3V9CA

Type-2 cu-depleted fungus laccase from trametes hirsuta at low dose of ionization radiation
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
499
structure length
499
Chain Sequence
b'AVGPVADLTITDAAVSPDGFSRQAVVVNGVTPGPLVAGNIGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQHGTNWADGPAFINQCPISPGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASRYDVDNDDTVITLADWYHTAAKLGPRFPGGADATLINGKGRAPSDSVAELSVIKVTKGKRYRFRLVSLSCNPNHTFSIDGHNLTIIEVDSVNSQPLEVDSIQIFAAQRYSFVLDANQAVDNYWIRANPNFGNVGFDGGINSAILRYDGAPAVEPTTNQTTSVKPLNEVDLHPLVSTPVPGSPSSGGVDKAINMAFNFNGSNFFINGASFVPPTVPVLLQILSGAQTAQDLLPSGSVYVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGSTVYNYDNPIFRDVVSTGTPAAGDNVTIRFDTNNPGPWFLHCHIDFHLEGGFAVVMAEDTPDVKAVNPVPQAWSDLCPTYDALDPNDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
molecule tags Oxidoreductase
publication title Crystal structure of T2-depleted fungal laccase from Trametes hirsuta 072 at low and high dose of ionization radiation
rcsb
total genus 145
structure length 499
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3v9cA03
1BXVA 3X1GA 4JKNA 2YAFA 3FQYA 4F2EA 1PF3A 2XX0A 1PLAA 3N2JA 3FSVA 5F7AA 1CC3A 1GS6X 2IDFA 2BW5A 3MBWB 2PPCA 1NPJA 3ASOB 1OV8A 3IN2A 4DPCX 4BDVA 2WSDA 1HFUA 1OOWA 1KGYE 3ABKB 3N55A 3PPSA 2H3XC 2CALA 1AS7A 1NPNA 2Y69B 3AG3B 3T6ZA 4KO5A 5FC9A 3IN0A 3WKQA 1JERA 2IAAC 3TA4D 1JVOA 2MRYA 1GY1A 2PPAA 3FPYA 3JT2A 3T6VA 4X4KA 3AG1B 1AZCA 5B1JA 1FA4A 3OMNB 2HX7A 5AKRA 2CAKA 3CDZB 2XYBA 4A2DA 4YSRA 4EF3A 1AIZA 3GDCA 3ZBMA 4F2FA 2BZCA 4N8UA 3FQ1A 1L9RA 2CBPA 2CUAA 3NJIA 6PCYA 3NJGA 1IC0A 4A2GA 1J9RA 1OE1A 2Q5BA 3OD3A 4DP6X 1KV7A 5TK2A 2BP8A 3ERXA 2BZ7A 1ZPUA 3UADA 1JXGA 4DP7X 3H56A 4AX3A 1GS7A 3WG7B 1SDDB 3NSDA 3ABMB 4BXVA 4KO7A 3DIVA 2PLTA 1PMYA 1ZIBA 4JHVA 4Q89A 2XVBA 1TU2A 2PPDA 2E86A 3S8GB 6PAZA 2GIMA 1NZRA 2OJ1A 2XWZA 4E9QA 2P80A 1SJMA 2DV6A 1RZQA 3CDZA 3S3CB 4BK5C 4WKXA 2UX7A 3QJTB 4N4YB 5EHFA 4HZ1A 3ABGA 1WA2X 3D12B 1NIDA 1SF3A 3WNJA 3CVCA 4GXFA 3TBBA 1CYXA 2YAEA 4A67A 4YSSA 1J5DA 2YXWA 3KW8A 3NSFA 1MG3C 4FAAB 5I26A 4A68A 3DTUB 1SHXA 5I5IA 3OQRA 4UAHA 2W8CA 3NJFA 4BWTA 2H5UA 5B7MA 1JZFA 2PCYA 4BDVB 1SHWA 2HLEB 2EILB 1MZZA 1W6WA 3X1NA 5I6KA 1V10A 2FQFA 3OMIB 1OCZB 2IDQA 2GB2A 1KCBA 1OE3A 4G7SB 1NINA 3EH5B 3FSZA 1AZUA 1KDJA 4HCFA 2OV0A 2FNWA 3G5WA 4E9SA 5AFAA 1ZDQA 1ILSA 1EHKB 4KNSA 1ADWA 1ILUA 1MG2C 1QLEB 4KNTA 2XV2A 3FU7B 2YAQA 1BQRA 1BQKA 2PP7A 2MTAA 2PP9A 4G7QB 3WNIA 2FT6A 5D4HA 4PAZA 1ID2A 4G70B 2DWSA 4DPBX 2AVFA 1PAZA 1J5CA 3FYIB 4GYBA 4E9XA 3FSAA 2ZWNA 2NRDA 3ZIYA 4QLWA 2FWLB 1X9UA 2PPEA 3QPKA 4K9JA 1CYWA 5B7EA 1NICA 1ET5A 4DP2X 3NYKA 4MFHA 3NT0A 1TEFA 2BWDA 1ET8A 3ASNB 1M9WA 5PAZA 3SQRA 4A66A 2HX9A 8PAZA 4YSPA 3FS9A 1GR7A 1AAJA 4GP8B 4BWUA 3QJUB 1AR1B 1OE2A 3UAEA 2I7SA 2BP8B 1JZGA 3FU7A 2PP8A 1SNRA 1HAUA 3FU9A 3CVBA 2QPDB 3FYEB 3HEIB 4DPAX 3TASA 3H4HA 1WS8A 1KBVA 1AZBA 3PAZA 3RYMA 1HAWA 4YSQA 2YXVA 2H47C 7PCYA 1L9PA 2FT8A 2AZUA 4G71B 4YSUA 4YVUA 3BQVA 4AKOA 4Q8BA 3QJSB 1AANA 1IKOP 3PLYA 2XV0A 3UABA 2YQBA 1OCRB 2QDVA 4YSTA 2QT6A 1NDTA 5TK4A 3SBPA 5B1JC 2EIJB 4DP4X 1L9QA 4HHGA 2CCWA 2XUWA 4KOBA 4PCYA 2ZXWB 4AKPA 3X2QB 2IH8A 5I6OA 1R1CA 1TEGA 1AS8A 1ASQA 4YSCA 1ASPA 2WO3B 1JXFA 1F56A 3X1BA 3QJVB 1OCCB 4E9WA 4UF7C 1MDAA 4NB7A 1DZ0A 1IUZA 3UGEA 1CUOA 3NSCA 1WS7A 2XV3A 4YL4A 3U25A 2ZOOA 3NJKA 1W8EA 1L9TA 3JTBA 1V55B 5IY5B 4A2FA 2XLLA 4M4RB 1N70A 5I6MA 2XX1A 9PCYA 5E9NA 1PCSA 2AFNA 2BWIA 4HHWA 1PLCA 5D4IA 2UXGA 4AKQA 1GW0A 2IDSA 2PPFA 4DP8X 2GHZA 1N68A 1ZIAA 1ZDSA 3TBCA 4G7RB 2CJ3A 1A3ZA 5AZUA 1BYPA 3CZUB 1ET7A 1XMEB 2IWFA 2XXFA 1L9SA 2R7EB 2YAHA 1DYZA 1T5KA 3QJRB 5B1BB 1J9TA 1WA1X 1XB3A 4E9YA 1NTDA 3IEAA 4E9RA 1PNDA 2RACA 3SBQA 1I53A 1A8ZA 1BAWA 2P80D 1FWXA 2DY2A 3IE9A 4P5RA 1FFTB 3AZUA 2J56A 2GI0A 1CURA 1TKWA 2J57A 4HCGA 2UX6A 2QDWA 3ZX1A 2GSMB 2I7OA 1J9SA 5D4JA 2TSAA 2FJSA 3FSWA 2YARA 3AG4B 3ZDWA 2QPEB 3NJMA 4BWWA 1NIBA 1AG6A 1E67A 2GC7C 1E65A 1NIFA 3OMAB 2VN3A 3DKHA 3T6XA 1JZEA 1JZHA 4AZUA 3X1EA 4TXVB 3S8FB 2VW6A 4F7KA 5I6NA 4YSEA 4HAKA 4NERA 4ZK8A 2A3TA 1OF0A 4A2HA 4E9TA 2J5WA 4G72B 4DP0X 1PZBA 2JKWA 2X88A 3NP4A 2I85A 2EIKB 1BXAA 3X1FA 2W88A 3EHBB 2IDTA 2BO0A 5I6LA 5B1AB 1A4CA 4CSZA 3NP3A 4M3HA 1QHQA 5B3SB 1B3IA 1WAEA 2DWTA 2BP0B 4KOCA 2BW4A 3FU8A 3S3DB 1W6LA 2XXGA 2VW7A 3EH4B 2FTAA 2VSMB 3AY2A 3AG2B 1OCOB 2N0MA 1BYOA 2Q9OA 3QQXA 2VSKB 1JZIA 2WO2B 3PCYA 4E9VA 2DYRB 2HZHA 1A4AA 1E30A 1VLXA 2HX8A 1XB6A 4W1TA 1A65A 2EINB 4KO6A 4FA7B 2IWEA 3FQ2A 1EZLA 2OCCB 1PZAA 3WI9A 4GY4A 3CVDA 3T6WA 3SBRA 1ETJA 3CG8A 2IWKA 4DP1X 2VM3A 4HIPA 1RZPA 3AW5A 2GC4C 2J55A 2DYSB 1RKRA 5ANHA 1SFDA 1ASOA 2EIMB 1KDIA 1PLBA 1SFHA 1XB8A 2Y1AA 1IBYA 2JFCA 2FQDA 3TU6A 3NJNA 5LDUA 2B3IA 5I28A 4WTQA 2FT7A 4NAJA 4YSOA 1YLBB 3S3BB 1KYAA 2B08A 4GP4B 1BEXA 1BQ5A 1PZCA 4KO9A 1AOZA 1NIAA 3V9CA 2FQEA 3H4FA 5B7FA 3UAAA 2XU9A 1GY2A 1GSKA 3PAVA 4QKTA 3IBOA 2UXFA 4BXSV 2UXVA 1GYCA 2HRHA 3WKPA 4W9ZA 4KNUA 4HCIA 2AZAA 1NWOA 1AZRA 1IBZA 1E5YA 2VM4A 2X87A 2IH9A 3NJJA 2AANA 5I5JA 2GBAA 3NJLA 3NJHA 4CSPA 1AS6A 4ENZA 3PXLA 1BXUA 1AACA 1J9QA 2R7EA 3C75A 3GYRA 1V54B 1X9RA 3KW7A 3GXUB 5F7BA 1PNCA 2YAPA 4L0PB 4YVNA 3FPXA 4HALA 2VW4A 3T71A 1UATA 2HRGA 1NWPA 3T9WA 7PAZA 3NSYA 2LLNA 2YAOA 2JXMA 2FQGA 1ZV2A 3QJQB 2IDUA 5A7EA 2UXTA 3MX0B 1JOIA 4GP5B 1AG0A 2PCFA 3V9EA 1JXDA 3PAUA 3WIAA 1WA0X 4P5SA 4YSAA 4DP9X 1KCWA 5I6PA 1JVLA 1A4BA 2TSBA 5B1KA 1JZJA 3ABLB 1AQ8A 2BHFA 3BVDB 1SDDA 3HB3B 1KBWA 3OM3B 1GS8A 1MZYA 4YSDA 3FT0A 5PCYA 3EF4A 1NIEA 5I5MA 4AI7A 1URIA 2HXAA 1RCYA 2BP0A 1AZNA 2VMJA 1E5ZA 1L9OA 1M57B 1M56B 4A2EA 3L45A 3UACA 1PY0A 2ZONA 4UANA 2YAMA 4JHUA 4DP5X 1SF5A 3EH3B 4RH4A 1QNIA
