2EE9A

Solution structure of the 16th filamin domain from human filamin-b
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
95
structure length
95
Chain Sequence
GSSGSSGVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 16th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Filamin-B
total genus 4
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ee9A00
1DANU 1DUZB 2M8XA 3T4AB 4J1UA 2DJ4A 3PWUA 1MI5E 4HIJA 5ID1B 5A16B 4J23A 4NSKA 5DJAB 6FABL 1J0YA 3EO1A 2O61B 1D5BA 5BRZE 1T7XA 4FNLL 3ARGC 3HUJA 4BSVA 5B3JE 5GRVL 5J3HD 5DUML 4OFDA 4F57L 1PX3A 4JM4L 4X8XA 5HGBB 3MLSH 1TDQA 4PTUB 1KG0A 4LDOB 4YFDB 5HI3D 4CMHC 2KQMA 4X9IA 4LGPB 1YEJH 1E28A 5FXCH 4UIMA 2V7NA 4C83B 1MH5A 4G3YH 4JPVH 2BCKB 3FZUD 2OL3A 4Z7OF 4NP4H 3QJHA 1PSKH 5E7FA 3MROA 4X9FA 2A74B 5LGHH 3U4BL 5ISZD 3SEPA 4MJ4A 3KAAA 4OB5H 3W2DL 3DWTA 1DANT 1HIMH 5CJXA 3RWGA 3CVHH 4X99B 2BJMH 1UZ8B 3VDCA 5GRYA 3KS0H 1ZHLB 1JYWA 3HZMB 3UAJC 1A6VL 2I07A 3W0WB 1GGCH 3H6JA 3WN5B 4PY7B 3NVQA 1G7QA 4U1GC 1H3WM 4PJDE 3C60B 4S1RH 1MCPL 3EHBC 1XF2B 1HXYA 4IHOA 3FO1B 3MFGB 4KUZL 2JCCA 4ZSOE 2FX8L 4UV7H 1W2KT 5D1QA 2PW1A 2F53B 2BFVH 3W81A 1EEZB 4OI7A 1RZGB 1T1ZA 3ECBB 4TOYH 4S1SL 3N0PB 1X7QB 4UT9L 3ABZA 3MXVH 5ISZA 1QO3A 3TBVA 1KTKE 3VWJD 3OQ3B 3QEQA 1K8IA 3VWKC 1II4E 3HI6H 3WNKA 4AL8L 5IK3B 2R0ZL 2NY4B 3S4SB 4WEBL 1LDPH 2HVKA 1U8OA 5ADPL 3MUGB 3ARSA 3V4VL 1I1AC 4G8FB 5KVGH 4Z7UB 4WIQA 1N5AA 4OCRL 4ZFOL 4KK8C 3BD3A 1MREH 5HYJA 1OB1A 4YK4B 3V2AR 2C3XA 3MRGB 2F58L 1FNSL 1RJZA 4MJID 2QADB 1A6UH 3TIDA 4OCXL 3NIDF 1LILA 5DD6A 3GEWB 3C08H 3U1SL 4QXUL 2X41A 3T65B 3H9SD 2EXYD 2RFXA 4JRXA 3MLXH 3QDJE 4UU9A 5DGRA 5F7MC 3EO1B 2O61A 1AQDA 1K6QL 2CKNA 1A5FL 5J9PA 3CH8A 5DJAA 4TN9A 2FJFB 3QDGE 5ITBL 1XGRA 1PKQB 1SYSA 4PJIA 5KJRL 4J1UB 1DUZA 1JZ4A 5L2KA 2V2TA 3FFDB 3K4ZA 2D7PA 3ARYA 5I0ZA 1YEFH 3O4OC 1IVLA 4RBPK 1NCWH 3KPMB 5IWLC 2NY3B 3LEYL 3PHSA 1CXEA 4JZOA 4W81A 5DJ6B 3AUVA 4PB0L 4TUKH 1L4IA 4XMKH 1DSFL 5JTWA 4LHUA 1BFVH 2X1OA 3O2DL 2J8UE 3OTTA 1MNUL 2JJSC 3GHEH 4XP1L 3EGSB 2XXMB 2DL2A 3F7VB 1AH1A 2HJFA 2HRLA 4XBEH 1AGBB 2QHRL 2PXYA 3MACL 4O51A 1QBAA 4X4ME 4HC1A 1H8NA 1YNTB 4LRIC 2E8YA 4X4XB 4UT7H 5D1XD 1NUFA 3OZ9H 1MSPA 2ESVD 3VDAA 4X5WA 3P0VL 4EI6A 1J7VR 3ZDXE 1I3UA 1PKQA 2VLME 3D69B 3D0VA 4NQEA 4ZS7H 2J1KA 4R7NA 3BZ4A 1NGZA 4DCQA 5EA0H 1N6VA 4WGVB 4X8JB 1KBGL 4ZUVB 3KXFB 3KYNB 2JJTC 4FQCL 3ULUC 4Z5RB 4P3DA 3FQNB 2D7QA 2ZUSA 4NQCD 4XP4L 3UTZA 1ZT1B 3F7QA 3QWRD 5CS7A 1HSBA 3EDEA 2YPLB 4P5MB 1PZ5A 1U8MA 4WI5A 5DD5H 4N8CL 4HZAA 5IQ9A 4YXLH 5IKCA 3EOTL 1SJVA 3WIIL 2ORBH 3SGKC 2NTFA 3FQXA 2B1AL 4J3TA 4OF7A 1RD6A 2A77H 4GRLB 5EO0A 3B9KA 1GL4B 4QCIB 2ITDA 3NIGF 3F58H 3JWOL 5KVMC 5D96C 1IRAY 5E2WH 3BEWA 2MKLC 2BSSB 3ZDXF 3IDYC 2QQQA 4PJAB 4EI5A 3LEVH 2HVKB 4D94A 5F3BA 1D5XA 1NDGB 5DHVH 4HT1H 2ZG3A 3P9WB 5EC2A 4XGZB 1CICA 4WFFD 1QP1A 5SWZB 1QO3B 4XC3L 5ISZB 1AJ7H 3KYKH 4GXVH 3S34H 3TO4A 3HE7C 3FFCD 4NCDA 1RZGA 1T1ZB 1YPZA 3VXMD 3VWJA 5L2JB 4XB8A 4EDXB 4ODSH 1TVDA 1S7XA 4M7KL 5EU7E 2VXUH 4AG4L 1EHLH 3BDBA 4TTDD 2XT1B 3V6ZA 2DI8A 3HPJA 4LSSL 4WHDA 3PWPE 2YSSA 5DUBB 5IMOB 1I8MB 1QA9A 2M26A 1JHLL 4DK3A 4Y5VA 6CGTA 3V6OE 5EOCL 4O2EA 4QXGL 3F62A 5DJXB 2CRZA 2D7OA 1A3LH 5C2BH 5EBLB 3STBA 4U3XA 3WDIA 1U3HB 3SGEH 4F9PA 4F8TA 2BX5A 5AD0B 5EBLA 2P46B 5BO1L 5TF1H 4XBPA 3INUL 4H0IA 2ARJB 4D9QD 1NMBH 4QHLA 5ILTH 4XAWH 4JPIB 2MSPA 1VFBA 3THMH 4G6FD 4BZYA 1DQJA 3TZVA 1S3KL 4FQIL 5C7XH 3LH2L 4JHWL 5FM5M 4BSJA 1IM9B 3U9UA 4AQ1B 4FG6C 1VGEL 5BQ7B 1QLFB 1BFSA 2HJKA 1DBBL 2OX5A 3EJZD 3QPQD 5EC2B 1J11A 5J57B 4YDKH 3VXUB 1CFNA 3ULUL 5F1IB 2UWEE 2F74B 2PTTB 2BSSA 4WV1B 3FQWB 1CD9B 2IG2H 2ITDB 2ZSVA 5E99H 2VL4A 4MJIA 4P9HL 3MJ6A 3Q6FB 5T5NF 5TE7H 1BPVA 3WUWG 1T21A 3AAZB 4DJMA 3T3PF 1CIDA 3T77B 2J4WL 1NLDL 4OKDA 4JRXD 4OF8A 4KKCD 5GGUA 1PZ5B 3SY0A 5HHXL 4NPYA 5FYJL 3T0WA 2IALB 5L6YL 3MODL 5JHDB 5I8KL 1EEUA 35C8L 1QSVA 3NN8B 3VMPA 3ULUD 4HFUH 3QI9D 1WAAA 4YPGA 4R7NB 5IOPA 3ARWA 1ITBB 1QOKA 2W0LA 3EW3B 4XNMA 1YZZA 2DYPB 1LWRA 5E9DD 1UB6B 5FHBH 3DGCR 4YFEA 2Y4SA 4U33A 1ZLUK 4EQ3A 3GK8L 4GAYA 5CJ8A 3C2SA 3G5ZB 1J12A 2N4IA 4LRNH 4Z18A 4NBZB 5DRWA 2F74A 3SGJA 5I1AA 3W9EA 5DHXB 1IKFL 1KFAH 3FTGB 5JPMA 1D9KA 3NCJH 5MP6H 2LQRA 1N4XL 4PJXB 3WMSA 3C5ZA 1TLKA 4Y7MA 3ZO0A 1DBMH 3MRFA 3U9UB 1FSKB 4NZDA 4M48H 4MAUH 4WI2A 5HHOA 3KLHC 4BZ1H 1BQLH 3MR9A 4AIZB 3U4AA 4X6EB 1Z0MA 5GGRY 5C0NC 3VGDA 2B8OT 1R0AH 3NCMA 1QBMH 3TP4A 5TGBB 5AZEH 1AGFB 3SE8H 1DQTA 4ZO9A 3BKYL 2CO6B 3VFSA 4XXCC 4NZRL 4DZ8B 2P4AB 4C57C 2VXVH 1BZ7B 4HEME 1HH9B 2X4SA 3NABL 5IHLB 4OCYL 3U82B 1WZKA 3WJJC 5GQBA 4WY7L 4XVUD 1NEZG 1CXHA 4N8VB 3RIAK 4NYLB 2DLHA 1MI5D 1LO3L 2DJSA 3BQUA 1KELH 1P7QD 3DXAD 4PJEB 4NJ9L 1ZA3A 3D39B 4RWYL 4BFGA 1FNGA 2I5YH 2R1XB 2YK1H 2RFXB 3IU3B 5HI5D 4OM0L 3T65A 3NBNA 2X44D 5CEZE 1TQBB 3D25A 1RFDH 3EDFA 3CMOH 3H8NA 1KXQE 3VI4F 1AO7A 4MXQC 2GFBA 3ZL4H 3MFFB 3C6LD 3HN3A 5B4MC 2B5IC 4JQIL 3SE3A 3VXSB 1SEQH 5HYJB 4GG8A 3ZE0E 5ICYA 1YEEL 3ZTJH 3EDKA 3P4LA 4IDLA 3X3FH 4D9RE 1EFXD 1QBLL 2YHGA 1L7IL 1J9CT 1NAML 2FBJL 5DSCB 1FNEA 5D7KD 3AS3A 