2EE9A

Solution structure of the 16th filamin domain from human filamin-b
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
95
structure length
95
Chain Sequence
b'GSSGSSGVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filamin-B
publication title Solution structure of the 16th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 4
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ee9A00
1AC0A 2V7HA 3GKZA 3UBXI 3C5JA 4NZTL 3TVMB 3MA9H 1FNEB 1MRFH 5E7BA 2OTPA 1QPPA 4U1KB 1OF2A 1S9WA 1P7QA 3EO1B 4AENB 5HHPA 4OCXH 1KF9B 1HYSC 1F3DH 1U3HD 3MODL 1CZ8H 5DC0A 2BNQB 3TPUB 1MCJA 4P57B 1CK0H 3H9ZA 2CIIA 1FSKC 1VGKB 5ADOH 4WTWA 4CVUA 4P2QE 3LKPB 5HYFA 5D6DC 1YEFL 5E8DL 5DK2B 3GHEH 1MIEH 2UWEA 4KQ3H 1CXEA 3V6ZB 4MA3A 4XP1H 2GTZA 5DDHB 3ET9F 1S9YA 3BPNB 1FBIH 2DQEL 3EYVB 4WTZG 3UZVB 1GL4B 4WENB 4F8QA 3U36B 4OZGA 1BFVL 4FMKA 1E27B 3NCMA 2BVOA 3RVUD 4QTHA 1GRWA 2FCBA 5FV2A 1NH6A 3MZTA 1QR4A 4AIZB 3HPLB 1TJHH 1RZGB 5CMAA 3L3GA 1QHPA 4YK4B 4HUWB 1YMHA 1KTKE 4M5YH 4NQVB 4WVRA 1WC7A 5CKGA 1OD9A 2ZCKH 3FQNB 3S4SG 4P2OD 4R8WL 1GAFH 3QIWD 5HYJD 2QBWA 1WZ1H 2ERJC 3B8SA 3KHQA 4Y4FD 3P40A 4DTGH 1MLBB 3EYSH 4NOFA 1T22B 4N0FB 3CK0L 1FZKA 3C8KB 3G5VB 5T1KD 2UWEF 4HWUA 4IDJL 4NRZB 4X6CA 2R1XB 2PYEA 2YA2A 1FNLA 4UV4L 1I7TA 4HK3N 3IYLW 3T1FA 2FIKA 3QBTB 1LO5A 2PCPB 3U4BH 1I3GL 3MNWA 3AS1A 4WUKL 1PW3A 4OZGF 3QJFB 1OT2A 2VLRE 3EYOA 4H88L 5DJAA 4XWGL 4DVRH 3RVVC 1TENA 1E4JA 4LSTH 2LVEA 3C2SA 2HFGL 1M71A 4JCLA 2VC2H 4DOHB 5FHBL 5GGRY 3V5HA 5T3ZH 1H3UA 1ZS8B 4IRSB 1IEAB 3KNBA 1OTTC 2XWTA 1J5OH 3MOBH 1QEWB 1JL8A 5C09B 1OP9A 2IALB 3AXLB 3ARDB 2A74A 4F58H 5I75B 1RFDL 4NRXA 2E9JA 3L9RA 1G9ML 3LKNA 2OR9L 1KPRA 2DLFH 2C3XA 4X6CF 4YGVA 1NQBA 2BX5A 5CSZB 4XPBH 1DQTA 5FKAA 3QXVA 5DZOA 1RK1A 3SDCD 5EO1B 2ADJB 5DWUH 3OKMA 5KSAB 3KG5A 1YUHB 3H42H 1JNNH 4F15C 3WHE0 3MTRA 4LFHG 4XBPA 2FYYB 3N1QC 2OYPA 3VXUE 3BP6A 1NCWL 4F7EA 1JPGB 3OKLB 1G6RH 1ND0B 3ZTJG 4HJGB 3LS4H 4I3RH 4ELKA 4AEEA 1A1MA 2GYSA 4V1DB 3RDTC 4P2CG 2AEQL 2MKLC 5T3XE 3LN4A 4U1MB 5DD5H 2N1KA 5GIRB 3ZTJH 4Z7VA 3IXTA 1TQCC 4JFPA 3I6KB 5I18L 2R23B 4LOUC 2P8PB 2CKBA 4ZFFB 3O6LH 2R4SL 4AMKL 3EFFA 4PS4H 3ZMRA 1IC7L 1QYGH 4R4ND 2VWEE 1H5BC 3HA0A 3P73B 4NKMA 5FYJH 1DVFD 2WBKA 3F7YA 1BLNB 4MX7A 1OTSD 3MLZL 4HUXA 4PJFB 5L9DL 4X4ME 5EOCL 4MD5B 4X5WB 3QUZC 2OZ4A 3ELAT 2YN3A 5DEGB 4KH2A 2BVEA 3MJ9H 3SDAB 1YYML 2HH0L 1GZPB 4F9PA 1CICA 5GISL 5TE6L 1ZGLB 1OAQH 4OV5B 5GHWH 1QUNA 4ZQKB 4Y5YC 4TTDD 3GMMB 4GXUM 3MV9A 1Q0XH 2JCCE 4N0YL 5BJTA 3GMNA 5CIPB 4QWWC 3NFNB 1IC5L 4Y19E 1EO8H 4WI5A 1N8ZA 5F6IB 4OCLC 1OAXH 1VADA 4ALAL 2R39A 3VU2A 1NCDL 4Z7VF 3V6FA 4HIEA 3NACL 2IAMC 2N7BA 3HC4H 5FGRA 3P77B 2J88H 3NABL 1P84J 2KKQA 4Z77A 2XZCL 1AQKL 2UYLB 3BZFA 3QH3A 5HDQH 2XIDA 4UBDD 2B0SL 3E2HC 2BVQB 1N6QL 3QUKA 3O3DB 1T1WB 3EOBB 4NRYB 2DD8L 2G5BA 4L5FL 4PRHA 4EZMA 3G08A 3FOMB 1S78C 2DQJH 5ABDE 4OLVL 4Z0XB 2HN7B 2HLAB 4N8VB 4L3EE 4HLJA 4GMSH 1QRKA 4LSRL 1VERA 3RIAK 4NP4L 1UYWL 1IZJA 3OGCB 4KDWA 2APWA 3FT3A 3S36H 5EBGA 2I9TB 2IPUK 4OGYL 3VWJD 5J1AA 1NGZB 1BIIA 5B39G 3A67L 4I77L 3OKDA 3KPNA 4HCRH 4ZXBD 4HPYL 4GAGL 1XFPA 1RJZA 3V5DA 4CU8A 4HG4K 2Y7QB 5F1IB 3FOLB 5CEYA 5BQ7B 6CGTA 4EDXA 4GLRI 3HKFA 5KG9B 5D6CA 3LMJH 1S9VA 1ULVA 2EDKA 4GRLA 4EI5A 2X4OB 2FO4A 3AY4A 4ZODA 4HPOL 2CGRH 2Q76A 4RCAA 1EK3A 2J1KA 3DV4B 4PLOB 5J9PA 3DUSA 2FD6H 5BW7A 2HT3D 2VDMH 1OP3H 3SDYL 4HZLA 3TN0A 5K9KB 5C08D 5KVMC 2ZPKH 3QEUA 2XTJD 2H32B 2HJFA 5FDWB 1FPTL 3U46B 4DQOH 4PPTA 5T3ZE 2IBZY 2Q8AL 3O6MH 3M07A 2PXYD 5JPMA 4P9HH 2XQBH 5EBWA 3DHJA 4M03A 1ETZA 4JRYE 2M26A 5EIVA 3DYPA 1OAYH 2EDTA 4HFUL 2I25N 2VZ3A 4M6NL 5DS8B 2VLLB 3O2DH 2X1PA 3SDDA 3THMH 5JIIA 5A16A 1B0WA 1FLRL 3BSZL 3D85A 3W81A 4PJBB 4HGWA 2LU4A 2NY6D 1BP3B 3MSPA 5EZJA 4N90E 3ZE1F 5HHXH 1F3DJ 4H5SA 5CJ5A 4JPIB 2IG2H 4YDLB 3OX8B 2NXYC 4EUPG 4ZFGL 1SY6L 3JV6A 1DEDA 4N0CD 4QY8A 1LGVA 4OBSA 5LQBH 1BQSA 3MRIB 1MNUH 4FTVA 2PO6B 5EBLA 3WKNA 3BRDA 3MLVL 1UA6L 1NCBH 4TULL 1DBBL 1J8HE 4PTUA 1U91A 4M1DL 3KYKH 3C6LB 5FIEA 4P5TA 2R29L 4PG9B 4EUPH 3GSOA 4MJIE 3DYOA 3FN3A 1NCAL 1ZLSH 5ITBL 1YEEL 3WHE1 3S35L 5GRVK 1MCQA 3P3YA 2D4FA 3WIHA 5I0DA 1IGTA 1FVCB 1BBDL 5DQDH 5HHMB 1MJ8L 3WDHA 4P4KB 5DD6B 2H2PC 4HDIB 3VFUA 5D7JD 1PJ9A 4GQPH 3IAQA 3N0PB 4NNPH 2VWEC 2EDQA 2FX7L 3BDYL 3QULB 5MENE 1A6TB 1RUPL 4RFEA 4JKPL 3MRFA 5FYJE 3AUVA 4HIIA 2XWBA 43CAB 3QB7C 3VGGA 3P4MB 3M17B 4LDEB 1PGRB 4WUUA 3QUXD 1C5DB 3O3BA 1TXKA 1A6ZA 3SOBL 2HYMA 2BRRL 2R9HD 2X4QA 1CXIA 2BHZA 3NFPA 3ARBC 1QRNA 4JJ5A 2HKHL 4GKNA 4M8QA 2IF7A 5SX4I 3KPMB 5J12C 1KOAA 2NQCA 5E2UL 2HTLC 1T20A 2APTA 4RFNC 1JWSA 1N6VA 3UX9B 1A1NA 3P11H 2EDJA 2AJUL 4YBQC 4UI2A 5D8JH 4L8BA 3MRKB 4OZFB 1S7SA 1ACYL 3DSNA 4JO3L 1U8HB 4WW1B 2R56L 2H3NA 3HNVH 1MIMH 4H0HB 3OPZH 1CLCA 2Y07L 5IVZB 2DQFB 4NQUA 5D93B 1UZ6F 1MJUL 3VXPB 5C3LD 3RWEA 1LP9A 2ZSWB 1J05A 3OKEB 4PJHE 3ALXA 3TZVB 1OP5K 2NY4D 4G9FA 2ICWJ 3D39E 5F7DB 2LE9A 4LNVA 3WFDH 1DUZB 3T0EB 3BWAB 4PJDA 1X4YA 4TSCL 4YZFF 4Z95L 3RWJA 1IGML 4XI5C 3NIFF 2RFXB 4N0UB 5C0CA 1XCTA 2A83B 4OCRL 1NC4D 3IJHB 4LCCA 2VR5A 3ARGB 