2EE9A

Solution structure of the 16th filamin domain from human filamin-b
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
95
structure length
95
Chain Sequence
GSSGSSGVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filamin-B
publication title Solution structure of the 16th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 4
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ee9A00
4PB0H 5IVXE 4XP4H 2NY1C 2G60L 1EJOH 1WSST 3QUXA 3B9DA 1Q9LB 3BDYL 5D70L 4KRPB 4IMKC 1CD1B 4U1JA 4S2SB 3RVXD 1F02I 5I1EH 5HHVL 3I50L 5J57B 1L0QA 5HDOA 3QIBA 3SJVD 1P7QD 4J8RB 4ZFFB 1AXTL 3V6OE 2A6JA 2AJZB 5HVHB 2H9GB 4HLZG 4XC1L 1OLZA 1Q38A 2R69H 1CTNA 1M7IA 4MA7H 2ZUSA 3ULUL 2V17L 2XFXA 5GRUL 5K93A 1AGCA 4HUWB 2X4RA 3AROA 4U1LA 2FZ3A 1MCLA 3NIGE 5GQBA 3LKNB 4R7NB 5EOCH 3SCMB 3TO4C 3PWPD 5E0QA 3MODL 1EEYB 2AABH 4BM7A 4PRBB 3HNSL 1LWRA 4D2NA 2Z9TA 2DBJA 5FYKE 1B6DA 4Z7WB 1BOYA 3D0VA 3KPLB 1RZJL 1FNAA 2APVA 4EI6B 4L3EA 5E2TH 4M8VA 4XNQA 5C0RH 3DSFL 4NJAH 3X14B 2IBZY 4S0TD 5I2IB 4F7EA 1N4XH 1UXSB 4G3YL 1RURL 5T1LA 4XVUC 3QUML 3RWJA 1HDMB 2F5AH 1IAOB 1D6EB 4TPRL 5EFIA 5D1XC 1OCWH 3P0GB 3S3JA 2EYRB 3UJTH 3D3VD 1WT5A 2O5ZH 1CLYL 5DQ9A 4MA3B 4DW2H 5E08H 1VGKA 5C9JA 4J4PC 5HGBA 4NQDD 2CO6B 2FBJH 3B2UD 1YMMD 4WI5A 2W9LA 1VEPA 4ZTPH 4U1MA 1RZFL 4NJ9L 4GKSA 4HK0A 1XF4A 4Z7NF 3CNKA 3GFUA 1MF2L 3F6LA 3FRPA 3EYSL 4Q9CA 2GJ6A 4JFFA 4XCCL 2X89A 4E42A 4WGWB 1EUUA 5B8CB 3IKCA 5SV4A 2XI9A 3IU4L 1NCBL 4Z0BH 5IBTH 5I1JL 3MO1B 4WVRA 4O9HH 2AEPL 3RVUD 2VXVL 4DKEL 1T7ZA 2DQHH 1CICB 3V4PH 2J4WL 1UWXK 2VKXA 3PL6A 1S7RB 3ARFD 4XWOD 2W9DL 4MQ7B 4EEEA 3LKRB 3WEXA 3JUZA 1E6JL 4Y4HC 3QIWA 1CF8H 2ZUUA 3OX8B 3QCTL 2A73A 5IMOB 2EDYA 4UI2A 1RUMH 3ZYIA 1U8LB 3MRDA 4YDJB 4XXDB 2W0FA 5CLTA 3BW9B 4U0RC 3M17A 4GKOA 1A3LH 5EUKB 1X5JA 5SX4I 4Q74A 2J3SA 4GLRH 4BK4A 