1IGMH 4R8WL 1IKNC 4Z7WA 4F80A 5JW4M 8CGTA 4OZ4B 4Z7OE 4PRHD 2RBLA 4M6OL 4P3CL 1Q72H 2YR3A 1RZ8B 1H3XA 4JR9H 3B9KB 1PEZA 1Q9WB 2FZ3B 1A6TB 4JFYB 4DGVH 4OLWH 1B88A 2XG4A 4IRSB 1MVUB 3LSOB 4LSPL 4OT1H 4MCYB 4CW1B 5JIKA 4KY1H 2HFEA 1H0DB 2ZKHL 3CLFL 1IBGH 1M7IB 4KRPC 3JTTB 1E4XH 1JGDB 3UTZB 1HWHB 3RVUC 4NZTH 3GJFK 3L7EB 1A3RH 4WWKB 4NGHL 5EIQA 3F7YB 4NQCE 3V5HB 1QSFB 5BS0B 3MRKB 1ZHLA 3PGFH 5CD3B 4LPYA 3M45A 1HEZB 1MQ8A 4LSVH 2PYEB 5HPMB 3LB6C 3DO7B 2OM5A 1YDPB 2FIRT 4ZG1A 3O6FB 3OAUL 1Q8MA 1LD9A 4FFZL 4AEEA 1CDGA 5BVJB 1U8PA 2V7HA 2WQ8A 2QQKH 4LLQA 5CLWA 2H26B 4PJ8C 4LSTH 1F58L 2WBJB 4Z6AT 2IBBA 5EU5B 4TSBL 4RNRB 2G5RA 3OKKB 3N50A 2R23B 5F7WC 4YUEL 3RBSA 1QFWH 2Q7YB 4KXZH 4UIMB 3WDJA 1JPGA 4LCYB 1ADQL 3UTTD 1JUFB 5GIRB 1IEAB 1FL5A 5JHLL 4KU1A 1Q0XH 2IPUK 4PJ5D 5D7JB 4J6RL 5KSBA 4LHUB 1WAAE 1ODAA 1A4KA 2P45B 2YZ1A 3BE1L 4TSCH 3W0WD 1OTUC 3PG2A 1GHFL 3LPFA 1CU4L 4KKAD 4KJQD 1MF2L 4RA3A 3HMXH 3NZ8B 2IGFL 5ANME 1D5BB 3U0TB 4BSWB 2AKRA 1EH9A 1DFBH 5FDWB 4H8WH 5H37H 1ZXQA 2NW3B 1IGJA 4NC0B 3WIHA 3BXNB 5ID1A 1NCUA 2R2BB 3QCUL 4HKBB 1IKNA 1XGRB 3ZKND 1YQVH 3B2UD 5HY9A 4WO4D 4ZOBA 5ESVB 3BHBA 2AEQH 4YHKH 1HYSD 1NMCB 3G5YA 5IIEB 2DKSA 2IH3A 4TUOA 3SQOH 2P49B 2QQLL 1GAFL 3BISA 3ES6B 1AR1C 3L5IA 3UZQA 2W9EL 4KKBD 5L7XL 2G75B 5C71A 2DQGL 4OIIL 1TVBA 2DMCA 1Z9LA 3FRPG 4LCWD 5DO2C 1FZMB 3TWCH 3D3VD 3KPSE 3DVNB 4N8VG 4QTIL 2E3VA 3OJDB 5HI4C 1VCAA 4U6HB 4LASL 3BZEA 4Z7QF 4N9GB 1EEQA 1N5AB 1LHZA 4GRMA 1FG9C 3EYSL 4JDVA 2BXZA 3QCVH 4PIRF 3U2SB 3I2CL 3PL6D 2DJUA 5T3XL 4QRRD 5IK3A 5H94B 4AH2A 5LWYH 2R2HA 4JN2B 5MENA 3VW3H 3TBVB 4P2RD 4P23B 4O2FA 3MUJA 4X9HA 4UZGA 2Q8BL 4GKNA 1UJ3C 1C7SA 2CR6A 4HWUA 4P4KB 4WNQB 3FMGL 5LG1A 1B6DA 2FJGB 4JY5L 5D5MF 1VSCA 5T3XD 3C60A 3KXFE 4LSUL 4N1HB 4X5XA 3WNLA 4A2LA 4LCWB 4PY7A 4M7ZB 4HK0B 5KS9E 4MD0B 2RR3A 3GIVB 2R0WL 2XN9D 3IETB 3IU4H 1I9EA 4DKEL 5L88H 1Y6NR 2QQNL 4F2MB 2PCPB 3HE6B 4UDTB 4KDTC 3SGJC 4PGEB 1FP5A 3Q3GB 4NKDA 4NNYA 1E4XI 1D5MA 2Q20A 1YEDB 2CGRH 5MEND 4R97B 1TTGA 3VFPB 1FH5L 5KVFH 1CN4A 4ETQA 4Y88A 5JO5A 4AZ8A 4B53A 4P23D 5C0DB 4AY0A 4ISVA 4G5ZL 3EOYG 1YNKH 4XC1H 1ZA6B 5DRNA 1DDHB 3QRFM 1HHHB 5ICXB 4QRQA 3QUYA 2A6DA 5HI3C 3SGDH 4CKVX 1JTTA 4O58H 5HYIA 1A6ZA 5GRUH 1YYLL 1XGPA 2I60H 5HHMB 4UOW0 3KXFD 2YMXL 4MA1B 4XVJL 1YJDC 1JGVL 4QRPA 5F6IC 3NIFF 4FQXD 5HGDB 3RVTC 3IAQA 2QSTA 3GSNA 3I02B 12E8H 2VQ1A 2EEDA 4LLDB 1X6NA 4ZTOL 1XR8B 4PGCB 2XPGB 5MERB 3EBAA 3QFJD 4MYWB 2BOCB 3ZKXB 1K5NB 1MJ7L 4JHBA 4OCSL 1GZPB 1HHJA 1KCRL 1NCBH 2IAMB 2IADB 1BM3H 3VRJB 3L5XH 3CFDA 3LOWA 3PGDA 2YUXA 3IFLL 3OXRB 4XRCA 2FEDD 5FK9B 2RCSH 4U1MB 5JW4Q 3EYFA 3QUMH 4GW5B 2NY5L 1TJIH 4JEGB 2MPAH 4XPBL 1GGTA 2P5EA 2DQJH 3WCYA 1AKJD 3MLPA 1NFIB 3NTCL 4NQDA 3TZVC 4A6YL 1P4BH 1YY9D 4FMKA 3OKNA 4KQ3L 1TZGL 2CKBB 4JO4L 3RGVA 2AXHA 3I9GL 4K23L 4KJPC 4KKLC 1OPGH 4X6DB 2B2XL 1E4WL 5CILL 1DVFA 1SEBB 3BFOA 2OQJA 1OAQH 3IDIB 2ADIB 3B5TA 2UWEB 5GHWH 4DKAA 4LDLB 4I3SL 1MIEH 5AWNL 4YFLI 4AEHL 2AGJH 5C0BE 4QYOA 2IH1B 2BC4A 5DK3A 4M00A 4IM8A 1XGTA 1I7ZA 1T20B 1GPOL 1GIGL 1UB5A 4DVRL 4ODBD 5IMMA 5HD8C 4JANB 1G9NH 4EVNB 3TO4D 4CVWA 1MFDL 2UV3A 1P5VA 3SDXE 4KWUA 1KXVC 2DTML 2W0KA 3KDMA 1CZ8H 4WUKH 4PD4J 3N9GH 5C07E 2WK2A 1F4XH 3P77B 5IB5A 2H45A 1U58A 5HYEA 3KG5A 4RZCB 5FUCE 4AJ0A 4FXKA 2H32A 5AAMA 3IVKB 4HWEL 4Z95H 1QHPA 3AU1B 3D3VB 3D39D 3TJEH 3QHFL 1I1AB 4PS4L 3E0GA 5CZVH 5D72H 3BJLA 5CINH 4DGIH 3BO8B 4K8RL 4OF3A 1OAXH 1W0YT 3P4MB 2XKUA 1KB9J 1XR8A 4PGCA 2X4NA 3GNMH 3WFEH 2DF3A 2R1YA 4P4RB 4YXHH 1Q1JH 4YK4C 5DFVC 4QGTA 1J88A 1NBYB 4LSDA 5ISZE 3CFIC 3RU8L 2PW2B 4OGZA 4FZ8H 4G9FE 4RDQF 3SGDI 3R06B 5EFIA 4KK9D 4OCWL 4LLUB 1DN2A 4NFBA 1YMHB 1N6QH 1U41A 5DC0A 1ZVYA 2ITCB 4XWOC 4JG1H 3PGCB 1RZIB 4NBXB 1RZKL 2ZG1A 1WBXA 2CR3A 4YDIL 1JWUA 2EDQA 5LGJB 2FGWL 4KVNH 1RZ7L 3V0VB 1I7UA 2HRPH 4GFTB 2Q6WA 3RTQB 4M7LL 5B3NA 2J5LC 2W9DH 4L8SB 3WKMH 1MIMH 2EH8L 1BWWA 3HPLB 1C1EH 1M7DB 1AO7D 4K3DL 5DFWH 3IJHA 1TVHB 3RGHA 4NC1E 2AJXH 1NGWB 4PJIF 1X5AA 4M5YL 1D6VH 1FAIL 2ATKB 1EK3A 3I3DA 5I1JL 2R8SL 3T1FA 4I2XA 1G9MC 2CJUL 1S7UA 3BSZH 5IB2A 3VJ6B 2C3WA 3RFZC 3RUGF 4X83A 1KJ3L 5I8OH 1C5BH 1YQ2A 3T3PE 3RWJA 2KDGA 4IOFD 4R2GC 5IMLA 5FB8B 3U36B 3O6LH 5FUZH 2VMFA 2HLAA 3OAZH 5IWLA 3TV3L 3OKMA 4QKXB 2DM2A 1NC2B 3ARGD 2VXQL 4MQXD 4L3CA 3IF1A 4JPWL 2H2PD 1KN2H 3O9WD 5D93C 3E2HC 1YEGH 3NAAL 1WBZA 2YRZA 1S7RB 1TPXB 5ALCH 4MS8D 2NXZB 1IC4H 4YHYC 2NNAB 5I30H 5KSAC 3C6SA 4ORGB 4PRHE 1P53A 2IFFL 4ERSL 1CXIA 2R2CA 3AREB 5GRJH 1U8JB 2EH7L 3KNBB 2IPUG 2YBRB 1XGUB 4LSQH 4ONOA 1EAPA 3QISA 4MJ5A 2HWZH 1TJGL 3NH7L 4CVUA 5IHBA 1HSAA 2AEWA 4I48A 4G6MH 1LEKB 3VXRA 3O4LA 3VFGL 4YBQC 1ETZB 5L8JB 4N0CD 4DEPC 1JPSL 3G5YB 1HINH 1OW0A 2WUCL 5IIEA 1TJHL 4ZUSB 3V8OA 4XZUB 1KCSL 4JFED 2NY6C 2ZZUT 4KTEH 3WIHH 3QDGA 5CBAB 3T3MF 2ZCHL 3OJMB 2GSGA 2MTPA 1CL7L 4L4VA 3QWRA 1FZOA 3MCKB 4Y4FD 2VITA 3FO2A 2DQTH 1CGWA 3LV3A 4BSWA 2A6IA 3C8KA 3QPQC 4S0SD 4NDMB 4WFGE 4ZYKB 1KN4L 5D7SL 2VYRE 2HFGH 1HWGB 1P7QA 2XZCL 1AXTL 4HJJH 4KDWA 3VDBA 3U83A 4NO0A 5IROA 2P7TB 3P9MB 4U6XA 2V2XA 3ULVE 3IFPA 4JKKA 3IFOA 