3V9CA

Type-2 cu-depleted fungus laccase from trametes hirsuta at low dose of ionization radiation
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
499
structure length
499
Chain Sequence
AVGPVADLTITDAAVSPDGFSRQAVVVNGVTPGPLVAGNIGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQHGTNWADGPAFINQCPISPGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASRYDVDNDDTVITLADWYHTAAKLGPRFPGGADATLINGKGRAPSDSVAELSVIKVTKGKRYRFRLVSLSCNPNHTFSIDGHNLTIIEVDSVNSQPLEVDSIQIFAAQRYSFVLDANQAVDNYWIRANPNFGNVGFDGGINSAILRYDGAPAVEPTTNQTTSVKPLNEVDLHPLVSTPVPGSPSSGGVDKAINMAFNFNGSNFFINGASFVPPTVPVLLQILSGAQTAQDLLPSGSVYVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGSTVYNYDNPIFRDVVSTGTPAAGDNVTIRFDTNNPGPWFLHCHIDFHLEGGFAVVMAEDTPDVKAVNPVPQAWSDLCPTYDALDPNDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Laccase
publication title Crystal structure of T2-depleted fungal laccase from Trametes hirsuta 072 at low and high dose of ionization radiation
rcsb
total genus 145
structure length 499
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA03
6PAZA 4E9WA 1CYXA 9PCYA 2P80D 2BP8A 1J9TA 2YAOA 4E9RA 1FWXA 7PAZA 1IBZA 1ASQA 1PF3A 1ASOA 3KW7A 3ZBMA 4A68A 4YSUA 5B1JA 2IWEA 3UADA 1E5YA 1BQRA 2FT7A 4G7SB 1GS8A 1JVLA 4BXVA 2I7OA 1V10A 2Q5BA 1BXUA 4MFHA 5E9NA 4DP2X 3WIAA 1X9RA 4DP6X 4QLWA 4AI7A 2PPEA 1AQ8A 2HZHA 5F7BA 1ZIBA 5EHFA 3NP3A 4AZUA 2FT8A 2MRYA 4AKOA 1MZYA 3G5WA 1KYAA 2DWTA 4GY4A 2J56A 3S3BB 1ZPUA 4UAHA 2XLLA 3WNJA 1MZZA 4DPCX 1ET5A 5B3SB 4N8UA 4A2DA 2FJSA 4DP5X 2EIKB 1RKRA 3FQ1A 3MBWB 1BYPA 3CVDA 1M56B 4F2EA 7PCYA 2HX7A 1BQKA 3ASNB 1GSKA 1IUZA 1RZPA 2PPFA 1TEFA 2UX6A 2XV2A 4BDVA 2PP9A 2QDVA 3HEIB 1QNIA 1GY1A 4AKPA 3CVBA 3TBBA 1F56A 2GSMB 2E86A 2R7EA 3BVDB 4EF3A 4QKTA 1OCRB 2BWIA 3GYRA 1ID2A 3IEAA 3IBOA 3NJHA 1RCYA 1J5DA 2PPCA 1WS7A 1R1CA 3SBPA 1PAZA 2VMJA 4E9QA 1V54B 1IC0A 1NPNA 3WNIA 2W8CA 3WG7B 2PP7A 1BXVA 2B3IA 1JZHA 2IDSA 4HHGA 1HFUA 4DP7X 3NP4A 3QJTB 3H56A 4CSPA 2BP8B 1E30A 3T6ZA 3NJJA 4HCFA 1TU2A 5I6KA 3FPXA 4A67A 3N2JA 2Y69B 1NIDA 1OF0A 1MDAA 1W6WA 2UXVA 5F7AA 3FPYA 1QHQA 1N68A 4A2HA 5AZUA 4W1TA 4DP9X 1OE3A 1A3ZA 1E65A 2H5UA 2QDWA 5I5MA 3EF4A 1PMYA 4YSQA 1XB8A 2HX9A 1OCOB 3FQYA 4GXFA 5I5JA 2XXFA 1JERA 3EH5B 1A65A 2BP0A 1KCWA 2OV0A 5B1JC 3X2QB 1FFTB 1ET7A 2DYRB 4HHWA 4AKQA 2LLNA 3FU9A 3OMNB 3NJMA 3UAAA 2GIMA 4DP8X 1AOZA 4E9VA 1AS7A 2X87A 1CC3A 3ZIYA 4G7QB 6PCYA 3QPKA 5TK2A 1AS6A 3AW5A 3WKPA 3GXUB 3FT0A 4BWWA 3ABMB 2QT6A 2WSDA 1XB3A 5AKRA 4BDVB 1IKOP 2IH8A 2X88A 2FT6A 3QJVB 2XV3A 1J9RA 3QJSB 1HAWA 2HRGA 2PLTA 2R7EB 2VSMB 4E9XA 1A4BA 2ZXWB 3NSFA 2FNWA 3EHBB 1KGYE 1AZBA 1GY2A 1JZJA 1WA0X 1YLBB 3JTBA 3SQRA 1FA4A 1URIA 2NRDA 1W6LA 2IDTA 4GP5B 2CUAA 5ANHA 1AZUA 3FU7A 1GR7A 2YXWA 1SF3A 1AAJA 1OCZB 3U25A 5IY5B 3ABKB 1JZIA 4KNTA 2BHFA 2FQDA 3EH4B 2BZCA 1PZCA 2YAHA 5PAZA 1ASPA 3PXLA 3KW8A 1AANA 3AG1B 3DIVA 3DTUB 4YVNA 5A7EA 4YSSA 1ADWA 1GS7A 3NJIA 4BWTA 2TSAA 2DWSA 1CYWA 1AACA 2WO2B 2UXGA 1SHWA 1VLXA 2VM3A 3H4HA 5PCYA 1NINA 1AZRA 3FS9A 1CUOA 1L9QA 4KO6A 4HALA 2DV6A 4KOCA 1NWPA 1WA1X 1WS8A 3QJRB 4G72B 4YSDA 3X1GA 3S8GB 4E9TA 1ILSA 1ZDQA 2GBAA 3H4FA 2JFCA 4HZ1A 2MTAA 2BP0B 1PLAA 5B7FA 1A8ZA 3CVCA 1OV8A 4A2FA 1JXDA 1ETJA 2FQFA 1AIZA 4BXSV 4DP4X 3ASOB 3FYEB 4DPBX 3AY2A 2PP8A 2HXAA 1T5KA 2HX8A 2IDQA 2YARA 3D12B 3IN2A 1V55B 1E5ZA 2YQBA 4M3HA 4BK5C 3NJLA 1BXAA 4TXVB 5B7EA 1KCBA 2P80A 3ABLB 4YSTA 4K9JA 4ZK8A 4HCIA 2PCYA 1NZRA 1HAUA 3QJUB 3T6XA 3X1BA 5I6NA 2I7SA 3HB3B 2IDUA 4F2FA 3GDCA 1E67A 2BO0A 4YSOA 1M9WA 2JXMA 2AVFA 1AG0A 2VN3A 3AG2B 3FU8A 1PY0A 3OD3A 4P5SA 4UANA 4WKXA 1L9TA 2OJ1A 4ENZA 3FQ2A 3QQXA 2GI0A 1OCCB 5B1KA 1BYOA 2FQEA 3FU7B 2ZWNA 1JZFA 4YSRA 3WKQA 2IH9A 1PLBA 2IDFA 2VW6A 3NJGA 3EH3B 3NSCA 4YSAA 1B3IA 1L9SA 2PPDA 3ZDWA 3PAZA 2VSKB 3ZX1A 1EHKB 3PPSA 1BQ5A 1M57B 2W88A 3TA4D 1J9SA 2J5WA 1AR1B 3ERXA 5I28A 3SBQA 4UF7C 2J57A 3OQRA 1AG6A 1L9RA 1CURA 4KNSA 1WAEA 1ZIAA 2YXVA 2CALA 1J5CA 3UABA 4JHVA 4M4RB 4YSEA 4FA7B 2GC4C 3S3CB 3FSZA 4A2GA 1BEXA 2XX0A 4G71B 1JOIA 3NT0A 5D4JA 1SNRA 3NJKA 1QLEB 5D4HA 1L9PA 3PAUA 4E9SA 2H47C 2JKWA 1ILUA 1PNCA 1TKWA 5B1BB 1PNDA 1SFDA 3IE9A 4RH4A 4E9YA 2EIMB 3PAVA 2EINB 3ABGA 3CDZA 3AG3B 1SDDA 5TK4A 4N4YB 1JXGA 2CCWA 3C75A 1JXFA 1AZCA 2AZAA 2YAFA 4DP0X 1JVOA 2XU9A 3AG4B 1DZ0A 1DYZA 2CBPA 2N0MA 3T71A 2XWZA 2YAMA 2J55A 4Q8BA 2DYSB 4DPAX 4G70B 2TSBA 2ZONA 2VW7A 1RZQA 3PCYA 4HCGA 4YVUA 3TBCA 2IWKA 1GYCA 3N55A 1GS6X 1XB6A 4P5RA 4HIPA 1EZLA 1AZNA 5I6PA 2UXTA 2FTAA 3CZUB 1SJMA 4NAJA 4X4KA 2BWDA 4YSPA 3T9WA 1KDIA 1SHXA 1UATA 1BAWA 2UXFA 4KO5A 1A4AA 3OMIB 1J9QA 4NERA 3FSVA 5I5IA 2RACA 3FSWA 1NICA 1PCSA 1OE1A 3RYMA 2XV0A 1OOWA 1A4CA 3UGEA 3T6VA 8PAZA 2IWFA 3X1NA 3UAEA 5B7MA 2CAKA 1NIFA 2QPEB 2PCFA 3V9EA 1SF5A 2XUWA 4KO9A 2YAPA 1MG2C 4F7KA 4KNUA 1X9UA 1OE2A 2QPDB 3OMAB 4PCYA 5I26A 3DKHA 5AFAA 2HLEB 2FQGA 2VW4A 2ZOOA 1ET8A 5D4IA 3BQVA 4KO7A 1NWOA 3NYKA 1KDJA 1WA2X 2AANA 3IN0A 2H3XC 1N70A 5LDUA 5I6LA 2IAAC 4PAZA 4L0PB 1KV7A 2WO3B 2DY2A 3CG8A 4HAKA 3PLYA 3S3DB 2PPAA 2XXGA 4YSCA 1TEGA 3OM3B 1NIBA 2AFNA 3NSDA 3TASA 2HRHA 4YL4A 2BZ7A 3AZUA 3T6WA 1NTDA 2GHZA 2FWLB 2EIJB 4GYBA 3FSAA 4A2EA 1PZAA 1PLCA 2Q9OA 1XMEB 4BWUA 4GP8B 4DP1X 1NIEA 1KBWA 2BW4A 3NJNA 1W8EA 2YAEA 1NIAA 2EILB 2YAQA 3CDZB 2OCCB 3MX0B 3NSYA 1SDDB 3JT2A 4AX3A 4W9ZA 4FAAB 5I6OA 4KOBA 2I85A 2AZUA 1SFHA 5B1AB 5FC9A 3SBRA 3V9CA 4A66A 1NDTA 3NJFA 4GP4B 2XX1A 4JHUA 1ZDSA 3X1EA 4CSZA 2XYBA 4JKNA 1GW0A 1L9OA 1ZV2A 4G7RB 2UX7A 2XVBA 3UACA 1AS8A 4Q89A 1I53A 2B08A 1NPJA 5I6MA 1MG3C 1KBVA 1PZBA 3X1FA 3WI9A 1IBYA 1JZGA 2VM4A 3L45A 3QJQB 3TU6A 2BW5A 2CJ3A 3FYIB 3S8FB 2Y1AA 4WTQA 2GC7C 4NB7A 1JZEA 2A3TA 2GB2A