chains in the Genus database with same CATH superfamily
3FFDB 2VIRB 4K23H 3SOTA 4Q0XL 4IRJC 4IW4C 3N2JA 2Q7YB 1YJDH 1GS6X 1MQKH 5AVYB 3D0AA 1SJEB 1UCBL 4ODTL 3PGCB 3UO1H 3MRMB 4L1HA 2CO7A 1J8KA 3DX0A 1KSRA 1GAFL 2AI0H 2VDPL 3DUSA 3IGAA 2WKOF 3WFBH 5HXMA 2BCKB 3K8LA 3QJOA 3APMA 2ZUXA 4ZNEA 5JOEA 2Y69B 2QVMA 2NMSA 4YNYB 3FB5B 1COBA 1FNHA 3QUML 5EU4A 1HSBA 3DMMC 1A3RH 4H0IA 3WKQA 1SQ2N 3G6JA 3MFGB 2P48B 1H3PL 1Z3GL 5DRWA 3O2VL 3LPPA 1I8UA 3CPUA 1D5BA 3KLHC 1DJGA 3FFCD 4Y5YC 3C08L 3V8OA 3HI6H 1FA4A 1MJ8L 3U46A 2Q0ZX 1N7MH 1UB6A 4TMPA 4JZOA 3QNXA 2VR5A 4LSDA 35C8H 2ZQKA 3CDZB 3VTTA 2BOBA 1AIZA 4L5FH 3VXOB 3OZ9L 4HUWB 4MYWB 3KYMA 3GMNA 1MCCA 3NJGA 2H6PA 4G7VH 1EDHA 1FHNA 5BRQA 4PS8A 5IESL 4XBPA 4ZOAA 5IBLD 3MLWL 3LS5H 3MRKB 4LXFA 4JO5A 3THML 5TK2A 3LKNA 2YD8A 1QO3A 2MKWA 3FUNA 3UJIH 3QPXH 3P0YL 2ODIA 2HJKB 4NQDA 2GTZA 3UADA 1A7BA 2DB8A 2JE8A 3QUXB 1KFAL 4XVOA 1KUMA 1H6UA 3WG7B 3OAUH 4Z18A 2K4AA 3U2IA 5IUCA 5FGCB 1EO5A 5HY9B 2K9UA 2AEIT 3TZVD 2ZCLL 1A1NA 4S1DC 4E9QA 5I2IB 2ITDA 4BSVB 3FK3A 2E9GA 1K4CB 4FQXC 3UTTE 3F04A 3CLEL 1YNTA 5FS5A 5C3IA 4OZ4B 3DMMB 1PL3A 4GRWE 1V7NL 5IMOA 3HRZA 5ANMB 2ZAIA 3ECQA 1H15B 4XX1G 4Z7VE 4K3JH 4PVNA 1IBHA 3EH1A 4IBYA 3RB7A 1Z2KA 1T5WB 4MJ5B 1BX2B 3BYTA 3VAEA 4DIXA 2VRAA 3UTTD 2VDLL 4UTBH 3T0EB 4MJHA 3L3OB 3NJFA 4QXGH 1J1PH 1CFTB 2AAVA 3MRJA 5E6IB 4E2OA 3O2DH 5HDOA 4PBXA 2DH3A 1YMMB 4HK3J 5EU3A 3SOBL 1CWVA 1OCZB 2KLSA 5C0IA 4JDEA 4MCZB 1NPUA 3QHFH 5IT2H 1LEIA 4PG2C 3K2MC 1QEWA 3KEDA 1A21A 4XP9L 1T21A 2H2PD 4K23L 3JV4B 1OCWL 3EO0A 2AK1L 2GIXA 1Q1JH 3GMQB 1OVZA 3V7AE 3GMMB 2E76C 3MTRA 4ABQA 3EXLA 4PJDE 1UJ3A 1EXHA 2PP9A 3VD5A 5CBEA 4MASA 3GSUA 1F86A 4NO3A 3RWCB 3BDBA 3QWRA 5LGJB 2OR9L 2C8NA 2P5WD 1QSFD 5F0MB 3RKDC 1HOCB 4K3JL 1RZGA 4KITB 1X9UA 3H1ZA 2IH1B 5C08E 4I3RH 5GGSY 1NICA 1U8HA 3NYKA 3QQ4B 5JW4R 1WC7B 1BFVH 1LD9A 3VW3H 2YXMA 4W6YB 5LCVL 3VXRA 3CZGA 4PW3A 5CMAA 1M9WA 3ULUH 2WXJA 3WMPA 2YEZB 4K7PX 5CHNB 1AXIB 4NNYA 5I16A 1AR1B 4L2LA 3MDJA 2VXTL 3OR6A 1SZNA 5C3LD 1MFNA 4KPHL 1XCTA 3NQKA 1J1XH 3M6DA 4HS8H 1Q72H 1P0SE 3BPOB 5IMLA 1RIVH 2MSPA 4I1PA 1R19A 2WQAA 2X6MA 4PWGA 5ISZE 5J57B 1U6AL 3M1BA 1O7DC 5TE4L 1SVBA 2JJWA 5IOPB 3PNWB 1DCEA 5CP7B 4DGIH 3UJJH 4W6XB 4N8CH 3V4VL 4KXAA 2EKSA 3EHBD 4HWZB 5ES4B 5IROC 4OQTL 4OTXH 3QH3B 4FNPA 3IAGC 4WFED 1IKNA 3BHBA 3MUY1 1G7HB 3CN1A 4BH7B 1MFAL 5ABAA 3MUGB 4LLUA 3NCBB 1JGVH 2F5AH 2PTVA 3BZ4A 3ZL1A 2FX7H 1JPSH 5FDWB 4FNUA 2WIIA 1CD1A 3LXUX 3RQ3A 1JDCA 4WWKB 4AYFB 1CFMA 4AMXA 1DDHB 3CSGA 1BJ8A 1F56A 2K9FB 4M56A 1BFSA 2CDGB 3ALWA 1D6VH 3P9WB 4H8WH 1GMEA 4MSWB 3FTGB 4ATTA 3GLDA 1JF6A 2Y2YA 2XWTB 2X4SA 1MDAA 4LVEA 4UTBL 5A2AA 5K9QI 2MHAB 2BNUA 2B39A 3RDTC 4AQZA 4RQQB 1P7QB 3PXJA 1V55B 3OKEB 4KY2A 4F15C 4F7TA 1D9KC 5F9OL 1BQUA 3KVQA 1S9XA 2EDFA 2A4EA 3KCPB 4I5BA 4E0RB 4MRBA 3IVKA 4AKQA 2LAAA 2R2BA 2BXZA 3O4OB 4XXDB 2FJFB 4DP8X 4PRBB 5SWZD 2A9MH 4AEHL 3X11A 1PIFA 2Z8RA 3GIVB 2NSXA 1BVLA 3S88L 1IBGL 1A3LL 3LEVH 4QF1B 5AVQB 5JZ7C 1A6ZB 4LPXA 1WPCA 4R7DB 3D39A 3OAUL 2I07A 2X4RA 5I6XB 1D5MA 3G9AB 1IMHC 4XHJD 1BQHA 1QRND 3DA0A 4JQXA 5DHVA 1A8ZA 5SWZE 3GT6A 1XIWA 3MRQB 2BJMH 3K7UA 1NCAL 1VACB 2ESVE 4P5RA 4WUUD 4Z7WA 3S0PA 3THMH 4Z7WF 4X7FC 3B9KC 4LQFL 2WNWA 1GL4B 3V5HB 1E7VA 4MX7B 4WW2F 1EHNA 1NFDB 4L4VD 2DD8L 3T3PF 1QRNE 4TUOA 4Y1AD 1T2JA 4R4FH 5I23A 4FFYA 5DO8A 5D2LA 4QYOA 3O3BA 1I7UB 3OMAB 1FO0H 1V3JA 1UVQA 3DKHA 1L7IL 3BLPX 1SMDA 1F58L 2XWJB 3FUHA 3QG6B 3E80A 3NGBC 4S1RL 3GNML 4LLYB 4OD2B 3VB9A 4R96B 5BOJA 1J5OL 1A3QA 4HC1A 1ZLUH 2FIRT 4ANUA 3I9IA 2Q8AL 5E6UB 5DXWA 4LEEA 4NUJB 4GRLC 4KUZH 4LPCA 4CSZA 3TEYA 2EDXA 1QHQA 2A38A 4N0CC 1DO5A 1YG9A 2OPCA 3NSJA 3X14B 4UILL 2NY2C 1WAEA 3POHA 4FQPA 3L4CA 4PY7B 3GO1H 1GGBH 3WLWC 2K3HA 2F19H 5JIDA 4LSVH 1CD0A 2WCGA 2N59A 4X9IA 4NN7B 4TLSA 2VZ1A 2VSKB 2MPVA 4UDUB 3CSYA 4NRYA 2Q86A 1F4XH 3DUHA 1XCWA 3C6LB 5G4NA 5BO1L 5BZDA 5KSAA 3ISRA 1G1CA 3G6JF 1KEML 2MOGA 1HCZA 3BWAA 3B4NA 3VU2A 4TNVK 3PG2A 4HH9A 3OR6B 5EDXA 4FXTA 2C4FT 2VL5B 3EJJX 1TTRA 3NQIA 3R4RA 5DJZB 1KJMA 4NNYB 2J6EA 4TRPL 2X0WA 3N5AA 2X28A 4I77H 1NGZB 4JRYA 1YEDA 4B9IA 5CMAB 1L7TH 2X4QA 5HYSA 3NPSB 1AGBB 2BSDA 3JV0A 2DS4A 2X2YA 1DZBA 2NXYB 3CHRA 3BWUF 1F18A 3MV7D 2Y25A 2X2IA 2ZPKH 1U91B 1NC2D 4XN7A 3MA9L 3GI9L 4XODA 3K6DA 3QNZA 4JFXA 3P4LA 3VFUA 4OIAA 2CG9X 2F7OA 3VFMB 2RBLA 4RA0C 4UQ9A 4Y2DA 2FQEA 4GFTB 4V1DA 4CMMA 4YO0A 1T5XB 3BUIA 5AW3B 2CRYA 3CXHK 2Z31B 3G6DL 4WTWA 4DW2L 2YZ1A 2XWBA 1IGYA 4MD0B 2CDEB 1N19A 3KWWB 5EU7C 2D8KA 3HZVB 4IRSD 1JDDA 2W94A 4HISA 2BXYA 4ZTPH 1QEWB 1KXTA 4G5ZL 3OB0H 2AZAA 4WU7B 1TTBA 1BHGA 1QFPA 3GSRA 4YFEA 5DVKA 4NWUH 1II4E 1LE9B 2NY0C 5T5NF 4JUTA 