1PSKL 5EU6E 5KVDH 3FB6A 4WTXA 3QZWA 3QDHA 3QEGL 5TFSH 3MV9A 4NFDA 5F6HI 2LU3A 2OR9H 4NQVB 2H3NA 5B8CB 2YWYA 1T1WB 3QDGD 2I27N 4OB5L 3WFDH 1OOAA 5E8PB 1JPFA 3RJDA 3C6LC 4MDJB 3CVHL 2BRRH 5J1TC 4JG0L 5JHDD 3SQBA 1C08A 4NN6C 4FOMA 1A6VH 1MRCH 1I4FB 3GMOA 5IW6B 1A14L 3WXVH 5F1KC 1CFTB 3TEUA 1RUKH 1F11B 2HMID 4HZLA 5I74C 4OLUL 32C2B 4KUZH 4Z7VA 3PF2A 5C0EB 4OLVH 2R1WA 3LQAL 5DD3H 4QRSA 1CLOL 1LO4L 5HYJD 3L7EA 4WJ5B 5BVPH 2QJDA 2KH2B 4PGZA 4ELME 2VDMH 3B2VL 1BMGA 4GMSL 4S1DD 4UT9H 3VRLF 5KS9B 3JTTA 1NPUA 3BP4A 3EYVB 3ZDZF 2HFEB 1XGYH 5EU6D 1VESA 3MLRH 1ZHNB 4JREC 3ARGA 5MEQA 1RIHL 3O8XD 1EO5A 5BCAA 1BQHB 4P59H 4U1JB 1MY5A 1INEL 1T0MB 1XIWA 4W6YB 5EUKB 1JF5A 2N56A 1LE9B 1SJHB 3S6CA 1NGPH 3WFCH 1C16B 1I9JH 2FHCA 4Z0BH 4J8RB 3BT2L 1FL6A 1AXSA 5GRVK 1I3RA 3IFNH 3TPKA 4ZFGH 3TCLB 5MEQB 3MNWA 1OAKL 2PYFA 4U2YA 1MFEH 4HV8B 4ONGH 5CWSB 4O9HH 3BP5A 5MHSD 1T7ZA 4OZGF 3CCHB 5JNYB 4XCCL 5CJQL 5CCKL 1A7RL 2BOBB 2HH0L 5CP3A 3QIWA 1K6QH 1SY6A 3DMMB 4WJ5A 1A7BA 4LNRA 5JIHA 3NIGE 1UM5L 2NYYD 3MLUL 1A9EB 5KJRH 2FB4H 5J13B 1YJDL 32C2A 2X4TA 4G42A 1T2QH 3GBNL 3O8XB 5D2LF 2X70A 4PJBA 2DLFH 1RJYA 2WBJD 4TULH 4WW2B 5DRZB 3VD9A 4MXWL 1RIVL 1LE5B 1W72B 3RVUD 3BGFC 3UTSB 2YC1A 1AP2B 3GSQB 2PXYD 5JQHC 2CRIA 3GKWL 5GSRA 3DURA 2OTUA 4O5LL 4OD3H 5D1XA 1KEML 4NQVA 4DKFL 5K33A 1MJJB 4XBEL 1BLNA 4K94C 3U0PA 3MA9H 4NKMA 5DHYB 4PJ8D 4H25A 3ZT6A 3MRLB 4U1LA 4QRUB 3WDHA 1X9QA 1VACB 2ZWLT 1P7QB 3UBXB 4CVXB 4AT6B 3TF7C 4JDTH 2DDQH 3SKMA 4LLVA 4FQPA 2SEBA 1RK1B 1TCRA 4F9PC 3DRQA 4R96A 1UM4H 2F54D 1H15B 3WS6C 2CK2A 1KJ2L 3FO0H 2I9TB 4F37K 1K85A 1G6RB 2AJ3A 4PG9B 5FECA 4XH2B 5TE4H 1BX2A 4PJFE 5C0CA 1XF5A 2P44B 1QLEH 2UUDK 4UQ3A 5KOVC 3QHZL 4PRPE 1HNFA 5KVEL 4MD5A 1DE4A 4MCZB 4PLOB 2BDNL 3TM6A 1CICD 5IOPB 3O2VH 4F3FA 2V17H 1TQBC 3WUWB 3QI9A 2YRPA 2C9AA 4ORZC 3LRGA 2W60B 1R24A 2CXGA 4IMLB 1DN0A 1R3KA 4M8VA 3K8KA 2D03H 3MV8B 5JHDA 4I48B 3IDMB 5FO7A 1IGTA 4I77L 3MRMA 3B8SA 1VEPA 1G0DA 1VDGA 2X4RA 5C6TL 2BVYA 2ZOKB 5BXFB 4BKLB 4P5TD 4DUVA 4ZUWA 3Q6FA 2BNUB 1I1RA 4JFFD 3DIFA 3T4YA 2AQ1A 5I6XC 5DUPH 3QNXB 3Q0HA 3JUYA 3CK0L 1CD0A 5J11B 2I9LA 3B9KC 2DBLH 2BVTA 3QPXL 2ZUQB 2PTTA 4IOSD 3HFML 3ILQC 1U8IB 4U49A 4M7KH 3AFLA 3FAWA 3HAEB 2FO1A 2LFGA 3DARA 5SWSE 1FGNL 3FL7A 1WTGT 5BQ7A 4HF5H 5FB8A 3RWDB 1QRNA 3IKCB 4K7PY 2QV2A 3BGMB 4C4KT 5EULV 3QIWD 4Q0XH 5CEYA 1QFUH 1JGUL 1W72L 4Y19E 5JDJA 1WZMA 4NOBA 4J4PD 5C08B 1EJ6A 1DLHB 5KOMC 2ARJA 4MNGA 4LFHG 5CSGA 5JQ6H 2HN7B 3B3IB 4QHUA 1FGVL 2R0KH 4MGXA 5T33L 1CE6B 4P2QE 1JZ7A 5FGBC 3INUH 4GUPB 3MBEC 3ISWA 4XCFL 2UY6A 5IHUH 2AW2A 1T1XA 3DVFA 4OD2A 1HK6A 1M7DA 4EXPX 2AXFA 4XWGH 4L8SA 4HS6B 1FDLL 3O3BB 1KTDB 2B20A 3RY5A 5IJKA 3EZ8A 4I9WD 4JAMA 4NM4H 3KJ6L 1OTSC 5EOTB 3QUZD 2NQCA 3K8MA 3C6LA 2J6EL 4CNIA 3DVGA 3PGCA 4LVHC 2VXTL 2J8OA 5EU6A 4MJ2A 2BHUA 5L9DL 1DBBH 3SDDC 3IDXL 3N85H 4A2MA 3FCTB 3MLYH 3GMPA 3OR7B 4PYHA 2EIBA 4V1DB 4N0UB 3K46A 4MB4A 4UT6H 3TC9A 5L2JA 3RI5F 1DEEA 3NZHL 2KBGA 3HNTH 3TO4B 2AK4B 3VMNA 5T3ZE 1YN7A 4M9OA 1TETL 3TBSA 4YDJA 3GSRB 4XMPL 5I71C 4HGMA 1CGSL 5INDB 2HKFH 4KJYB 4ONFL 2DWEA 4BFIB 4EXKA 5FA3A 5TPWL 2NY3D 1FLTX 2BMKB 1HQRA 4D0DA 3BZFA 4M03A 2VLJE 1MRDL 2XKSA 3BIKB 3NFSH 2H41A 4JFEA 2APBA 1CFQB 4QWWD 4M43H 1SBBA 3FQXB 2NX5A 2EDDA 1CQKA 5IB5B 4XNZB 5TJWK 1JYVA 1K2DA 3H3KA 4JZJA 1IEHA 3A0OA 4YE4L 3BPLB 1HHKA 1NANH 1MFAL 3CFEA 2YPLA 5KSVA 5HHOD 3BP6A 3C5SA 4NHCH 1KJ2B 4GXUM 2AEIT 3CVHB 5DMIH 4OZIF 3EYUH 1CE1H 1I8LC 5T3XE 2OSLA 2VISA 5M7QA 4DCQB 2V9RA 3LMJL 3GK8H 4NO0D 5GGRB 3RY6A 4DAGL 2B39A 4XPTH 1EJOH 1N59A 3D0VB 4FQ1H 4ODHL 3X11A 4ZNEE 2CDGB 3MUZ1 4PJCF 1ZHBA 4R2GD 1NBVL 1JHTA 4D3CL 5JW5A 5E94B 1SM3L 4CDHA 2VE6A 5KSAA 3AROA 2OJEB 1Y18A 4M48L 3EOAA 4NCC1 1T03H 1U92A 5DFVD 3A67L 5ADOL 5D71L 3Q5YA 2VLJD 4Z7QE 2EC9U 3QA3A 4GAJH 5BZWB 1F3JA 3SOBH 2YPLD 3I50L 4P5TC 5F72S 2B4CH 3TO2A 2FO4B 1T5XA 3GMLB 3OJVC 4KVCH 3SKOB 2BP3A 5MHSE 2WIIA 1BFOB 4AEIH 4JO2H 4QRRA 4J4PA 2P5EB 4FQ2H 4NO2B 2FD6H 2EDWA 1CGTA 5CJXC 4IJ3B 5KZCD 1BQHG 4OM1L 1ZLVK 4U1MA 3FHAA 1XF3A 3RHWF 3UJJH 5HVHC 1OLZA 5J8OA 3NGBB 5LQBH 1KELL 2DD8H 3CVIH 1MCIA 2O5YL 4JFEE 1VADA 4UMGA 3HC3L 3LKPB 4R6UA 1E4KA 2VLJA 1MVFA 1WC7A 1PQZA 3A6BL 1U93A 1VERA 3SE4A 3CMGA 4PR5B 4X7CC 3MRJB 4CJ0A 4R3SB 2PKDA 3DSNA 5E5RB 4MMXC 4PJHE 5HHQB 1GGBH 1R3JA 4TVPD 3PP4L 2VDPH 2X9YA 4RFNC 1SYVB 1JNNL 2ZSWA 3LRSA 2BERA 1S7TB 1MCNA 3MA7B 2AK4E 4DZBB 3HG1A 2O5ZH 3VCLB 3MBXH 4BELD 1RUML 1FZKB 3PV6B 4CN6A 4NM8L 3U4EB 1CDYA 4OV5A 5C0DA 4UOW1 1UWEL 2B0SH 4E0RB 1M71B 2F15A 4G43B 4YHLL 4RRPG 3QEHB 1JZ5A 4M6NH 4G8FA 3QG6A 3SCMB 4M1CD 1P7KB 3MRNA 2EIEA 4NZUL 1MAJA 4U6YA 1CLYH 1WIUA 2NY3C 1EMTH 3RAJL 3TT3H 2AJVH 3IT8D 3U9PL 4L8CB 3PV7A 2VXSL 4P2QA 5IESH 4G8GD 4J4PC 2X4UB 4LDEB 2GKIA 1WICA 4RAVA 1B0GB 4JFXB 5D1QB 2PTVA 1Z5LB 2NMSA 4IIQC 1MAKA 1K4CA 3WO4B 4EZMA 5FV1L 4LVNC 3DHJA 1IAMA 4C56A 5JOPE 1AHWC 3QUXA 3O45A 3D5OF 3V52H 3RWHB 3UTSD 4B5EA 1JTOA 4EEEA 4Z76B 2IANE 3ARPA 3HE7D 1ZT7A 3L1OH 4NQCB 4X6DE 3GIZH 5CEZD 5CZXC 2FEEL 1DQMH 1AXIB 4P23A 1QLRA 2BY1A 1DBJH 2XWJA 3WL9A 4WEBH 3TH3T 4Y4HA 