5KVDL 2A77H 1QD0A 2V5RA 4PJ9C 4QRUA 5F9AC 1N0LA 3C60C 4NKDB 5EOTB 1BD2B 1YDPB 1R24A 3L5JA 2G9HA 4FS0A 2AABH 4ODVL 1PZ5B 3BT2L 4KRLB 1LO3L 4G8GD 4KRPD 2PTTB 3WLWD 4ZDHA 2IBZX 5DRWB 3BJLA 4JVPA 4LF3B 1KENH 2EYSA 2FECL 1B0GA 3BP4A 4KHXL 1LNUA 1N4XL 4G42A 1OCWL 1QBLH 2VO5A 4KUCF 4WY7L 1J86A 3HCVB 4XNZC 4BJLA 4MNQA 5D1QD 4YXHH 1KC5H 1LP9F 3GJFB 4ODHH 1A21A 1N5AB 1N59A 4J1UA 1YZZA 2C7UB 4OUUA 2SEBA 3L95A 5EZLA 5AUMB 3RTQD 4PJDF 4O51B 4LSSL 4HUKB 5CEXB 1IQDA 1A4JB 1QHOA 4FQ1H 5HHOA 1CGSL 1VFMA 3Q1SH 1UB5B 1OAKH 2X89A 3GSUA 3IS1X 3MJ8B 5IW1A 5DD0L 1FZJA 4L9DA 1ZOXA 2H2SC 3GSRA 1CFTA 1N7ML 4PY8J 3W9EB 5HYQA 1AGCB 2X4SB 3DI3B 5HYJE 2XKUA 5EU7E 3UBXB 3ULUD 1NCTA 4PYGA 3UTPE 1KYOK 4Y16C 3UTOA 3F5WA 1HSAB 4HV8B 1TVHA 2L4OA 4NQDB 5BZDB 3QRGL 4RAUB 3VXMA 3V6OA 2ADFL 3BKML 3BP7A 4PJ8D 5HJ3B 1OGAD 4JZJC 5M94B 2VABA 3TO4A 4Y1AD 1YJDH 5GSVA 4Z6AT 2DRUA 1F4HA 2XV6B 4NDMB 4U7KA 4K3EH 1K4CA 4NN5B 1NSNH 5SX5K 2AV7A 3REWA 2R0LH 3QR2A 5I30L 3N50A 2F8XC 4CUCA 4MNGE 4GBXD 2W9LA 4HIJA 4CU6A 1EJOL 2XZZA 5KS9E 2AJXL 5HPMA 5LGKA 1U8NA 3O4OC 5FO7B 4IBLT 3REVB 1PAMA 4ZAKC 1AI1H 1H15B 3CSYB 4IHOA 4XHJD 2OM5A 1EFXB 1F6AB 4XCEA 3HI6H 2AJ3B 1RUML 2X1QA 5LAXB 5D2NB 1IE5A 3WFCH 2IPKB 4RNRA 5GRXG 4AH2B 1MY5A 1HHGB 4WCYL 1D9KD 3RWDA 2EIZB 1E4WL 5HGDA 5EU3A 5FCUL 5DHYB 3RWFA 1BQLL 2Q6WA 1LE9A 4R96B 1YMMB 2BNRB 4WGVB 4PRID 4ZTOH 3V4UH 1PKQB 1N5YL 3KPOB 4OD1H 3OJ2C 1A64A 1TQBB 1CL7H 1FV1B 5CJXA 3MPCA 4XNMA 4ZFZA 1RURL 4M4PA 3TT3H 5F1SA 3H3KA 1UKSA 5CILH 1N3NA 2CDFB 3PWLB 3K7UA 4FRWA 4KTEH 3S37X 3K74B 1INEH 3V8CA 1WWWX 4Z5RA 1UEMA 3FQWA 2VZTA 2ATKB 4Z0BL 1IEBA 2FJGA 2QEJA 5E1HB 4MAUH 5INCA 5LXGL 1V7ML 4U6XB 5IQ7L 4NO2A 1RZ8B 2FJHB 1IM9D 3DUHA 1U3HC 5EN2A 2F54D 2WBJB 4IOIA 3OQ3B 5DYOB 1GYAA 4LCWD 4JB9L 3GI8H 5DQ9B 4G6AD 3DO7B 3QUYC 4ERSL 1WAAE 4MNHB 5IBTH 4H1LB 1I8LA 5EO0B 4X7FC 4UQ2B 2Z8WC 2P5ED 1CQYA 2R15A 3P4NB 4E41A 2P44B 5I74B 2IGFH 4LPUA 3TCXA 3GUTA 5B8CC 1AO7D 4L4JA 2V9TA 3VXSD 4OGAD 2QJDA 2W9EH 4P46C 1KT2B 3WN5B 3CCHB 1U6AL 2MCPL 5C6TL 4X9IA 3D0LA 4I5BB 3U0PA 1A6UL 3VXRA 3NOIA 4JFED 3EZ8A 2BY1A 1U8IA 3BPLB 3RVUC 1BX2B 2K3TA 5FF6B 3VXQB 2AJVL 3RWIB 3ZHDA 4V2BA 4P9HC 3RJQB 4UTAH 4NNYB 3S9DB 5C0AD 3DX6B 1KJ3L 1MUJA 1SQ2N 4X80L 1YN7A 4FQLH 4RQQB 1RIVH 3B43A 2YD3A 5JIHA 1DBML 3TYGL 4P2OC 1KEML 4M7LH 3QIWC 3PNWB 4NN7C 3L6FA 1BQHG 1W0VB 3ZTNH 3IB4A 1FQ9C 1KJVA 1R3LA 5K9QI 4M6AA 5EU7C 3L3JA 4Y4FC 1S9XB 1MFBH 5C0ND 1NCNA 1XH3B 5C9JA 5D7SH 1K4DA 5IQ9B 5C0EB 4GRWF 4APQB 3OZ9L 2IPTH 4PG2A 4WV1B 1FVDB 3IKCB 3WNOA 5I16B 1T03H 4H8WL 5BXFB 1BBJB 4ODUB 1NC2A 1AD0B 3P9MA 3HZYA 1AGFB 4HJ0D 5JORA 2HVJA 2ZSVA 2H8PA 4C4KT 3EZJB 3MRJB 4ZFOB 1A7PH 5TFSH 3GO1H 2CK0H 5I8EB 3DRQB 5IR1B 4PJIE 5MEPB 3QEHB 3QO0A 5ISZB 2R0KH 4HULB 3O6FD 1DANT 1CU4L 2R2HA 4ODTH 1CIUA 5D7LA 5FKPB 3UTTB 5I8OL 5GGTL 3ZYJA 4K9EH 1IC4L 4IMKC 4JPWL 5F88B 5DRXB 3BESR 5HY9A 3O4LA 3ZYIA 2CMRL 3IJYA 1RUAH 5DMKB 1F13A 1VFOA 3FHAA 3ZDZF 5I1GH 1P9MA 4K8RL 1PY4A 5GQBA 1T1ZA 2J8UE 2GFBA 3HE6A 4LLWB 4E42A 2DF3A 4PY7B 3AU1A 2B1AL 5E0QA 3W0WB 1HN1A 4S0SD 3V4VH 1ZEAL 5C92A 3MRHA 5H35B 5CBEA 2DLTA 4EQ2A 2AXGB 3ROLB 2CR3A 1SY6A 3HNSL 2V9RA 4P59H 3T0XA 1ODAA 3HG1B 1ZA3A 4X6BA 2EDNA 2NW3B 3EFDL 4QRPD 2VZSA 2R4RH 4QYOB 3A6CH 3LD8C 4LRIC 3ZKSD 4X8JA 1KN4L 4GRMA 1U8OA 1T3FB 1W72H 2ESVE 4D9RD 3QFJA 4I0CC 4ELME 3MLRH 3WSQL 2BZDA 3BEWB 2I60H 1PX4A 1UACL 1JGUL 4XC3H 1MCEA 3TVMA 4WFHD 1MJ7H 4NQXB 1CBVH 1FNEA 2C3HA 4YPGB 4R4NC 2MFNA 4EBQL 1PDKA 1BAFL 1V7NL 1DVFC 4PD4J 1DLHA 5LG1A 1OTSC 3ARQA 5IFAH 5CWSA 2BY3A 3TPUA 5ACZA 4NYLB 5T1LB 4JFXA 1HINH 4C56A 1BGXH 1CXHA 2UVFA 1FH5L 3RZCD 3IDGB 2FX8H 4XVSL 3OB0K 1KG0B 3PL6B 4TTDC 5JW4N 2OK0H 1FDLL 3UTSD 4F33B 2BMKB 1GPOL 4WRLA 3D2UB 4HT1H 5IW3A 1RU9H 2AI0L 4TN9A 1L4IA 3VWKB 4XCFL 1MFEH 1NUGA 1UJTA 3SE3A 2F19L 4PJ5E 3QDJA 3G6AB 3KPPA 4YHNA 1DP0A 4LEXL 1ZAGA 4JDZB 1B9ZA 3EO9H 2QQLL 1EHAA 1EVTC 2NY0D 2MPAH 3RY6C 1QZ1A 2VUOA 3C08H 5LVEA 4NZRL 4LRNH 1ITCA 2VRAA 4UBDC 4K07A 2HKFH 5DD1L 5E70A 4KKLD 1Z9MA 4UZGA 4LHJB 1FNSH 4YLQT 5EBMB 2VXVL 3LV3A 4ISVB 4DW2H 5F9OH 5FEBA 5IG7B 5D1ZD 2YMXH 4LU5H 3EYUL 4QCIB 2CRMA 1RJLB 4XPTH 1Q94A 1B90A 3SKJL 2BOCA 4HWNA 4M8VA 3VWJC 7CGTA 4ZXBC 5L88L 4KZDH 5KVFH 5DR5H 3GRWH 4X6DE 5E6ZA 2XWJB 5AWNL 3G6JB 4PB0L 4EVNA 1T5WA 1FAIH 2WINB 2B8OT 1UH4A 5GGSB 3M1BB 4NNXB 1J1PL 1S7VA 2AGJH 4BM7A 1NGPH 1IGYA 4NQTA 4LSPH 2JB6B 2K7PA 1DEEB 3EW3B 2PKDA 3IRPX 1UEYA 4QRRA 3NN8B 4OFKA 2A6DB 1MPAL 3EOAA 5IOPA 4WJ5A 4UT7H 3ZT6A 4RWYL 1RZFL 4G8IB 4LKCA 4UILH 2BERA 1U58B 4GKSB 2ZOKB 3CX5J 1TPXB 1Z5LA 3MO1B 4PJGA 3MRGA 2BP3A 4P5KB 2X2YA 4K23L 3ULVL 3RGVC 1VESA 3CVHH 3VFGH 2PXYC 3BQUB 2WWKT 4XMLL 2FHFA 2BNQD 4NJAH 5KOMC 2V2TB 1XIWB 1U93B 3WNNA 1BVKB 4RWHA 5SWZB 3ZKNC 1G7JA 1AR2A 1RAMA 1R6VA 5F97E 5JOFA 4P3CH 2YUZA 4BFEA 43C9B 3JWDL 3KR3L 2DLEA 1ZKAA 4I18B 5HVWA 1A7RH 1G1YA 4UT9L 4LVOB 2NY6C 2DTMH 4ZS6C 1H3PL 2YBRA 5D71L 3SJVB 1A7NH 2WUBH 3V7MA 5I1EL 1NGYB 5E56A 1Q9KB 3H3PH 3GSQB 4Q74A 5C0GA 2ADJA 4N0CC 4X6EB 5FA4B 1G6VK 1OB1A 4O02H 4FXKA 1D6EA 1OGAE 3SY0B 2F58H 1JIBA 1X4ZA 4WI2A 3QNZB 4GO6B 