1L6XA 2HVJA 3ALPA 1RPUA 1AS6A 1S7UB 2EEXA 3VFPA 2HFGH 3C5SA 5C08A 1QLEL 2CKBH 1M2OA 4MXWL 4PJHF 5EU5A 4OB5L 1P6WA 5EU6E 2W1NA 2J6EL 3D33A 1MJJA 4IDJL 4XGZA 3Q0HA 3FDWA 4LCWD 2HLAB 4AUUA 1FNSL 4G43B 4P2RE 2ROXA 4F24A 2YAOA 4PTUB 3D0VB 3GBEA 3GBDA 1HK6A 1SUHA 4JO1L 2WZ6A 3VXSE 2O6FA 1QWHA 4GT0A 5T1DH 4BSVA 3QXUA 4PJEA 4P5SA 2XIIA 3RX8A 3STZA 3SDDD 2MCAA 3DX8B 4P2RD 3ZT7A 3QCVH 3TLRA 3MLUL 4CVZA 3V6OC 1MWAB 4UT9H 4YZFE 2WQ8A 2A6IA 4O9HL 2JIXB 4U3SB 3HZYA 1MJ8H 1Z32X 2OMTA 4K9EC 4JRXE 2X9XA 3VH8B 4CC1A 1U2HA 1DUYB 4NQSA 2Y24A 5I5MA 1WCBA 4OD1H 3DX6B 4N2HA 4JKPL 5JPMB 1OTSC 3IMTA 1TXKA 4BFIB 3W38A 4R97B 2YA1A 4TQIA 1JZ8A 3R1GL 1T04A 2OZ4L 4GI8A 4Y5VC 1BVNT 3DRQA 4C4UA 3VXQA 4MNGB 1AH1A 3FCSB 4JFHD 3P4MA 3DVFA 5JW5B 3BKYL 2CO6B 1M7DA 3TIEA 2FO4A 5IB1B 1KENL 1TDQA 3GI8H 2H1PH 2WLZA 4MMZC 1RZ7H 4APXB 4PR5B 1JJUA 3FT4B 1JSYA 4PRIB 3G6JB 1EHLL 1MCIA 3Q44A 3BYYA 2Q2LA 4EZMA 1J0HA 3T4AA 1NC4A 2QVFB 1ZLVH 4DGVL 5IFJB 3JTTB 1KIRA 3PIQA 4W70A 4IRZH 3DPDA 3WLWD 2CO7B 1NC2B 3K8MA 1SJEA 1TPXC 1TENA 2VQ1A 5B8CC 2HT2C 4ZXBA 1AJ7L 3VI4B 4OBSA 5EO0B 1I3UA 2W60A 3PQYB 4U3CA 4Z78A 2XETA 1EDYA 2XYBA 3MXWH 3CU1A 3FUEA 3WFEH 4WWKC 2OZ4H 4ZOBA 4CU8A 1P1VA 3L2MA 3WTYA 2AMUA 4NDMA 4HCRH 4L48A 3HG3A 4KKAC 5IVZB 5GGSA 2VDRH 1S7TA 1YEGL 3D0LA 3ZUCA 5JPMC 1QUNA 4JFZL 4DP6X 5EBWB 5BV7C 4GW1A 3P11L 1RK7A 4B9ZA 4RFEA 3QZOA 3ROOB 1B0RA 2KS0A 4WY7H 1NCUA 1OB1B 2EAEA 1S9WB 3E0GA 3LIUA 4X6FB 3FUIA 4XBEL 3SKNB 4QRUB 2PLTA 1E4WL 2XXCB 3S4SB 5CR1A 3S8GB 2E86A 2PYFA 4Z7QF 1YNLL 5CEZD 4TUKL 2BHZA 1AO7E 1UH4A 1WITA 5FO9B 5EOTB 3BE1L 2UX7A 1NDGA 3FTVA 4S2SB 1FL5B 4O00A 1ETB1 4NUGL 4AEIH 1GRWA 5B3JE 2EE6A 3GSQB 4L8DA 4F57L 5DURD 3HC2A 2R0WL 3E7JA 4PREB 3D12B 3GGWB 4U6XA 5KW9L 4MA3B 3VUAA 5I30L 2KT6A 4BA0A 5IEHA 1KXVC 4Q14A 5D72H 1UXLA 3IPEA 1MI5E 1FVCB 1AO7D 1A66A 5HI4C 1WD9A 2WLNA 1YPZE 1R6VA 1ZXQA 3RY6C 4MBRA 1BWMA 2GK0B 2Z35A 2Q3ZA 1Q94A 3HVNA 5B7MA 3WS6A 3IJEB 2RB8A 3IETA 1R4XA 1JPGB 4IS6A 1AQKH 2ZP8A 2KPWA 2XZCH 3I84A 4XNMB 1MFEH 1FCGA 1A7QL 4AENA 1KBKA 1UWEH 5SWQA 2B0SH 2I32A 4AVKA 1MRDH 4TUJB 5ENWB 2WAQA 4XPAL 2GSGB 2KZKA 3SCMC 2ZSVA 3VFTA 2GFBA 2H32B 1WH0A 1S6NA 5HI5C 1F8TH 3WN5C 1QLEB 3B9VA 2PYEB 3QDMB 2XV2A 3FU7B 3K1DA 4K73A 2P24A 4HUCA 4CNIB 1W72A 4NKDA 5T3XH 3ILPB 4PAZA 1CDCA 3CH8A 1O0VA 1Q0EA 2GPZA 4XO3A 3LKOA 5ESQB 5CZRA 3P9MB 3RNKA 4PJHE 4OAWA 4TVPE 3ZIYA 2FJGA 2F7PA 3AWEA 1AI1L 3EGSA 5DJCB 5J12B 1AFVL 4BH8A 3BUBA 5JHDB 3DOSA 1GZPA 4HQQH 2FIKA 3QEHA 4F2ME 4WJG3 1RVFH 5EIIA 4GQRA 3H9SA 2E4FA 3DBXA 3UGXA 4X8XA 2F58L 1KN2H 4L29B 2VR4A 5DFAA 1RUPH 4A66A 3CFKB 2HX9A 4CC4C 3D08A 3ZDYE 2DLFH 4I2XB 4WHYH 4OV6F 1PG7W 2JQZA 2BP8B 2XOTA 4ODWA 3MLYH 1G9NL 4N24A 5IM7A 4RFNC 4JJOA 4GKSA 1GCFA 4PUBL 1VCAA 3GEWB 4DUWA 3PXHA 4I0PB 2QKSA 2K8MA 2APSA 1CE1H 1FIGH 1FV1A 1NEZG 3X3GH 1VPOL 4L9LB 3FO1B 2MH4A 3K6SB 1CICC 1ETZB 3W9EA 1T4WA 2FJHA 3CXDH 1MEXH 3HMXL 4Q6KA 1ACYL 3S2AA 1UWFA 2VXQA 3WFCH 2HJFB 1TJHH 4PJ9C 1FHGA 3KLDA 3WNLA 3QQ3B 3B7SA 1YJDL 2NY2D 3HLAA 5DRNA 4G5ZH 2CIIB 3L3KB 2P5WB 2OX5A 4BZ2H 3U36A 1VPOH 4H8WC 4O2EA 4XE5B 4U1MA 2RQEA 3VCLB 1SLUA 3CVIL 3IDUA 2DJUA 3X1BA 3O0RL 3O41A 3ET9F 4J3OH 1RZFH 5TGBA 1VDGA 2YKKA 4IEFB 5E8PA 1EAPA 2EP6A 4JQVA 3BP7B 4E9WA 4UF7C 2ATKA 5GZOA 1IUZA 1DR9A 1E3XA 4PJFF 3DHMA 4AJ0A 3HNVH 3K71B 1A22B 1T6VN 1E9OA 3Q3GB 1KELL 5CN1A 2RALA 1OAUH 3GHBH 4JLRA 4MA1B 1SN2A 3TIDA 2EEAA 5HHNB 2BWIA 4HBCH 2N4IA 4K3EL 4YUEL 4YEEA 1I1CA 5A6MA 4CN1A 2E9JA 4GSDL 1QLRB 1AGFA 5D7LA 2NNFA 4GUPA 1BP3B 1NFIA 2FUTA 3D69B 3ULVC 2IWFA 4IGBD 1QA9A 3K1KC 4IGBA 1CDYA 4YDLB 3ARPA 2IGTA 1JN6A 2OSWA 3BO8A 4I0CC 5JIPA 3G5YB 3T0BA 3VJ6B 4M5SA 2C9XA 1JNNL 4L0ZA 4A6YB 4CAGA 4GINA 1YNKL 3KPLB 5E2TL 3OQ3B 1CFVL 3BMVA 8FABB 4CGUB 4EUPG 1B4TA 2F61A 3MI6A 4HCGA 5LO7A 5K59F 4NO2A 3TURA 2C9PA 4FZ8H 2NYZA 1I8IA 4LLMB 1OQXA 2DPKA 4FL4C 2IPKA 2V2WA 5D8JH 1YMHB 4J1UA 4RAVA 4WDIA 3WJMB 1QPPA 4QRFA 2OYPA 1AKJD 4FE9A 4AVHA 1U3ZA 5I6NA 3RWIB 4FS0A 1X5KA 4NRXA 5F3BB 1SBSL 4P9HL 4E5XB 3QCUL 2YMOA 4BQ6A 3QQ9C 2D3NA 2J5WA 2G0LA 1CI3M 3IFPB 5F9JB 1EA9C 5KW9H 4Z7WE 3SCMD 4QOKB 4OI7A 2GT9B 4RMBA 2FX7L 2J72A 3UTTB 3BIKB 4QJ5B 3QUZC 4BFEA 4FMKA 1NAKH 2IIJA 4PJEE 3VGFA 1BOGA 1TVBA 2CNZA 2Y06L 4R0LB 2L3BA 1DQLL 2E7HA 3OKDA 5I73C 2YA2A 3NA9L 1YEIH 3QFJE 3WMQA 5MHSD 3WKNA 2ZJSL 3Q1EA 4GMSH 5B38B 2YUVA 1A4AA 3W9DA 1P9MA 1JGEB 2VLRD 2X44D 1FO0L 2HLFD 4JE0A 5D70H 3D30A 3M17B 3TTYA 3WLBA 3GF8A 2OCCB 3AB0C 1YEGH 2KHAA 4M7ZB 3U4EA 5FA3B 1BVKB 4L4TD 4PJ5D 2R1XB 3RX7A 1AO7B 2QFRA 2W9DL 1J11A 4JO4H 4Y4KD 1CK0H 2DQEH 2E6JA 4BJLA 3SB3A 3DROA 1MPAL 4P5KA 5GRYA 4HEPA 5HGDB 5K9JL 5TFSH 3D34A 1Q9KB 3K4DA 4K5PA 4HHAB 4QWWC 1SFHA 3L1OH 1RIHH 4TNWK 1RPQA 4I77L 3F12B 1JRHL 3TU6A 4XCCL 3NJNA 4GW4B 2GJ6A 3EFDH 1VADA 3ZDYF 2IADA 3VQMA 3QI9A 4DQOL 4O2CA 3U4BH 4OUOA 1G7MA 2F68X 3AM8A 4JY6A 5E2WH 3APDA 2A9ML 4BBWA 1H3VA 5FGBA 4M7LH 1QKZH 3P30H 1VZGA 5AB9A 3CMGA 1RZKL 1QBBA 1SYSA 4MBOA 1SEQH 5F71A 4R90H 5K9QG 1GCYA 1UWGH 4NSKA 2BNRD 3FTSA 1A7NH 1CI5A 5F7NC 3N41F 5DK3A 1FDLL 2WZPD 3FB8B 1N6QH 2OL3L 3QUZA 2DMBA 3KVDD 1I3GH 1ZA3B 2EQDA 5HHXL 1WT5A 2PTTA 5GZOC 3SE4A 3KYOB 3MBEA 1FNAA 2F5AL 1BPLB 2P8LB 1LP9E 