chains in the Genus database with same CATH superfamily
2FB4L 2Z8RA 2OMNA 3UCRA 2WC7A 3KPSA 2B4CL 3KYMB 5L8KB 2P80D 3PV7A 4AUYA 5EZIH 3BPNB 3T3PB 1FNAA 1R3HA 3VH8A 4XVUD 4JKPH 3TA3A 3QBTB 2VN7A 2NTFA 1XL4A 4NQUA 2AITA 5B1JA 3UADA 1E5YA 2HKFL 4U1IA 4WENB 5B1CA 3WS3A 4LGPB 3T77B 4ZAKB 2XWBB 5DHDA 3ZTNH 1OHZA 2WSKA 4RAHA 5LBSH 5CBEB 1DL7L 2KZKA 3FO0L 3NAAH 4XO5A 4D3CL 2X89A 2XRAL 4HK3J 2XETA 3FCBA 3FU5A 4QYAA 1EAQA 2ICES 3LEXA 1QG3A 3MKKA 3PIQA 4L29B 5D2NC 5FDWB 4ETYA 4F58H 4UT9A 3D52A 3HNTL 2I07A 4IGBD 2GITB 1C5DA 3GSNA 1B4TA 4G8EA 3MJGX 5D7KD 1PPIA 4F93B 4UAHA 3TIDA 1YC8A 3D2UB 4OF5A 3KLDA 5AZEH 1AGEB 3RGVC 1ZHLB 3BN9D 2BERA 5I0XA 4Q0XL 1LLAA 4EEEA 4GXVL 1JRHI 2BNRB 3FT9A 4MQTB 3TVMB 4M7KL 1F3JA 1PJ9A 1ZLUK 4R84A 1WZLA 3ASNB 3QNXB 1F11B 2Y9RT 1IM9A 4FXKB 2C3XA 4Z7QE 4UOQA 2NDFA 4LSQH 2AK1L 5HDBB 1JDDA 3ZR5A 3H42L 5BW7C 4WI6A 4JFXB 3C87A 3RWHB 2DQDH 1QNIA 5KVEE 4Z76B 4GSRA 3GTVA 5I1JH 2AAVA 2YXFA 3TBBA 4GKNA 2EKSA 5F21B 3AXIA 3DOIA 4PH8A 3TX4A 1FBIL 1F4XL 4FX5A 3AREC 3K6FA 2AHIA 2IV8A 4ZUWB 1D7BA 4R26H 3TBSA 3FUHA 3BPCA 4G8IA 4HC1A 3EFFB 3K5RA 5C7ZA 4AEIL 1YEHL 2IPTH 4WI5A 5EZLB 2FWSA 2VDRB 3TNNA 5BRPA 5J12B 4TS6A 4HJ0C 4S1QH 1KB9K 2LFEA 2OL3A 2PP7A 1Z3RA 4YFEA 4HULB 1LP9A 2OCJA 2APTA 5KYNA 3RWGA 3P9MB 4YGVA 1IIIA 1JPFB 2CCLA 4QRRD 1Y18A 1E5AA 4OSUL 2WNKA 4UUJA 4QGYA 1RZ7H 4HEMA 4H40A 4A67A 2WLLA 1P7QD 2FL5B 3D0LA 5F7AA 5L4IA 1QHQA 1YNLL 3LKQB 4YL9A 4O02L 1HDMB 2XZQL 5DJAB 1JD7A 2E6JA 1BD2D 2QGDA 4HZLA 5I1EL 3VSVA 2BNQD 2QDWA 3DA0A 3QWRD 3ARZA 4QHUB 1KULA 1KG0B 1I8IB 4QTHB 5IT2L 4P5TC 4N8CL 3MNZA 1GAFH 1LO4H 4Y1SA 1I8MB 1BYNA 4AQ8C 2DYRB 1WWAX 4RCAA 4JZJC 3PQYE 1ACCA 3QIBA 1J8HB 4JPWL 4D9QE 3T8XA 4BSVA 4LAJH 4JFQA 4QYOB 2VZSA 3S34L 3LXCA 1ZA6A 2H0FA 1FVEB 1AO7B 2D9CA 5B4MC 2E6PA 4JG0L 1TJGL 2K8QA 3ML9A 4PJXE 2J73A 1MCLA 4KKLC 2ENJA 4UNIA 5D70H 5DD0L 1MHPL 3S7GA 1UACL 2ITDA 1GHFH 2R8SL 4PGDB 3SGDI 2NY5C 4PJIE 1D9KC 3QJVB 4UBDD 2CUHA 4ICXA 2HTLC 3RWIB 3UYPB 3MRPA 2HRGA 2XZZA 1VKXB 2AV1B 2R7EB 5C0BE 1XCTA 5JXEC 3PWLB 2DWYA 3UX9B 1MWAH 1LQBC 3MLTA 1FPTH 3NABL 2MQ0A 4JQIH 5GS2H 5KTEL 3LIZH 1QVOA 4MXWH 4BUHA 4K94C 5SX4H 4HUVB 4UQ2B 2CUAA 2ZCLL 2FAUA 3HC0B 4EI6A 3UTPE 3WHXA 1XF4A 4GG6A 3BZDA 1LL1A 1KEMH 1J1XH 3NCBB 5MHSE 4JB9H 1WPCA 4B96A 3LKPA 3O3DA 4L8BB 3BO8A 3NIFF 5D6DC 4BCZA 5KUKA 2EDMA 3F65A 1K5NB 3S5ZA 5E8PA 3CZSA 4TSAL 5JHBA 5FF6A 4NZ8A 2QKIA 3SGJC 4KTDL 3AU1B 3EHBC 1CS6A 1LK2B 1OAZL 1TTBA 2D0FA 2J2ZB 2KI6A 4XPAL 5F2FA 1CXHA 3NOIA 3U30B 5HPMA 4FJ6A 1CMOA 1I1FB 4BFGA 2DQUL 1FYTD 2X4NB 1QTSA 3BZEB 1FP5A 2VSCA 3HCVB 4Y16B 3ZT5A 1AJ7H 1V3MA 4NZRL 3SE6A 3UO1H 1JI2A 2F8XC 4OZ4B 5G4MA 5A2IH 1JSYA 3KH3A 2ZNWA 1MOEA 1FZJA 4PEEA 4TKWA 1NEZG 2XWTB 3HNSH 1PLAA 2DQCL 5IJVB 1FORL 4PJ9D 3S98A 1ETJA 3WGVB 4BXSV 1K4CB 4H44C 2VLKA 2DQFB 4HUWA 3SQBA 2XQBH 3TOPA 3ZHFA 5BUGA 5HHXH 1XGRA 2C9SA 1P4IH 2XZCH 4ABUA 2ADGA 2IDQA 3IDYB 3SCMD 4MAZA 5IMKA 5ID0A 5CEYA 3FDWA 4P2RE 2P80A 1HSAB 3V6ZA 4IRSB 5DS2A 4GSXA 2A9DA 1WZ1H 2X4QB 5CO1A 4TTDC 2XQYG 5EN2B 5I6NA 1Z9LA 1F58L 1E67A 3M7FB 1GMIA 4MAYB 2EADA 4OZGB 3VGEA 1R5WA 2VGLM 4HV8B 2CU9A 3RPBA 2F54D 5I23A 2YMXL 3AG2B 5DVKA 3V5KA 3GI9L 3IF1A 4FG4A 1FNEB 2FLBT 3L9RA 4PRDA 1F6AB 3VXNA 5F1SA 1CZ8L 1NOFA 4MA1B 4LL1A 1QSVA 3GXTA 2YGNA 4AH2A 2G60L 3KEDA 4IGBA 3RWDB 3HB3C 4YBQC 3WKQA 3ILQD 2FX8H 3L9EA 4K5OA 4NKOB 3UYRL 2X1WL 4W6WB 1F6LL 4KZEL 3SKNB 4U1JB 3T04D 2QHRL 4WFGD 1NBZA 3EG9B 2YEVB 4OJFH 1D6VH 4XPTH 3ZTEA 3BKYH 2HT3D 1X44A 5L2KA 5D2LE 5SWSE 3FUJA 5J6SA 4K71B 4Y9EA 3I6SA 4GRMB 1TZAA 4F8QA 3OQRA 5ANMA 1YMHA 1JWSA 5F44A 3GMMB 2FWUA 3SJVA 3RHWF 4TM9A 4M3KB 1KCUL 1WFNA 4ZTOL 1E27B 5ITFB 1ZIAA 1MVYA 2Y1YA 5C7XH 4XOCA 1LJMA 2X6CA 4NAQA 4MRBA 1F8TL 4APQC 1ORQA 3CXFA 4JCLA 1B9KA 1WCBB 4UU9A 3SPJA 1IFHL 4X98B 4XPBL 5DJ6B 3QQ9D 5FYKD 3NT0A 1NOLA 3VXOA 2HFFB 3B1TA 1DBBH 3S36X 3EBHA 3I2CL 2J72A 4P8QA 2VXUL 4I0PD 1N8ZB 1IVLA 5I16A 3IE9A 1USZA 1JWMB 1B4RA 4AT6B 3O45A 5KVFE 5DMGC 4X5WA 3WY1A 1MIEL 2J5LC 4QRRA 4GG6F 4HUXB 5TK4A 3GBNL 1CL7I 4PRNA 3WFDL 4KRPD 3TT3L 4PGEA 1B6UA 1ZY9A 1HJBC 1QUNA 4LF3B 4P9MH 3R1GL 5LDSA 4BEIA 1RZKH 1YEGL 2P49B 1BMWA 1BD2A 1NAKL 2L7JA 4YDMA 2BNQA 3QWRA 2P5WB 1GPOH 2GFBB 1P5UA 3QDHA 3AGVA 2XA8L 1FG2A 1CDGA 1ZWIB 4P5RA 1D7CA 2QV4A 3HJEA 2R69H 4ODBD 3CPUA 1EZLA 1EFQA 3CZUB 1RK1B 4F20A 3DJZA 4J3VA 1V7ML 1YY9C 5ALBH 1KDIA 3U9PL 4MJ5A 5E6IB 43CAB 1OM3L 1BBDH 2XTJE 5DMIH 4Y4HD 1JD9A 3MJWA 5I5IA 5E1QA 4ZUVB 2X7LB 1L7TL 4P4KD 1I7RB 1UKQA 1OE1A 2E4TA 3EYQD 2QQKH 2EXYC 4HWBL 5C07B 2KQNA 3T6VA 3U7YL 5F6IB 5B39G 3V9EA 2P42B 2XPGA 3K7UA 2YAPA 4NZTH 1MCBA 4PCYA 3S36H 4KK9D 5IMLA 1XCXA 3WUWA 2R27A 4DEPB 3X3FH 1K8DA 1XF1A 1IGIH 4NOBA 