1ZGLA 3U7AA 3U2SA 5T1KA 4OFIA 4PRID 3HNVL 4NKIL 1WEJH 3HI5L 3MGOB 2L4OA 4OAWA 2GJZA 1IGIH 2UZIL 4HUNB 3KJ4C 3SJVD 1EUTA 4XAKD 1DL7H 1YC8A 2BCKA 3NACH 2F58H 4XCYB 4M7LT 4OFYD 2R4SH 1MF2H 4I0PC 5EO9B 1XEDA 3RGVC 4GW1A 4L29A 3NPSC 4HIIA 4JZJC 3FFCB 4HW6A 2NY7H 2JIXD 1BF8A 2CQVA 3WV0A 5BOPA 4YHNB 1BWMA 3T0VA 3QCUH 4K3JL 5FYKU 5D6CB 2X4UA 1I3GH 4LGSB 3UBXG 1G7IB 4GAGH 4M1GH 3ESVF 5T3ZL 3PHOA 3IDYB 1FO0A 4ZUTA 3CDFA 4YAQB 1T0NB 4U6YB 3BPOC 3EO9H 1VA9A 5E2VH 3WXWH 5FA4B 2DQDH 4MD4B 1NGXA 1LQSR 3QG6B 4OZFB 1L9NA 4X6CE 3OMZA 3HKFA 1IAOA 2EDKA 1DBAL 3LEYH 4YHPA 5F7LB 1MY7A 5DJ2B 3WIFB 1I9RL 3AY4A 4TUKL 5EU7C 4XMKL 1NEZB 1ZSDB 3WFHA 5K9KA 1F13A 1B0WA 3L95B 1UXWB 3GRWH 5DTFB 2GT9B 5IVXF 5C0FB 3V5DB 4C58B 1X4ZA 2XG5A 5BOZG 5C0RH 2CDEB 1FIGH 2F8OA 5D7IB 3PIQA 3KS0J 3ZHLA 3VFMA 1SYVA 1JUFA 2YKLH 5EU4A 1R3JB 4ZFZA 2E27H 3I2CH 2P8PA 4NUJA 5E00B 1SBSH 3BZDA 1AD0B 2IC2A 3OKKA 3TBTB 2Z93A 4HLJA 2PO6C 4LL9A 4RNRA 3LQZA 3VW3L 5EIIB 3S35X 3EDJA 4HCRL 4L4TE 4OGAC 1MCRA 4MX7A 1RQ5A 3GI9L 5TH2A 2X7LA 2PUQT 5H37G 4FMFA 1U8PB 2V7HB 3O81A 4XXDB 2M2DA 3VXTB 5BW7A 1G9NC 3X3GL 3UEZA 3SDDD 4I5BB 1FFQA 4HPOH 3UXFA 5DEFB 4ZS7L 3O6MH 4JO3L 1CLZL 5C0JB 4PJ9B 1KT2A 2ZNWA 1JPTH 4WO4C 1DTUA 1ZV5A 3D39E 3PQYA 4ELKB 4ELMB 3LS5H 3MRKA 3FT3A 1ZEAL 5HYSG 5DJYB 5L88L 2GTZB 5TF0A 3HC4L 1BAFH 4DOHE 2BNQB 3VI3F 3KWWA 4HXBL 4OGXL 1NFDA 1VGKB 2A73A 1U95B 2WQRA 3WE6A 1YNLL 5C0GA 3CDGB 3HI1B 4QHMA 4XNUL 4M4PA 1JV5A 4FQXA 1BEYL 1MLCA 2F53E 5D9SB 1PAMA 1PW3A 5C0ND 1A47A 4U2ZA 3QBTB 3MUHL 4E42B 1HOCA 4XT1C 2V5MA 1MUJB 4XHJC 4XNXL 4M7JL 3OXSA 2DYPD 5FF6A 2VLRE 4Y4KC 2UYLB 3OV6A 5D5MA 4HKZA 1JHTB 5JW5B 3X13A 1CFSB 1GZQA 5EB9A 2QEJA 4LHUG 2D0HA 3KLSA 4ZAKD 1TENA 1S78C 3UX9B 3S88L 3AXLA 1A6AA 2Z31D 5EC1A 3VG9C 1T04A 4PTTA 1L6ZA 3HZKA 2EXWC 1BGXL 2CLZA 3MJ9H 1AD9B 3LS4H 4GLRH 1NLBL 1CFBA 1EVUA 1H3TA 4OLYL 4ZPTB 4NHUB 2LAGB 1UCBH 1U8LB 1A1MA 4EQ2A 3F6LA 2R1XA 3SJVA 4QXGH 2QSCL 1F02I 4Z7VE 1U8KB 4LEXH 5IVXB 4NQDD 2Y9RT 3V5KA 2NX5B 3R0NA 1G7HB 1BBJA 1UYWL 3B5GA 3QUYD 4ODVL 4PRNB 4N8VA 2FSEA 3UZEA 1YEKH 1AR2A 1LO5B 4F7CB 5HYSA 4WHYG 4FQLH 4HH9B 4ZUUB 2P8LA 4BFIA 2JIXA 4NZJA 4K3GA 4P0DA 1ADQA 4NNPL 2EDEA 2GK2A 4JFPA 3BPNB 1BF2A 4PG2A 3DXAB 3QFJA 5E8DL 1R3HB 4AMKL 3QIUD 2ADFL 4X6EA 4TNWF 2KZWA 4EN3C 3BUYA 3QDMD 5KN5B 5K9JL 1KIQB 4WUUE 5T1MA 2ICWJ 4EUPB 3LKRB 1NGQH 4LF3B 4GSDL 5HDBE 5TDNB 1C12A 2E9WA 2AGJL 4N1CA 2EKJA 2ZG2A 4QNPE 4P9MH 2UZXB 4NNXB 2J88H 2ATPB 3ROOA 2YOCA 1OP3K 5I15H 5EWIL 3U0WL 3RZCD 5DD0L 2EIZA 2F5AL 1LP9F 1NBZB 1J1OL 1UWGH 2WAHA 5KBNC 1EEYB 4U1SA 2OK0L 4QEGA 4ZFOA 3MV01 4KK8D 1LO2L 4E5XB 1KXTB 5CGMA 1IC5H 3S5LB 5F7EL 2XWBB 5I16A 4LBEA 2XN9E 5FO8B 1C5DA 1JK8A 4WFGD 2OL3L 1C5CL 4PJEF 1B0RA 1QRNB 3HZYA 1WUNT 3ARRA 3IKCA 4MAYB 5JUEL 4L4VD 4AENB 3NOIA 4KMQA 3AAZA 4JDZA 4KROB 3OGOE 4OLEA 1XIWD 3GBLA 3S3JA 2LTQC 1T5WA 4Z78B 4CN4A 5TQ0H 5C9JB 5MENE 3RL2A 1XT5A 3QQ3B 4YXHL 4PRHA 2VLKE 5K59F 4KV5F 1EUUA 3VFUA 2RJMA 5GS0L 1CFNB 4PJCE 5D4QA 3H42H 5IFJB 4PJ5B 1CGUA 1KC5H 3UO1L 1KGCE 4EOWL 1TXKA 5DK0B 3QXDA 3QNZB 2AABH 1QLFA 5I19L 4KRNA 3AGVA 4HMDA 4XMLH 4W6WB 1FFOA 4MAYA 3KPNB 2ZOKA 1NCTA 5FYKH 1A1OB 1UEMA 3UC0L 3CX5J 4X4YB 4HX1B 4P5KB 1DQJB 2XWBA 2V2WB 1CFVH 1BVKA 1DN0B 3MPCA 4FFWC 4RIRB 4YIQA 1DBKL 4LCWE 4Y19B 4BZ2H 4NRZB 2XFXB 3L9RB 4IRJA 2R4RH 2EEAA 1V5JA 4HC1L 1BQUA 3QUZB 5F9OH 4OGYL 4PJ8B 3IDUA 1PLGH 3MSPA 1QKZH 3L5JA 3MRBA 3LB6D 1IAIH 3CH1B 2XZQH 1V8HA 4PP1D 5IGXH 6FABH 1JE6A 2YSSB 3BDXA 4FQJL 2QR0B 4WUUA 4LF3A 5D7JC 4I4WA 4EBQL 4WI8A 4MHHG 5DWUH 3HPJB 4L9DA 5GS1C 2EZ0C 3LKSB 4KHXH 4EUPA 3VH8G 1KIQA 4JN1L 1V7ML 3DSFH 4YFLF 2EXWD 5EPMA 5GRXG 2I26N 4NO3A 4RGMC 3U6RB 3GSNL 2CPCA 1RJLB 3QFJB 3NAAH 3ZE0F 3QIBC 4ZNCD 1KF9B 2QSVA 1TZIA 2C1PB 4OV6F 1CICB 1OARH 4MLSA 1P1ZB 4QRTA 4U7KA 3CXDH 5DHVB 1YEHH 4TTGA 1JL8A 4EI5B 1CI5A 1ORSA 4LSQL 3BP7B 1J87A 2VDNH 5EBWB 3WKNA 5J6HB 1XZ0A 4YZFF 5TQ2H 1OW0C 4PRNA 5C3TA 1HHGA 1URLA 4LSPH 3GHBH 3LKQB 4L3EA 4APQA 2A6JB 3V9FA 1T2JA 2ADGB 1ZS8B 4J2XA 3CLFH 3QZWG 5HJ3B 4NQED 3S4SG 3V0WH 1FORH 3FOMB 2Z92B 3FB5B 5DR5L 2HJLA 3QEUA 3SKJH 3UYRL 1IGYB 2LU4A 1OM3L 3X12A 1GGCL 4OQTA 1QR4A 5C07D 4MNQE 1OD7A 5C9KA 5D2NE 3ZT5A 5EORH 3VGFA 2IFGA 1MFBH 3G5VA 1CL7H 3ULVH 5DS8B 5CWSA 2NY0C 4R7DB 2PYFB 2YUZA 4TPRH 4DW2H 4EI5D 2C3GA 1DQQA 1TQCC 1CFSA 2QQKL 5CIPB 3GM0A 1KIRA 1OTUD 3ARFB 4P57B 3WS3A 1AIFA 3MRCB 4RMSA 1C16A 1HOCB 2G9HB 1A2YB 1QACA 2H6PA 2VABA 1N7MH 1IMHC 1XF4A 2Y7QB 2VL5B 3BX7C 1F2QA 2OTWB 4YDVB 1AGBA 5DF0A 4Y1AA 2AI0L 5FM4A 4QHMB 3RBGA 3EGSA 1X5GA 1IAII 4G7VH 1KPVB 2XYCA 4HH8A 3FRUA 4JJ5B 4G7YH 3RIFF 2JJWA 2A0LD 2F8XC 2NXYB 2I25N 4XPFL 5EZOH 3TN0A 3MXWL 3C09C 1LO0H 2EDLA 2P24B 4PG2C 4Y5YB 3QEQD 1P6AB 3MCG1 1MWAA 5DT1L 4H0GA 1H8OA 3MGTA 4MSWA 4NN7C 4JFDB 2OR7A 4PJIB 2OJZH 3VXTA 4XXDA 3X14B 3GSWB 1IC7L 4Y1AD 1MQKH 1C8PA 1SJEB 2QQLH 2FLBT 3TIEB 2K3TA 1S9XA 3SO3C 3T04D 3G6JE 5CP3H 2W92A 5BJTA 4KZDH 2EDRA 5EH1A 4G8GA 2AV1B 5EU4B 2GJ6A 4X9GA 1T1YB 5C0IA 5ITFB 1B3JA 5F7DB 3NFPB 3ZYOA 4C56D 2BSRA 5E4EC 5FYJE 4HK3J 1OP5K 3SPVB 4F7PA 4G6JL 5IJVA 2VLRD 