3MJ9H 4TQEH 2Y23A 2IH9A 1CLYL 1N10A 1W9XA 4P48A 4PP2A 4WI3A 3MV8B 2X6BA 5DC2A 3HHRB 3GXNA 4FQ2L 3B37A 1CTOA 3TH4T 3FBQA 1ZHNA 4KQ3H 4X5WB 3VRLE 1WIOA 2P28B 5SWSA 4DZBA 4MMZB 4DZ8B 2JJTC 1JHLL 5K39B 1WWCA 2VDQL 1T1ZA 3T4YB 5AENA 5GGUA 3JWDL 3T0XA 3MLTA 5F3HA 2EYRA 3D39D 4NNXA 4AMKL 5E8EA 2X89A 3UP6A 1QRKA 4RETB 5DD5L 3VWJC 3QJQB 4AQ8A 2UWEE 1TNNA 2AITA 1N59B 1A8JH 1ROCA 3GXTA 5IW1B 3BW9B 3T2NH 2GK2A 3RUGA 3IRPX 4JPSA 8CGTA 4ODVL 1SDAB 4FQCH 5IB3A 3U9PH 3RVWD 4JFYB 4D0DB 1WA0X 4PJHA 1RI8A 1MWAH 1LP9F 1FL6A 3WGUB 5A6IA 2ZOWA 4NJ9H 5BS0E 2DQGH 2RGSA 1GKEA 5BVPH 3E38A 2H3NA 5IQ9A 2Q87A 1SDDA 2AV7B 5EORL 4KJYA 5C07D 2X9YA 3PWUB 2LOEA 3ESPA 4MZIA 5PCYA 5AW9B 4HYTB 2ZIDA 1RCYA 2BP0A 5D7IF 1YC8A 3G5ZB 2VH5L 2HKAA 4LT7A 2DDQH 3QO1B 4BKSC 1TTAA 1CN4A 5HBBA 3IDJB 4NC2B 2DTSA 4P46A 4M8UA 5ID1B 5JR1H 1U8NA 5EZLA 2R8SL 5DHDA 3U9PL 1IGIH 1A9EB 4RGNE 1OPOA 3CFEB 3T3MB 1N0LA 3QZWA 4XPTL 1LEKA 2YAMA 2X4UA 3N3EA 4X4XB 1OT1A 1HHJA 1MHCA 4JHUA 3DV4A 2QHLA 4OF6A 4CVXB 1MFCL 2ZUQC 1PF3A 4QGYA 1T0PB 2LTQC 2PWDA 1JHLH 3O8XB 3GMLA 3N6YA 2PPCA 4PCKA 3WE1A 3CAFA 3OF6A 4Y16D 3B2UC 5GQBA 1I8KB 1HI6B 1M05B 2Y1ZA 3S8WA 4JRFA 3KWUA 1SJHA 1OOWA 1GTNA 1HH9B 3VFVB 4PIRF 1OAQL 5FXCH 5LBVA 4AIXA 1FZKB 1D5RA 1A1MB 2FBJL 2EYTA 1TKWB 2N0KA 3FH5A 1JVOA 3EJPA 4X9BA 3ZRFC 2H9GB 5D72L 5ALCL 1I9RH 4X4KA 2EXWC 5AW4B 2GI7A 5I82A 5E8NA 1MH5B 5HVHB 1U58B 1I3VA 1CLZL 1KJ2H 3ARFC 3HMXA 1VGEH 3OMNB 3FN0L 4JGUA 4CADA 3C60C 3P4OA 1J88A 5FDYA 5FYJE 2J44A 4N1EA 3GDCA 3HNTH 2KLTA 2YPKA 5KJRH 4N8UA 1NUNB 3VX0A 2CUAA 5BUGA 5E24E 5CLWA 3FOLA 4X0KA 3ESUF 4YDIH 2Q5BA 2JQMA 4JO1H 3D2UA 2CO1A 4Y4KC 4J4PD 2VQTA 4D9LH 3LHAA 3TNNB 1FNSH 2JTDA 3D2UB 1I4FA 1U2YA 1IE4A 3RTQD 2VAAA 4S0SD 4DP7X 2Z34A 1NANH 3HMWH 3MFFA 5MEPA 2ADJB 4PV8A 2WJ5A 1D5XA 3GTTA 3DDGA 4Z7UE 1UD2A 4FKKA 6PAZA 5IF0B 4HWUA 3D8MA 1CICD 5BW7C 3D3VD 3QUXD 4Y2OA 1WWWX 1XF2B 1G4MA 1BM3H 2DV6A 3WEMA 4YBLC 2UYLB 1JPEA 4WEEA 4BE5A 4PJDB 4UQCA 5L7XL 5EEZA 4LSUH 5JUEL 4GW5A 4KTGA 3KLLA 5AW8B 1NOAA 1L5GA 1BREA 5E95B 1ZHKB 1INEL 2K0RA 3MRDA 3JWOC 1WYJA 3SZKC 4FAAB 5HI3D 5I26A 3S36L 3DTUB 3HG2A 4PS3A 4AQAA 4UAHA 4Z3IA 1RJZB 4PRPA 1V5JA 2X70A 4PJAB 1A3RL 4BV1A 3IF1B 4PB0L 4B27A 1I8KA 4DAGH 1RK1A 2VLJA 2H1PL 4Z7UF 1WD8A 4M9PA 2Z3FA 3KGSA 3ZYZA 2VN4A 3QR2A 2ZE0A 1E9QB 2ENYA 4MZ3A 4TQEL 3TV3H 5I8CB 3MGTA 1IKNC 4NBYB 1FE8L 4NO0B 4PBVC 5HYQA 4HCFA 2DI8A 2OV0A 4JCLA 1N5AA 3B8YA 2JK5A 4FQLH 1ILUA 3RWHA 1MG2C 4KNTA 4HV8B 2H0PA 1NM9A 2GITA 1YPZF 1FSKC 2XKNA 1CFNB 2WD0A 4FRWA 4ZX6A 2BVEA 5F7KC 2EE2A 2G9HA 2OSLA 2YPVH 2VXUH 3I75B 2WWMD 3V4UL 1J5CA 3VQ1C 3M88A 2AABL 3FYIB 4M48L 2YGNA 2AQ1A 3U7YH 2XHNA 2XZAL 3VWKB 5AW2B 4X7EC 3BMWA 5KYUA 5B7EA 1UXSB 5HHVL 4RBPK 2D3JA 1SDYA 1MLBA 3G5VB 3N40P 1OGTA 2QSVA 1TU2B 2LLLA 3QIWC 4U6YB 4PJHB 5E94A 3NZHL 5D7JD 4NQED 3RLSA 1EGJL 3SQRA 5E2UH 5I71C 1R17A 5LKNA 1M7IA 3CNKA 3O6FD 4HDIA 1JF1B 5E8EB 3V4PH 1T7YA 4UAOB 4XMWA 4EN3A 3CVBA 5KVGH 2GJ6D 3L95B 5SWZA 1D6VL 2TRHA 1N6UA 5F88A 1E8XA 4I0KA 4WHTA 3MOAL 2WLKA 3D4GA 1E4XL 4LNRA 2E9WA 4JFED 1RHHA 4PPTA 3UG4A 1SPDA 5H2BB 2A99A 1NMBH 4HF5H 3TVMB 1KCSL 4GRLB 3VI4E 2XV6B 3CIQA 1QBMH 2XV0A 3SPIA 2Q3AA 3WD5H 3U6RA 5IIEB 1OKEA 2P8LA 2A73B 4Y16C 4M8RA 2R23A 4NQCE 4K2UH 1NGPL 2LTQB 1BD2E 5DDHA 3TFKD 1DSYA 5DVMA 3K4AA 1FZJB 1E3ZA 4TYUA 3P2BA 4HS3A 1D6EB 1R1CA 5D1ZB 5JW4Q 1HWHB 1H3PH 1XBRA 2NY1C 2AJVL 2X1XR 4UBDD 1P69B 4I0PC 4WHDA 3ULUC 2CLRA 3OR7B 3WD5L 3BP5B 3B5TA 1MI5B 1U8IA 4MS8D 1NMAL 5HD8D 3HNSH 4BQ8A 4YL4A 1OGSA 4Z5RA 5FYJU 4LVOC 1FBIL 4WSJA 5D6DA 2GHWB 3PHSA 5EZJA 5EU6A 3KPOA 3ES6A 3L3IA 2RR3A 3PV6B 1F90H 4I87A 3L81A 1G0DA 1TZGL 5SWSE 2ADFL 4QUOA 2HT4C 4GEJA 3WIHA 2ADGB 3PWJB 2FECL 5CIPH 3T8MA 5E6ID 5AYUH 2GHZA 2YQ3A 3GHEL 3BESR 3PFQA 4X80H 4MXQC 4MJ6B 3TBCA 4LMQI 4CDHA 1A3ZA 2DQIL 4OUUB 2XBTA 3QORB 3UYPB 5F2FA 2F1EA 1MREH 5FM8A 1GZHC 1G9NC 4N85A 3WV0A 3QBTB 4BKLA 1QMUA 4GJTB 4HX1B 4ANWA 4HD5A 3QIUC 2JTYA 4M5YL 4PJFE 2D3LA 2RACA 1TQCB 4YDMA 4QAWA 5DR5L 3GJEA 4QRBA 3AB0B 4GT7A 4TVPD 2JVUA 4PJ7E 3SPHA 3EOBB 1U4EA 1KBGH 1F02I 2WQUA 5AYQA 3C6LC 2UY6B 4N2DA 1TTUA 2V2XA 4JREC 4Y4FA 5DSCA 3RNQB 5MI0B 4G5AA 4XP6H 2D4FA 4ZD3L 4ZFFA 3QW9A 3UDWC 2GJZB 4MA1C 4BD4A 4ZG1A 3P54A 3RVXC 5AVRB 3L5JA 4HUMB 1JFHA 1X9LA 3PAYA 4NKIH 5DD0H 3F05A 4RGMB 4YMPA 3CFBA 3PGFH 3MBWA 2LABA 3Q8BA 4TXVB 2VW6A 1ZWIB 2BWQA 5F93C 2NUPB 1IEAB 1R3KB 3MZTA 4JAMA 3NFPA 1SYVB 2JI3A 4JFFE 4H88L 3LKPB 4DO4A 1NEPA 3GUTB 3O8XD 1ZY9A 4Q6IB 4AH2A 4TSBH 3UROR 2CPUA 1KF9B 1ZA6B 3ULSA 1IM9A 1E6OL 4ZFGH 3WFCL 3AU1B 5L4FA 4LMQE 2Y7LA 3QSKB 4AVJA 1C5DB 3NIFE 3HG1D 3FFOA 2BW4A 4NIKB 4PBDA 3S3DB 4U1KA 4ENED 2VSMB 3QEQD 1BVZA 1X4YA 4WCYL 1EFXB 1NCBH 4JFQB 4ECNA 3LQZA 1F00I 2C1PA 2UY7B 4MNHA 2A6KA 4N2MA 3ORJA 2ZWKA 3LAFA 2QJDA 1DBKH 5C1MB 4I7ZC 4MHHI 4NPKA 1E7UA 4OW6A 5CM1A 3CXHJ 3PWPA 3Q13A 1FSKB 3TS8A 4B5EA 3TF7C 5ITBL 1EZLA 1HDMA 1T1WA 2MPAL 1QSFE 3GFUA 4YDIL 2D31A 5D1QC 5D7JC 2WPGA 2OMNA 4MJID 5F6IC 3C60A 5C70A 3CG8A 4O02A 2CDFA 3R19A 4JG0L 3ZE2E 1FI8C 5SX5K 4YHML 5KUKA 4LKXB 1FCCA 2CGYA 2XQYG 4GRWF 2JSFA 4Q2ZB 3FRPG 3LKQB 3L3DB 3C60B 4GBXB 4Z7QB 2Z93A 4LCUB 4HIQA 3K71A 1L9MA 2FEEL 4W9JC 4LCWA 