4S1RH

Crystal structure of a vrc01-lineage antibody, 45-vrc01.h08.f-117225, in complex with clade a/e hiv-1 gp120 core
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
235
structure length
235
Chain Sequence
QVRLVQSGPQIKTPGASVTISCGTSGYDFMESLINWVRQDIGKGPEWMGWINPRGGGVNYGRRFQGKVTMTRDVSSGTAYLTLRGLTSDDTAKYYCVRGKSCCGGRRYCNGADCFNWDFEHWGQGTLVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system/inhibitor
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
publication title Maturation and Diversity of the VRC01-Antibody Lineage over 15 Years of Chronic HIV-1 Infection.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 37
structure length 235
sequence length 235
ec nomenclature
pdb deposition date 2015-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s1rH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s1rH01
4LPXA 4KUCF 1CXKA 2ED7A 3RX7A 1AP2B 3MRPA 1TVHA 2D7OA 2BERA 1RSFA 3NCFB 1UWGL 2XN9E 3MRIB 5CP7A 4M6OL 5DC9B 3EIFA 4P3DB 4G8GB 4LU5H 5JIHA 2F5BH 5FO9A 4HS3A 4QOKD 4XBPA 1K3ZA 2ARJQ 3RPIB 4MHHI 4FOMA 1S5IL 3QUKA 3WMSA 1OTUC 5D5ME 1KEMH 1CFTA 2P24A 2NY4C 2Q1EA 5L2KB 2XTLA 3TLRA 4NZRH 5FGSA 1JZ8A 3HR5A 2B1HL 3J7HA 5DD5L 3BZFB 2OR9L 1AI1H 4N1HB 4ZO7A 1QACA 1C08B 2X40A 2VL5A 3PGCB 1OD9A 3QXTA 4NBZB 4HBCL 3VGAB 3DBXA 1HYRC 4GAJH 3FO9B 1FORH 1YY9C 3WBDA 3GSNL 1V7ML 3DTXB 1QFWL 5JMRA 3ARBC 4N0CD 3CVHL 4Q74A 4PLNC 3CFCL 1S8DB 1A6TA 1JF1B 1LP9F 5CZXC 1I7RA 3MMEA 5DJCB 1ZHNB 1PKQB 3MRHB 2OP4L 3Q6FB 2AKRA 2P5EE 3MFGB 3KPMB 4FMKA 1FFPB 5JW4N 1A3RL 3R4DA 4FG6D 5B3JF 5DD3L 1J9CT 4OZGA 3UZEA 3FFCA 4ODVL 6FABH 3DO7B 3BDBA 3U4AA 4AIXA 1BEYL 4Z7WA 1NBQA 1YDPB 1T20A 5EO9B 7CGTA 4G8EA 4ZMAT 4JFQA 3BWAB 1T2XA 3WCYA 4DEPB 5E8DL 2VLKA 1FO0L 4KVCL 3FN0L 1CD0A 4G6JH 2DRUA 4YHOL 4ZFOB 4XPHL 5TQ2L 3MO1B 4PG9A 3RZCB 1NLBL 5K9JH 3O9WB 3WD5L 3RTQB 3DHMA 3MJ8A 5D5MF 4EN3A 1JGEA 4JQVA 3H9YA 2CDFB 4ZFGH 4IRZH 3AMLA 2Z91B 4R0LA 4PJ9B 2HG5A 4PJGE 4PRHD 3CDGA 1OTSC 4WJ5A 3BGMA 3LN4A 4PGBA 1IT9L 3GBML 3VXOA 5GGTA 1DLFL 5H2BA 4HAFA 2IGFH 1ORQB 1IC4H 5EU5B 4YXKH 3T0EB 1U2CA 3QEGH 4KMTL 4B5EA 4RGNC 5I66B 5FB8B 1NCTA 1BBJB 3LZFL 4IOFC 2HT4C 1HZHL 4X0KB 4YO0A 4TRPH 5B8CC 3T1FB 3G08B 2NY4D 5KVGH 3VW3L 4PJDF 3RIFK 4W70A 3WDJA 2EDHA 2BSTB 4HS6B 4BELD 1F58L 3HPLB 3BXNA 1L0QA 1R5VA 3K4DA 5C0CD 1BF2A 4N0YH 4OD2B 3NFSH 4LEXL 2NX5D 3QEQD 4GAYA 2LTQB 4MQXC 4Y19D 2FZ3A 3MLSL 3UJTH 32C2A 3GUTA 2C9AA 4JCLA 3UC0H 4EXKA 4PJ5D 3D2UD 1CFBA 3F7YA 4NJAH 5IR1B 1RQ5A 3VD3A 5CZXD 4JVWA 3VXSD 1GGCH 4UNVA 1JWMB 1CLZL 1SJEA 3K4ZA 2L4OA 3QRFM 1N6UA 5C0GB 3S6CA 5KZCB 2VR5A 2I07B 2GITB 5CJQH 3THML 1U8LB 4NN7B 1MFDH 2N56A 4PJGF 2G75A 3PWPB 2X4TA 4PGCA 1MCPH 5BW7A 2FHFA 2FL5A 5TE4L 4UIKL 5EOQL 5F9JA 3C2SA 3MJ7B 1OAZH 1I9JH 3BP5B 4U05A 1Q9WB 1W0VB 4WFHE 3CSYB 2RCSL 2VLJA 4OF3A 2DBLH 1MRDH 3MR9A 4R4BA 3SBWA 2YD4A 5IEKB 4J2XA 1U36A 1QKZH 5HY9B 3MCG1 5ITBL 1MJ7H 5D2NE 5AZEH 1SM3H 5D1XB 1FLRH 5KVDH 1EBPA 4YGAB 2BHUA 2GFBA 4UUJA 3GNML 4PJEE 5D7JC 5E6IC 2C3HA 4KJWC 3S4SA 3ZTNL 1N5AA 1CE6A 3H3BC 2YPLE 1EO8L 4RGND 3HZYA 4RSVA 3LKOA 1Q9LA 1DZBA 2Q20A 4OD3L 1ZA6B 4TTGA 2HT4D 2FJFA 1DUYB 5DD0L 4DW2H 4WUUA 5HGHB 2M1KA 4GBXB 1A3LL 4OLEA 3UO1L 1AQDB 1CIUA 1TPXB 1XF2A 3MRRA 5AZ2L 3I50L 4JY5L 3RIFF 4TSCL 4F80A 3F58L 4Y5YA 2W91A 4GLRI 5KBNC 4A2MA 4WCYH 4H25B 5T3XD 1YQVH 1CK0H 3KS0J 1FGVL 4MQXD 3VRIB 5D72H 4EIGB 3BEWA 3FFCE 4XCYA 4LLYB 2NY3C 2Y72A 3GHBL 4AEIH 5B39G 1OW0C 3DGCR 1RZGA 5JPNB 2P5WA 1AIFA 1GOFA 3MC0A 4JRYD 1OAKL 1Q38A 3BKMH 5IKCB 5CJXC 5CINH 5GSVA 3FMGL 3U7YH 3MROB 3B2UC 4ODBD 1JHKH 3RWCA 4ZUTB 1U8PA 3BD4A 3QNXA 1HH6B 5D6CA 4R26H 4XT1C 2CRZA 2DKUA 4MNQD 5KOVC 2AEIT 3B5TA 4KQ3L 5GGQH 1HYSD 1QFWM 4XVTH 2OSLA 2I26N 3UBXB 1G0DA 1YUHB 4PJ7A 3BO8A 1W0YT 4HKZB 2C1PB 2OZ4L 3BI9X 5HDBE 3VFGH 2G60H 4AM0A 4ZS7H 1BECA 1J0IA 1XR9B 4ZUUB 1LE9B 3FKUS 1I8KA 1BZ9B 3LEYL 2BNQA 1IJ9A 1ED3A 3PGDB 1A7PL 5T3XH 3BW9A 5L0QC 5GS3A 1I8IA 4KJPC 4NZDA 3WUWG 5D7JD 1ZWIB 1KBGL 3BPNC 4KJWD 4QRTB 4WWKC 1P7KA 4YDVA 5F97E 5GRUL 3RBGA 2I9LA 1F97A 4HV8B 5TF1L 2ZUWA 4HUUB 4J6RH 4Q9CA 3EDDA 5I30L 5DGRA 3FQRA 5HVGB 4UT7H 1JGUL 4O2CB 1LK2B 4DTGH 1WAAA 2J5LB 5D7SH 2FGZA 3QHZH 3QZWG 4NWTH 5JQ6H 2OTUA 3EYOB 4LGRB 1EFXB 1TCRA 3UTPD 2OMNA 3BP7B 2O61B 2MJWA 1X44A 1LO5A 4JFYA 3H9SE 2MKWA 4X6FB 3SOBL 1I3RB 1UYWH 1PG7H 2NW3A 1JZ3A 2A6KA 2NY3D 3LEVL 3UTTD 4M7KH 2Z31C 4P99A 4GAGL 4MA8H 3MV8E 3GB7A 1GZPA 3GK8L 4KDTC 3TO4A 3U48A 3UJIL 1UZ8B 3RNQB 3IGAA 2FGWH 1JRHH 5F71A 1IL1B 3B2UD 4Z7OE 1BD2E 3HUJB 3FONB 4XPAL 3MQIA 4M9OA 4G7YH 1TFHA 4H0IA 2VDNL 2VLJE 3TN0A 3F7QA 5DHYA 5JPMB 1KJVB 2ERJB 3BEVB 5DD1L 2VDLL 5INCA 3QI9C 3OJDB 3MRMB 1HDMA 2BHYA 3HC3H 4U6VH 4U1MA 4Y5VA 1LDPL 4OGZA 4V1DE 4YBHA 5JZ7C 2RAMA 1NDGA 3QCTL 2AJZB 4RAVA 4WRLA 1NJ9B 4XAKE 1FZKB 4H20H 4XCFH 1TJGH 2J6EA 3ROOB 4NM4H 3G6DL 3BT2H 4E42B 2BY0A 4M3JA 4ZFOL 5IW6A 4ZOAA 2QSQA 4EUPA 4G9FA 3TT3H 4PJIB 1AQKH 1A7NH 3HI6L 5JIIA 1FCGA 4P9HC 2C4FU 2ZJSL 2J88L 1CD1B 1KTRL 4M8QB 1TTGA 5D1ZA 5C07A 2NY5H 3JTSB 4KDWA 2FEEI 2O26U 3H42H 2IPUG 1ZGLM 4UU9A 4HSQA 3TO2B 5FA4B 4WWKD 4PFEA 5EOTA 2MQ0A 1NUGA 1JPSL 2JJUA 1S9KC 5HHNA 