2EE9A

Solution structure of the 16th filamin domain from human filamin-b
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
95
structure length
95
Chain Sequence
GSSGSSGVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Filamin-B
publication title Solution structure of the 16th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
total genus 4
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ee9A00
4G8FA 2HT2D 4L4TB 5CKAA 5EIIB 1RUKL 3WSQH 4NFDA 5L2JB 4JG0H 1XGYH 5CP7B 3EYFB 3MV9E 3CC5A 1ZT4A 4K7FB 5GRJL 2XZAL 3VXNA 4MJID 5EN2B 1NGWA 1KLGB 2NY1C 2XZZA 3EGSA 3W0WB 4J3OC 3WL9B 5LWYL 3KPLA 1KB5H 4NM4L 3HE7B 3LCYA 2X41A 1CZ8H 1WQVT 1ONQB 3BYYA 3LOWA 1H9VA 3SKJL 3PGCB 2CR3A 4LKXA 3PJSA 4XVUC 1JN6B 1YDPA 3BEVA 4JM4L 5F1IB 1FIEA 4X6FA 1NBZA 3X11B 1QFUH 4HC1A 2R56L 2A83B 3FT2A 3I50L 3GSRA 4CMMB 3K3QA 4MA8L 1U91B 5IMOB 4RCAA 4OLYH 3RTQB 4OZGB 4UINL 1R0AH 4N0FA 3ZE2E 4NYLB 2NXZB 4I3RH 2F74A 4QOKD 5IFAL 3BSZH 4HUUA 2VQTA 3S5LB 5BXFB 5KW9H 1J86A 1AGEA 5IHBA 3VXUA 2MCPH 4WDIA 1UM5L 4KAQL 1DL7H 1U8QA 1MCIA 2DS4A 3V5DB 4NUGL 5I1IH 5C0RL 3B43A 3QXAB 4Z8FH 2GITA 4O5LH 2FEDC 5DRZA 3C08L 4HJGB 5I8OH 4LDOB 5F7UA 4PJDB 3MRCB 2A73A 4MVBC 5D96B 3BP4A 1FYTA 4OBSA 3WD5H 3HI1A 3JTSB 5F7YC 1C7TA 4XXDA 2D7MA 1JNLL 5ESVA 2G60L 4WHTB 2QHRH 1JUFA 2DIBA 5DJ8A 3O8XC 2FIRT 1QLEL 3L3HA 5F88B 5DJ6B 4P9ML 5C0AD 4GKNB 3FQRB 3GKZA 25C8L 2GK0A 1WBXA 1P7QB 4POZC 1BQHG 1TIUA 3FZUD 5JOPE 1T1WA 1CDHA 3W9EA 1L6ZA 4PD4K 3RWIB 4ZUWA 3GMRA 3WIFB 5E2WL 1YYML 2W9DL 1YPZA 2WSKA 2WUBH 3P0VL 4WUUD 3O41B 3T0EE 4U1IA 4W6WB 3HB3D 1HNGA 1NCCL 1AQDA 5AEAA 3ULVC 4HBCH 5CJQL 3SDXA 4HCRA 5HJ3A 4APQC 3DI2B 4H88L 1K5NA 1OARL 2RHEA 1GOFA 2M26A 5DMKA 1A4JB 1QRNA 3HG1D 4JO3H 3QI9C 3LEXA 2ADJA 1NCBH 3TPKA 3MOAH 5LQBL 5LCVL 3SOBL 4BA8A 5C07A 1KLFA 2AS5M 5LKNA 5H37H 1J1PL 4JFHD 4HS3A 4DN3H 1Z6JT 2X70A 3C5ZD 1CXIA 4LRNH 1ADQH 4BQ9A 3DHMA 4QRUB 3C60D 5HYQB 2VDMH 4C54A 1DQDH 3KS0H 4X80H 3GJFA 1A47A 4H25A 5HXMA 5E8EA 5AD0A 4U6XB 3RGVD 3JXAA 1IAKB 1MIEL 3DX6A 3PGDA 5EZOL 3DUUA 4TVPD 5JXED 5JOFA 2CDFA 4FFYH 1FG2A 2A74A 4KJQC 1P84K 1BGXH 1CS6A 2H8PA 1FPTL 3MFGB 4FZEH 4HKXB 3UZVB 2CQVA 1RULL 1P4BH 3C8KB 4JM2C 1A8JH 3CU7A 4I4WB 4WW1A 3S96B 1MHPH 2F9BT 3VXMA 4C4KO 3RVWC 5LBSH 1ROWA 4RBPH 5K93A 5DS8A 2Q87A 2OR8A 1DQJB 5HYJE 3BXNA 3BPOC 1OLLA 3WFBL 1MCLA 4U6VL 3O2WH 4RGMB 4A2MA 4M43L 4GRLD 3EZ8A 1DEEB 1YEEL 2R0WL 5DK0B 4F58H 3PWNA 4HF5L 4EI5B 3WYRA 4RIRB 3EZJB 3JWOC 4M6ML 4JY4A 3BI9X 1R3KB 1ERNA 3QUKA 1G0XA 2I5YH 3L3DA 1FN4B 1LO2L 4P4RA 3O4OC 4XP6H 1HNFA 3W9DA 5CINL 1AR1C 1KLUB 1HH6A 4FABH 1MRCH 4J3XA 1FGVH 1A7QH 1H0DB 2VLJB 2VDRL 3THMH 4NQCA 1I85C 2VLRD 2WBJC 3QZWB 4PV8B 4HKBA 3OAYK 5HHVH 3ALWA 4JO1L 1AHWB 3VXOB 3CXHJ 1DE4A 5C0EA 1KPUA 5DRXB 3QDMB 4WW2C 4GUPB 5GJTH 3QDJD 1YEFL 3OMZA 3PWLA 3BP7A 1MFCH 1S7QB 1FDLH 2K7PA 3JV0A 3QG6A 1A64A 2H3NA 1DVFD 5T1KA 3RZCD 4ZXBB 2BNUA 2HLFC 4OM1H 3WXWH 3L3OB 1K6QL 2XYCA 5FV2A 4DKFL 1ZHLA 4LCUA 1RQ5A 4ODHL 5DGRA 3MFFB 3O8XA 3QIBD 5J8OA 1BQSA 4NCC2 2DL2A 4K94H 5ILTL 2P7TB 1UWEL 4N1HB 4KI5C 1QSVA 2VJXA 5ACZA 1TPXB 4XPAH 2HFFA 2W60A 1A6UH 4GAGL 2ICEB 5FUOL 4LCWE 5F9AC 5C0CE 1EMTH 2HG5A 3AREB 4MCYA 1GHFH 2Y9RT 4WU5A 2D0GA 5DJCB 4FFVD 3FO0H 3I6GA 4Q0XL 1EUTA 3CFDA 1QYGH 1FL3A 2G5BB 3QCTH 4PJFE 4DKEH 3DPBA 2AP2A 5EC1B 2D7OA 2NW2A 4KZDL 3HUJE 4APQA 3DVNA 4JRWA 1AXSB 3IDIA 4LQFH 1QKZL 4EI6A 3U7WL 3MRKB 4NBZB 3V7MA 1U8IB 3QI9A 1TVHA 5E4EC 1NBVL 4H1LG 2B2XH 1HOCA 5HD8C 3WHXA 1DBAL 1IEAA 5EBWB 4JHWL 4LNRB 4MCZB 5C0FA 3S6CA 1D5IH 5C0ND 4HUWB 1IGFH 5CEXB 1A3LH 4H20H 1HIMH 1C5BL 5JNYB 2YR3A 2D4DA 4FZ8H 4K7PL 3IVKB 4L8SB 3ILQD 5TE6H 3ARWA 4DZBB 1DFBL 1XH3B 3B5HA 1WWWX 3W39A 5ID0A 5ID1A 5ITFB 3D3VA 3HUJF 4TUJB 5F3BA 4ZFZB 1E4KC 1NCWH 3T0AA 4R0LB 5AAWA 3SJVD 4OZFA 5GS1C 3L3JA 3F58H 5DJXB 3TVMD 3BVNA 3BPLB 1OGAD 5HHMD 35C8L 5TGBA 3U9UA 4YEFA 2EC9U 3MRPA 1JZ6A 1F58H 4JM2A 5F96H 3MA7B 1A22B 2VABB 3OQ3B 3EYUH 4P9HL 1TZIB 1U58B 2XXMB 4OCRL 1JHKL 2VDNL 2BNRA 2EYTA 3DHJA 1G7LB 3ARSA 2BOBB 4HS8L 2C3VA 4RMSA 1NLBL 5K9KB 4F15C 1QSFB 5D93C 5F7HA 1OTUC 1WV7T 3TO2A 2AKRB 5IQ7H 6FABL 4FP8H 4LCWB 2J12B 1KJ2H 3IDMA 5DHVB 1YNLL 4OCYH 3DRTB 4CJ0A 4WFHD 1BFVL 5ACLA 1M6OA 4CGTA 1F4YL 4PJFB 5IQ9B 4PTTA 1KCRH 3HAEG 4OV6F 3QO1A 4NN5B 5EZJA 1Q38A 3U6RB 3HUJB 4LQ1A 1JGVL 5EWIH 4QHLA 1I85A 2WBJA 5E1AB 4PIRF 5TFSH 4OFVA 4S1RH 2P8PA 1NCAH 3SKUD 3MRDB 4YDIL 3C6LC 3BQUC 1BFTA 3NAAH 4IRZH 4WW2A 5J57B 1ZEAL 5ADOL 3ULUC 4M7KL 4X4ME 3VRIA 1T6WA 3O0RL 2XPGB 4Z0XB 15C8H 3BN9D 1XR8B 2CPCA 4KMTH 3DROA 4XMPH 3HN3A 2F8XC 2W91A 4OD1L 1IT9L 4NC0B 1HZHL 3EJYD 4ENEC 1X5ZA 4P2QA 2PETA 2HVKA 2GUOB 1YNKH 1HI6B 1AP2A 3SKMB 3NZHL 1YNTA 1G1YA 4S0TD 5I1AA 5I6XB 4UB0H 3BAEH 4RFOL 3DECA 4LAQH 3HRPA 4WI9A 3S3SA 3RWCB 1FVCB 5FIEA 2VDPL 3KPRD 2SEBB 5DD6B 2ZOLB 5F44A 4LVHB 2YPKA 2MPAL 1W0YT 1ZVHA 2WANA 2FRGP 3WLBB 4HPOL 4JEGB 4MNGE 5IMKA 4PGCA 4Z76A 4ODXA 1W0WA 3S37L 5M94B 5GRUL 4WI8A 4HS6A 4GMTL 2HN7B 3MCKB 1FL5A 2W92A 3QA3A 4NQEE 1ZGLM 1U36A 5E24E 4CNIB 4YK4C 1DDHB 2DF3A 1NEZG 1T3FB 5C71A 2X4SA 3V9FA 1W0VA 1KNOB 3MLUH 