3V9CA

Type-2 cu-depleted fungus laccase from trametes hirsuta at low dose of ionization radiation
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
499
structure length
499
Chain Sequence
b'AVGPVADLTITDAAVSPDGFSRQAVVVNGVTPGPLVAGNIGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQHGTNWADGPAFINQCPISPGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASRYDVDNDDTVITLADWYHTAAKLGPRFPGGADATLINGKGRAPSDSVAELSVIKVTKGKRYRFRLVSLSCNPNHTFSIDGHNLTIIEVDSVNSQPLEVDSIQIFAAQRYSFVLDANQAVDNYWIRANPNFGNVGFDGGINSAILRYDGAPAVEPTTNQTTSVKPLNEVDLHPLVSTPVPGSPSSGGVDKAINMAFNFNGSNFFINGASFVPPTVPVLLQILSGAQTAQDLLPSGSVYVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGSTVYNYDNPIFRDVVSTGTPAAGDNVTIRFDTNNPGPWFLHCHIDFHLEGGFAVVMAEDTPDVKAVNPVPQAWSDLCPTYDALDPNDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
publication title Crystal structure of T2-depleted fungal laccase from Trametes hirsuta 072 at low and high dose of ionization radiation
rcsb
molecule tags Oxidoreductase
total genus 145
structure length 499
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA03
1B3IA 1KBWA 4A68A 2N0MA 5D4JA 3NJLA 3SBQA 3V9CA 3QJTB 3EH5B 4DP6X 2B08A 4YSRA 1PNCA 2IWKA 3AG3B 1JXGA 4KO6A 1GSKA 3CVCA 4P5RA 3NSFA 3OD3A 4BXSV 2H3XC 4DP0X 1ZPUA 1SDDA 1ASQA 1ZDSA 1TU2A 3V9EA 1OCCB 2FQGA 1PF3A 3ABMB 4HAKA 2FNWA 5B7MA 2X87A 3NP4A 9PCYA 1NIEA 1GR7A 4DP8X 1XMEB 2XV0A 4YSPA 4BWTA 2GIMA 2XLLA 1FWXA 2W88A 1JERA 2QDVA 2J5WA 3UABA 3T71A 1NIFA 4YSDA 1KV7A 4BWWA 2QDWA 1V55B 1ILSA 1SHWA 2QT6A 1GY1A 4AX3A 2RACA 1AANA 1PMYA 2J56A 2EILB 1MZZA 4DP1X 1AG6A 4E9XA 1CYXA 1NWPA 2GB2A 2BHFA 1IBZA 1BXAA 3AW5A 3FS9A 1SDDB 1GYCA 4BDVA 2YAEA 3DTUB 3FYEB 4YSSA 4G72B 1JXDA 2EIKB 2XV3A 3CG8A 3FPYA 1E30A 3GDCA 2VM3A 5I28A 4N8UA 3WIAA 4DPCX 2YAMA 5AZUA 1BQRA 3ASNB 3UAAA 4N4YB 1FFTB 3ABLB 5I6MA 1BXVA 1PY0A 2AANA 4L0PB 1PLCA 2J55A 1ZIBA 1NIBA 2PLTA 3QJUB 2IDFA 2P80A 3IBOA 1PNDA 1W8EA 4GYBA 4P5SA 2PPDA 2Q9OA 3PAVA 3TBCA 4G70B 1RZPA 4AZUA 1J9RA 2B3IA 2DWTA 5B1AB 3ASOB 1GY2A 1GS7A 5I6OA 2UXTA 1BAWA 1KDJA 2H5UA 1PZCA 1NWOA 4YSOA 5ANHA 4HIPA 3S3DB 3NJIA 2HX7A 1AAJA 4BDVB 3PPSA 4KOCA 1UATA 2DYRB 5PAZA 3T6VA 1AACA 1TKWA 1L9SA 3PAUA 1NDTA 1AZNA 4GP4B 1BXUA 5AKRA 1J9QA 3FU8A 1J9TA 1AZBA 1E5ZA 1PZAA 2FQDA 3DKHA 4CSZA 2TSAA 3EH3B 4WTQA 4DPBX 4PAZA 1ZDQA 4E9WA 3IE9A 3FSAA 4DP2X 4KNTA 4MFHA 4QKTA 3IEAA 3OM3B 2XU9A 1NINA 1AZUA 3MBWB 3X1NA 2HLEB 4F7KA 1OCOB 1OE3A 1IUZA 6PCYA 3FYIB 1JZHA 1CC3A 1URIA 2XV2A 4AI7A 1KGYE 3G5WA 1NPNA 3SBPA 2YAHA 4A67A 3PXLA 3QJQB 1V10A 6PAZA 2BP0A 1I53A 1YLBB 1IBYA 1OV8A 1AZCA 2BP8A 3UACA 3RYMA 4BK5C 2PPAA 2PP7A 2JXMA 3NP3A 4A2FA 3CZUB 1XB6A 1TEFA 4DP4X 5I26A 2FT6A 1MZYA 1ETJA 1OCRB 1L9TA 1EHKB 4BXVA 2MRYA 3UADA 2TSBA 3EHBB 3X1EA 5I5MA 4GP8B 1M9WA 5TK4A 5TK2A 3X1BA 1QLEB 2OV0A 1FA4A 2GSMB 1SHXA 4G7SB 2AZUA 5E9NA 3NJKA 2HRHA 4QLWA 2ZOOA 5I6LA 1XB3A 1XB8A 2HZHA 4HCIA 3WNJA 1A65A 1JXFA 2VW4A 2HRGA 2YAQA 3NJMA 1ID2A 1R1CA 1BQ5A 2BP0B 2IH8A 2YARA 3EH4B 2PPFA 1KCBA 5B7FA 2BP8B 3GXUB 1SJMA 2FJSA 2W8CA 3PAZA 2AVFA 3WKPA 5B1KA 1JVOA 4Q8BA 3TU6A 3AG1B 2PP9A 1DYZA 3FU9A 1J9SA 1A4CA 2DWSA 1OOWA 4YVNA 4HCFA 2DV6A 3S3CB 1WS8A 3FQ2A 5F7AA 7PAZA 3H4HA 3AY2A 1X9RA 2FQEA 1JZJA 3CDZA 2PCFA 1SFHA 3KW8A 1GS6X 2IDUA 3ZBMA 1RZQA 2P80D 2VW6A 2IDSA 2FT7A 1HAUA 1AIZA 2BO0A 1VLXA 2ZWNA 4AKPA 2AFNA 1PCSA 2DYSB 2NRDA 4CSPA 1JOIA 1ILUA 1KBVA 1NTDA 4KOBA 5EHFA 3OMIB 4E9YA 2EIJB 2FTAA 4E9QA 1BEXA 2CUAA 3H4FA 1JZEA 1SFDA 2OCCB 2CBPA 5PCYA 3FSWA 3S8FB 3ABGA 2GI0A 1ET7A 3WNIA 5FC9A 3NJFA 1HAWA 1CUOA 1NIDA 1OE1A 4UANA 4JKNA 2IDTA 5AFAA 2MTAA 4HHWA 1M56B 3S3BB 3QJRB 1MDAA 1L9PA 1AZRA 3CDZB 3FSVA 2HX8A 2VM4A 4G7RB 1J5CA 1JZFA 5I5JA 2GC4C 1ET8A 2IWEA 2BZ7A 3FU7A 3QJVB 3JT2A 1KYAA 3AG4B 4W1TA 5B7EA 2Y69B 4A2EA 2IH9A 5LDUA 3DIVA 4F2EA 5IY5B 4YSAA 5I6NA 3OMAB 3X1FA 1GS8A 5I5IA 1OE2A 1E65A 1AS8A 3UGEA 1CYWA 2Q5BA 2H47C 4F2FA 2FQFA 3HEIB 3WI9A 2JFCA 4DP9X 1X9UA 1TEGA 3WG7B 4M3HA 1CURA 1E67A 3AZUA 2BW5A 1NICA 2CJ3A 1L9QA 1SNRA 1BYPA 4A2HA 2YXVA 1A4AA 1WA1X 1WS7A 3NJHA 4UF7C 1EZLA 2UX6A 2VMJA 3FU7B 1OCZB 2PPCA 4YSTA 1F56A 2YAFA 3EF4A 1PAZA 3U25A 4KO5A 1ASOA 8PAZA 4HALA 1MG2C 1SF5A 2XX1A 3WKQA 4G71B 2GC7C 1L9OA 1WA0X 1SF3A 3NJJA 3ZX1A 1AOZA 2QPDB 3N55A 1DZ0A 1N68A 1M57B 3ZIYA 2I85A 1L9RA 3NJNA 4GY4A 3FQ1A 4HCGA 4UAHA 4DPAX 5A7EA 4E9VA 2XUWA 2GBAA 3X2QB 3TA4D 1WA2X 3KW7A 4Q89A 5I6KA 4YSEA 3D12B 3IN0A 2YXWA 3NSDA 1ET5A 1A3ZA 1PLAA 1IKOP 1BQKA 1AS7A 3OMNB 3ZDWA 2EINB 2CAKA 1PLBA 4W9ZA 2XYBA 1N70A 3C75A 2AZAA 1RCYA 4M4RB 4AKOA 5D4IA 2IAAC 4RH4A 3T6ZA 1ADWA 3NJGA 4YVUA 2A3TA 4KNUA 3NSYA 3L45A 4KNSA 4FA7B 1QHQA 1V54B 2XX0A 4AKQA 1JZIA 2XXFA 3BQVA 2ZXWB 3QJSB 4EF3A 5D4HA 1PZBA 2LLNA 2WO2B 2J57A 1BYOA 4E9RA 4YL4A 2R7EA 2I7OA 3S8GB 2XVBA 3QPKA 2VW7A 1WAEA 4ENZA 3AG2B 1J5DA 2HXAA 1T5KA 4ZK8A 4E9SA 3GYRA 2WSDA 5B3SB 4WKXA 1E5YA 1JVLA 2I7SA 4GXFA 4PCYA 3H56A 1ZV2A 2BW4A 4YSQA 2BWIA 2UXFA 2GHZA 3UAEA 1A4BA 3PCYA 1QNIA 3IN2A 4K9JA 2XXGA 3CVDA 2OJ1A 2PCYA 2UX7A 3CVBA 3T6XA 4YSUA 5B1JC 2DY2A 2ZONA 4FAAB 4A2GA 3HB3B 4NB7A 3MX0B 1NPJA 3JTBA 2QPEB 1A8ZA 1AQ8A 4JHVA 1NZRA 3FPXA 3FT0A 3T6WA 2FT8A 2E86A 3SQRA 2EIMB 2IWFA 2YQBA 1W6LA 3FQYA 1NIAA 2R7EB 4NAJA 2WO3B 1MG3C 4HZ1A 4A66A 3TASA 1IC0A 2JKWA 2CALA 3FSZA 2CCWA 1W6WA 4KO9A 7PCYA 2VSKB 3PLYA 3SBRA 1OF0A 2Y1AA 3QQXA 4KO7A 5I6PA 1AG0A 4YSCA 2VSMB 3NT0A 4A2DA 4DP7X 2FWLB 4NERA 5B1JA 2UXGA 3OQRA 4JHUA 3NYKA 2HX9A 2YAOA 3ERXA 4TXVB 4BWUA 1ZIAA 3BVDB 5B1BB 3T9WA 2X88A 3X1GA 1RKRA 1ASPA 2IDQA 2XWZA 2YAPA 4GP5B 1KDIA 4G7QB 4E9TA 2PP8A 2PPEA 4X4KA 1AS6A 3NSCA 1JZGA 2UXVA 1KCWA 2BZCA 5F7BA 1GW0A 1HFUA 2BWDA 3N2JA 2VN3A 1AR1B 3TBBA 4DP5X 4HHGA 3ABKB
