAE 5E5RB 4BEIA 4HDIA 4QTIH 1U8CB 2UZXB 4ABQA 1J9CT 2NYZA 4L23A 4JG5A 4AZ8A 3QCTL 2FGWL 1J8HB 5LAXA 4GKZA 4JFYB 3S37X 4A1RA 4BXVA 5A3ID 3SDDD 1N5YH 5FYKD 3ZPDA 1K6QL 2HWZH 2VXQL 3P2DA 1CFQB 4HALA 1J5DA 2NSQA 4NWTL 1UWGH 1O9VA 2EYRA 2B1AH 3OJVC 1QLEB 3VFTB 2XWZA 4XCYB 3ASNB 2WQVA 2QQLL 3FB8A 4K9EH 4Q0XL 4WEBH 3DX2A 3VMOA 3GFUA 1J7VR 3MGTB 1IGMH 3V6OC 1IAKA 2NQCA 2XA8H 5F93C 5KSAA 3A6CH 4QRPA 1Y6MR 3T0EE 3G5ZA 5IKCB 2H4EA 3EYOA 1OIOA 1A9VA 4X6DA 5EZLB 3JUYA 1FNSH 2P44B 2XTLA 3RJOA 4MAUH 5EU7E 3ZE2B 4G6AD 5CZVL 4OCRL 4MHHI 3RNQA 3REWB 2IGTA 1V3LA 3SDDC 4HC1L 1WGVA 2R1YB 1FP5A 1TSHA 3FF7A 1GS7A 1MCWW 5JOFA 4XX1E 3TONA 2EIBA 1E4HA 1ZE3C 2CLZB 2A1WH 2YEQA 3PWPD 5J12C 4AI7A 1RZGB 4JFWA 4L9DA 5ENWA 5ETUB 4J3OC 3QQXA 4KBPA 2GEQA 4M93B 4XHJC 4XCCL 1M42A 3KPSE 4J4PD 5A1AA 4MWFB 5IBTH 1T5KA 4YPJA 3WS3A 4FADA 1ZKAA 3WLWC 4BM7A 2HG5B 4JGMA 1KDJA 2APTA 1BLNB 1L7TL 2UX7A 2Z4QB 5CHNB 4OZFA 4M7ZB 4R2GD 3D25B 3M88A 3R7QA 2Z4TA 5DO8A 5IEKA 5J13B 1ZGLB 5G5DB 2XWCA 3WTSA 1T2JA 2J20A 4AQ1A 3BVVA 4JBSA 5HDOA 4M6OH 4H44C 5I6XB 4H8QA 4X5RA 2ZWNA 4YZFF 5KYNA 1DO6A 5EZJA 4ES9A 3F5WA 3N41F 1ZLWK 5C92A 3C12A 4DKEL 5AAWC 5GRJL 3QDMD 3V4PH 5BZZA 1BQ5A 4JRFA 1DVZA 4TVSa 4NQXB 3BUDA 4WGWB 1IEHA 3PL6A 5JW4N 3FC8A 2Q2LA 3ZE2E 4APQA 4I1RA 4P9HC 1LO3L 3D3VD 5AAMA 4F92B 3RZCD 3QIWB 4LLUA 4Y4KA 4OSUL 4QRPB 3B8SA 1GAFL 1I4FB 2ARJB 5E9AA 3V4PB 4LPXA 2CDFA 4ODUA 1ZTXL 3SYQA 1PLGH 1J0HA 2V8LA 2M2DA 1U8IA 3BHBA 1QPPA 3MYJA 2I9TB 1TZIB 4JDZA 2OMWB 4WI7A 2V9TA 3KPOA 2DI9A 4WHDA 3RIKA 4LEXL 4FX5A 2BP5M 2XQYK 4G8EA 4R2GC 4CA4A 4W9LC 1MW3A 5HBBA 1OLZA 1E5YA 4A55A 3TS8A 1KGCE 3SGDI 2IAMA 4J3VA 5EF0A 2C4FT 3PP3H 4NQVB 3IU4L 1JPST 1P7QD 3EJCA 4RWYH 4ZFOB 4AT6A 3AADB 3L3OB 3CFIC 3FUEA 1CGYA 3ZT6A 2ICEC 4PRIE 4U7MA 1LK2B 1SVBA 2YJLA 2LVEA 1JPGA 1VEMA 4FI6A 2WJ7A 4BHUI 1EJ8A 3TOPA 4KO6A 1QOKA 2FT7A 1NCCH 2J1XA 4PPTA 1TYJA 2Y06L 3OC5A 3H1ZA 1UWGL 2CDGB 4GO9A 4KRNA 2VMEA 3T1FA 5A16A 4PW9A 4JFQB 4H25A 5TD4A 3JVGA 1F18A 1QLFA 3ARBA 4BBWA 3PP4L 2JJWA 2VAJA 1MNNA 2VN7A 2ZKHH 1JV5B 4XOAA 5E9DB 3RGBA 3VXRA 5ID1A 1FL5A 1NIFA 5E4EC 3MZGB 3SE4A 3H42L 1UFGA 2A9NH 3QO0B 1S7TA 5T3ZL 3ORJA 3QCTH 3QJZA 3CXDL 4Q6KA 2XG5A 2CLVB 1UWXH 1NC4B 3X1BA 3WKNA 3CPLB 3EOTH 5D5MA 4NSKA 3VYNA 3OVUB 2CD0A 3RWIB 2ZUUA 3OKDB 4OFPA 1WZMA 