3HMXL 4NRZA 4OLWH 4G42B 3ZKXB 4TUKL 5AG8A 3H42H 3K8MA 5BOPA 2CUMA 1EA9C 3C9NB 3BDXA 3HZYB 3HC3L 1KJMA 4HHAB 3UCRA 1FYHB 1IRAY 5D5ME 3VXTB 1WICA 2AK4D 5GIRA 1LO4L 2HT3C 5J1TC 2AEWA 4RGOH 1JFQH 2H32A 5IF0A 1B6DA 1SBSL 3VG9C 1NSNL 1U93A 4RQQB 1AGFA 1NCTA 3CDGB 3MRBB 4ORGA 2P8LB 5CD3B 3OZ9H 1E4KA 4Y5YB 2RCSH 5DDHB 5EC2B 4OB5L 5DC9B 2P46B 5GS1A 4ZG1A 2MNUA 3AS1A 4JREB 1G7QB 1MHHA 3GBLA 1KPRB 3OKNA 5E03A 2ZUYA 3LQAL 4CAGA 2DBJA 1T7ZA 5D5MF 2IPKA 4K3EH 1HHIA 2HTKC 2FO1A 4Z7WA 5J56B 4LCIH 2CDEA 3GSWB 5E8NA 3MV7D 3ARBB 1LE5A 3PQYD 4N9GB 4MNGB 2ZUWA 4JB9L 2FJHA 4U05A 1AD0B 3TO4C 4KV5E 3SDCB 4B0MM 1BPVA 4CADA 2DM3A 1NDGA 1CLOH 5BRZD 2PNDA 1HYSC 4LSVL 4P5KB 4XCNA 3S97C 2Y7QA 4NQEB 5HHQA 3D18A 5JXEC 2ZOKA 3FMGL 4M6NL 1WFNA 4Z78A 1P53A 5DRWB 4BZ2H 1YY8A 4WEBH 2EDWA 4V1DB 2FIKB 2W0FA 3UC0H 3ZSTA 5LVEA 1MCOL 5TH2A 3KPMA 4M3JA 3RZWA 4DEPC 2QQNH 3MLXL 4M7JH 3KLSA 5I9QB 5F70A 5IESL 1WBZB 3ZDZE 3MNZA 3QNZA 3IDJA 5IFJB 3ES6B 4HJ0C 5EFIB 2ZSWB 2CLZB 3GBML 4KHXL 3K1KC 3LS4L 1RZ8B 3C6LA 2FGWL 3BQUA 5HVHB 1RFDL 2EYSA 5DT1L 5IG7A 2J6EL 4KVCH 4KV5F 4IS6A 2OL3L 5E2JA 1MJJA 2EECA 3WUZA 5AZEL 4W4OC 2EDEA 4M1DH 4PJ8C 5C0BE 4ONHA 5CSZB 4AG4H 2NLJB 5IK3B 1YUHB 4KJPC 3VD5A 4KZEH 1F3JA 3KPPB 3BMWA 4OQTH 4D9QE 2Q7YB 2EKSB 5F1NB 1T7YA 5CP3A 1E4WL 5DRNA 4GS7C 2LTQC 2QL1A 4K23H 2HJKA 2UUDK 4HX1B 2OQJB 2XIDA 4M5ZH 3CZFA 3IAPA 5FUCE 1BVKA 4PGJA 5DEFA 5MENE 1QFPA 2OTUA 1NL0H 4LMQE 4MAYD 3UTSD 3ALXA 3BE1L 5D70H 5SWZD 1U3JA 1F8TL 4OF3A 5B4MD 1UADC 3JTTA 3QCVL 4YWGH 1S9YA 3I3DA 5F9OH 1LGVA 2LU4A 3I02A 2VLMD 2BERA 1MJUH 1HHGB 1Y6MR 5I1HL 2A77L 3MRLA 3FQXB 5GGSY 5EIQA 1T1ZA 3K4ZA 3NTCL 5JR1L 1KCLA 5DFVC 5KTEH 3OXRB 3RWHA 3U36B 3WJLC 2DI7A 4X5XA 1T7VA 2H6PB 1LK2B 4PYHA 3VJ6B 3UPRB 3SDAD 3A67L 5DK2A 1FQ9C 1PFCA 3BT2H 4TN9A 1CDIA 3WUWA 2VDLH 3EO1A 5BV7H 1N6QL 4R8WH 1A5FH 1AQKH 1C08B 1RVFH 3ARPA 3MRGA 4X0KA 2YWZA 4JFDB 4Z77A 2DWEB 5C0BB 3O3DB 3RVUC 1CGSL 1VFUA 3GHEL 2RB8A 5EBMB 1CE1L 2G75A 3KYMA 4RWYL 5LGJA 3L3GB 3M17A 1NJ9A 4HWUA 3QHZH 2VXQL 1ITBB 4IJ3B 3KXFE 3PWVB 4KKCD 4MGXA 2CRYA 4PGEB 1HSBB 4PRAA 4ODWB 1L4IA 4F7CB 5DURD 1CVRA 1C16B 3TO4A 3QEHB 4UIMA 2ADGA 3G5VB 3OKLB 4NT6B 2ZSVB 4NZDA 2A9NL 2P5WB 5JHLL 4UOW0 3EOTH 1NGYA 4NQUA 4ZAKD 1BEYL 4U1KB 5JXEA 5C09E 2YRPA 3BKJH 2ZG3A 5ECJE 4HLZH 4P4KD 1UQSB 2GTWA 4FQJH 4NCDA 3DTXA 5SWQB 3DUSB 1SBBA 5D72H 3VWKC 4X7SH 4NDMB 1ZA3A 4D0DB 5C0DB 5KSBB 4KK9D 1OD7A 1WC7A 1PW3A 2GJ6B 5IBLC 1I1FA 2A9ML 1T4KB 4BSWB 4W6XB 1I8KA 4GH7B 2R1WA 5SX5H 1UXWA 4YQXH 2A0LC 4N90E 1QTYT 4W4OA 3HAEA 3ZLQC 4PJ8A 4Y1AD 4MNQA 2WUCL 3RU8L 1XF2B 2QQKH 3HE6D 5D2LA 4CVXB 5FFLA 4CN4A 1YYLL 2KZ1B 4UILH 3RWEA 3LKQA 1EK3A 4I0PB 1XIWC 3TBTB 5TQ0L 2BJMH 3EYQC 3WNMA 1FZKB 4Y2DB 2R9HC 2VISB 4PJEA 3H0TB 5J06A 4ALAH 4NRXA 1DR9A 4QF1B 3SHSA 4UT9H 2XFXA 4JDZA 1Q9OA 4QGYA 1GRWA 3D39D 4XCFL 5GGTA 1AKJD 3FO1A 3OKEB 4K7PY 1KFAH 4PBXA 1C5DB 2UZXB 4HUXA 2IH1B 4WI2A 5HGHA 5DHYB 4XH2A 5D7KE 5D7IA 4M5YH 3KXFB 1QR4A 1UJ3B 1SYVA 1R3HB 2X4TB 3NOIA 1PBYA 4XVTL 5L9DL 1CLZL 3CUPA 4WUKL 1OAKL 5E2VL 4YAQA 3QDAA 1F4WH 4PJ7E 4U1HA 2FJFA 3F7PC 1ZT1B 2BNQE 3VXRD 5ISZA 1FO0B 3DETC 3MA9L 4JHBA 3EJYC 2Q7NA 2AERT 4XC1L 5FKAA 3K46A 4PS4H 2E7CA 1XGTA 3O2DL 4LGPB 2YSSA 5B22A 3VCLA 5DI8A 1KIQB 1UA6H 4ZD3H 1FH5H 2VLKD 43CAB 3RDTD 4BUHA 1FBIL 3WJLA 5L88L 4MXQD 4ELME 4J3UA 1YN7A 2GKIA 1A6TA 1FZMA 1N8ZB 2W38A 2PN5A 1OSPL 1NEZA 3MREB 1X4YA 3QAZC 3STZA 4PJ7F 1RU9H 2Q20A 5CJ8A 3STLB 4JO2H 1Z2KA 3AVEA 3DVFA 4OCNC 3LEVH 3MR9B 5JO5A 3MRFB 3BD5A 4W6YB 4XCCH 3ABZA 4FRWA 3M45A 4KVNL 4QRPD 1ES0A 3UX9B 5FYLH 3SE3C 5EO0B 1FLRL 2FCBA 1MCPH 3O6KL 3RAJL 3J7HA 2FZ3B 1EEYA 3K4AA 3BIBX 3BZEA 5CUSL 2ZCKL 3FRUA 3REWB 5IB5B 4ELMF 2YPVL 3RNQB 1FFNA 1YEKH 3ILPA 4R3SA 5HDLA 4DVBA 5EU6B 4G80A 1HKLH 1JGLH 4RNRA 5MP6H 3RY4A 3TEUA 1REIA 5IJVA 4KJYA 1YA5A 4HH9B 1KTLA 1TQBB 4L4TD 1IKFH 5F7EH 1R3JA 2YD1A 2A6DA 4UTBL 4FFZH 1J87A 1YEDA 2YC1B 3GSNH 4H8WC 1UEYA 2GY5A 1HILB 4HUNB 1BJ1H 3KDMB 3MTRA 4U6HB 3W0WD 3LKPB 1CL7L 5AUMA 3SGKC 1B9ZA 2QKIA 2B1AL 2BNQB 3HE7D 4XCYB 4TVPL 1J8HB 4LKCA 4RMQA 2NMSA 5I30L 5FDWA 4N8CL 3VWKA 3DWTA 5IHZB 4C83B 1EO8L 4GSDL 1Z9SA 4RGNB 2DTML 5A2LH 1LMKA 1BBJB 3RTQD 3CH1A 3HR5B 4TNVK 3LIZL 2MHAB 1A7OL 5MEQB 1W72L 1Z3GL 4NKIL 4DW2H 5GRJH 2WQ8A 3OBAA 2BCKA 3K2UH 3S36L 1CBVH 2X4OB 1XIWA 1XCQB 4WENB 1QUNA 4B5EA 3V0AC 3MJ9A 1P4IL 1JI1A 4Y16B 4PV9B 4PJBB 1I3VA 3GUTB 1K8DA 4JM4H 2A2QT 1L7TL 2NY3C 4O2FA 2V2WB 3FT3A 1U8NA 3L7FA 5BS0A 3MBEB 5E95B 1A7RH 3I50H 4X6BA 3OX8B 4CDGC 4GQ9H 5I75B 3CH8A 3GMNB 1X9QA 1DBBL 4OGXH 4DK3A 2BRRL 5C92A 1NCUA 1XF3B 5GSVA 1LDPH 4LASL 5EUOA 4WY7H 4YDJA 4YHLL 4K3HA 4NKDA 2YWYA 4HIIA 1QSEE 5EA0L 3TWCL 4X8JA 5HVGB 1R3LB 2FLBT 4LSQL 1P7QD 3O3AA 2X1XR 2VOTA 4YBQC 3GJEA 4OZIE 1HXMB 1BQLL 1X7QB 1AGCA 3T09A 2ZUTA 2CGRL 3IU4L 2FNBA 2APXA 5HPMA 1EGJL 3VXSE 4K8RD 5TF1H 5J13B 2G60H 3MRJA 1MFAH 3I6LE 3SKOB 3CCHA 3ARGB 2VRAA 4ZUTA 1GZPA 3EHBC 4JZNB 2B8OT 3MV8E 1QR1B 1OP3H 4UBDD 5I74B 4BM7A 25C8H 3SE3A 3L3KB 4XP1H 4OZIF 2JTDA 4Z0BH 3RWGA 3EOBB 1P7KA 2RBLA 3CSYA 4PJHE 4P3CL 4WCYL 1U9KA 5D9SB 3RWFA 4F9LC 