4FP8L 2CKBA 1IAIH 2FDBP 3Q1SH 3TVMB 3J8F7 4H0GA 1WTLA 1T22A 5I1IH 3SKOA 5F7UA 2HT3C 2P46B 4LNRB 5IIEB 3I2CL 2XKUA 3TA3C 3QIWC 12E8H 2OR7A 3O3AA 3DV6A 4MCZA 4HZAA 1VA9A 5DDHB 5IK3A 2PYEE 4A6YB 4B7IA 3V0AC 3IDYC 4GT7A 4Y5XC 4AH2A 4K3HA 4W4OC 2HWZH 4Z7OF 1MCOL 4TNVK 3Q5TA 5E4IA 4P59H 1UXSB 2VDML 5ALBH 3MRBB 3SDCB 1NGZB 3CU7A 1I7TA 4JG0H 3GMPB 35C8H 2NLJA 4JRXD 5F8QC 3PDGA 25C8L 2QKIB 3QDMD 1K8DA 4PRIE 3RDTB 1CT8A 3QUMA 1WWCA 5ITFA 4XNMA 2HH0H 5EC1B 3UDWC 1J0KA 4PJ7E 4YHPB 4BK5A 1AGCA 4XNUH 2P8LA 4MWFB 1FNAA 5C0BB 3UPRA 3ZDZE 5BOPA 4I3SH 3QI9D 5E2VL 4P2OB 2VAAB 3T77A 1G7HB 1IAKA 4P57A 5I1AB 5I2IA 2H8PA 1WIOA 4ONFH 5H8DA 5CD3A 3HNVH 1BZ7A 4JKLA 4E41D 5J06A 3HMXA 4X6BA 4DVRH 1L0XA 1B0GB 3GKWL 3GSRB 5HPMB 4LPVA 4PUBH 2AEQL 1OP9A 3QO1B 2X7LA 3BPOC 3F12B 3V6OC 1YN7B 3BMWA 1WCQA 1YEEL 1T4KA 5TE7L 2JCCB 3DSFH 2H9GB 2VMFA 4WWID 3V5DB 5E9DB 2AEPH 2N4IA 2ZSWA 4P3CH 1AGDB 4I9WD 4NKQB 4FTVA 3SDXA 3ESUF 2V5RA 2DM2A 3LIZL 5ACLA 1S7UB 1YEJL 5ALCH 2DQGL 5T5FH 1H15B 4PR5A 3C6SA 3EO0B 2YD1A 3TA3D 5J13C 3WIHL 1UXWA 5DURB 4LCYB 4L4VD 5F7KC 5CWSB 1CR9H 1ZHBA 5DLMH 5I1LB 4PJ7F 1WEJH 4FQLH 3UTSD 5JHDB 2FHCA 5DK2B 4HGWB 4TNVF 4XHJD 2J8UA 1LEIB 3U4EA 4M61B 2J8OA 3MLTB 4M7LT 1OSZB 5F1NA 5J6HA 5DYOB 1FGNL 4P23C 3G5YB 1OCWL 4LSVH 4PP2A 2JJVA 3DX6A 4PTUA 4NSKA 1U3HC 4GUPA 1RK1B 2Z35B 5C1MB 5IFAH 1U8QA 3D39E 1CDHA 1V3KA 1T83C 2V5YA 4QHLB 3NCYS 2Q7YB 1IGJA 4Z7VE 4DN3L 5LJYH 3GSWB 4P9HH 1ND0B 4HK3N 1D6EA 2PTTB 4K7PL 1CU4L 1VFUA 4HH9B 5HHVL 2X4NB 5E8NA 1F3DH 3HE6D 3QEUB 1K8IB 4PGEA 2XTJE 1RUQL 1WAAF 1DUZA 2FJHA 1FYTB 2GJ6E 1NQBA 2GCYB 2APFA 2B4CC 2P49B 3CJJA 4PY7B 2YSSA 1TQCC 3JVGC 5HXMA 3D3VD 3EBAA 4I3RL 4OGXL 4KGJA 3QXDA 4OLWL 2UVFA 4OSUH 1EHAA 4UTBL 5FOBB 5HVHB 2C3WA 3QCUL 2AJSL 2XKNA 4I18C 3C6LB 1RFDH 1FAIL 2IPTL 3ZYOA 3EW3B 3IFNH 4N8CH 4NDMA 2NR6C 1YEKL 3VDAA 1FL3B 3B2VL 2EDDA 4KK9D 1PD6A 1LEKA 1HINH 1MI5D 7FABH 2BOCB 3OKYA 4BQ8A 1RZKL 2DD8H 3CFBB 4HJ0D 4YIQA 1Y18B 4X7TA 5SX5K 4BFIA 2ZUSA 1QTYT 3BD5A 3FHAA 2WBJC 5INDA 3DRTA 4HWBA 1R3HB 1GVIA 5GS1C 2Y6SD 3OWEA 4LPUA 3LDBB 2HFGH 5JW3L 3DMMA 1XH3B 4LCWE 1KJMB 4WFGE 4WU5A 5EOCH 1TZIB 1I7ZB 4WY7L 5KVFH 4KUCD 4Z7VF 3JV5A 2Y36H 4OCYH 4WW2C 4B41A 1A14L 4NC0B 3TPUA 3CX5K 1OGAD 3RJDA 1PZUB 1AHWC 4KMLB 3E6FA 3QDGD 4N0UB 4ZOEA 1DBBL 2M8XA 2ESVD 3P30L 3FT4B 4NQEA 2FX8H 5DJ8B 3H7BB 2PYFA 4I0KA 1A02N 1EMTH 3NZ8A 4Y4KA 3I6LE 3BRGC 4AT6A 3DX8A 5EUOA 2QQLL 3HMWH 3RKDC 5LKNA 1ITBB 1UCBL 3OG6B 2HFEB 3CLEH 4LPYA 5F7DA 3FB8A 5TFSL 1CICC 4NKMA 3MLYH 4NO3A 3SCMB 2EE3A 4FFZH 3BQUA 3W2DL 4ZDHB 3JSSA 3NN8B 4X98A 2O5XL 4NQVA 4PD4J 4LCIH 2VO5A 1QFWI 1KJ3L 1KJ2A 1I9IH 4NQCD 5GJSL 4UT6L 5D71L 1VEOA 2WZPD 4BH8A 3D25A 5DK0B 4JZOB 5JW4R 4K7FA 3QFJD 5DUPH 3OJVC 4ONGH 1DN2A 4QRPA 1WBXA 1JGLL 3LS5H 4FQ1L 4M02A 1YYLH 1MLBA 1N59B 1S9WB 2Q87A 4LSRL 2F53E 5GGSB 2C4FT 2X10A 3OKOB 4MD4A 3B43A 1P1ZB 3RY5A 3HS0A 3GHEL 3SDDA 2D0GA 5HD8D 4LAJH 4YXHL 2XN9D 1TJIL 3ULSA 3GSOB 3QPQD 4JR9L 3V5HA 3QDAA 4UBDC 5KN5A 3IRPX 4OFVA 1J0ZA 4K23H 4M6ML 4XB7A 3RGVA 5IHBA 3IJSB 2BCKA 5FDWB 2X4QB 1UH4A 3MJ9L 1NEZB 4A6YL 5C6TH 2YRLA 1H3PH 5IMKA 1F6AA 4DJMA 3V0WL 1AD0B 1OB1A 3EOTH 2FO1A 3UTZB 3H3PL 3JTTB 5F44A 3MNVA 5FF6A 1QRNE 3L6FA 2P42B 1QLFB 3O41A 3I3BA 2E3VA 4PTTB 4LBEB 5I18L 1KTLB 5FUZL 4ZFFB 3BDYH 4JFFA 3U30B 5IBLD 3GJEB 1W72B 5TF0A 2NY6D 1T7ZA 2DQIH 1E28B 4JHZA 3O4OC 5LWYH 3GMNB 2G2RB 5FA3B 1WBYA 4RGMB 2R0ZL 5EUKA 5K33A 4U1JB 1I1YA 4P5TA 5C08D 1UM5H 4WV1B 2X4UA 1AO7E 4O51A 3TV3H 1VGKA 2A2QT 4WEMB 3T0EE 4MJIE 3ARVA 2VQUA 4RMSA 5AD0B 1WF5A 2XA8H 1WIPA 1A6UH 3KNBB 1S5HA 1OP5H 3D85A 1KTKE 5E94B 4ISVB 4HAGA 2J8UF 4KTEL 1MHCA 4HEPG 2WLYA 5T1LB 1A6VH 5HGDA 5IWLA 4Q2ZB 1M1SA 2W0LA 4Z9KB 4NT6B 2AGJL 2HFFA 2OJZH 3ZTJH 2E27L 4YGVB 1TZGH 4S1QH 4JM4H 1EJOL 4U1HA 5E7BA 5BS0B 1U92B 2JK5A 4AYFA 1DBKH 4JHBA 1HNFA 1T7XA 4BZ1L 1CL7L 5A43C 3BE1H 3MNWB 4Y16C 3TZVB 3V6ZB 1RUML 5B21A 3DURB 1FVCA 4MA1C 3VFRB 3MRKA 3PJSA 4MS8C 4JB9H 1CFSA 2IBBA 3PGFL 4U1IA 5GIRA 2ZKHH 5ERWA 3SKJH 1JUFB 4LDEB 3X12B 4RRPG 2XA3A 3Q5YA 1MAJA 2YPVL 1E6JH 1U8MA 4F3FA 1BZQK 3WFEH 4TULH 4FQ2L 5MI0C 2XQBL 2X4RB 3PWPE 4JO2L 3WXWH 5DQJA 3S5LG 3MCLH 1P69B 3O6FB 1P7QD 2XZCH 5TDNB 1CTOA 5ISZB 2OL3A 3EGSB 3WLWC 2J4WH 3UAJC 2NW2A 2ZCLH 1IM3A 2Q8AH 1QSFA 2FBJL 2R0WL 1TQBB 5KJRH 2A1WL 2R1WA 3W5NA 3EDFA 3HC0A 4NRZB 4HUNB 1KEGH 3ULVE 1AR2A 2W59A 2VE6B 4N8VA 5I8OH 2OYPA 1OSPL 4Z0XA 2X1WL 2CXKA 1KPUB 3PQYB 5JDSB 5T1DH 4YHKH 2VXSH 4M43H 1U95A 3RWEB 4OF5A 5GRVK 2YXMA 1MAMH 4JDVA 1TIUA 4EN3C 3WFHA 2VITA 1NL0H 4G8IB 1KB5A 3TBWA 4JQVC 4OLXL 3L3JB 4Y4HB 3CX2A 3MRJB 1RULL 1ZSDA 3PG2A 4FQXD 4XWGL 4F8TA 5GRXG 1QLEH 4R0LC 2FWOB 2AJ3A 3MV7B 4JHWL 3FCTA 1UWEL 3PWUA 4QXGH 1S7TA 2W9DL 4WFHD 2V2XA 1VCAA 2VLRA 1HI6B 4KKNA 5CZKA 2XWTB 1RZFH 4YHYB 5BRZE 1IRAY 4U6YB 1U58B 1R3IL 5BVPH 4M48L 1YNTA 3DI3B 4XP1H 3ZYJA 4OCNC 4JY6B 1D6VH 3P0GB 5IT2L 2IFFH 1O5DT 2VDPL 4PJ8B 3QA3A 2Q7NA 1PZ5B 1OAYL 3MBEB 3RA7H 3SO3C 3GMRA 3VRJA 3EYVA 3P9WB 1A4KB 1RVFH 3KPQA 3VXMA 3VXRB 4YBLB 1F4AA 2NY7H 1DFBH 4K8RL 4OQTL 3WE6A 3WNLA 5ESVB 3VWJA 3HCVB 1A1OB 2HYMA 3ULUC 4XP6H 3QUYB 3NGBC 5JW4M 3ULVF 1NGWA 2CLRB 