3CU1A 1ZTXL 1FVEA 2OI9B 3MCLL 1FBIH 2XACC 2OP4H 4N0RA 4N9OB 3LY6A 1CG9B 3O3DB 1I85A 3ZKXC 2D31A 3EYSH 1G0YR 4ZXBA 3TBYB 2DBJA 2CLRB 2VITB 3VI4E 4PREB 4YQXL 3CFCL 4JY4B 2KL6A 1G1CA 4XNZC 1S9YA 3DTXA 4PRIA 4ZXBC 5KZCB 4YGVB 2FIKB 1ACYL 1VPOL 4XZUA 3ECBA 3H9ZA 3TYGL 2FH8A 5D1ZB 2LVEA 2JF1A 1KIPA 2HMIC 1HI6B 3R1GL 4YHNA 3RIFK 1AGCA 4S0TD 1T2QL 1LEKA 5IM7A 2KPNA 3O2WL 5D70L 1N6UA 2LE9A 2EE6A 3RWIA 2I07B 3W0WA 3JVGC 3O9WB 4WWID 3S36H 5LVEA 4L3ED 4PV8A 2FATL 1CTOA 1IQWH 1XGUA 4Y5XA 2D7TH 5EN2B 4NWTH 1OAYL 5FCUH 1NGYB 1HKLL 2D9QB 4YXKH 5DEZA 1U8HB 4P46C 3WEXB 4HG4K 1VEOA 3BDYH 5C0BA 2YXMA 1CDUA 4OD1H 4S10A 5IQ7L 5IBTH 3V4UL 2AQ2A 2XTLA 3W9DB 5LXGH 1YN6A 1CD8A 3QIBD 4LRIA 2PO6A 5CKGA 4BH7A 5IHZB 4Z76A 2LABA 2ICWA 4MA8L 5C8JB 4RFOH 1I1YA 1ZHKB 3QAZC 2DDQL 3MJ8B 1R5VA 3DV4A 4HIXH 5BZDB 3SDAB 1K4CB 1D5ZB 1K8DA 3RTQD 1U9KA 4RFEB 5E5MA 2BNRB 2M1KA 3HA0A 3RA7L 1EBPA 5LAXB 3ARDD 4L8CA 5IFHL 3KYMA 3PABA 1OAZH 4CMMA 1WFNA 3DX9B 2AVGA 4O4YH 4ALAH 4FFVD 1NJ9B 1YY8B 1JMXA 1NAMA 4PGBB 3O2VL 3QDAA 4WHTA 3L5XL 2CIKA 4QY8B 2C1OA 4GLRI 5F89A 2FYYA 5E6ID 2JJVA 2YD9A 3RKDC 4WTZG 4JLRA 5CBEA 1W0VA 4IDJH 3PDDA 1F97A 2NY5H 3CZFB 4XPAL 2IQAB 1T2XA 1I7TB 2WSKA 5DK2A 2IQ9L 3IGAA 5BV7H 1FFNA 3DX7B 4YZFE 3H9HA 2ITCA 5GGQL 2XA3A 4A6YH 4XAWL 3L3GA 1OCWH 2YRLA 5TDPA 2YPVH 5FUOL 3UJTL 3LH2H 5I1HL 4K23H 3LN4A 3KPSB 3GSVB 4IBLT 4HJGB 3IXTB 3QJFA 2VLLB 4P4RA 2NY5C 3AS0A 3MRPA 1WC7B 2P5WB 1OY3B 1B2WH 4YX2L 4PBXA 2NY2D 3F5WA 3MNVA 1J8HA 1WCBB 1I1AA 3LIZL 4KPHL 4ODWB 1OAUH 5F1NA 2AK1L 2KUTA 2FL5A 3RUGA 2AEPH 4FXKB 4PJFB 1R3IL 4PY8J 4B41A 4WU5B 3DUUB 4PJDA 3CX2A 3N1FC 1Y6KR 3NCEB 1UXSA 3W39A 4KGLA 2OTPA 1OGTA 5I2IB 4D8PB 3OAYH 2R29H 1T7YA 3W11C 3EUUA 4AL8H 3VXMB 4YHIA 1MHHB 2R0ZH 3GMLA 4GQ9L 3SDCA 4KHTH 4JFZL 5E08L 1FDLH 1PYWB 5JZ7C 3V4VH 3LN5A 3KPSD 4Z95L 4HS8H 4QXWA 1PY4A 5BZWA 3WLBB 3E2HB 1T3FA 2EICA 4HKJA 4ZODA 3VFTB 1AC6A 5CHNA 4LKCA 2NXZC 3EOAB 4YHYB 3MJ9A 1I1AD 1Y18B 5CZVL 8FABB 2Q8AL 4ONHB 5SX4H 3BW9A 4XCNA 3R0MA 2A2QT 2PR4L 2WWMD 3KJ4B 5SX5H 3Q2CA 5CZKA 3Q6GH 3BH8B 4JHAL 3T0EE 5AUMA 5DMKB 1Z9SA 4HJGA 1J10A 4YNYB 3DNKA 1JGEB 3MUY1 5MP6L 4J12A 2AP2A 5J0BA 1WQVT 3MLXL 3NPSB 2IBGA 3H7BA 1EIBA 4FQQB 1EFQA 2X89A 3OBAA 1N6QL 4LHUD 1TZHA 3MOAH 4NQDB 3EO0A 4OF6A 5ITBH 1KB5L 5TPWH 4G9DA 1G7PB 4ZD3L 1X5XA 1A64A 5E0QA 4YHZL 1C7TA 3K2UL 3ZLQC 4LMQI 5I1KH 2NZ9C 2OCFD 4JLRB 4P2CG 4U1KB 2BVQA 4XPGH 3LHPH 2WW8A 2YUWA 3NABH 5F44A 3X17A 4PGBA 1T6VN 5CSZA 1RULH 2X4OB 4PJ7F 1NCCL 4JFFB 3TT1H 1R3LB 3K74B 4CMMB 1EGJL 5INDA 4MNQA 4ZAKB 1CXKA 3MNZA 4JE4B 1CD1A 5DURB 1G7PA 2GAZB 1LP9E 4DAGH 2J8UB 2ZP0T 4MS8C 4WU7B 3EO0B 4TNWK 2W9LA 4CMHB 5J1SC 4ZQKB 1N8ZB 4FQQA 1J86A 1FCCA 3CMOL 2ZUYA 4F57H 4G8EB 4HXAL 2V5YA 3C6LB 2UZYB 1PZUB 3A67H 3BH8A 3K0WA 1DUYA 2NXZD 3BQUD 3VRIA 4ERSH 3UPRA 2P47B 3VE0A 1K3ZA 4JPKL 2CSPA 1SQ2N 3WNPA 1NCDH 4KZEH 4G8IB 2HN7A 3B3IA 4QHUB 5EZIL 4MNGB 3EOBB 3U4BH 3VFRA 4RISL 4WW1B 25C8L 1MHHA 3EOTH 3VXMA 1NH6A 3DPBA 1A1NB 43CAA 4ZSOB 1RK0A 1RUPH 2W65A 3SE9H 3VXUD 4QOKA 1I8LA 3CVIL 2DD8L 1E4XL 1S9WB 2QTEA 4R9HA 3JV0A 4U6TA 1ZMYA 4YWGH 3HC3H 3BAEH 4GKZB 4WU5A 5IF0B 1FYTB 2Y5EA 2VQUA 1AFVL 2MNUA 2BVPB 3PGFL 1D5IH 1AQKH 2K7QA 3DTXB 2ZCHH 3HG1D 2VIRB 2VKWA 4JN2A 5MENB 5D8JL 2FX8H 4UV7L 2P8MB 4Y4FB 4UINL 5I76A 2K7PA 4UUJB 4RGOH 4M1CC 2DWDA 4RMQA 3I6GA 1ZANH 4IS6A 1JNNH 4NJAL 3P11L 3DUSA 5F3HA 3C2AH 1Y6MR 4Y16B 4HJJL 3I75A 3TVMA 1BHGA 1RJCA 4TSBH 1FC2D 1RUMH 4LLMA 2W59A 1NFKA 3WFZA 3BPCB 3DVNA 4UTBL 4F7PB 1KPRA 4QT5A 5GISL 2VQTA 3KLAB 5EOCH 4X6BA 1UA6H 1MFCL 1UT9A 1LEIB 4B50A 5BMFH 1AO7E 5CUSL 5E2TL 5JLZA 2FHBA 3O8XC 5IEHB 3SDDA 5BRZA 3O3EA 4TUOB 1GHFH 1I9IL 1FN4A 3HR5A 2F9BT 1SJEA 2VDKH 1DLFL 2VLKA 4XVSL 4LCCA 3GBML 2IGFH 3P4NB 4JG0H 4LPCA 3HAEG 3UTPE 3WJJA 3LD8C 2WINB 2X4PB 5TDOA 2B7DT 4QY8A 2Z91B 3U30C 4PG9A 5F96H 2L7JA 4AK1A 3O4OB 4HS3B 3THML 1UH2A 3QWOA 1MLBA 2BVPA 2NW3A 4XXCA 3SHSA 3TNNB 2GITB 4G6KH 3SKMB 1CLOH 4FQXC 1LO4H 2FX7H 1VGEH 4X6DF 4AT6A 3IRZA 2MHAA 2W65B 3T2PA 3OKYA 4MWFB 4OUUB 1WK0A 3C5ZC 4BH8A 5I1LB 4K9EC 3RGVD 1DQLH 2J3SA 4PV9A 3G5XB 5F9WB 1I1YB 1ZHKA 3O0RH 4X80H 2H9GB 4OZIB 1BLNB 1XF1A 1QRKA 4XCEB 1FQ9C 1D6EA 1T6WA 5HXMA 2R23A 3W5NA 5EO1B 5TE7L 5D1XB 4V2BA 3VRIB 3FQUB 1NGPL 3DURB 1I9JL 5C0BB 3F12A 3L3JB 3WEXA 4DTGL 5GGVH 4ZTPL 3PWPD 3NACL 4WI9A 3FN0H 3GJFA 5C09E 5IFAH 5EG6C 3AMKA 3CUPA 4XX1E 1IM3A 3OGCA 4UDUB 5L0QB 2DQHH 2H1PL 3M8OH 4KRMB 1F6LL 2VZOA 3EYOA 4H26A 4HFWB 4U0RB 5DS8A 4KROD 1F90H 1LMKA 4POZD 2NY7L 1HZHH 4OIAA 3G04B 3K1KC 3D18A 5K9OA 1B6UA 1J1PH 1JFQL 1RVFL 1N2RB 4QHNB 2XWTA 3X12B 5JORA 1J05A 3VFOA 4M1GL 3GUTB 4C59B 1JGDA 2HTKC 4MMZC 4P2OD 4I18B 3CCHA 3GBNH 4HWBH 4WI7A 4GRLC 5HJ3A 1RZFH 3AY4C 4X4ZA 3LZFH 3LKQA 5JOPD 2XRAL 4ODTL 5FGRA 3H0TA 4LGRB 3VGEA 1EXUA 1H3PH 2NW2A 1TTUA 5J6HA 3KPPB 2XIDA 4OGAD 4DGYL 4JFHD 5GS3A 3QCTH 3QULB 4O5LH 4JKLA 1QSZA 1LE9A 1ORSB 1JI1A 4HAFA 4BZ1L 4O02L 3WS6A 1FH5H 2BHZA 1TIUA 4GT7A 1X5IA 3FZUC 4XCEA 1HQ4B 3K3QA 4Q9BA 4WWKD 5L8LB 3D1MC 1I7RB 4OJFH 1J8HD 4GG8B 3LEXA 2H9GA 4JM2C 4NRXA 4OZIA 1JWSA 1SBSL 