2F54E 1FIGL 4PJCA 2EEBA 2DWDA 1T1YB 1T66C 2W9DH 32C2A 5JIPA 2R1YB 1BD2A 3V4VL 3MX0A 3P0VH 4U1GB 5DFTA 5MEOA 4GAFB 5L6YL 4XX1E 2FSEA 3QNXB 3LN5B 5FB8A 3HI5H 4LDEB 2WBWB 3OJ2C 4H88H 3O6FB 2YK1H 4JFFB 1H15A 4G6ML 4PP2B 2ENYA 1KYOJ 5L7XL 2P44B 4NP4L 3SGKA 3Q3GB 4PBVC 1SY6H 2FX9L 1NKOA 4XP4L 2R0KH 5EUKB 3SE9H 3ARVA 3QFJE 1RZJH 5IEHB 3N1FC 3L6FB 4IOIB 3PNWA 5JOPD 5D8JH 1ZAGA 4WWKC 4NQDA 4EI5D 1AD9A 3PABB 2DQDH 3DXAE 4KK5D 4HW6A 1CF8L 5IGXH 4J3SA 4HXAL 1UVQA 4KQ4H 3QXTA 1MIEH 3OR7B 2Q3AA 4PRPD 1NMCC 1NUFA 4MXVE 1ZHNA 1UB6B 4EDWL 3F5WB 4P57B 1FPTH 2YZ1A 4MJ5B 3EOAB 1RULH 1LHZA 1JI2A 2E7LC 3ARZA 4LHUD 4ZUSB 4HG4J 1QA9B 2VLJD 4ZFOA 4YPJA 3TFKC 1I4FB 2BZDA 3OKYA 1WITA 4MAUL 4DGVL 3MV8B 1KIRB 3QDMD 2QSVA 3BWUC 4U6VH 3U2SA 3C5SB 5F1OB 3L5JA 4LF3B 2VE6B 4BFIA 1ZTXH 1RZGA 4F7TB 1WZ1H 3RWJA 2C4XA 4PJHB 5F7KC 4MXWL 5FUZL 2X1WL 5DTFA 4HC1H 5IVXE 3N50A 4MXVF 3DIFB 3FHQA 1B88A 4ZXBD 5T33H 1KELL 4S2SB 5E5MA 5F3HB 2XXCB 2NNAA 5CINH 7FABH 1WFOA 2ADIB 3HE6C 4DVRL 5ESAB 4E41B 4TSBH 4ZFGL 1NDMB 4JJHA 4EN3B 3HC4H 5KVDL 2B4CH 4P3WA 1YEJH 4YFLI 3SGDI 3VMOA 3GSXA 2WAHA 2EO1A 1INDH 3H9YA 4F7EA 4XPHL 4F2MB 1KF9B 1ZMYA 5K9JH 3U30B 2BP3A 4M1CD 3QFJB 5A16A 3ARED 2Z91A 1G6VK 5IVXF 3UZEA 2DBLH 4U6YA 3FB5A 3CLEL 1VB9A 1BM3L 4U1JB 4CVUA 1MFBL 2XWBB 4WI6A 2YPLB 4G6KH 3UTSA 4OD3L 4TNWF 1N7ML 4FQCH 3QQ3B 2L7JA 1Q9LA 5F9WB 1ZGLA 2MKWA 3FO9B 5BJTA 3MSPA 5KAQF 4E0RA 4QHNB 1U8MB 3OKOA 3GRWL 4YXHL 3DO7A 2RJMA 1ZA6A 4J8RB 4JY6A 3HI6L 5FO9A 1MNUH 1AE6L 2EDFA 4NUJB 1S7RA 5HY9A 4M61B 3OPZL 4QGTA 3I84A 4I18C 4KKNA 4M9PA 4UV4L 4G8FB 2QQLH 2NPLX 3PDGA 4YBLC 1N59A 1U8LA 1WT5A 4GAGH 4L4VA 4F9LA 1YJDL 1DLFL 2D7PA 4MB4A 2FX8L 3OKMB 5J3HD 3CC5B 1ZT4B 4OLXL 3VXNB 3FT4A 4EQ3A 1IGCL 3HPLA 1NGWB 4ZO9A 3EGSB 1CN4A 3KPLB 5MEPA 2GFBA 5TE7L 4OCLC 4ZS6D 3TNMA 1KT2A 2LE9A 4KUZL 4JZJB 1FNSH 4LKXB 1QKZH 4HCRH 1YDPB 3BEVB 5KS9A 3B3IB 3H9HA 4X6FB 1NBZB 5L8KB 2FH8A 1NBVH 3FT2B 2XTJE 4TQEH 1GGTA 3QUZC 4QRTB 3GSRB 4MQXD 5T3ZH 2ILLA 1DBJL 3RI5F 2CKBA 2OP4L 3GHBL 2AXJA 2YD5A 3NCYP 4IM8A 5C08E 1PYWA 1S9VB 3V4PL 1MJ8H 3IDYC 4N0FB 4HQQH 1OVZA 1C5BH 2F74B 2RGSA 4WWKA 1QSFD 3TF7C 1I3GL 3V0VA 3T65A 3KPSA 5DVOA 1AGEB 4YHOH 3VXUB 4PJXA 2XA3A 1A6AA 2HKFL 3I9GL 2XKUA 3GJFH 4LCWD 1TFHA 2VZOA 1U8QB 3IXAA 1HCVA 4NZUL 4ODUA 2YXMA 3G5ZA 1PKQE 1IGML 1M7IA 1SJHB 2GITB 3MODL 4L3CA 3F6IA 1H3PH 4QXTA 1J7VR 5DRZB 2E7LA 2HJLB 4LLMA 3AXLA 1E0OB 4WIQA 5DJ0A 2A73B 4KRPC 2UWEE 1S7SA 3BP4B 3LHPL 3HI1B 1L9MA 4OCRH 2VDNH 4LEXH 3NFSL 2Q8BH 4X6DA 1OAQL 1CFVL 1KPVA 4XXDB 5E8OA 1QQDA 5EU5A 3H3KA 5ESVB 3DX7A 4WV1C 5TE4L 2JJVA 4M03A 1JUFB 5DJ8B 1EAPA 4CN6A 3L3HB 1TCRB 4S1DC 5LXGL 1DLHA 4X6CA 6FABH 5F89A 5LG1A 2NXZC 1HXYA 3LVEA 1WBXB 1FL6A 3ARYA 2VUOA 4F8TA 1T1WB 5DEZA 5JW3L 1ZVYA 4ZUWB 3TJHC 3GMRB 3HE6A 1AY1H 1A9EA 4NM8H 4KROB 2UWEF 2ORBH 3U0TA 1YPZB 2X6MA 1U6AH 5SWSE 4U1IB 4WTXA 3PF2A 3GKWL 3LKRA 2VWEE 3IKKA 3PUCA 3SDXB 3DBXA 4OIIL 5HJ3B 4F7MB 4FQHB 5IR1A 2J8UA 1K5NB 4J6RL 2DQGL 4HXBH 5DMKB 5EO1A 5B38B 2NY5L 1GZQA 4TPRL 2XKNA 4OD1H 1UZ8A 1AGBA 5DMGC 5C07B 1IC4L 1KN4L 3H9SE 1EHLH 4JDVA 4PLKC 2ZP0T 1K9TA 3B5TA 2X70B 4L3EA 3PV6B 1HWGB 5H35B 2M1KA 4OCWL 1QO3A 2VDPH 4GMSL 1GPOH 5F9JA 1J12A 3FB6A 3SPVA 4NGHL 5E8EB 1JYNA 5AD0B 3VDAA 1CDJA 1HHKA 3DX6B 3FRPG 3PGDB 4I18A 5DGQA 1FNGA 4MHHI 4HKJA 1N0XH 3RUGA 2ZNXA 1NC4D 5JOFB 2CDFB 4J1UB 1FG2B 4K07A 2A74B 4JQXC 3ZHKA 5J4MA 1GYAA 4O2CA 4UTAL 3QR2A 2YMXH 2H2SD 4ACPA 4KHTL 2X40A 1OQXA 5CD5D 5C7XL 2NY1B 4WW1B 4K8RC 1L6XA 3IFOA 3VXMB 4ZUVA 4HK3N 1QLFA 1GC1L 3HMXH 1RV6X 5DS8B 1DQQA 2FYYA 1PLGL 3BXNB 3ULVH 4NWTH 4P2YA 3DOSA 4OGYH 1NGPL 1DANU 3VFOA 3MO1B 4LP5A 4WHYG 3PWNB 1JZ5A 5INCA 3QUZA 2ARWA 4JY4B 4G8GE 5A3IC 1IEHA 3QUKB 3M1BA 4IOFD 3L3DB 3CLFL 1G7MB 1BAFL 1LO4H 3ARBD 1RJYA 3OGCA 5E6YA 5SWSB 2JJSC 1U8HA 5EOQL 3MNWA 1PGRB 1BP3B 5GGRA 1PZ5B 2FD6L 5HHNB 3SDCD 2VH5L 3I3EA 5CS7A 2OR9L 1IQWL 2NTFA 4NQED 4BKLB 4NQCB 1GXEA 1CFBA 4BYHA 3R0MA 4HKBB 4IOSD 3HKFA 4HBQA 5JMOC 5LJYH 5L2JA 3P4MB 1DE4B 5D2NE 5C0EB 1KPUB 4K7FA 5M7QA 2V5TA 2MWCA 1S5IL 4ONGH 4M7LH 3H9SB 1NCDH 4V1DD 1VGEH 2WWKO 3S9DB 3CVIL 1KLGA 1YC7A 4OIBA 4OZFH 1QEWA 3NH7L 3PWLB 4DWHA 3P9LB 5FYJU 1OTSC 4LSUL 4O02L 4M93C 1Q8MA 3QG6B 4KTDL 4JRXE 5JPMB 4NO2A 4J3VA 4RGMC 5T1KB 4PG9A 2BNUB 4EIGB 4HMCA 4FQ2L 3E6HA 1L0QA 4MDIA 2NYYC 1ZHLB 4M9OA 2XT1B 4WV1A 3HNTL 1FRGL 2V5YA 3JWNC 3HS0B 3O8XB 3WFDH 4KK5C 1BOYA 2CUHA 2MQ0A 4KTYA 3R1GH 5D7LA 5I76B 5E6IC 4OZGA 4M6OH 4YGVA 4ZMAT 3T0EC 2EXWC 2PYEA 3GSOA 2BSSB 5JUEH 2I24N 3UJIH 2RQ8A 4XWOC 5ACZB 4X4XA 5E0QA 3PDOA 4YBHA 2W60B 4JFEE 4QRRA 2YA1A 3BKMH 4PRHA 5CWSA 1MCOH 4B7LA 2HG5B 4FTVE 3BOVA 2HMID 1NUNB 2EE9A 5GRXG 1NBYA 5JOEA 1FL3B 2Y72A 5LGHH 3UYPA 3GMLB 3LS4H 2CIKA 2FGWH 2I26N 2NW2B 2C3GA 3DMMC 5I1EL 1UCBL 2J6EH 4APQB 2HRPL 1N5YL 3MUHL 3QDGE 5FGRA 4Y8AA 5IBTL 3ZTNL 3FL7A 5AZEH 1FAIH 1UT9A 1GCFA 1TVHB 4DUVA 2BHUA 1A7PH 5HTSA 1HOCB 3U0WH 4M1GH 3WLWD 4WHTA 3WHXB 1DUZA 3X17A 1EPFA 5E99H 4OBRA 5C0FB 4QXUH 4XHJC 3RIAF 3WXVL 1GL4B 3MV9A 3D69A 1NUDA 1F4XH 2V7HA 5ID0B 1I9JH 1Q1JL 1TPXC 3D3VB 2BVTA 5F3BB 3WIFA 