chains in the Genus database with same CATH superfamily
5KANG 2NX5E 2ZUVA 1RUMH 5DHEA 5IJBC 4NFBA 1BLNB 5D2LF 4L3AA 4JHAH 2B08A 3EJYC 3ZKNC 4PB9L 4YSRA 3L7FA 5B38G 3TBTA 4L4TB 3MGTB 4DEPB 3PPEA 2XV6B 1JXGA 2E6PA 4YX2L 3RKDC 3DX4A 3NFNA 3Q0HA 1ZLVH 3WTYA 3TVMA 4GSRA 3ARSA 2IAND 3FTZA 2H3XC 3U46A 5SWZE 1BFOB 4JL2A 5EOTA 1BAGA 5LQBL 3JV0A 1V7NH 1QSFA 4Y5YC 2FQGA 2YLKA 4HAKA 1I4FA 3PXJA 1CZ8H 1S7VA 3CFUA 1E4WH 2LOEA 1PYWA 2MNWA 3JTSA 3QH3B 3NP4A 4GEIA 2Z65C 1IGFH 1GR7A 5DRZA 5DT1H 4Z0BH 4HGKC 4HULB 5T3ZD 5I1DA 2C26A 4O58H 1GGBL 4AQ8C 3WGVB 3ZKMD 2YGVA 5B39A 1QI4A 1W0VA 2ATKA 5C86A 5JHBA 1OAKL 3GI8L 3IU3A 5T5FH 1XWVA 43CAB 3I3BA 2J3SA 5KYUA 5KANI 4WDIB 3WS3B 1YEJL 1FNGA 1U93B 4AGNA 2GUOB 3INUH 2NLJA 25C8L 4U1IA 1TVBB 3KPRE 3VFOA 1G7LB 1NKRA 2P26A 3O0RH 3GJFK 4ODWB 4NQCB 1ED3B 4L9LB 5ITBH 4YMPA 3KDMA 1B2WL 1HEHC 3C5XA 1D2OA 4R7VA 1SYSA 1SDDB 1UM6L 4B96A 3QARA 1H3PH 3FYEB 1MREH 1ZLWH 4BKTC 1EFXA 5JZ7D 2BC4A 3V4LA 4P46A 2L4OA 4K71B 5GQBA 2QGDA 4XMLH 2A9MH 5FGSA 4DPCX 4NHUA 4O02H 3N0AA 4ABVA 3HG2A 5DEJA 1TETH 3DMMB 3KJ4B 1L0YA 3MODH 1AO7B 2ZOKB 4HD5A 1AFVH 4P9HC 3WTSA 5EFIB 4LHUB 2FAUA 2PLTA 4G8EA 4O2EA 4OF8A 4QT5B 4QRTB 1ZKAA 2MIZA 5GSVB 2IDFA 4M6ML 2VR8A 3O4OB 3QGVA 1W8EA 2ICEC 3T3ME 1SGKA 1U58A 4KX9A 2OI9B 3MREA 4GAJH 1TQVA 1A9BB 2C3VA 2UUDH 5BV7L 2IFFL 3ZRSA 2YN5A 5ANHA 3FTGB 2B3RA 3ARED 1JE6A 2XTJB 4AE1A 2ZWYA 1OANA 1MAML 2R4RH 4HU2A 2DLHA 5TF1L 4GPVA 1MQKL 2VERA 3QE5A 4FFTA 3DYOA 3L1FA 5MI0B 3TZVA 1U91B 4BSWA 2D7MA 4RAVB 1ORQB 3GXIA 4FKEA 4HBQA 3S96A 4AGLA 3CVHA 4QHPA 2WQAA 4IOFC 1T6VN 5ESQB 4HVBA 1CDHA 4FTVB 1JS4A 2CUMA 4IRZL 2I60L 4UB0H 3DI2B 4ATTA 1OEZW 4UUJA 4XWOC 3D50A 4JN1H 4NZTL 2WXQA 3ECQA 1CB4A 2A74C 1CC3A 4ZMAT 1MCHA 4JFYB 1RJYA 1YC8A 3P02A 1RFDL 1KWGA 4J3OG 4N0FB 1KNOB 2VZOA 2BP5M 5KSUB 2X70A 3AVEA 5F7KC 2R2CA 1ZGLA 4X7SL 5AZ2H 2D7PA 1I1AC 2XPZA 3ZTNH 2JXMA 3NP3A 3WJMA 1D2PA 3V5DA 2GFBB 2WIMA 5DZVA 3D39E 1VKXA 3IB4A 4J4PA 3PGCA 2APXA 2VDRL 2NW3A 1Y07A 4NBZB 3FCSB 1JGVH 4OGAD 4OZGB 4WGVB 5ILTH 4IGBA 2RFXB 5DJDA 4L48A 1NL0L 1X3DA 3Q01A 4HS6B 4DZ8A 4M62H 5EZLB 3FO1A 1AQDA 2QGBA 2DEYX 3N1FC 1W72H 4PRID 1L9MA 5F9DC 1L0QA 3JV5A 3WUWA 5H37H 3LPWA 2JKTM 2W60A 2HZHA 5GGUA 4FXKA 4KHTL 1RZKL 3OR6A 2IBBA 3CXFA 4WWKC 5JW3L 5KS9A 1AXSA 2YAQA 4MMZC 1SJEA 3VYOA 1LO2H 2DYPB 1KB9J 4FQ1H 4HA1A 5BO0D 1SOXA 1UJ3C 5FFLA 4HKJB 1TF4A 5AYUH 1PW3A 2JJTA 2BHUA 1FORL 5CP3H 3L3JB 1DEEA 3HPJA 3TT1L 4KITB 5FXCH 3KBHE 3NCJH 2DI7A 4EAEA 4N9GB 3HC0A 4RBPH 1DLFH 4V11A 5DD0H 4Y9BA 1JXKA 3RWEB 3EG9B 2NUPB 2W9EH 5D1XB 5KN5B 5IROA 4XRCA 3SDXA 4QTIL 2HWZH 1F11A 1U3HA 3NFPB 4JRXD 2RH0A 4L3CA 2R69L 1N7ML 3GJFH 1DJYA 3TWCL 3SGDH 4AJYV 5GS1A 1F86A 3Q3GB 3PS6A 3MJ9H 5EU6E 3C5SB 3FT9A 4M7ZC 4OKVA 1E8ZA 1RZJL 4N5EC 1FZJB 3S34L 1CXKA 2IQAB 2XKUA 1MVFA 1Y6NR 1KG0A 2DMCA 4ZFOB 4UQ2A 2E46A 1TZ8A 3DV4B 1MCWW 2VDLL 2YK1H 3DRQB 3OGOE 2F0CA 5HYIA 1R3LA 3THMH 5KJ7E 5ISZD 3PL6A 3SKJL 2F5BL 1LO5B 4FL4C 3O2DL 4PJEB 4XODA 1UXSA 1L9NA 1TTAA 2X1PA 3ALXA 3IJYA 1OE1A 2D4DA 3OHXA 5GRUH 4A7UA 4PY7B 3FFCA 4NQQA 3MHZA 1Q0EA 1OAUH 2EYSB 1S7WB 2ZYHA 3FSVA 2FECL 4NNYA 1NKOA 3P3UA 1FFOA 5MENB 32C2B 5EU5A 5GS0C 1GZPB 4KVCL 2QZQA 1Z0NA 4OGXL 1WAAE 1IJNA 4WFHE 1EK3A 3AG4B 2L3BA 3ZDYF 4F2ME 2V7NA 2X3CA 5IBLD 3BGAA 4GO6B 1R46A 3ZYZA 4NAQA 1YYMH 3LS4L 4HJ0C 3X1FA 2V7HA 4LRNL 4EUPH 4CJ1A 3U7AA 1TQUA 3CJJA 1A4JB 3HS9A 1QSEA 3WLWD 2J1WA 4NGHH 4PV9A 2BRRH 3O4LA 1MCFA 2DMBA 4XE5B 4DQOH 3TO4B 5IFJA 3UTQA 1R3JB 5C6TH 3VG0L 1XGRB 1V7ML 3RGBA 5KBPA 2GY7B 4AEIL 4KC3B 1XTMA 4QTFA 3G5VB 3K7UA 2G4GA 4XCEA 3V6OE 1YEIL 3HCVA 3PJNA 1I8LC 3WTTA 1GCYA 3KMDA 5HGDB 5C71A 1A6AA 4G8AC 5HJ3A 4HZAA 1A4AA 1WA1X 4YE0A 1WWCA 3U0TA 1GJIA 3FU7B 4RGMB 4BRJA 2VDPH 1A2YA 2JJWA 2Q8AL 2CHZA 5DS1A 2DQIH 2YRPA 3GGWB 5E1GA 5IBTL 2VUOA 1N19A 2CA3A 1EWHA 2DQGH 1XF5A 1TLMA 5FB8A 1P6AB 1NCBL 4XO4A 2F74A 2WXOA 5D7KD 5EEUA 2AKRB 2YD2A 4I5BA 3DGGA 1QRNA 4J5VA 4NZRL 1DN0A 3F12A 5GGTL 5BRZE 2ZUYA 3S6CA 4HXAL 2ADFH 3SGKC 2P43B 1DBAL 5CSZA 5JIMA 1S5IL 3BAEL 2FJFA 1OTTC 1CJYA 1KJMB 3B9KB 3LN9A 3RTQC 3VCLA 2NNRA 4OM0H 3QUXC 4P2OD 4S1DC 5DD1H 3OMNB 1FAIL 3VXSD 5KVDE 2JQMA 4Z3EA 2XNAB 5C0EA 5EC1A 2HJFB 1IQWL 4O2CA 5FOBA 2HLAA 2DQ6A 1KJVB 2VLLB 2IAAC 4RGOL 1HEZA 4JHZA 3QFJD 5IFHH 3EDEA 1CLOH 4N2CA 4FQLH 5KSAD 1U8NA 4OZ4B 3AQDA 4C59B 4HKBA 3VFGH 5D1QB 3KDPB 3CU1A 5BOPA 1RPUA 3BESR 2QV2A 5DRWB 5LXGH 2P8PB 5DJZA 4AKQA 3BFOA 1KB3A 1JZIA 1O9WA 1AMYA 4Z7VE 3Q5OA 5I8CB 1INEH 4TNWF 4LLMB 3MRIA 2YBRB 3NIDE 5LGJA 5GJSL 2YKLL 4X0NA 4B9FA 5EZJA 1HXYB 4M5SA 2IFGA 4ZFFB 4PJFA 2WO2B 2D31A 3EO0B 2XZAH 2DWXA 4N2MA 1JDCA 4IOIB 3BH9B 1ZANH 4PUBH 3IJHB 1LMIA 4W9IC 3SD2A 