2XFXB 4RZCA 1KPVB 2GUOA 4QY8A 3MTRA 4BUGA 5C8JB 5AYUH 3OGOE 3WXVL 1R0AL 3ZTJG 4LGPB 4WENB 3DGGA 3QP3A 1FG2A 1ORSB 2X9XA 3K46A 3U2SB 3MA7B 1A7OL 3FFCD 2EE2A 3BOVA 1ZANL 4OZHA 3UAJD 1IGCL 1DDHB 1NBVH 3KPNB 5B3NA 3LQAC 5T1KB 1YMME 4Q6IB 1BFOB 3ZLQC 4CU6A 5D93B 4H1LH 5BW7C 4AIZB 4JFDE 1JJUA 1C5DB 3H0TB 1DVFA 2Y07L 4QCIA 3MFFA 3KLHD 2XWBB 1SBBA 1KLGA 5I17B 4MA7L 5D2LA 4L8CA 1OF2A 3WKMH 5IB2B 2DQDL 3ARTA 3BIBX 1BWWA 5IHZB 4HZLB 2NNAB 2I9TA 4LVNC 5L7XH 3SBWC 3AROA 1A2YA 1EVUA 4F33B 1XF4B 3O6MH 5J89A 1N5YL 3ARFB 1OARL 2IH3A 2VTFA 4PGDB 3MYJA 1FNGB 2V2TA 4XTRC 3DWTA 5TPWL 5C9KA 4U6TA 5EB9A 3V5KA 5TDOB 1I8LC 5I1DA 1VEMA 4YE4H 4ZODA 4LRIA 4NQUA 2HMIC 4RQQB 4Z78A 3B8SA 1S9VB 1ZA3A 1XCQB 3EDJA 4QRQA 3TIDB 4XNXL 3G9AB 1PLGL 5IMMA 1A9EB 2W38A 3ZHLA 5JQHC 3A0OA 4E9LA 1T03H 4YR6B 2VDRL 2F54B 3RWJA 5ICZB 1T1WB 4KKCD 2V9RA 1QUNA 1XGUA 3GKZA 4G9DA 4MNGB 1JI1A 3BP4A 4GRLA 4BZYA 1CGYA 2E8ZA 4Y1AB 1JIBA 4Y5YC 3VFPB 1EHNA 1IMHC 5J1AB 4HQQL 2OCFD 4FFWC 1ACZA 3M8OH 5J11C 4RFNB 5CAYB 2CDGA 1GC1L 2EO1A 5KSVA 4MXVE 3LB6D 3HUJE 4APQB 4L8DB 4KAQH 4U0QB 1CGSH 3P9LB 4CN1A 2J12B 2AJXL 3AB0B 5BOZG 4K2UH 4TYUA 3TCLB 2IPKA 5HVFB 2WQ8A 5CSZB 3O2VH 2FRGP 2VDQH 2VZUA 2AABH 3ZO0A 4BSJA 1HHJA 4RFOL 5BV7C 5HHOB 1QO3A 3S96B 3MLWL 4U3HA 3U36A 4QLRA 5EBLB 5CD5C 3F5WA 4PRPE 4TNWK 1FPTL 4H26B 5DRXB 3LHPL 1KTDA 3OV6A 5FYLE 5DZNA 1C12B 3KJ6H 2E5EA 4DFHA 4MDJB 1F6FB 5E08H 1S7RB 2QL1A 1Z5LB 5D96C 5DTFB 5TE6H 1N3NB 3KDMA 4TUJB 1W72L 4HIXH 5IQ7H 4YDIH 1IGYB 4U1GB 1D5BA 4FNLH 1AGEA 1JFQH 3T0VA 4AENB 3LKNA 3IFOB 3FT2B 3QQ4B 1MIML 2VLJD 2BNUA 2FJGB 3IDMB 5B4MD 3X13A 5I75B 1NSNL 4YDLB 4GOSA 4V1DD 4L8SA 1G6RB 4QXUH 4XTRD 4XAKD 3KR3L 5EZJA 3LMJL 3LRHA 4TTDD 2HMID 1XF3A 1SQ2N 4MXVF 1XR8A 3FFDA 3I6GB 4K94L 4DCQB 3HUJF 4D9QE 2MQCA 3C08L 3MV9E 1LDSA 4RCAA 2XZAL 3VXME 3GGWB 2ZPKL 1TJHL 1UJTA 2BVQA 4HLJA 3MJGX 4WUUD 4H1LG 5C0DA 5E2TH 3RGHA 1KUMA 4K3DL 3HB3C 3ARZA 2WLZA 3CH1B 3L5XH 1NANH 4P2RB 1DSFL 4YXLL 1EBAA 3OR6B 3ISWA 5EBWB 4CJ1A 5TDPB 4FFWD 1ZS8B 4NM8H 3V52H 4AL8H 2R9HC 2XWJB 1MCSA 4G8FB 5MEQB 1FSKC 3PABB 1G1CA 1OOAA 4DVBB 5ADPH 4P4KB 5FYKL 1HCVA 5C0BE 4CN6A 3IDNB 2YUXA 2AK1H 3X11B 3FQNA 3TO4C 1ZLSL 1L9MA 4QHKI 2CGRL 3MRQB 3GSUB 3AGVA 3W9DB 3T3ME 4XAWH 1PY4A 1RU9L 3F7VB 3VCLA 4KRPB 5CD5D 3LKPB 3QQ3A 4GXVH 5BXFA 5I73B 3HRPA 1KYOJ 3AC0A 2FD6L 4TNWF 3QHFL 2HKHH 5F7WC 5C0AA 2ZP0T 1CS6A 3RVXC 1JZ4A 3TN0C 1JV5A 1JNJA 2ADIB 1YEHH 1AFVH 3NAAH 1MJUH 4Y5VC 1N64H 1G1YA 3RJQB 3OZ9H 4XCEB 2ATPB 3BZEB 2GSIA 1WBZA 5E2JA 4S1RH 4JY4A 5DQDH 2D7MA 4HW6A 3L1OL 1BFSA 1MJ8L 1QLRA 1IC5L 2NTFA 1CIDA 2R1XB 1IKNA 2BNQD 3B9KB 2IADA 4BFBD 1K9TA 5D1ZC 1L6XA 3P9MA 4J8RA 3S36L 2Z0BA 3D87B 4ZXBA 4IRJA 4LLVA 1QG3A 3UYOD 1RZ7H 3HNSL 4U1KB 3QULA 2HLAB 4UDUA 3VXUB 5IF0A 3A67L 4JZJA 5I1GH 2EDJA 3BGFC 4BKLA 4C58B 4JFOA 4BSWB 3JUZA 4OJFH 1TNNA 1GIGH 3K2UL 4WIQA 5DMYA 1F11B 3DVGB 3DX9A 5CJOH 4W6WB 3WDIA 1MJJB 4GG6B 2GSGA 5BV7H 1HXYB 3T3MF 1NAMA 4JM2A 3UBXI 4ELMB 4KI5E 1ACYL 1ZEAH 4CL7A 3KYKL 4JHAL 4YDJB 5D2LF 4NUGL 2DQEH 3L3IA 5E5MB 2VQ1A 1NUNB 4F58L 2F15A 2PO6A 2VZ1A 5JUEL 1XGYH 4KWUA 2E6JA 3T4AA 3LV3A 1TDQA 3RVVD 4JJHA 1MCJA 2ICWB 3SE8H 1RZJC 1U8KA 3TO4D 3EFFA 3WKNA 1AC6A 1DBJL 4PYHA 1HQ4B 2LVEA 3GI9L 2EXYC 1PSKL 3OKDB 5BCAA 4CN4A 1R6VA 2YC1B 4JGJA 3GSNA 4PB0H 4POUB 4QOKB 4X9HA 3KYMA 2X9WA 4RMQA 3CVHA 4FS0A 1I4FA 4XNYL 2XXMB 5LQBH 1XF1A 1LK3L 2AJVL 3BUYA 4I4WA 5AEAA 2VISB 4ZPVA 2R0KH 3WN5A 2FR4B 4LPCA 1RAMA 2YXFA 3D39D 5B39B 3EJJX 3UPCA 5DD6B 5HI4C 2I5YL 4KZEL 4LP4A 3O3BA 4IS6B 4LK4A 1RHFA 4ENEC 5DMGC 4QRUA 1HSAB 2X9YA 1MH5B 2YA2A 5I1EH 1ZLWH 2WBWB 1YMHB 2EKSB 4P46D 1FO0A 4OCWL 5JLZA 4K7PY 4KI5F 1M7IB 1SEBA 2R1YB 3EJYD 4LCUA 5DS8B 2OLDA 4LAQH 5DEFB 4F57H 3S7GA 4YNYA 4NC1C 3HI1B 1X3DA 1BQHB 2X4OB 3TNMB 1HOCA 5JTWA 4WTWA 1LO2H 4MB3A 2CK2A 4FZ8L 1EH9A 1CE1H 3MRLB 3LH2H 3PP4H 3REWB 1U93B 4CW1A 4I77L 1CXLA 1ZT1B 1M71B 5EU3A 1KT2B 3O8XA 1HXMB 4Q9BA 4Z5RA 4M4PA 3N9GL 1UWXK 3RL2B 1S7SB 5IM7B 2IFGA 4TQEH 3X14A 4JANA 4HWEH 3RWFB 1I9RL 4UAOC 4XBGA 5DJXA 5FKAB 6CGTA 4GQ9L 4JE4B 3WUWB 4JAMB 1JHLH 5DA0B 4LCWD 2XV6B 3Q2CA 4WFGD 3WEXB 2IH1B 5DF0A 4LCCA 4NCC2 3K81A 4R96B 3I02B 5EBMA 4W6XB 1B2WH 4EQ2A 1NCCL 2QHRH 4PRHB 5DUML 1E4KA 1NLDL 3MPCA 3TWCL 3V4PL 2F5AL 3KJ4C 2J6EH 4YHIA 3DV4A 2EXYD 3HZMA 5CS7A 2JB6B 2BY1A 3H2WA 3NIDE 3KLAA 5BZWB 1J05A 2ILLA 2GIYA 3QISA 2WK2A 3P0VL 3KPOB 3ZL4L 1WT5A 1GAFL 4U7KA 2AV1A 1LQSR 3BHBA 3QDJA 1I3UA 1OAUL 2NY4B 4UT9L 3IDIA 2EC8A 4DZ8B 5LGHL 5SWQB 1ONQB 4LLMB 1X5KA 4OD1H 1X5FA 3W39B 3NIGE 1QBLL 5E8OB 5C0CB 3SQBA 2GAZB 1UGNA 3BSZH 1SVZA 3ZE2E 3QXUA 2NX5B 4G6AC 4ODUA 4DGVH 1S7VA 3EO9L 4Y19B 5DMGD 5FHAH 4U1SA 3RWGA 5FECA 5I71B 5DJ6B 3CFEB 1V8HA 4PJAA 1ZGLA 5I8KL 4CVZA 5K9QG 4OV6F 3MCKB 1RMFH 4UB0L 4PJ5B 3D2UB 4ETQB 4ONHA 3EYSL 3VXSB 3MLVL 3RNKA 1GXEA 1VPOL 1RHHB 4H5SA 1G6RL 3ILPA 3CPLA 4JZNB 1QA9B 2L7JA 4FTVD 4O02L 5KW9L 2DLGA 3H8NA 1HHIB 3KYNB 2H2PC 3SKNA 1RZJH 3DMMC 2F53D 3U0PB 4JDZA 4CDGC 4K3JH 4MVBD 3T1WA 1A21A 3AXLA 5KTEH 1FC2D 3NIDF 1UA6L 2NXYD 5IG7A 1JZ6A 3NTCL 3R06A 1HEZB 5SX5H 5TGBA 2WQRA 5M95B 3TBSA 3RKPA 2XPGA 3WIIH 2W0FA 2AS5M 3HAEA 