3QULA 3FJTA 3KLAB 3BE1H 4JRXB 3L3JB 4JQXA 4HZLB 4JFZH 1U8OB 4JG1H 1RURL 3BVNB 1KG0A 4J4PD 5JDSB 5TGBB 3MRPB 4JM2B 4JFXA 1JPTH 2CIIA 4JFDD 3P0YL 1OCWL 5C0BD 5I15H 3BPOB 5IB4A 1A4JA 3NTCH 5JR1H 5HDQL 1W8NA 2XI9A 1JTOA 5CLTA 1RK0A 5IEKB 5E1HB 3MRQA 1RIHH 3TO2B 4LSPH 3A6CL 3QWRA 1FSKC 2F53E 1LO0H 3UTPD 3IDMB 5DUBA 4FTVB 4JFPA 3RWDA 4QRUA 1MAML 5HYQA 3O4OB 2NTSP 4HGWA 1ETZA 1MCKA 1M6OB 2JJSA 4RRPG 4XBEL 4PTTB 2ITDA 5EZJB 3DNKA 2P5WD 4N1CA 2H32H 2VXVL 5DVKA 2AV1A 4QHLB 3QDGB 4F7PA 2H1PL 2WBJB 2ADFL 3SGJC 1YC8A 1MVUB 2OI9B 4CW1A 3MOBL 3BDYL 4MDJB 4WW2B 3MACH 4JPVL 2QJDA 3VRIB 1CE1H 5EORH 3ME0A 4NNPL 4A6YH 4K2UH 4P5TB 1DQLL 4K3JL 1PG7L 2Z8SA 3DROB 5EOCJ 5IIEA 5L2KE 5GQBA 4Q9QL 5B39G 43C9B 4DKDC 1DBMH 2GJ6D 2AABL 1X44A 4P2QB 4R2GC 1MCQA 2HVKB 4OLUL 1AP2B 2DQHL 3A6OA 4FMFA 1EJOL 1YNTB 4GO6B 5I1AB 3QQ9C 5J9PB 2J5LC 4JHAL 3WKML 1VEOA 2A9NH 1I7ZA 5E6IA 5JHLH 3O45A 3N1QC 5ALBH 5L8LB 3E6FB 3X13B 4RWHA 2YPKB 1F2QA 3T0EA 4I0PD 5IMKB 1RZ7L 4PGCB 4Z76B 4ODXB 1J10A 4NN5C 4Y2DD 3SN6N 5KN5B 5DJDB 1ORSB 3ROLA 3QUYB 3BYTA 4HS6B 4NZRL 1FL5B 2DQFA 3QA3B 1J1XL 5IW3A 5HI4C 1FVDB 2EDKA 3B9EA 1MY7A 3UPAA 3DV4A 2ZKHH 4TTGA 5F1SA 1M05A 1U95A 1W0VB 3S4SG 1OW0C 3DSFH 3DMMA 4NRZB 1H3VA 2WV3A 3KXFD 5C3TA 1WWAX 1S7QA 5EPMA 3ULUH 2VZ3A 2XA8L 2GSGA 1WISA 3UYRH 4XBGA 2LV4A 3BPCA 5T3XE 3G6DL 3NCEB 4NRYA 4N0CD 5TQ0H 5GRYA 4HIXL 1INQB 3ARUA 4LVHC 1G7JA 5CP3H 3VG0L 4X9IA 5INDA 2H32B 2ESVD 2P7TA 1U93B 3OSKA 3ZL4H 1QBMH 4XCFH 1LO3L 2F5AH 2VYRE 4WI5A 1KXQE 1TLKA 4HIJA 3RKDD 3WSQL 2YD8A 5HYJA 1XGYL 2HT4D 4XVTH 5L9DH 1OAKH 3LD8B 2Q3ZA 3ET9F 3E8UH 2P48B 5T1DH 2G5BA 5IMLA 2PW1B 3LB6D 1KB5L 4AEIH 1CZ8L 2IPKB 1HHIB 3O2DH 5LAXA 2AXGA 3HRZA 2CDEB 1XCTA 4FFWC 5I19H 3FRPA 1D3CA 3QWQB 1LE5B 1U8IA 1LO5B 1QFUL 3BWAA 4L4JA 4MLSA 4JKMA 5C3LD 2D9QB 3P40A 5EU6D 3V6OE 5HGDA 4XCEA 2APVA 5EBWA 4CADB 4MCZA 4XCNB 1R0AL 2Y7QB 4HUWA 4BK4A 3AUVA 3D18B 4RAVA 1ZANH 2ZOKB 5JNYA 4Z78B 3BSZL 2W0KA 3IVKA 9CGTA 4DZBA 3QHFL 4FNLH 5KW9L 2LU3A 1XMWA 1XH3A 1MWAA 2W0FB 5MHSD 2BOCA 5FO7B 3BIKB 5EZIH 3TCXA 1M71A 1WGOA 1NCNA 3IDUA 1DL7L 2DYPA 1KGCD 5FYJE 3KPMB 4FQIH 2X10A 5I1IL 3KYAA 3SGJA 3MNZB 3IDJB 1X5GA 1OQOA 3O6KH 5C2UB 1J8HD 3FHAA 4O5LL 2EKJA 3U1SH 3C6LB 3BQUB 2Z4QB 4C56E 5JORA 4RMRA 2EYSB 3CFIC 4X5LA 5I8OL 4YO0A 1UWGH 1MJJB 5FDYA 1WEJH 1NGXA 3QUMA 4G8EB 2ERJB 2IFGA 4M00A 4TUOA 5ESQA 3WD5L 1CI5A 2NZIA 4PJAE 1JVKA 4IOFC 4ONHB 4RGND 3IU3A 2BOBA 3K81A 3JWDC 2QHRL 2ICCA 5CJ5A 5ICYA 5BZWA 1MJ7H 3SDCC 5DRNB 4UTBH 3QEQE 2HJKB 4LCWA 4MQTB 5F8QC 5C0CA 5DHVA 3DRTA 1BVKB 5JXAH 4PP1C 3QO0A 5F6HI 5DEFB 5MI0B 3JV6A 4ONFH 4PJFA 1KULA 1WBYA 1CGWA 3SBWC 4Y16D 3HUJA 3WDHA 5I30H 4X7TB 1X5IA 3FN0L 3FO2A 4N8CH 2B1HH 5HI3C 3JTTB 4PJAF 1S9YB 2WUBL 4YK4B 4H26A 8FABA 3MBED 4G9FE 5FYLD 2VXSH 4DTGH 3I02B 2I07A 5C2BH 3MRDA 1GAFH 1BF8A 4GSDH 4HBCL 1E4XL 1UH3A 4DOHB 1OW0A 4Z7QE 2GY7B 3MRLB 4M6AA 4Z0XA 1T1ZB 1XR8A 1W72H 1NKRA 2OXHA 1YEIH 4JO3L 2QSTA 1KUMA 2RIKA 1NCBL 4NNYB 3GI9L 3MOAL 5IROC 5I1DA 3OKKB 2BVOB 4I3SH 1CDCA 2GUOA 4D9RE 4DN3L 4HWEH 4N9OB 4LRNL 1QP1A 3V8OA 3EAKA 2VDML 3BFOA 3OF6D 5DK2B 1FVCA 3MUJA 1DQDL 2SEBA 3OGOE 1ZOXA 2ZOLA 4RMVA 3K2MC 4X80L 3L9RA 4WI3A 5JDJA 3EO1B 3VG9B 5E08H 2FBOJ 3IFLH 4Z7QF 4X0KB 4MYWB 4H1LB 3FKUS 4FFYL 5GGTH 4Z77B 2HN7A 3B83A 3H8NA 3MCKA 1IILE 1DBBH 3D1MC 1RUMH 3C2AH 2XOTA 4JN1H 1T3FA 3ARGD 3KYMB 1MHPL 3M17B 1NJ9B 2R29H 4NOBA 4JO4H 4GW1B 1F3RB 2LAGB 3O2WL 3V8CA 5C0GA 1G6RB 3C9NA 4GBXB 4F58L 3TNNA 3TO4B 1QFOA 1A9BA 4HHAA 2ADGB 5BO1H 3T8XB 2I5YL 3VXTA 3CSGA 4YUEL 1F2XK 1NGYB 4XP6L 5D1XC 3GMMA 1SVCP 1RJLB 1HQ4A 1JL8A 4Z5RA 3RVVC 3L5XH 2XZQL 3O6FD 4FABL 4JFFD 4K9EL 2GTWB 4X4MA 4TTDD 1MRCL 4L29B 4YHML 5I8KH 1A7QL 1NAKH 3CDGA 3DTXB 4KMQA 4Z18A 4DEPB 5HHVL 1ZA3B 5EC2A 3BP6A 4EDXB 1T6VN 3LH2L 1WC7B 5GJTL 4AENB 3S34H 4U0RC 1G7QA 4P3CH 4L5FL 1Y18A 2R1WB 3OKDA 1MFCL 4RRPA 2YD3A 3GM8A 1UXWB 1FDLL 3HFMH 4RMWA 3TT3H 3EYOA 3HAEB 1G9MC 4PJ8B 2OTPA 4KUCD 4LLVA 4MNQB 4XNUH 3V4VH 5ADPH 4YHZH 5FUCC 3BH8B 4I0CC 5D2LB 4OM1L 3Q1SH 3KLDA 3WXWL 3KPOA 3LKQB 2J1KA 2LABA 4MNGA 4NQXA 5HVFB 4Q9CA 2YEZB 4XBPB 3SDCA 3L7EB 2IJ0C 4PJEB 3H7BA 4RX4D 2LTQB 4LSSH 3B9VA 3RL1B 4G6MH 5I1CH 4K94L 3ISWA 4NQEA 1IAOA 1S78D 2XFXB 3PGFH 5JA8B 4XWGH 5IOPB 3FO1B 3WN5B 2JF1A 2X9YA 5HYIA 1X3DA 3MV8D 1A6UL 5HGHB 2YD9A 4UDTA 2D0FA 3SBWA 4XH2B 5D7IB 1EFXA 1KBGH 1SYVB 5IHLB 1GHFL 1DN2A 1UCTA 4YAQB 4U1HB 3FO0L 4PFEA 3QCTL 1QYGL 5E8DH 2EIDA 4FXKA 2DQTH 4DKEL 2OCFD 5EFIA 2ZSWA 1IEBA 2YKLH 4HXAH 5FKAB 5FCUH 5B3NA 1XGTB 2YSSB 4MLIA 5DI8B 4LQFL 5D5MA 3VCLB 1IBGL 4MJ2A 3BZDA 2R8SL 2NLJA 5IROA 4E41D 5IBUB 2B2XL 4EN3D 4FQXC 3WO4C 3PG2A 1YN7B 1A6TB 2IPTH 1IVLA 1FZMB 2YRZA 4ZS7H 2EE2A 5F1NA 1NEZB 1D5IL 3MJ8A 1IGFL 1A3LL 4MAUH 4PLJC 3MYZA 1HIML 1F6AA 3OV6A 4FZ8L 3S4SA 2OQJA 4YXLH 3MJ9H 3QFJD 1DQMH 5JO5B 3BUYA 4LOUD 1QRKA 1NQBA 2AGJH 5F72S 1NCWL 2YPLD 4CN1A 3MLSL 4MD0A 3AGVA 3F58L 5GISL 3QQNA 1EEYB 3EO0B 5DLMH 5A2FA 1F58L 4KUCF 5F96L 1Z0MA 3HZMB 5JW5A 4ZFGH 1JF5A 3EYUL 4OUUA 4R3SB 4Y88A 4G80B 4AL8H 1B6UA 3GIZH 2DAVA 4LARH 4RNRB 4U2YA 4JE4B 2W07A 1QBAA 3MOQA 