1J0HA 1FPTL 1CXLA 2HTLD 5IT2H 1TNMA 4UBDD 1ZAGA 3ULSB 4OCYH 2XI9A 1KJMB 5ACZA 3ULVF 4GXVL 1AJ7L 3KYKL 2Y06H 5IV2B 1F4WL 4AM0B 2X40A 1Q9LA 3ARTA 2ARWA 3PWNA 2AJSL 3MOBL 5CIPH 4AYFA 2VLRA 3TIEA 3V6OC 3EDDA 2AV7A 2VXUL 2Z4QA 4XCNB 5KSBF 4GW4B 1JPTL 3GSXB 2NR6C 3V0AC 2Y07L 5AYQA 3GSXA 4Y5VC 4H1LB 4Y4HC 3QUZA 3WLBA 3MJ7B 1KCRH 3CZJA 4LVHB 3LN5B 3MBED 4IRJB 1BM3L 1ZVSA 4OQTH 4K55A 4NO5B 1JRHI 3ZZ1A 4OFPA 5DMGC 5GS1B 3FT4A 2VLKD 3TJHD 4AM0A 4XVUC 1EO8H 4HDIB 3MV9B 2BNQE 1JBJA 2QADD 5E6IC 3W0WE 2R0LH 4X5LA 1DP0A 2V2WA 4P2RE 4RGMB 2MPAL 4XPBH 3W39B 5E2UL 5FM5O 4JRYA 1YEJL 3PQYE 3QUXC 5DVMA 1AHWA 3MR9B 3TO4C 1W8NA 4AIZA 1JWSB 1KPVA 4OQ1A 4BJLA 1CICC 4D0BB 1I1CA 3C5JA 4M62H 3UYOD 5DEGB 4KAQL 4L9LB 5ERWB 5ENWB 5GRZA 1D9KB 5C7XL 2C4XA 4PRIE 5DO2D 2EDTA 4UUJA 1F6AB 1EO7A 3VRLE 4H20L 1HNGA 3BOVA 4E41A 1AIFB 3W2DH 3HE6D 4K7FB 4ZDHA 5IVOA 3CFKA 2CLVB 5AWNH 2BVOA 4UNVA 4HJ0C 2Y6SC 1SY6H 2AS5M 4XBGB 3V6FA 4GRLD 1RZJL 4K7PL 3L3HB 4TSAH 1BIIB 1OGAB 4YPGB 3RDTA 3VXRE 3QH3B 2H2SC 4YBLC 2JB5H 1MRFH 3NN8A 4JFDD 1KCUL 3VFOB 3VXRB 1CTNA 1YMME 1NC4D 2YA0A 2WUBL 1MFDH 1UM6L 1XMWA 3D18B 1JVKA 4G8GE 4R26H 1OQOA 2YN3A 3SY0B 2NY0B 4RGND 1NUNB 5E1AB 4X6CA 5E56A 4FQLL 3G6JA 2YBRA 5FOBB 1TQCB 3QRGH 5HHMD 3ARFC 2ZOLB 3EJJX 2O93L 2ZSVB 1NAMB 3LDBC 3LN9A 43C9B 3UTSE 3DX9A 5AZ2H 3DBXA 4WV1A 5IB3B 1WBZB 5DDHB 4CVZB 4J6RH 1ES0B 4MA7L 4NKOB 4M9PA 5I1IH 1S7WB 2CRMA 3NA9L 4HHAA 3NIDE 1RI8A 1AY1L 4RFEA 5A2IH 3CC5B 3UDWA 2C1PA 5HDQL 1IGFL 3MV7E 3CPLA 5E95B 2A9NL 1MCHA 2DLIA 3IJYA 4O00A 3U6RA 3MJ8A 4UILL 3SBWC 4R4FL 4UT6L 3NZHH 2ICWB 3C09B 4PJGA 2J8UA 2VDRH 1MCWW 1Q9OB 4Y5YC 3W9DA 1CD1B 1KCKA 1NMAL 3VJ6A 4FXLA 4P5TA 3T1FB 4MAUL 2F5BL 2CDFB 3JXAA 4L5FL 5DDHA 4CVZA 4YHKL 2GUOB 4F15C 4U7MA 4R4ND 1B4JH 3DBXB 1EHAA 4JFFA 3QWOB 3KPRA 1NAKH 1BZ9B 2NX5E 3N1PC 2DN7A 4R0LB 5I73B 3TBWA 1IT9H 2X6MA 2ZOLA 4TVPE 3MLZH 2X4PA 5TDOB 2WINA 1B4RA 4Y5XB 1CDHA 3SO3B 2IANA 3CIQA 1U42A 1MWAL 4PV8B 5FYKE 5C86A 4R90L 2JK5A 1C5CH 3RY6C 5IMOA 2UWEF 3MLVL 5DFTA 3ULVC 3VGAC 2F19H 2XZZA 3BUTA 4Y2DA 3PWJB 1CE1L 3H3PL 3V6ZB 4NHUA 3GMNB 4URTB 5C07B 1BJ1H 3RDTB 3NCBB 3HRPA 4YR6A 5C6PB 2OI9C 1AD9A 1QVOA 4Y2DC 5I8OL 2MFNA 3JZ7A 2X09A 5J7CC 3HZKB 4EDXA 3FHQA 3BPCA 1EDQA 5DQJB 1I8IA 3QNZA 3S36X 4HJ0D 3CFKB 1KPUB 5EUOA 3DUSB 4L3EE 4XGZA 5AUMB 5DUMH 1NBVH 5I17A 2FGZA 2VWEE 3RPIB 2DWDB 3GGWB 1D3CA 3BW9B 4PYGA 3VXRD 2P8MA 1KN2L 2R39A 2V5SA 8FABA 4ZXBB 4KTDL 3BEWB 2HT2D 3REWB 4HKJB 1CK0L 2YD1A 4UV4L 3I50H 1T4KB 4J3OC 1OGAE 4IRZL 5D9SA 1QNZL 4D9LL 4G9FB 5IJVB 4KVCL 4U4BA 4GKZA 4LVNB 3SDCB 2VH5L 4GRWB 1AHWB 3ET9F 5ITFA 7FABH 4P5MA 1C5DB 3P4OA 4XPHL 5E8OB 3W11D 3JV6B 1E6OL 1QSEA 1HSBB 3BKCL 2JCCE 1UXSB 3MX0A 2XZAH 3GM8A 3VXOA 5DRXA 3VA2C 1MOEA 3QIUB 3D2UA 4UB0L 3V79C 1J8KA 3VFRB 3L5WA 4ELKA 4ENED 1MHCA 3QO0B 2ADJB 5KVFL 1INDL 4S1QH 3T09A 3O6FC 1IAIL 3OX8B 1VKXB 1E6JH 1FYTE 2O5YH 1JPSH 4WHCA 4P46B 1TJHH 3ZKNC 2Y36L 1UKSA 3MNVB 3MV7D 4JFDA 4JFFE 4R4NC 3TH4T 3WIHL 4EBQH 4YO0A 3T0EB 1GOFA 4LSVL 2VDLL 5E4IA 4A6YA 1V7MH 4LARH 4NRYB 5DQ9A 4OLXH 1IARB 1BVLA 3ZKSD 1UGNA 3G08A 1C12B 1HXMB 4OKVB 3RGVB 4FFZH 2YMXH 3QAZB 1ZGLM 4ODSL 5JOFA 3LKRA 2VDPL 2B1HH 1WFUA 2A83A 4Q9RL 2WWMC 4CBPA 3HI6L 3D2UD 3P0YH 1FE8L 3D85D 3LEXB 1NFIA 4YHOL 3H9HB 5K9KB 5GGTA 1MCLA 3WLWC 4Y8AA 2DIJA 4Q6IB 3TFKC 3S35L 2G9HA 4HPYL 5ETUB 5AEAA 5DI8B 5GJSL 2X4OA 3QUMA 5SWZD 4RCAA 5D6DC 2ESVA 4NCC2 1FNSH 5I66B 2C7UA 1KYOJ 4F7MA 1T0NA 3RDTD 3H0TB 3CFBB 4Z8FL 3GSOB 3S97C 5HD8D 5J9PB 1G7IA 1HCVA 4HQQL 4EUPG 1IGCL 4M5ZH 1EFXB 4PRBA 3CSGA 1S9VB 1NSNH 3A6CH 2Z8SA 4C54A 4OSUH 4KH2A 1JYNA 5C0AD 1OPGL 3TLRA 4TPRL 1FNAA 2VDML 3B2VH 3HB3C 5E6IA 4TUJB 1ORQB 3MRGA 5LBSH 2VWEC 4FXGA 4I3SH 2B4CC 3QI9C 5IR1B 3D9AH 4PLJD 2DQGH 2GJZB 4NT6A 5DD1H 5JW3H 4WCYL 2UYLA 3OHXB 3VFPA 1INEH 3VXPA 1MCOH 1WJ3A 1UJ3B 4LASH 3Q3GA 5DLMH 4XP1H 3BT2H 5JR1L 1SVCP 1MJUH 2QHRH 1YECL 3VFNA 5I1DB 1PYWA 3CDGA 3IDGB 3HI1A 4WUKL 1OAKH 4ZPVB 3VFVA 3MV11 4Z0XA 4LP5A 3VA6A 1GH7A 2EECA 4QNPF 3F65A 1N64L 2A9MH 2VR5A 3BIBX 5HHNA 1HXYB 5E8EA 1PEWA 4MXVE 5CCKH 1K9TA 1NDMA 5CJOH 4JM2A 5I8CB 2VN7A 3MZGB 4NWUL 2FJGA 2JLLA 1EPFA 5J1AB 3MLWH 4XNYL 3TCXA 3VWKB 4DGIL 5IBLC 1U2HA 1B9ZA 3NIFE 2NY4C 3KYOA 4GKOA 1UKQA 4OLZL 4O2FB 4QF1B 4LCUA 1KJVA 2NLJB 3U7WH 2R2HB 2BVEA 3EAKA 3F5WB 5T1LA 3D3VE 1JGLL 2ESVE 3BEVA 4H5SB 4F8QA 2VLKB 1ZOXA 1EHNA 1ONQA 3HZVA 2XFXA 3FONA 5EIIA 2PYED 4LCIL 4Y19A 1RMFL 3KPSA 1YUHB 3U7YH 3GRWL 3LN4B 1ZLWK 4N0YL 1G6RL 1HYRC 5I1EH 1LEIA 3WIIH 3GJFH 5GGSA 3WHE1 1MH5B 1FIGL 1E28B 4U1NA 5F7UA 2JELH 1GC1C 1PY9A 3B6SA 1MAML 3QIWC 4YC2B 5IG7B 1RUAL 4PTUA 1ROWA 3LEVL 5DK2B 4RMVA 3QXDB 2DI7A 4JGUA 3N1QC 3QUYC 2ZPKH 5IFJA 1Z3GH 3ILPB 3FT2B 2Q3ZA 4XI5C 5I8EA 5I76B 1JCKA 3V8CA 1VB9A 3SDXF 2Z9TA 5D6DA 5FO9B 1XCTB 1G9MH 1V7NH 5T1KD 5A16A 5IUSA 5HGGS 4JFDE 2EDOA 1KENL 4LCUB 3MGTB 4MSWB 4ZAKC 1C5BL 4U6VL 1XIWC 4ZTOH 1FYTA 3BPNC 1INQB 3LS5L 3U0TA 5DJCB 2VB5A 5JXAL 1XF3B 1Q9KA 2CK0H 4LVOC 5E9DA 1KGCD 5ECJE 5KVEH 4XHJD 1D5ZA 1RFDL 3MYJA 4LAJH 4NO2A 3IAGC 1X5ZA 3TV3H 3FFCA 4DKDC 4KRPD 3LVEA 2WBWB 2BNQD 