1N64H 3BDXA 2CUHA 1F6FB 2ADGA 4L1HA 2IAMC 5KSBA 3JVGA 3O4LB 2DKSA 4XAKE 4OZGF 1WZMA 3X3GH 1T2QL 1T6WA 1EV2E 1LGVA 1X6LA 3C6SA 1EPFA 4RFNC 1UWGH 5TDNB 1AE6L 5HVWA 4LPCA 4HCRA 3SDAB 3SHSA 4Z76A 3TVMB 2GCYB 3QDMB 4KU1A 3QDHA 4DOHB 2DQJL 5F6HI 3CVHL 4BZ2L 5F44A 5E1AA 1K4DA 4Z8FL 3ETBF 3Q48A 3UPAA 4NQXA 4OZFG 3ARVA 1T1WA 3CJJA 1CFBA 3DV4B 4PJEA 4POZC 1WAAA 1YPZA 2HFFB 3MJ8A 1SBBA 4O2FA 1HKFA 2X4SA 5TPWH 2IQAB 3WNLA 1XCQA 5TE6H 1RZKC 3N50A 3U2SA 2FD6H 5TH2A 3O8XC 3GMMA 3QHZL 4R2GB 2HLFD 4U1NA 1J1PL 2VMFA 1UQSA 5EO9A 5I1LA 3O2DL 2UVFA 1RZ7L 3MA7A 3EO0A 4I48A 3SDXF 3MNZA 4NP4H 1HNFA 3I02A 2EKJA 3BH9B 4HDIA 5D1ZD 2DM3A 4FFVC 4DEPB 4Y4FC 1F4WH 4F9PA 1L7TL 1X5XA 5KW9H 1PVHA 2XZAH 3KJ4B 3EOBB 4NN7C 1MWAA 3OJMB 4L4TA 3VXMB 2FL5A 4NNYB 1BQSA 2GSIB 1UZ6E 3PIQB 4J3VA 2ARJA 1RK0B 5FYJU 5E9DA 5IVZB 2DRUA 2SEBA 2DIJA 5C0EB 4LU5H 4PJXE 1CE1H 1OL0A 4CW1B 4X7SL 3MNVA 2RGSA 4JRWA 4XPGL 5I1GL 5ICYB 5DVMA 3GMOA 4ZO6A 2X6MA 3VW3H 1EMTH 3UZVB 2YXFA 2J88L 5DDHA 4NQEE 4JM2B 3U46A 2DQUH 4M43H 4HMEA 4U6VH 2Z31A 4RMVA 1RIUH 5GS1C 1AJ7H 3EDDA 3REVB 4JR9L 2VJXA 1PQZA 1MFEL 1A1NA 5TF1H 5ACZA 3CXHK 1XIWB 3TCLB 2BCKA 1OT2A 4CU8A 3TV3H 2XZQL 4QT5A 3QDJE 3FT2A 2Z4QB 3UJIH 2AV1A 1DE4B 1MHCA 1GCFA 2OI9B 1KEGL 2YUXA 1UCBL 4LKCA 5I71C 5DMGC 3EYVA 4HKZA 1JWSB 3D69B 4KK8D 4F58H 3IDJB 4KJPD 1WC7A 3HLAB 4MXQD 1IC5H 5L9DH 5FHBL 3DROB 4KTDH 1CU4H 5A16B 3RRQA 3A6CL 2EIZB 3LQAC 1U3HC 1R3HA 5JLZB 5F7WC 5GGVH 3QPXH 2FECL 3CXDH 3K4ZA 4GS7C 3TBSB 4M5YH 4OIBA 2ORBL 4M1DH 2IJ0C 4UQ3A 4PJFE 4PJBA 3EAKA 2Q86A 2H26A 1NMAH 1KN2L 3DHMA 4G43A 2O93L 3QIUA 5IQ7L 2UUDH 3VXQB 1OPGL 3VXSE 1UWXH 2VB5A 4XBGB 1OQXA 3IFLL 1OVZA 1AR1D 3CX5J 5D7JD 1P84K 1UWEL 1EH9A 3W11D 3DVFA 3U9PL 4JJ5B 1U8IA 2DS4A 2QEJA 3ZDYF 1A4KA 1WEJL 3FQNB 4X9HA 2Y07H 3HAEB 3QEQB 5DGRA 1OAKH 1DFBH 4P49A 1B0GB 