3QPQC 3U36A 5T5NF 3RHWK 3SGDH 1KTLB 4TYUA 3J8F7 2UVFA 2A6DB 4X98B 1BLNA 5IQ7L 1YEDB 4FP8L 5KZCB 1B4JH 1TVDA 3TP4A 1MCWM 2IWGA 3VJ6A 2V17H 4MWFA 4OCYL 1MFBH 5AUMB 1I75A 5D1XA 4OD3H 2QKIB 1N7MH 5HGBA 1A4KA 2AI0H 5ANME 2Y5TA 4HIHB 3VXPA 4LKCB 1TJHH 2DM4A 4OD2A 5FDWB 5ITBH 4RBPK 5EWIL 5IHUH 5CEZD 1JZ8A 4H5SA 4YXHH 5TFSL 1WCBB 1A7NH 3QWOA 3VWKB 4S1RL 2ZCLH 5C0BA 1NCAL 4ZSOE 1G84A 3NAAL 2X1QA 4UV4H 5E6ZA 3CH1B 2EICA 5KVEH 4AIOA 4U3HA 4ZNEE 2G5RA 3L3GA 4OI9A 5HHPA 3ZKMC 5JZ7C 5JW4R 4KMTL 2FX8H 1MLCA 3PWVA 1RY7B 1YMME 2E9WA 2BCKB 4QWWC 4F8QA 3DGGB 3VXUD 1FC2D 1H3XA 4OCXH 1ZVSA 2KL6A 1YNKL 4X9HA 5TE7H 3WO3B 5CZXC 5MENA 4OT1L 3U4EB 4G5ZL 4KUZH 1T89C 2QBWA 3BAEL 3G5VA 4LAQL 4HK0A 3S5LG 2H45A 4MA7H 1K8DB 1OWWA 1QBBA 3HHRB 3QP3A 1KB9K 1FG9C 4U1KA 1U8NB 1U41A 5FYKH 5BS0B 3BRFA 4H8WH 3E2HC 1X4XA 4AEEA 1FYTD 1DBJH 2OP4H 1BOGB 1WTGT 3VRLE 2P8MA 3MRMA 1TDQA 5GGUB 1NPUA 4UIKH 1WZKA 3FN9A 2NY2D 4LLDA 5GSVB 1S9KC 1EIBA 2GTZA 2BFVL 2DIJA 4D0DA 2DI9A 5EUOB 4YDJB 4Q6YA 4JRYE 4OF0A 1M7DA 4NKDB 4HIIB 1T4KA 4BSWA 3MLUL 1B0GA 4HFUH 3DARA 4OLWL 1MFDH 3EDEA 3LN9A 4X8JB 3KNBA 1GJIA 3O3AB 2MQCA 3H42L 4ODSH 3GJEB 1XF2A 2AJYL 3K7UA 1X5KA 1AGCB 4CVXA 4LHQB 4PJIE 4FQXA 2OM5A 2X4NA 4EVNA 4UT7H 3TH3T 3VRLF 2CK0H 1JNHA 3AB0B 1FZKA 3D5OF 3O81A 3I2CH 3LHPH 2JB6B 4PRIE 3NFSH 3H0TA 4N0UB 5JPNA 1CFVH 1TQCB 1CICC 4PPTA 3QAZB 5JHDE 4JQIH 4RGOL 1JFQL 3MRJB 4GXVL 4CRPA 3W11D 3UBXG 4X99A 4KI1A 4MZ3A 2E5EA 1QRND 3OKEA 4GXUN 5LXGH 4ZUTB 1C5DA 5I75C 4HFWA 1RIVL 3MRIA 5EO9B 2RCSL 3PWPE 5C07D 3KXFA 2X4TA 4TOYH 3MZTA 2X4QA 4B41A 2AEIT 1B0RB 3OWEA 2HWZH 3RWGB 2VTFA 1P7KB 4HSQA 3CSYB 1FO0A 4PJIF 1JGEA 4PJCB 2YUWA 3TN0B 2DWDB 3SEPA 1BD2B 4LCIL 1EHAA 3P73A 5C09A 2NW3A 2FSEB 5E9DE 5IB1A 5FB8B 2AXFA 1N8ZA 2CLVB 1CLOL 2FGZA 1Q72H 3MREA 4RAHA 1FLTX 4BZYA 2NY1D 2HAZA 4TPRH 3VXMD 3T2PA 1IC4H 4WO4C 4WEBL 4OF6A 1RPQA 4NZTH 3NZ8B 3PXJA 4JRYB 3ALPA 4JFOA 4YE4L 4DGYL 3MRFA 3ZSSA 4XVUD 4LVEA 1MCWW 2QQNL 3PNWB 4M7JL 4NQDB 5HDBE 5T3ZE 1AD9B 3WNNA 3L95A 4JJ5B 1LP9E 4G8IA 1J11A 2FZ3A 4WEMB 4BSVB 4F37K 3REWA 4KK8C 5IB5A 4PJIB 4NQVB 3V0WH 1RUQH 2R4SL 4GRMA 4PRIB 4M1DL 4I5BA 1P2CA 3G6AB 4UTAH 5JHDB 4XVSH 2HJFA 4AG4L 3IDNB 5DD5H 3SKNA 4KZEL 3JZ7A 2YA2A 4OF8A 4W70A 4KY1H 4OQTL 5C7XH 1A2YB 3OR6A 4ZFOB 4NQCD 4Z7NF 4MB3A 2JLLA 1T89A 4XGZA 5FHBH 2YC1A 4LMQI 3HZKA 4K23L 3U2SB 3H9SD 3MJ7A 4M5ZL 3KJ4B 5HDBF 4R96A 4BFIB 4LHUG 2NY3B 4PJ7A 3RWJB 1LWRA 5IKCA 2BNQA 3WIHH 1D6VL 3QZWG 4XCYA 4MVBD 4Q6IC 3VFTA 5DTFB 4N8PA 4FA8A 4E9LA 1NL0L 5T1KD 5D70L 5I1KH 1BJ8A 2DKSA 3BRDA 4GKZA 2QTEA 4P46C 4YX2H 4JAMA 5E5MB 3BUTA 5F9OL 4NJAL 1BBDL 3N9GL 4MD4B 5IHZA 4C83A 3O8XD 1X6LA 3DX9B 1MJUL 4XNQA 5E9DB 3MUZ1 5H37G 2VH5H 4ELMA 1YN6B 1J05A 1BBJA 4GG6E 2J3SA 3HR5A 5KOVC 3VI4E 2ITCA 5I8CA 4POZD 1T03H 2EE6A 1RZKH 5FCSH 1JRHI 2VITB 3MGTB 2EDHA 2EIEA 2VDOH 4NN7C 4O2EB 5A16B 3VWJC 4MJ6B 1XCQA 3FB5B 4U6YB 4CDHA 4KTDH 2FR4A 1YY9C 3CXDL 2COQA 1A0QH 2EDYA 4PV9A 4TVSa 4M7ZC 5F6IC 1CICA 1VERA 2QSCH 3BT2L 3VFWA 12E8H 1LP9B 2VDLL 5EOTA 4APQD 1JIBA 5BV7L 1ZGLB 4R8WL 4YIQB 3HNTH 1FRGH 1KCUL 1A5FL 1AQKL 1RVFL 1K4DA 1Y0LB 5BJTB 1LNUA 4GG6F 3OKOB 2H2PC 1A3QA 4LPCA 2XRAH 1OAUH 1UACH 4JY6B 3VI4F 5FO9B 3EBAA 4NHCL 3UROR 1S7RB 1EEUA 2BSED 3EO9H 4R26H 2YD4A 4PLNC 1JZ7A 3OHXA 1N59B 1U8LB 4L4VB 3U0PB 1FCCA 3QHZL 1XEDA 1UXSB 3GO1H 1R3LA 4ZPTA 4HULB 5I1LA 4EUPA 1EO5A 3HPLB 3MZGB 4GRWB 4GQPH 3CVHA 1MI5E 3D3VD 4U3CA 1SHMA 3EJZC 5MEPB 4LPXA 2I27N 3TNMB 3AS0A 2V9QA 4C57C 4JRXD 5C0IB 4KPHH 2X4RA 4KJQD 1ZE3C 2N7AA 3V2AR 2W9EH 5IBTH 3TH2T 3EOTL 5KS9B 2GAZA 3H9HB 2YUVA 5J6HB 4HDIB 4JM2D 3BKJL 4WO4A 5EU4A 2CKBB 2FX7H 3SKOA 2BNRD 3AC0A 3CJJA 1PYWB 4FQJL 4L8BA 4YLQT 3UYOD 5D72L 3MJ6A 1UYWH 3TC9A 4X7SL 4WWKB 1NLDL 2DQJL 3V0VB 1WTLA 3T65B 3KPSB 5J1SC 4MX7A 1ND0A 4LLWA 3X12A 3EOBA 1A6AB 3TBSB 5D9SA 4FTVD 1F97A 1QLRB 3IXAB 2E8YA 3GSQB 1NMCB 1OAYH 2D3VA 1AC0A 1CFTA 1OB1A 4YQXL 4U4BA 3G5ZB 5DVNA 1T1YA 5KJRH 1CT8A 1M7IB 4YEEA 2O5YH 4WFGD 2JJWA 2R1YA 1AR1D 4YHPA 2QQKL 4L3CB 3GBNH 1N6VA 1TJIH 1G9NC 4UILL 5KG9A 4LLMB 5T1LA 3AXLB 2AJUH 3LS5H 3T0DA 5GRWA 4OLZH 3ULVF 1AGDA 5HGAB 3QDGD 5DJ0B 2WBJD 2BJML 1S7SB 4JZJC 3IJYB 1JZ3A 5DMJB 4X6DB 4ALAL 2EO9A 5EU5B 4JZOB 3B9KB 1KIUA 4UT9L 1OGTA 5L0QB 2O5ZL 3Q3GA 5DD3H 1EAPB 1A21A 2XQYK 5E7FA 1FFOA 1KN2H 4P5TD 4X6CB 3A6CH 4Q6IA 4HWBA 5EUKA 1QSEA 2J88H 2HVJB 4WHDA 1CGTA 4M5YL 1HXYB 1I7TA 1FL6B 2HLFD 4IOIA 4P2QD 1F02I 4P46A 1A3RH 2AJVL 1NGZB 4OZIA 2UV3A 3PABA 1IGJA 3RA7H 1KTDA 2UY7A 3U0TB 3AMLA 1UB6A 1UA6L 5HI5C 3O4LE 3UXFA 2HA1A 4P57A 3VXSA 4KI5D 3BDYH 3EOAA 4KKAC 3PHQA 3DBXB 3QUYD 4ZUSA 5IR1B 2J8UB 1F6LL 3VFVB 1JJUA 2B0SH 4WFFD 3F7VA 4IRJC 3VWJA 2XN9E 3QUXB 2EDLA 5EO1B 4HMEA 1DQLH 3MV8A 1GZQB 1KIRA 4DAGH 2XKNB 4Q9QH 3Q2CA 1AGBB 1RU9L 4JDVB 4UNVA 2AABH 3VRJA 4Y0GA 4F7TA 1U2HA 4JO2L 4OAWA 3LEVL 3FB8B 4L3EB 4PJHA 2ZPKH 4L8CA 1KV3A 3RBSA 1RK1A 4L9DA 4XCCL 2OTWA 2F54A 1JF6A 4JHAH 4OJFH 3WKMH 5FYLL 1MUJA 1MCPL 3FB6B 3SPVB 5HD8D 2IBGA 1HHKB 1FNGB 5EOCH 3QG7H 3RUGB 1CR9H 1A1NA 4KROC 4GKSB 5MP6L 4O2CB 2M8XA 4UAOC 4CVZB 1TTGA 1KXVC 2FEEI 3IFOB 