1U3JA 2P1YA 5GS2H 2EDHA 3EZJB 3RWFA 4K3EL 5T1DH 1JPGB 1OSZA 1QBLH 3SGEI 3T1WA 2FRGP 4R8WH 4OD1L 3GI8H 4WI4A 1XF4B 2Y7QA 1UJ3A 4M6OH 4DN4H 4GRWF 4BQ9A 1X44A 1MCWM 2ATPA 2HWZL 3MRCA 3ROOB 1O7VA 2VOTA 1RHFA 5D7LE 5T1KB 3ZTNL 5C0CD 2DQIH 4NT6B 3CK0H 3TA3B 4DGVL 3O6FA 4JQXA 4OF0A 3I9GH 4LCCC 4QXTA 4JO1H 1P9MC 3IJSA 3VXNB 3RNKB 1R6VA 4XX1G 5AAWA 4NQCA 2Y5TA 3F7RA 3C5ZD 2QBWA 1KEGH 2BJML 1A8JH 1HINL 1MCKA 4K94L 4YGAB 1LP9A 4NZTL 5DZNA 4WWKA 3PL6B 3EFFA 2VSCA 3P30L 4PUBH 5F1OB 2CUMA 4JHZA 2H32H 3BP6B 3C5SB 2YPKA 3IRPX 4LAQH 5J12B 1KIPB 5IROC 5E99L 4MCYA 4YJZL 4W70A 3WHXB 3C9NA 3TVMC 5FUCC 1E4JA 1R3LA 1JNLH 2AXGA 5C1MB 1NLDH 4HGWB 3GJEA 1XZ0B 1T22A 2XZCH 5T33H 4LSTL 4XPAH 2BVQB 5I66A 4HGWA 5FYJH 2JE8A 5IP4A 3ETBF 4OZ4A 4UQ2B 3KPRE 5DSCA 4MLIA 3I3BA 1QFWL 3J8F7 3JSSA 3KJ6H 3HMWL 5FKAB 2YPKB 1YN7B 3TBSB 1XCQB 2R69L 5BS0D 4JKPH 4UTAL 2HYMA 1OWWA 2UUDH 4GJTB 5H2BB 3B9DA 5FHBL 2NY1D 5FYLL 4TYUA 3ZE1E 4W4NA 3N85L 4N5EC 1JRHL 5EC1B 1M6OB 3L3DA 3VGBA 3MGAA 4I4WB 1FC1A 1X5JA 4MB3A 3U46B 1KFAL 4QXTB 1JHKL 2J7LA 4KPHH 2J5LB 3W5MA 4N68A 1N4XH 1U3HC 3BN9C 2V6HA 5FF6B 4YHMH 4JAMB 5DQDH 3X14A 4L4TB 1JNHB 4YBQD 1NL0H 3RZCB 1RZKH 2AXFB 2AERT 1CBVL 1UWGL 3UTTB 1MCBA 2P5WE 4WDIB 4GMSH 3KVQA 4E41D 2FGWH 3VD4A 4FQXB 1OSZB 3STLA 1IZJA 4F9LA 3NFSL 4DZ8A 2A73B 2ED9A 4JM2F 4C4KO 3VFSB 2X1WL 3WYRA 1PX4A 5TGBA 5F7EH 15C8L 2X89D 1FRGL 3MYJB 3G9AB 5E8OA 3S9DB 5HHOE 3QIBB 1CIUA 1JWMA 1ND0A 3DV6B 5M94B 3H9SB 5D2LA 5HHOB 5DJCA 1AI1L 1LO3H 2OLDA 1FLRH 4MNHB 4FRWA 4H1LG 1S5IH 3ARZA 4WDIA 1G7MB 4DN3H 4RDQG 4Q58C 1J8HB 3PDOB 1EJOL 4PFEA 5I1AB 1NFDF 3DX6B 5KSAB 4O9HL 2X7LB 2VN4A 3O6LL 1AKJA 1A6WH 1UQSA 1X4YA 5GGSY 5BV7B 4D3CH 3M1BA 2Q8BH 3DIFB 3GSVA 1E27A 5DJ8A 3ME0A 4NUJB 3E6HA 4J3VA 2DQCH 3RY4A 3PWLB 3B9KD 2A38A 2P48B 5HHVL 3WD5L 4LKXB 1KUMA 5SV3A 4PGJA 5C07A 4BYHA 5K9QI 3SE3C 4MQ7B 3SDXA 1K3IA 4X7TB 3QDJB 1ZLUH 3FOMA 4PJHA 4ODXB 1YMMB 3ROLA 4LVEA 3VG0H 3GKWH 4DVBB 2A6JA 4MJIE 4OZFA 4L4VE 4HC1H 3RVXD 3HHRB 2FYYB 3OWEA 1XF5B 4KUCF 4PJHF 2C1OB 5F89B 4X7SH 5CEZH 1AR1D 2D7NA 4QF1A 1TTFA 3EYQC 4R0LA 2WUCH 5LAXA 5C92A 5CP7B 4JY6A 3WHXA 2SEBB 4K9EH 4GBXD 4QTHA 3O6KL 4YDJB 1J1XL 1F5WA 2KQNA 4TQEL 3OAYK 1MCPH 3UBXA 4CVXA 4H1LH 3DV4B 5E8EB 1LVEA 2ICWI 2VUOA 3PL6A 1U3HD 3BN9D 2IPTL 5KN5A 1W0WB 4N0UA 5EPMB 4KUCD 2C5DC 4TOYL 3VFVB 4S1SH 2Y5TB 3IJYB 3LPGA 5I1DA 2V5TA 4QOKD 1CGVA 3VFNB 3BYYA 3CPLB 3RNKA 4EKXA 2E9IA 2N1KA 4U1HB 4JPIA 4P2QD 4MQTB 5B39B 2EYTB 4LSSH 2VLMD 1N26A 4N5ED 4QHLB 1WSST 1YEHL 1P84K 1LDPL 2VERN 4NM8H 5ANMB 4JY6B 2FBOJ 2DLGA 4NN6B 3S37X 5FDYA 4OCSH 3CLEL 5SX5K 5EZIH 3C60D 1CDJA 5EZJA 5IW3A 3QWQB 4Y4HB 1CDCA 4HS6A 1IM9D 2XWJB 3WL9B 5D1QD 1DVFC 3UTSA 3V6OA 3LPWA 2CD0A 1CE6A 1JP5A 5DRZA 1RJYB 2AAVA 3OB8A 4DVBA 1TJIL 3HLAA 4L8DB 3HMXL 1CF8H 3ZDYF 3PQYD 4BK4A 4QXUH 3S96B 3QUXB 1NCAL 3JWDH 2BRQA 1A14H 3WXVL 5ALBH 5E4EB 2GCYB 3WSQL 1Q38A 2BOBA 4OLUH 2HA1A 4L9LC 2YPLE 1EFXA 5JNYA 3PWLA 2OZ4H 1CT8B 3DI3B 4OZGA 3OKLB 1XGQA 4PRIB 2AJZA 3HFMH 4ZOCA 2NPLX 5GJTL 3TCLA 4WRLA 2A0LC 5FO9A 1S8DB 3OXSB 3NMEA 3QO1B 1F6AA 1NC4B 1Q94A 5ESQB 2E8ZA 3FT2A 5I8EB 2VKXA 3ILPA 3MRQA 3PDOA 4QRPD 1T0MA 1CG9A 3O3DA 4FP8H 5C9JA 1G7MA 4NKIH 4GRLA 2FR4A 4FFYL 1U6AL 4HMEA 5FM8A 5HYQA 5CAYB 1NC2D 3ARGB 1JV5B 4YBLB 1BD2E 2KKQA 4HIHB 2CRYA 3E8UH 1MNUH 1DL7L 2J8UF 2ARJQ 3BP4B 3KPOA 4YEFA 3ZHDA 5FO8A 3LQMA 4U1NB 1FGVH 1T0PB 1DLFH 4XVSH 4XP5L 1A7QL 2ZCKH 1MFEL 4IMLA 3KXFA 1PGRB 3FT3B 5I8KH 4QRSB 3FONB 4NRYA 4I13B 5DQ9B 5I1GL 4NO5A 5DT1H 3BGFB 1H3VA 4HZLB 5F7HA 2C3VB 4WGWB 3BEVB 4X7DC 4YO0B 3D69A 3CDYA 2YEZB 1BX2B 1BZQK 2EYSB 5T1LB 2J6EH 4I5BA 4YDLB 4XH2A 4P46A 1WZ1L 1IFHL 5I75C 3HTLX 4GW4A 2ZCLH 3VGHA 4HKXA 3GNML 4BQ8A 1AC0A 3IYLW 4KDTA 3MLYL 1MHCB 2DLFL 1PG7W 4FQCH 4KI1A 1X3DA 2EXYC 2Z93B 4KZDL 1JPST 3D2UB 1FNHA 3O0RL 4X80L 5E00A 3VXOB 4X6CF 1MHEB 2I24N 1WZLA 3JVGA 4OCWH 1QSEB 5HHNB 1KJMA 3KPOB 1BD2D 4HWBA 1KYOK 4K8RD 1OVZA 3C60C 1UACL 2F8VA 1YC7A 1I7RA 4YDVA 3E3QC 4DK6A 4OTXL 4C55A 1T4KA 3OF6A 4KVNL 4HBCL 4UIKH 4F15B 1P4IL 1ED3A 3BKYH 5ESQA 2DQHL 3VXPB 3LCYA 4P46D 3LV3B 3R8QA 4HT1L 4XP6L 4XVTH 4G6AC 4FABL 2CUHA 1ZHBB 1FZOB 3MCKA 3VWKD 3GJEB 3CDCA 4PLJC 4NHCL 2AJZB 1BBJB 5HGHA 5HI5C 4OZGB 4FXGB 1QQDA 2NCMA 5JIIA 2ILLA 2X4TB 3KR3L 1KJ3H 1EX0A 5B39G 3SGKA 4HUWB 3WUZA 3DMMA 4Y2DB 1IGYA 3S96A 4MDIB 1SVZA 3DHMA 4U7SA 4GOSA 1R5IB 1RJZB 1QQDB 3HMXA 3TYFB 4N0CC 5C2UB 4MJ5B 3BMWA 4L3EB 1A3LL 5C2BL 4S2SB 4HFWA 5CSBA 3VXNA 1CQYA 3GSOA 4JGJA 3QCTL 1YEEH 3FJTA 4O02H 3PJSB 1I3RB 2XKNB 3N1MC 3X3FL 1N0XL 1AGEA 5FA3B 2EYRA 5E24E 3CX5K 2EH7H 2W0PA 2COQA 2QSQA 3GSRA 1EERB 1JF1A 4Y2OA 1UVQB 2L7UA 5EO1A 4AEIL 4ZFFA 2NY1B 1MCDA 4JR9L 2AJYH 5DVNA 5FIEA 1I1FB 1MLCB 3GFUA 1D7FA 1F4WH 3MLTB 3RWFB 4PJGB 1GCFA 3UPAA 5ABDE 3TN0C 2JCCB 1A7OL 5CILH 2GJ6D 1MCEA 3FKUS 5I1LA 3ZKMD 1MHEA 4RGNE 1G7QB 5EU6B 2MHAB 3VMOA 3ULUH 1A7PH 4CNIB 2E7LA 3KPLA 1OT2A 5IBLD 1S7WA 1BECA 4GS7C 2CMRL 3QG7H 1F11A 5KANG 5DGQA 1DQDH 1MLBB 1RY7B 4PJ8A 1BREA 2YEZA 2Z91A 2DI9A 2DIBA 2CKBH 1F8TL 2C3VA 2ZUWA 1MCSA 4U3HA 3P4NA 5T5FH 1JPFB 1L0XA 2YS4A 