3R8QA 4Y1AE 5I19H 1FL3B 1JYVA 3LN5B 1ND0A 3LH2L 3CFKB 3GM8A 4PJGF 3EBAA 2VXSH 5C0RL 4NC0B 3QDHA 5C0BD 1QSVA 3HHRB 2DMBA 4BH8A 3PWJA 5IJVB 5HVHC 4YQXL 1IT9L 3DWTA 3EYFA 2NZIA 1MAML 4LHUB 4UIKL 1FZOB 4CL7A 4NHUB 2Y6SD 1WBYA 1A5FH 4XB8A 1I1RA 4MA1B 3I6KA 3D18B 5IWLA 1H9VA 2R23A 1D5BB 2P8PA 4NKIH 5D7JC 5JW3L 3I2CH 1ZWIA 3H9SA 2BHUA 3DRTB 2GI7A 1XZ0B 4XXCA 3P73A 2EDDA 3IFOB 2O5ZH 3TBSB 4Q7DA 4YO0B 1UWXH 4M6OH 5DEGA 3QUXC 4HQQH 1ZLVK 4MCZB 4ZYKA 1P4BH 3KPQA 4K3DH 3KYOA 3W39A 5ILTH 1C08B 4MMZC 1MCWM 5ACMA 2I9LB 2ADIA 5EZIL 4UIMB 2ZUTA 3WYRA 3UJIH 2PYFB 2GK2A 4G9DB 2ZCLL 1CFNB 4OCWH 4CVXB 4UQ3B 4XPGL 4HWEL 4UT6L 1FGNH 5C09D 4JM2B 3ARDD 2V5MA 4IIQB 1I1AB 3T0AA 1ZT7B 4O58H 1I85A 3RUGA 1T1WA 4MDIB 4DN3L 4J3WA 1CXLA 5JOEA 2NX5D 3VA6A 4W4OC 4I2XB 1DN0B 1AXTH 3NZHL 5HI4D 1F4WL 1RPQA 2HN7A 2Z8RA 3MREA 1CDIA 2X6MA 5T1MA 2EDWA 3KJ6L 4J8RB 3L3IA 1I3RB 4PTTB 4JFFB 3HB3D 4WIQA 2I9TA 3AC0A 5DT1H 1YEIL 4OJFL 5F7LB 2DM2A 2ICWI 4IRJA 3GJFK 2W0FB 3WXWH 3IAPA 4UAOC 2FATL 4X4ZA 4WHTB 1KEGL 5HVFB 4ENEC 5JDJA 3WLWC 3UPRA 4XPAL 1URLA 2CRYA 4PLKC 3OKOA 4OIBA 4WW2C 1PSKL 1AO7E 5BRZD 3VXSE 3W9DA 1HCVA 1NUNB 2VLJB 4P4RA 4AQOA 5J6GB 3DV4A 3MCLL 2HWZL 1FG2A 3QZWB 3RUGF 1EEYB 1ZT1B 5D1QC 4KK9D 4MAYC 5FM5O 5FDWA 5DVLA 2BNUA 1TITA 3KYNB 3IDMB 3LB6D 4U6YA 2EO9A 4XMKL 5BS0B 4ZPVA 4TUOA 4JAMA 1LK2A 4NBYB 3QPXH 3PGDA 4GW4B 3RTQC 4Q2ZB 4QKXB 4L1DA 5E4IA 2XRAL 4S1SL 5C0AE 1K8IA 2HJKB 1FSKB 4NT6A 5C70A 3SDAD 1ES0B 2VDRL 4G7VL 4K9EC 3NGBC 1S5IH 5GGQL 3JBG7 3SKNA 5CGTA 5B38B 2DQIH 3ROOB 4HUNB 4ZSOE 5CD3B 2E27H 4PJBA 1T83C 4XP6L 4PBVC 4G8FB 1AFVL 3HMXL 2CD0A 3MRLA 3AAZB 1JZ2A 2IMNA 3VG0L 2HJLB 5L2KD 4XNXL 3SE8L 2R69H 3WXVH 5FYLL 1QKZH 4ORGA 4PY8I 2VDKH 1S9KC 1VFUA 4L3CA 1J1XL 3OKYA 5CHNB 4YE4L 2XN9B 2D03L 3B9AA 1U95A 4A6YL 1CQKA 4D0BA 1P7QD 1DDHA 4U2ZA 3ZDXE 4E0RB 3QNYB 1YYLH 1MI5E 1BMGA 3PHOA 4HUUB 4MQ7B 4QLRA 4ZOBA 5FFLA 4ZUSB 3MNVA 2L7JA 3VFTB 1GOGA 4GBXC 1GHFL 4F7PA 2BFVL 2YD2A 2A9ML 2ERJB 4ZD3L 2ZG2A 4LSDA 2J2ZA 4G80A 4GSDH 4HDIA 1JGDB 2V17L 4QF1A 3HUJE 3VXOA 1LEIB 1VEOA 4OZIB 4M7KL 4PJBF 3IDUA 5ALBH 1T7YA 2GJ6B 1X3DA 3JV5A 4QRTB 4QXUL 1LEGA 3PWUA 3P4MA 4XCCL 3VFPA 1CGYA 5FGBC 1KB9K 2P5WB 4D9QD 5B3JE 4YHIB 3MV8D 5GGTA 4P2RD 2OTUB 3NIGE 2EZ0D 3S35X 3GMLA 5C0DB 2HP4A 1D9KC 4MSWB 1H0DB 4UDTB 3D3VD 4CW1A 4YIQA 2VB5A 5CZVH 1JRHH 5EDXA 2GTWB 1JZ7A 4E5XB 2XQYK 2JJTC 4I3GA 5JNYB 3H2WA 1KIQB 4LLVB 4JM4H 3U9UA 2DIAA 1WTLA 3MRKA 1QBMH 3MRRB 3O6KL 1XF5B 4EI6A 1K6QH 3QWRA 4QRPE 1I1FB 4H25A 4HIHA 2F5AL 5ICXA 1R0AH 2EDLA 1NGXB 4PGEA 2LAGB 4D9RE 3C9NA 4S1QL 4MCYB 3VXPA 1XCQA 1FNGA 2ZSWA 1XF4A 1KXQE 2J8OA 4PJEE 5C0IB 2RCSL 4PJ7B 5HGAB 1I3VA 5I1IL 3SGJA 4TSBH 4U3XA 1QNZL 1DUZA 5I1JH 4F15B 1JHLL 5K33A 3ZE2F 3ARGA 3EO0B 5D1XA 5FM5M 4G6AC 5ICYB 5T1DL 2KZWA 1EZVY 1TVDA 4IEFB 4J3TA 3GMOB 5GS1C 3DLQR 4EXPX 3QIUA 1CD8A 1F3RB 1KPUA 3RDTB 1IAIL 1I4FA 3AGVA 5JZ7D 2FH8A 1YPZE 2AEWA 2IAND 3FQUA 3BRFA 5I1AB 4NO3A 1MAJA 5DJDA 3S3PA 1MRCL 1QTYT 4OGAC 1W0YT 1TQCB 2OBGA 5IB3A 2XFXB 3O3AA 4LLYB 3C6SA 5I1KL 5DJ2A 1S7TB 2A6KB 3D9AH 3HCVA 1H5BB 1LVEA 5ID1B 3AS2A 3X11B 4LVHC 5FUCE 5CP3H 1P6FA 3QUZB 4TOYL 1P5VA 2DWDB 3O2WH 5CEXA 3IGAB 4GXVL 2AS5M 1R5VA 3VG9C 2X05A 2ZUQC 5DK3A 1CDUA 4OZHE 4P2QB 2DBLL 4Y5YB 4L4VE 3MJ8A 3LVEA 4I0PC 4S2SA 2QQKH 1YNTB 2F5BH 3QAZC 2VIRB 4KDTC 2V7NB 3W9EA 4LASH 3SBWA 4RISH 2X4SA 1PZUB 3J8F7 5E9DA 4RA3A 4F7CB 4NM8H 3UBXA 3GBNL 5IT2L 4Y5XC 4G43B 1G1CA 5C0NC 2R2BB 3HI1A 5JO5A 4ETQB 4XZUB 4JN1H 2IAMB 4B50A 5EULV 5CGMA 1J18A 5BV7H 2ZJSL 1PYWB 4MWFB 4QOKA 1ZHNA 1HZHL 1L9NA 1YEHH 5EFIA 3FCTB 1WWCA 5DJ6B 3WJLA 1L7IL 5DSCB 3E2HB 4HJ0C 4BQCA 2G75A 1M7DA 3TNNB 3VI3E 3AREB 2UV3A 5AG9A 3DX8B 1W0WA 1TTUA 4LEOA 2EC9U 3TZVD 2IQ9H 3RWCB 1U3ZA 4NQSB 1GSMA 4NUGH 3RX8A 4YR6A 1CICD 2C9AA 4KGJA 3BD4A 2YK1H 3PWPA 4N5UA 1ZLUK 2UUDK 2ILLA 3T0ED 4MD4A 1EGJL 2NY5L 2OJEB 5MP6H 2F74B 3REVA 3CSYA 1CFVL 3GFUA 3FO2A 5IF0B 2X7LB 1X4XA 3CMOL 2F15A 4RZCA 3B9KA 3P9WB 1WVZA 3RWGB 3TO2B 5LAXA 4ZNCD 2DMCA 5E24E 5T33H 3T3PE 1I8MA 1JF5A 4NHCH 3L1OH 3RKDC 1XGPB 1MF2H 2VLRB 1AGEA 5E2TL 1ZANH 2YUXA 1S7XA 2HLFD 1L0XA 1NEZA 3HZMA 1EBAA 2Z31A 4TSAL 2CRZA 4FFYL 1YMMA 2BNRA 5MEQB 4PRHD 3F7RA 1HIMH 5DUMH 2OTWA 2XXCB 2JELL 3PP4H 4WFGD 2FBOJ 1IEHA 3RIFK 1JGLH 3MRNA 3SKOB 1GGIL 1X5ZA 5DURD 3G9AB 5KVGH 1GGCH 5F7EH 5C0BE 4KHTH 2JJUA 4AEIL 4XVUD 2XKNB 1KFAH 2EKSB 2OSLA 3GSNL 4RIRB 2Y25A 1U8PB 2BVYA 2Y72A 3STZB 3CH1A 3R1GH 4JANB 3T09A 3ULVF 3G6DH 1NDGB 4U6XA 5FUOL 5GJSH 3BH9B 2NXYB 4QHNA 3SDXE 3IDJA 5F6HJ 5L6YH 3CVIL 3FB8A 4JY5L 2JIXB 4NQDD 1BM3L 5KVEL 1ZHBA 4XVTL 3WJJC 3GBLA 1V8HA 3VXUB 4JVUA 3TN0D 4LKXB 3D69A 4GOSA 4ZS7L 2PW2B 1ONQA 2EIEA 3STBA 3TBTB 1FL6B 3BZ4B 4B7IA 3MYJB 3RZCC 1TZIB 5E6YA 2H41A 5EU4B 2VAAA 4ZNEE 1S7WB 4Q6IC 4Z78A 4GW5A 1FIEA 1NBVL 4DFIA 2ICES 4BFIA 4IJ3C 5BVPH 4EOWL 1T1XA 3U48A 4JLRA 4XH2B 3SDDD 2DBJA 1UCBL 5IB5A 2A1WH 4L8CB 3CCHA 3CFDB 4OF5A 4LCIH 2YA1A 3D85D 4HXBH 5DEFA 5DRZB 3L3OB 3KPSA 1XGYL 1TNMA 4CGTA 2DL9A 1Q72L 5FUCC 2NY0C 3V0VA 3S96B 5JHDA 2ZUVA 1SEQL 3MMEB 32C2A 3J7HA 4FTVD 2W92A 1IKNC 3QG7H 