4L1LA 1Z3GH 4KKLC 5L6YH 2DQMA 3GXMA 3SYCA 4G8EA 1MCLA 2Z31D 2OK0L 1MFBL 4H5SB 2GEQA 4MNHB 2QGDA 2R0KH 2LU7A 3CFQA 4JG1L 3TBTB 1Q4NX 3L5XL 3GSVA 3MNDA 3SDCC 4XBMA 5GPRA 2P5EE 2QHRH 2XU9A 2X1WL 2Y4SA 4XWGH 5K9KA 5CWSA 2J1YA 2L7JA 5FF6B 1TVHA 1XGQB 4B0MM 5GS2D 5IQMA 3FQUB 1THAA 2UXVA 1YPZA 3S96B 2HRHA 3GXPA 3ZHKA 3WDJA 4QTHB 2ZKWA 3VG0H 2DTMH 3GEFA 3SOBH 2GAZA 5DEJA 1DO6A 2R4SH 1OP4A 2VXQL 4KC3B 1EO7A 2WWKT 1AIFA 1RMFL 4UU9B 4QRQA 5E56A 5L2JB 4KI5F 5JW3L 1G7QB 4P3CH 5K69A 4J3OC 3ARDB 2HG5B 4OCYH 2DDQL 5C0DA 2D9QB 2QR0A 1UUNA 3LXCA 4L9LA 1FV1B 1OAYL 1M9SA 2FRGP 4ONHA 3BN9D 2CUIA 4ELMB 4LPYA 1KFAH 1ANUA 4L4TA 4PJ5A 3RI5K 5GS0D 4ODXB 4S0HA 1DJWA 1OSYA 3II2A 4NI6A 4OFYA 3PWJA 2AJYH 1CGXA 1OSEA 4G82A 4XTRC 2YKLH 3D4CA 1NSNH 1FORL 4W9HC 1WIPA 4A1RA 5L2KE 3PHOA 5J1AB 1CLOL 3KPOB 1MLCA 3LKRA 3HE7A 2QVKA 4IBWA 3F00A 3CBJB 4DKAA 1FG9C 4C83A 4AL8L 4BKLB 4YBHA 3UYPA 4GQZA 1CE1L 5JHDA 1A9BA 5L2KD 3QIUD 3IS1X 1NCBL 3OM3B 4MJ6A 2PYED 1MCWM 3EGDB 1KYUA 1WVZA 1XEUA 2ILLA 3I3EA 3QDMD 3ZKMC 3BSZL 4XO4A 3RJOA 4WVRA 4NQEB 1OP3H 3TJEL 2Z91A 4N2LA 3O3DA 1FZJA 1F4WH 3MGOA 3OZ9H 1PDKA 4PGCB 3F01A 2HKFH 3WTVA 4IRJB 4L4JA 5EU6B 1T66D 2EUWA 3L1FA 4WO4A 2H32A 2OJZH 4NQTA 1ND0B 1X6LA 2FLBT 3MXWL 4ZRGA 3VFTB 3VVVA 2A77H 4WNQB 3BJLA 2JB5H 3DC0A 3NH7L 1KXQA 4F2EA 2F1AA 4GRLA 1EDQA 5D4QA 2F7QA 4M43H 3IK2A 4KHTH 5I71B 4J3OF 2O5XL 3HC0B 4H8VA 2QQLH 2IANA 4LSTH 2VNCA 3DX2A 2BW5A 2ZCZA 4LNRB 4K71C 5CCHE 1KB9K 3WN5B 3KXFD 3T8XB 4XPFL 1QPKA 4M1CC 1TUPA 1W0VA 3NCYP 4DKDC 4KROD 5IR1B 4HS3B 4P4RB 4U0RB 4XPGL 3TVMC 4Z7OF 3AWGA 5DMGC 4PV1C 1LK3H 1CQYA 5T1KB 2R29A 3VYNA 5D71H 3WSQL 3DARA 3TCLA 1N6QL 1I85C 12E8L 4X4ME 1DTUA 1FGVH 3FPYA 4MAYC 3ARWA 4G6JH 3FHQA 1BZ9A 2Q6WA 4ELKB 4WI9A 3A0OA 4N6RA 3CGTA 3ZY7A 4MQTB 3QIWD 3A6CL 2VR6A 4OLUH 5E03A 4IOSA 1TEYA 4YHKL 4YHLH 3ZMRA 4E36A 5DUMH 2ESVB 1RZJC 2CZNA 3F65A 4QHMA 3FQXA 2PTUA 1E50A 1J9RA 5CIPA 1XO8A 2WHVA 1IM3B 1NH6A 5A2FA 2I9LB 4MB1A 5LBSH 2XWCA 1P5UB 1KBGL 4F7PA 1KEGL 2BRRH 3JSSA 3AITA 2AK4D 1WBZB 1X4XA 2EZ0D 4ALAC 2DQGL 4F8OA 2VXVH 5AG8A 4DCQB 4XN5A 1TU2A 4R8WH 2N56A 4FFWD 1YQVH 3DHUA 2BNQD 3W2DH 2J1XA 3D2TA 3RZWA 5IW6B 3KPTA 3LQMA 1RZQA 1IFHL 1XGTA 4RGND 4ANXA 1I1FA 1INDL 1PD6A 4OZIA 1T22B 4JY5L 2IEPA 3O0RH 2G9HB 2OSLB 7TAAA 2X70B 4LP4A 2XCMC 3ARDD 2BNQE 4IIQA 3NN8B 5DJ8A 2Z4QB 1MFMA 3PIQB 5IJVA 4YHPA 2M8XA 4PJXB 1G9MC 4YPGA 5GZNA 2ZCHL 4UQ3A 2JI2A 1G94A 3PDOB 4AL8C 1P2CA 1D5IH 4UTBA 4MD4A 5KBNC 3IGKA 1JZFA 2YGOA 2APVA 2BSCA 3B9KA 4GXUN 4P46D 1PG7L 3GM0A 2C3HA 4XNBA 5F0JB 5GJTH 1O6SB 1ZT1B 2FQFA 1UOKA 5A3IC 1RZKC 1T0MA 3ZQ9A 3OPZL 1KCBA 1NOLA 4G7SB 1ZTMA 5CLYA 3PJSA 5EUOE 1H3XA 2J73A 2FNWA 1AP2B 2CXKA 4PV8B 1KULA 4L9LC 3QA3B 4KK9C 3ZE0E 3UZQA 1ADWA 4GXVH 2B1AL 1M71A 1XWVA 3D2UD 4PRPD 2PWFA 1EBAA 3HZKB 3VFSB 2KPNA 5MP6H 3PWLA 5D4HA 2OYKA 3DJTA 1WCBB 2CGRL 4O5LH 4ZTOH 5CLZA 3HA0A 5CZKA 3OWEA 4PJAF 1KC5L 1NCTA 1NGYB 1UCTA 4LRNH 2ADYA 5I1LA 4R0LC 1WK0A 2L7QA 4RMVA 4NC1E 3I74A 1MRCL 1QFUL 1Z9SB 3B9DA 3H7BB 3VXRD 3LMJL 2ADIB 2VUKA 1NGYA 5DO2C 5GIRA 1MH5A 1YEHH 1PZDA 4CJ0A 4DQAA 4DF9A 2W0KA 2YPVL 2J6WA 3HKFA 1GOHA 1JMZA 3QCTH 3C5ZB 3CC5A 2ITCB 5EDSA 4TULL 1GR7A 1A6WL 1MF2H 2BY0A 2K3TA 1A4JB 1BGXL 4XRCB 4YHKH 5JA9A 1CF1A 1YMMD 4QI3A 3K2KA 3QEUB 3SKMA 4NN7C 4WI5A 3EYVA 4MNQE 4P23A 4N25A 5HGAA 1KBVA 2HVBA 5I0WA 4UM9B 5KAQF 3UAJC 3WO4C 4PRHB 4BA8A 5E8DH 3VXUB 1VFAB 2L4OA 1OT2A 4P04A 1KC5H 5IJCC 4YC2B 1HJCA 3Q01A 2HVJB 3R0NA 2XZAH 2CGRH 4O5LL 1A7QH 2FYYA 5DZJA 2HVKA 5E8NB 3PDGA 1ZVYA 4LCVA 2YQBA 1Q0YH 3TBYA 2WKOA 1AZVA 1TOXA 1IGJB 2WNGA 3MRIA 3H2PA 4G9FE 1TVDA 3RTLA 5IFHH 1CFBA 2CDEA 3OTTA 4HC1L 4ZW8A 3NN8A 3B43A 3LNGA 1MW2A 3G5ZA 4IDJH 4PMFA 2O6EA 4EDXA 1U8LA 5ESVB 1AS8A 3L4WA 3P3RA 3NDYE 3FMGH 4I18C 1YZZA 2OP4L 2DAVA 4JFDE 1FLRH 4LEXL 3VACA 3VE0B 3GRWH 1IVLA 4KJYB 5D7LE 1GIGL 3O8XA 4HXBH 4XMKH 1LO0H 2VOTA 4X6CF 3GS4A 3FOMB 1B4RA 4AWJC 5DZVA 3RIAK 3VGGA 4BGDA 5FYKD 1SLXA 1FP5A 2EE9A 1YCSA 4AM0B 3NSCA 4ZXBD 3AXLB 3O9WC 3ZDXF 1JP5A 2Z0UA 4NP9A 3BDYH 2DM7A 1WBZA 3CFEA 4HSQA 1Y07A 1EXUB 4B9YA 4DGIL 4IU2A 2A83A 3SSGA 4YHPB 2VMCA 3SGJC 1P5UA 5HDBB 3INUH 3W11D 2H6OA 1WF5A 2Q7AA 4B9FA 3SO3B 2VMFA 3RE0A 5L0QC 4NS0A 3AMKA 3IPFA 3PS6A 4BK5A 2A9NL 1G9NH 3A4DA 4XMLL 5E5UB 4JFZH 1ZDSA 2EZ0C 3H9ZA 4M1GH 5DLLA 3V55A 1ES0B 2ZOLB 5SWSB 1S8DB 2VR9A 2OMZB 4KVNH 5F1KC 4YQXH 2AEPH 4M7JL 3DGGB 4OIFA 5L8JB 3NK4A 3UBXA 3OMZA 3E6FB 3DHPA 5E2UL 4E9YA 3LCYA 4HJ0D 4HBCL 1RIUL 1JPTL 5LBGA 4WAFA 4G11A 3KYAA 4UTAH 3CFCL 3BW9A 2WWOA 4FQXA 4B96A 1X7QA 5LBSL 2PTTB 5F97E 3MMEA 1FFTB 3AZUA 5T5FH 1JAEA 3ZZ1A 3U0TB 3QNFA 3ZX1A 4YHZH 4UYPA 4G80B 2VO5A 4GUCA 4POZC 4JG5A 2QPEB 1HH6B 1RUMH 4MMXA 2HMIC 4MMZA 4DZ8A 3ZKQD 5DMKB 4ZFZA 4MCYB 2XIBA 4FTDA 5BO1H 2IAMD 3N0PB 5KBKA 1JVKA 3CVIH 3PPEA 2IAMA 4HJGB 4KK8D 4LCIL 4OD2A 1JZHA 2V17L 2CHXA 3WAJA 3MV8A 4FQLL 5CJQL 1H8OA 1VADB 2XWJA 4FERA 2B0SL 1UVQB 1ODUA 1NDMA 1QOKA 3KYOA 3MBEB 3TEUA 1MFEL 1QZ1A 2BO0A 4HPYH 4IRJA 4PGCA 1XL4A 1B2WH 4DVRL 4P9HC 1B3IA 5J89A 4U6VH 1D5IL 1KTBA 3U30B 2X09A 3FU8A 5D2NE 4QXGL 4Z3JA 1R3HA 3K46A 1J18A 3ZJAA 3KLHD 2DWYA 5ITFA 1NLDL 2R1XA 3LVTA 5DD6B 2IFGA 5FA3A 1Y0LA 3WN5A 5AOKA 