1FNSH 5IVZA 4HUXA 1NFDE 4HKXB 1INEL 3KPSB 4XBEL 3BMVA 4LHUA 5I74B 3FQXB 4BFGA 2AXGB 1RUKH 4RNRB 1X5JA 1CL7I 2O5ZH 4HJGA 4Y4KC 1MUJB 2VERN 3QQNA 1T0NA 2EH7H 3C5JA 4PP1C 1NPUA 4RGNB 2AK4E 3ARDD 3OJ2C 3MRFB 3UJJH 5JOPE 1QRND 3BQUC 4YAQB 3ARYA 4XPFL 3SGKA 1EJ6A 3O6LH 1DTUA 3CSBA 3VFTB 4XCCH 2EYSA 5EZLB 2IAMA 4FQPA 5BS0E 5F7YC 3P73A 1C5BL 4M1DH 2UZXB 4R4NC 3N1PC 3VFSB 2DTMH 1KPRB 5CBEA 3CH8A 3AS0A 2YA1A 5ICXA 3VD7A 4DUVA 5IMLA 4OCSH 4G6AD 1W0WB 5IMOA 4WTXA 2H6PB 2DQFB 3P4NA 1AKJA 3RWDB 4Z95H 1AO7D 4CMHC 2DI7A 3TC9A 4MJID 3BGAA 5K9KB 3OKLA 3IU3B 3KYOA 4LL9A 3IETB 4MDIA 1IQWL 3CK0H 2QR0B 5FUCE 4MXWH 5ACZB 1HIMH 2F5BL 4PB9H 3LQMA 1T5WA 2ZUXA 4OFYA 1A6AB 4JRYB 4DFIA 5D7KD 2OZ4A 1KEML 3AY4A 3NIFE 2W07A 4JFEE 1KSRA 1NFDF 3O0RL 4L8BA 1N8ZA 4NZRL 2BSSB 4FFYH 1VFAA 1L7TH 3DMMD 3OAYK 1KOAA 1AP2A 2JF1A 3BN9C 4MNQB 5ISZE 1P7HL 2HA1A 3RGVC 2UWEA 4QF1A 3RWIB 1ZV5A 4WUKH 4IMLA 3MRIA 5AAWA 1HQRA 4NZUH 4P5MA 4P3DA 4G8GA 2EDOA 3G04B 2K7QA 5IUSA 2ZCKH 3FQUA 2B0SH 2VXUH 1K6QH 5E6ZA 5GS2D 1OTTC 5C3LD 3QQ9D 1PJ9A 5L2KA 4K7PX 1NC4A 2FX7H 2YMXH 3Q6GH 6FABL 4K3EH 4Y4KD 5D7JB 5GGVL 3UMTA 1T66C 5IHUH 3PGCA 5CEXB 4O58H 4G6JL 4GKNB 4P5TC 3DTXA 2CR3A 4X7DC 1SBSH 5C70A 1FE8H 1A8JH 1T0MA 4Z7UE 5AUMB 5E03A 2ZSVB 3NIFF 4R4ND 1PKQA 1MQKL 4HWBH 1DQML 2R4SH 3Q6FA 3V79C 1KGCD 3KPMA 1FFPA 4ZFGL 3ULVD 4IRZL 4GW1B 5EN2A 1VKXB 1R3JB 1U8HB 3V4UH 3M07A 3DO7A 3PHSA 4N9GB 5IWLC 3LVEA 2IGFL 2NY3B 4HMEA 5J12C 3UTTB 1IC4L 1FRGH 4YXKL 3BWAA 3ME0A 3PWNB 3QEGL 4LLQB 2GJZB 2E7LA 3VXRE 1J86A 2SEBA 2ITCA 3SDDD 4ZFOA 4TRPL 4HGKC 1K5NB 3MO1A 5KVGL 3RZCA 3N1QC 3RWHB 3O9WA 2E8YA 5BRZD 5GS2H 3MNZB 4RFEA 4WFFE 3EJZC 1E4XH 3NFSL 4NN6B 4QRRA 3BN9D 1NMBH 4GJTB 4KV5E 4PJ9A 3C5ZD 3UJTL 2YEZB 3EDEA 3GSQB 3VFVB 2ARJB 1A3QA 4QXTB 3UC0L 4PJHA 1T0PB 4NJAL 4G5ZH 3CLFH 5I66A 5FB8A 1GGCL 1A9BA 4GG8B 1K4CB 1M6OA 4PJAF 4Y89A 2CR6A 1X7QA 2J8HA 1OQOA 3IU4H 4Z7UF 3D5OF 3P4MB 5EBGA 1OTTD 3T1FA 3G08A 4GKZA 2NZ9C 5L0QB 2BSTA 3ULVH 1MCNA 5CJQL 3FTGB 4NQDA 2GY5A 3E6HB 3BPNB 4F37K 4WWKB 5IB4A 5HDQH 4OD2A 4WI4A 1LEGB 4OM0L 1MCPL 3FT3B 4KROD 4X7SH 8FABA 3DYPA 4P5TD 1OAZL 1I9JL 2A6JA 4NUJA 1PYWB 5CEYB 1U8JB 1YMMD 5IR1A 5C09E 4JREC 2DBLL 1MRDL 1JWMA 1DEEB 3NPSB 2ZG2A 3LKRB 4JFDD 1GHFH 1X5ZA 3D85D 3DARA 3L5IA 5F7HA 3PV7A 4ZFZB 5IGXH 1QKZL 3S34H 1YNLH 2F54E 4P9MH 1MJ7L 3FO0H 5HBBA 2GITA 1FLRL 4C83A 1F4XH 1ZTXH 1J8HA 1QVOB 4Y1AE 3KPRA 4I2XE 4JPIB 4KV5F 5ID0A 3W9EB 2AQ2A 1B0WA 3D48R 4HWUA 2DMKA 4JRXB 4MXQC 3T2PA 4ALAH 4XPBH 5BQ7A 3QDMB 1G9NH 4PJXA 5C7XH 1HHHB 3MJ7A 4DW2L 2UWEE 1T3FA 3BP5A 2AXFB 4XCNB 1E4JA 5JIPA 3V6FB 4RIRA 4LMQE 3PWVA 2Q86B 2ARWA 5L6YH 1ZHLB 2PW2B 4WCYL 1QSVA 3D18A 3EJZD 1GZQB 1CK0L 1YQVL 2R0LH 3WNNA 5IEKA 4G42B 3QI9B 1F8TH 1WC7B 5JXED 2X4PB 3VGHA 4JGUA 5D1XA 3VWJC 3QRGH 2ZOLB 5D72L 4ZUSA 1SYSB 2L7UA 5SWZE 4AEIL 5A2IH 5SWSA 4E41B 4OKVB 1CXEA 4XB8A 2LQRA 5DWUH 4XMLH 1MCHA 1ZA6A 4OB5H 4OF7A 5E95B 5GGSY 3QEHB 5J9PB 3BKML 3T3PE 3WIHA 1DUYA 4NNPH 5CINL 1CDCA 4WU7B 3W11C 2BVTA 5HGHA 3U7YL 2OBGA 4FN0A 4GBXA 3VJ6B 2V5TA 2NZ9D 3AFLA 2YUVA 1JHKL 1H0DB 4PREB 4YLQT 2YD2A 1QYGH 4R26L 3HKFA 4MAUH 4F37F 3ZT6A 3IXAA 4IHOB 5GGQL 3VMNA 1DVFC 3H9ZA 4XVTL 2VAJA 3FOLA 3WDHA 4PRPD 1T80A 3SDAA 1OT1A 1GGTA 5FYLD 3TA3B 1R5WA 5D7LA 5FAAA 4PJFA 3VFGL 2D31B 2G60L 5JPNA 4ZS7L 2XYCA 3IDGA 4L4VB 3D6GA 2UWEF 3GI8H 5AWNH 3WJLA 3RVTC 4Y5XB 4BUHA 1F90H 1MCCA 2QADC 1JNNH 3UTSB 1SY6A 3VH8A 2D7TH 5IQ9B 1FIGH 3M1BB 4O5LH 1JP5A 4P2RE 1IGFH 2VLRD 3HI5H 1HH6A 4LRIC 5DI8A 1V7NH 4LLDA 3WL9B 1R5IB 1P2CA 1YPZB 1N6QH 5DEGB 3UPAA 5FHBL 4J6RL 4MXQD 4KZDH 4HT1H 3B6SA 1AXSB 2JIXD 3UBXA 3PXHA 4UT7L 3BYYA 3IVKB 5I1HH 2EDKA 3S3JA 3CFIC 4DTGL 5D7SL 4HKZA 2C1PA 5J1SC 2DBJA 3QHZL 4GRLC 4NWTL 3T3PF 1PEZA 5JQ6L 4H8WC 2OL3H 5TJWK 4ZUUA 2NY0D 4PBWD 3UROR 4EDXB 1FL6B 2YS4A 3MV9D 3HE6B 3VXMD 4JPWH 3QIBD 4I13B 4KTDL 1ZAGA 3BPCB 4RISH 3MRCA 4ODHH 5DJYA 4LASL 1J87A 2H45A 1UYWL 2CRYA 1DANU 3D3VB 2BHZA 4QRTA 4M7KL 1P5UA 3K7UA 4HUUA 3PXJA 4MA8L 1SYVB 4CAGA 3DUUA 3NOIA 1M05A 3VFUB 1JZ7A 5FYLH 1J18A 1JVKA 4O2CA 1BPVA 1AXTH 1JRHL 3W11D 4MAYD 1FFQA 1NC2D 4Y4FD 1EA9C 4UNUA 1MI5B 1NAKH 1D9KA 5CKAA 5LCVH 3BP7A 2O61A 5IJKA 2FO4A 1R24B 1Z9OA 3GO1H 5L2JA 2VZOA 1G7JB 5MEOA 3HC3L 3JWOC 1YECH 4U6VL 1Z9SA 3AM8A 3STZA 1JZ2A 1BVLB 1A7RL 4X6FA 1I3RA 4MLIA 3DJ9A 1I1FB 4H20L 1TJGL 4X80H 3S5LB 4QTIH 3WFBH 5J13B 4NM4L 2IQ9L 3BT2L 3C5SB 1UKTA 4GFTB 4LSPH 3VXUE 5J0BA 3TT3L 1AQKL 1A7NL 1EEYB 4WTZG 1UZ8A 1MY7A 4L8SC 3SQOH 5IV2B 4Q9RH 1OGAB 3I9GH 3IJHB 2NY5L 3FONA 4GG6E 3H42L 4FABH 4NO0D 3QDGB 4YHZH 3QT2A 4ELME 3P0YL 1LD9B 1VADA 3NA4A 4X4YA 2Z4QA 2ESVB 3QG7H 1IAIL 3MRMA 4WEUD 4C56E 5DT1L 1H3GA 1MEXH 4HLZH 5HYJA 5I1IL 1I7UB 3BWUC 5IFHL 1OGTB 2ID5A 1RK0B 1XAUA 1NJ9A 4JJ5B 12E8L 4HCRH 4E42A 1MHEB 1NMCC 4PJIA 1PW3A 2HWZL 3SE9H 1I1RA 4CVXB 4GS7B 5EULV 1CD1A 4M8QA 4P59L 3JTSA 1TQCB 2DJ4A 5ALBL 1OM3H 4QOKE 1FFOB 5FA4A 4OIAA 4NQCB 5EDXA 3ARGD 3UCRA 1G9MH 2D4DA 1GYAA 4KI5D 3ARSA 5GS0C 4JG0L 1LP9B 35C8L 2CXGA 3QWQB 2BZDA 1OPGH 5GZOD 3QFJB 4YFDB 2W0PA 4OV5B 4I18B 3BIKB 4OLUL 1DE4A 2HVKA 3L3DA 1FNLA 4LNRA 5DXWA 2HH0L 3N85H 2ICWJ 5IBUG 1Y0LB 3MJ9A 