1MCKA 2HT3C 3ZIMA 1TQBB 4U31A 3P4NA 4FERA 5EF2A 3VXUD 1QTYT 3T2NH 1FL6A 4WKXA 4GUCA 2W9LA 3LIZL 4DZBB 5M94B 5I66B 5J1TC 2J20A 1RMFL 2ADIA 1KCSL 1QNIA 2K6YA 2CO3A 4UNTA 2ZE0A 4ES8A 1BP3B 1D6EA 4J3UA 2P5WE 5FUOH 5EUOF 4ELMA 2BCMA 1A7OL 2DY2A 2DQFB 2IOMA 3BGMA 4NQXA 4ODTL 4TVPE 2W59A 4XNQA 5I15H 4QAWA 4CNIA 3PHOA 3MKGA 3N06B 3QXAB 2HVKB 4MAYA 1PU0A 3T6WA 1A7RL 1CR9H 2EDMA 3QDMA 3OKMB 4NAJA 4JFQB 2Z93A 2DQEH 3CZEA 4PJHA 4CVZB 4WEBH 1UH2A 3UH8A 4HJJL 5D7LD 3V6OC 3MBEA 1EAJA 3S88L 4AMXA 3RY5A 5C09A 3EYUL 3IAQA 3FSZA 2LAAA 5FK9B 3V0WH 3T08A 4PJDB 1AGCB 3IDMB 3MLXL 4MNQA 5TFSL 4AG4L 2OMWA 5E6SB 5KVEE 1FO0A 2EYTB 4B9JA 4B50A 4MS6A 1LO0L 2VSMB 4C4KO 1TZIA 1I1YA 4G42A 1H6EA 4JREB 2OFQA 1DSYA 2HX9A 5FM8A 4B53A 3AXLA 1HK6A 3DIFA 4Y2LA 4CVWA 3O3AB 3ZK0A 3GIVA 1ZAGA 2F54D 1XF1A 2JKJA 3ARGA 5D7IF 2ICEA 5FYLH 2MQ3A 2MCMA 2YAPA 5CLXA 3RA7L 3S4SG 3O11A 3SGJA 3SDAD 3B7SA 1N3NA 1XCTB 3DUSA 3Q1SH 3QDJB 1AC0A 1TEYA 2X4NA 5D7JC 5GGSY 2AXFB 4GI6A 4HEPA 5J12B 3D2UD 4WGKA 3AU0A 3U4KA 2VN3A 2EH8L 1KFAH 3WBDA 3KPQB 1P1VA 1Z7JA 1L5GA 3NJLA 4YDKL 3RVUC 2XWBB 1VDGA 1ACZA 4GG6F 2EEFA 2FIKA 4I2XB 4HEPG 4U3HA 4Y4HC 5GHWL 1F58H 1AHWB 4PJCF 1CXFA 3NH7L 4ALAL 3VXTB 5I0YA 5K39B 3ARVA 2RD0A 1T04B 4JFFB 5E4IA 3QC6X 3ARZA 2YN3A 1FFNB 1ASQA 3VRJA 4GRWE 5E5MB 3VDAA 1QEXA 2QPFA 1LWHA 4P2RA 3M86A 1JV5A 1W0WA 3QRLA 5GS3A 3K5RA 3A6BH 5DHMC 1XAKA 3ULVC 3WU1A 3IK2A 1U6AL 1GGTA 1WC7B 2MHAB 4PY8I 2E7LC 2E4TA 2OX5A 3RB7A 4Z3FA 4HETA 2FATH 4KAQH 3D3VA 2P4AB 1B0WA 2JCCE 3IFPA 2VZSA 2KPWA 2Z1PA 3LZNA 3MOBH 1JYVA 1NCUA 2F19L 1DLHA 2M1KA 3ELAT 2X4TA 3GT6A 4ODHL 4NJAL 5I76A 1IBDA 5T3ZE 3F83A 1ILSA 1BBJA 3TBTB 2AXHA 4KHXL 3BN9C 1AANA 3II3A 5JW4R 1Z9PA 1MCCA 3N0PB 3OAUL 3H42L 5LGKA 2NY0C 3FUDA 3PGFH 5E51A 3NFNB 3PY9A 4OIAA 4JO5A 2OJZL 1PY9A 1VZHA 3L4UA 1IFGA 1NLBL 3TVMB 4HIXH 1LLAA 4IRZA 5C3LD 3U46B 4PS8A 5K9JH 1NMAH 4XB8A 5EOTB 4DEWA 5I8KL 3DTUB 2Y36L 2YPVA 3HG5A 4YSSA 1QSFB 2CGRH 3QZPA 4W68A 3TJEH 4OB5H 3QORC 1I4FB 4N0RA 4PW3A 1S7VB 3BUIA 3JTSB 4WWKA 5C08D 2IBGA 5JXED 5DRZB 2V3DA 4XOCA 5C0CD 2P5PA 1KT2A 3T0VA 3WIIH 4LSUH 2HFEA 5DGQA 4M1GL 3CFKA 5B39B 1W0VB 2ATKB 1D9KD 3ZHLA 3IU3B 3IFNH 5FPIA 4UDTA 2XFGB 5KYUB 1DVXA 2P5ED 1HH9A 1FNGB 1YAZA 2DI8A 4F8TA 4F91B 5D93C 3CSGA 2EEAA 1SLUA 2NLJB 3FTSA 1PD0A 4NWUL 1JHKL 5DZLA 2CRYA 4JPWH 1OK0A 4OCXL 5GRVK 3TH2T 3O9WA 1WFIA 5DA0B 3ULUD 3S5ZA 3VM5A 4FFZL 4QHNA 3HLKA 1G9MC 4JX0A 2YD4A 4HPOL 3T2LA 1J0IA 1SYSB 4ZFGL 3ARFC 3VUAA 4JM2F 1EFXB 1ZE3C 2APTA 3PAUA 1HXMA 1O6TA 2BC4B 4P46B 4GIOA 4KTDH 4PWEA 4H13C 2XBTA 2F08A 3M7FB 4NHUB 3G6JB 1UZ6F 2WLIA 5EO1A 4HLZH 2AS5M 4WJKB 5C0AA 2F2HA 4JVPA 5DQDL 4GQ9L 4OZHE 4RZCA 4O2EB 4Z7OF 3X11A 1X4YA 3GZPA 3BSZH 2QEJA 4UV4L 4TNGA 1IGJA 2OS7A 3AT0A 3Q8BA 3WFDL 3MJGX 3OMZA 5A40E 4X7FC 1TPXB 4HPHA 4PJXE 3MREB 5B3JF 4TM9A 3SBPA 2R0KH 3GSXA 4P23B 1U8QA 2C3VB 3ROOA 2R51A 4H2AA 4IBZA 2ESVA 4FX5A 3DOIA 4B3EA 1TTFA 3PABB 2PPAA 3W9EA 5IB5A 4PHXA 2APWA 3TZVB 1T7XA 2R69A 3L9RA 4BSWB 4XMXA 4NHCH 4TUUA 4GFTB 3Q8EA 4M6NL 5D6CA 3CVHB 3S96B 3UTPD 3H54A 3U9UA 3X1EA 2E7MA 3RWFA 1NSNL 3BKYH 1AI1H 5KVDH 1QTSA 2X53A 1QLEB 2NY4B 1FHGA 1CVRA 1EJ8A 3NIFB 4OJAA 4OBSA 4MMXC 1P6WA 4NQEA 1IC4L 2MOQA 4YC2C 1DQMH 5D9SB 1KULA 4HLEA 4H88H 4HUWB 1RJYB 3EFOA 4JFDD 2DLFL 2IAMD 5JOFA 4F15C 4KH9A 1SN0A 1R1CA 5B7FA 4IRJC 4M7KL 3I2CL 3ZZQA 1ZGLB 2XWJA 1MFUA 3ZT6A 2JXMB 3VFRA 3WJMB 3V4VH 2E0PA 3KE0A 5B1KA 4Q8BA 3VW3L 3C2AL 3K4ZA 2QHRH 3PGCB 2NW3B 3ZYJA 4OLZL 4P05A 4IGBB 2YKKA 3S3CB 1JBJA 1WS8A 4DZ8B 4L4VD 1N59B 1JZ8A 3KPSA 3IDIB 3FO1B 1AQDB 3U1SL 4BKLA 1FIGL 1GRWA 2F53A 1VFMA 1BMGA 3GMMA 4ZUTA 4PJGF 2M2DA 1JZJA 1IM3D 3WUWB 1WJ3A 3IDGB 5LGHL 4X5XA 1OAJA 5GGUB 1ZV5A 2G5UA 2VW6A 4FXKB 3T65A 3OR6B 4XC3L 4MAZA 5FCSH 5TD4A 5KS9B 1AXSB 2B4CC 4NQVA 1SJEB 3HZKA 1FCGA 5IV2A 5CBEA 2QHLA 3OBAA 3MLVL 4TVPH 4PU2A 2E6QA 1JOIA 1WLHA 2X5PA 3K2KA 4MASA 1F90H 2OTPA 3QEQA 4JRXE 4U1MA 5GJTH 4WW2F 1GGIL 2FSEA 3BP5A 1AR2A 3QFDA 2K3HA 1DEEB 5JHAA 2RA1A 5CNHA 2CBPA 5PCYA 1VCBC 3FSWA 3DO7A 4L4JA 1OVZA 1ETA1 5ITFA 4ILDA 3HC0B 3C5JA 4PVNA 4TNVF 4F57H 2JKLA 2FECI 3ZE0E 3PRZA 4LE8A 2PXYD 4YDVA 5DVPA 2ODIA 3ULSA 2PWDA 1Q0XL 4LNRB 4XRCB 3SDXB 1F11B 5GGTA 1QFWH 3OR7A 4L3CB 5DLML 1CDGA 2F7QA 1EMTH 4QIRA 4NKIH 5KVEH 4NO0B 3W5NA 3OJ2C 5GS1B 3FC8A 1MNNA 2F8VA 4OKVB 1EJOL 3MNDA 3IYLW 4Z7QB 1ZE3H 3FH5A 1GS8A 4JFWA 5GGRB 3DSFH 4AJVA 4XMKL 1KG0B 2O72A 4NZUL 4UQ2B 1RERA 2HRPH 5SWSA 4F2FA 1CYWA 5FCUL 3H85A 4R0LC 3PL6B 5DWUL 4LU5L 4E0RA 1VZIA 2B77A 4QXGH 1REIA 5IWLC 1RUQH 4JDVA 3IJYB 3OHXB 4K8RH 4Q9QL 3PP3K 1FHNA 1S9YA 4DVRL 2HG5A 2CJ3A 3RZCD 1TJHL 3CK0L 1T1XB 4NNYB 4RESB 1FFOB 2VLRB 4NUMA 3F7LA 1RD6A 4UF7C 1KSRA 3SO5A 1QD0A 4X98A 2VWEC 3VXQA 4LIQE 3WTXA 1LHZA 5JQIB 1BFVH 1OP9A 3WHE0 2V7NB 4FFYL 4N1CA 1YEFL 4F27A 5J56B 3HNTH 2LW3A 2V7HB 2WAHA 3H9SD 1V5JA 1UOVA 3ATFA 4L3FA 4GRWH 4G8GA 1QSEB 3WFHA 4PV9B 3CZJA 3WKMH 3O4LB 3TV8A 2CKNA 3HIZA 1L0XA 4NO2B 5INCA 2Z6FA 3LIZA 3UTQB 5IFJB 2ZXEB 3WXWH 4E9VA 4B3VA 4LOFA 3W0WD 5L6YH 4YBQD 5D7KE 3TA4D 1WA2X 3RJQB 4BFEA 2FX7H 2YUXA 4K9EH 2QELA 3D12B 4XCEB 4YSEA 3IWVA 2R0WL 1DQTA 4QWWC 3AAZB 1A6AB 1BQKA 5F9WC 5HJ3B 3QJXA 2FGZA 2DN7A 