3RAJL 3LZFH 4KKLC 1RZIA 1MCPL 5TF1H 1DBJH 2Y5EA 5J13C 3KPRE 3KXFB 2P1YA 3ARBB 4QHLA 1OAZH 4P5TD 3WO4C 5D1ZC 1DQQB 5BVJA 4CNIA 5JHLL 2JCCB 1T04B 4EXKA 3INUL 1T0MB 1KLFA 1OOAA 3GSWA 1NFDB 3DROA 4RFNB 4PP1D 1JWUB 1OTUD 1U2HA 4NUJB 2V2WB 3X14B 1J1OH 3D5OF 2F53E 3HI5L 2OQJA 1BFTA 4Z7UE 1K9TA 1X5YA 5HBBA 1J0JA 4LDOB 1G7MA 1UB6A 2AP2A 1AGFA 3V0WL 5BRZE 5C7XH 3K81A 5FDYA 1NFIA 4WUUD 2BJML 1XR9B 4G5ZL 3ZYZA 5IGXH 3DRQA 3NH7H 3KJ4B 4JFZH 4NO0A 3VXTA 1QRND 1FZMB 2VISB 4PJ9B 4LAQL 1ZTXL 4OLXH 4OF6A 3C60B 4D0CA 1DQLL 4FABL 5FKPA 1CL7I 5FA3A 2X41A 1KCVL 1FJ1A 4OCSL 5EWIH 3EDKA 4OM1H 2Q7YB 6FABL 5HHNB 3BXNB 2X4RB 2E6PA 3QDME 3DBXA 1H3GA 3MCKB 2XNAB 3U1SH 3LEYH 4W70A 1G7PB 2YD7A 3BKYL 3ARVA 5I15H 5FYKH 2R1YA 2MSPA 4IS6B 4N1CA 4KUCD 2FWOB 3VA2C 3TH3T 3ZE0F 5D9SB 2A2QT 3K1KC 4GMTL 5HHVL 1PG7L 4XNZB 5L2KE 3X12A 2CKBH 4WWKA 2FJFA 3VFMA 4JFDA 4PP2A 1QSEB 4G9FD 5DVMA 3W2DH 5E2WH 3MROB 1AXSA 1KJ2L 3IU3B 2ICWB 3GMQB 2VDQH 5C0CD 4F57H 5D2LA 3X3FH 4NQEA 3PQYA 5CZKA 5HGBB 2OZ4H 3K8LA 2HT4D 1HHHA 1CLOL 35C8L 1II4E 4A6YA 2HFTA 2Q86A 2QSCL 3I3DA 2Y6SC 4NZJA 4NZUH 4RX4A 1EJ6A 4PR5B 5C07A 4YX2L 3S37H 3WKML 2XOTA 5DRNB 1SJXA 1VACB 2DQTL 4NQXA 2UWEE 4Y16B 1CLYH 4MHHG 1NAML 1FYTD 2E6JA 1JPFA 4OGXL 4TPRH 3T04D 5AYUH 1F45A 1JHKL 3B2VL 4JZJB 4PIRF 3M8OL 3H7LA 3ILPB 4D9QE 4APQD 2J8HA 3L5WA 1HH6A 1G6RB 1AP2A 1EAJA 2BSTB 2G2RA 3FAXA 2EH8L 4OZGE 4TRPH 5EC2B 1MCBA 2R0ZH 5F89B 4LSUH 4OSUH 3I50H 4ODXA 4PV9A 3KHOA 3EOYG 5FXCH 4OLYL 5D2LF 2BMKA 1QQDB 3QJHA 4KK5D 1D6VH 1MVFA 3U9PH 3HRZB 4YHKH 1B6DA 3O4OB 4ZAKB 1BJ1H 3DVGB 1QLFB 4QXGH 4JDZA 3RNKB 1I8IB 4OLWL 5LBSL 3UTTD 1A9EB 3H9HA 3T0WA 4Y5VA 1QVOA 3P30H 1QFHA 4GS7C 5IK3B 4CADA 2AVGA 3HE7C 4X6CE 4ONGL 2PYEE 4OFYD 4YWGH 3HC0B 4U1SB 3PF2A 2YR3A 4XC1L 4XGZA 3TO4D 1P1ZA 1QLRA 2BCKB 5HI4C 3LQAL 3TT1H 3BGFC 3GMRB 3VFVA 5DHVA 1YEJL 5IG7A 3Q0HA 3LPWA 2ARJA 3HB3C 5SWQA 2Q8BH 2LAAA 1F02I 1JHTA 1M7IA 5ANMA 2DKMA 2X4TB 4O2CB 3QA3A 1D5MA 3O45B 5I2IA 2DWEB 5GGVL 5I1DA 4UNUA 5ETUB 3HG1D 2WINA 2VXQL 5BV7C 2M2DA 2R0WH 4IDLA 5FV1L 3B6SA 1IM3B 3MUZ1 3RX7A 2O61B 2VXUL 1U8KA 3VGBA 3HNTL 1UM4L 1BJ8A 4BUHA 1DBKH 3OKKA 1XF2A 4PJHB 1LILA 1IQWL 1PLGL 4NWUH 1BOGA 1R5IB 5BMFH 5EB9A 1U2CA 4ZUTB 1DE4A 3SKMA 1EH9A 3D39B 3MV7A 1OLLA 5EZOL 3LB6C 1U3HB 3S34L 1YEGH 5C9KA 3WEXA 1ZHLB 2JJVA 4K2UH 3BN9D 2P24B 5IEKB 3QUYB 4IMLA 5IBLC 2QKIB 4XCYB 1C5CL 1X5JA 1JE6A 1QLEL 2GT9B 3MBEC 1J0HA 3O0RL 4KJYB 4JHWH 4YHLH 5LWYL 4N1HB 2NY2C 3L5HA 3BO8A 3MR9B 2B5IC 3RJDA 1JUFA 4I18A 1DQJB 1XGQA 2HT2D 5B8CB 2PETA 2C3VB 3T2QA 4XBEL 2HRPL 2J4WH 4BFBD 4XBGA 5B39B 5IM7A 4P46B 5FYKE 4JG1H 3WIHH 5C86A 5DD3H 3SO3C 1FFPA 4Z7VE 5BCAA 5F1NA 3SE4A 4Y2DA 4OIIH 4HKZA 1T89A 5I8CA 3QEGL 1M05B 3CAFA 3V6BR 3IFLH 3MA7A 3CFKA 5DJCB 4ZMAT 3U0TB 3T4YB 2D3VA 4JG0L 3RA7H 5L2JA 3ARFA 4YHZL 1KELH 3QG6B 1NCCH 2OR7A 3IFPA 2AK4A 2VSDA 4H1LG 1FZOA 3JV4B 3LIZH 4ONOA 4U4BA 5A2IH 4P2OB 2JB5L 3OKNA 1KCRH 4NN7B 3QIWB 3O3EA 5HYJB 1MRDL 2GAZB 5HDBF 3MLSL 4Y4FB 3UPCA 2YXMA 3MV9E 4KXZH 1NL0H 5FOJA 2GK0B 1I9IL 3FFCA 4N9GB 5CJBA 5T1KB 5EUKB 4G7YL 5JUEH 1MFNA 2IFFH 3RGHA 5DGRA 1EGJA 3IXAB 4JY6A 3TBSA 2GUOA 3LKSA 3IT8D 4U6VL 5A2FA 3WFZA 1E6JL 5IVXB 4BK4A 5DZLA 2OMBA 3WE6A 4MCZA 1Z0MA 2HG5B 1U8MB 2EZ0C 2JKXA 5IKCA 2Z4QB 4EUPB 2ID5A 1A3RH 4JPKH 2IH3B 4LAJH 1PVHA 3SPVB 3IF1B 1QFUL 3FMGH 2I5YL 2YS4A 4MMXC 1JV5B 5L7XH 2CDGA 3LDBC 3QXUA 4MNGB 4PRHE 1EHLL 5HGHA 3WNKA 4R26H 3O11B 5KS9B 2CXGA 4UQ3A 5KSUB 1WT5A 5HI5D 12E8L 2BVPB 1MEXL 2VLKD 3BQUD 4NZTH 3H0TB 4UTBL 3WFHB 1UCTA 2D0HA 2P7TA 5ADOL 3EGSA 4TUJB 2EE9A 4LPYA 1R5WA 1U8QB 3HAEA 3MODH 4LLDA 3TA3A 5EU5A 3ZE1E 1AHWC 4X6FB 2D31A 1UZ8B 4QRSA 1JF1A 1S7UB 5LCVL 3ORJA 3GSNA 3SJVD 3AB0C 1YEFH 2GJZB 4OQTL 3TBWA 3PDOA 2B4CL 3GSXB 1BF2A 3F58L 1QR1B 2ADGA 3QHFL 5TDOB 4F3FB 3VFRA 2CDEB 1H8SA 3D0VA 3F7PC 2DQEH 3LD8B 4PJXB 5JZ7C 4GKZB 1MCDA 2MTPA 3MV11 1BFVH 2ZCKL 4LHUD 2CJUH 1WBXB 1GAFL 4IRZL 4J3UA 2P43B 1T80A 4WI3A 1WITA 4I0KA 1S7QA 5J1TC 3QZWA 1KN2L 2W65A 1X9QA 4R3SB 5FK9A 3KYNA 3WFBL 1DVFB 3IDMA 5KSBA 1T5XA 3HE6D 4F7TA 3K46A 5ESVB 1KLUA 3PABB 4R8WH 4RGOL 2M8XA 3ZKXC 1QFWL 4FTVE 4CVZB 4BYHA 2P45B 2DJ4A 3U4BL 5I6XB 3CK0H 1ES0A 2ITCB 1G7LA 1Q9LA 5IHZA 4IDJH 2H6PB 4O2FA 3GB7B 4LSTL 4UV4H 3QQ4A 3BE1L 3VGFA 4OI8A 5IB4B 3FL7A 1I3GH 3HTLX 5IW6A 1S7RA 4WUKH 3VFWA 2FIRT 5AZEL 2IH1B 4H88H 3CU7A 1AGDA 3VCLB 2YEZB 4Z8FL 2HFGH 2EYTB 3FT2A 4JM2D 5CHNA 3PWVB 3DGGB 3HC3L 1UZ6E 1I1AD 3K2MC 5FHBH 5C0FB 3CDCA 2X4UA 3F65A 4I48A 5KSBF 1ZGLP 3IVKA 2EDXA 1SEBA 5AD0A 1JZ3A 1INQB 4L4TA 4WUUE 3ESVF 5IB1A 5IBUB 3ILQD 3MNZA 3P9LA 1RFDH 4F9PC 3PXJA 1CICC 4YZFE 4OV6F 3I9GL 1BJ1J 3NIFE 4PRAB 1G9MH 4Y4HA 1YEDA 2OR9H 2AJYL 5DXWA 5DWUL 4PJAB 1QRNE 1UJ3A 4F2MB 4QXWA 3VWJB 1PQZB 4MQTB 3UXFA 1NUFA 4ZXBB 1QSZA 3BD5A 3BH8A 3BW9B 4DWHA 4M7ZC 3QDJD 1IRAY 1GC1L 1TETH 1OSPL 3I6GB 3MFGB 3WHXA 1Z2KA 2DAVA 2YC1B 5DD5L 1NCWH 5C2BL 1FFOB 5I17B 1KB5L 1A1OB 4MXQC 1Y6KR 1BFOA 3LKRA 4I13B 5IMKB 4GAJL 2HLFC 3E6HA 4HKBB 1LP9E 5C08B 1MFDL 4X7TA 3IDIA 3PWNB 3KLAB 4PJIB 2AEQH 4G9FE 3BMWA 4JRXA 3D6GA 3JWNC 4NPYB 5FAAA 2VITB 3RGVB 