4GW5B 2WUBH 4DKFH 4Y2DD 2WW8A 4PJXF 5DDHA 4A6YA 5T1MB 5D7LE 4PJFE 4XNUL 4NNXB 2BDNH 4I3SL 5E00A 4OZIE 1JGDA 2XN9B 1T7VA 1I1AD 1WVZA 4X6DA 4UQ3B 2Q3ZA 5CLTA 4ONFL 1U6AH 3SDCA 3OTTA 3BUTA 3HNVL 4WHYH 1J11A 4PGZA 5D5MB 1IKNC 3RDTA 4H8WH 1S7QA 4N0FA 1R3LB 2O5YH 3MRNB 3PDOA 1BQUA 3DSFL 5JO5B 5EC1A 1DBAH 4JO3H 4GRMA 3LQZB 5FGBA 4FQHB 4ZXBC 4IRJC 1JYNA 4YHPA 2AEPL 4F7MA 1Q0YL 5CFHA 1NFKA 2AJUH 3OKKB 4P3CL 5GRWA 3O11B 5F72S 1MWAH 4JZJC 4P2OA 3EFDH 4LVOB 2JJWA 4C59B 4ZD3H 5T5FL 3G6AB 5E4EB 5I1AA 2NY6B 1Q1JH 3DETC 5FO7B 3TCXA 4PJDB 2P5EB 1B0GA 3GSRA 1CR9L 4JM2C 5HPMA 5DLML 2W9EL 4X99B 5C08B 1IGMH 3TPKA 1WEJL 3L9RB 4FQLL 4LOUD 1REIA 2PO6C 3UEZA 2JCCA 4PJFF 3H9HB 2H9GA 4DK3A 5FM5M 3VGEA 2IG2H 5E9DA 2ADGA 5E2WH 1X5AA 1XGTB 2F74A 4NGHH 4OZIF 3IDJA 5KSUA 5D7IE 2D9CA 5MHSD 3IAQA 3LY6A 2KH2B 4R7DB 4LSVL 3BPLB 3NPZB 4HIEB 2EZ0D 1T21B 1S7UA 2X70B 3JV4B 3MUY1 4PV9B 1KIQB 3GMLB 2VLMD 5IFAL 3EO0A 1U42A 3OQ3B 5FO8B 4LCYA 4HLZG 1S9YB 3QEQE 3FQTB 5C0AD 4DGIH 4Y19E 3QG6B 5HHPA 1JZ5A 5F1IA 1LE5B 1J12A 1QFUH 5JHDA 3WN5C 1M4KA 4HGWA 4PJ5E 3KPLB 4M61A 4Y0GA 3VXSE 1EFQA 3MUGA 4XP5H 3IB4A 1BIIB 4OSUL 2ATKA 2E6PA 4FZEL 3KG5A 1OAXH 1PKOA 3KHOA 1RFDL 3OKMB 3Q3GA 1RK1A 2Z35A 1A6ZA 3AAZB 1FJ1A 3IFNL 3V7MA 1NGPH 4GKSA 4JN2A 4WNQA 4IRJD 1HINL 2MCPH 4X4ZA 1G7QB 7FABL 3S88H 4XP4H 1P7QB 4QHMA 2E9WA 2DD8L 5DZLA 2YBRB 4JQXA 1FYTA 2EDXA 3HZKA 4N68A 5D7IF 2APVA 5LBSH 1VACA 3ZMRA 4W68A 3O8XC 4ERSH 4IRSA 4M1GH 3NFPB 5EOCL 2ZUTA 4L3CA 1VENA 2DLTA 5KVFL 1N2RA 5DMIH 5GGRB 4OZFH 2Y36L 1UEMA 4OCYL 2PO6D 2HRLA 4WHYG 1FL3A 5I19H 1EEZA 2WIIA 4P2QA 4PJCA 3I84A 4RGNE 3CAFA 4LCCC 1WIUA 2BOCA 1UWXH 5D4QA 3O3UN 2F8XC 4FQXB 1IAIM 3MRPB 1TVHB 3CFBA 1Y18A 1E4KC 1G7IA 2FX8L 4H1LB 4HMDA 1EMTL 1DANT 1FH5L 3HHRB 3LKSB 1RIVH 1MCDA 4BM7A 1LO0H 3RY6A 3HMWL 4OQTA 5L8LB 1KJMA 5T3XE 4HS3B 4TSBH 3NCCB 1S9XA 3MLYL 1WT5C 4FFZL 2E9JA 3QUKB 5D2NB 1CFTB 3FHQA 2P24B 4N1CA 4ELKB 4JFHD 3V8CA 3HR5B 5FGCB 4LCIL 2QQKH 4MA1B 2AK4D 5JOPD 2Z92A 3E1F1 4N0UA 2VL5B 4JRYE 5MP6H 3FT4A 3H7BA 3ARUA 3K0WA 5E6YA 5DUPL 4YHNB 2PXYB 2G5BA 1NAMH 3LS5L 4M6OH 1YYLL 3CFKA 5MI0B 1MCWW 3GSVB 1X6LA 4RMWA 3KVQA 3MMEB 1JBJA 2W65B 1KN2H 4MNQE 2HFEA 4U7SA 2DJUA 1H3VA 1N7MH 3PNWB 3K3QA 5A3ID 1F3JB 4ZDHA 4RX4A 5I76A 2APTA 3FFCB 2EDNA 1RJCA 1T20B 4UIMA 1O0VA 3STLB 4G8EB 2HFTA 3O8XD 2AP2A 3ABZA 2DQJL 2CIIB 2DQHH 2PUQT 4K23L 5DK0A 1NCBL 4JZOA 4P5KB 4JFED 4X6DF 3GSNH 2NY1C 3P11H 4U33A 1QFWH 3K80A 3U0TB 4IJ3C 3G6JE 3L7FB 1S7XA 2HKFH 1H3PL 1IEAA 1N59A 2VSDA 1S9WA 1E4WH 5IVOA 1G7PA 3EOTL 5M94B 5IB3A 1JGEB 5J8OA 3LEXB 2K1MA 5GGSA 3T2OA 3OKOA 1P1ZA 4XWOC 2HG5B 3MXWH 4XMPH 3CDGB 4L3AA 4WJ5B 3BGMB 4LEOA 3BVNA 3LN4B 4PGBB 1CFNA 1BEYH 4NKIH 3EAKA 5ICYB 1CFVH 2DQIL 2B5IC 5LWYL 1YYMH 3WJJA 2C7UA 4X6CE 1FO0H 1YJDC 3LAFA 4X4MA 4YPJA 3SGKC 5FDWA 3CCHB 4YO0B 1UM5L 3SJVA 1MCEA 5E1AA 4ETYA 1HKLH 3UTTE 5EG6C 3D69B 3U7WH 4JDTH 2IAMC 2Y7QA 2XA8L 2D03L 1AD0A 2K9UA 1R5VB 5J56B 3N1GC 3SO3B 3UTZA 1A6UL 5CIPH 4OZFG 1F2QA 1YN6B 4NO5A 4GAYB 1QLFA 4TUOB 4PTTA 5GGVY 4LBEA 1PEWA 1UH2A 2ED9A 4ZFFA 1A6VL 1RZIB 2BVOB 1W72A 2OJZL 3F7YB 1E28A 1TZGL 4JM4L 4S1QL 5FIEA 5FA3A 1WFNA 1DBKL 1SJEB 3S8WA 1HZHH 3G6JF 3STBA 3BE1L 2R56L 4WV1A 3TJHD 3AY4C 5F3HB 5FGRA 3VFWB 4ZNEA 2E7BA 2VXTH 4XNZC 5FM4A 5AD0A 5DHVH 1BVKA 4KQ4H 2G75B 4P2QE 3MV8B 1I3GL 4PJCE 4D0DA 4JB9L 4ZYKB 1INQA 4U7MA 1F42A 4M03A 2FL5B 2ZKHL 4ISVA 3BRFA 5F9JB 2DL9A 1E6JL 4ODSL 5T1LA 2HVJA 4X6CF 2OJEB 3IFLL 2J1KA 4KI1A 2ICCA 4YGVA 2M26A 2VLJB 3PWLB 5KANG 3WXWL 5FXCH 1BJ8A 1U92A 4WFFD 3MCLL 4R4BB 4IM8A 4K07A 1Z9LA 4QRSB 4WHDA 3OAYH 3BP6B 3QAZB 4LHUD 2XZCL 1NEZG 4CADA 4L1DA 2VDOH 4V1DB 3MNWA 3TZVA 2J4WL 3V6ZA 2ZCLL 1RUAH 2GFBB 4UUJB 2Q8AL 1QBMH 3THMH 5KJRL 5EH1A 4YC2B 1N5AB 1CE6B 1VEPA 4U6HB 3HZYB 4OZ4A 1MFBH 3LKOB 1KEGL 3VGAC 1JUFA 4NPYA 2FJFB 3QIUD 5I8OL 2RIKA 3WO4C 4G6FD 4WUUB 3H3KA 3MRRB 1FZMA 2RCSH 5T1DL 2IAMD 2VXSL 2X4RA 4M43L 2GK0A 4YHKL 1SMAA 1MAML 4YHMH 3ILQD 1NL0L 4NOFA 5J11B 3SEPA 5TDNA 1QLEL 1HILB 4G3YH 4I0PD 3EGSA 3TBTB 5J3HD 4PJCF 4L5FH 4QXGL 1V3JA 4ZAKA 1EZVY 5C09D 3GNMH 4G6KH 2EIZA 4YEFA 1FVDB 1RZFL 3EZ8A 4LSQH 3PUCA 5CMAA 3WS6A 4NRZA 2E7LC 4DAGL 4YWGH 4XP1L 5DD0H 5AG9A 2DS4A 5I8CB 2XT1B 1D6VL 1BJMA 1HHKB 3VFMB 5BV7B 5F9AC 3CMOH 1T1ZA 1DJSA 2IFFL 3RZCC 5JNYB 5E8PB 3T8XB 2X2YA 3RWCB 3O9WC 1U8PB 1HH9A 5JHLH 3RWEA 3GEWB 1PQZB 3F58H 5D6CB 4G8IA 2GTWA 4NIKB 4JFPB 4Y4HA 3MRJA 1RVFL 5D96B 1PBYA 2KZ1B 2FWOA 4PJ9C 2NY7L 3S9DB 1GGYA 3MV7A 1DFBL 1OT2A 1QP1A 2OSLB 4NJ9H 4S2SA 5ETUB 1B4JH 1J1XH 4PJ7B 3VMOA 1YJDH 1HI6A 3BO8B 4XP6L 3KXFA 3DI2B 5A16B 4AM0B 2XY1A 4MMXC 4I9WE 1XGRA 2BNRA 5AYUL 4JCMA 4D3CH 4R2GB 2BNQB 5HI3D 1U8NA 4JY6A 2BC4A 3HG1E 4LHJB 3SJVE 4PJ8A 2WIMA 3BW9B 1NBVL 1NC4D 1PZ5A 1I8IB 5SWZD 2VJXA 1JPTH 1XIWA 3BX7C 4L4VE 1P7KB 5JW4Q 3OGCA 1KF9B 4N5EC 2NZIA 3QUXD 5FKPB 1A4KA 1FNEB 4J3OC 5ESVA 3HCVA 1A1OA 4IOIA 1F3DJ 4HIHA 1BFVL 1BGXH 3WKML 3QUYA 3ARED 2CLRA 1KPVA 1JK8B 1YPZE 2DQTH 2OTUB 5L7XL 1TCRB 2HLFC 3O6ML 4X6EA 1NCDH 3LEYH 1LO5B 3ZDXE 2OM5A 1ORSA 2AQ1A 1TTFA 1JRHI 1GGBH 2AJYH 4YE4L 2NW3B 4NN7C 5ENWB 1X6NA 2A6KB 1BFOA 1KCVH 2ZNWA 1TVDA 4DN4H 