4YO0B 2EE2A 5FUZH 1NKOA 1FL3A 4WO0A 4EBQL 1MFNA 2H3XC 2CKNA 2C9AA 5A16A 2ZCKL 3CDFA 5FO9A 4KTGA 2JCCB 2EKJA 5AB9A 1SVCP 1KBGL 5FO7A 1UQSB 1JBJA 3LRHA 4LL4A 3HAEA 4ZXBC 1CN4A 1KYUA 1UCTA 1M53A 5KS9F 2CDFB 3I3DA 2JELH 3HHMA 2P47B 2FR4B 4JRFA 2VDQL 1ZLEA 4JR9L 4YGAB 3EO9H 4YHML 4GYBA 4HGKC 1MJ7L 4KAQL 4W6YB 1OWRM 1EH9A 2FGWH 3A0OA 3CHXA 2VDKL 3UBXI 4DP1X 1RZFH 1UWXK 1RSYA 5HYQA 1UKTA 2ZUVA 4MVBC 3G6JB 4ISVA 4QXTB 4FNUA 4PJ7A 3ZE0F 3VQ2C 1P6WA 3K4AA 4P46B 1FYTA 3JT2A 1Y7VA 4P2CG 4XBEH 3ZZLA 4UQBA 5KYYA 4OW6A 4WNSA 4KK8C 4P0DA 1EO5A 2E56A 4XN5A 4PM1A 4DGVL 1ZHBA 2JI3A 1WBZA 2NQDA 1YYLH 4DNLA 4F5CE 1Q9KB 1UA6H 4DVRH 4XE5B 3CFMA 3MACL 3DECA 3GKWH 2DTML 3CQQA 4RBPH 2OR7A 2Y5QA 4L5FE 4M61B 4A39A 3CUPB 4DUVA 2W38A 5MERB 1I53A 3IDGB 1JK9A 1HKLL 3BESR 4TPRL 2CA4A 2CK2A 4PJ9A 4K94L 3MRQB 1XIWD 3GXPA 4EI0A 4AQZA 2BCKA 5J1AA 2JMRA 4PRAA 3EJZC 2VM4A 2DKSA 1EO8L 1PQZA 5GS1C 4EMZA 3IGLA 3EJUA 5ESQB 2V37A 3BIKB 3MUGA 4XB3A 3OLEA 1IC7L 3SCMA 3MOBL 1B4JH 2EDJA 3OXSA 4RAUA 3L7FA 1A21A 4QHNA 2LU7A 5GJTL 1KNOA 2DBLL 2W07B 4H8VA 1R46A 4B9KC 1FWXA 5HSFA 3POCA 1UJ3A 2B3RA 4EN3B 3F2LA 3PPEA 1AQDB 5DD6B 3K2UH 4JM2B 1MFAL 3KPOB 3ILPB 3O6FA 1F3RB 4M6NL 3MO1A 4U3HA 2DEXX 1FO0H 1AQKL 5J3HD 1HH6A 3IJYB 3DPBA 2F54A 1EHLL 2CXKA 1EXUB 2VH5L 3OKLA 4BUGA 2NY4C 4FABL 4TQPA 3Q2LA 1ZCRA 4NO0B 4NC1E 5H37A 5DFVC 4EUPH 4PJ5E 5E4EB 5F7BA 3JTTB 4HIIA 1FJ1B 4NZUH 3BDYH 1GW6A 2VDLH 3FMGL 3G5WA 5TDPA 1E4WH 4EOWH 4Z7WE 3F85A 3TFBA 2QGCA 5HGDA 3S3BB 4LSPL 2AQQA 4DCQA 5BJTB 2KMWA 4DFIA 4S2SA 1HHKA 1AGDB 1U21A 1YMMB 4NJAL 4Q9BA 1NUDA 4C56A 1A1MB 3HC3L 5CJXA 3GK8H 1FNGB 5KYWA 4Q58C 7PCYA 3UTTB 1OGAE 1JRHL 3G5ZA 3O11A 2Y23A 5E1AA 5INDA 3QR1A 3I9IA 5TDNB 4X42A 1TJIH 3O4LD 1MN4A 1MW0A 3UEZA 2KUTA 4HIEA 4IU2A 3RVVD 3BKJH 3H0TA 2DWDA 4OF7A 3RKDD 4CSTA 1FZOB 5E08L 2A2QT 2MQCA 3FCSA 5CINH 1ID2A 1RJLB 1SOXA 4AVHA 3D1MC 3IEAA 4OF8A 1TVBA 1GRWA 1OPGL 3NESA 1RCYA 1GYVA 3WGUB 5D93C 2AJVH 5GGVH 3CZGA 2CO2A 4I0PA 2EO9A 2MNUA 1CFNB 4XN2A 1BXVA 2V9QA 4KJPD 3KPLB 4LAQL 2VC2L 2XBDA 1AQMA 4PV8A 3FRPG 3MLPA 2AJXL 3QFJB 4PJHA 4XC1L 3RL2B 3T6ZA 2F68X 4IHBA 1A7RL 5C9JA 2WXIA 5AD0B 1H9DA 4V1DD 2YKLH 3ZIMA 4MA7H 5FYJE 3CLEL 3U46B 4OM1H 3BD4A 3BX7C 2N1KA 1FIGH 4HZAA 2UWEB 1FVCB 1S9VA 5TH2A 4HAFA 3CVHA 3PHQA 3P30L 1ADQL 1MFCH 5EBLA 3RU8L 1QZ1A 1IEBA 4YR6B 3ARFB 3QI9D 4DHLA 5DLMH 4N2CA 3ZE2B 3WO4B 5EU7C 4YC2B 3LMJL 4PRIB 2EDLA 5A2KH 5BOZG 3W9EA 4ZW7A 1KCWA 1MRCH 2OV0A 3UDWC 3RAJL 2OK0H 3VFGL 2VO5A 3D39B 1MFDL 3L4WA 4WKZA 3PWUB 4OF0A 4P4KA 4UM9B 4QCIA 1U93A 2W91A 4DK5A 2W1NA 3SB3A 1BVOA 1T5XB 1NBVL 2ESVE 3O9WC 5CWSB 2C3WA 3GXUB 3D2TA 4NBXB 3ZMNA 1H8OA 3QZBA 1ZAGA 1CFSA 3A67H 4IBVA 4JFDD 3WKMH 3KWXA 5BO0D 3VFUA 2ICWB 4X5XB 1S3KL 4HCRA 4BSJA 3GBEA 1N3NB 3GSRB 1MF2H 1S9XA 3WOVA 5D1QD 4OD3L 4JO1L 4M5YH 1T80A 1B4LA 1WO2A 3HMXH 3UBHA 5JQ6H 2EIZB 4F7PB 3CGTA 4WO4D 1YLBB 4OB5H 1FA4A 3KDPB 4JFSA 4XX1G 3M86A 4OVVA 3PE9A 5AB0A 4MDIB 3N85H 1ZLSL 3U25A 4OGXL 4KC3B 4AW4A 3BPLC 1NDMA 1CGSH 4JPKH 3MRMB 3NH7H 4UQ9A 2WMPA 3B6SB 5FA3A 4JVUA 1FG9C 4Z7VE 3HUJB 1N10A 3ES6A 3SDCC 5PAZA 4JN1L 1I9RL 4ZPTB 3B9KD 3BQUC 3WN5A 4FI8A 4BH8A 5KVEL 5CS7A 3NTCH 4QEGA 5EO1B 4LP4A 2A74C 3H2WA 3QCTL 3S88L 3SDDB 1VLXA 1X5HA 1Y07A 3VFOB 5PCYA 1I8KB 1FGVL 5E2TH 1C8PA 1WTGT 3ZKXC 1NCBH 1UA7A 5LGHH 4YN3A 1LO3H 4AYFB 1KFGA 2DIAA 1LEGB 2V9TA 5AOJA 1BXXA 2EC9U 2XPYA 1H8SA 1ZDQA 1CGVA 4L1LA 2W5PA 3W82A 5T3ZD 1HYSD 4Y5YA 4M43L 3TH4T 3VFMB 2YGPA 1YCSA 4NYLB 2IANB 1M42A 1AIFB 1HQ4B 4TRPH 1OAQL 3S48A 3LH9A 4E41A 1OSPL 1WH0A 1VCBC 3QNYA 2XY1A 5CUSL 5BRZB 5KAQF 1XIWA 2ORBH 3O6KL 3TBWB 1DDHB 2FX9H 4HXAH 2DYPB 5CD5C 32C2A 2VR7A 3SQOL 2HG5B 3UPRA 5DJCB 1GSMA 4H0GA 2HXAA 2R39A 1KUMA 3OSVA 3QHTC 4YDJB 2CDEB 3NJLA 2Z34A 2XICA 4X0KA 1ZTXE 1NC2D 3TTSA 1N4XL 2VZ3A 1DO6A 1FLTX 1V3JA 3CBKB 3GMOA 4FQIL 4K9JA 4OIFA 2A1WL 2O5XH 2GJPA 5ISZD 3UL4A 4WAFA 3B2UC 4FI6A 4KXCA 2IDUA 1ED3A 1ZE3H 4J2XA 3B7SA 1WK0A 4P5TB 1JNNH 3A6BH 2EE9A 3HG4A 3GM8A 4JO3L 3WEXA 3B9DA 3VDCA 5IVNA 1OK8A 4PJHF 4OJEH 4QMEA 2MOVA 3KR3L 2VDQB 3LRSA 4JZJB 3BKML 3BGMA 2R29A 5C0ND 1AP2A 1KXTB 2EDHA 1BZQK 3FQ2A 3I50L 5IHWA 1EAPB 2FO4B 1KT2B 5FCUL 2CHNA 3L3KB 5C0EB 5IW1A 4WI8A 4JO8A 1RJCA 3TONA 3DUUA 4FFYL 4Z78B 1OF2A 3DPDA 3AY4C 3MLRH 4NPYB 4CKVX 5AVRB 1DBAH 3WIIL 1BOGA 2H1PL 2F8VA 1NGXA 4HUNB 1D9KB 1HHJB 2O6PA 5D7IA 2WZPD 4CC4A 4DUWA 5I18H 2HRPH 2VLRE 3SO3B 5DUPL 4ETQB 1IKFH 4ZPVA 4YK4B 1U2YA 4YBLC 2P44B 2P8MA 3OX8A 2WP3T 1L9RA 1D7FA 3EUDA 1IGML 4GBXC 1QP1A 3IAGC 3HI5L 2ZYHA 4NC2B 5MEPB 3ZT6A 1WTLA 5I0YA 1T5WB 4HKXB 3O4LA 5CLZA 4H20L 3WS6C 3QIUC 4PI2A 2CO3A 2X2HA 1T83A 1VGEH 2QLVB 1BM7A 4A2GA 4PYHA 4YZWA 3CFBA 1KCRH 5MENB 4OFQA 5BV7H 2NY1B 5LQBL 4WY7H 1F4HA 4NM4H 5IBUB 5HI3D 5EZOL 3ALPA 1CD1A 2ZXQA 3IGAB 4FCHA 4Q14A 3CFIC 3OZKA 3RURA 3NPZB 5F97E 2ATKB 3CZJA 5E94B 3H6JA 2KHAA 5E2VH 4ZBJA 4V1DA 4DKEL 3TT1H 4N4YB 1JXGA 2CCWA 2H32A 2O26U 1OT4A 3C75A 2B9AA 4JMXA 3NACH 1UWXH 1W9XA 1S7SA 2CSPA 5GHWL 1NCHA 2PETA 3B7TA 1PX8A 2XWZA 2OSYA 1W72L 2YOCA 4HDIA 3UC2A 1NLBL 1F90H 1CL7L 4CADB 3FT1A 2DYSB 1F4WL 3FCGA 2XIDA 4Q9RH 3LB6C 4RVBA 5LUMA 1PLGH 3V0HA 3QI9A 1PZDA 4DJMA 5JZ7C 5AVSB 4N0CC 