4F7EA 3L6FA 5BCAA 2BIOA 1JZIA 4HFUH 2VXSH 5EIVA 2FDBP 3COOA 1EGJA 3DPBB 5ICXA 2FB4L 4PRIE 1MKFA 4WNQA 3RHWK 4QF1A 3DSFL 2DQHH 3QJZA 4QNPF 5EEYA 3L1GA 3BP6B 4U4IA 5D55A 4HWBL 3M7OA 1IGCH 1BM3L 1MHPH 1NOFA 4DP1X 2ZWLT 5E2VH 4KKBC 3AW5A 1YHPA 2WZAA 5IB2B 2LFEA 5ANHA 1ULVA 3KYKL 1ZEAH 2ZNWA 3QISA 4ODXA 4L4TB 4PJ5B 4JUSA 1T66C 2XTLA 4HFUL 4W6WB 3HRPA 3RGHA 1Y7VA 1SY6A 5SX5H 5CINH 3JWNE 5CZXC 2FGWL 1A9BB 1S7VB 1T83A 5E5RB 2CE6A 3UZVA 2IV8A 3FZUD 4N3UA 3HRZC 3FJTA 5JZ7D 2VAJA 4C83B 3C9NB 3DOIA 3CZNA 5C0AE 5CUSL 2F1BA 2B08A 2P42B 3OKDB 3UIZA 4YHIB 4L5FL 4QTHA 1DBJH 3QQNA 3VI3B 3B9KD 3W0WE 4MXVF 3ZKNC 2UXFA 2DBLH 1T1YB 4Y5VA 2AQ2A 1J05A 1VENA 4L8SB 1INQA 2QTVA 3HOGA 2WTRA 3V95A 1V05A 1SXBA 1BG9A 1KTDB 2VM4A 1YRKA 5C0DB 2PO6C 4ELDA 2F7RA 4E5XA 2H8PB 4R2GC 2O4EA 1T2QH 4QRQB 5EF1A 1SM3L 5DWUL 1T20A 5TDOB 1BM7A 1KY7A 4OD3H 4P4KD 3KPSB 5GRJH 3OG6B 4FQJL 4AJYV 4AK1A 3UBHA 4G8AC 2W80C 1ED3B 1DQQA 4IM8A 4NUGH 4LZKA 1XHHA 4FG6C 4AEIL 3HS0C 3P3TA 4JANB 2YXFA 5KSAD 1ZV2A 5DD3L 1V3MA 5B8CA 2QELA 1HXYA 1YEJL 1PX3A 5EWIH 1DCLA 2OMUA 1FO0A 4NT6B 3TBTA 5IFAH 1YNLH 3HE6A 3DETD 3O6LL 3VXSB 1WC7A 5DQDH 3L5HA 5LNEA 3T65B 2BIQA 5CSBA 5I6PA 3AREC 1BQSA 1S7WB 2NZIA 4K7FB 4YH6A 1RUKH 3HE6B 3JZ7A 2JKTM 1B0WA 1RZGB 4NN6C 2YSSB 5DHEA 2ITFA 2WQVA 5D93B 1HEZA 3IFOA 5JHLL 4YHMH 2M1KA 2E6PA 1OARH 4NX0A 2G2RA 1O7VA 4C56D 4W4NA 4TQ8A 2V7HA 5D6CA 1NAKL 1JBJA 3LN5B 1ZCRA 2OYLA 4U6TA 2O1AA 2CSPA 3N04A 4LP5A 4EIZC 1CFQB 2WBXA 3I6SA 1GZQA 1BFVL 4L1TA 2X05A 3UFIA 3P9LB 3LYRA 1M3IA 4LEXH 4U0QB 1R3KA 5FK9B 5D7EA 3FQYA 5LUMA 2K6YA 3CSPA 3QZMA 4DKEL 3BJ91 4FG0A 2WZ0A 3HN3A 1NBZA 4QT5B 1ZTXH 5J3HD 2QKIC 2PN5A 4HKXB 1H6EA 4B6ZA 3LQZB 4JPIA 3IXAB 4J3TA 1F4YL 3F64A 1TETL 3MX0A 3UAJA 2F54D 2VSDA 5FKAA 4U1MB 4ZZFA 1IAIH 1NGPH 1Z0NA 4L8SA 4CA4A 4MWFB 5BNXD 1N4XH 1A7PH 2GJZA 2BIIA 4HXAL 4MJ5A 1WFMA 4HP5A 1N3NA 2R4SL 2BP3A 4Q6YA 5D5MF 3U1QA 3BGMB 1FAKT 4E5XG 2IAAC 1H15A 4H88H 1ZK5A 2D03L 5IMOB 1EXGA 1T20B 5TDOA 5GSRB 1MJ7H 3Q6GL 4BZ1A 1OP5H 2OJEB 4A37A 2XQBH 3UTSE 5FEBA 4UM8A 2H8PA 4QHNA 3O9WA 5KVGL 3ZDZF 4OUUA 4GSRA 4R26H 4KWUA 5D2NC 1IC4L 4A7GA 1QHPA 4NLHA 4NO5A 4RX4A 4OIBA 4X80L 3UTSD 1RHFA 3L4TA 4G1EA 5DURB 4NKDB 5DZNA 2BP8A 3MNWA 5DVPA 2D7TH 5H35B 2HTLC 4P2OD 4GAJL 3CFKA 3TJHD 4AX3A 2PYEE 3QDME 4L29A 5FO7B 3ABMB 4KO7A 1T6WA 2CQVA 5C86A 1LO4L 1MPAH 5ICXB 1QFWM 4Y2DC 1NZRA 1UOVA 2VISA 2KKQA 5FR3A 1EAQA 2CUHA 4FMVA 1RZJH 4OLVH 4WENB 4Z8FL 2P80A 3CDZA 4HPHA 4OJYA 4K94C 1MVUB 3MKKA 1VIWA 3IMRA 3ZDZE 1XR9A 2O5ZH 3H8NA 3ARUA 3RNKB 3MLVL 4QLRA 3FCGA 3IGFA 3ILEA 3ZZLA 1TJIH 2HFEA 1Q1PA 4CNIA 4GAAA 5DDHB 4PRDA 4WWNA 3PQYD 3EBIA 3ZKND 4Z95L 5E0FA 2ZUSA 4A7SA 4HG4K 1Q9OA 2PCYA 4HUUB 1EX0A 5D96B 5D1ZD 5SV4A 3Q8AA 4XT1C 1BBDL 3H3PH 3L7FA 3VNZA 4XPBH 2OW7A 1MCQA 4XNMA 5MI0C 4MCYA 1MUJB 2CR0A 4XOCA 5DD6A 5DMKA 2FJUB 1NINA 4XC3L 5F7HA 1B4LA 1P1ZA 1W15A 2OCJA 1R5IA 4ABUA 1PG7X 3DV6B 1IE5A 2FATL 5DUBB 4XXCC 2PP7A 1IRAY 1JF1A 1THCA 3BPNC 3C5JA 3K2UL 4HDIB 4PJBF 4MAYB 3KXFE 1TQBC 1X7QB 4AW7A 1ZLSH 1VFBA 1BMGA 5L2KA 4A7GF 1UTDA 5LDSA 1ORSB 3U6RB 1A7OH 4ZUSA 4B50A 5C7ZA 3U6XA 3FUFA 4LDLB 2BK8A 1Z9OA 3E6FA 3D3VB 2A9DA 2WJ7A 3QPKA 1S3KL 1UXSA 2EO1A 4IKIA 1RHHB 2V8LA 1CFVH 3D18B 4R3SA 2MNWA 3S5LG 1AQDB 4ZFZB 1S8DA 3AY4A 2AK4E 3DXAD 5F9WC 1RSFA 3BIAX 5IB4A 5F88B 1CU4L 1PKQB 3I9AA 4MDIA 1UWYA 3RWFB 3HJ0A 4HJEA 3D50A 2W0LA 2UUDH 3V4UH 2C9VA 1AAJA 4HETA 4MQ7A 4HPOH 1UZ8B 3RA7L 4U7SA 3TEXA 2PWEA 1QSZA 4POZD 5IFJA 4IU2B 2E74C 5KSBA 2BM3A 4FQXB 4JJ5A 4GW1B 4TULH 2UZXA 4N26A 3VD3A 5EZOH 4BZ2A 2EXYC 1N5AB 5E94B 1CFSA 4OY9A 4P2RB 5FO8A 4AM0A 1D7DA 3FT4A 4XC1H 4IOIB 3DX1A 5ESAB 3OSVA 5I8CA 2QL1A 1E9QA 1NCWL 3QG7H 3KE0A 2AZUA 5LQBH 3VB8A 2H1LM 2W60B 3PQYA 5EU7E 1IM9D 1KJ2B 3UC0H 5E4OA 3UABA 1AYRA 1PQZB 3SPVA 3VXQB 1NC2A 1OPGL 2IALA 3IGUA 2VN5A 4PRNB 3AJ7A 3LZPA 2OLDA 4AMWA 3B34A 2VDLB 3C12A 2XUWA 3TO4D 3T08A 4M5TA 1NC4B 3JTSB 3Q6FB 4FCHA 5I1HL 3NH7H 4X42A 5C0BB 4FFZL 4PRIA 1JGLL 4NQSB 5F8QC 4YLCA 5J11C 5J6GA 3W1ZA 1X5XA 3QUYB 4QRRE 4IKJA 3W56A 1BBJA 2UYLA 3GMOB 3ZE1F 4KQ0A 1NCCH 3K6OA 4PRPE 5IGXL 4OQTH 4OTXL 3VXUA 1NQBA 1U95B 2DRUA 2XPGA 5F7YC 1BWWA 1XEDA 3BZFB 1DZ0A 5K1VA 1U8CB 2CA3A 2E8ZA 1D5XB 4G7YH 4ZX3A 4HJTA 2XV3A 1KTLB 3CXFA 4KUCD 5ESVA 1AOHA 4HGWB 3WY3A 2VAAB 5IY5B 3WIHL 2XLLA 2XY1A 4QRRD 3HE6C 5T3ZE 4KKBD 1F97A 1A4JA 2AF2A 5CEYA 4NIYE 1JS4A 4V33A 2ISDA 2R0ZH 1HXKA 3QPXL 2NXYD 4K94L 2W81C 3TPUB 3SJVE 4RFOH 1K2DB 1Q90A 5D7IE 4D9LL 2VLMD 5CZXD 4Y8AA 2YIHA 2JWYA 4DK3A 4N0FB 2VXTH 2CJ3A 3WN6A 1BECA 1VFUA 3OAYK 2XY2A 5ABDE 4HWNA 5AVSB 2JIXA 1V7ML 4UM9D 3QJRB 2BINA 4JPWL 5HHOE 2ATAA 2VSCA 4E9RA 5D7JA 2NQ3A 4GPVA 4TOYH 4H20L 2D7QA 3B2VH 3KL3A 1BAWA 3BDXA 3E1ZA 5DYOA 1CR9L 3TPUA 3MJ8A 4WI7A 3HZKA 4G8GD 5FUZL 3P2DA 3OWRA 3TEZA 1CD9B 3KLQA 5C92A 4FTVB 2I7OA 1QTPA 5HHOD 1A0QH 2CK0H 4HGWA 1AXTH 2N7AA 5DLMH 4WI4A 1S7QA 1WFIA 1Z1WA 2WXLA 1IQWL 4MNGE 3RILA 5K1NA 2FSEB 2GC7C 2UUDK 5CILL 5ICUA 3VD9A 3L16A 4MZ2A 3QNZB 2XZZA 4K5NA 1ZHLB 2JKJA 4ZBJA 1JTPA 1UCBH 2JMRA 5LB1A 4CADB 4F37K 1ONQA 2KDGA 3TV3L 4OZGF 2X4UB 1V3LA 4HJJL 2K78A 3A22A 3Q6FA 1N0LB 1XH2A 4Z7NF 2H2PC 1A4CA 4GS7C 1PSKL 4PW9A 4P2AA 1RZKH 