2WCPA 3H3KA 3ECUA 5T3ZH 3U0TB 2DQJL 4W9ZA 2BS8A 2K3TA 4KI1A 1A2YB 2ED6A 3U30C 4D9LH 3OZKA 2W95A 4RX4D 1XF5B 2ALWA 3WY2A 5FB8B 4PS7A 2FGWH 1ADQH 2CJUH 2F7IA 3NA9H 3SCMD 1EJFA 3S5YA 1EFQA 3DGGB 2XQYA 3VXSE 4X7CC 5AAMA 2J21A 4FLQA 4UINL 1VHPA 3WMPA 4Z7WF 2D2OA 3FOMA 2RCSL 3SPHA 4ZXBA 2CHDA 5CIPB 5CSZB 4U6VL 2WTRB 5IVXE 2FJFB 1GOHA 1VPOH 1FDLH 4N2IA 1XF4A 3OAWA 5E8DL 2QZ5A 4FZ8L 1A1NA 1PZBA 5DF0A 3T8VA 3VCLB 1CD0A 2F58H 2HTLC 2HUEA 1R33A 1TYRA 3D0AA 4E9SA 1WWAX 5C0EB 5T1JA 1QO3A 1SVBA 1OPGH 4HV8A 4X9FA 4AGQA 1OALA 2HLAB 5FOBB 5D2LE 4ZS7H 4DGYH 1A4BA 1HEZB 2V5MA 3ZHKA 3UC0H 3BISA 2G60H 1U8NB 4DO4A 2UX7A 4Z0XA 3T6XA 2P46B 2VT0A 3KH4A 3VXUE 3D06A 1R34A 4RGND 3WKNA 4JFED 3GLAA 4KKBC 4YHLL 2D9CA 3MV8D 4JHVA 3IJ7A 2A1WL 4ZNCD 2IQ9H 3VVVA 4AQAA 5LGJB 5EZJB 5LN8A 4PJFB 1UENA 2NYZA 4TUKL 2D31B 4JO3L 5E5RB 3LZRA 1KLFA 3CMGA 4K3JL 5SX5K 3VGGA 5CJOL 4AEEA 2V9RA 2WO3B 1VEOA 3TIDB 4JB9L 4KPHH 2W65A 4K3DL 4NN7C 3P4NB 1VFUA 1XR8B 3EYOA 3QO0A 3QXUA 3VXME 1GVIA 3JWOC 1D6VL 3LXAA 3CFQA 3KPMA 3LKOA 2WANA 2VDQL 5DFWH 4BFGA 3N85H 7PCYA 2VSKB 4MJIA 5DC4B 3RL1B 4X5WA 2ADIB 4GBXC 1JGLL 1NBQA 1WK0A 2YD8A 3SKUD 3UTOA 1UT1A 4IOSD 4LFHG 4HIHA 3WJLA 2JLPA 1D6EB 5K9OA 4G6AC 4ELMB 2J6WA 4KMQA 2Y23A 3OV6A 3BGMB 3PYCA 4XNQB 2CJSA 3UZEC 5DURD 1G9EA 4AL8L 3FF8A 4CNIB 3PHOB 4LF3A 1D7CA 1JNLL 1KV3A 3A22A 4KZ0A 5DHVA 3NDYE 4MAYB 4AH2A 3U6XA 1MKFA 3F7QA 4L29A 4ZTOL 2M8XA 4FQIL 3FNKA 2RAMA 3N9GL 1YCSA 4GP5B 1ACYL 1JHLH 4X4KA 2ISDA 3QDMB 3NSCA 2Z93B 4PJHB 3DOSB 5CBAA 6TAAA 2XHNA 3L5JA 3MBEB 1JZ5A 1KIUB 3WO3B 3AS0A 5C09B 3BKJL 4ONOA 5L8LB 2F54E 4QXUH 3V95A 1I31A 3GMOB 5DVOA 2I5YH 4MNQB 3NDZE 3QJTB 3G6DH 1S3RA 2OMWB 4JM2D 3BX7C 1FO0B 2FEDC 4MTMA 4IRSD 1UKQA 2NR6C 3MRDA 4PH8A 3AG3B 1F1AA 1KGUA 1TZIB 3RG1C 3IJ8A 4G42B 4UOZA 1T89A 3LQAC 5EB9A 1UWGH 3OD3A 2J8UF 3V8OA 3PNWB 5JW4Q 4EQ2A 3AXLB 4C55A 3DIFB 1S7UB 1Z32X 1A4KA 3GIVB 4FNLH 4P3WA 3ARGB 5BZWA 4XMZA 2ICEB 3DVNA 5JPNC 3MJWA 4HZLA 3QIBA 4CC1A 1R6VA 5DC2A 1N3NB 1LE9A 1UJTA 3RPIA 3EBGA 2X4NB 4FFZA 3AQZA 2CIIA 5A2KH 1KEMH 4GB9A 4NZDA 1L5GB 2V3FA 5ID1A 5F72S 1X5YA 1UCBL 1RK1A 2FD6L 2FIKB 4XP4L 1JRHH 3U1PA 1F41A 3C60C 4FLOA 1GY1A 4NRYA 2H2PC 3OPUA 4S0TD 1X9QA 4NAMA 3WD5H 3ZZSA 2KS0A 3C5ZA 2VC2L 1J0KA 3MRLA 5HDWA 3TA3A 1G6RL 1MHPH 1VSCA 2ED7A 3TN0A 4PTTA 5DS2A 4G3YH 4QF1A 5KVFH 2AI0L 1JV5B 3FPYA 1RZFL 1W0WB 4B95C 3FCUB 2A74B 5DD3H 4ZD3H 1VFOA 3NEXA 4R9HA 4JDTL 2WWMD 1BQRA 5I6XB 2C8NA 2VLKA 2XRAL 1BXVA 2HT2D 2OX5B 1PY0A 2P49B 4L0PB 5BOJA 5CKGA 5AZEL 1YMMA 3D3VB 3CTTA 1AKPA 2BHZA 4HK3J 2DLEA 3MRQA 1IGML 1FG9C 2R4SL 1G1OA 4WGWB 4DKFH 4PW4A 1JZDC 3QJUB 4Z7UF 3MBWA 1DLHB 1KCVH 4K7PH 2Y1YA 3PQYA 4TNEA 4TTDD 1BBJB 4OZIF 1EBPA 1RUML 1TZGH 3ASOB 2YXMA 3FTYA 1MLCB 4QGTA 4JHAL 4LVNC 2P5EE 1M6OA 3APDA 1JWUA 4BQ9A 4C83A 1UZGA 1U8CA 3ECVA 4J3OD 5SX5H 4GP4B 1F5WA 3CN0A 1F1GA 4WWKB 1E5ZA 3EJTA 4MMZB 1KT2B 1V7NL 3UBXG 4N2OA 1G7IA 2ICES 1CZ8L 1E4WL 1M9SA 4Z0BL 1IGFL 1FBIH 4KNTA 1UQSA 2Q86A 1TJIH 2OYMA 1AZUA 2LABA 4LIQH 4LP5A 1HH9B 3LEYH 4O58L 4ENED 5HGBA 4WUUD 3DHJA 4FA6A 1JVKA 3HOGA 3FQUA 1IAIM 1URIA 1ITBB 1A0QH 5GIRB 5T5FL 3ZLQC 1NC4A 3WHXB 2K8MA 1BYNA 2DB8A 3KCPA 3O9WB 1WF5A 5BOZG 4QHNB 4IIZA 3INUL 2X2IA 4FQ2H 2ZSVB 1YLBB 1B4RA 3O0RL 4NKOA 1AZCA 2RTTA 4O5LL 1UD4A 2ZCHH 5KBKA 1HXMB 4PJ6A 4R26H 5ITBL 4Y19A 4N8CH 5JMOC 3BMVA 1T1YA 1H3PL 1L9TA 1EHKB 1Q94A 1MREL 3K6DA 2WLIB 5EO1B 1S3KL 4M7ZB 1F18A 4WENB 5AD0B 3H2PA 5C0AB 5HGHB 4PRHA 3RUGA 4ZS6D 1JNHA 2A9ML 4JM0A 4LLYA 4RZCB 4XMLL 3VRIA 5GZOC 4O02L 1K8DA 3WDIA 3X11B 2GUYA 2JE8A 3QCVH 4ELDA 1TETL 3D4GA 2NY5H 1ZTMA 1IGJB 3MODL 5IHWA 4WI5A 3TFBA 5I6LA 1HKLH 3KHOA 1XB3A 1AFVL 3UTPE 4R0LA 5I19H 1TNMA 3G3LA 3LQAH 4FL4B 1P1ZB 3QXTA 4GSQA 1MUJA 3G7TA 3ZDYE 3ZQXA 2VITA 3BGFC 3ROOB 3VNZA 2N7SA 1U8HA 1J5OH 2ESVB 2GK2A 4RDQG 4IBVA 3W9EB 2JJUA 4GAJL 5IB5B 5KBMA 1NGWA 5AW8B 1U3HD 3D0VA 3L9RB 1WO2A 2EIBA 2RGSA 4JFDE 2FEEL 3FU9A 1TMQA 5D1ZI 5D6CB 5IOPA 3U7WL 4B41A 3MRMB 4HCFA 3AACA 4NXSA 5AW3B 1GAFH 4HUNB 4L37A 3Q9QA 1DVYA 2X9WA 5CO1A 4H26A 2DM2A 2NY6D 3V6FA 4G6JH 4S1RH 4NQEB 5DD5H 1HHJB 4UU9A 1SUJA 2VDLB 1UB5B 3ZE1B 3ZBMA 5IB2A 5IW6A 4UB0L 5CJQH 4N5UA 3EFOB 1YVLA 1AD0A 2VZ3A 2AFNA 4UQ3A 1G9HA 5JOFB 5E00A 1U92A 1S7QA 3ZZ1A 4PJ7A 1ACCA 5DO8A 2XWJB 3FFCD 2LE9A 4MZ2A 3V0AC 3VFRB 5FO8A 3TJPA 2LGNA 4PJ5A 2HKFH 1JGIA 2LTQB 5IQ7H 5AZ2L 3ZTNL 2J73A 3KBPA 3KLSA 3KPSB 4BKLB 4DF9A 5KOMC 2R15A 2K0RA 2F53B 3GHBH 1IZKA 1M56B 1EHLH 5ILTL 3GMMB 1JGVL 3GIZH 4L05A 3VTAA 4M62L 1LQBC 4MVBC 5ACZA 4JK0D 2WZ5A 1W72L 1KGWA 3PWVA 4NQVB 4W1TA 5B7EA 2A99A 1FI8C 1YUHA 3BW9A 3HZKB 4FFWC 3V2AR 5IV2B 2E7BA 3LB6C 2QLVB 5CBEB 3HG1E 5IY5B 1XBRA 1YEEH 4U1MB 2FSEB 3HZYA 3QFDB 4V1DE 1I8KA 3NABH 1LO2L 4FQ1L 3W39A 2Q5BA 3DO7B 1T03H 1XXFC 4QRRE 3RI5F 4ZMXA 4KKAC 2K7QA 5AYUL 4BINA 4LLVA 4PVLA 3C5JB 3QISA 3UAJA 2VH5H 3MRHA 4DGIL 5L7XH 5CS7A 1VADA 1OOAA 4OTXH 3NCJL 5C1MB 1ZGLP 4RMSA 4M5ZH 3SYOA 3ULSB 1PQZA 1DQLH 5HHMB 3OKEB 2BJMH 2H2SD 4HWBH 5DD0L 3POHA 4DQAA 2BNRB 1QRND 3F7RA 3OR7B 3QUMH 3N04A 4YHNA 2W9EL 3JT0A 4PLJD 3NJHA 1BD2D 2FBJH 1F56A 3H3BC 2GIXA 5E6IC 3AU1A 2R2EA 2HWZL 1SXBA 2FIRT 4L1TA 1DVUA 1ASOA 4F9LC 5I30L 2ZXCA 1NFDF 