1JV2A 1XB6A 4X6CE 1HCYA 3Q8AA 1BVLB 3JSSA 3TC9A 1BSIA 1G1CA 4XAWH 4K23L 4PRBA 4HJ1A 1CF1A 1UATA 2WQVA 1JTPA 3QVAA 2XYCA 5SWQA 2VB5A 2VITA 5GISH 3NFPA 1OXYA 1XR8A 1R24B 5DD3L 2AS5M 3MA7B 1JWUA 4KKCC 2XV0A 2VYRE 3RDTB 1A4CA 3LAFA 5GS2D 2AABL 5DA0B 2K6YA 4PREA 5E0QA 2D7TL 3GRGA 3HN3A 5F9AC 2WZ6A 2PCFA 3NQIA 2XJKA 3JWDC 3LZRA 3MV7D 4M6OL 1N0XL 1MG2C 4JFOB 3NCXA 1C16A 4PS3A 1YEDA 1IAMA 2YKKA 3O2DH 4YHKH 5CXPA 1FF5A 1CTMA 5HHNB 1MQKL 1ET8A 4XPGH 2BIQA 2VXQA 4X6BB 3CDCA 2B16A 2K9FB 4ZW5A 1NWOA 2R1YB 2BFVH 3KYKL 5FGBC 3GMRB 1WA2X 1W91A 4XP6H 3EYSH 3AB0C 2VC2B 4N9GB 4JFUA 1R9FA 4B7LA 1A9EA 1WAAF 4WO4A 2WXPA 3D0VA 5BS0B 3N1PC 2DM3A 4KX9A 4LSTL 1R19A 4MD4B 5FB8A 1RJYB 3CG8A 3C6EA 5FKPA 4Z0XA 4DAGL 1B9ZA 4B9FA 1M1XB 2AFNA 4LRNL 5C2UB 4RZCB 2B5IC 3OAYK 3JT0A 1BGXH 3ARVA 1I4FA 1PG7H 2JB6A 2D2OA 4A2EA 4NO3B 3B9KA 4LVOC 4UILH 4KV5E 1YAZA 3OPZL 3ZZQA 5KSAD 3FQUB 5I1CH 1GJUA 1F1GA 1K3IA 1Y6NR 1KPUA 4P5MB 2WLZA 1SXAA 3DVGA 1RFDH 4APQB 5JIHA 1NKRA 3IPEA 2PYEA 3HE7C 3MRKB 3MMEA 4QHMB 5D7IF 5E4IA 4O9HH 3NFNB 2DQIH 1ZSDB 2I85A 1J0KA 1PD6A 2EYSB 3PGCB 1K72A 1UB6A 1TQTA 1A6AB 4JPIA 3TCLA 5HHOD 3DX1A 3QISA 1LDPL 1TYRA 1TNMA 2GTZA 4Z7OE 2YD5A 3VNZA 2EP6A 3ARQA 5KG9B 2CGRH 3QDMA 2XZAL 4XTRD 5A6IA 3DK2A 3ZKND 5KVFL 1I1YB 2YWZA 1NPJA 3I6LD 3ZE1F 1KWGA 1LO5B 4NDMA 2KLSA 1HCVA 1M7UA 3QJQB 1FVDB 3GEWB 2OX5A 2BZDA 1CE6A 3TCXA 5E8DL 1NC2A 3M1CA 4Z7NF 2VRAA 1CFTB 2QVIA 3GT6A 1M7DB 1VFOA 1FL5B 4I7ZC 4DUXA 5ISZA 4L4JA 3ZTJH 4BUQA 3KLAB 1NL0L 4Y2DC 5FUCC 5C97A 3OJ2C 4K2UL 3GIZL 4JGUA 1A4JA 4FMKA 4P06A 1YEWA 4OLUL 3GMNB 4YE4H 3SY6A 1JPSL 3VGFA 2FT7A 5I2IA 3SZ6A 1MNNA 2I7OA 5DEGA 3HBGA 3MRLA 2L8AA 4DP6X 2AJ3A 1U30A 2WXKA 2YD0A 4OQTA 1W15A 1B0RA 3M8OH 1ZIBA 3CU7A 4YIQB 4CGTA 3LKSB 1LWRA 3MROB 3N9GH 5EWIL 3A24A 4AKOA 5BUPA 4ZO6A 1O7DE 3CX5J 3F58H 5D5MA 5J13B 5J6GA 3Q8FA 4KTEL 4JJ5A 3C08L 4X4ZA 1ZPUA 5DLLA 5DJYB 2IAMD 1MAJA 1F42A 1RU9H 2GBVA 2G0LA 1NH6A 4H1LH 3E6HA 1H6EA 4ZDHB 4RNRB 2HLFD 4Y1AA 3OKEA 3PJLA 5E9DE 5AW3B 1T3FB 4AIEA 1Z3GL 4MCYB 4PY7A 4NGHH 1IIKA 5GRUL 1N6UA 3WMSA 2ZD0A 1BM3L 1GZQA 2EH8L 2Q8BL 4KJQD 2D03H 2GSMB 1WFUA 2Y7SA 4ZUUA 4OGQC 4PWHA 2AV7A 1BQUA 4H0HB 3N1FC 1KN4L 1RULL 1QMUA 3P1VA 4QKTA 4DSYA 5DMJB 3N0AA 5K9OB 1CR9H 2ARJA 2HWZL 1BJ1H 2HT4D 1A6TA 5F6HJ 2J6EH 3F7KA 3JZYA 1PAZA 4BD4A 4KUCF 4MNQB 3RUGB 2R0KL 1KGCD 4TUOA 3QPQC 4GAFB 4WTZA 4FLQA 4NKIH 3HN5A 5K69A 5DJ0A 2X2UA 4XCEA 1OK0A 1G9NH 1QEWB 4XVOA 1N59B 2WYTA 3BFQG 1HI6B 1EWHA 3ARDC 5JORB 5EB9A 1S8DB 3S5LB 4NX0A 4ZFGH 3UZQB 3T4YB 2HT2C 2AQPA 1RZGB 2FE0A 2H2SC 4JRXE 4HCFA 1YEJH 5IB4A 2HVBA 4JDTL 4DOHB 1JN6A 3GMLA 3COOA 9CGTA 4CC0A 2NDGA 4PJCA 4L5FL 1KTDB 4HU2A 3VXRA 4EXPX 1LMKA 1BZ7B 3GLZA 4BZ1H 2ADJA 3QUMA 1NFIA 3N6YA 1MXGA 1KF9B 3WTSA 2WOBA 1ZHKA 1D2OA 5T33H 2H5UA 1YPZB 3EF4A 5EC2A 4GFTB 3FTSA 1N19A 2NCMA 1HNGA 5C0BB 5CCKL 5EU3A 3RNQA 3X2QB 5I9QC 5DGQA 4CU7A 1GJWA 4P4RA 2R0WH 2X4SA 4OIIL 1FH2A 5DEZA 2W9DL 1CO1A 4PI0A 4G83A 3GHBH 3K6OA 4UT7H 1BZ8A 3CFCH 1CB4A 4MBRA 3TN0C 2R2CA 4JQIA 3WTXA 3WKPA 2WTRB 3KBHE 5F7NC 1X5ZA 3U48A 3X12A 3MV7A 4FNLL 1F1AA 2I60H 2UYLB 2NY4B 1SJEB 1ECZA 4FG6C 2HN7B 4Y5XC 3HR6A 2E7BA 5CIPB 4BGDA 4KVNL 4AM0B 5I66B 5DC4B 2IGFL 4M03A 3V7AG 3C2AL 5EDXA 3IDJA 4RQQB 5ENWA 5DHEA 1OD9A 3CIAA 1EAJA 4OIBA 5IR1A 1AMYA 3M46A 4IDLA 4R4BA 2CNYA 1EHNA 4KJYA 3VWJC 3VD4A 2GK0A 2VDRH 3SYAA 3EO1B 3SE8H 4IYKA 5IQ7H 1IC5H 3A23A 4HLZG 4DGUA 4QOKD 4GW1B 4Y19D 3SQRA 4A7UA 3BJLA 3H7BB 4GP5B 4WW2C 3MYJA 5GZOC 1A6UL 4JFEE 1JL8A 2BK8A 1NGPL 2JJTA 2R23A 3T4AB 5IBTH 4BCYA 4LIQE 3ABKB 3AQXA 2GEQA 2ICEA 3I6GB 3ZSTA 1CICD 4TULH 4M1GH 2NY2C 3PXLA 1FCGA 5HHPB 3AG1B 3OKYA 1AC6A 4AG4L 3HC2A 2CWRA 1QSEE 3SDAB 1PZ5A 3OJDA 2X12A 5E23A 3CSYA 1IAOA 1PZ3A 1X5JA 5E6YA 3T5WA 1XGUB 3OKDB 3UC0L 3FS9A 3DYOA 2B59A 1Q38A 5CZXD 5HJ3B 3LVTA 5D93B 3HC4L 3GLAA 5HHOA 2R56L 4YSDA 5HHME 2NXZD 4ODSL 4AIXA 1ILSA 3EW3B 1PD1A 3DI2B 5DZOA 3WXWL 1OTUC 1FV1B 5B7FA 3N41B 4UIMA 4RFNC 3CXHK 4F8OA 2GJ6D 4I5BB 4QHPA 2QSQA 3O3EB 4HYTB 3VRLE 4Q4IA 4YAQA 3D0AA 1AIZA 3IJSA 4QY8B 4FXGC 3IFLH 3CSTA 5FYJL 5AZ2L 2J7LA 3DRQA 2VDNL 2J71A 3N06B 4U1MB 1ZS2A 2CKBB 3PP3K 4M3HA 5DYFA 4EQ3A 4J5VA 1DE4B 2Z91B 4MA3A 3WNNA 1EX0A 3A22A 2IGTA 4QO1B 5TF1H 3QSKB 1UEYA 1A2YB 1ZJBA 3GXDA 5E8EB 5E99L 4ZJ9A 1CF8H 5ALCL 2A9NL 3KLHC 1BX2A 4NHCH 4NRZB 5FW6A 2AQTA 3K2KA 1UWGH 3VI4A 1O5DT 3SYCA 4PJCF 4UANA 2OMYA 3C5ZA 3I85A 2PXYB 4Z3EA 1IL1A 1X5GA 3OHXC 3IFOA 4LHUB 5D1ZI 4ENZA 4R0LC 4YHNB 3Q1EA 3VXMD 3O9WB 1FL6B 5CSZB 2GYSA 4KKLD 4IBSA 4YSRA 3UBXB 1ANUA 4K3GA 2WZAA 5EOTB 2NXYD 2AEIT 2E7CA 1XEDA 1U8MA 1R47A 4R3SA 4G3YL 4R97B 4I85A 1DBML 4F9LC 4BQ9A 2IAMA 5E00A 1L9SA 6CGTA 1SYVB 2C34A 1Z0NA 4NUGH 3LNGA 1N64H 4JPSA 2KYIA 2WQRA 3OQ3B 2CJTA 2YFNA 3WUWG 5EG6C 3ERXA 5DO2C 4IBWA 2BJMH 3C60C 2R1XA 3BP4A 2EVJA 5DURD 1SBSH 4U2YA 5TQ2H 1OSYA 1UM4L 4Q6KA 1BAFL 3CHPA 4KNSA 2XXCB 4KK5C 1DANU 1NCNA 3QXTA 3LNDA 1IFRA 3U0WH 3K71B 3HAEG 3HR5A 1TVHB 3NVQA 5BVJA 1T89A 1AZZC 3A21A 3IDUA 1DN0B 3EHBD 3SDCB 3QNFA 4KROC 3AABA 5KW9L 4U0RC 1QATA 4JKKA 3SPHA 4PJBA 5D4JA 2QZ5A 2YD8A 3FHAA 2ZUTA 2RAMA 1SN2A 4L37B 2A74B 4QTIL 4PJEA 3CE1A 2CUIA 4CMMA 1NBQA 3QIWC 1P1ZA 1H6FA 