1FZKA 3FB6A 4XZUB 4PJBA 2Z92A 3V4LA 4BKTC 5DJZA 3MV9D 3NEEA 1AP2A 1YY8B 1OSZA 4L8SC 3AG2B 5IK3B 4OGZA 5KYXB 1JTTA 1XGTB 4FABL 3BLKA 4JPQA 4B41A 1P5VA 3PCYA 5CN3A 3TT1L 4G6MH 5I66B 3IDGA 4DERA 4XCFL 3E1F1 3VRIB 2G5BB 3QAZB 4RGOH 4J7RA 3JWNG 2CBQA 2IWEA 4D0DA 1MAJA 4B95C 2COVD 4TSCL 3J8F7 4DN4H 5D7LD 4F1ZA 1HXMB 1VGKA 4N2CA 4YPGB 4BEIA 1ETJA 1YEDB 3EZJB 4NZJA 1KCRH 1UQSA 4F8NA 5F70A 4A7QA 4RWYL 3IFLL 1G1KA 1X5ZA 3HMWL 3KBEA 4MQ7B 2DYSB 2YD2A 4ESKA 3Q2LA 1K5WA 5JPNA 2EH7H 4TVPH 5LCVA 3UJIL 1KB5L 5C0GA 2HSIA 3MBXL 1I1FB 1SY6H 1BLNA 1J86A 1MCSA 2H3NB 2X3AA 2ZCKH 4IHOB 5IQ9B 3QIWB 3ABZA 4LLYA 4ZAKD 5J3HC 4UQ2A 2L7UA 5IFAL 1BBDH 1AGDA 2NY6D 4DCQA 5IMMB 1YLBB 4O51A 4ZUSB 2Y0SA 3B3IB 2VXQH 3EHBC 1N12A 2KDYA 2R0LL 3UAAA 4XVSL 4Z0BL 1GSKA 2I9LA 3LOWA 1G9HA 4BFBD 3S35X 4GRWH 1G43A 3MV8E 3WUWB 1W80A 1S5HB 4NSKB 4Q0XH 3SDXE 1OD7A 4OJCA 4M29A 1DQKA 3L54A 1NANI 5DHMC 5IFHL 2XXMB 3MA9H 4QY8A 3SKOB 3L7FB 2GTQA 1ZMYA 5I24A 1KYOJ 2CK0L 1D5MB 2XYCA 4ELKA 2H3KA 3LNDA 2ICWA 1IC5H 2WN2A 4ODSL 5C0AA 4RCAA 2J43A 4GW4A 5J9PA 1IAKA 4XMTA 3C75A 3KBFA 1KPUA 5FM4A 1X9RA 3F12A 1I7UA 3X11B 4LL1A 1USZA 3O3BB 3DUUA 3T71A 2DTML 1EAOA 2HRGA 5DS8A 1ZA3A 1E4XI 1MNUL 3JUYA 4HHAA 2V17H 4KRPD 2QQKH 4TTDC 3QO0A 5D6DC 4AK2A 1NLBL 2Z91B 2P9RA 3GMRB 4OVUA 4NQEA 2EDQA 1GHFL 3NABL 2NY1B 3IB4A 2FQGA 4M7LL 4QAMB 1AGCB 4QO1B 3MR9B 2ATPA 5A7EA 4URKA 5IREA 3T8XA 1AHMA 3OKEA 1MVUA 1IGML 1MCRA 1G7MB 5E6YA 3C2SA 1VESA 2OZNA 3T3PB 2EXTA 3T6QC 3G6AA 3QRLA 3HE7B 1HCVA 2VR7A 1DJSA 3K72A 5DEGA 1O6TA 4ZFOA 1F13A 2BSED 2VDKL 5EEXA 3MGOB 4U1HB 3BKJL 1C8QA 3MLUH 1FF5A 3GIZL 3M8OH 4NO5B 4D8PA 1OQOA 1SJXA 1MCWW 4OZIE 4ELMA 5EUKA 2AEWA 2VN6A 2HCZX 5F9JA 3GB7B 2AJXL 2MHAA 1BXVA 2ZX6A 4GNKB 4ERSH 1IBFA 2CHNA 1QAWA 1DBKL 2X53A 3F2LA 4KRNA 3TGXA 4HUVA 1VZHA 2QSQA 3BSGA 4S1QL 4ZOCA 1M1XB 2IDFA 2BS8A 3D5OF 4GB9A 2MJWA 1JK9A 3F5WA 4IIQC 4NKIL 1G6RA 5DD0L 4WUUB 5E08H 1TZOA 1YMHA 4AYFA 3ESNA 4RAUA 2H45A 3Q05A 5DC0A 2J5LB 2ICEA 1CG9A 4YXLL 3UL4A 2B9BA 4HT1L 5K9KB 3WS6C 3NCWA 2KERA 3FMGL 2YSTA 2JB6A 2XSKA 4OZIF 3IFPA 4GQ9H 4JZNB 4NQDD 1P4BL 1E42A 2HG5A 4QRPE 5EPMB 2VERN 2HX7A 1XGYL 5IQNA 3LN9A 1SXAA 4QXTB 5DQJA 3QIUB 4XO8A 3GS0A 1EUUA 4ABVA 3I50L 3LZNA 3IJSA 4B3EA 3L3DA 5LGKA 4A2GA 4LVHB 1E4JA 5GS1C 3AXHA 5FW6A 2XN9A 5DD3H 3BN3B 3M45A 5C0JB 4S0TD 1KV7A 3RZCD 1F3RB 2N7SA 2BNQB 1MIMH 2DIAA 1ZPUA 3QI9C 4PY8I 2WNKA 2IOIA 1BV8A 4FCAA 1DJYA 4BXVA 1T21B 5GGQH 3W3BA 4BZ1H 1S9VA 4MA7L 4NHCH 4M5YH 4U49A 3AREB 5TD4A 3RVWC 1MRFL 3T65A 1OSPL 1SMAA 5AOMA 5C0IB 1NUGA 1Y1DA 4LCWB 4AQEA 2A6KB 5CAYB 4AGNA 1ZVHA 4AC2A 4KJWC 2ZSWA 5F6IB 5BV7B 5GRWA 2G9KA 5JXAH 2OMUB 3C8DA 5D1ZI 4EBQL 2YRLA 3ETTA 3OB8A 5JO5A 3LKQA 4GBXA 1CFTA 5JOPD 5CO1A 3QDGA 5J6SA 1JWUB 2YAEA 4V2CB 2O6CA 2F53E 2F54B 1DQQB 2XRAH 4P0DA 3QYMA 5B22A 2K4WA 1SEBA 5CR8A 2D7MA 2YN3A 3Q43A 3FC8A 3P73A 4L8CA 5GISL 3NDZE 1MAML 3US0A 1UH3A 4MLSA 1SYVA 2HLEB 3SE4C 3X1NA 3BP7A 2FJHB 1DDTA 1KZQA 3CDYA 2FEDC 3V0VB 5C9KA 1YMMA 3FO1A 3QZLA 3BVXA 2AXFB 4R83A 4BCXA 4CU6A 1G84A 1JNHB 4PJGF 5I0XA 2AHIA 3FSZA 3SDXF 4U1KB 4WKZA 2M83A 3F84A 3GJFK 1WZLA 1ZT4B 3P40A 5DRNB 4Y2NA 5D5MB 2VDOH 5HJDA 2CA4A 1IM9B 3HC3L 4MAZA 4I2XA 1T7VA 2HJFA 3TBVA 2ZUWA 5JIIA 2FT6A 2OM5A 5IBTH 3OLDA 4A6YH 3LKPA 1E3FA 4ZX5A 4B97A 2LHAA 3DI2B 5E99H 1VKXB 1DP0A 4JN2A 2YC1A 1D7BA 4ZI8A 4GYBA 1CIUA 4E9XA 4B7LA 3U7WH 3RDJA 5KBDA 1PX4A 2ITDB 3Q8CA 3EGXB 3DTXA 3OKKA 2PW2A 3PNRB 1XF3A 3H2QA 4ZMQA 5EO1B 4RSVA 5HY9A 2GCYB 3SDDA 2GW5A 4ZW5A 2YD9A 3O6LH 4MD5A 3WJJC 4FXKC 4OGXH 1IC4H 4AL8H 1KCUL 4GUOA 2P52A 2HJKA 4NQDB 3BSZA 3FQ4A 4FLQA 1MVFA 3UBXG 1QO3B 4P2OA 1A1OA 4J4PC 3FU7A 3J27A 4HWBA 4QWWD 4XNUL 3PV6A 3ZGIA 4CN4A 4R4BB 3TASA 3IJ7A 2ZSVB 4JPKL 5LCVH 5DJ0A 2JCWA 2X40A 5ALCH 4HUWA 3PGCA 2O5YH 3L9BA 3HNVL 4H0HB 2YXVA 4I88A 1N18A 4E42A 3K3QA 4HJ1A 5I1KH 5DJCA 1N5YL 4PFEA 4UB0L 3WNPA 4JO8A 4HXAH 2HRLA 4KI5E 4Z3TA 1RZIB 4KJQC 3CUPA 3MLPA 4XPGH 2XZCL 2W95A 1Q94B 1IZJA 3VFGH 3AS3A 1OCRB 3UCRA 3VA6A 3BKML 3H3KA 1NDTA 3VMPA 3F6LA 2J8UF 3NZSA 4YJZL 1MN4A 3L5WB 1Q9LA 1HQ4B 1P7QD 2OMVB 3ES6B 1N6VA 3P2TA 2R23B 1TEGA 4U6XB 1NDMB 3OGCA 4L8DB 3DJZA 1MI5A 1U8IB 4D0BB 4ODHH 3X17A 5HHPA 5FO9A 2XG5A 3Q8EA 1VHPA 1QPXA 2IXQA 4KDTA 3HS0A 3RFRA 2VLRA 4OLYL 4QRUA 2GVYA 3E9UA 3F58L 3JTBA 3N44B 4EI5D 5LN8A 4ZMOA 3EYUH 5ID0B 1UM4L 3HE7C 5DA0B 3ROOA 5KVEE 9PCYA 1JTOA 4NP4H 1UA3A 4OJFL 3VWJA 4AQ8C 1ZEAL 4PWKA 1PCSA 2A77L 4XAKD 3F3HA 1NGWA 4KXBA 5DUJA 3GGWA 1NL0H 4M62L 1ZS8A 2AXWA 2VN7A 3CC1A 4NZTL 2WXIA 4WWPA 1R5WA 4C4KT 3WTWA 1MLBB 3G5VA 4X6DB 1XMEB 1UH2A 4OV5A 5CZVH 4KU1A 4X6EB 1EVTC 3LRKA 3CFJB 4DEPB 3WTTA 2SEBB 3L3JA 1BSIA 3E2HB 3IMUA 4Q58C 3EZ8A 3V10A 5IBUG 3TYFB 3SBQA 1XX9C 1F45A 3L95A 4D2NA 3PRZA 4XCFH 4X98B 5HDBE 3D4YA 5FECB 1BZEA 5GZND 2HRPH 4PTTA 4EI6B 4LPWA 5A2CA 5AVWB 3O3EB 3ZTDC 2J2ZB 3OKNA 3KBPA 2MCMA 4Q56A 5F1SA 5IBUB 4CKVX 5AW1B 2YARA 5CJ8A 1G6VK 2ARWA 5HTSA 1X9QA 3QR1A 2J5LC 5CCKL 1AG6A 3S98A 4FKHA 5AAWA 1XGUA 1TYEB 3CZJA 3EJSA 3A6OA 2EH8H 1AHKA 4WFGE 5J8OA 5CFAA 5IB1A 2C9AA 3KPQA 1G7IA 3T6XA 1MXGA 2Y36L 2E7DA 2VLJB 3D85D 5HJGA 4ZSOB 4ZXBB 1ZVSA 5MERB 3HI6L 3VE0A 2EVJA 1RZ8B 3B2UD 2JKWA 1I1RA 