4HALA 1MG2C 4JRYD 3U7YH 3HE6A 5CSGA 3VD9A 1B3JA 1WA0X 2OSLA 4WTWA 2JF1A 3NJJA 2MPAH 1JZ7A 3QRFM 1HYRC 3BUTA 3MJ9L 2FK9A 5EUOE 3QRBA 1P7BA 5SWSB 3EJUA 4HSAC 4JHBA 2BOCA 2EE0A 2Z31D 4BD4A 5I75C 4Q52A 2WO4A 2I85A 3ZRCC 4PJ9D 4GY4A 4E0RB 4FQXC 1BAFH 4XX5A 3UBHA 1XCQA 4JDVB 2YK1L 4B0MB 1O6VA 3WNPA 1S9YB 1UTDA 4IBWA 4X8CA 3WLBA 1A3ZA 5JORA 4WNJA 2VLJA 3NCCB 4MB5A 2PABA 3UZEA 2BIHA 4DKAA 4JLRA 1PIFA 2QSTA 1PLBA 4OD1H 4WI2A 4X98B 1OAUL 3HE7C 4G5AA 3VXQB 5ES4B 2WXHA 2WWKO 3HBGA 2EEDA 5HDQH 1SY6A 1ADWA 4IJTA 5E08H 2EE9A 3ESPA 4G8GB 3CAFA 3WFHB 3C8HA 4PJIE 1TVDA 5INCB 4MQ7A 5BXFA 3MUGA 2XWRA 5D7IE 4NGHL 1KGCD 1P4BH 2BRRL 2D4FA 1KLUA 4DQOL 5DJCA 3VXRE 2PWFA 3QUZC 3P9WB 5C6TL 5FDYA 3ZTEA 5FW6A 1WAEA 2A83B 3OX8A 4U1JA 1T5KA 5FEBA 3FQXA 1SN5A 3CHXA 1I9JL 1O9ZA 3BUYA 4PRNA 1ACXA 4R97B 1S5HA 4RA0C 4X6EA 2YQ2A 4OF6A 2OULB 2VN7A 2VDPL 4POZC 4PJCE 5IVOA 4XNXH 3ZHNA 2DQIL 5F7LB 2DQGL 3FOMB 2B9BA 3HNSH 5JO5A 4DERA 1A8ZA 3FTVA 3FPXA 1BM3H 3T0EC 3ZYIA 4MJ2A 1FL5A 2E86A 3NGBC 1A1NB 1FNLA 3VVWA 4TNWK 4GAYA 1W6LA 1NH6A 2VSCA 1MLBA 3T3PB 1TUPA 4JFEE 3V5KA 3K81A 2CR3A 1GJUA 3MV8E 3SDYH 3TH4T 5L4JA 3OXRA 5CZVH 4OM0L 1YDPA 1ZS8B 1WUZA 5G5DA 3PWUA 4Z6AT 3V0IA 2A9BA 3ARWA 4HV8B 1G6VK 3LMJH 4X8XA 4K3GA 1M05B 3ECBA 3HAEH 4HS8L 4BE5A 4OZFG 3S36X 4K3HA 3VQ1C 4Y5VA 4Z0XB 1FNAA 3E80A 4LARH 3SYPA 2ENJA 3KWXA 4DT2A 1GSMA 3POCA 2AXGA 2ZYSA 1TZOA 5IFHL 2LV4A 3NYKA 4GO9A 4FQLL 4LBEB 4QHMA 4K3EL 5IJDC 4DO5A 3VFGL 2K9FB 4AQAB 4D0BA 4Y9GA 1RKRA 5GGVH 5EOQH 4L8CA 1BEYH 5LXGL 4M5TA 4N8VA 2Z1KA 1GGYA 1KLFB 1INEL 1UZ8A 2FSDA 2NYYD 3G9VA 2NW2A 4FNPA 1QFHA 2W65B 2XN9D 3TBBA 3EYOB 5DZ9A 4X4YA 3KVDD 4HHGA 3VX1A 1TKWB 3OGCA 1ZANL 4PUBL 4MJIB 4P2RD 4X5WB 4ZX5A 5EF0A 1AZVA 3QS3A 3T2NL 3HMXH 4HIHB 5TQ0H 1Q9KA 3CXHJ 5K9OB 1O5PA 3LJ3A 4WO4C 3VSUA 5JIQA 1D5IH 5B8CA 4D8OA 3NSFA 1TZHA 4M8UA 2CLRA 1HE7A 1QZNA 2KDGA 2XZQH 5DHVB 1TU2A 3IF1A 5FUOL 4AH2B 3KNBA 3L81A 3ABMB 4KKRA 4L29B 4OZGF 5D93B 4JCMA 5F89A 5I15L 2TRHA 5C07D 4E5XA 2BDNH 3N1MC 1MSPA 1UZ6E 5I17A 5KYWA 3T4AA 5FYKD 1E40A 2FJGA 3KLAA 5CD3A 1A25A 3QWRA 5CBAB 2GIMA 1MXDA 1CR9L 1BQUA 2AAAA 4YZFF 4Z7OE 1ITCA 1JDDA 2DWYA 4AY0A 5CXPA 3HMWH 4WEBL 4L8BA 3HC2A 2Q7AA 2TAAA 4RMVA 2GSIA 2P1YA 4AUJA 4ETQA 3V0WL 4AX3A 2NNCA 1KBBA 1PMYA 4Z5RB 5B3JE 1BDYA 1UKTA 2EILB 3F7YB 2E74C 4IU2A 5GZOA 3WMSA 5HHNB 1FFRA 1PTZA 1KXQA 4LVHC 1S8DA 1R0AH 2WZPA 3MUJA 1A4KB 3DYPA 3C9NA 4G72B 5IK3A 1CIDA 2XV3A 3BP7A 1E30A 5BZWB 3DVNB 1T83A 1ZD6A 3GMNA 4HZLB 3QIBB 5T5FA 4MNHA 2YAMA 2NXYD 5IFAH 3D2TA 1ICTA 1A64A 3RPIB 3RHWF 3DA0A 4AENA 2PW1A 2Z92A 5FYLL 3P0GB 2HFGH 3KXFA 1MJJA 1NIBA 1WBZA 2CIIB 2Z34A 5MERA 1A9VA 5HJBA 2X7LA 3O6FC 3SE6A 1AXIB 3KPNB 4OGQC 4G9FE 3Q1SL 1NC2A 3S3JA 3I3DA 1HC1A 4ANUA 4DCQB 5ID1B 1WSST 3AXHA 1KEGH 3S37H 4MKMA 5BS0A 5IHLB 1RK1B 3B9DA 4KDTC 1KFAL 4ZUUA 3RIFF 3T77B 4NRYB 1DQKA 1JTTA 4N28A 5EZOH 3ARDC 1M1XA 4IM8A 5DFVC 1H0DA 1PZCA 3C5ZB 3MLSH 1CGYA 3MRLB 4O02A 4NUJA 3TA3B 1F58L 3TN0B 8FABA 4PTTB 4UQBA 4QF1B 3BFWA 4XN4A 4PJEF 4WFFE 3NZSA 4R5VA 4L3EA 4P04A 5KYNA 2CNZA 3O0LA 4JKWA 3GMPA 2D8KA 4PEEA 2EDRA 3OHMB 2MQGA 3FOLA 3U6XS 4FMVA 3AB0B 1GYVA 2R29A 1CIUA 1ZDQA 1YMMB 2NXZB 1OF2A 3MRQB 4IRJB 3PWPE 4MFHA 2AEPH 5LO7A 4PJGE 2EDJA 1S4IA 3MBWB 2YD6A 4LCUA 5EN2A 1E9PA 4LCWD 5E6RB 2FATL 4JFHD 4KAQL 3PQYB 2E47A 4A38A 1DDHA 1Q72H 3DJTA 5E0FA 2O5ZH 3ZDXB 1OQXA 2L8AA 2NZ9C 3MOBL 4QRPA 2F6AA 3OKNA 4AYSA 5C0NC 2A6JA 2MCAA 2QMJA 4N87A 5E6UB 3NCFB 1JWUB 1WZMA 1GYUA 2QJDA 2I27N 3L4TA 4JPSA 4C83B 5E8OA 2BIQA 3PGFL 2PTVA 5ESAA 4CGTA 1U8CB 1F13A 2A4CA 1TEFA 4IBUA 4N68A 1KGXA 4HIXL 2Z7UA 5K9JL 1NMAL 2E7DA 3RGVA 1SDAB 3BWUC 4X9BA 4H8UA 2CBMA 2CGRL 3TJEL 1N5YL 4OB5L 2F7OA 1G7IB 1BBDH 4Z7NB 2ZWKA 2NY1D 1UQSB 1SHSA 5E9NA 2Q86B 1TSRA 4QMEA 3WIIL 4LSUL 2AEIT 5HGBB 4QJ3B 5IREA 2XVKA 4QYAA 3H1ZA 1I1RA 3IFNL 1CTMA 3MV9D 1NC4B 2CDEA 2QADC 5DJAA 1K4CA 3CDYA 4M48H 4S1QH 1SLVA 1PDKA 4F92B 1LE5A 1T5XA 3EO1A 4NKOB 4JPWL 1JF1A 2XN2A 3CHSA 3NQIA 3OC5A 2FEEI 4WI0A 4RISH 5HHQA 3TCXA 4J2QA 4Y8DC 5EH1A 2H41A 1HWWA 1KTLA 4Y19B 4F37F 2KKQA 1OGAA 1T1YB 1W72A 1FV1B 1Q94B 3U4EA 1NBCA 3O8XA 2GHWB 1PZ3A 4KZCA 3QJHA 3QIWD 4V33A 4KTDL 4PRHB 1JNHB 4LLYB 1TTRA 3DHUA 2IC2A 3MFFA 1K8DB 2PR4L 2EAEA 4KTEH 2IADA 4C56A 1GC1H 2WWNA 3QEQD 3IU4H 3QUYA 4P2QD 4YDLC 5HGGS 1BFSA 1SFHA 4ZW6A 3V52H 5H37G 2PETA 1IE5A 4R0LB 2EVJA 3D18A 2Z8VC 2MFNA 1HOCA 5DYOA 3QJFA 3VYPA 2OBGA 3BSZL 2AJUH 2GT9B 1MUJB 3HBQA 4MAUH 3K6SA 4C4UA 3L4YA 2ZWNA 1CFBA 5FUZH 1OAXH 43C9A 4G6MH 4XO8A 1ILUA 3ALWA 4KOBA 1MCOH 4HFUH 2ZIDA 4W9FC 1NGWB 3D0VB 4MXQC 5AW0B 1JN6A 2NMSA 3RWCA 4Z77A 3WTVA 1F2QA 1CD9B 1XIWD 1EUUA 4KQ0A 4MA1C 4NQDE 4L37B 2IDTA 4H26B 5J6GA 4XX1G 3EHBD 3OZ9H 1EEZA 1MDAA 3UTTE 3GXFA 3I50H 3IGUA 3E1F1 3BKYL 1AI1L 5KVDL 5IB2B 5A6LA 5IW6B 3TESA 3P9LA 4LOUD 5HHOA 1EXGA 3JT2A 1AD0B 3PV7A 1O7DC 4W9KC 4Z9KB 4P5TC 4UQ3B 1DQML 3QDGA 1ZVNA 1KJ2H 1YPZE 4H88L 3BQUA 2W38A 5FO8B 4CGUB 4PJ5B 1FH5H 3LEVH 4WW2C 5KSBA 3U30B 1AGBA 2C9QA 1N5AA 1J0YA 4NCC2 4HDIA 3IMVA 3V4VL 1UWXK 5G4MA 4JQXA 3V7AG 3WG7B 4QOKE 4I0CC 5FFOA 4N6RA 4PJDF 1PFCA 5FYJU 1A22B 1Q38A 4BGLA 2VLMD 2J43A 4M6AA 5ACZB 1KWKA 2PPCA 3VWKC 2H7WA 2ZNWA 