4EDWH 3MXVL 5F6HJ 3GMMA 3LQZB 5L8KB 4ODXA 4JKMA 5IHUL 2CUIA 3QYCA 3U4EA 4M6ML 1LK3L 4KAQH 3JV6A 3QNYA 4HFUL 3FB6B 4WTZA 1UWXK 4LKXA 1S7SA 3ZYIA 3QHFH 4MA1C 4X6BB 1ZGLP 5E8DH 1G84A 2ADFH 2QHLA 3RWCB 1F45A 3IFPB 5D72L 3I85A 1V3JA 5DK0A 3HUJE 4TSCL 1OAXL 3WFHB 1S7VA 5JPNB 1Q0YH 3IDXH 4APQC 3ZYZA 2MJWA 4CRPA 1NC4A 1Q94B 3RIAF 1QYGL 3P4MA 1YEIH 4HUUA 3PXHA 4NSKB 3DX6A 5D96B 1TITA 5F9DC 4WHYH 5EUOB 2AEPL 1UFUA 1KCUH 5MEOA 5DQJA 3AB0B 1CGSH 1RHHA 1CT8A 4QGYA 2VDOL 4D0BA 1B0RB 4NN5B 3F8UB 4LLWA 2X4RB 4R26L 3QIBA 2GCYA 4LHJB 3SDYL 2APVA 3IDMA 5FO7B 3S5LA 3OKOA 3PWJA 1A7NH 4M7LH 3Q5TA 4QRRB 1DBJL 2PTUA 3L7FA 5L7XH 5GS0C 5GS1A 5E6YA 1DE4B 1ZVSB 4HS8L 1MJ8H 4MCZA 2W1NA 1EAPB 1MFAH 4RGNC 2IANB 1D6VL 4PRPD 5C0CB 3KNBA 5JUEH 2GJJA 4P2YA 1QRND 5DMIL 4NC2B 3IAPA 3VE0B 3BQUC 3TBWB 1JNHA 1QFOA 4PPTA 4Z0BL 1IGFH 4RWYH 2Z4QB 3OHXA 3IFNL 5ANMA 3DRQB 1TCRB 3IDNA 1G0XA 2YD3A 4LU5H 3IF1B 2EYTA 1Q9LB 3T0XA 3OKMB 1M6OA 5CJQH 3RL1A 4LQFL 5KSBE 5IW1B 3K2MC 3ULSA 2HH0H 1RURH 3RWHA 3U36A 1W0WA 2DB8A 3MV8D 4HUMB 1SEQL 3DETC 3Q1SH 1R3HA 4NRXB 1UH3A 3U0PB 3CVHA 4BFEA 2BSTA 1HQ4A 1KB9K 4W6XB 4M1DL 1HHKB 1B0GA 4JFXA 5E2VL 4RAVB 5EA0L 3HRZB 4TULL 4Y2DD 5D7KE 4NKOA 2P8LB 3EJYC 3BYTA 4XPGL 1CCZA 4OF5A 1WITA 1F4YL 1T22B 2BK8A 4R90H 3ULVD 2C7UB 1H8SA 3RVVD 3JV5A 4GO6B 3SCMA 3V5KB 4OGYH 4Y16C 2ENYA 1PLGL 3UJIL 3G6JB 2R9HC 3TVMD 2FHFA 3VFGH 4G42B 5E1AA 4LLDA 1HIML 1OP3H 4I18A 5C6WH 4X7TA 5E2WL 3MA9L 3VXQA 2E27L 4KI5E 3T2NH 3GKZA 1I8KA 4KQ4L 4FQJH 1LP9B 2HFFB 3OKDA 1BIIA 3WFBL 3BP5B 2A6DB 3QUYB 1HHIB 2Z35A 1HN1A 1NUGA 4XBGA 2Y25A 1DDHA 1E27B 2MMXA 4HXAH 2I60L 4R3SA 5H35B 4PJXF 4ISVB 1JGVH 1BVLB 3CUPB 3LD8B 4HKZB 3O2DA 1AKJB 3DJ9A 2LVCA 5IVZA 4E41B 4PD4K 3P0GB 4UV4H 5JO5B 3U30B 5B38B 4I3RH 1QNZH 5HTSA 1YY9C 3T0EA 3CXDL 1G6VK 1XIWB 4JPKH 5ADPH 3QHZH 5CHNB 4MNHA 1BAFL 1ADQH 1EZVY 1BIHA 3P2TA 3QXAB 5GPRA 4RZCA 2ADJA 2V9TA 4K3HA 4F2MA 3H9SA 3WO4C 3P77A 1JWMB 1JNJA 2D4DA 3T0AA 4MVBC 4JRYB 4M8QB 3KDMB 5LKNA 2VZSA 3D87B 4V1DD 2HFTA 2VDQL 4OCXH 1E6JL 4D8PA 5C0EA 5J3HC 2Y36H 5T1LD 4M6AA 3STLB 1YA5A 4LPUA 1T20A 1H3UA 1RUKL 3MJ7A 1LGVA 1BD2A 4RRPA 3RUGB 3UTTA 2Z8RA 1U36A 1Z9OA 1Z2KA 4Y8DC 2P42B 4OLVL 4POYA 4JHWH 2P43B 4NKQB 4QYOB 1XCTA 3RUGE 4L4TA 4PJGF 1E4WH 5BVPL 4UINH 1CYGA 3TA3C 4ZO6A 3BD5A 2AV7B 3IDIA 3WO3B 3JWOC 4JDVB 3GGWA 3RPIA 1GAFH 2QKIA 3TBTA 3PWNB 1WWBX 2PO6D 2VLLA 3QR2A 1NCWL 4Z7VF 4I0PB 3G6AA 1JJUA 3L3DB 3MREA 2EKSA 4PP2B 4BK5A 2VISB 3HNVH 2HLFD 3R8BB 3S35H 1KJ2A 4DEPB 1XCQA 1BJ1J 2G75A 4V1DE 5JW4R 2GJ6E 5GJSH 3ARBC 3CSYB 4K71B 2J4WH 4Q6YA 3ES6A 3HNSH 4XP9L 3VWJC 3VXUE 4MQXC 2DTMH 2VZ3A 3HZVB 3U48A 2IH3B 3TPUB 3MXWH 3T3ME 5KTEL 3MODH 4ONGL 4UT7L 3BIKA 3KPPA 2MQCA 3CFDB 1IGCH 4NUGL 3B9VA 4YAQA 2YN5A 1RIUL 2NW2B 2CIKB 1PKQE 1NSNL 2D3VA 3P0VH 3KYMB 3C9NB 4KJYA 4G6KL 5D6CA 1RK1A 2AKRB 3UMTA 2FX7L 1BOGA 1YJDH 1BVZA 1OHQA 2BNRA 4U1IA 1KLUB 2VC2L 5EOQH 5LCVH 1K8DB 1J05B 2N7AA 4GSDH 3EFFB 1RIVH 3VH8A 1FVDB 1A1NA 1A4KB 1IKFH 4G9FD 2XTJD 5K9OB 3B83A 4ZPVA 4WW1A 5DHYA 5T5NG 1J0IA 2OR8A 3EOBA 1X5LA 3G6JF 5B8CC 1HHHA 5DD5L 5ICXA 4TRPL 4KKAC 3IJSB 1DBML 4K2UH 1ZA6A 5DRNB 3DVGB 1FFRA 3E1F1 2HKFL 1QZ1A 4JG1L 3TA3A 1BQLL 1BJ8A 2A77L 5I18L 2OTUB 3DLQR 3RZCC 2P5WD 2AJUH 2NY2B 1MIML 2EH8H 5I74B 5SWSB 1W72A 5EN2A 3P9LB 4UDTA 4YQXH 5B22A 2FX9H 3DO7A 4GRWE 1ORQA 2C4FT 3S34L 5HVGB 1WLHA 2PXYC 4WY7H 1YYLH 1FAIH 2XV6B 4MD0A 3TYGH 3O45B 4IOFC 4LNRB 3RWJB 5KSUA 4FTVE 1LDSA 3BSZL 3VH8B 4KKNA 3V4PH 5CEYB 2ED8A 3FO0L 2VNCA 2BY3A 1F42A 3BGMA 3DETD 5FHAH 1Q9KB 4JREB 1AGCB 4PRBB 3MNZB 5TE4L 1OGAA 1F3RB 3JUZA 4P2QB 5EOCJ 1MCQA 2XRAH 2ERJB 4ODTH 1MJ7H 4ZXBD 4FNLH 5C0AE 4ZO7A 4F58H 1Q9WA 2FZ3A 1IEBA 1JZ6A 3ZL4L 4JY4A 4JM4H 1Y0LA 2DAVA 1RZ8A 2ESVB 3U7YL 5GZND 4NWTL 5ADOH 4L1HA 5DJDA 4Z7WB 1FN4B 3TPUA 1FNEB 2JELL 4Q6IA 3O3EB 2DQJL 5ENWA 1BBDL 1NAMH 3CSYA 2B4CL 5JLZB 4L9LA 1JYXA 5IG7A 3C5JB 4BKLA 4NP4L 3MA7A 4M7JH 4DZBA 3OPZL 1YMHA 1I3VA 3UYPA 3LRSB 3MRMB 3KLAA 2OMNA 4FQ2L 5D2LE 4KQ3H 3KPTA 4JO4H 4KKBC 2E9BA 2G60H 1HXMA 4OKVA 4G6ML 3G6AB 4I0PA 3QXUA 3MRJA 1RZKC 5LQBL 5BJTB 3FT4B 2WBKA 4IS6B 1S9XB 4EJ1C 3MJ9L 4H5SA 1OP5H 5DA4A 2VLJB 1KCSH 1I4FA 1KJVB 2PF6A 5IFHH 2VIRA 1C08B 2EE2A 3KYOB 3IVKA 4MDJA 1AE6H 3VWKA 4OQTL 3QO0A 1X5FA 1G9NL 2ZJSL 4P23C 3O4LD 4HUKB 3LRHA 3UTTE 5AYUL 5EZLB 3GO1L 3QIUA 1T83A 5I8CA 1EO8L 1Z0NA 3NZ8A 4MA3A 5FYJU 4LIQH 1M4KA 1QHOA 2R0LL 4K3EH 5T1DL 3S5LG 1FVCB 2MCPH 1PG7X 5HHXH 4FFWD 4GMTH 4MHHI 2BVUA 5L6YH 4U1LB 4Z0XB 4I0PD 4JJ5A 1ZLSL 1EHXA 3DUUA 5GGTL 3QFDB 4GXUN 5D7JA 4NKMB 5EIVA 1UB5B 4YUEH 5GIRA 3NCFB 4J3WA 4DN4L 3E3QE 1FHGA 3QXAA 5FAAA 2FL5B 5F21B 3VGGA 4AMKH 1PDKA 2GQHA 3V95A 5JW4N 4MZ3A 4PRAB 1D9KD 1FZJB 4R0LC 5FYKD 5I1HH 4TVPL 2HG5A 1A2YA 2PETA 3B5HA 3MOQA 1BFTA 3BKML 4X0KA 3WFDL 4NQXB 1CU4H 3T08A 1DVFB 1SEBA 4BUGA 1EGJA 5IVZB 3V0WL 5IB1B 1EMTL 1EXUB 1DQQB 1KPUA 1LE5A 3C08L 1MRCL 1DFBL 1FG2B 4DWHA 4TSAL 3NCJL 4H8WL 1HHIA 2Z35B 2QLVB 1TETH 3ZYJA 2OSLB 2XA8H 4YR6B 1MRFL 5I15L 1A9EA 1MFBL 2HFFA 5BS0A 1RU9H 1UENA 2X1XR 2JKXA 5HYFA 3WNNA 5JORB 4Z7WF 3V52L 5D2NA 1N0LA