1KXTB 4ZUVB 1QLFB 1IKFL 5F7EL 3W11C 1DQQB 2FYYB 3QFJA 4FFZL 4OFKA 3VFOB 3QDHA 1AI1L 2YPLA 3ECBA 1JPFA 3DXAA 3QUZB 2V2XB 5KOMC 5A43C 1V3LA 4GXUM 3M1BB 3P9MA 5TDOA 2BRQA 4I8DA 4QTIH 1RJYB 1ZS8A 3OGCB 4P48A 4PY8J 1U8HB 1KIPB 5EBLA 4DUXA 4RDQF 4GW5A 1X5XA 5DJZA 3U4BH 2LQRA 1OTUD 4OF5A 4O51B 5CIPB 3WE6A 2VR9A 1YQ2A 2NTFB 1JGUH 2LFGA 3B2UD 1VA9A 3RX5A 3RY6C 3OKMA 4DW2L 1F90L 1FNHA 4YFDB 3K2UL 1U3YA 1CBVL 2OL3B 1QEWB 4WNQB 3P4NA 3FB7A 3EYVA 4XPGL 1QBLH 1FNEA 3ELAT 5DC0A 4KRPB 5IVXA 4JZJA 4NO2B 4K8RH 4OM0L 4HK3J 1NC2A 4PG9B 3S8WA 3C6LD 3BQUD 1KJVB 5I17B 3B3IA 2D0HA 2DLEA 3E6HB 4MDIB 3ULUD 3VD3A 5D4QA 2VL4A 4WV1B 4UNUA 4J3TA 4LVNC 1A7RL 5E94A 4GQ9L 4QRTA 4X83A 5D7LB 4LLAA 3VE0A 1S9VA 5SX5K 1J5OL 4YGVB 3VMPA 3TBVA 4OGXL 2L0DA 4ENED 2PYEB 3GSOB 2VWEC 1LDPL 3QHFH 4X4XB 2Q6WB 3PDOB 3QYCA 4WY7L 4HZAA 1T0NA 2R2BB 4QRRB 4PRHB 5CWSB 3R8BB 4XI5C 1SYSA 4PY7A 4M4PA 3HZVA 2V9TA 3QJFA 1NBYB 1SJHA 1CDYA 1FFQA 2CIKB 4LPUA 3BD3A 2HJLA 4FQ1L 1Q0XH 4MJIE 4RZCA 1KCSL 5EU7E 3T0WA 1OT2A 1UM6H 4IRJA 4JVPA 4X8XA 1EZVY 1UH2A 4Z7WF 4POUB 4HWZA 5TF1L 4HEPG 4TNVF 4WTZG 1DUZB 1MFAL 1ADQA 2FHFA 3IFPB 3C2SA 1CD1A 3CFJA 1JYVA 1TCRA 4X4ZA 4WFED 3WS3A 5JQ6L 4HUKB 3MV9B 4D0CA 3V7AG 3D69B 3G9VA 4XP1L 5CSBA 4Z0BL 2V7HB 3FFDA 1NEUA 4G43B 4QOKE 2Z31C 3QULB 2HT3D 2ZG2A 2VZ1A 4LIQL 4F33A 3FN0H 2JCCE 4HIEA 2JJTC 1R6VA 5HYSA 3AS3A 1KG0B 4OKVA 3PHOA 1LVEA 4YHNA 5I0ZA 1E4XH 4JFXB 4BZ1H 2CIIB 3DLQR 4F7MA 3HI5L 4FQHA 2YK1L 5C08A 3UMTA 2IPUK 5IB4B 1DUYA 5B38A 3GI9H 5D1ZC 1QFWI 2DLFH 2FECI 1RK0B 1SY6L 3E3QE 2VZUA 3FOLA 3MRQB 2R0KL 5T1MA 3MLTA 3SE9L 5FO8A 4XNXL 3MLVL 3PV6A 2HTKD 3CDCA 1RZJL 5H35A 5DUBB 4JFPB 2X1PA 3RWDB 2JCCF 2J4WH 3Q6FA 4HGWB 1ETZB 4GBXD 5D8JL 3QNYA 5D2NC 1PKQA 5CGTA 1NAMA 5C0AE 3TO4D 4NQTA 1Q9KA 2ITDB 4M02A 2DQDL 2J8OA 2HFGH 5IGXL 2OJEA 4KQ4L 3H9ZA 4KGJA 1HYSD 2AV1B 3TA3C 3CNKA 1N5AA 4F7PB 5D1QC 2UWEA 2E27L 1QPXA 2AXHA 4J1UA 4X7DC 4R4NC 4G6JH 4CW1B 3RY6A 3P3YA 4YPGA 3D6GA 4RA0C 1I7UB 1T80A 1N2RA 4WUUE 4D9LL 4G3YH 4Z7VE 4XXCC 2XKSA 3GB7A 4M93B 5GS0C 5IIEB 2P1YA 1R5IA 3V6FB 1J9CT 4HJ0D 3F8UB 3MO1A 3WBDA 1ZTXL 1WZ1L 3HG1E 3NACH 3LN4A 3BGMA 4G7VH 1OPGH 4HC1L 4PJ8D 1HHJB 4MNQD 1I7ZB 5E6IB 3O45B 4YUEH 1G7MA 4FOMA 5T33L 4KJPD 4NJ9H 3G5YB 4QXGH 1FE8H 5SWSA 4BQ6A 3T0EB 3AMKA 7FABL 1VACA 2Y5EA 3N0PB 1PZ5A 5HHNA 2XZQH 2YHGA 4Z7VF 3ROLB 4K9EH 4TSBL 2P43B 3OXSA 1DBKH 3HC4L 4YHMH 2B4CL 2DQFB 4BKLA 2V7NB 5DXWA 1YEJL 3VH8A 3KYNA 4TVPE 2OI9C 3DV4B 3P4MA 1IFHL 4N0RA 2R4RH 1INDL 1M05B 1U95B 4YHIA 3H9SA 3LH2H 5I0DA 4MMXC 5K9JL 3DMMB 4XP5L 4L5FH 3Q0HA 3P9LA 1NANI 5KSVA 2DBLL 4P5TC 5EPMB 2X42A 5JPMA 1T20A 3UTTE 1MFEH 5ISZD 3BESR 2GSGB 3O6ML 4G6KL 4P2RE 2FB4H 3QUMH 4FQCL 3O6LH 1I9RH 4XBGB 3RGHA 3BPCB 1Q94A 4NRYB 3HS0A 4JGMA 1TENA 1DJSA 4MD5A 4IMKC 5ALCH 2E9JA 5DFVD 5I76A 1I8MA 4PJ9C 2HH0H 3TZVC 1G7JB 1SM3L 1MNUL 5INDB 3TT1H 5C6PB 4DGIH 2BSSA 3MRHA 1CE6A 5A2JH 4U1LA 3FN3A 5DHVH 3DJ9A 2QQLL 2Z31A 3QUYC 1H3GA 2Y06H 4HIJB 4M8QB 4R7NB 5HYJB 1T2QH 5EZLB 3CDFA 4LNVA 2JJTA 2VLRE 3WNOA 5IMLB 3HG1B 4Z7OE 3FQUA 3GMLA 3PWJB 4OTXH 3CK0H 4HLZG 4G8GA 4XNZC 1ZLSH 5LAXB 2AXGB 1FNSL 2C5DC 1XGPA 3QDJE 1IBGH 3HRZB 3RVUD 1XCTB 4HCRL 1OP3K 3SY0A 3R4DA 2R8SH 4W81A 3BWAB 3C60B 5E56A 4TQEL 5D1ZA 5FGCE 5T3ZL 3KR3L 4IHOB 4XCEB 5HGDB 1KJ2A 1H3TA 3SDYH 1FSKB 5CSGA 1MJ8L 3VU2A 4HQQL 1UC6A 4RAVB 4NKMB 4U3XA 3ZYJA 4Y89A 5D2NA 4Z7OF 3DYMA 3UTQA 4YHOL 1MWAB 4DQOH 2BOCB 1HCFX 5KZCD 4AY0A 2YUXA 1S7UA 1TVBB 1M71B 2DYPB 2EYRA 4OZHE 3TA3A 4HKZA 3GMPB 4N5UA 5D1QA 3KLAA 4JRXA 1J18A 2CLRA 3MLSH 3UTTB 5A40E 3LD8C 4HZLA 5GISH 4P2RB 2VXUH 1U8OA 1H3PL 5JDSA 3P11L 5JORB 5CGYC 1VFOA 4NKOA 4M3KB 2DMKA 1OP5H 4YO0B 4XXCA 4G6FB 1NGXB 2PO6C 3QUMB 3VWKD 2XTLA 4TUOB 5ESQB 4LEXL 2Q8BL 3BKCL 2VDKH 3IU3B 2X89A 1IQDA 5IBLD 4PYGA 1S7WA 4R2GB 5ICYB 3V4UH 2WNGA 5BZWB 1WK0A 3CX2A 5IEKA 1EEZB 2QADC 4QT5B 4NO3A 4EZMA 2BC4A 2A0LD 4JFEA 1HEZA 4YC2C 4OZHF 4Y4HC 2O5XL 4JKPH 1U3HC 5E2TH 2J5LB 5C0CB 2MTPA 1SMOA 3CX5J 2X05A 4FTVA 3B2UC 1M1SA 3QO0B 2EXYC 1XIWD 3JV6B 3TYGL 1WBYB 3EYQD 1PDKA 1AY1L 4YFEA 2R9HD 4NM8L 1CFQB 4Y5VB 3FO2B 2ORBL 3QDGA 1U6AL 3O9WB 5BS0D 8FABB 2E7MA 4H26B 1MVUA 2I07B 4OQ1A 3SJVE 2X1OA 1JPSH 4MDJA 2C26A 3QFDA 2A6IA 4PRBA 2BMKB 2N4IA 1ZHBA 4Q2ZA 4U31A 1OGAE 4HXBL 3GMQA 1VFMA 2ERJC 5BMFL 4R90H 4P5TA 2AJZA 1F3DH 4P49A 3CD4A 4IDLA 1PQZA 1ZK9A 5BQ7A 43C9A 5I1DB 4X6EA 3DETD 3T0BA 1IAMA 1EHLL 4ZO7A 4YXKH 2R2EA 3H2WA 4JVUA 4OT1H 4G5ZH 4XRCB 1I7RA 3JBG7 1A02N 5I66A 3PV7A 3JWDH 5J9PA 5C70A 4KDVA 4IMKA 4AT6A 5DQJB 5DK3A 5DO2C 4DFHA 5BV7C 4PJ9A 1GPOL 3LMJH 3TZVA 3L9RB 2VR4A 3E6FA 3RIFK 3X13A 2P24A 2R0ZH 1W8OA 5MI0C 4U1NB 5IM7B 5B8CC 2VZSA 3WDJA 5DJDA 5KN5A 3MLRH 1N0XL 1ORSA 3QUYA 1NFDE 1EERB 4FMKA 4R7DB 3IAQA 3RX8A 1VENA 4EQ2A 1JZ2A 1FVDA 1Z9LA 1V7ML 2YMXL 5DD0L 4NSKA 4BH7A 2BFVH 3K4DA 4K7PX 3IKCA 4MS8C 3V6OC 2DQCL 3PDDA 1EDQA 1IGYB 2J7LA 3KLHC 5DVLA 1PKOA 2N1KA 1C8PA 1VHPA 2X44D 2F53A 3ULVL 1BQHA 3V5KB 4NWTL 1KTRL 1LD9A 4OGYL 2RFXB 5J11C 5C0GB 4XNYH 1MCSA 3TNNB 2AJYH 3NIGE 2PXYC 2HLAB 2EH8L 1IAII 5C6TL 4G6AC 1A9BB 1KEGH 1BD2D 1V05A 