3VX0A 3PWVB 3U25A 1YUHB 3BW9B 3ML8A 1DE4A 1OLLA 5C0DA 1UOLA 3N50A 1DUZA 1UYWH 5AVRB 4AV0A 4UOJA 8CGTA 2W07A 1AHKA 2AV1A 2OCFD 3AUWB 1I9EA 3V55A 3HZYB 2G5RA 1I8KB 2VDNH 2HSIA 2B0SH 3HI1A 4JVUA 2EDWA 3LPGA 3W39B 1W80A 4TVPL 1G87A 3D8MA 3ZY7A 5DA4A 7CGTA 3GRGA 4KDVA 3S0PA 1F90L 1WPCA 3NJNA 5GJTL 2NX5A 1MJ8H 4JRYE 1S7SB 3MRHB 5HPOA 5FM4A 5BVPH 1FAKT 1VADB 4PR5B 4S11A 3KW7A 2J6EH 5T33H 3U1QA 1E50A 3NSDA 4F57L 4KH2A 3B7RL 2V2WA 4YHNB 4OIFA 2W94A 2HG0A 4HKZA 3MRPA 1XH3A 2CAKA 4H25A 1ZPLA 2JSFA 2FDBP 3DXAD 3HZMA 1QUPA 4ZXBD 3AU1B 2R2EB 2VGLM 1O7VA 3K6NA 1QFWL 2Q20A 2R0LH 5GRVL 4H8WH 1Q0YL 3HE6B 4O9HH 1EMTL 3BD3A 3MOAH 4NKIL 5KVEL 2KPNA 2OSLB 4YOKA 1KXVC 4J3SA 4NOFA 2A3TA 3NSYA 3SPCA 4MQXC 1QHQA 2BOCB 4J7RA 4QHUA 3DSFL 4YBHA 5GGRY 2Q7YA 3R4DA 4XXDA 1XCQB 5G4NA 1CU4H 1FZMA 1KYOK 2C9VA 5DR5H 2LLNA 3TS8A 4QPEA 3R19A 4Y2DA 3NOIA 4EUPA 5CU9A 2XVBA 4CN4A 3WLBB 1GZQA 4QXGL 4X99A 2PYED 5JORB 4HUMB 2UY6B 2VLJB 4K8RL 1JNNL 4PJ8A 2XACC 3EYQD 2LLLA 4OCMC 2WBJA 2WSDA 3GSNH 5B3SB 1QABA 1N6VA 4GG8A 3BXNB 1KGCE 3OKYA 3B43A 4LKCB 3LCYA 4IKKA 5A2LH 3WXVH 2PTUA 1TIUA 3IT8D 5E4EC 2LVCA 3CVDA 1V27A 4OD2A 3EOTH 1BFVL 2VL4A 5MHSD 5FA3A 3SDCD 1RSFA 1N2RA 1AXTH 3FT4A 2KQMA 3HNTL 2J8UE 3NCMA 4LFHD 4LL9A 1F6FB 1KY6A 1NPJA 5J06A 2XI9A 1F0LA 2E3VA 2VDQB 3H8NA 4MQ7B 3MUGB 1WFTA 1Y6KR 2WW8A 4NQSA 5KWYC 4RETB 3WKML 5E8EA 3TBWB 1PX8A 1SXZA 2UY7A 1KLUB 1FLTX 5DJCB 3FHEA 3B2VH 1B0GB 4OH2A 1NIAA 1UC6A 4NN6B 2R9HC 4EE2A 2VN6A 3WXWL 5L6YL 1T66D 3P2BA 2YEZA 4JQVC 1AJ7L 2FX7L 1NBZA 4K9EL 4NC0B 3FQXB 1MHCA 3BUYB 4PRNB 1DUYA 4LKXB 1S5HB 4OR1A 3BPOC 4X6EB 5T3ZL 1VACB 2NSMA 4C8XA 1B88A 4YSCA 2GITA 1OSZB 2X6MA 1A6UH 5AW9B 3BEVA 2JI1A 4A2DA 4D9LL 4QHKJ 4I88A 4R4FH 5F7YC 1BSIA 1N18A 2A7BA 2FGWL 1ADQL 2CJUL 2BVYA 3NA9L 4NSKB 5DVNA 2E8YA 3G6JF 2LR4A 1IEBA 2VZTA 2VM9A 2B9AA 1FL5B 3M8OH 4NC1E 3VGAC 5EEYA 1H15A 4B9YA 4KDTA 3DYMA 2PP8A 2BY0A 3B3BA 3K2MC 1ZHKA 3PGDA 5F3FA 1I8UA 3KYMA 3A3YB 4OI8A 2WK2A 3RL2A 1VPOL 3KBFA 1FDLL 4LL1A 3V5KB 3F01A 5F7BA 1MI5D 4XNMA 1ERNA 1AR1B 3OXRB 4GRLD 2F58L 4FFVD 5G5DB 3L95A 3PWUB 1UHVA 3GSRA 3PNRB 3CX5K 1IGYA 2OR8A 2K6ZA 3DGCR 1S78D 3U0PA 2O5NA 1CE6A 1F02I 3D39A 1CXLA 1SVCP 2ZAIA 4FLSA 5DUPH 3KWTA 4OZIE 3D34A 1WYJA 3JZ7A 4Y5VB 4FF9A 1N4XH 1OPGL 1WE5A 2ZX5A 2XN9E 4HUKB 5C0IB 4ZS7L 4PG9A 3L3GA 4DGYL 2AXGB 2FL5A 3UC0L 2G60L 4QHMB 1E90A 3SE4A 4KY2A 4D0BB 1T7WA 4MX7A 4PRPE 4L8CB 5B7MA 1CGSH 1WHOA 4N8VB 2BVQA 4N0UE 3TBSA 1L3NA 3P0YH 3NIFF 3GMLB 2IQ9L 3QI9D 4KI5F 4PVMA 1JTOA 1ID5I 4LVNB 3NJXA 4AMWA 2WJ7A 1KIQA 4X4YB 1MH5A 3HVNA 4U0RC 3KPOA 3OGCB 1OD7A 1DDTA 4DHLA 2OW6A 4KPHL 5C07E 1KCRH 5HD8C 4A39A 2WGNB 5FYKE 1Q9KB 3N85L 1Y7VA 2VLKD 5B8CB 2G2RA 3MLRH 1BPLB 1IBZA 1TZHB 3JVGA 3QG6B 4ODSH 1GYCA 2CLRB 2G5BA 1TU2B 3IF1B 3KNBB 1R24A 2Y6SC 5JHDA 5F89B 5F8QC 3GDCA 4XHJD 1J0ZA 3WIAA 2PW2A 3JWNE 4XI5D 4E5XB 1ZGLM 4OD3L 5EU6A 3T4AB 1QACA 2FJGB 3KLAB 5T1LA 5CD3B 4KXDA 3MUY1 3QS2A 1JHLL 1TYEB 3QZLA 4QRQA 4XO3A 3ZL1A 5KYYA 4NP4H 3KZ8A 3P9MA 4L8BB 5KS9F 3IBOA 4P5SA 4BQ6A 3TBCA 2GSIB 1QSZA 4U6YA 4CL7A 3ESNA 3T2OA 3QZWA 1RL1A 4QXUL 2BINA 2I5YL 5IHUH 1MCDA 4ZAKD 3ZTCC 1IIIA 3DETC 3G6DL 4M93C 1KDJA 4Y5XA 4IU2B 4HEMA 1LJMA 3NJIA 5I6NA 1AAJA 1S8DB 3VH8A 4A2LA 3CFBB 1S7RA 5BZDB 5IK3B 3BP7B 5FUCC 1UWGL 1HZKA 1ZK9A 3GMNB 3FU8A 3ZE2B 4MNHB 1AZBA 3QPQD 5DHYA 4YLCA 1ZXKA 1ZK5A 1H8SA 1WAAA 4NC1C 1E5BA 4QHLA 5D6DA 4FNLL 4WTQA 2J2ZB 5TTRA 3SDXF 4F20A 2Z92B 4F2MA 1DL7H 4U1GC 4XP6H 4HC1H 1MJJB 1WBZB 4GKNB 3IE9A 5D1ZD 2KZWA 2X7LB 3CFJA 3EYSH 3C09C 2BY3A 4XOBA 2R2BA 4U7KA 5BS0B 1FC1A 3KCWA 4ZUUB 5CEZH 4S0HA 1T6BX 2VRKA 1KEML 4Z7QF 2K1MA 4TOYH 3AY4A 1M1XB 2D3NA 3BAXA 5DJ8A 1OP5K 4H8HA 1BJ1H 2Y5TA 4W4OC 5DJYA 1H0DB 3K4AA 2EZ0D 5LBVA 3K5SA 1JRHL 4UI2A 4NUJB 1EBAA 3P3RA 4LCWE 8FABB 2ZOLA 4JFHE 2OR9H 3WD5L 4DVBB 1K8IA 1WGVA 5EC2B 2C3HA 3CH1A 4L3EB 3TC9A 2B14A 3WFCH 1XFPA 3GMPB 4FQJH 4H1LA 1MHPL 1NGQH 3LSOA 4G3YL 5KVFL 3FOLB 3O3BB 2IF7A 2A5UA 3PJSA 4FD0A 3V4PH 4O4YH 5DD3L 4ZD3L 3VD3A 3QQ9C 1OF2B 2OV0A 2YWZA 1SHXA 5HBBA 1HQRA 4RRPA 1HL8A 2WQSA 3ZRFC 4B5EA 4LCUB 5DUBA 1E9PB 5DZNA 5EN2B 2HRHA 4NM8H 5F9AC 5BRZA 1QATA 1SUHA 3GBLA 1MFEH 2ADGA 5AKSA 4DKFL 1QHPA 5AW7B 1OAZH 3ETSA 2AQQA 1KCVL 4K7PL 3OKNB 3B4NA 5AVXB 5L2KE 4J3TA 1C7TA 1U95A 4XMWA 2BOLA 2WLJA 4GSDH 5E8OB 1TZGL 3GSVA 5ESAB 3PV6A 5IMMB 3MLTA 3CVIL 1QEWA 3FHQA 4HU8A 4Z3TA 3VWKA 1AH1A 3Q8CA 3FCTA 3VI3E 3RGVB 1CCZA 4JG0H 4F3FA 2EE2A 2OMTA 2JI2A 4Y4KD 4FHBD 5C97A 5ETUA 1NCAH 2OZ4A 4YDZA 1R3KA 3EH2A 4XNZB 1ONQA 2Q2LA 2J4WH 2GBVA 2QLYA 2XFXA 1NUNB 1QBAA 4JO2H 2FWUA 1OIOA 3NACH 1FC2D 5I1GL 1DANU 4Y1AA 3W5MA 1K2DA 1FBIL 2VXTH 3WIFA 3N43F 2CDEB 1TJIL 1U3JA 5DJAB 1K4CB 4LIQL 3LEYL 4XTRD 3V4UL 3V4VA 1HAUA 3OAYH 3FQNB 3K71A 5IQ9A 1PDKB 5CCHE 2X9ZA 1HDMB 3W56A 1LYQA 1A0QL 1E2ZA 1YUKB 4Q4IA 4EVNA 1T5XB 4UM9A 3B7UX 1H9DA 4KKCC 5HHQB 3O6MH 2YFNA 3UBFA 5TE7H 1BQHB 4FQ2L 3LNFA 3GZOA 5LHDA 1OGAB 1D3CA 1YNKH 5I1JH 4WU5A 2XZZA 3O8XB 3C6LC 2ZCHL 4JFXA 2UWEB 3QJHB 1KGJA 2VR6A 3HRPA 4ZPTA 1PG7W 4OLWL 4JKNA 3T5WA 4F7EA 4N8CL 4X6CE 2V5SA 1KIPA 3EUDA 3MFFB 3NZUA 1E42A 4C56B 4HX1B 3WLWC 2P5WA 2AEQL 3QUYB 4RFNC 4F5CE 4WTZA 2QFPA 5I75B 2ZXDA 5I5JA 