4PRPB 3CD4A 5B1BB 3G04A 3R7RA 4XE0A 3G9VA 4RH4A 4E9YA 2EIMB 3Q1SL 2JI2A 4QXGH 3UEQA 2EINB 4KHXL 3K6SB 2R69A 5C0CB 3F7VA 1I82A 4LLQB 3CDZA 3ULSB 3G5YB 3ZDZE 3V4VL 3Q6GH 3SGKC 5CD3B 4GO9A 3WFBL 1RUMH 35C8L 5FHBL 3NK4A 5ETUB 1MFBH 2N0MA 1KPRA 2P24B 4PJDE 4F2ME 2JXMB 2EUXA 3ULUC 4YDLC 5IZ7A 3BGAA 3ZW3A 2A73A 2Y1VA 3HMWH 5DD5H 1NMBH 1QO3A 5GGSA 4ANXA 3GJEA 1MPAL 1KJ2L 1FFPB 2EDOA 4RGND 1ZEAL 4J3OF 1U6AL 2FHFA 4PLOB 2F8OA 3IBEA 3KPRE 5GGVY 5GIRA 3ATEA 1G6VK 4KKQA 4R4FH 2BSSA 1E2WA 4U1LB 1ONQB 3FSWA 3N42B 3QUYD 3F5WB 3HFML 1FHNA 1M6UA 3C2SA 4XP5H 1SXSA 3OV6A 2VABB 5KVDH 1I9IH 3ESOA 4S1SH 1NIFA 2DKMA 5D2NA 4PS4H 1JNLH 2CBOA 3QULA 4G43B 4KNUA 2R0LL 5I26A 1P84J 3TWCH 2AKRB 3Q01A 3MNDA 1QFOA 4PP2B 2SEBA 4YBQD 2FB4H 2ICCA 5GGRY 2B4CH 2G3XA 2Q6WB 5H37G 2W65B 1G7JB 2D3LA 1X9QA 3DO7B 2GW5A 4KKNA 1PFCA 4U6XB 3RGVA 4K7PX 3L3IB 4TUJB 4MXVF 4XX1E 4HJJL 5LDUA 1Z5YD 3FB6A 1BZ9B 3ARGC 2HKFH 1P0SE 5CGBA 4QOKA 4Y19A 4AZ8B 4ANUA 1JMZA 4JHZA 2APXA 4IEFA 1DL7H 3OAZK 3FO0H 4YSCA 5KZCB 4D3CH 3OKMA 2XRAH 4LQFL 3EJCA 3B2PA 4WI0B 5I0VA 5DDHA 2CLRB 2Y6SD 5BW7A 3CSFA 1CICA 4XBGB 1TKWB 4I9WE 2GHZA 4GBXB 1T1YB 3W0WE 1L0YA 1W0VB 1XMEB 2Q9OA 3HNTH 5HTSA 3R06B 2GABA 2GIYA 3NJNA 2FO8A 4XMLL 3AREA 5L8LB 3RIAK 1XF2A 3GHEL 1H6TA 4OLVL 3QIUB 4F27A 1AR1D 5A3IC 1QD0A 1LDSA 1QRNA 3VRJB 3G5XA 3EOAB 5GZNC 3EZJB 4Q0XH 4L3EE 5I6OA 2ZIDA 5I74B 1J87A 4GXVH 1JGDA 1KYOJ 4YE0A 1FDLL 1KLFA 4M7KH 3FQWA 5DQJB 4XXDA 2B20A 4FQXC 4ZQKA 3UO8B 5AVVB 5AVZB 2B9BA 3KPPA 2R2HA 3A5VA 3R19A 5AQ0A 4AUUA 4ZSOA 4OGAC 2AK1H 5BUAA 4MBOA 3H42H 3TURA 1GW0A 4FMFA 5JHMA 1QNZL 4NPKA 3ZO0A 5IV2A 1RP9A 4U2ZA 1VEPA 2GJ6A 5D1ZC 3OKOA 4E68A 1ND0B 5JW5B 1FO0A 1TIUA 5AB1A 3MFFB 1FBIH 1F4XH 3PGDA 4UZUA 1Q0XL 2Y2WA 2XWCA 4G9FD 5IMOB 4UTBL 2IQAA 5EU5A 3HLKA 3TJPA 1T20B 4XNZB 5D9SA 3PG2A 3QDJD 4AEIH 1YEHH 4PJBF 4M62L 2JKNA 1A1NA 1K8IB 1J9TA 4PJEF 3WV0A 5TF0A 4E9RA 1D2PA 4NQXA 1RPQA 1IBZA 4U4IA 4M56A 3QG6B 2RB8A 4EZMA 1G6RA 3F83A 2Q1EA 2CQVA 5L2JB 1A66A 4AQ8A 2JIXA 1PZUB 1CIDA 1DVFD 4G6KL 5DQDL 4HKBA 4PQXA 4BXVA 2ZYRA 2Q5BA 2CR0A 4OSUH 2ZTBA 5BXFA 4AUJA 1BLNB 1SN0A 4GQPH 1MCWW 2CPUA 1KB3A 2EXYD 3QEHB 2B7DT 1TMCB 4AI7A 2WCPA 2WM0A 1E3ZA 2GK2A 2Q3ZA 2OCFD 5EHFA 1YNLH 1MCNA 3NP3A 4KXBA 4O02H 3VXMA 2XZQH 4F1SA 1TDQA 4L8CB 3W2DL 4GY4A 5I1EH 4E42A 5G5DA 2FDBP 1QFWI 2YJQA 2AMUA 3IPBA 3QDAA 2H4EA 3BP7B 1IC1A 1UFGA 1I1AC 1J05B 1FC2D 3FB7A 3MRIB 5DRZA 3W1ZA 5IT2H 3PNRB 2FJGA 4N8CH 4ENEC 5C08E 1QX1A 3K4ZA 1VJSA 2IPKB 5JXEA 4QXWA 3FU0A 3K6DA 1RKRA 2BRRL 1A6WL 1BYPA 5GXBB 4G9DA 1NEPA 4MNGE 2EECA 4JPWH 3T0VA 3I02A 1G1KA 1H3XA 1U8IA 2WYZA 4MRCA 4XNMB 4NT6A 3S34H 1MI5D 5I8CA 3K1DA 3F04A 4BDVA 3CHOA 4R96B 4JG0H 4I2XE 5J9PB 1TJGH 1DJSA 1C08B 2DWXA 3BVDB 5AW1B 5DD0H 1MHPH 2B5IB 1UACH 1RJZA 2R8SH 1EBPA 3UTQB 3HG1B 3QRLA 4Y4KC 1I31A 4KXAA 1KMGA 1Z5LA 1HE7A 1HOCA 2OYKA 3W3BA 4CKQA 3STZB 5JW4Q 5IW6A 1NC4A 3TIEA 3RVTD 2JCWA 1U8HB 3NABH 5KTEH 5DHYB 3W9DA 1FFOB 4HBQA 1RK0B 3S3SA 2VAAB 3HE7B 5TDOA 3OR7B 3OC5A 3A4DA 3FO9A 3HNVL 2XWRA 2VLJE 1NKGA 1OHQA 2ZCLH 3ATAA 3QFDA 3BAKA 3FFOA 4JY6A 5IKCB 2VDPL 1E30A 1QPPA 3ROLA 1DUYB 4LESA 5FGSA 1TU2A 3N04A 3P2DA 2YD1A 3DK0A 3RP1A 2RR3A 3OG4B 3FPYA 3ARWA 4TSAH 5AG9A 4UM8B 2NZ9D 4MJ4A 4KTDH 3PV6B 1GTNA 1OAZH 4XPAH 3MREB 1NGWB 3QR2A 3EJZD 3IFNL 4TNFA 1MHHB 3DYMA 1BBJB 2DQUH 2NMSA 2OJEA 4HF5L 5J0BA 1F5WA 3X3GL 4HUMB 4IHOB 4F7TA 3HE6D 1OAUL 3OR6A 1A6ZA 4HIHA 2F18A 2OXHA 5C0DA 2MHAA 2L0DA 2YLHA 3LKOB 1WFTA 1A1OB 1I3VA 2BVOB 4NZRH 5DRXA 1K3ZA 1X5XA 2KPWA 1MLBB 1YN6B 2E46A 5J6HA 1U95A 5A6MA 5DI8A 2AQ2A 3OMNB 3OHMB 2W80C 4U3SA 3QUYA 2UZPA 4Y2DB 4DP8X 1XH3B 2TRHA 1JUFA 3QPKA 2DQCH 2JQMA 4HKZB 2R59A 1LQSR 5MEOA 1FORH 2OI9B 5DFVD 1XF3A 4NNXA 3FT0A 4BWWA 1KENL 3O0LA 3PL6D 5KSBE 1E5CA 1W0WA 3OB0H 5E70A 3PP3H 2YHGA 5FKAA 1TCMA 5I8EB 5E2UL 1ZV9A 1AMXA 2G2RB 1E9QB 2P5EB 1EDQA 4JGNA 4JDEA 3ZYJA 3PDDA 2H6PA 3VYPA 1BZOA 3EFDL 2VSMB 4E9XA 1ZJAA 3L3GA 1F58H 1XZ0A 3JTBA 3FT2A 4I87A 4P57B 3RIAF 2CDGA 1CI3M 1HXMA 2YMXH 4FHBD 1RZIB 4MSWA 2VISB 3GI9H 4HFUL 1T0NA 1MW2A 1AHWB 1JZIA 1WIUA 1CZ8H 4YNYB 5I1LB 1DQML 2FQDA 3WFHA 1NMCC 3MRRB 4F92B 1B0WA 3LHAA 2G60H 1RHFA 3EJRA 4Y7MA 2P8LA 4GS7C 1E4JA 2H45A 4ACTA 2OTUA 3W57A 4XN8A 1GS7A 3NJIA 4A7QA 3UYRH 2B1AL 4KZEH 2HPOA 1OSEA 3FCTB 1SHWA 1KJ2B 1QQDA 3FAWA 2QHRH 3H4HA 5HGHA 2P4AB 2A83B 3UPAA 3O4OC 5EBMB 3G9AB 3RZCD 4EKJA 4IBZA 5MEQB 4DZBB 5IHUL 3BZ4B 4P05A 1Z6JT 1WSST 1WA1X 4IRZL 4YJZL 3DRTB 3H4FA 4KZ0A 1FNLA 4PVLA 3D69A 3JWNG 2BNUA 4TSBL 3CFEB 3V8OA 4TQ8A 1R5IB 1S7VA 1T0MB 2A0LC 2FGZA 3ARDB 1UJTA 3DTDA 1KCUH 4ZTOH 4ELME 4I0KA 5BRQA 3DUSA 1MCRA 3CCHB 4JFZL 1TXKA 1F8TH 3K46A 3MLZL 1EXHA 4AXWB 1UOWA 2JWYA 1NGZB 2JKSA 4BQBA 1FZMB 1IFHH 4XPBH 3O8XD 4P2OD 5DJ2A 1KJ3L 2G3MA 5CZKA 4G8FB 5ICXA 3TBTA 4A6YB 4PVBA 3I2CH 3OZ9L 2OSXA 1YEEL 1SUHA 5KSUB 2VXUH 1FYHB 4U6HA 5FHAL 4B9JA 1ECYA 4MD0B 1KJMB 4N9OB 3T3MF 2VLRB 2MOGA 5GGQL 3BN3B 2F5BL 4GNKB 1DVFA 4G11A 4NBYB 1LE5A 4NCC1 4FMVA 2F74B 1BVZA 1TQSA 1MIEH 3DMMD 3DOSB 1QAWA 4U7KA 1OD7A 5I9QB 3GBNH 1PY0A 2UY7A 3WFDH 2BC4B 3TT3H 5DRWA 15C8L 3BVXA 2HCZX 1NA8A 3DROA 2H3KA 2NNXA 3R1GH 3TN0B 3E3QC 4KXZH 1YEGH 4A1RA 3SPVB 3QAZC 