4PJDE 5BS0D 4PRPD 1A6WL 1B4JL 2PXYB 5I18H 3QXAA 5C0CE 1A6AA 3U7WH 1LO0L 3ES6B 3CJJA 3UO1L 1ZV5A 2R4SH 4AMKH 2FX9L 1IC7H 1MCHA 4ZUVA 4XVUC 1T0NB 1SYSB 1KJ2A 3VI4F 2ATPA 1F2QA 5DVKA 3MLZH 3QQ3B 5L9DH 4G6JL 5EOCH 2NY6B 5CKAA 1DJSA 3MFFA 4XCNA 2FZ3B 5H94A 1IL1A 3DXAA 2J8UB 1HYRC 1U9KA 1YYMH 2HH0H 4GRLC 4JDVB 4EI5C 2I24N 3AY4C 5GISH 5TE6H 4HXAL 4GRWH 5E00B 4QRRD 4RBPK 3CDYA 3RL1A 3ULSB 1IGJA 2V2XB 3EO0A 3HC4L 3TBYB 3TN0C 5BW7C 2EICA 3BP5A 4MNQE 1NAMA 4LVNC 2XN9D 1IC5H 1UXSB 3U0WL 2OL3L 5F6HI 2DI9A 4ALAH 1CD1B 3VRJB 1ZHKA 2DYPA 1NCDH 2VZ1A 5F9JB 3HZVA 4HH9A 5HVHB 1EXUA 3NACH 5LJYH 5HHOE 3QWOA 3NABH 3BVNA 2XZCH 4ELMB 1AQKH 1Q9WA 3T2NL 4FHBD 3PP3K 1A14L 1A4KA 3HFML 3SDDC 2B0SH 1N6QH 1JTPA 3CPLA 1OPGL 5D7JB 2IADA 1I75A 2LABA 4AQ1B 2DD8H 4L5FH 5GJTH 4U7MA 2Z35B 4OLVH 5AZ2H 3TWCL 1CG9A 3RP1A 1T1YA 2GJ6D 4LSRH 3IDNB 4X83A 3VXME 4PBXA 4NP4H 1UYWH 4HS3A 3V6OE 2P4AB 3QUXB 1FG9C 3NAAL 1WCBB 4OGYH 5HPOA 3A67H 4I77H 4I9WD 2V6HA 4FFWD 5F7YC 1IFHL 4GAFB 4HPYH 1T4KB 4GAGH 4UU9B 3PDDA 4P5TC 3G5XA 4ZUWA 3VW3L 2FD6L 3OTTA 2VIRA 4KGLA 1UKQA 2PTVA 3UPAA 4L8SA 1NLBL 4DQOL 2CLZA 4NM4L 4LHUG 4PP1C 3I02B 4YXKL 4HPOH 4N68A 1OTUC 4TVPD 3MC0A 1D5XA 3LS5H 3HZKA 1RSFA 1PYWA 5LGJB 1H3TA 1FPTH 3H9SD 1CFQA 1P7KB 3QDAA 4OAWB 5SX5H 1HKFA 3FCTA 1NKOA 1F4AA 2KDGA 2Q8AH 2DQUL 3L3DA 3AREA 4YH6A 4JKMA 4U0RC 5JR1L 1OW0C 2IG2L 1GZQB 4HFUH 3NFSL 3FB7B 4M6NH 1NC4B 4LCUB 2DQGL 5A43C 1JRHI 1FLRH 1HEZB 3BSZH 1P4IL 3SCMA 3VMNA 4JFYB 4U1GC 4X6DB 3EIFA 4CVWA 4TQEL 2CQVA 4UAOB 1SY6H 4Q97A 4DUXA 1ZVSA 4QGTA 1CDHA 1SJHB 4WW2B 4CJ1A 5TGBB 2XPGB 3K8KA 1UA6H 3MLVH 1U3YA 4TULH 4M1DH 4X9HA 3CMGA 4M6ML 1FGVL 1J88A 3PG2A 4LOUD 1XGUA 4F7MB 4HG4J 4HFWB 4P3DB 1NCAH 5D1QB 1E6OH 1YEEH 4MAYB 1BZ9B 5DJ8A 3S35H 5ITBH 5E8NB 3BFOA 1IKFL 4KPHH 5L8KB 1KJMB 4WEUD 5JXEA 1BBDH 3FB6A 5FB8A 1JN6A 3ECBB 1AY1H 1MJ8H 4PRDB 3RTQB 4OLEA 3BIKA 4LCCC 1I7UA 2AK1L 5D72L 1SHMA 1QA9B 1VCAA 5ENWB 3NGBB 2FX7H 3BDYH 1F2XK 2W9DL 1RUPH 2FSEB 3S7GA 4M61B 4IRJD 1HQRB 4I3SL 3PJSA 4YPJA 2HAZA 4LVEA 1OM3L 4M62L 1NDGA 4E41E 3SOBH 4JREC 1PG7W 2BRRH 4CJ0A 3L3KA 3P11L 4LLMB 4WI7A 4NKQB 2QADD 5ECJE 1G7QA 3WIIL 4GRWE 3MQIA 4PJ8B 4ONFH 1OGAB 1DL7L 2HKHH 3NZ8A 4Y1AB 4X4XB 3HNVL 4UB0L 5E2UH 2PW2A 1KV3A 3TBTA 4AL8L 1IGIL 3VXRE 3BPOB 5F3BB 2AJUH 2XTLA 3ZDYF 4HK3J 1KSRA 4HS6B 4XAWL 1NJ9B 2H45A 1K85A 2XXMB 3OF6A 1S8DA 3OXRA 2JK5B 1ACYH 3IRZA 4KROD 4JO3H 2C1PB 4KK5C 2R56H 4GBXB 3TF7C 1W72B 2Y07H 2FEEL 3MRCB 1RZKL 3N85H 5ITFB 2X1OA 4PUBL 5E94B 1BWMA 5MERB 1MJUH 3CFDA 4U1NA 4OD2B 2F8VA 2VL5A 4S11A 4D0DB 2R2CA 1QACA 5DRZA 1NAKL 4O00A 3QO1B 4MQXC 2UZXB 3AM8A 3CDGB 4TSCH 1IGMH 1WSST 4YNYB 4OCRH 1H3XA 3V6OC 4L1HA 3LKOB 3ZDZE 1O7SA 3MRBA 1JNLH 3TO4C 4GG8A 4EN3A 5JDSA 4XP4H 1D9KB 5CJ8A 3KXFA 2Q3AA 1LD9A 3V7AE 5DJ0A 1U8JB 3BJ91 4DZ8B 4P23A 3BT2H 1LO3H 2NNAA 1JGVL 3KYMB 4JZOA 4PRIB 4YHYC 4GT7A 2EC9T 4UINL 3QNXA 1NFDA 4YDVA 1A6VL 4F8TA 5E95B 4KHXH 2J6EL 1N4XH 1WFNA 4DKAA 4NUJA 1BZQK 1OCWH 2PNDA 3PIQB 4ZO8A 4OQTA 4XXDA 4WY7H 1HQ4B 1P4LB 3DV6A 3WS3B 2W38A 3TPKA 5D7LE 3D48R 3HR5B 1INDL 1A2YA 4MXVF 3DJ9A 3EDFA 4HLZG 5TDNA 1VFAB 4LSSH 4OF7A 3QCVL 3O4LE 3CFBA 5D70L 4WTZA 1MOEA 1E28A 1CGSH 4AM0B 2P8MB 5C0JB 5IHUL 4Z76B 1IM9B 2NXYD 4Y4KA 1BVLA 1G9MC 4EJ1C 1Z0NA 5DD0H 2F54B 3C5ZA 1P6AB 4PGDB 1N7MH 4RMSA 4HLZH 1DUYA 1YJDL 4AEFA 5L8LB 4K8RD 5GGUB 4FFZL 5GS1B 1OP3K 5I1LB 2YPKB 5FOBB 5EOCJ 3QWQB 4L4VA 1NFDF 2Q7YA 1NDMB 3QRGH 3S4SA 5J6HB 5CJXC 3V79C 2P5EB 1QFOA 2ADFH 3BKMH 2E7LA 1AH1A 1RUKL 4I4WB 2XNAA 2HT2C 1AO7B 5CEZE 3VXSB 4DAGL 2FNBA 5EU6A 1R3IL 3QFJE 4LCYB 1BREA 5GGVY 5T5FL 3VD9A 4JPVL 5CBAA 4P99A 3HR6A 4LVHB 4HKXA 1GXEA 5I30H 4U1JB 5EO9A 3F7QA 1RI8A 1RV6X 1IAKB 4ZUUB 5DUBB 4FXGA 3CVHB 4LBEB 1Z9LA 1CTNA 2AJXH 2MOVA 5K9OB 2Y9RT 5D1XD 5C0AB 3VG9B 2ZUQB 2DL2A 3T8XA 3HN3A 5FECB 4X5XB 4C56E 1Z9OA 1MLCB 1RUMH 4I0PB 4WU7A 4MD0A 3GMPA 3QAZB 1I8LC 4YHPA 3RNQB 1GIGL 2DN7A 1UH2A 2QSVA 1N64L 4R7NA 4GAYB 5J3HD 1EMTL 4BZ2L 4Y5XB 1T7VA 2EDEA 5DRNA 1C12A 1PG7X 2W60A 4Y16A 4Y19D 1RQ5A 3F62A 1OT1A 4WCYH 1TCRB 2EE6A 1E4WH 1G7HA 1UC6A 5FCUH 2ENYA 1BQLH 4WU5B 3QDJE 2LU7A 1K3ZA 1IAOB 1OAUL 3B4NA 2QSTA 3VGAC 4RAVA 5F7MC 2E7BA 1CGUA 2FR4A 1N5YH 1GOFA 1KYOJ 1WEJL 1LWRA 4FG6C 1RURH 4PRBA 3DMMA 1J0IA 1ORQA 4HK0B 1KIPB 3DOSA 2AQ2A 1KBGL 2X70B 4X7DC 4AG4L 5HYSG 5IHBA 4L3ED 1WBZB 3TJEL 1KB5A 3CFCL 3QISA 2H26A 1DTUA 3VMOA 4JFOA 1A9BB 3BI9X 1EEZB 3QEQA 3MBXL 3HPJA 4Z0BH 3HUJB 3BWUC 5HI5C 1UVQB 1EIBA 5E9DD 3BGMA 1J10A 4C58B 5LXGH 1V7MH 2ICCA 2RBLA 5IQ7H 1WIUA 4J2XA 4L8DB 4CN6A 4U1IB 3F12B 2BSRB 2QQNL 5K93A 3GK8L 5ERWB 5IK3A 3LEXA 1YY8B 3C09C 2DQCL 5J8OA 1EA9C 3O2VL 2IGFL 2HMID 4JB9H 3V95A 4X98B 4PG2C 4ERSH 4QOKD 3CC5A 3MJGX 4K7PL 5CCKL 2X4PB 4POUB 2COQA 3EJYC 4QRRE 3FT4A 2OP4L 1C16A 1QBAA 2PR4L 4U6HA 3X3GL 3PHSA 4PJGE 3PWPD 3PV6A 2ARJQ 4LLQA 4POYA 1OGTA 1U6AH 2MCPH 5H2BA 4QRPB 3PHQB 5ETUA 2NW2B 4JRYD 1QOKA 8CGTA 3FO1B 5E5MB 1RIVL 1A6UH 4LHQB 2OL3A 3B9KD 3ULVD 1VDGA 2VKXA 5BOPA 3A6BH 3UTQB 1D5IL 1HHKB 2JE8A 4U1HB 3MXVL 1BZ7B 2E9IA 3ZYOA 2VZUA 1KJ3H 4R4FL 5ESQB 5TQ2L 1P9MC 3BUYA 