3FL7A 5TF1H 1EDQA 3GB7B 1GZPB 4NFCA 5KSAD 3IXTB 3TO4B 2H26A 1C5DA 4MJ5B 1A4JB 1TITA 1JGUH 1T03L 1J0JA 4M8VA 1J1OH 3TBYA 4Z6AT 5CCKL 5IHZA 1WGOA 4HDIB 4F33A 2BX5A 2ZUQB 1GSMA 3M8OL 3ARFA 4QRRD 3L3HB 3I6KB 4GO6B 5K59F 2JLLA 3V6OE 5EOCJ 4U1MB 3FZUC 3CSGA 1FNGA 1UJ3B 5D1XC 1X4YA 3D39B 5TDOA 1BMGA 1NDGB 4N8PA 3FQWB 4Z7VB 4KAQL 1MI5E 2BY3A 4O2FB 4RQQA 3T0BA 4K2UL 1XCQA 3TIDA 3O2VL 2HJLB 2VDQL 2AABL 4BK4A 3UJIH 2Z93A 4P46B 2OTWA 3HLAB 1I8MA 1S78C 1E0OB 1IAII 1YPZF 3R0NA 5ICZA 2YKLH 4GBXC 4NBYB 4D0BA 1TPXC 3PHOB 1GL4B 4MNGA 3NCMA 1JN6A 2IANE 4I0CC 4NQDD 4OBSA 3VFPA 4UU9B 5J1AA 3OB0K 3KJ6L 5EOTB 4N5ED 4S0TD 2DLFH 5T5NF 5I8EA 1K85A 5F8RC 1Y6KR 5E08L 3MA9H 2VDLH 3RX8A 5TE6L 5KSBA 2FATH 4HIXL 5IQ7L 3BGFB 1OGAE 2XI9A 4FNLL 4DQOH 1JI2A 4L8DA 1JFQL 3IFPA 3QCTH 4HXAH 3GMQB 3SDAC 2PW1A 3BKCL 4KFZC 4M7ZC 5EIIA 1MF2H 4L9LA 3DV6B 4FRWA 3MUZ1 5F6IB 3WJLC 5IK3B 3BH8A 4AH2B 2DN7A 4AMKH 2ZJSH 5HHOA 3ZE1F 2BXZA 1UM6H 4MMZC 4QXUL 1XGPB 3OXSB 4LCWB 1J8HD 4H26A 3KPRD 4ZSOA 3VG0H 4QXWA 4KTYA 1IGTA 3B83A 4MDJA 2NLJB 3PV6A 1Z5LA 3O6KH 5DTFA 2OK0H 4XH2A 4TUJA 1FQ9C 1MRCL 1K8DB 1IGYA 2NXZC 3MX0A 4XNMB 4AENA 5E2TL 4U0RC 4M4RA 3QQ4A 3L5XL 1T7WA 1KCSL 3LOWA 3BAEL 3D0VA 2FJGA 3IDMA 2GEEA 1AGCB 4S1DD 1VERA 1ZOXA 4J23A 2LAGB 5CILH 4NM8L 5F6HJ 5FYJU 2BNRE 3V52L 3EOAA 4AL8L 4C56D 3UPRB 1CFQB 5H94B 1EIBA 4AG4H 4U6XB 1G6RA 1WISA 2EYTB 3GRWH 4EOWL 3EO1B 1UQSB 3T77B 2VB5A 2H8PB 5I2IB 4JFXB 1RV6X 5ADPL 3FRUA 1QQDA 1H3TA 2VR9A 4Z18A 5LAXB 5SWSD 4JVUA 3I6GA 4DCQA 4KPHH 2V9QA 2AK1L 5DMKB 9CGTA 1NGYB 25C8H 5DFTA 4OLYH 5CBAB 2X7LB 1ZLUK 1WWBX 1S78D 3CUPA 1EZVX 1T4KB 4XAWL 2UYLA 2J5LC 2YN3A 3VWKA 4GXVL 2P4AB 3CH1A 5DJDB 5EBWA 4DK6A 5TDPA 1D9KC 4R8WH 2GT9A 2ZSWB 4OT1H 4Y16A 5IJKC 1JGVH 4FTVB 1YEHL 1N6VA 1AFVL 3NAAL 1MJUL 1N64L 2XWJA 3AM8C 1UKSA 3OZ9L 4G8FA 4JFZH 4L4TA 5MEQA 4PR5B 3PABA 3SDAD 2A77H 4MJ2A 4R7NB 2F53B 4P4KA 3U79A 1UXWB 5D7LD 2WP3O 3IDNA 8CGTA 3C8KA 1KACB 3X11A 5GGUB 5I1JL 2NXYB 2AEQH 4JLRB 3T04D 3MRQA 2EECA 3GSUA 2KQMA 4G7VH 3W9DA 4WDIB 2J8UB 1ZVHA 3EDKA 5GRJL 4PJDE 3MLUL 3WNKA 1QR1A 3QFDB 1EGJL 5J6HB 2V7NA 1RZ7L 5C08E 3DXAA 4PP2B 2HJFA 4V2CB 5AYQA 3KJ4B 4NSKB 3N1FC 5I1GL 4XCEA 2ATPA 2EDYA 3BZEA 2NXZD 2XZZA 2IQAA 4GUPB 1N26A 2C26A 3RU8H 4OJFL 1GIGL 2V5MA 1BM3H 3WIHH 1IGJB 5CJOL 2MHAA 3ARDB 1PY9A 1QRNB 1CCZA 5BV7L 1D6EB 1ZEAL 2EDTA 2H2SD 2IALB 3B9KA 4G80B 2DQEL 5E8NB 3O3DB 4PGEB 4CNIB 1QHOA 4PJBA 5HHQB 2YSSB 1XGYL 4XVSH 3VD5A 4YFLF 3RAJH 1BVZA 1NBYA 4WW2F 4B53A 4KK5C 3SE8L 4S11A 4U1KA 4XNQB 1ZE3C 2EO9A 5JORB 4J4PA 3DVFA 1DLHA 2XKNB 1AO7B 3HZVA 4MJIB 4BSWA 4NDMB 4POYA 4MQSB 1LEKB 3ZT5A 1SY6H 5J7CC 1MFAH 4L3EA 1HXYA 1D9KD 1OTUD 5BMFH 1CG9B 4FXKA 5LQBL 1CBVL 4YBQC 5E5MA 4X7TB 1RUQH 2Y1VA 2R0KL 3DRTB 3LKQB 5F89B 4ZTOL 1G7MB 3SDCC 1HK6A 3DMMB 3MOQA 4BH7A 5DRZB 1C5CH 1JHTB 3VXTA 1MFCH 5EFIA 4WU5B 1YY9D 1RJLA 4RMUA 5JDJA 2AJSH 3QO0A 5I1EL 3RDTC 1KIRA 4IMKA 1HQ4A 3ARBD 1JTTA 3WLBA 1CGVA 1VGEL 4DKEH 4TVPE 1TVBA 1BJ1H 1UENA 2QSCH 2YC1A 3MLRL 1KFAH 5FGBC 4LAQL 3VE0A 4F57L 2XRAH 3E6FB 4MNHB 2FCBA 2F9BT 1LILA 2VISA 4P2OC 2FR4A 4LSDA 1CE1L 4XHQA 2GI7A 3RUGE 2VRAA 3LH2L 5HYJD 5ANME 3NZ8B 3PP4L 1WCBA 4Y4KB 5B39A 4AT6B 3NFNA 4R3SB 4MB4A 1UVQB 5DD6A 5TQ0H 5C2UB 5CLWA 4IS6A 5KSBF 4NKMB 3WFZA 1U2HA 1HSAA 1MH5A 1EK3A 1YMHA 2EKSA 4HWEL 4X98B 1H5BB 3U4BH 4NQVB 5EU6A 5IEHB 1JHLL 2R1YA 5DS8A 1EXUB 3F7PC 4IDJH 4F15B 2LAAA 3ALWA 2X4OA 4I1NB 4FQQA 1B2WL 1OTSD 2QHRL 4HIJA 4ODWB 3P30H 3D25B 1I8LA 4K7FB 5BO1H 2J6EL 4LSSH 3MRLA 4B50A 4CMHB 5F21B 5FGCE 3GFUA 1U93A 5GISH 1WBXB 1ZT1A 1BIHA 1UM4H 4OIBA 1HXMA 1DL7H 4IOFD 3L3KA 3G5XB 1UCBH 1MPAH 4R9HA 3RL2A 4GKOA 2Y5EA 2VN7A 3G5ZB 5TFSH 5IM7A 5I6XB 4MD4B 3HS0B 4YBQD 3SDDB 2V2WA 1T04B 2CD0A 1LO3H 3WUWA 3UXFA 5BRZB 4OD1L 3WEXA 3V5HB 2IH1A 3INUH 3RPKA 5KN5B 1DQQB 2XICA 3BSZL 5J1TC 4R96A 3RUGF 2ADFH 1MCWM 3T65B 2VZSA 1P4BL 4PRHA 3C5ZB 3P4LA 4DGVL 5FHAL 4OZGE 3SDYH 3TT1L 2BCKB 3DXAE 4K9EC 1GPOH 2JB6A 4Z7WE 4D9RD 1PFCA 1JGLH 1RMFL 3QZWA 5CSBA 3PDDA 5C0IA 1KCUH 2WV3A 4OLZH 3SGEH 5IMKB 1CI5A 4NQSA 1OB1B 2CLVB 1XF5B 4NHUA 2VLKE 1EERB 3V8OA 1QSEA 3MNVB 5FF6B 1QOKA 3L6FB 5CKGA 2LU4A 4HF5H 3O41B 4JQXC 3V2AR 4DZ8A 5SWQA 1AH1A 1ONQA 3VH8G 2FX9L 1Q0XH 4KJYB 3QHTC 4O2EB 5E8OA 5C0CA 2GAZA 1RZJL 4IRSC 3GIZL 2Y25A 1BQHG 3BH9B 4K3JL 5JW5B 1WBYB 5KTEL 5IESH 4KROB 5HVHC 2B1AH 3V7AE 3S98A 1I1YB 1WFTA 4P5TB 5DJ6A 3CFEA 2AEWA 4J3SA 3MCKA 1YMMB 1VGKB 3D2UA 4ETQA 3WIIL 3F65A 1FNSL 1RHHA 4D8PB 4JFDB 3D85B 3SKMB 1D5MA 3PE9A 4L3EE 2X05A 1RUKL 2P8PA 3QNZB 4MX7B 2O5ZL 1MHCB 4XRCA 1IAMA 5E6ID 1V5JA 5HGDB 1QEWA 3LDBC 3MJ6A 3RY6C 5J12B 4K8RC 4OZGF 2FYYB 3U0PA 4RAUA 4U1HB 2A6IB 3UJJL 2R0ZH 4Z7WF 1AXIB 3LPWA 3MRGA 1VB9A 4KXZH 4DZBA 1ZVSB 3HNTH 4AY0A 3ULUE 1VFMA 4XPTH 4XCCL 4LQFH 3MSPA 5E1HB 5AG8A 1FVCB 3MRKB 4M1DL 4HKXA 2DTML 3PL6B 2VZ3A 3KPSA 1CFSB 4BZ2H 5F96L 5MENA 2WWKO 3FQXA 4U1IB 5GIRB 2AXGA 4OCSL 4RNRA 2AVGA 2BOBB 4PJBF 5FCUH 5M7QA 1KV3A 4J1UA 4Z95L 3OL2A 2YD3A 4F3FB 1MUJA 5I9QC 2WINA 5IBUB 5GZNC 4Z76B 4LIQH 3UTOA 1HIML 3CNKA 3MRFA 4H0HB 3A6BH 2KBGA 4PB9L 4DWHA 1UADC 1A7BA 1KENH 1J7VR 2OL3B 3VFTA 1JYWA 1IM3B 5EZLA 2P45B 