4NP4L 1JZFA 1YHPA 1NAKH 2W92A 5TE6L 2VW6A 4F8TA 4KZDL 3EGXB 4G59C 1U2CA 2XA8H 5EUKA 3RWCA 4Y5XB 1T22A 5C0IA 4ACPA 1RXLA 3BMWA 2X2JA 5D8JL 4U6YA 1V7MH 2Y07L 3GSQA 1Z5HA 1EHKB 1PZ2A 4P23D 4WRLA 5GS3A 3U9PH 5JNYB 4CU8A 2W0LA 1QFPA 2ZOLA 4PG9B 5L8JB 3E80A 3DLQR 5T5NF 1OM3H 4X8XA 4L3CA 2WV3A 3Q0HA 5EO9B 5IFHL 2EVHA 4NLAA 4KKBD 4ZXBA 2EYRB 2E7HA 1L7TH 1G9EA 1AG6A 1MI5A 4HWBH 1ZT1B 5GSVA 1JV5A 4NSKA 3U7YH 4PJAE 4HJGB 1SOKA 4WW2B 1J48A 1KELL 3I84A 4YZFF 5AKSA 4FHJA 1Q0YL 2QV2A 2X6VA 1R75A 1MCIA 4LIQL 2F19L 2WXGA 5GGTL 3D06A 2QVTA 2YQ2A 3BQUD 3QORC 4ZAKD 3U9WA 4ZYKB 5B3NA 3Q6FA 1BEXA 2NY2B 3VCLA 1WZAA 4G71B 4JFYB 1K2DB 1RIHL 5INCB 4FOMA 1VERA 1J5HA 4L4TD 4EBQH 5HDQL 3TV3L 4X6CB 1WYJA 4B0MM 2ZCKH 2A6DB 3CZFB 5F3HB 2PNDA 4E9SA 4OZIB 1WD9A 1C1EL 1KBGH 1MVUA 3BCDA 3OAZH 2ZUSA 2PWGA 1G7QA 3CH1B 5B8CC 3WO3B 1BVKA 3GRWL 3VXSE 1WC7B 2Z31C 3QDGD 3ME0A 1T04B 3MRGA 4TYUA 2N3JA 2VDQH 3QJFB 5F7EL 1YN7B 4JR9H 4HK0A 4YHMH 2Y5TA 4JY5L 1HN1A 4AYDC 1MJ7H 4KAQH 5E95B 2XU9A 3TVMD 2VDKH 4CVZB 4QRUB 3ZL1A 3G6AA 5CEZL 5GS1A 1F4AA 1T6VN 4GI9A 5ICYA 1RZQA 4GW5B 3X13B 2PO6C 3OBAA 4FXGB 3HE6A 4L8SB 3DX2A 4DGVH 3FFCA 4TOYL 2LR4A 5H94B 2DI7A 1NGYB 4PYGA 2BWDA 4OY9A 1DJZA 3MACH 3BVTA 1K4DB 4H4NA 2DTMH 4MCZB 3K81A 2HUHA 4B9PA 2UY6A 3GMPB 3QWOA 2R2BA 4JCWA 1P4BL 5KSVB 1NICA 1HQRB 4TPRH 1HKLH 1JI1A 1KBKA 4Z3GA 4V33A 1NQBA 4K94H 4O58L 4EAEA 1HTYA 2EDNA 4JDVB 4FERA 5EUOA 4N3TA 4L8DB 1SF5A 1VZGA 1EO8H 3V7AE 1OTSC 3PL6A 4JN2A 4LNVA 2COQA 5KS9E 3TO2A 1IAKA 1IC7H 3ULVC 3MOBH 1WAPA 3P3SA 3FN9A 3ARTA 4R0LB 3KPMB 3KWVA 4J28A 4J2QA 5EO0A 2FUTA 4TUKL 5GJTH 2DBLH 1M6OA 2R15A 1DSWA 3SD2A 2X41A 4Y5VC 5CN3A 2QPUA 5DRNB 4NWTL 4PB0L 2AANA 3ML8A 2GJJA 2QTVA 1MFAH 1XH0A 2Q20A 3DARA 3L3HA 4ONGL 4M6NH 3FT3A 1X7QB 1AD9B 2G5BA 1ZVHA 4P48A 1AQKH 2VDPB 1RZJC 2CIIB 5CLYA 5JHDE 2CLZB 4B9ZA 4AM0Q 1EHLH 2R2EA 1NEZB 4ZUSB 2VH5H 3OJMB 3TGXA 3T6QC 1VA9A 4FABH 2OMUB 4YL4A 2IADB 3C60B 3CFDB 5L2KE 3V4PL 3DBXB 4QHLA 4MD5B 2EXSA 4OZHA 2G5RA 1PLCA 3FMGH 4TQIA 3H55A 3SJVE 1I85C 3PHOB 3MBWA 4ANWA 4LSPH 3V2AR 5JMOC 3HRZC 2O61A 2F5AL 3B56A 5B21A 5JIDA 4NJAH 3VFWA 4F3FA 3BAEL 3HC3H 4IW4C 4KRNA 3RZCA 4JL2A 2YUXA 1GZHC 3PWPA 4U0RB 3RQ3A 4J12A 4G8GA 3QJZA 3ZRFC 1NDTA 2BS71 2IJ0C 2WQXA 5L7XL 2J8OA 1JRHH 3LQAL 3QIWB 1F86A 2YSSB 4BFIA 4LSUL 4MMYB 2VR8A 4DH2A 4D0CB 2P5PA 3A4AA 4WTZG 1NEUA 3F7YA 3DV6A 2HFGL 4YHPA 4D9LL 5I6MA 1QW9A 3D3VD 5E08H 1HINL 3LQZA 5HGAA 1BVNP 3JQOB 2BW5A 3LKRA 1M1SA 4KZCA 5DK2A 1CVSC 4P2OA 4WTQA 3RWJA 1OPGH 2X6UA 4NB7A 4PTUB 2GB2A 4D0BB 5T1JA 5F3BA 1BVNT 2JB5L 3QNZB 4X5QA 5HYJD 2H6OA 4YDLB 1J10A 4IOIB 3RIFF 2PN5A 3GZPA 1ASOA 3C5JA 4A68A 4BKLB 4Y4FD 3UDWA 2ALAA 4LAQH 2VC2H 3KGRA 2DMBA 4ZFFA 4ADGA 2AJXH 3D50A 3DMMA 3TBYA 4XC1H 3IGUA 5E9DB 1A7RH 3GLEA 3T0EC 2KLRA 4Z7UE 5T1MA 5HJGA 3B34A 3CLEH 1NBYB 3V52L 4N6QA 1KTJA 2HFEA 4MZIA 1VEOA 5AUMA 2HZHA 2AK4A 1XH1A 1EJ8A 3VSTA 1U3ZA 3LZFL 3FQTA 2WINA 2M1KA 2XTJC 1AGFB 2F53D 1ADQH 1MH5A 3P30H 4X4YB 3RU8H 1WEJL 5FA4B 3L16A 2C1OA 1ZHNA 2WIIB 4KY1L 4UDUA 1M7IB 4L1HA 4WTWA 1RUQL 4PRHD 2EDDA 3LMJH 1MZZA 3AWGA 3PWJA 1K85A 1T7ZA 1UD3A 3EBAA 5DMKB 1X7TA 2BDNL 2CRIA 5TQ0L 1VACA 1BP3B 1QFWL 1CLCA 3HS0C 4P23A 3RAJH 1WBXA 5L6YL 3QW9A 3VFGH 4WFED 3CVDA 4BCXA 2CO7B 1MFDH 1ETZA 2QGBA 1T21B 4DQAA 5EBWA 1S7RB 1OB1A 2ADIB 1PCXA 2UZXA 2CO4A 4XAKE 4LVNB 3K2IA 3ARGB 3E0GA 3IJEA 1NBVH 3DGGB 3BSZA 1E8YA 3CQPA 3X17A 3QH3B 5EUOF 4N2KA 5DWUL 1UYWL 1F56A 4XBPA 1HHHB 2E86A 4U1GC 3U1PA 2V33A 4R7NB 1CQKA 1S3KH 4MAYD 3BQUA 4X8JB 5T5FL 2RCSL 1VIWA 1LM8V 5EU6D 1J7VR 2NUTB 4OD3H 1JPTL 3DO4A 3D18B 3NJHA 4IQHA 4JO1H 4BH7B 2HJFB 4X6EB 4EI5B 4L4TA 3ISWA 4QRPA 4X9BA 1RHHA 3HFFA 4IRJB 2IF7A 4NHUA 4H0IA 1ZGLM 3TEUA 1QWUA 3WG7B 4P2YA 2IDSA 3V0VB 5CFAA 4FQHB 1G9MC 2COVD 5FV2A 3QEQE 3AS1A 2V8MA 1ZLSH 3QDGA 5FW8A 4OGXH 4FQXB 4X50A 4S1RL 2QPFA 1WF5A 5I6KA 3QIBC 4CDHA 5B39B 2AXFA 4LCWE 3RGBA 4OZHF 4NQEB 5I82A 3HPLA 4JN1H 4CBZA 3RG1C 1PX3A 1I9RH 4KMLB 1CLYL 3HBZA 3BWAB 4J3OG 2ATPA 5KVEH 5EOCH 3INUL 4F7CB 5D1ZB 5AZUA 3WTWA 2MWCA 3TYFB 2GY7B 3QCTH 3S88H 3H53A 5EEXA 5KVGL 1FN4B 4ZMVA 3B43A 4HKJB 1LD9A 5F1OB 1SYSB 4YSQA 2EYTB 1FGVH 3GKZA 4P3DB 2HX9A 2WLNA 3FQYA 4HSCX 2Z92A 5DSCA 2Q7NA 1JERA 1E8XA 4DEUA 4P2QB 1I1CA 5C86A 1XGYL 4LPVA 4OVUA 1NANI 2J1XA 4XP9L 5I15L 2Z4TA 4M43H 4HHAA 3NJMA 3UAAA 3QUXB 1OAQH 3QB7C 1H8LA 5EZLA 2RGSA 5DQ9B 2H2PC 1QSFE 1OSPH 5EC1A 1AS6A 3AW5A 5CUSH 2OQJB 2EE6A 3O6KH 1CBVL 3FTUA 3GSVA 1HOEA 2P1YA 2NZIA 3KXFD 4QRQB 4KX8A 3SQOH 3BP6A 2Y7LA 3HZVA 2ITCA 5EN3A 1OGTB 2L4OA 1XTLA 4RETB 1IE5A 2WZ5A 3D4GA 5DD1L 3GJFA 4YDVB 2X9YA 2D7MA 5EPMB 3PUCA 3VD7A 1EDYA 1QSEB 4B3EA 4OM0L 5AW2B 5IK3B 3ZPDA 1HHIA 1N4XH 1G7HB 5GS0L 1Z9SA 2FX7L 1AC0A 4FQIH 4NC1C 3AY4A 2A1WH 4FTVE 3VI3E 1Q90A 1KPVB 3KYOB 3ALWA 2Z1KA 3MGTB 1I1AB 5CKAA 2H0EA 2OPCA 3WJMB 5HD8C 1RURL 3L3JA 4JANB 4JO3H 4R7DB 4DN4L 3KR3H 3PYCA 4N22A 3FU7A 2FWOA 3EOBA 3IU4L 3DHMA 4C56E 1F3DJ 3BKMH 2YRLA 2ZCHL 1OLLA 2ZSWB 2NUPB 2W94A 2QR0A 2WVUA 4W70A 5LJYH 1VGKB 3I50H 3L3OB 4XNBA 1U8CB 5E6ID 2E8ZA 1AANA 4XMVA 1LVEA 5D7LE 5FCUH 4JLRB 4RAVB 4FFYH 1OCWL 3E2HC 2HMIC 4X7TB 4OCLC 1D5XA 1CYWA 5C07D 4C83A 1AYRA 1X6LA 2XN9D 