1J12A 5MHSD 4OFPA 3HE6C 1TTGA 4AY0A 1DBMH 3TYGH 1KEMH 1ZHLA 3WDJA 2IPTL 1O7VA 5IEKA 3I3BA 3HS0B 1T03L 1W8NA 3RWHA 1J8HD 1P69B 2NZ9D 4I9WE 4OM0L 3RZCB 3BAEL 1NGWB 2X4NA 4MJID 1YPZB 4RAHA 3UTSB 5GRYA 3U6RB 1VKXB 4Q6IB 3OZ9H 2YWYA 3FRUA 5B8CA 1JWMA 3ZZ1A 3U4AA 4A2LA 2A38A 2OLDA 3ETBF 4KVNH 4PGJA 5IFJA 3LEVL 2QR0A 3BUTA 2VXTH 4ZAKD 1TDQA 1HSBA 3KGRA 3TBVA 2MHAA 3STLA 2AJZB 3TVMC 2NY0B 5MEND 1I7ZB 3H9SE 4D3CL 3H8NA 3T0VA 1X5KA 4RMVA 5IMLA 3PGCA 4JY4B 3QDGA 2BC4B 1RUAL 3KPLA 4J3OC 1CU4H 3QG6A 5HHQA 4JO1L 5TDPA 3ULUL 5J13B 4HUVA 4ZO9A 4OZHB 5GGTH 4DCQA 3ILQC 2VDOL 3DTXB 3WO4B 1UM5L 1XGTB 5D1ZB 1IC4H 4JPWH 5GS2D 4NQCA 3GBMH 2CMRH 3V4VL 1C1EL 3U79A 4UUJB 1HH9B 1L6XA 2NY1D 4K8RH 1MSPA 1D5ZA 1M6OB 5EPMA 3SE3C 3KAAA 4Y89A 3DARA 5DQJA 1RK0B 4DGYL 3H7BA 3MRQB 5E8PB 2B1AH 4OB5L 2I27N 1V3MA 4HIXL 4FP8L 1A7OL 4WHYH 5CP7B 4P5MA 5IVXA 3O9WD 3P0YL 5CS7A 3FQRA 2HG5A 4WO4A 3HNSH 2VDNL 4EUPA 2NLJB 5DA4A 3NCCB 1JNHB 2MKWA 3RUGE 15C8L 1RHFA 2R2EB 3EFDH 2A6JA 4NSKA 3D39D 1IAMA 1N2RA 3PGFL 2DTSA 1KN4H 2CRIA 4OF8A 3VE0B 5IFAL 4FQQA 2BY0A 1UACH 4M5ZL 4JE4B 1YC8A 1JGUH 4AYFA 4YDKL 3QUYD 2AV1B 3G04B 3T0DA 2EKJA 1WWAX 3GNML 5E8EA 4EBQH 1ZT4B 1BAFH 4IMKA 1K8DA 1CE6A 1J0KA 3VXNB 4HF5L 5DC9B 2RAMA 2HVKB 4J6RL 1KCSL 1FH5H 4P46D 4Q0XL 4EEEA 5IVXF 3SDCA 1F8TH 4XVSH 4X99B 1UXWB 2VQ1B 4M93C 4FQJH 1FDLH 1HHJA 2UZYB 2XA3A 1GPOH 3DIFB 3JUYA 2AI0H 5DLML 4DGIL 3G5YB 3OMZA 4MLSA 4XCFH 5GSRB 4MS8D 1FN4A 4YDJA 2F19H 5TDOA 4NO0D 1YECL 5C0BB 5FO9B 2CUMA 2ZNXA 1HI6B 2LTQC 1FO0L 5E5RB 4PJXA 4LEXH 3VD5A 1JBJA 2W07A 3T65B 4HJJL 2K1MA 2QQLH 1AJ7L 2FBJL 3DURB 4DW2L 4D8PA 1P7HL 1MH5A 4NZRH 2D7PA 5INDB 4KRNA 5I66B 5DD1H 4OF0A 4PJBE 3RKPA 2WP3T 3SDXB 4Z7QF 3UTPD 4JKLA 4O2EB 3BZEB 4TNWK 2VXVH 5D96C 5IEHA 3UTZB 5F8QC 1CTOA 1K5NB 3EYUH 3TIEB 3DX7B 3T3MF 3SKJH 4QXTA 4JFDD 3SE9L 4PGBA 1U36A 2VERN 4FFWC 1CWVA 4BFGA 2Z92A 3S5LG 2HFFA 5AWNH 4P49A 4NQED 4PB0H 3D1MC 3UZQA 1J1PH 3NIDF 5IB4A 4PJXF 5GGRB 3QFDB 5GRVL 4FZEL 2BSSA 5F7UA 4UV7L 1SYVB 3U4EB 4RX4D 3CVHL 4KXZI 3L7FB 5C07D 5IWLC 1MPAH 1IVLA 4RWYH 1RZFH 3KWWA 2EYTA 3BHBB 3FONB 3DGGA 4BK5A 1XR8B 1TJIH 4GS7B 2GITA 2X42A 5D5MA 4XXCC 3HE7B 5C2UB 5C0FA 1MHPL 4OI9A 2J6EA 1FFNB 1NEZG 1YQVH 4H26B 4U0QB 4G6ML 4K23H 4KJPC 1TVBA 3ULVH 3G9VA 4MA8H 2NX5B 1T7WA 4R7DA 4XMLH 3OGOE 5TH2B 1CT8B 3N1MC 2NMSA 3KPRB 1U8LB 3QI9A 5DFWH 1LK3L 3BGFB 1Q0YH 3FN9A 4PJCA 3VFNA 4ODWB 1G7IB 4L29B 3ZE2E 4GG6A 1UADC 4LNRB 4PJAA 3QUMH 3ZKMD 3JWDH 3KR3H 2F58L 1MWAL 4UT9H 4UDUB 3U2SB 1H3PH 3DVNA 2OJZL 3UAJD 2XQYG 3GIZH 1L0YA 2F53B 3K8MA 5BV7B 4QHMB 4Z7UB 2OXGA 1VB9A 3WS6A 2YC1A 5BRZB 1A7QL 1AGBB 3OHXA 3B3IB 1CLZH 4XMPL 5MI0C 5I17A 4QHUA 2NTFA 3LH2H 1HDMA 2AXFB 5D5MF 5C0RH 1I85C 3GGWB 3WDIA 1CFSB 3BKJL 5FUZL 5C08A 5EA0L 3TCLB 1C8PA 4R2GD 3KLAA 3B5GA 5IV2B 3CXHJ 4G8EA 4YQXH 1IT9H 1MAMH 4X4YA 5F44A 2CLVB 5TE7L 1QO3A 3VH8G 4JO2L 5IJKA 4PJCF 3OG4B 3FO0L 4GG6F 2Y36H 4PJAF 5JW3H 2D7QA 5F72S 1P4BL 1G0DA 5JPNB 1SYSA 1MHEB 5F96L 2NY2B 4CBPA 2B5IB 4IRJC 2LV4A 1HXMA 5GS2H 1K2DB 1KGCE 3E3QE 2BOBA 3MRDB 5TE4L 1RJYB 1MVUB 2MMXA 1MJJB 1FORL 3GJEB 4XRCB 1TTFA 2CLRA 1FL5B 4BKLA 5L2KB 2QADC 1JNJA 4KKCD 5IHLB 3I6LE 4U31A 3C5JB 4OKVA 4YC2C 4OLZH 3QXTA 1P2CA 5EZIH 3VRIA 5F1OB 1JTOA 1OF2B 1ROWA 1Z3GL 5DJZA 1S9WB 1P7QB 5HHPB 2VE6A 3MJ6A 3K3QA 4XT1C 5I71C 3JZ7A 3T77A 4DKDC 4CDHA 4XPGH 3TC9A 4HWEH 4UT6H 1I8KA 4UOW0 2Y06L 4TNVK 2CIIB 3O81A 4KROC 1B3JA 4YGAB 5AAMA 4NJ9L 4DN3H 4I1NB 5E9DE 4YHML 3NZHH 2FHBA 1JGEA 4MA3B 1F4WH 2GTZB 1ZE3C 3E6FA 1S9YB 2UZIL 2WM0A 4AT6A 3ESUF 4Z7WA 3KJ6H 1HKLL 4MJ6B 4TUKL 4YFDB 3MV8B 3PDGA 2BY2A 4P2RB 1YEIH 4OZGB 3MRPA 4QOKE 1QSFA 2BVOB 4KU1A 4QTHB 3WUWA 2WQ8A 1T4KA 4C83A 3D3VB 4P3WA 2FATH 3MXWL 2EYRA 3ARFD 3CLEL 4X9GA 1KEGH 3LDBB 1HK6A 4PV8A 4A2MA 5CMAB 3L3GB 1YMHB 4XPAH 3GKWL 4H8WC 3C5SA 1J8KA 1PSKH 1WC7B 4U33A 1I1CA 4HD9A 3PWPE 1CDCA 1Q9OA 3RGVD 1CD9B 4F37K 3MCLH 3ARSA 2HWZH 3Q3GA 5EIQA 1FZKB 3FFCD 5LGJA 3ZKND 4CMMA 1P7KA 4OAWA 4X6CB 2XA8L 4XMKH 2ED7A 2PYEB 4LPVA 3CGTA 1UWGL 3DETD 3ULVE 1IGFL 5DI8A 1I7TB 3T1FB 1AHWB 4Z7WF 2FIKB 3OR7A 3KDMA 1LO5B 3PXHA 1ZLUH 2XRAH 4ZS6D 2UUDH 5A3ID 5CUSL 3TIDA 3MNWB 3BISA 2GY5A 3UYRH 2VDRH 5FO8A 4G7VH 3AB0B 2OI9C 1DFBL 5GGQH 3EYOB 4L9LA 5MHSE 5DJAB 1EPFA 3WXVL 3RQ3A 1QKZL 2OXHA 2VDKL 2ZKHL 2WIIA 1M71B 1YMME 4JFYA 4TNWF 1AQDA 5CEZL 2BNRE 2E9WA 4XP6H 4K8RC 1M1SA 1XGRA 2X40A 3V5HB 1AFVH 3HMXH 2FO1A 3KNBB 4Q9CA 2XWTB 3QIBA 4G8GA 3VG0H 4XNXH 3SE8H 1BQHA 2A74B 5FYLH 2IANB 3MLTA 2Z9TA 4NRXB 1J1XH 4YE4H 3CZJA 2EDOA 3L9RB 2FL5B 3LKNB 2ESVD 4A6YH 5M95B 5DJXA 1B0RA 3V52L 1KPRB 5H37G 3LKQA 4YGVB 4HFWA 3TA3D 1BZ9A 3OJDA 4KY1H 4WHDA 5E6IA 5FKAB 3SGJC 1KJMA 2V5YA 1RK1B 4PGZA 4JGJA 3L5IA 1GHFH 4MGXA 3ZKXB 3OKMB 2BFVH 2A9MH 3ECBA 3RTQA 5GRUL 4ZD3H 5H37H 1KPVA 4XBPB 5D1XC 3BP6B 5F3HA 4M7KH 3FKUS 4DN4L 2DIBA 4M61A 4ELKB 4QXUH 2EXWD 1HNFA 4XCCH 1HHIA 3QIUC 1A1MB 1I9RL 1HILB 4MXWL 5J3HC 3E3QC 3I75A 3LN4B 3JTTA 2XI9A 4H20L 4RRPG 4S0TD 4O9HL 5ALCL 5SWSA 3IXTB 4JFPB 4PJ5D 1RD6A 5E8OA 3JVGC 2CKBB 4PJ8A 3EFFB 2Z93A 4JR9L 4NKOA 1IMHC 3KPSE 5HTSA 3L3HA 4NKMB 