2C3GA 2GKIA 3GIVA 1MELA 4FFYL 3B4NA 4IRSD 1L7TL 1DP0A 1KPRA 4N9OB 3QJFB 3WO3B 1W0WA 3EYFA 1MREH 1K4DA 2DQFA 2H6PA 4QO1A 2GQHA 3RWDA 4MQ7A 4Z0XB 4WUKL 4PRPB 5K9KA 3IU3A 3IETA 4YJZL 4NZUL 4P2QD 2QR0A 4JREB 3TIEB 4JDVB 2ZUVA 1ZT4A 3WFHB 5ID1B 3ULUF 3VFNA 2ZCKL 1ZSDB 2UUDK 2VXUL 5DJ0A 1RURH 2AJ3B 4WUUE 4KJPD 1JE6A 3FCTB 1UACH 3ZKMC 1S7TB 2FX7L 2WUCH 2YMXL 3Q6GL 2VDKH 2DMCA 4K3EL 1U91B 2VLRB 4O00A 2BSSA 1YNKH 2EKJA 1RJZA 2E7HA 2G5RA 3R1GH 4K9EH 1N0XH 3BZ4A 3WJJC 5IHUL 2GHWB 5KVEL 1C7TA 4O58L 4Z7NE 1H9VA 2BVPB 3O4LA 2JIXB 3W0WA 1SBSL 3B3IA 1I75A 4EKXA 2WBKA 1FE8L 1UZ6E 3A6OA 1AGFB 2P5WE 2NY0B 3GMRB 4NQTA 3VRJB 1F02I 2R4SL 3EYVB 3EYUH 4XWGH 3MV9B 3VXMB 3DLQR 3QIBB 4JHWH 3V4UL 3WE6B 5IFJB 4DUWA 2A6DB 2Z31D 5IROA 1FRGL 5HJ3B 4QY8B 1R3IH 3QYCA 5JR1H 5CEXA 1RJYB 3ZYIA 2ITDB 3V95A 4RX4D 3X3FH 4WV1C 2NQCA 3DGGB 4MAYB 1FG2B 2BFVL 1UB6B 5DK3A 1NC2B 4Y4FB 3L5HA 5C0RH 2ZSVA 2Q76B 1FN4A 1ZLWK 1LWRA 4YX2H 3BN3B 3ZYZA 1E4XL 2I60H 5GSRB 2BNQE 4C54A 1NMBL 1R3KB 2VR4A 1HHGA 1R3JA 3QWOA 5JZ7D 3BJ91 4K94C 1KLGB 4MQTB 5D2LB 4L8CB 1M7DB 2NY2C 4Z7NF 4G5ZL 5HDOA 3CLFL 4F7EA 4OCXH 2N7BA 3ROLA 3WNMA 4OIIH 2I9TB 3SPVB 4N5UA 5I0DA 1UZ6F 3IU4L 2IH3B 2HAZA 5J6GA 3TZVC 4HMCA 2ENSA 4MD5A 2EIDA 3MYJB 3BFOA 1ZANH 1WAAE 3JZ7A 3RWHA 3ZKMD 3ULVL 3MNZA 4NO0B 4HG4K 1EPFA 2CJUH 3HTLX 4Z78B 5HDQL 1ZA3B 5IMMB 4JO4H 3CXHK 4X7SL 3HG1D 3KAAA 2HT3D 2YEZA 3SJVD 3GSQA 4MA7H 3RWJB 1FFRA 3ES6B 2ARJA 4Z0BH 5GGRY 5LGKA 5ESQA 3QIWD 5F93C 1ERNA 2DQDH 1RY7B 4HUWB 3BP4B 4M93C 3VGBA 1QRKA 15C8H 4GG8A 1K4CA 2BRRH 4CU8A 2WWMC 5IGXL 3P4MA 3O2DH 4HJJH 1YNLL 3WS3B 4P9ML 3NZHH 5KSVB 2LV4A 3FO0L 2RR3A 3EOYG 4ZAKC 3FTGA 1F4XL 1ZTXL 1TQBC 1MWAB 4J3WA 2OXHA 2QSVA 4FXLA 2DYPA 1YQ2A 3ARGB 4MSWB 2IPKB 5GRVL 3WS6C 2YWZA 4XNXH 5F7LB 4NZTL 1ZGLP 1URLA 2XY2A 3FT3A 4ALAL 3OMZA 4XPBL 1G9NL 2AI0H 2DWEA 3K4AA 1AJ7H 1UB5B 1HHJB 5C7XL 3FAWA 1QO3B 1PYWA 1U8JA 4XGZB 4F7PB 1OWRM 4Y2DB 1KTDB 1DEEA 2QQNH 1IAOB 2ZUYA 5CUSH 5F1SA 5L6YL 3LKRA 4G9FE 1RD6A 4Y4HC 2R0LL 4ZFZA 5EZOH 3KDMB 1F8TL 5C07E 1I1AB 2EE6A 3QRGL 4R90H 3GMMB 1QVOA 4JPIA 2NY2D 3CXHJ 3MXVH 3SY0A 4YHYC 2X89D 3OKEA 4LARH 4UILH 1KLUA 4JRXA 5DWUL 4XMLL 4OB5L 1MLCA 3QDMA 3IKKA 4K3GA 3X13B 4DOHB 3C87A 4NNPL 2QTEA 2VABA 4UV7H 5EO0B 5FV2A 1Q9OB 2AXFA 1BLNA 4XCNA 3DSNA 5IOPB 2OQJA 4PJ8C 3V6FA 1ETZB 3MOBH 5IB1A 4Z77B 5CGTA 1XIWC 2Q86A 1L4IA 2EDEA 1NANI 1XR8B 2LFGA 1QYGL 2PW2A 2R8SH 4BYHA 1P4IH 3MBXH 4MAUL 2H1PH 1WC7A 3RIAK 4OCMC 4HIIB 1MFNA 2BVQB 2ZOLA 5IVXA 4LLWB 3ET9F 4XZUB 3LSOB 2IAND 3QUYC 4GXUN 4YK4B 4OKVA 3L7EB 4NRYA 1FLTX 5AWNL 3GI8L 4U1NA 2DWDA 3WFDH 4ZUVA 5CZVH 1F90L 3QEHA 5J9PA 1QFPA 2WWMD 1JNNL 4X8JA 3RL1B 5ILTH 1U8IB 3VJ6A 2D7TL 4EVNA 3OF6D 4O5LL 1H0DA 1T7YA 4ZAKD 3E8UH 1CLCA 1IGFL 4OKDA 3HI5L 1TNMA 2B39A 2AQ3A 4JVPA 5C2BH 4P23D 2JELL 1VSCA 1V7NL 1BFTA 1FNHA 2B2XL 1D5XA 2H32A 2FLBT 3L95A 2ZNXA 1N6QL 3P77A 1U3HD 4HT1L 3FQNB 1EAPB 5I1HL 4KKLC 1DN0A 4X5WA 3DVNA 4HULB 2C5DC 2FB4H 4L29A 2D31A 2OL3L 4OZFB 5L8KB 2YD7A 5C0AB 3GSXB 1JV5B 3ARFC 4XX1E 1JMZA 2A9MH 4RISL 4ODHL 3NCJH 3M1BA 5H37H 4J3VA 3GDBA 2GSIB 1WBZB 1MCQA 4HKBB 4KHXH 3KXFD 4AIOA 4NC1E 3WL9A 1R5IA 3REVA 3VG9C 4FTVE 2BNRD 3SDXE 2K7PA 1KB9K 2NTFB 5FYLL 4BQ6A 4J3TA 1AC0A 2LE9A 2NR6D 3IVKA 2IADB 2W0KA 3M45A 1AXTL 1N4XL 1ZLVK 3S35H 1D5ZB 4M3KB 2VYRE 5HYQA 5IJVA 4IRJB 1XIWD 2FD6H 3S37L 1NAKL 5D1QA 4LLVB 1W8OA 1SVCP 1I85A 3CX5J 5LCVL 4EDXA 1FL6A 1ZKAA 3C8HA 1KG0A 2WBJD 3HE6A 4RFNC 3GO1L 4UDUB 1GGUA 5IF0B 1UH3A 4S1SH 1ROWA 3BPCA 1YECL 4MA3B 4PRAA 2J8UE 5F88B 4BKLB 3X17A 3RIAF 4JFOB 3UYRH 5CSGA 3ARWA 3D3VA 1EHLH 4X80L 4QTIL 3UP1A 3WFBL 4L9LC 3E2HB 5DJ2B 5CHNA 3OJMB 2GSGB 5DJAB 3OB0H 3OHXB 3PIQB 1NAMB 1P9MA 4LSPL 3VFUA 3I3DA 5K9QI 1EV2E 3OPZH 1B0RB 2PO6B 4JO1H 3SQOL 4Q9RL 3I9GL 2R2HB 1DQTA 4J3XA 4S0SD 4FABL 2B4CH 3LV3B 4PBXA 4YHZL 3HNSH 4QWWC 4RRPA 3U46B 3U7AA 4NP4H 5JOFB 3QG7L 1U8KB 3FB5B 4D94A 4U1GC 4EDWH 4UDTA 1T1YB 3RKDD 3SDXF 3RHWK 1I1FA 2D3VA 3GSNB 1NFDB 3VMPA 3HE7A 1CICD 3ELAT 4HCRL 1NMAH 3TEUA 3KYMB 2W1NA 1WZ1H 2GTZB 1ADQH 2F58H 3QWRD 5I75C 3LCYA 1A7QH 1Z3GH 1EEYA 3BUYB 4OLVH 3SE9L 3L3OB 4YDKH 5T5NG 4M6NH 5IW1A 3QPXH 2YD9A 2ADJA 2D9QB 4UTAH 4NWUH 4RBPH 4A2LA 2AK4B 3U9PH 3QDGA 3MODH 1CGWA 5D7KE 1G9ML 1LD9A 3NH7H 5DR5H 2ESVA 4UMGA 1YEDB 3GI9H 1I7UA 3M17B 1OGTA 5F70A 1RK0A 5EPMB 2AXHA 3VWKC 2WANA 2F8OA 3B9VA 3CVIH 3N85L 1T1XA 2YK1H 2LU7A 2HN7B 2P47B 2WUBL 3TJEH 4DKFL 4C4KO 1T2QH 4M62H 1HOCB 1MAKA 1U3YA 2BDNL 1JPST 5CIPB 3LS4H 4U2ZA 1ZLUH 3X3GL 3T0XA 1FIEA 4CW1B 1SJXA 4ZQKB 1IBGH 4UBDD 2VSCA 1QFOA 3O8XB 4P4KC 1GOHA 4KK8C 1LP9A 5IBTH 2MCG1 3X14B 4NQEE 4JFEB 1DQLH 1QFHA 1Q72H 3QFJA 4OV5A 4CJ0A 3BIKA 3VXQA 2DJSA 2Y06H 2O5YL 2BVYA 1DQJB 3ETBF 5EUOE 2A9NH 1DBAL 4JO3L 1C8PA 4YUEH 5A2FA 2R2BA 1VHPA 1IM9A 5T1MA 5ESAA 5E7FA 4MYWB 5DHVB 2AJUL 5EBMB 1CN4A 4NNXA 4MZ2A 3P4OB 1CQKA 1MWAL 5A1AA 2XN9A 3EFDL 4TVPD 3LRSA 2M2DA 2FSEB 4ZD3L 4D0CB 2BXYA 5IW3A 4KRNA 4NO2B 1Q1JL 2ZG3A 3RHWF 2VC2L 2VWEC 1KGCE 1TZHA 1FZJA 5F7FA 5D5MA 5DQ9B 4AEHH 3B9KC 2P8MA 1IGML 3GZKA 4WO4A 1R3LA 4AQ1B 3MRNA 4QRPE 2PR4H 3U6RB 1MCRA 5JO5A 3LQZA 2IG2L 3V6BR 4KMQA 2X4SA 4OUOA 