3WIIH 1KGUA 3FTGA 2H1PH 3VM7A 3FL7A 5FK9A 4J6IA 4XOEA 4Y4KB 3H9SE 4LCYA 3T1FB 1WRFA 2FJFA 3SDXB 5DUPH 2CO6A 3WMPA 2X1XR 4BELD 4XVUC 3BZFA 2Z7UA 4PJFA 4Q56A 4BZYA 5L4FA 3HLAB 4MQSB 3LRLA 2WYIA 4Y2NA 4HZ1A 1IGMH 4NEHB 2YD4A 4YWGL 3HI5H 5JYLA 4JO4L 3UJJL 3ZJAA 1E7VA 1AH1A 3QO1B 1NMAL 4H20H 2V2WA 4ODXB 5EF0A 4GO6B 3MHZA 2D0GA 3D25A 3D3VA 3ARSA 4HD5A 4ES9A 3NG5A 5I1AA 4PS8A 4U1NB 4PJHE 4GRLD 1KTBA 3FYEB 1Z0MA 3FUFA 4KGLA 5AALA 1ZPLA 1D5MB 3C6SA 5CIPH 1U91B 4UT6A 5HDRA 4AJVA 3SO5A 5HYJA 4JM4L 4IGBC 1I7ZA 3IGFA 1Q9WA 5LQBH 5LHDA 1HK6A 3VXUB 3S2AA 3GXIA 2IQ9L 5ACZB 4NQCE 5EZOH 5ESAB 4TSCL 4Y4FA 1RPKA 3QJUB 2EZ0C 3BN9C 5D7JC 1MWOA 4G5AA 4RISL 4QI3A 1QI3A 3DIFB 3RDJA 3V4PB 4Y89A 1A4KB 4DKEH 1M71B 3FQNB 3NCJL 4NQDD 4RGMB 3JVGC 4ZOCA 1MY7A 3X14A 4M29A 3LH2L 5GHWH 5D1XD 1W72H 1KBPA 1NLBH 4Q74A 5GJSL 1CL7H 2F53A 1F4WH 1MVFA 3RVUC 4H13C 4LDLB 1TQBB 2ZZUT 3JV0A 2BOCB 5HYEA 5I6XC 3EYOA 1EPFA 4PRHA 5IEKA 1B3IA 1CFVL 4K7PY 2OMTA 4R7LA 2DLGA 4K23H 2JH2A 3B4NA 5E8OA 3N42F 3CPLA 3WEOA 1I9EA 5GRYA 3IWUA 4UT9L 1BECA 3ZZ1A 4ZX3A 2GIXA 3FRPB 1PD0A 5H2BB 1D5ZA 5E03A 5DD3H 3FOMB 3NIDF 3UGUA 4NN5B 2YPLB 2MEJB 5GZOD 2AABH 3BXNA 3DTXA 1E9OB 2D7TH 2FSEB 2QLYA 5FFGA 3ZDZB 4U33A 1THCA 3ZQWA 4EN3D 4M6OH 1N0XH 4QRFA 5C0AD 3BVWA 4F80A 4XCNB 3H54A 4PJDB 4YSEA 5FUOL 5EU6A 4OBRA 3FSZA 1BIIB 1MQKH 1MCOL 4OCSL 4CAGA 2IXQA 3MLSL 3OC8A 3IRCA 4NO0D 3KYKH 5EU4A 1E9PB 4OR1A 4LLYA 1GOFA 5JPMA 1QOKA 2CRMA 1H3VA 2GVYA 3D07A 1GYWA 1P5UC 1SMDA 3ZQ9A 3ZVVA 4D0DA 1R0AL 4JAMB 1YUKB 2NX5B 3O4OB 5DHMC 5FAAA 2K4WA 4DAGH 3CHSA 1VDGA 3M1OA 3KWWA 3FO1A 3JTSB 3LN4A 4LRNH 4HC1L 2EDXA 3BP5B 3DXAA 3MX0A 4X9GA 3S35X 5EORL 4WIQA 5IG7A 4R7VA 3HZMA 4ZTPL 1R3JA 3QHZL 4A7SA 1FAIL 4DKDC 2WD0A 4P59L 3J7HA 2IALA 2OL3L 5FYLD 1UXMA 3OPZH 5C0FB 4A37A 4W4OA 3LD8C 2ZF9A 4E41E 2P7TA 1BIHA 4K7FB 4LU5L 4ZMXA 4HCGA 2GPZA 4YVUA 4EQ2A 3D7PA 3EFOA 1JHTA 4UBDC 2PW1B 2Y1ZA 3NGBB 4FQQA 2RTTA 1U4EA 5C8JA 2Z0BA 4ZNCD 2Z35B 4PJFF 2Z4QB 5DHVB 1BAWA 3RFZA 1LDPH 1YNKL 2VUOA 3MGOA 3ZZSA 5FOBA 1MFVA 1NGQL 3MV8D 1CVRA 1JNHA 2EIEA 3LSOB 4RIRA 5H35B 3KJ4C 4K9EC 2XZAH 3RYMA 1ZKAA 3BH8A 2CLVA 3K72A 1WAAE 2IH3B 3PU7A 3VB8A 1G7MA 5KVFH 3V4UL 3KXFA 1ROWA 3H3PL 3BIAX 4KO9A 3Q2NA 4OAWB 3BYYA 1X9UA 2O93L 3PAYA 4KQ4L 4PR5A 4N2OA 3MV9D 5E8DH 1BCIA 1P5VB 5EMYA 2CO1A 3BQVA 2WVVA 3SYQA 1EIBA 1MLCB 4NWUL 3SKMB 4ZQTA 4L9LA 1NL0H 4L3EB 2X44D 4WUUA 5AG8A 3U2JA 4BFKA 4DZ8B 5C6PB 5IREA 3M1BA 4XNXL 3NQKA 4K2UH 3GIZH 1KEGL 5F88A 4OLUH 2B39A 1JPSH 2MFNA 4MWFA 1QA9A 2BNRE 2DMKA 2Y06L 3ARFD 1DO5A 2VL5B 3OM3B 4AMKL 3VDAA 4WLCA 3DX7B 2C9RA 1REIA 4GRWF 3H9YA 4KBPA 3HKFA 2WWNA 3N40P 3GSUA 1H5BC 4NFBA 5EWIH 4M4PA 4WWNA 4MS6A 1AD0A 1YDPA 4ORGB 4PJ9C 1W8EA 4KTEH 1ZXKA 2X4UB 3C08H 1ES0B 1MCQA 1XGQB 1GZPA 1SJHA 1CU4L 6TAAA 2XN9A 3IMUA 4AC4A 1F02I 4C4BA 3SCMC 1MEXL 4YXLL 4G80A 2AZUA 1W80A 5IB3B 4JREC 4X80L 1KIQA 2LW3A 3JWNE 2D31A 2NY0B 2OTWB 2WXNA 1M05A 5DYOB 1UJ3C 1YO4A 2C4FT 1Z3GH 4D94A 5G4OA 1WBYA 1BFOA 2GJZB 4JKNA 5GRUH 3MJ8A 4R90L 4X7FC 4AQAA 3VJ6B 4AIZB 2VO8A 1BF5A 1AI1L 1BM3H 2EH8H 4HGWB 4RWHA 4H8HA 5E8NA 5GRZA 2Q8BH 2C5DC 4D9RD 2ZUQC 2Z31B 1SXCA 4OFPA 3M07A 4J27A 4NRYA 1KN4H 1RULH 1ZVSB 5F1KC 2C9VA 2VQ4A 4GRLA 3S8FB 2D3JA 3CDGB 3FYIB 4J1UA 3DSNA 2FD6L 2HWZH 2YZ8A 5M7QA 1EEYA 3ULUD 4JKWA 4DETA 2GC7C 1WZKA 3KNBB 2E75C 3HPJB 4J4PC 5JOFB 2WKOF 4P3CL 4LBAA 4MJID 1E2ZA 2R0KH 4O02A 1UOKA 3ILQC 4WJ5A 3J2PA 2CCVA 5JO5A 4Y2LA 1PF3A 5C08B 1B6DA 2PO6B 2XY2A 4W68A 4WK0B 5T1KD 4OI8A 2VDOB 3CTTA 5CJXC 3BJ91 3ZYIA 4MNGB 2HT3C 2DPKA 1IKNC 3BD3A 2DBJA 1S5IL 1Z32X 4W9HC 4JDTH 4BQCA 1J8HE 4NQDA 1UM5L 4GLRI 4L5FH 3MZTA 5FDYA 4AQ1A 5J7CC 4XMXA 1ZGLA 2VMFA 4I2XB 4XOAA 5D1XA 3PWVB 3TS8A 4WUKL 2X0WA 2XKNA 3L1FA 3L4TA 4NO5B 3VMNA 4XMWA 2NSQA 5T5NG 1KY6A 1DQJA 1KYAA 2V2XB 1H3WM 4JRYD 3KS0H 2IAND 1HEHC 2BSTB 4OLXL 3QFGA 3PDOB 5BRZD 4DEWA 2HVKA 4XRCB 4A2DA 1WWBX 5CCKH 3QQ9C 2Y2YA 4QLRA 2DYPD 3VWJA 3MUY1 4R8WL 1U8OB 4LCVA 3WEBA 4KTYA 2RD0A 5ESQA 4OIIH 2MTPA 2W9DH 4Y5VB 1DR9A 3S96A 4FTDA 4I0PC 1MFMA 2ZSVA 3AXLB 2VLJB 2PPFA 5GZOA 3MNWA 1FNFA 2QZQA 2XV2A 3B3IA 4KXDA 2W59A 2LAGB 3TTYA 2PP9A 4WNJA 4N90E 1AYOA 4ZMPA 1AQDA 1Q9LB 4M5ZL 4NZFA 4FNLH 1P1VA 5C0AA 4BRVA 2X9WA 4KI5D 1HILB 4WI7A 1I1RA 2N4IA 5BZZA 2GAZB 4KVNH 5HI5D 5IOPB 2IGFH 1QACA 4KRPC 3C2AH 4R2GD 4ZNEA 4GOSA 2EDEA 4N2DA 5A3ID 1LEKA 1SOSA 1U8NA 2E4FA 4HS6A 1V54B 4K8RD 4A2LA 2DJSA 2HVJA 3HRZB 1L5GB 1V3LA 4OI7A 4BINA 1D6EB 3ZDXF 5KBNC 3JV4A 3FQRB 4OU3A 1AOHA 1FFRA 3BWZA 4JG5A 2PYEE 1A6UH 4WFHD 5F1IA 3KPSB 3A6OA 3FSOA 1NGPH 1R3HB 3NJJA 4JVPA 5AL8A 1XZWA 1A1MA 2NTFB 3I9GL 4Y4HC 4BQ8A 2D4FA 4P4KC 3BEVA 5T3ZE 1FFQA 3EYQC 4U1IB 2DF3A 3ARXA 3WS3B 4V2BA 2VN4A 2DLHA 4PIRF 4AG4H 4QAMB 1GVIA 1T66C 4BJLA 1NAML 3QDME 1NOAA 3BAWA 3Q9PA 4KK9C 5F71A 1UD4A 3LEXB 3PIQB 5CGYC 3UC0H 1XTMA 2E76C 2LE9A 4GXFA 5LXVA 3NIFB 5CLXA 4EDXA 2BP0A 2NY6B 3AQDA 2I07B 3HC4H 4QRTA 2K7QA 2J44A 4IM8A 1C5DB 2R56H 3GSNB 4G8EB 2ED8A 3U4BL 4ODSH 1RJLA 3TBVA 2ZYSA 3MFGB 3MV8A 2XQYK 3FU9A 4H7VA 3TIDB 3APCA 4CGUB 1UFUA 1WGVA 3QEGL 1MIML 1AXTL 3WXWH 4XC3L 1S2EA 4E9LA 3I74A 5DZVA 2EACA 1F3JB 4ATWA 5TE7L 5FYJH 5AZ2H 1PL3A 3ZN6A 3P4LA 1IM9B 