1GCFA 4RMUA 2B2XL 4U1LA 4ZTPL 5TPWL 5DZNA 3F7YB 5KSVA 3LSOB 4MX7B 5JHDE 1CI5A 4HUXB 3RFZC 1WFOA 1RVFL 3O6KH 4HKJB 4XP9L 3V5KA 1W8OA 2F5AH 1CICB 4N8CL 2C1PA 1S3KL 5DUPL 2MCG1 5MEOB 1CE1L 4PREA 5F8RC 1UG9A 5DHVH 4JN2A 4LP4A 3PE9A 2D2OA 4S1QH 3MV9B 5E08L 4GW1A 3SBWC 2RCSH 4D0DA 5BJTB 3GMNB 1DCLA 1LQSR 3UP1A 4UOW1 5I1IH 4M7ZB 4X7CC 3WLBB 3ULUF 3QO1A 4JZNA 1QNZH 1VADB 4TTGA 1N6UA 1JHLH 1VPOL 4ENED 3V6FB 4HIEB 3IJSA 3NPSC 2E7CA 2HMIC 4PLKD 4Z77B 4HEPG 5T1DH 3BZFB 1CXFA 3QH3B 3ZE0E 5HYEA 2ICEA 3WJLC 3QUKB 3TNMA 1IAIH 3RBGA 1KB9J 2G5BB 3UJTL 5IMMA 1LE5A 4PRHB 4PRIA 4MAYD 4FZ8L 5IBUG 2WUCL 3QYCA 4JFQA 4Y4HD 5DURB 1ZSDA 4N9OB 3FT3B 1KTLA 3FJTA 4LDLB 1MFCL 5I1KH 4ZOEA 8FABA 3WL9A 2XZQH 2XT1B 3OJMB 1BIIB 3U7YL 5IFHL 5J1AB 5JLZB 3OKDB 3KPNB 3WS3A 1AKJD 1WFUA 4KMTL 1GGBL 1R3JB 2QV2A 3RVTD 3B9KC 4FOMA 1LDPL 3V5DB 3ULVC 2LFGA 5CEYB 4TOYH 4EDXB 1FO0A 1A3LL 5D6CB 1S9VB 2AW2A 4GXVH 4EI5B 4OZ4A 4QEGA 2FO4B 2BDNL 3RIAF 4BSVA 2Q76B 2DBLH 2VR9A 1NFKA 5J9PB 2F54A 5DTFA 3TN0B 1VFBA 4PGDA 4HZLB 4LCWA 2Z31C 3QEUB 3JWDC 1ED3B 1JZ5A 3IDYC 4LVNB 3GBNH 4JFDE 3VMPA 5IT2H 2DICA 4K7PY 4JRXD 2NZ9C 3NVQA 2CR6A 3NCJL 1KLGA 1I1YA 5JPMB 2P5EA 2FLRT 5B22A 5EBWB 5D2LE 4NQEE 3PQYE 1ETZB 5FYLE 2ZJSH 3CZFA 1HZHH 1MCNA 1RIHL 4RDQF 3FN0L 3SDDB 1L7IH 5A16B 3D85B 4HGWB 5C07E 4WDIB 5EZJB 4H5SB 1JPSL 1KXVC 5EUOA 2I07A 4ZUUA 4JFEA 3JV6B 3B5HA 4QY8B 4U3HA 3CVHA 4LBEA 4FTVB 3VFSA 2VZVA 1EGJH 5IVOA 5EBLB 5BZWA 2VQUA 2UY7A 1CFVH 1F11A 3CFEB 1FIGL 4PTUB 5FECA 5HI3D 5IB2A 3QSKB 1MLCA 4ZG1A 3CMOH 4P5TB 1S5HA 4DVBB 3HLAA 5IIEB 3GSOB 3OXSA 2DYPD 2EDRA 2H9GB 2W0LA 1CS6A 4X0KA 4QRQA 5DFVD 4R0LA 4Z7NF 2NY1C 3DX9A 4GKOA 4LLUA 1JPTH 3TEUA 5E2TH 3LRSA 3MGTA 1GGCL 3FO9A 4WU5A 3VFUB 4TSAH 3EOTL 4KHTL 4W6WB 3RBSA 3G5ZB 4FFYH 3OR6A 1MWAA 3GZKA 3DUUB 1HWGB 1WK0A 3CFJB 3O9WC 4RFEB 3MRFB 4FQXA 2JELH 4HIIB 2XWBB 5D7IA 5EUOF 2D0FA 3FQXA 1GGIH 4M1CD 4U0RB 4WUUB 3HAEH 1KIPA 2Z8SA 1A6ZB 3QQNA 2HFEB 1MCSA 3GHBL 2X4QB 4AEIH 1JYWA 1DSFL 4ONHA 3ZSSA 4EIGB 3GSNH 3NFPB 1A9BA 1T21A 1QRNB 3L5XL 2QHLA 4JJ5B 2A73A 1X7QB 4M9PA 3QCTL 3O6FA 4GKNB 4M8QB 4ZPTA 4PRNA 3W5MA 1V3LA 2FECI 1ZA6A 4U1GB 5ANME 2L0DA 3F7VA 25C8L 1JWSB 1SMAA 3MRMB 5DMIH 2BSRA 4OD3L 1L6ZA 3CVIH 4JY5H 1BM3H 4L8BB 5KVEH 2XG4A 4XVTH 1FYHB 1S7SB 1R3KA 1L7TL 2H3NB 4ZS7H 5IMOA 4NGHL 1AD9A 3RPIA 1KCUH 3RWEB 5D7IF 3P4OB 3AVEA 5F1KC 1QG3A 4G9FB 2YA0A 2X5PA 3MV7E 3T4AA 3KLHD 2WZPD 1NBVH 3RL2A 1I7RB 4HHAA 4PJDB 3RWJB 4EOWH 5C0CB 1XCTB 2DLHA 4MS8C 4C59B 4LCCB 4W6XB 1UCBH 4HWZA 3B5TA 2PF6A 3WO3B 4QRUB 3PHQA 4Y8DC 3SCMD 5GS0L 3X13A 4J4PA 5TF1L 1VGEL 1XGYH 3FO1A 1R3HA 5E1AB 1Q72H 1R24B 1D7FA 2G9HB 1WF5A 4I0PD 4F9LA 1SEQH 4KI5F 5HDBE 3T2OA 3RVXD 1CXKA 4K7PX 4ZDHB 2C5DC 4JREB 2EYSB 1BZ7A 4RA0C 1B0GB 3BP4B 5ESQA 1MCPH 1FYTB 1KULA 3VD3A 3LAFA 2WBWB 4OLUL 5EC1A 4MNQB 5M7QA 3CDFA 1NBZA 3QXDA 1N59B 2IQAA 4WWKC 3BMVA 4OUUB 1DQML 1F4XL 1GVIA 1G0XA 3V4PL 5JXED 3VGEA 4JO4L 3O8XA 1MHCA 5EZLB 3WIFA 1MI5D 4MLIA 4X9BA 1C5BL 5F7WC 1IQDB 4XNQA 5HHOB 2VDPL 2XYCA 3BPCA 3PV7A 2APBA 3ZO0A 3DVFA 2AK4E 2YPLA 3ARRA 3GSUB 1E4XH 5IW1B 3V0WH 1EAPA 1FZJB 3GSRB 5HYQB 1CFTB 5DJYA 2R1WA 4HAGA 1U92A 5KN5A 5CAYB 1Q1JL 3D25B 4AJ0A 2YSSB 4G5ZH 1MQKL 4FNLL 1I9EA 5EWIL 1GJIA 3F5WB 3FFCE 3SQBA 1TVHB 1MCKA 3QPQD 3VXMB 2FGWL 3TYFB 2IEPA 3UMTA 2BC4A 4LAQH 3KLSA 1ZTXH 2VABB 3TO4B 4GUPA 1WFTA 3CUPA 5GSVB 3RKDD 2ZOLA 1YNKL 1DQLH 4FABH 4WNQA 5J89A 3FTGB 1KCVH 2PN5A 2C4FU 4OCSH 4DKEL 6FABH 1K4CB 4KFZC 4YAQA 2AV7B 3REWB 4PGCA 4YHYB 1NGQL 3ZKMC 3OF6D 1LDSA 5J0BA 4Z7OE 1EO7A 3BKYH 5DC4B 4HIJB 4JQIH 2XZAL 3UAJC 5HHVH 4GMTH 5HPMB 4JQXA 1PG7H 3QHZL 4IHOB 3UC0L 4XCEB 1TZHA 4KVCL 1C7TA 1EFQA 2D7TH 1KJ2H 3ARWA 4Y5VC 2XICA 2A9NL 1NCUA 4G3YL 1CLOH 4YEFA 4R2GC 35C8H 4U1KA 4WI6A 2DKUA 5HVGB 1F58L 3RWDB 5AYUL 5HGDB 2QSCH 3EO1A 4AENA 3RWFB 2Q6WB 1M4KA 4JEGB 2BNQA 4YX2H 1M7XA 1SM3L 3WKMH 4P57A 3Q48A 1NANH 2DQTH 4TRPL 1NAMH 4OGXH 1VGKA 4XNMB 5JMOC 3LKPA 1JHKH 4D2NA 3JWOL 4JHZA 1JZ6A 5DK2A 1N3NB 5JXAL 3U9PL 4NWTL 2RGSA 3V6ZA 4YHKL 2EH8H 3FQWB 5DDHA 4OUOA 1IEBB 2FJGB 1CGVA 4X99A 3S97C 4KKCC 3EYVA 4OLYH 5GZOD 4S1RL 4NO2B 1HOCB 3U36A 5CZXD 5AYQA 3LQMA 5L0QC 1E27A 1DZBA 4Y4KD 2F8OA 5KSBE 3ARUA 5EN2B 1FHGA 1HI6A 3NMEA 3QQ9D 4AIZA 3HPLA 1RZGA 3LRGA 4OLWH 4HUWA 1JYXA 4NQVA 4L4VD 1BWWA 3FQNA 4YFLI 2GSIB 3N06B 3ARYA 4ONGH 1D3CA 5IROA 3EDEA 2GHWB 4XC1H 3GUTB 3BRGC 1MLBA 3VDBA 3VGHA 1T22A 4N0FA 3G5VA 3C8KA 3LQAH 1VHPA 4GRWB 4NRZA 2R1XA 1YEJH 4LQ1A 3TIEA 3DX7A 3VGAB 3SE4C 4HS8L 2PCPA 1IZKA 4Y2DC 3U0PB 1IGCL 1T89C 2FGZA 4LIQL 4LSVL 2ZUWA 1DBKL 1U8IB 3MJ7B 3QJFA 5E2VL 3RI5K 3MOAL 5GGVH 5FM8A 3ARFC 2VXQH 4L4TE 3WNLA 1MUJB 5JQHC 5F7NC 1YN7B 2Y1VA 4XX1E 2VXUH 2ZCHL 3HNTH 4FQ2L 1UM4H 5I1CL 1ZS8A 4IRSA 1IEAA 1SYVA 3L6FB 1IQWH 1PLGH 5JW4R 1R3LB 1QEWA 1TNNA 2VLKB 4H0IA 5C09A 2IALA 3AXLA 3ARDA 5CP3A 1NEUA 5C9JB 2NY3C 3VI4E 5SV3A 5EZOH 3LHPL 1K4DB 3C09B 3S34H 1FFNA 1FFRA 3CNKA 1UGNA 3DETC 2NX5A 3UYPA 1CT8A 5CSZA 4RGMC 5A3IC 1T7ZA 1C5CH 3P9MB 1QLEH 2RR3A 4BZ1L 3S6CA 3O0RH 2HVJB 4M7JL 5LWYH 2ZSVB 2H8PB 4JCMA 5EO1A 5J11C 1ZMYA 5KSAA 