4ZSOE 5DYOB 1HOCB 3QJFB 1H3UA 3QCVL 2NY5L 5LNGA 1OP4A 4OD3H 3RILA 1HKLL 5C8JA 3AS3A 5I19L 1SMDA 2EECA 3LQAL 3EBHA 4Y16A 2J8OA 4LPTA 4Q0XH 1E65A 4Y7OC 1J5OL 4TVSa 4IJ3B 1JN6B 3RWCB 3HEIB 4Z77B 3UPRA 3HE7B 4PJFF 1LK2A 2YPLA 4HAFA 4BCYA 3MCYA 4PBWD 3IMRA 5J6GB 2DQHH 1EEZB 3AZUA 4LLUA 5TDOA 1MJ7H 2PYFA 35C8H 1GAFL 4XN1A 1BYPA 2BNQB 2WLMA 4LZKA 4U4IA 5CLTA 2IH1A 3B8SA 4HOWA 1WS7A 4U1LA 4RFOH 3P9LB 4TRPH 1CDIA 3RZWA 4G6JL 4S1RL 5HHOB 1PAZA 5DD5L 4M4RA 4R7XA 4PG2C 4Q4EA 2N56A 4ELMF 3QDGB 4NQCE 2I9LB 3SOTA 5CJQL 2HKAA 3BQUB 5ALCH 5AAWA 3ZKXC 2EIDA 1DZ0A 2VLME 1T20A 3ZQ9A 5A3ID 2OK0H 5KOVC 1M57B 2O6EA 3CFTA 5KSBB 5HDOA 1IAIH 1WDAA 1AGBB 4ZOAA 4HG4J 1N5AB 5B4MC 3RI5K 2HKFL 4TS6A 4NCDA 1AO7E 2EC9U 3IN0A 4FNRA 1DVQA 1MCEA 1NMBH 1T4KB 2XY1A 2YXWA 4RQQA 3VAEA 5IQ7L 3O2VH 1IT9H 3VD2A 4N6RB 3VU1A 1K85A 2L04A 3S8WA 4B6ZA 1VRSA 3INOA 3UZQA 3GHBL 1EHLL 5FYKH 3GXTA 3GIZL 4HGMA 1J5IA 3ZOAA 3G04A 1RJLA 3TH3T 3BZEA 4YPGA 1G7QA 1NA8A 1BVLA 5C0DB 5JMRA 2ZKYA 2ENPA 3SDDC 1DUZB 3QYNA 4PD4K 1TITA 2P44B 2AV1B 4D9RD 2WSKA 2XTJE 3SE9H 2BSCA 3EAKA 3HI1B 4NKMA 1TCRB 3BRDA 1IKNC 3T1WA 3RWIA 3D30A 1YEEL 3JWNH 3VI4E 1W9XA 1JGUH 2NX5B 4URKA 4X6FA 3NABL 4XN8A 4FGMA 1T03L 1G7PA 1EHAA 2J57A 3TT3H 1TMCB 3QQDA 4LSTH 4AYEC 3IRZA 1J0JA 4FTVE 1Q9WA 1OD9A 4Y4FD 4MD4A 1KCUH 2V2WB 4OTXL 4DK6A 1ADQA 4HKZB 1EEUA 2D3LA 2D0GA 3MRPB 4H25B 4M5ZL 4WU7A 5D8JH 3HZMB 4U1NA 1JVLA 2H32H 2BJML 4JAMA 2V37A 2H8PA 4HWBL 3T0BA 4Z3IA 5LWYH 4YSQA 3QUML 3UFIA 2GHZA 1P5VA 2HYMA 3PCYA 5JTWA 4DEPC 3GTNA 2FBJL 2A4EA 1LP9E 3GFUA 4XBPB 3O3DA 3VFNA 2ORBH 2APBA 4J2XA 2P8LA 3L5XH 3R0NA 1WICA 3U7YL 4X6DE 2FYVA 3IRCA 4W6WB 1HL5A 4QHUB 4N6QA 2MPAL 1YYCA 1NZRA 4XPAL 5E1HB 4XXDB 2HLFD 5DQJA 4OZGE 3FAXA 3SQRA 1FZMB 2EIMB 2JELH 4Y2DB 3IDJA 4EUPB 2OXHA 4JFVA 4A7VA 1GZQB 1BAFL 2EICA 4X99B 1K5WA 4QR7A 4YFEA 3C12A 2ZP0T 4PJ8B 1AKJA 1CFSA 2CDFA 4LLDA 4P4KD 4Q7DA 2H9GB 2CCWA 2WBJB 3FUIA 1FFQA 4YZFE 3X14A 3IGFA 1W6WA 5C0BD 2AQNA 4F8QA 1ZT1A 7FABH 2ZKXA 4OD1L 5I6PA 3B5HA 3FMGL 4OJDH 4MJ5A 4ACTA 4OD2B 1ZEAH 5LCVA 2E5EA 5FA3B 3AREA 1N2RB 4L9LC 5B1JA 2P8MA 4WLCA 2D03H 3FT4B 4MYPA 3IJEA 4OZHA 5HDQL 3I9GH 1GCFA 4G8IA 1QBBA 3F5WA 2X2JA 5E08L 1PPIA 2QSCH 2B1AH 4HH8A 4NQSB 1M3JA 4K71C 1Y18A 2XWZA 5E8EB 2UY7B 1M6UA 1ZHLB 3QAQA 3T3MB 4KJPD 1QAWA 3DHMA 2VDMH 2DKSA 1LWJA 3DMMC 4P57B 1KCWA 4JPQA 3QUKA 1P4BL 2HT4D 3WV0A 2YEZB 4L5FH 2PCPA 1NBZB 1QG3A 2DWEA 2EUZA 3JUYA 4N85A 4L8SA 1B3IA 1F8TH 3CSFA 1KBWA 5CILH 1MHCB 3O4OC 4A68A 4UT9A 1E2VA 1DUYB 4ISVA 3RWHA 1A1OB 5J89A 5KUKA 4DKTA 1JXJA 4H20H 3H9HB 5I0ZA 2GITB 2X6CA 3MLYH 4DN3H 3P4OB 3D9AH 5GXBB 3ZTDC 1MNUH 4BFFA 3IJ9A 3B2MA 2VZVA 3QWRD 1ODUA 2AJVH 3O6FB 4XAWH 2Q6WA 4NI6A 3FB6A 4XNXL 3HB3D 4IHOA 1IEBB 2EC8A 5MI0C 1GMEA 1U8IA 3HNSL 4PYHA 3ATEA 3PGDB 2DQUH 3B7TA 3KYMB 4YN3A 2VB5A 3RL2B 1K6QH 1BM3L 3CZNA 3VGEA 4BWTA 4GAGH 4XNMB 4PRIA 2EIZA 3ZMEA 5MENE 3ARPA 3L95B 2CLVA 2QDVA 3GSRB 4G6FD 1IGYB 3FU5A 4UMGA 4OUUA 3U0PB 1CE6B 3D39B 1SEBA 3JV4A 2GQHA 5CZVL 1NEZA 4Y9FA 4JG5A 3LMJL 4TLTA 1YN7A 1F00I 5A43C 5K1VA 4PG9B 3L3GB 1CLVA 1VESA 2L0DA 4U7MA 1PVHA 4UIMA 2VRQA 3KXFD 1SRDA 2N7BA 2O30A 4YUEH 3VQ2C 5CR8A 5J0BA 1VGKA 4LARL 4MS8C 5I1CH 1NC2D 1WQVT 2BXZA 1FH2A 3JZYA 2BVQB 3TBSB 5EEXA 3ULUC 4ODVH 3UAAA 2Y72A 3AMLA 5I6MA 3NJVA 5GGVL 2AANA 1QW9A 5EOQL 3R8BB 2J55A 5DZOA 1BEYL 3N44F 3WJJA 1K9TA 4MJJA 3ZE1F 1KIQB 3PWJB 5CZKA 1D7FA 1MH5B 3EZ8A 2PWHA 1SEQL 4JRXA 2C4XA 3KPOB 3DROA 4I85A 4TQIA 3LOWA 3QQ4A 3K1KC 1J9RA 3CC5A 4KUZH 1ETB1 2UZYA 3K3QA 4DUWA 5IB3A 4RIRA 3IFLH 2G2RB 4Q9BA 2OQJA 3HMXL 5TQ0L 3V10A 4JR9H 1CXHA 2G5BB 4KOCA 3WSQH 4OCWH 5IVNA 4I0PD 1D5IL 1R24B 2RHEA 2WLLA 1UCTA 3D05A 3MKKA 4LMQE 2Y2WA 3N3EA 3MTRA 2PW2B 3L48A 1Z0MA 1XX9C 1EIBA 1PZAA 3FUFA 1GMIA 2XZQL 4DN4H 2UVFA 5EU6B 1YEDA 3FW6A 4PS4H 2GJ6B 4K5NA 5T1LB 3ZHDA 2VZ1A 4QRPD 1A02N 1DVFD 4KY1H 4R96A 5D1XC 4QRQB 1EX0A 2BDNL 4U1SA 1QI5A 3X1NA 2DQMA 2Y6TE 3QQNA 5C2UB 2YD3A 3QVAA 4I3RH 6PCYA 2CBOA 4U6YB 4R2GD 4IBTA 2CSPA 2Y5QA 3SHSA 1JRHI 2MEJB 2PO6D 1ZWIA 3HMWL 3VNYA 5BW7C 4WWID 2FO4A 4E41D 5D1QE 4Y5XB 4FHKA 2UVEA 4CMHC 3VH8B 3IMSA 4YDLB 1S7RB 4WZ9A 3N40P 2VDOB 1XB6A 5DDHA 5IHBA 3SYCA 1MZYA 1R0AL 2H0PA 4QHLB 3D6GA 3IXTA 1Z6JT 5GGQH 3VMOA 3AROA 2CBTA 1NPUA 1M9WA 1BQLH 1KTKE 5IFAL 3CFJB 3F8UB 3AABA 3OAZK 4YHOH 1JZ4A 1J8HD 2R2BB 1Z9OA 1J8KA 4WI6A 2RR3A 5H35A 5J8OA 4UYQA 3FBKA 2HFGL 2BFGA 1P7KA 4FKKA 3GI9H 3MC0A 3IFOA 3T2PA 1W8NA 1QHOA 4L0ZA 1KPUB 2HRGA 4PREA 1A6VH 3EJYD 4MA1B 5DJ8B 1KEGL 1NAMA 1TZAA 3S37L 5DJYB 5IUCA 2RJMA 5CFHA 3ULAB 5EZOL 5AYQA 3ATAA 2ZOLB 1TR7A 2CXGA 1EDHA 2DTSA 4OF7A 4XZUA 4BK5A 1K8IB 3KEDA 4IU3A 3CH1B 2WBKA 1JVOA 3MLSL 3TO4C 1OY3B 3HG0A 5E1AA 4H1LB 1OKEA 1CFNA 3LSOB 5I73B 1RLWA 2YEVB 1YECH 4P5TB 3PJSB 2GK0A 4A55A 2RQEA 2VOTA 4HMCA 4P2OA 5F7AA 3GUTA 3UC2A 3GUFA 4EXPX 1HQRB 3VXSA 3SKOA 2WXJA 5CCJA 4PJDE 1A3QA 3P77A 1D5BA 1E4XH 2ADGB 4RGMC 4B0MM 2Q3ZA 2AEPL 4GH7B 5T1KD 2EUXA 3QFJA 2ZJSH 5KSAA 1A21A 3ILQD 4YHPA 2WYZA 4ZPVA 2O4EA 4PV1C 1JD7A 1G9NL 4P4RA 2IMNA 4S0SD 1U95B 2O5ZL 3P69A 3OMIB 1NJ9B 4QXTB 1HSBA 3GSVB 5C92A 2E8ZA 3PV6B 4LSRH 1K4DB 2Y7QA 3MRRA 1JD9A 3RLSA 3MLTB 2DQCH 4PLKC 2JNZA 4C4BA 