3LV3B 3ARFC 4PJ8D 4XWOC 2D4DA 4NUGL 4PJHB 3KYOB 5CJQL 2BY1A 3ARBD 4PRIA 1MAML 1Q0XL 1AI1L 1ZANH 3MLSH 3ARWA 1MCPH 3DUUA 3DMMD 2H2SD 4Y5YC 2Y72A 5GS0L 3MV7A 4HWEH 5T3ZH 3CVIH 3EZ8A 3LD8B 4XH2B 3WFHB 1NCAL 4XP1H 3EKCA 2K9UA 4LAJH 1A8JH 3W0WB 1WBXB 3LIZH 1ONQA 4EN3D 2OMBA 2Q8AL 3BGAA 4KPHH 2CIKB 4WENB 1I85A 2XQYK 4HS3B 3BPNC 4S1DC 3GJFA 5E2WH 4F3FB 4N90D 1FORL 1X5FA 3DGGA 1JPST 1MVUB 2PYFB 4IRSA 1N2RB 4LCUA 4GW4A 2VUYA 3AUVA 5D7LA 3QO0B 1IFHL 4AEIH 2F19H 4YBQC 3D85D 2AKRA 2EDLA 4EIGB 4ODBD 5EN2B 3I3BA 3R06A 4LMQI 3IJYB 7FABH 2UY7A 1QBMH 1QA9B 1RMFL 3K81A 3MROB 3Q2CA 1I8LC 3KXFB 4ZUVA 4P4RB 4J1UA 4UOW0 1G9NH 5I17A 5D1ZC 1Z9SA 4F33A 4XMKL 3BGFB 3HE7B 4IOIA 1LD9A 1K8DB 4QXGH 2G5BB 3MUHL 1KT2A 5E8OA 1OAQH 1L9MA 3NIFF 2XQBH 3BIBX 2YD3A 1JNNH 4NWUH 4G8FA 3CC5B 3STZB 5E6IB 3U83A 5GGSY 1CGVA 3MLTA 4K2UH 1MLBA 2ICEA 4NZDA 5A2LH 5C0CB 1CVSC 4ZAKA 4OGXH 4CVUA 4YDVA 1ADQH 2XN9B 3P30L 4JY6A 1ZWIA 4MQSB 4JDZA 2R23B 4DK3A 3RGVA 4U1IB 5LAXA 5F93C 5IB5A 3V4UL 4AY0A 1KTLA 4LLVA 1NUGA 2AJYH 3WJJA 4OB5L 4MJ5A 5JORA 1D5MB 1WWWX 3T2PA 2AGJH 5FHAH 4X5WB 4P2YA 4BH8B 1C5CH 2AV7A 2JJWA 3MOBL 3WNNA 4PG2A 4X0KA 1CE6B 2ZSWB 2N4IA 2H41A 2MOVA 3CUPB 4OLYH 3WBDA 4I2XA 3MV8A 1F11B 1T1XA 3EYQD 2WINA 5C8JA 1DQLH 3K80A 4OV5B 3D39B 4AENB 4MDIA 1EK3A 4ZFOB 3O6LH 2HJLB 5BVPH 2OSLB 1MPAH 3U4EB 3T77B 3T09A 5D6CB 3WE6A 4ODUB 1N5YH 1BZ7B 2X70B 4XGZA 3EO9H 1DBBL 4NDMB 4MXQC 3WIHH 3QO1A 3SY0A 4PJIA 1KC5L 1WISA 3T3ME 4LEXH 3CSGA 3MLWL 2NTSP 3LS4L 2YWZA 3L7EA 5D7IA 4PJGF 4JPVH 5IR1B 1MLCB 5DYOB 4RRPA 3ESUF 4OV6F 1K5NA 4A2LA 3A6BH 3RZCB 3THML 1OAZH 4CMHB 1QFWM 1BOGA 1GAFH 1ZHBB 2XT1B 3IAPA 4PGCB 4YXHL 3U0PB 1G0YR 4ELME 2VLJA 2ID5A 4RGNE 3ARGA 4P5KB 5ELIA 4LSUL 4RZCB 2X44D 3BESR 1IC7H 1NGYB 5F8QC 2VAAB 4UT9L 4PJ5E 4E5XB 3PWJA 1ZGLM 4RGOL 1JTPA 4HBQA 4TSBH 2VLRA 4QEGA 