1YUHA 3DMMD 3BYTA 1JFQL 2FYYA 4XBEH 2HRPH 1JPGA 3OKLA 3UJJL 3QO0B 5EOQL 4HJGA 4JRXE 1SVZA 1NMAL 3FQTB 3RA7L 4J7RA 3QEQD 5E7FA 2R2HB 4NCC1 4X7SL 2L7UA 3E8UL 1OLZA 4V1DA 5D7LB 2VH5H 5BO1L 4U1MA 3QEGH 3MACL 2RHEA 5GIRA 5T5NG 1MREL 2AXJA 4RMRA 4OTXL 4JG0H 5HY9B 3O4LB 1Y18B 3IJYB 4YHZH 4ZFFA 3TA3C 3MCG1 3A6OA 4YXLL 4R9HA 1T1ZB 1O0VA 3BEVB 3DXAE 3HE6B 4E42B 2JB5H 1BLNA 4ZO6A 1ORSB 3AU1B 4PJFA 3OAYK 1MRDH 4MD5A 2EXYC 3MLSH 4X5WA 4RGND 1G9NL 1YC7A 4OT1H 3MRHB 5CBEB 3SDAA 1I9IH 1GZPA 2O5YL 4G7YH 1ZGLA 4OV5A 4KJQC 1AR1C 2WWMD 4ZQKA 2EXWC 1ZA3B 3GMMA 4X6BB 4U6VH 4KUZH 3S88L 5CIPA 2J3SA 1E6JH 4X8JB 4EIZC 3NFNA 1MJJA 4GRMB 1U8OB 4IM8A 1CD0A 4LSQL 1QFUH 2I5YH 4GXUN 1T2QL 1DBAL 2VAJA 4PB9L 3P77A 1EHLH 2Y5TB 2AEIT 2UYLA 5JW4M 3HE7D 1DLHB 4HZAA 5CWSB 2BVQA 3O3DA 5ACZB 12E8H 3EOBA 1MEXH 4JFXB 4PJFF 5ESAB 4NRYA 5KTEL 2AJSL 4C56B 3PP3H 4UTBH 3FOMA 3KPRD 4Z0XA 4M1GL 2HLAA 4N8VA 4XNUL 3OAZH 2PUQT 3OGCA 5IESL 1NGZA 2NXZD 5LCVH 3ZHLA 5B3NA 1WUNT 1V5JA 4MYWB 5HD8D 3MGOB 5FHAL 3W5NA 3QDJB 3KPPB 1ITBB 4WEBL 3IDXL 4MJ6A 4CN1A 4YHNB 2Y7QA 1KCKA 5F1IA 5J1SC 2F53D 4OQTH 4IOFC 1CDBA 3FOLA 5BQ7A 2B4CH 4ZFOL 3MV8A 4PBWD 5KG9A 4P2RA 2X4OA 4DK3A 2CJUL 3F58H 1QPXA 1KNOB 4AEHL 2CSPA 2ENSA 3QHFH 2VR4A 2EDHA 3D3VA 4D9LL 3QDGD 5K9KA 5CLTA 2H32A 3LV3B 3U46A 3SGDH 5C71A 4R90L 4EDWL 4IRZH 4PRPB 4Y4HC 4PLJD 3CX2A 1Q94B 1UJ3C 4KQ4L 2BOCB 4NQCD 5IBLD 1KN2H 3EYQD 2GSGB 1OL0A 5GZND 4LPXA 3MBED 4K94L 1RIUL 3WFBH 5E99L 5DS8A 2VLLA 4KAQL 2NY2D 1I9JL 3RVTC 4EVNB 4RGOH 1T5WB 3QDMD 1AHWA 1QFWH 1S7VB 4JPIA 1IGYB 2WMPA 4RMQA 4WO4D 2ZNWA 3OX8A 5I1HL 4QRRB 4M93B 3EOAB 4MB5A 5IOPB 3MRIA 4WJ5B 1KCLA 2PO6A 4LKCB 3BE1H 4P48A 4XP5L 1ZLWK 1RY7B 1Z5LB 3EDJA 2EC8A 4PJGB 3MRGB 3C6LA 1CDGA 3ZDYE 4JKWA 4PG9A 2LTQB 1T66D 5AZEH 4KDVA 5K9JL 4Z8FH 2IANA 2DQHL 3NA9L 4YEEA 2P48B 3HC3H 1G7JB 3RI5F 3IS0X 3RU8L 1MCRA 2FL5A 1FVCA 4GQ9L 3OAUL 4Q9QL 2YKLL 5JOFB 1IC1A 4P4KA 4HC1L 5DD6A 4OCYL 3RRQA 2ZUUA 2YBRB 3LPGA 5D96B 1MCCA 3BOVA 3QULA 1A6TA 4RFOL 3I9GH 1B4RA 5C0GB 2AJYH 43CAA 1TETL 1OB1B 4FXKB 3M17A 1D6EB 1OSZB 1ADQL 5KZCD 2KH2B 5KAQF 1C5DA 1MCLA 3QRFM 5HI3C 2X1WL 5CJQL 2FB4L 1EV2E 4BH8B 1GC1H 1OSPH 3PWJB 1HILA 2Z8VC 5DFVC 3KPMA 3EYFB 5FCSH 1KACB 5C2BH 1WBYB 1KB5H 3WD5L 1A22B 1BOYA 3U7WL 3S8WA 1KIUA 4GAJH 4OZFA 1MFDH 4XWOD 1ZWIB 3H9SB 1U8HA 2O26U 4WW1A 3U30C 4MXVE 5IVZA 3LSOA 2DQFA 1X5LA 4C57C 2PYED 1A6WH 1B4JH 4M1CC 4DEPC 4N1EA 1LO0H 3OKEA 2EEAA 3UO1H 3TZVA 4HKJA 3SO5A 3WCYA 2FX9H 4ZYKB 5F7DA 3KPQB 5MEOA 3KYOB 2ITDB 3W39B 3KXFE 3T0EA 3BWAA 1OY3B 2RFXA 4N0UA 2A83A 3IJHA 2CXKA 4G6JH 2ADIB 4JDTL 3HMWL 4OFVA 5E4EC 1H8NA 1A8JH 4L8SC 5C6TH 4NKDA 5EOTA 1NFDE 1BD2A 3WLBA 2D7NA 1YDPA 3LQAC 4HXAH 4MA7L 1PZ5A 2PTTA 5DRWA 3KLDA 5JW5B 1BEYL 4LF3A 5MI0B 3X17A 3VRLF 1J0YA 3U0WH 4XB7A 5E2JA 2OL3H 3RUGB 3QXWA 5A2JH 1NLDL 4O5LL 1Q8MA 3AREC 2G60L 4MDJB 5GJTL 3GIVB 3GJFA 3QI9D 1N5AA 2C7UA 5CSGA 5AZ2L 3F6LA 3MREB 5T1MB 4BSWB 3KLHC 1A0QL 4LARL 1E4KA 3L3IB 3T2NH 1A14H 3HFMH 5AUMA 4O51A 1OPGH 3TV3L 5JLZA 1A4JA 1DQDL 3SCMC 2AEPL 1SBSL 1UB5A 5HYSB 4IRJB 5EG6C 3NTCL 4CN4A 3TWCH 1R3JA 2B1HH 4KRMB 3RVXC 1AGCA 3UPRB 3NAAH 3OKOB 1RZJL 5FYKD 5TQ0L 3BIAX 4O4YL 3W9DB 1IFHH 5BZDA 1HSAA 2QADB 4HV8A 4NQDA 4P4RB 5B4MD 4MQSB 4Y8AA 4J3XA 4RAUA 2EIDA 2O5XL 5EU6E 2VDLL 3LS5L 4YC2B 5F9WC 4XNYL 3VW3H 1FG2B 5GXBB 5F71A 5HJ3A 5D7KD 1ED3A 2BNUB 1NLBH 3OB8A 2R8SL 1QSEE 4NM4H 4U6YB 3SHSA 4NDMA 5I71B 4YXKH 3QCUL 5JXEC 1GGYA 4ZPVB 4TUOB 4JAMB 1LK2B 2EIBA 3PGDB 3P0VH 4KROB 1K8IB 4NT6B 3MLXL 1OARL 3N9GL 4FFVC 4KTDL 1FE8L 4P9ML 3SKNB 4HBCL 4LMQE 2QTEA 1JPST 2DQUH 3MV9D 5FO7A 5JR1H 4WDIA 1H15A 4DKFL 2O93L 1CR9H 1EFXA 1F6AA 3F6IA 3SKUD 2AJ3A 2GQHA 3NFSH 3MRLB 3R0NA 3QPQC 1VEPA 5D2NA 2DQGH 4ORGB 2EEDA 4DGVL 1BF8A 4L3CB 2IPKA 1P4IH 2BHYA 2ORBL 4MJ5B 4AH2A 1HHGA 3CFEA 1CFBA 1U95B 4KC3B 4D0BB 1DDHB 1LO4L 1X6NA 4TQEH 4MXQD 1RULL 2EIZA 4DVBA 5DHYA 5IIEA 3PHOB 4NN6C 1E6OL 4R96A 3N1FC 3DNKA 1MCIA 2H9GA 1OHQA 4KPHL 2MQ0A 1PKQA 3MNVB 3WBDA 3KPOA 5JQ6L 4F7PB 1AY1L 1FV1A 4M6MH 1FGVH 4G80B 3QEQE 2DI7A 4QF1B 3VXOB 3G5ZA 3NCBB 3UDWA 3DUUA 2CDFA 3PWLA 1IKFH 1MFAL 1CGWA 3CFJA 1JI2A 1FRGL 4C55A 2CUIA 2DDQL 1JMZA 2YPVL 3AM8C 1LEGB 2VTFA 3PWUB 3VFPB 2EDFA 2ATKA 1OW0A 5C8JB 5I9QC 1J87A 2AK1H 3ZT7A 5D72H 3EJJX 4BH7B 2HFEA 4GRLD 4EI5D 4B41A 1PEWA 2OI9B 3GMLB 1RZ8A 2AAVA 2FJHA 1QSFD 4EN3C 2W9DH 4I3SH 1IAII 4CW1B 4YIQB 4ONFL 1X7QA 3EJZD 2WBJA 4P23C 1OM3H 5DYOA 4RGNE 4M62H 5DQ9A 4BUGA 4MB3A 3DO7A 3NA4A 3DECA 4MNHA 3MRMA 4QNPF 3Q6GL 4H1LA 5EO0A 3U9UB 1BFSA 4UQ2A 1JK8B 3WIIH 3SGEH 3FZUD 4EI6B 2X10A 4LGRB 1DL7H 3P4NA 4H25B 4HIHB 2B4CC 3D87B 5ICXB 3K2UH 4JQVA 4UB0H 1J0ZA 4HBQA 4PGEB 3BX7C 3N85L 1IGIH 4AL8H 2YXFA 1KT2A 2D9QB 2DMKA 3C9NB 3WN5A 1XCQB 1FNGB 1XF4B 3ZL4L 4XAWH 3P4OA 5C6WH 4XPHL 5GZOC 1CGXA 4I5BA 2EH7L 3FRPA 1IAIM 1I7RA 2Q20A 5CZXC 3ZHKA 5IUSA 1LO2L 4Z9KB 4Y4KC 1RZKH 4N0RA 3KJ4C 4PUBH 1BX2A 5FF6A 3EAKA 3VXQA 4CDGC 3RWIA 3C5ZC 3CSGA 5D1XB 3QQ9C 1YNLL 4NNYA 1JNLL 4B5EA 1NAKH 3BKCL 3DX6A 3R8BB 2NY7L 4XP4L 1RUQL 5E1AA 4RQQA 3GDBA 1PEZA 3QIUB 3QIBD 1KPUB 3WNMA 1F4YL 1I4FB