3WNIA 3VWKB 4NO3A 3FCTB 4NT6A 4XN9A 1MCJA 2QQKH 3AADB 4X4ME 4F3FB 2OMTB 2H6UA 5ETUB 5DUMH 3V0EA 3A24A 3REVB 3JV6A 2A9DA 2MTAA 4LO9A 2Q0ZX 2XFXB 1E3ZA 3VXUA 3NEOA 3BH8A 2VM4A 3DVGB 2MKLC 4Y1AB 4WHTB 2XPGB 1K2DB 2H3NA 1JZFA 1ZHBB 2GBUA 4WI3A 1ET8A 1FUNA 4IYKA 3WIFB 5BUPA 3CU7A 4I2XE 5F7UA 5FKPA 2DICA 1TTUA 5IQ9B 4LXFA 1X5KA 2F15A 3OMAB 1P7HL 2MQ0A 4EVNB 1OGTA 4UM9B 1DSFH 4XXWC 2Z64C 2EDOA 4M48L 4S1QL 3UEZA 3TLRA 2YRBA 3OQ3B 4XOAA 5ADOH 3VXMA 1I8MA 4WU5B 3RFZA 3HZVA 1X9UA 2Y07H 4RISL 3T3PF 1GL4B 1PZ5B 2M26A 4ZPTB 5MEPA 4HS3A 3FRUA 1KIPB 2JI3A 1NICA 3NCYS 3AWGA 4ESKA 2G2NA 2EXWD 5J1SC 1TQBC 4AYFA 1KBPA 2ZWZA 4XWOD 1T2XA 4KTEL 3ULVF 1GC1L 1UUNA 4FJYA 1YJDC 3IU4L 3V52L 5I2IA 2JIXD 1F3RB 4JPVH 2AEOA 4HP5A 4G71B 4X2UA 4M1DH 3SOBH 3U2SA 3UIZA 1GZHA 1IFHH 1SF3A 1CG9A 2AJUL 3ZX1A 3HW7A 1L7TH 4KQ4H 4MAUL 2X3BA 4TUJA 2O93L 1QSFE 4L8DA 5FUZL 1I1AD 4ZYKA 4G6ML 3UPRB 5D7SH 4YEEA 2F54A 4HCGA 4DPAX 4QHKI 3FQ1A 4HFUL 4HWBA 5SWZD 1LK2B 2YPLB 4IQHA 3QUMA 3K4DA 4PM1A 1S9KC 3SDAA 5E4EB 4Q89A 1DQVA 2XBZA 4HSQA 4CU7A 2V8LA 5F1KC 3D2UA 4LLUB 5TDOB 2MJWA 3U36B 1T1WB 2PYFB 2PF6A 4MZRA 4U1LB 3OZ9L 4BRVA 3GSUA 5IW1B 1BJ1J 3NESA 2IOOA 2AZAA 2Q76A 4M4RB 4C54A 2H0FA 3I50L 2W92A 3I6SA 3IWUA 3OTTA 3T6ZA 2OPCA 4ZMYA 5DJ2A 3OKOB 3KPRD 4YVUA 4JREC 1DQJB 1LVEA 5L88H 1T20B 3P54A 4KNSA 4NFCA 4NX0A 1U8JA 2GYSA 4N2NA 2WHVA 2XXFA 4GQZA 3HTLX 3G6JE 3QPXH 3WDJA 4ES9A 4YXLH 3BPOB 1I7TA 3QJZA 3HR6A 3BPNC 3MRCA 5D4HA 1FH5L 3S35X 4TSBH 3LEVL 3TNNA 4EIBA 3BKMH 4Q6YA 1PS3A 5J12C 5IT2H 2AJXH 5AB2A 2D73A 3FTXA 4NBXB 2VXSL 3MLZH 1PZ2A 3UZQB 1D7DA 3CN2A 5CJXA 1MFAH 2GEQA 4QY8B 5ECJE 4J39A 3VGAB 1SM3L 3RVWD 1JHTA 1RJLB 1WFUA 1JTPA 2IALB 3MNVA 3VWJD 1G7QB 3BZEB 1BVLB 2BNUA 3JYBA 1ES0A 1AHWC 4YK4B 2OJ1A 1OT2A 4ONGH 3CVBA 4ZNEE 4N5ED 2IANB 3APNA 1YZZA 1OWRM 4NKMB 4LASH 4FQCL 4ZZFA 1PKQE 1JYNA 1A7NH 1P0SE 1BFTA 1UYWL 4OQTL 1WZKA 1AQ8A 2EXYC 5M7QA 3FT0A 5C08A 2VDNL 1PEZA 2B0SL 3WN5C 4DESA 5JXEA 2X4UA 3WUZA 4F33B 4UTAA 5C0CA 2IWFA 1G7PB 3EFDH 1U8LA 1KYUA 3QQDB 5I1IH 5E0QA 1MJ8L 4GS7B 1Q9WB 3NIFE 1D9KA 4KI5E 5F7EH 5HGAB 3RB5A 4MD4B 1HE8A 5BVPL 5IIEA 2J6EL 2AMGA 4A7TA 2P5EA 4Z78A 2W0FA 2AK1H 4WU7B 2Z7ZA 2VUKA 4I3GA 4U1NB 5LUMA 3HFFA 4JAMB 2H8PB 1JPTH 3SBRA 3ASWA 1OF0A 2ZOUA 3IGLA 1P5VB 1YNLH 4ZO9A 3O3DB 4U2ZA 5F7NC 4HJ0D 3VFNB 2Y7MA 4M02A 2P8LB 3TVMC 4H8WL 5L4IA 4O9HL 4U0QB 3MOAL 5A2AA 4NJ9H 2FVNA 3UCRA 2F1AA 5C0BE 1T4WA 3UAFA 1HNFA 3CFMA 1NGYA 1UFUA 5J5EA 4CW1A 1UUSA 5F9OH 4PJBB 3I6GA 5DJ6A 5L2JA 3KGTA 2WM0A 3KD4A 4KUCD 4OLXH 5CF3A 1AS6A 4Y2NA 3IDJB 3ETBF 4IIQA 2OXHB 3WNOA 3DARA 4BZYA 1CU4L 4Y7MA 5DR5L 3QHTC 5FYLD 3N2JA 2D2CC 1CFSB 2CDFB 4LLDB 1U2CA 1YN6A 5EU4A 3WL9B 2N0MA 4PY8J 4AE0A 5KS9E 5AVTB 3UGXA 2QFRA 3EH5B 1ZT1B 1JF5A 2ADYA 3HAEG 3GSNL 1R4XA 4Q56A 2X12A 2H6PA 4LPCA 1GSKA 1XGTA 2WXIA 3AREB 4TULH 3NK4A 4LVEA 4WVRA 2P8MB 4YIQB 2FHCA 3IJEB 1FJ1A 3P3TA 4ZO6A 5DMJB 3UJIH 3BPLB 3FXIC 4G8IB 3EOTL 3F5WB 5DFTA 4KRMB 5CN2A 1AXTL 3AWEA 4P46C 1Y18B 4ZX6A 5E2WH 1DP0A 1OTTD 4JBSA 4Z7NF 1YQVH 4IK7A 1UVQB 3RTQD 5E9DD 2GTWA 4XP1H 2C7UA 1P84K 4PWIA 4QRBA 3QUKB 3QUXD 4ANVA 5CKAA 2PCPB 2DWEB 3B2VL 4E9LA 2YJLA 4L8SB 3HUJB 1BF5A 1MW3A 2J5WA 5EN3A 4PRAA 3P11H 3RWHB 4ISVB 2FYYA 1T2QH 1CS6A 1V55B 2YD0A 4JFDA 3NRPA 2HT2C 2IAMA 1AD9A 3U9WA 3BCDA 2OMNA 1MZZA 5HHXH 1DBMH 3S9DB 3LDBC 2Q6WB 2QTEA 3C09B 3EGSA 3FRPG 5KVGE 1A6UL 2BIOA 4IHOB 4MHHG 3P30H 3ZTJH 4R4FL 3TZVC 4TTDC 4XVUD 3MCLH 1U8IB 4J28A 3BZ4B 4RWYH 3T8XB 4L4VA 4YH6A 2NTSP 3TYFA 3FL7A 4UT6H 3CDGA 5H2BB 2UZIH 4XVTH 2V9UA 3M8OL 1AE6H 4KWUA 5DS8A 4LDLB 4PRIB 4HH9A 2NY4C 2EIZB 2NT1A 2VLRE 4M7LH 4CMMA 3ABZA 1IM3A 4KI5C 4YNYA 5E2TH 3GTVA 4WV1A 4J3OC 2CHWA 4DGWC 4OUUB 3ZT5A 2PPDA 1SEBB 3JV4B 3Q2NA 3LEXA 1NEZB 3CFCH 4X5QA 5E94A 3A4DA 5E5UB 2I26N 2MOVA 3KPLA 2YUWA 2FEJA 2ZCZA 4HJGA 2GJZA 1GY2A 2E7HA 4CADA 5C7XH 1YN7B 2UXTA 2N7AA 1XGYH 4W9CC 1MXGA 1NWOA 1QSEE 4JKPH 1NCIA 5EULV 5DUPL 4NENB 2ZX7A 3O4LE 1V3KA 5DMKA 1JUFA 4GUQA 1N4XL 5IQOA 1UATA 1VGKB 2FE0A 1L9SA 1J9TA 3M1CA 2KZBA 2CO6A 3US0A 3DKHA 3FAWA 4IGBC 3BUBA 2PXYA 4B9ZA 4B9PA 2CRMA 3IKKA 3HG1A 1CGSL 4QEGA 5BCAA 4JRXB 4GW4A 3P0YL 3DROB 3FCGA 4F7KA 3QQ4B 4OV6F 3UZVA 2XBDA 1HVXA 4FXKC 1XZ0B 4ZTEA 2JTYA 3CC5B 1TG8A 1MIEH 4A7GF 1UURA 1MFBH 1X7QA 4OUOA 1IGTA 2ENYA 5EO9A 4F7MA 1KXHA 2NY3D 4ZS6C 3J07A 5IB3B 4RIRB 2IGTA 1KCRL 3HLAA 1GA2A 2YRZA 2WTOA 2OQJB 4POUB 1NUDA 2AQPA 1E9OA 2JJTC 3K2UH 3CIAA 2VDKB 4KVPA 4P06A 5ISZB 2WLLB 4EDWH 1QSVA 3CZUB 4DP4X 4GQRA 2ROXA 4L9DA 4ODSL 1USZA 3IJSB 3UCQA 1HSAA 4E41E 1EAQA 4HAGA 2EIEA 5EF1A 5AW5B 2ZYRA 2EP6A 4DO6A 1VEMA 4R96B 5D7JD 1H8NA 5TK4A 5IROC 3RZCA 4R84A 4XXWA 4U1SB 2DTMH 1U3HC 2E27H 2EVHA 3WELA 1PZSA 4R5TA 1FLRH 3J2PA 5KSVA 4HYTB 4NRZA 1G7JB 4UOW0 3RVUD 5GS1C 2Z4TA 4JFTA 5T8IA 4NP4L 1MPAH 4YXHH 2QVFB 4Y4HD 2FO4B 3H9SA 2ZTBA 4BJLA 5I0WA 4JG9A 2NY6C 4MCYA 1BVNP 3G5YA 3EH4B 4NRXA 2JB6A 2MCG1 2VABA 1GJWA 1HCYA 4XBMA 5IHUL 2FB4H 3T0XA 2FJSA 3D08A 4RFNB 2R8SH 2ZCLL 5DDHB 3PL6C 5BRQA 3APCA 2FX9H 3W0WA 4GNKB 1IBGH 5C2BH 2CKBB 2DV6A 2I24N 4FXGC 4N2AA 1O0VA 2UYLA 4I7ZC 3GO1H 2HPTA 2IPTH 3H4HA 1I7UA 1SJHA 4E42A 3OC8A 2X2HA 1BMZA 2V3EA 4H8VA 4BQ8A 2AJSH 1MJUH