5E2WL 4GSDH 4NGHL 4EBQH 1T5XB 1YEGH 2WP3T 5K9OA 5JIKA 4IIQB 5C0JB 2YWYA 4J4PC 4U1SB 3MACH 4PJAB 1KNOA 1IARB 4R4FH 3G6AA 4Z7UB 2Z8VC 3VWKD 2P5EA 3A6CH 2UZYB 3ILPB 5EUOF 4DGIL 3CPLB 1JNHB 4Y16D 4X99A 1WJ3A 4ZO6A 1QFUL 2EXWC 4UT9H 3IJYA 3HRZB 1FNFA 1NGXA 4L4TD 3JXAA 3DRQA 4MS8D 3T4YB 4XP5L 1MY5A 1XGTA 2VLLA 4TVPH 4JDZB 4EI5A 1DBMH 3ZKXC 3CDYA 5IG7B 5MEPA 1OAXL 3R06B 4IMKC 3JV4A 1KIQA 4NRXB 3GMLA 4JFFE 4UB0H 3TBSB 1NGPL 2XPGB 5FO8A 4AJ0A 1S9YA 2MCPL 4OGAC 3JV6B 3S88L 2QJDA 4XP4L 4PJGA 4HFWA 4LHUB 4I48A 3WIFB 4Q0XH 3PHQB 4O02H 3WLWD 5KS9A 3DXAD 4PS4H 1CQYA 2IBGA 5KW9H 4HJGB 4HC1L 4QKXB 3NCEB 4WVRA 5LBSL 3CZFA 5HHME 1FL5B 2KUTA 4HFUH 2Z8SA 1A5FH 4ERSL 1XGQA 2VLKD 1FZOB 2B5IB 4M1GL 3D0LA 1BIIA 4HD9A 4WFEE 3LRGA 3QIUB 4G6FB 3ZDYE 4ACPA 5DMIL 3OKMA 4YPGA 1NFIA 4N0CC 1C1EL 2EIBA 2EYSB 5I19L 4AK1A 2IAMB 4EN3D 5TH2A 3P73B 1TCMA 1NCAH 4NFBA 1MHHA 4P2CG 5ICXB 4I0PB 4O9HH 2YBRA 4FG6C 4ZTPL 4J4PD 4EXPX 1MVUB 4G43B 5JMOC 3QUZA 3GJFA 5C09B 4XXDA 1RIVL 1KCRH 3OKLB 3KYOB 1LO0L 4H88H 5I16B 5D9SA 4TSBL 4HPYH 1JWSA 1T5WB 4L3ED 4Y2OA 5DO2C 5HGBB 4MCYB 1AE6H 4KKBC 5GGRA 2EXWD 4NN5C 4OM1L 2RFXB 3VI4F 4I2XB 1N8ZB 1AD9B 3U9UA 1ZT7A 2QQKL 1C5BH 3WUZA 1VFAB 1YY8A 4FQXA 4G6MH 4PRNB 2B20A 3DUSA 5MP6L 2XOTA 1IFHL 2UWEB 3FB6B 3ULUD 4QF1B 3O2WH 4H1LA 4P2YA 4WEBH 1QSFE 2DQCH 3HPJB 4IMLB 3LKSA 3V0VB 1NAML 4HHAA 1IQWH 1HQRB 4JQIH 4P5MB 4LRNH 1NGQH 2AAVA 3ZDYF 3FO1A 1KN2L 2V9TA 4QGYA 4YQXH 5L9DH 3W82A 4OGAD 4PG2A 3HA0A 3FQUB 1N7ML 4QTHB 3C09B 5D2NA 2CO7B 3O0RH 4ELKA 4PJEA 1NC4B 2COQA 5SWZB 2YPLA 4XP9H 2G9HB 5DRNA 3RVWC 1Q9KA 4LF3B 5GGTH 3E0GA 4UINH 3QUXB 4KC3B 1EHXA 4TUKL 3U83A 2DQHL 4BQCA 5I71C 2A73A 3KPPA 1U8OA 4QHNB 4UOJA 3WO4B 3P11L 4YHNA 2E9IA 2PXYA 2VLRE 3AREB 5EU6D 3VA6A 2HKFL 4HX1A 3GSVA 4Q9QL 3KLDA 1E4WL 1T0MB 1XEDA 1KC5H 2W65A 3CDCA 5HGAA 1LNUB 1OP3K 3PNWA 1F3JA 5EN2B 3MXWL 4XMPL 2AXJA 3TYGH 4U3CA 4KHTH 5EWIH 4NKIL 1HE7A 3STLA 1CFVL 5SX4H 3ULUH 1CDJA 5GGVH 2R23A 4U1LB 2CIIA 1YYML 5ADOH 5KSAB 2H3NB 1FHGA 5T3ZD 1E4XI 4QT5B 5DO2D 4P5KA 2CK0H 2SEBB 2ITCB 1ZHKA 1G0XA 5DA4A 4KKBD 3U0TA 2BSRA 1HKLL 3L7FA 3U7WL 4JDTL 1BQSA 3GMOB 3MGOA 1MQKH 4RFEB 3LEXA 3LQAH 1DQMH 1E6OH 4JN1H 1IQDB 4QRRB 5I74C 2EDFA 2Z8WC 3OX8B 2MWCA 5DVMA 1VFBB 3CFJA 5KS9E 4OZHE 3C60A 5L8JB 5ICYA 4PJHB 3JWDL 3UYPA 2P5WD 2V5SA 1Y6MR 4E5XB 1A9BB 3GJFK 1M6OB 1QSED 4JG1L 1CVRA 1X7QB 3VXNB 3CCHA 5CEZE 4GKZB 3QCVH 5D2LE 3RFZC 2VXTL 1KIUA 4AZ8A 3D69A 2RHEA 1OD7A 2DQUL 3NBNA 4KQ4L 4NQDB 3RVWD 5IB4B 1YN6A 3L3GB 4NCC1 8FABB 2IEPA 4TUOA 3MOAH 4M7LL 1Y6NR 2I27N 2VIRA 1CLYH 4M5ZH 4NQXB 2A74A 5KOMC 3RQ3A 1RZIA 2A6JB 4NUJB 5T3ZH 2BVOA 1X5LA 3PWJA 1HN1A 1FV1B 3U1SL 3Q5OA 1BAFL 4LKCB 2WWKT 4WW1A 5T33H 3FB7B 2VUYA 3H9SA 2VDOL 1TXKA 5F3HA 3VFWA 5LGJB 2A0LC 1BP3B 4MLSA 5IVNA 4C83B 1RUAL 1J8HB 1QBML 3KPRB 5ID0B 2XG5A 2YPKB 3MV8A 1KIPB 5KS9F 4OZHF 4ZYKA 4OM0H 1MFBL 2Y5TA 2GJJA 4F2MB 4KVNL 1EO5A 3QSKB 3V7AG 5BQ7B 1HYSC 3QH3B 4PJXB 2UUDH 1FBIH 1JWUA 2CLZB 3HB3D 1T3FB 2OJEA 4NYLB 1BD2A 4ODXA 1V3LA 1BOGA 4RIRB 3PWVB 1I3VA 3PWLA 4WI9A 5B38A 2ZOKA 2EEDA 4YHML 4QRSA 3MZTA 1EUTA 2R9HD 2PKDA 3BP6A 3D18B 3DX7A 3KPSD 4C56B 5MEND 1RIHH 4G3YL 2DDQH 4C55A 1ZXQA 2DM3A 4V1DA 5FYKU 3U82B 5IB5B 1IC1A 1K2DA 2CH8A 4EEEA 4J3UA 4L5FL 3VD4A 4ZUSB 5F9OH 5EC2B 4G6KL 4UQ2A 5IROC 3G5VB 4LKXA 1J88A 4RWYH 5SWSB 4LSQL 5F3BB 4U6HA 1BX2A 4M7JH 3ZSSA 5HHXH 3TM6A 4O4YH 4LQ1A 1WZKA 4YWGL 2Y9RT 2WAHA 3VI3E 1WZMA 4KGLA 1E27B 3F7RA 1KN4H 3JWNC 3CMOL 5CJ8A 3FRPA 5JHLL 3I75A 3RVXD 3TN0D 1AGBB 2ZZUT 4DKDC 1HWGB 2UV3A 4DOHE 2NY5C 4OAWB 1TENA 1HILA 4OUUA 5E2UH 3TBTA 3IXAB 1EGJA 5I15H 4NJ9L 3QNYA 4OGYH 3FOLB 4KY1H 1B4JL 1J1XL 2W60A 1YJDL 4HUVA 3SDAB 3WHE1 1FVDA 3C9NB 4M7ZB 2PYEA 1R5WB 5D7LB 4PJFB 4R97B 4G9FD 1MFEH 1F00I 3IDGB 5E8EB 4ZUWA 5FYJE 1BBDL 43CAA 4D3CL 4NCDA 1FFNB 4ZOCA 4HGMA 4OZIB 5I8CA 3NCYP 5C07D 1ULVA 5D1ZD 1CZ8H 1HHKA 3VFMA 3VH8B 4HH8A 2A0LD 5JNYA 5DRWA 5LVEA 5E8PA 3T8XA 3AU1A 4IDLA 3CGTA 5GQBA 4P4RB 5H35B 1JPTL 1PQZA 5DI8B 4LLDB 4JFPA 3ALXA 4NN6C 1P2CB 1D5IH 1BQLL 3KPTA 4PJEF 4PRIA 1QNZH 3B6SB 1SJHA 3O4LD 1CF8L 2NXZB 3DPBA 5ETUA 3W0WD 1BGXL 3S4SG 3HC4H 4U0RB 2E6QA 5K93A 5C0NC 3VI3F 5A16A 1H3XA 5MHSE 2DQTL 1CXFA 5F7EH 2VNCA 2B7DT 3K2MC 3NACH 1NCDL 2BP3A 2VLME 3MRCB 5DJYB 2PTVA 4I5BA 1GGBL 2DLHA 2AJYL 3QB7C 5HYSA 4MJ6B 4HS8H 4NNYA 1KCVL 4DN4L 5C0AE 4CDHA 5FKPA 4M6AA 4EIZC 1YEIH 3O3EA 4HBQA 3DUUB 1FNEA 5FHBH 5FM5O 1M05B 5SV3A 3UZVB 5GRYA 1H3WM 2GYSA 4EUPH 5BZDA 2DI8A 3QXWA 1NKRA 1J1OL 1FAKT 2YD5A 2C1OB 1JK8A 5D7IB 2FNBA 4WI6A 1D9KB 3NPSC 2FO4B 2DICA 5L2JB 4KTDH 2KPNA 5MEOB 5EU4A 3STZB 4QYOA 2DKMA 2CKBH 1Q8MA 2OTPA 4LASH 5HI4D 2UY7A 5ENWA 2J7LA 3QEQB 1PG7W 5C0EA 1UKQA 4ENED 5EU7C 1JYVA 1INDH 1JCKA 3IXTA 1JPGB 3TBVB 4MJ5A 1A4JA 1F3RB 5HDBF 3ARBB 2DTSA 4QHUB 4XC1H 2YKLL 1KXVC 1KLFA 4UZGA 1CYGA 2ZCHH 1P6AB 4HDIA 3E3QC 3SGDH 2DLFL 1VADB 3L3HA 3I6KA 3ZE0E 4X4YB 4ODTH 2Z4QB 3MA9L 2EYRA 2FATL 5J4MA 5DC4B 1UJ3A 5HYJB 1XZ0A 3D39A 1A7RH 3MGTB 4DQOL 3FQWA 4HXAL 4Z7VA 3QUMH 3GM0A 4O2FA 5C0ND 1MF2L 2IQ9H 4WGWB 3P40A 3ARRA 1HSBB 3F6IA 2HJLA 4IOSD 4AMKL 2GJ6A 4P46A 3HLAA 5A2KH 3ECBB 1UM6L 5FK9B 4OQ1A