2N1TE 4PJAA 5L88L 2RCSL 4GKZB 3EHBB 2HG0A 4WFFE 4YGVB 4QXVA 5J06A 5TPWL 4KTEH 3QXVA 1KIRB 4IOSD 2NTSP 4QRRA 5LJYH 5HI5D 1OTUC 4QHKJ 1OPGH 3MRDB 4GRWB 1IFRA 3RWHB 4O4YL 1MF2L 5C09A 3G08A 3IU3A 3WGVB 4EEEA 4NPYB 2ALWA 4M3KB 5DHYB 3IDMA 2XXGA 3AY2A 5ACZB 2R29H 4B9PA 2E7MA 2DM4A 1E4KA 1TFHA 1DFBL 2WO2B 4RISH 3SQBA 1KG0A 3DO3A 1NCDL 1ROWA 4YPJA 2ERJC 3IDIA 3ULUD 3QDHA 4W1TA 4WTXA 4UM9A 3B5HA 4WHYG 1Z0MA 4AQOA 1WZ1H 2VDMB 3EAKA 3KGRA 3Q9PA 4P9ML 2WUCH 4ZJ9A 2XI9A 5T1DL 4MGXA 1QSFB 4HIPA 3L5IA 3K6NA 3B9EA 4BFNA 1XL6A 2J8UA 4G43A 4GIOA 3C5ZA 4HD9A 4LPUA 2JJSA 3H53A 3SQOL 4HKBA 1DE4A 3RDTB 4YAQA 1I8MA 4GW5B 4K94H 4DGYH 1IQDA 2CWRA 3OSKA 4RGNB 5EU5B 2W07A 5DJAA 3LPOA 4U0RC 2FQDA 3U7WL 5KBLA 1XTMA 1IGTB 4G8GE 1UGKA 4JCMA 4Y19E 5EFIB 1OF2B 4AC4A 4P07A 5KOMC 4NAJA 3AROA 1O7SA 4G7VL 5I0ZA 2APFA 1FJ1A 3SE9L 1J12A 2N1KA 4I9WE 3GSRB 1XXFC 4GP4B 2AQRA 4CJ1A 2WXHA 1DVFB 3CPLA 4KGLA 3TNNA 2ZG3A 3VXMD 3L9RA 2Y6SD 3V0AC 3FUKA 1HHGB 4UZSA 5DWPA 4KZEL 1H5BA 1B0GA 3FTWA 3JV6B 1A2YA 2Z31A 3L17A 3FO2A 4F8QA 2A74B 1KIUA 4PI2A 3ZTCC 5J5EA 5DS1A 5DGRA 1HZKA 4MTMA 3VFMA 1IBZA 2ERJB 1FL3B 4PJ9A 2X87A 1AQHA 4X8CA 1G7JA 2QKIA 4YX2H 3MLSH 3QPQD 3NJLA 1YEEL 4KV5E 2Z6FA 5FA4B 3SGDH 4CVXA 4CSPA 3GK8L 1QBML 5FLVA 1P5UC 1PS3A 3GYRA 4R8WL 4NQQA 3OAWA 4NFCA 2N01B 3RHWF 3OXRA 1A9EA 1RJLB 2FK9A 3MOBH 4N2AA 1KPVA 4UYQA 1NGZA 5DJ8B 2EC8A 1T0NB 4J12A 5I1CL 5FYKE 3VI3E 3T2PA 1P4IH 1X5IA 4UQIM 4N8VA 2O5ZL 4XX5A 2WWMC 2Y7OA 1PGRB 1T22A 4RMWA 3DIFB 2PCFA 3FO0H 4N2IA 2EACA 1Q0XL 1CBJA 3O3AB 4OLWH 4XMLH 5D1QE 4YSAA 4XNXH 5D2NA 1BMWA 1JGUL 1U2CA 4RMSA 4C8XA 1MHCB 2BHFA 2VWEC 1AGBA 3CCHA 5E8OB 3EYQD 5HYSB 3HC4L 3NA9H 3U0WH 4OFDA 4D94A 3LNIA 4Y0GA 4TRPH 2JF1A 1U8NB 4DN3L 1FNEB 5DJYA 1GC1L 1V7MH 4LHUG 4J3BA 3KS0H 2CXGA 1AZNA 4LDEB 3TT3H 1D5ZB 3MLTB 2ZXDA 2UV3A 1BFOA 5C0CB 1M57B 2NY3D 4W9EC 3FQXB 4A2EA 2W9LA 1CICA 4HZLA 4DH2A 5IMKB 3GHEH 3BWAB 3E2HC 4AGPA 2EJ1A 3UDWA 4NUPA 2AEQL 1XSIA 4G6KH 4RX4D 3GBNH 4LAQH 5IROA 3UXFA 4A2MA 5I17B 4G83A 3WXVL 3EH3B 4R96A 5BOPA 4N6RB 3C6LA 4JG9A 4BHUI 4FF9A 4ZW6A 2HTKD 1FL6B 3FSVA 4Q7DA 1E5UI 1IIIA 2NX5A 3ZR6A 4MZRA 4AGLA 5AWNL 3RUGB 1OV8A 4M4PA 2R2EB 1L7IH 2DKMA 4CILA 4DPCX 4UILH 5T1KA 43CAB 4NWUL 2R2CA 2D7PA 4PY7A 4QCIB 3ZYOA 4X5LA 2IH3B 1AS7A 4E9LA 4Z77B 2E9IA 1M53A 1W0VB 4XX1E 1A6TB 4AIZA 3U48A 4U1LB 2JJUA 2X1QA 2XRAL 3O4LE 2PPAA 3TH2T 3SD2A 3S2CA 1D2PA 4LLWA 1XF4A 3UPRB 3S34L 3QJFB 5F7MC 1INDH 2IADB 1TZHB 3MNMA 3IJ8A 2AV1B 4XCEA 5FM5M 3UG5A 3ZBMA 3EJTA 3IFLH 3SCMB 2EEFA 3Q48A 1PFOA 3HN8A 4AXWA 1OIOA 1ZLWH 4MYPA 1M7UA 2VLKE 4XN1A 3GZQA 1GVIA 4ZO9A 1V3KA 2PCPA 3FU5A 2X3BA 2HH0L 5KG9B 4NN5C 5F6HI 4K3EH 3WO4B 1RH8A 2APXA 4J3WA 2P8MB 3V6FB 5HYJA 2BZ7A 5B1CA 4M4RA 4G6ML 3H56A 3HPLB 1P84J 2PCPB 3U4EB 3QUYD 4LLDB 5DJ6B 5ADOH 2EIDA 3T8VA 4P2QA 2VLKD 3F85A 5C2BL 1MW3A 4O2CB 4F9PC 1RL1A 1FFOB 2XQYA 4YXHH 2X4OA 2VXUL 3RJQB 2MQCA 3VRJB 3L1EA 4JFEA 1FQ9C 3E8UL 3MROB 5C7XL 3OJDA 1Q1JL 4G9DB 1Z9NA 1DDHA 4KTDL 4XXDA 4YL9A 5GS2H 2NSQA 4EKXA 4YSSA 1CYXA 2C7FA 2ENSA 3BAXA 5J11B 4PMEA 4ZDHB 3W81A 3BZ4B 4D0CB 3KXFB 5C0AD 2HH0H 1PEWA 3MJGX 4Z77A 3WFHA 1BVKA 3OQRA 4B3VA 2EYSA 1WTGT 4JRWA 1P7QA 3MJWA 4Y4HC 2Q2EB 1O5DT 4AEEA 5B3JF 3POCA 4YBQD 5TH2A 3WOVA 5HHMD 1RXLA 1JG9A 1FYHB 1HYRC 5INDA 1DLHB 1UT9A 4PB0H 4UU9A 1ZLWK 1AIFB 1RQ5A 4OQTA 1H3TA 4TSAL 2RCSH 5C0CD 3MV01 1O6VA 3UBFA 2G75B 1BOGB 1I8IB 4K71B 3WKYA 3EOAB 1TVHB 1XGQA 5ICZA 4OBRA 3CV5A 3I2CH 4NOBA 1D5ZA 3T0EC 3WNIA 2F18A 4ONOA 4N2GA 5CHNA 1Y6NR 1QATA 3QH3A 4KMTH 1J87A 5FYKH 5I1DA 4NRXB 1BF8A 4K07A 1PY4A 1J8HB 2ED9A 3MCKB 3MNZB 2C34A 4QLWA 1IFGA 3GHPA 5CP7A 1VERA 1F3DJ 1WSST 1QA9B 2C3GA 2ICWI 2P26A 3DWTA 3HBGA 2APWA 1LHZA 5CGMA 3VI3F 4AUJA 3AQYA 4PJGE 3JQOB 3V6OA 1EH9A 3TN0D 4W4OC 4PJFB 4XVTH 5PAZA 4C56A 2DEWX 5CD5D 4QRPD 2B5IC 4HIHA 4LKXA 3FS9A 3RVVD 5BRZD 1HHKA 4WK2B 4BWUA 3BUTA 2X6AA 4YDJA 3IMBA 5IJBC 1EV2E 1JZGA 4OLZL 2PP8A 1LO5B 1HYSD 3PY9A 1JD7A 3EUUA 2VWEE 1XXDC 1PVHA 3UTPE 2QEJA 1A6UL 1YY9D 2F5BL 2DQ6A 1XGPB 1X5JA 1RJLA 1U3NA 1AZBA 32C2A 4JFTA 3I85A 1LEIB 4NQVB 4ZMWA 4R2GB 4Y9EA 3FTUA 2GBUA 3BX7C 4IEFA 4M93B 1ZRUA 4GO8A 7PCYA 5TGBB 5F1OB 1OAKH 4P3CL 4L37B 4JREB 2DLEA 1QVOB 4R26L 5JHMA 1R9FA 2ZAHA 1OK8A 1PSKH 5F0LB 2R2HA 5D1XB 2QDVA 2QT6A 3V0GA 4LU5H 3ATAA 5B1JC 3QRBA 1JGDA 4X4ZA 5ALBL 2VDPB 2CCWA 3FO2B 3N91A 3Q3GA 5KZCD 2EECA 5FYLH 1RUAL 3BSHA 1I9RL 1I3GL 1P4LB 3FRUB 5JOPE 4YR6A 3MCLL 1DVFA 3CPLB 2R4RL 3A67H 3OBAA 1EEYB 5AD0B 1ZWIA 1UZGA 4JGNA 5BQDA 2AAAA 3CFBB 4GXUM 2DLGA 3MRPB 1QFWH 3MPCA 3RAJL 3WIIH 1RAMA 2AQTA 1T7XA 4OGAC 4WSGA 1I8LA 5AZ2L 3LRMA 4YDZA 4NHUB 1MCBA 1T5WA 4HCRA 5I6MA 3KZ8A 4POUB 2APBA 4QRSB 4U1GB 3DGCR 4G8GA 3I6LE 5E9NA 2RMNA 1UHVA 3HRZB 5KS9E 1WZKA 3GSXA 2XKSA 1RSYA 2OQJA 1EJ6A 2PPFA 4LBEB 4UOJA 1TQCC 3PWNA 1OEZW 1TNMA 2H6PB 5HYSG 4M6OL 4OZGA 3EO9H 3L4ZA 5H4YA 5KSUA 1ZSHA 4HK0A 2LFGA 3A6BH 4TNEA 2XTJE 5LNGA 3ZYIA 4LHUD 1T5KA 3ILDA 5GHWH 1XZ0B 1XB3A 3VW3L 5AUMA 1KG0B 3DIDA 3IDNA 1I3RB 4GAFB 4HS6A 4OCNC 2ENQA 3P9MA 4RIRB 3UTZB 1QWNA 3QNYA 3OLEA 4P99A 5DO2D 3QUXA 2B59A 5ACZA 3EADA 5BXFA 2IPTH 2DZEA 4PLKD 2UX6A 2VZUA 3LKNB 4PLJC 5D4JA 4Y1AA 2WUCL 3O45A 3SDYL 4CSTA