2E47A 2VDNH 2E7LA 3QXAA 2ZCZA 3MV9A 4Y9FA 2X88A 3ATFA 4L0ZA 3WN5C 1P7HL 4N20A 1V05A 4WGKA 1HAWA 1PYWA 4NAMA 4GKNB 2EKSB 4MS8D 3MCKA 2CHXA 2WN2A 4H25A 2FNWA 2VJXA 1BG9A 2EXWD 3TBSB 3BPCB 4G8IB 5E99H 5ALCH 2I9TA 2A9NH 2PWEA 3ECQA 4CNIA 1K9TA 3TNNB 1E4KC 2VLLA 5IY5B 2XQ0A 2IEPA 2OL3B 1HXYA 4Y1AE 1LP9B 4P9HL 3RWGB 1UWEL 3G5VA 4KGJA 4YGVB 3DTUB 1PTZA 4CJ0A 2ZQKA 1L4IA 1UOVA 1Y18B 2R1WA 5K1JA 3TZVD 4G3YH 4U1GB 1DBMH 4UUJB 2MPAL 3RDTD 2WLLB 5DVLA 2N01B 2YRPA 3D0LB 5HBBA 2DV6A 1X3DA 2ICWA 3FK3A 4OKDA 4L4VD 1HHGA 2YSTA 1U8LA 4HZLB 3P3YA 5F8QC 4GO8A 4OT1L 4PVNA 1UM4H 3MUJA 4N2IA 4Z9KB 2QQLL 1BAFH 3GFUA 4ANKA 5IIEA 3M7OA 5GRJL 3MNZB 5J3HC 3UMNA 1KCLA 4AQOA 2VOTA 4O00A 4M93C 3UBFA 2JKTM 1QEXA 3F01A 4ZFOL 2B1HL 3VGGA 3QIBB 5LAPA 3T8XB 4BSVB 3GM0A 4JFQB 5KW9H 2PP8A 4NN6C 1S7WA 1ZA6B 3IN2A 1E5ZA 2XWJA 4PJCE 2Y0SA 3VXRE 4MJIA 5L88L 4QTIH 1CXIA 3F3HA 2P5WE 2PCYA 2EO1A 2C3GA 3MRDA 1EFXA 4RA3A 4JJHA 5F9DC 2ITDB 1C7TA 4AL8C 2IGLA 2Z6FA 5T1KA 2D8KA 2MCPL 3Q1SH 5GPRA 4CC4C 1WQVT 4KHXH 1BA9A 1GYUA 3MRPB 3SGEI 1S46A 1XCTB 3V4VH 4OCRL 3MLTB 3WFBH 3IVKA 4LSVL 35C8H 5FHBH 4ZMNA 1QVOB 2WGNB 4X9HA 2GI0A 4AYSA 3P4MA 3VFVA 3HIZA 1JCKA 3BUTA 4EI6B 4JRYA 3WHXB 2QFPA 1XF4B 2ZX6A 2ZXBA 3LEVL 4MJ6A 3WU1A 4ZZKA 4GG6B 3CZLA 3EH3B 3RVVC 3RKDC 1MFEL 3P73A 1FGNL 1T83C 1IJ9A 3LKPB 3MAWA 1MAML 3L3DA 4GKZA 3O3DB 1H3PL 4FYSA 4AVKA 3BO8B 2PPDA 1MPAH 1J0ZA 1T0OA 1KJ2H 1ZLWK 3Q2CA 5E8PB 1V5JA 1ZEAH 5FF6B 2QKIB 5AAWC 1U6AH 4YXKL 1JHLL 4AQ1B 5HPMB 4XNDA 2PABA 1XDTT 4QWWC 4Y0GA 2JCCE 2VE6A 4KJPC 4ZTEA 3HFMH 2LGNA 1J0IA 1YEFL 5HPOA 3SBWA 3TEWA 4LLUA 1XCWA 1MY5A 4LK4A 2R0LH 3UABA 4MZ2A 1FZJB 5HY9A 2X1QA 5F7LB 3UG4A 2P8PA 2X4RA 1DCLA 3IKKA 4WDIA 3G6JE 4EZLA 1T4KA 3E2HB 4GSUA 2DJ4A 4HBCL 1JZ6A 2JF1A 3QI9C 2VLKB 4HJJH 1WGOA 4HUWB 3MKGA 4X6DA 2YC1A 3SQBB 1XGRB 1RUPL 4N6RA 4WVRA 2ADGB 2WNWA 5IMKB 5ID0B 5CEYB 5B3JF 5D7HA 4LQFH 1IARB 3V6ZB 4Q7DA 1Y0LA 2KDYA 2VR6A 2A0LD 2WN3A 3VA2C 1MCEA 3CC1A 4GJTB 2X2YA 4XMLH 4WFFE 1KLGA 2BSRA 3GHEH 1R5WB 4RMQA 4TUUA 4WWID 4OLVH 5K39A 4G70B 2I69A 3V5KB 3IF1B 2WLYA 3BWUC 3L9RB 4FC3E 2CBMA 2ED9A 4PRDB 3WFZA 2IMMA 3VXNB 1ERNA 1GYCA 3E8VA 5D1QC 4XNQA 4AH2B 2IV9A 1FDLH 2UXTA 1YY8A 4IGBB 5J8OA 3T9WA 2CGZA 3FU6A 5D6CA 1S5HA 5H4YA 5I73C 1DVXA 4JY4A 2AQRA 1EGJA 1A4AA 3ZE0B 4RESB 3CVHL 3EUUA 4WO4C 4NERA 3KPTA 3K5SA 1QNZH 4FKHA 1ZSHA 2WBJD 1NBZB 1OOWA 1T7YA 4JFFD 5SWZE 5IGXL 5L2KB 3WDJA 1Q0XH 3GDBA 3REWA 4RSVA 4UTBH 3ULUF 3OMAB 5ANMB 3R18A 1YMHB 3PQYD 1H15A 1JWSB 3SJVB 4D9QD 3STLA 3B9KC 3ROOA 4M62H 3WLBA 5J11C 2J8UA 4MLSA 5I1GL 4JRLA 1WISA 5I6XB 4X8CA 4O2FA 1ORQB 1YMME 4XHJD 3U6XS 1KYDA 3K3QA 5CCJA 3AS2A 1P4LA 5EEVA 1JS4A 5DUJA 1BJMA 3NJXA 2ILLA 4G6KH 5DQDH 1GGTA 4HAKA 3TEXA 3RTQD 4FLRA 4XNUL 4HX1A 3VXOB 5K9QG 3KDMA 1HYSC 3D09A 3UTTE 4JFHE 1LYQA 2D0HA 5C0BD 1HU8A 4LCUA 5I16B 2EIJB 3KVDD 1L3WA 1CDJA 4NZDA 4N3UA 4HEPA 4BZ2L 1DUZA 1ZK5A 3O45B 3W2DH 4QRRB 4FYTA 4FULA 4X5WB 3TZVA 1N26A 1J88A 1L3NA 2APWA 4LZKA 1N6QL 4WEBL 4KITB 4IK6A 1V8HA 4UIKL 3MR9A 4PRNB 4PGEB 5MHSD 5IFAL 4IS6A 4N0FA 2F1EA 1QUNB 2HLAA 3KL3A 2BRRH 1A6WH 4WK4B 3KBFA 1C7SA 3GLDA 4L4VA 1BD2B 4WGWB 4BKTC 5AYUL 4ZMOA 2BNQB 1P5UB 3II2A 1FG2B 1NCIA 2DQ6A 2J20A 3CX5K 4PJEE 3UG5A 1QYGL 3JYCA 3JYBA 3NIGF 5AL0A 3QFJE 4TF4A 5LVEA 4MJ5B 3K2MC 1I8AA 1PVHA 5C0NC 1XD1A 2A6JA 2Y1AA 2UWEE 4A7TA 3PFQA 1WT5A 3Q8EA 2FHBA 3VX1A 3LD8B 9PCYA 4GXUN 4GT7A 4TNVF 4X6DF 2XPGB 3GMQA 3AITA 4S0TD 3ZE2E 2DJUA 5IMLB 4MQ7A 4PRIE 5LCVA 3WUWB 4WI3A 3HNVH 1BQRA 1K8DB 3N43F 4FF9A 4FL4B 2VDPH 2WNGA 1V10A 3D39E 2E7MA 1FL3B 4P2RD 5C70A 1AGCA 5CCGE 2XVLA 2CR3A 1TPXC 5A16B 1NCWL 5FO9B 3H3KA 2X40A 3KHOA 3KJ4B 4WI4A 5FO7B 3UERA 3VFTA 3HAEB 4AZUA 2C9QA 3IFNH 3U36A 1L6XA 3QS2A 1MCFA 5CU5A 4HF5H 2K8MA 4GPVA 1R17A 3CMGA 3X3GH 1B2YA 1OAUH 3WNJA 4XVJL 4DPCX 5D2NE 2YPKA 3GZKA 4GQZA 5B3SB 3RRQA 3F6IA 4AEHL 5HYQB 3FQ1A 5JXAL 1RD6A 4ONFL 4ISVB 5IVXA 4UYQA 4BRJA 4QJ4B 1TEYA 4PJ7B 2VMCA 1CDBA 1FYTB 4GAYA 5HI3C 3MLUL 4PCTA 1GSKA 4K15A 5KYYB 1Y6KR 1VESA 2UX6A 5I75C 2G5UA 1ZHBB 1WBZB 4KJWD 2OJZL 5K9KA 4AKPA 4TNEA 3CVBA 2KZWA 1IGCL 4LEOA 3KYNA 1KENH 3DX6A 4DK3A 2WAHA 4UOW0 5IMMA 1J8SA 5SWSD 1G87A 1NLDL 2VRKA 2OBGA 3HUJE 5E2UH 2AP2A 2X4PA 1IZJA 3GSOA 2J8UF 2FZ3A 3EOTL 1JK9B 3FH7A 3WIHA 4PJ9B 3EFDH 2OYPA 2RFXA 3PUUA 1OZTG 2O4EA 2BCKB 3MRFA 4RLDA 3OZLA 4LHUD 4PRAB 4AJYV 1PQZB 3E9UA 4AOFA 4NUQA 5E1HB 2VXTL 3IRZA 3MUGB 3SCMB 1QRNE 1HFUA 4A55A 3QARA 3OXSB 4RAUB 2BHYA 3HZKA 3L7FB 4QHNB 1KNOB 4HFUH 5AW5B 4AV0A 4IJ3C 5HVFB 1UJ3B 4M8QA 4M48L 4ODVL 3GQFA 1DQMH 3N2JA 5JHAA 5MI0C 1T7VA 2I5YL 4GUQA 4NUPA 2HA1A 3O6FB 3MO1B 4ZDHA 4ZSOE 5AB2A 1HH6B 4QIRA 1WP6A 3DPBB 2F54B 3P0VL 2ZUQB 4HXBL 4PHZA 2B1AH 4NS0A 5C0GA 2DLIA 3OKLB 4PFEA 3ZKMD 1EXGA 1JDCA 2ZG1A 3U2SA 4EE2A 5I5JA 4HIIB 2V7NA 4ZO7A 5IHUH 5T8IA 4WV1A 5TDPB 4IRZH 3RBSA 3PXJA 1G1YA 5HGDB 4G6AD 2BXYA 2NNAA 2YBRA 4LO9A 4DCQB 2LLNA 4K5LA 4TSBH 4P5KA 3BRDA 1UT2A 1YYML 1YQ2A 1HHKB 4FQJL 2WBJA 4S2SB 5EZPA 5C09A 2ZAHA 4BM7A 2BY0A 4C56B 3QQDA 4JFFA 4BFRA 4JUSA 3NCEB 3BIBX 2BY2A 1Z9OA 4JFZH 2FYYA 3MLZH 2JJTC 3D85D 3DYPA 4U1KA 2RIKA 5KYWB 1E4XI 1YNTA 3ABMB 1ZVNA 3PQYA 2YK1L 2UUDK 3G5ZB 2XTJD 3BD5A