1NFDF 3DX8A 1MOEA 3GMMB 4TRPH 4LU5H 1INQA 5FV1L 1HQ4B 1F4AA 4Z5RB 3KPRE 3FFCE 5IWLC 4LPWA 4GXVH 3ZHLA 4JPKH 1XZ0A 5FYKD 1CDUA 4UU9A 5IFHH 4Q7DA 4GW4A 1RIVH 1T2XA 2Z8RA 1H3UA 2I60H 3NCYS 4CL7A 1DP0A 3BP6B 2F5BH 1D5XA 4ONGL 4GLRI 4M7LL 1NCDL 3TYFA 1VGEL 2VXTH 3NIGF 2NY4C 2AEPH 4MJ4A 1T1XA 2PW1A 5J1AB 2P5EE 3CMOH 3DYOA 4HJJH 1Y18B 3OKDB 5D6DC 2APTA 5FA3A 1U92A 4NQDD 2PO6A 5H2BA 3RJDA 3EYOB 3INUH 4LLVB 3ZHDA 4NIKB 4GBXC 3WJJC 3KPOB 1LO5A 1VPOH 2B39A 4NQXB 3VGAC 4V2CB 4G9DA 3WFDL 2AQ2A 4PRID 3R1GL 3GJFK 3C8DA 3F12A 3H7BB 5JHDD 4Y4HA 4M6OL 5FA4A 1U3HA 4IIQC 1A1MA 1IAOB 2AQ1A 1R5VA 4JPWH 3JWOL 1CFNA 1JWMA 5JUEL 2AK4E 4JHZA 4O9HH 3UJIL 1FC1A 3MPCA 1TMCB 2H41A 3F7YB 3FONA 3UAJD 2Q86B 3HLAB 4YE4H 3TLRA 4DGYH 4UDTB 2FH6A 5FO7A 5B39B 3BIKA 3BKML 1EFXB 5GZOC 2NY6B 5T5NG 3D85A 2NY3D 1CIDA 2QR0A 4FXKB 5LGHL 3W2DH 1IEBB 5C0JB 5FM5O 2Z4QA 4EBQL 2R4SH 3TBWB 5D5MB 3S37X 1E4JA 4G8EA 1FAIL 5AYUL 1CXLA 2F58L 1A7PL 3T0XA 3SDDC 1U0QA 3CIQA 2Q1EA 3BH9A 3FFCB 3U0WL 4M1GL 2G9HA 3B9DA 3FQWA 1G9MH 5I71C 3MV7E 1U2CA 3IFNL 5E99L 4UZGA 3PQYE 2DQEH 4QXUL 3MJ8B 3L1OH 4NOFA 4YBQD 3CFKA 2Y07H 3CFEB 4ZO8A 1F6AB 2Z35A 3B8SA 3S4SB 4JKLA 5BRZE 1F4XL 4TULH 3VFSA 1I9JL 1D6VH 4KKLC 3WN5C 5B8CA 3BUYB 2P5EB 1XF1A 3CPLB 4MA3A 4X7TA 1T5XB 4MD0B 3MRNA 2A1WH 4JFZL 1V3MA 1G1CA 4JG1L 1JE6A 4HPYH 4NJAH 1BBDH 3N9GH 1MIMH 2P42B 1CXKA 4FG6C 2B7DT 5JW5B 2LVEA 3EHBD 2ZG1A 1JPTL 2KH2B 4M48H 4OUUB 3V6OA 4IRSC 2HFEB 4PJ5E 3T04D 4ESKA 4HV8A 4B53A 5I15L 1XF5A 1GGIH 3V6ZA 4S0SD 3M8OH 4NNYA 2AK4B 2FO4A 3OKKA 2HRLA 2PXYA 4L4VD 3OL2A 2BVOA 1RIHL 1DN0A 4LSPL 4EJ1C 1BLNB 1JRHH 1T66D 5F7LB 1LO0L 1SMAA 3PIQA 4MWFB 4RISH 3CXDH 5D1XB 1AXIB 3G6JE 1S9WA 5HGBB 1A4KB 3MXWH 1P4LA 2Y5TB 1VEPA 3VXPB 5IWLA 4PB9H 3BHBA 4C56A 1KCUH 4LHJB 4OD2B 5GS3A 1MCHA 1KC5L 4H5SB 3QWOB 1S7TA 4H1LA 1WCQA 4U7SA 1Q0YH 4PJAA 4NHCH 1B4RA 3T77A 2XZCH 3UTSE 2IC2A 3EYSH 3VGHA 5SWZE 1FP5A 2Z93A 3MACL 4U0RB 5EORL 1EO7A 5D6CB 2X5PA 4A6YL 5HHPB 2VLME 3CU1A 4K2UL 4PLOB 5D6DA 2OZ4A 3VFGL 2AAVA 4WWKD 2BY0A 4I2XE 4GW1A 1AJ7L 1FO0H 1MLCB 2IGFL 3MLWH 3QEQA 4PJGE 3HNVH 3KPSD 2ZJSH 3G08A 1DBML 3G6JF 4KJWC 1G6RA 1ZVSB 1MELA 4GBXA 4OSUL 3WJJA 3RBGA 5MENB 4NC1E 4M7LT 5J6GA 3R06B 4AK1A 3ZYZA 2C1PA 5A1AA 1JF1A 2IG2L 4HK0B 1PY9A 2IBZY 2JJUA 3T8XA 5MERA 2VQ1A 2FHBA 3MRRB 1S7XA 1JHLH 2ARJQ 1FFRA 5ALBL 1CFSA 4IIQA 3FAWA 1HHHA 4NZJA 4G9FA 1RJLA 2R0LH 1I9IH 5AZ2H 3TFKD 3C87A 3UO1L 4D2NA 4QEGA 2P8MB 3MRMB 3GK8L 5JQHC 4L29A 4PJ5B 1K85A 3DVGB 2FL5A 3OAUH 4NQSB 4PJGF 4LSDA 4LLDB 1JWSA 1ED3A 1NLDH 2GTZB 2DQJH 2ZKHL 3IT8D 4EDXA 4AENA 1M7DB 2C1OA 1XGUB 3U79A 4QYOA 1B0GB 2D7TH 3BW9A 3DSFL 5I18H 4KMLB 2X4PB 3KNBB 3T4YB 1G7HA 1S9XA 3ULUL 4CU6A 2PUQT 4ZUUA 1S5HA 2VQUA 2Z92B 1ZLWK 1BVZA 3BH8A 3SDDA 3UYRL 1V8HA 4FQXB 3WO4B 2HTLC 2X4NB 2F19H 4E42B 4EVNB 1JNHB 2YEZA 4XBPA 3L7EA 5JPNB 2Z8WC 3AAZA 3ARXA 2R2HA 3RL1A 2FATL 5FF6B 4ZYKB 3VFNA 3ZL4L 1QBML 2E7HA 2O5ZH 4X99B 3ZTJH 5IOPA 2F5AL 2R69L 3QUXD 4EIZC 3WN5A 2DD8H 4HFWB 3MRIB 2KBGA 2AEQH 1QVOA 3GSUA 4I2XB 2X4QB 2GK2A 1JV5A 2AJVH 4RFNB 3E8UL 4L3ED 5T1DL 1S3KH 3OTTA 4G7YH 3ZT5A 3LDBB 2E6PA 4XAKD 1JGEB 4AEIL 4PJXF 3ZE1E 4XPBH 3K8LA 4IRSA 1MCCA 2NY0C 3NVQA 1BECA 5I19L 3RPKA 4KRNA 2Y4SA 3P73B 3SDAB 5C09B 2NW3B 5IB1B 2KZWA 4Y1AE 1TETH 2JB5H 3GSNA 4Y4FB 2AXFB 2P47B 1X5FA 3ULSB 3QRFM 4V2BA 5FM8A 3AB0C 2EDQA 1MCJA 1JK8A 2FJGA 3DURA 1ZANL 1TQCC 5K59E 5TJWK 4FNLL 3V52H 4UT6L 4JFOB 5EZIL 3RVXC 3ZE1F 2XG5A 2YOCA 5FKPA 3D39E 3EDFA 3BZFA 4FQIL 4PREA 5DJAA 1XAUA 5FXCH 2VR5A 2H26B 2OLDA 3L95B 4ZQKA 3QUZD 4G8IB 3TCLA 1BF2A 2KQNA 3EO0A 4PUBH 3U1SL 5K9OA 4N68A 3HZMA 1UWGL 5I1JH 1G9EA 1WEJL 4GRMB 3TN0C 3VXRE 3C5JB 3REVA 4I5BB 1P2CB 2HJFB 3SKNB 2IF7A 4FXGA 3ARFC 5FOBA 5DHXB 5K59F 1KSRA 3OR6B 4EUPH 1MJ7L 2VLKE 3CVHH 1FVEA 4X98A 1AXTH 3KYOA 4XGZB 3HZKB 2BDNH 3MJ7B 4P4KB 2DOCA 3BDBA 4R96B 1AI1H 4PJ7B 5JXAL 4LLQB 5IKCB 1XT5A 4KQ3H 4ONFL 2GQHA 3E2HB 1EBAA 3VFTB 4KRPD 4HIHA 1FNLA 4GKZB 2B1HL 4B7IA 3MXVL 4JAMB 4PD4J 2BXZA 4Z7UE 1WCBA 3X3FH 1E6OH 4OGZA 2VXSL 4DTGL 5C2BL 1P9MC 2BVYA 3EUUA 1GAFL 4QRPE 4S1DD 4XNQB 5D7LD 1GGBH 4AIZA 3ZKQD 4ELMB 1J05B 5IB2A 5BVPH 1TNNA 3MQIA 2NXZD 5CJOH 2PYED 2ITCB 1YEIL 5I8CB 1F6FB 5FM5M 4JFYB 2J8HA 4DZ8A 1F90H 3MJGX 3DGGA 3TJHD 4QRRD 3GEWB 4JN2A 4I3SL 4UQ3A 4PRHD 4IMLB 4XPGH 2YBRA 4HWEL 3U4EA 4CUCA 3UAJC 1HDMA 5K33A 4OFYD 2FR4B 5CILH 4L4TE 1FORH 2YD6A 4OM0H 4Z7UF 3KJ4C 1CICB 3VFWB 3BJLA 1RZFH 5EOTB 5D7SL 4GAYB 5E08L 5GGQL 1DSFL 1K4DB 3IFLL 5F7FA 3HCVA 1LNUB 3W0WE 4OKDA 5IVZA 2V5MA 3WNKA 1QNZH 1BOGA 5CBAB 1CGUA 1MH5A 4WGWB 5GGTL 3T2QA 5GGUA 2DQUH 3NN8A 1J5OH 5DMGD 1OSZA 1QZ1A 4HWBH 3LQZA 3GMOA 4PLKD 1RUML 1SEQH 3C2AL 4JN1L 3UDWC 1IGIH 1HK6A 5DJ2B 1RHHB 4M62L 3OHXB 1P84J 3HPJB 5GJSH 4GAJH 2R29L 3P4LA 4UV7L 3MLPA 4XTRD 3MV9D 1YECL 4JO4L 1NFIA 5KBNC 1I1AC 4ZPTB 5I1LB 1Q9WA 4EUPB 3CVHB 4I77H 1CTNA 4ZOEA 5ANMA 3D0LA 4LPTA 4FQ1H 1UKTA 2X4RB 1KCSH 2ATKB 5BO1L 4P59H 2GAZB 2JB6A 4Z7UB 4N0UA 3TBYA 5E4IA 3B8YA 4WO4B 4ZSOA 3L5XL 5EU4B 1BFOB 4LFHG 3E1F1 1ACYH 5GZNC 4K3DH 4OZFG 4X9BA 4C59B 3LPGA 4L8BB 5I8KL 1RJZA 1O5DT 