3P4MB 3RWGB 2YK1H 1HT6A 3IGKA 4NQEE 3V0IA 3TBTA 4AZ8B 3AREA 4LLYA 2PPFA 4WK4B 2HVBA 3QDHA 1DFBL 4R96B 4HX1B 2X6MA 2CO3A 4OCSH 1FFOB 4FMFA 2A6KA 3CU1A 3TT3H 4IBUA 3HPLA 3QXAB 5DT1L 1PZDA 1UM4H 2YA0A 3ZY7A 4F5CA 3TYGH 3MLRL 5LGJB 2HX9A 3BPCB 4P2CG 5TFSL 1NBZA 5E6IC 5EIIA 4A38A 1BVKB 1FFNA 1I3GH 3QFGA 1AQDB 4HIIA 4HJGA 3VFRB 2QPSA 1QSED 1CFMA 4IIZA 5HJ3A 5LGHL 2ZUTA 3LRSB 2BK8A 4M5SA 1NBVL 4LSSH 4YXHH 3EOAB 2V5MA 2QZ5A 2XWBA 4UCFA 2ETWA 4HUUB 4NOBA 1E30A 3KDPB 1P7QA 3F64A 5DA4A 5D9SB 2A9MH 4IRJB 4S1DD 1E50A 4DP1X 1B0RA 4LRIC 1KBPA 4U1LA 2HFFB 3IXTA 4AV0A 1QG3A 1YEFH 3DTXA 1OALA 4PCTA 1D5IL 1LK3H 2E86A 1F5WA 1TQBB 5E03A 4Z7VA 4UQAA 4P23D 4I13B 1D5XA 4YR6A 3O81A 3QWQB 4QYAA 3WJJC 5I1KL 3NCEB 5T1LD 1GGYA 5IESL 1U8OA 4OY9A 3LRLA 5JIPA 4XBGB 4PG9B 4HMEA 3FB5B 2CO6A 4JHBA 4DVBA 2BY3A 5FPIA 3HUJA 3JQOB 1KLUB 3MNMA 5EG6C 1CGVA 3J27A 2YPLB 3PHOA 4NBZB 2LQRA 4ELME 4G8AC 1MFEL 1FNHA 4PJEE 1VCAA 2ROYA 2UY6A 3LDBB 1FVDB 4AEHL 4G1MB 1X5KA 4DH2A 2CKBB 4BKTC 1XGUA 3EYFA 4BCZA 3MV01 4QXTA 3WNIA 1MWOA 1L7TH 3PJSB 1PX4A 12E8L 1IGML 2AEPH 3IK2A 3Q48A 4DN3H 2DYPB 4HU8A 1NFDE 4QGYA 5E1GA 3MUY1 4Y8DC 3UZQB 3FN9A 3D7PA 3ZDXE 4Z77A 1KIPB 4B0MM 3TIDA 4ADIA 4HISA 1ZXKA 4NO5B 2ARJA 3SPCA 3DIFA 4HPHA 2GIXA 1Z66A 3HUJE 3DVGA 1XMEB 3BYYA 1VERA 5B39B 1T2QL 5CHNA 2RA1A 3IMBA 4QHNA 3BP6A 1GOHA 3H9YA 1OAXH 4RETB 5CWSB 3UPCA 4UDUB 5KVDE 3ZTJG 4OT1L 2EC8A 2NLJB 1IT9H 4KKLD 3SDDB 5FUCE 4Y19A 5EB9A 3BAEH 4MJ6B 3K8LA 4XVOA 1SXSA 2J1KA 2YAEA 4DCQA 1JD7A 5LQBL 1QABA 2VITA 5J56B 4GUCA 5F7DB 1MFDH 1SEBA 3S98A 1HXMB 3CU7A 4KGJA 4HJIA 4PGDA 1T5XB 3EJSA 2QQNH 2Q86A 3H4FA 3T3MB 1M9WA 1NCIA 1HSAB 1AO7A 1PG7H 2IFFH 4QY8A 1S7UB 1EJOL 4TS6A 1FZJB 2K3HA 4R90L 5F1OB 3ZE0E 3OC8A 5GGRB 3SDXA 1MCHA 4KJPD 4EIGB 1NLBL 2ITDA 2XX1A 1N70A 2HT4C 5HYSA 2OZNA 3QZOA 4MA3A 4Y5YB 1FA4A 3PCYA 5CP3H 2VERA 4NC0B 3F84A 4QTIL 2HN7A 4IRSD 1WCQA 1GCFA 3NA9H 3PQYE 2RD0A 5D4QA 3C8KA 5IB5A 3OKLB 3VQ2C 4DP6X 3CFDB 3REWA 4AG4H 2PN5A 5IVZB 3ATBA 4S1QL 3G6JA 5EA0H 5JOEA 5EBGA 1D5BB 3BSZL 5IEHA 3ESVF 4GJTB 4NCC1 3S5ZA 4MQ7A 4M43L 1B2WL 3KDMB 2WBKA 4PP1D 1JUFA 3LKNA 1MHPL 1BLNA 1FGVL 3QCVL 2EZ0C 4BFFA 3DHUA 3P2BA 5HPMB 4HHGA 4N0YH 2B39A 5LB1A 4WWKA 3RY5A 3ZJAA 3OHXA 1XF4A 2VE6B 3OTTA 1ZTXH 5DFTA 5BNXD 4Z76A 3MLSH 4BDVB 3NK3A 4WTZA 4G9DA