1NAKL 5FGSA 4PJDE 2PTVA 3QHTC 4ZNEA 4HLJA 5EO9A 4OLEA 2EDTA 5JQ6H 2KUTA 4OZGF 5DYOA 4ZDHB 5GXBB 1YMMA 3QIWC 1B0RA 1J1OH 4MX7B 4P3DA 3QWRD 1ND0B 4LLWB 1H8SA 3LRSB 5FOJA 3G04A 3S34L 3U46B 3X12B 5A3ID 5JLZA 5CBEA 2WP3T 4CMHB 5I16A 1BWMA 1D5ZA 4CBPA 3I75A 4L3AA 2GW5A 2VNCA 1T7XA 4DCQA 1T04B 4LIQH 3HFML 1CFTB 1OB1B 2DTSA 3TN0A 3TT3L 1CT8B 3IB4A 4XNUL 5ADPL 4YHPB 5GGSA 4YHZL 4YDKH 3LKNA 4QRQA 4XAWH 3Q1SL 4CKVX 3ARFA 4P9HC 5KG9B 5T1LB 2OK0H 4N8VG 1AGDB 4KKBC 2MCG1 1OL0A 5GGVH 1YEGH 1F13A 2OJZH 4PJDF 2CLVA 4LSSL 5KSAB 1JMXA 1UFUA 5I1CL 4DJMA 3T1FA 3SO3C 1OGTB 3PGFL 1ORQA 5AYQA 4D0BA 4XWGL 5TPWH 1OTSD 2C3XA 1FFOB 3NZ8A 1CXEA 4JRYA 3S36X 4Q6IB 1QSEB 1QFWH 5IV2B 4XNXH 3MLVH 4XPFH 3FQNA 1KBGL 5GSRB 2Q8AL 4S1SH 1I7TB 4Y4KB 4BQCA 4ISVA 4P46B 1YZZA 2NYYD 2R23A 1WUNT 4OZIB 1CDGA 5E8DL 1HE7A 2DQTL 4JJ5A 1IGJB 1P9MA 4FXLA 5HVWA 5IT2H 2UZYB 1XGRB 2YKLL 4BSVA 1KTDB 4KK6C 5FCUL 3IGAA 4PJIA 4JKKA 4NQVA 5E6ID 4CJ1A 2GSIB 4I0KA 2E27H 3T0ED 2EXWD 4PRIA 1FV1B 3G6AA 2JKXA 3VXSB 5JHDA 4XWOD 2I9TA 2CXGA 3IDNA 3ZZ1A 3PHQB 5KVFH 3T2NH 3T4AA 4XPTL 2DMCA 1A2YA 1JWUB 4Y5XC 2IPTL 4D9LH 2GYSA 4NN7B 4Q58C 4AJ0A 4RDQG 4RMTA 3F7VB 3VWJB 4ZS7L 2NR6C 3BJ91 2C4FT 1LEGA 1G9NH 4U1MB 3PWPA 2GT9B 2R1XA 3ZE2F 4M7ZB 5F6IB 4K71C 4YXLL 5JMRA 3B9KC 3VRJB 3DMMD 3MJ9L 5L0QC 4OAWB 5HPOA 4PTUA 1DQML 5F7MC 5BZDA 4L8CB 3S88H 5CEZH 4WI4A 1RK1B 2MMXA 2AGJL 2OTWB 2F54B 4DK6A 5EDXA 4D8PA 2BY3A 4DUWA 2VIRA 1MUJB 3P2TA 2H9GA 1MQKH 5DLML 3GNMH 4O00A 4YZFE 4J3WA 4MD4A 3P77A 4PG2C 3TIDA 3UDWA 3DX9A 1LEIA 5E9DA 2PYFA 4XHJD 4KDWA 1YN6A 1A1NB 2YD2A 4AL8L 3GIZL 3IJHA 4LARL 5GPRA 3EFFA 4FQQA 3UBXB 4YHYB 1I1AA 5CMAB 1MVFA 3PL6B 4FQLH 4PRPE 1KB5B 2DJSA 1IFHH 1BZQK 1TZGH 2EDJA 4NFBA 3IDXH 1IE5A 4LCCC 1OAZH 2VITA 3MGTA 4XP5H 5IB3B 5HYJD 4O2EA 4P2OC 4NO0A 1HQRB 1B4JL 3NCMA 3QUXC 4MJ6A 1N6UA 2V17L 2VLJE 4ZODA 1B90A 1NANH 3O6MH 3ECBB 1JPFB 3LEYH 4WI7A 4YZFF 1OM3L 2AI0L 1LP9A 3DXAB 1RJCA 3QDME 4LVOC 4YNYB 4Y2OA 5AG9A 2ENSA 4YIQA 2XV6B 4XVJH 1Y0LA 1TJHL 3P9MB 5TDOB 2ATPA 5ITBL 5IHUL 6CGTA 1ZS8B 1A7NL 1D9KC 4JPIB 5EBLB 1G7PA 1VDGA 2X4UA 1SM3H 2ZCLL 4GW5B 4RAUA 5DJZB 2E9BA 3QIWA 1IL1A 1CK0H 2CDGA 3WE6B 3D2UA 5KVEL 4P5MA 3U0PA 2E3VA 1UXSA 3ARDB 1PJ9A 4NO5A 3DSNA 4PB0H 3LQAC 4OCXL 2VDQH 3P4NB 3FB7B 3EYVB 2DYPD 3LKSA 1FNEB 1MY5A 3BN3B 1P7HL 1O0VA 2EDNA 5C0IA 4XMKH 5IVXB 2AW2A 3UTTD 4IDJH 3VDCA 1WFTA 1XF4A 4P2RD 1NC2B 4MA7L 1ZT7B 5J6HA 1SEBA 4HDIA 5FYKL 4H8WL 1RD6A 4G6FD 2NZ9D 2I9LB 5DMYA 5E94B 3KR3H 3K1DA 4XMLH 3VE0B 4GG6A 3W82A 3K8KA 2DDQH 4UIKL 3TBVB 1UZ6E 3RHWF 2Y36H 4R2GD 4PRPB 4KXZI 4WU7B 1P6FA 2DN7A 1T0NB 3TBSA 3QQ9D 2XICA 1NAMH 2HFTA 5C0CD 4HFUL 5IUSA 1MFDL 1YQVL 4LHUB 1QLRA 1SYSB 4PY7B 3BX7C 3GSQA 3IAGC 3HZVB 3RVTC 3QJFB 4ODSL 3LY6A 2OMNA 1BX2A 3EOYG 3P11H 4OCSL 4ZO6A 5GHWH 5C9JA 1WWBX 4RZCB 4Y5XA 4P23C 4UT7L 1X4ZA 5HGAA 3O9WD 2CK0L 4IRJB 5HI4D 3QIUC 1UKSA 5KVGL 3ARTA 3I2CL 3IJYA 1IZKA 1UZ6F 4ZFOL 3BKCH 3O3EA 5EULV 1OF2A 4JQIL 4HWZB 4JZOA 4MQ7A 3B9KA 4S11A 1CD1B 3CFJB 1G0YR 3NABH 1KYOK 4QNPE 2CR6A 2O5XH 3WS3B 1OTTC 2HVJA 2OX5A 1Z5LA 4D0CB 4TOYL 4HH8A 3TGXA 3QRGH 2HWZL 4JVWA 1XGQB 1NGZA 1MI5A 3FFDB 1FAKT 2WMPA 5I8EB 3TYGH 2VC2H 3NPZB 4PG2A 3D9AH 3NPSB 1QSFE 3KWWA 4F33B 5GS2D 4HIEB 4PR5A 5HYSB 2NXYC 4OKVB 4UAOB 1GVIA 2I25N 3PHOB 4YHNB 3HMXA 2XTJB 4LCCA 4MB5A 2HKHH 3VFVA 5J7CC 4TSCH 3BGAA 3GDBA 5C08B 3WUWG 4QNPF 4P2OA 1Q72L 5BMFH 3QUXA 2BSTB 1DUYB 3SCMC 5DVMA 4HG4K 5CLWA 3MLZH 4HGMA 5CGMA 2D31A 1G0DA 3FOLB 4NZTL 4NNXA 2IAMB 3QH3A 4OCMC 3OB0K 5FK9A 5T1MB 3MLTB 3S98A 5FO8B 3FB8A 5BOZG 5J12C 2BX5A 4FFWD 1R5WA 1S8DA 1INEH 3Q6FB 1JNJA 4XTRC 4ODTH 3QNYB 5D7JC 3P30H 1D5MA 1D9KA 1PKQB 1NAMB 1Q9KB 2OJEB 5DD1L 4PJFF 3KGRA 3D25B 3V0WL 3BO8B 4WWID 1BZ7A 1RUQL 1T5WB 4LBEA 4AMKL 1N5AB 2VUYA 2UWEB 4F57H 4GKSA 4XVSL 5ETUB 3UTZB 4YPGB 5DD5L 5BVJA 1V7MH 4CVZA 5DD0H 2BXYA 4KY1L 1RUPH 1RHFA 1N2RB 5DUMH 2DQCH 1GGCH 3GB7B 4XP9H 2Y25A 3HR6A 5TQ2H 5FHBL 2L7UA 1R5IB 2WWMC 5CEYB 2A6KA 1UM4H 3TJEH 5CHNA 3OAZK 3LRGA 3MCLH 2EH8H 3LN4B 3WIHL 5C6TH 1MHEB 3BGMB 4LVNB 1HN1A 2V2XA 2DLIA 2APWA 1CU4L 7CGTA 1I3RB 3MGAA 5DUPH 1IAIH 3MROA 5I1KL 5DFWH 3JV5A 4YX2L 2CKBL 2HT2C 4N8VA 1KIPA 1EHXA 3O4LA 5CJBA 1VACB 4O51A 1A6VL 5CIPA 1JGDB 2IANE 3CZJA 1MREH 3OJDA 3OXSB 1EBPA 5EU7C 3GIVA 1NMAH 1TJGL 2XN9A 4LLYA 3VH8B 3KYNB 4ZTPH 4PP1D 5DR5H 1T03L 4JANA 1RZKL 2A38A 4YHIB 4N5ED 2J6EA 2V2TA 4OUOA 3VW3H 2OL3A 2WIIA 2VKXA 3BKYH 1EFXD 1SJVA 2VDOL 4WNQA 4GLRH 4F80A 2NY6D 2W65A 5KSVB 5HI3D 4P23A 3OJVC 5DWUH 4J7RA 3QIUA 2V6HA 3U7AA 1T20B 1Y6KR 4F37F 1A0QL 2IFFH 1OLZA 2EDOA 4R4BA 2EIZA 2QSCL 5I17A 12E8L 1KJVA 1WSST 4QKXB 4BJLA 3DVIA 8CGTA 1E6JL 5GS0H 1Q94B 3M07A 3S35X 2XWJA 1JP5A 1T0MB 4MD5B 4H0HB 3MV01 1I8MB 4HUVA 2BHYA 2XRAL 3KYKL 1OAUL 1PZUB 5E5RB 1UACL 4NC2B 2E8ZA 2A6JB 3FFCD 3JWOH 3G9AB 1ZLWH 3EO9L 4R26L 3MRHB 1CE6B 4HAGA 3T08A 4U1LB 1JYXA 2EE3A 5EIVA 2JIXB 2Q6WA 1I8IA 5LGKA 1I8LC 2Z31B 1U8KB 2Y23A 2R2BA 1N4XH 3SE8H 3GO1L 4J2XA 5IBUG 4OFYA 1FGNH 3MNVA 4KTEL 2P5ED 2BVQA 3QXWA 3E3QC 3FQUB 5F8RC 3TPUA 3IF1A 4EBQH 4G8GB 2D03L 4V1DE 3IJSA 4KPHL 4UDUA