5L88L 3VXRD 3E3QC 4JFOA 2YBRB 1L0YA 1BQHG 1FL3A 4PJ8C 1T03L 2Q1EA 3CU7A 4KUCD 4HUVB 1AO7D 4UV7L 3ARBC 1CL7H 3ULVE 3P4NA 2QTEA 1JGLL 4OFYA 2HTLD 2YD9A 3O9WB 1ZTXH 4X5XB 5FV2A 3VXPB 4QRRA 4GAGH 3GMRA 4KVCH 4Y4KA 2XXCB 2YSSB 4HJ0C 1T0MB 5EZLB 4B53A 1ZEAH 4YWGH 4Y16B 5CEZH 1SY6L 1CWVA 5J1SC 4QRSB 5KSAB 1NMCC 2PW1A 1LE9B 2A83A 2BHYA 4JZNB 2Z8WC 5FYKL 4OIIL 3UTZB 4F2MB 3G6DH 5C92A 4Z7VB 4N0CD 4LHUG 5BV7L 2NX5A 1T5WB 1KCKA 1DUZA 4P3DB 1RD6A 3CFJB 4PFEA 3V6ZB 3VA2C 4QXTB 5L7XL 1BD2D 4HS8H 3PABA 5IEKB 1AXIB 1J0KA 3ZE0F 3VGEA 1AC6A 4JGJA 3FO1A 1EEZB 4M3KB 9CGTA 4FQHB 2DMCA 2W60A 5EC1B 3WLWD 2VXTH 4FQ2L 4WFGE 4YHOL 5ESVA 3T0WA 3E6HA 4YBHA 4U6YA 2WV3A 3ZDZE 3MX0A 2YKLL 3TZVA 4YHKH 4OJFH 1IGFL 5HDLA 4PJDE 4UBDD 1NDGB 2VXUL 1B2WL 4PB9L 1BM3H 2B5IB 5DFVD 2VKWA 1G7PB 4MNGA 3L95B 3LH2L 4WV1A 1OGAA 1D6VH 4JO2L 4DVRH 1QFWI 3GBML 4EOWH 2HWZL 1E4XL 4PUBL 4YHZH 4LLMA 2A1WL 2NLJB 4NO0D 2AEQH 3NCCB 2BVPB 1CDIA 3ZZ1A 4LCYB 1D5XB 5HGHA 5KBNC 3PQYB 5MHSD 5EO1A 1A7PH 4MDJA 5KSBF 1ZGLP 2EH8H 4RISH 4X7TB 5F71A 1QLFB 3UP1A 4C57C 2LU7A 4M1GH 4YFEA 5JOPE 4H88H 12E8L 5EIVA 4UUJB 2AI0H 5IJKA 3C6LA 4XP6H 4YE4L 3QAZC 4JG0H 4F7MB 4NRYB 2RCSH 4NRXA 3VFVA 1TZIB 4D9RE 2YA0A 1IAIM 2RBLA 4UIKL 2CRMA 4PJEF 1LEIB 3LHPL 1S9YA 1WAAF 1FFRA 1YPZF 1T5XA 3MRCA 3T4AA 5EOQH 3VD3A 4LVOB 4HIXH 2Q76B 3EYQC 5ALCL 5CGMA 4DCQA 4KHTH 2A74B 1A6PA 1LDPL 2J6EH 4UILH 1XGUA 1H8NA 3C5SB 3Q6FA 3I3DA 4YX2L 1U8KA 3RDTD 1N8ZA 1PSKH 3INUH 4ODSH 2CDGA 1A14H 4O02H 1HEZA 1HXMB 3PGDB 4XPBL 5C07A 1PDKA 5HI4D 2I9TB 3DWTA 1YYLL 2BVEA 2VC2H 1C5DB 5DR5H 1BIHA 1D5IH 3EOTL 3TF7C 2CLRA 3G08B 3OL2A 3SKUD 4CL7A 5T1KB 2VDML 4MXWH 5ITBL 2I5YL 4EI5D 1AXSB 2EDWA 3BSZL 1PKQB 3GO1H 3GSRA 5ISZA 1ZA6A 2NY2B 2PKDA 3IB4A 1P9MC 4KDWA 1KLGA 2F5BH 4LFHG 4FG6D 1RJYB 2P42B 4NWTL 1QYGL 4K3EL 1I7UB 3L3KB 4LSRL 5D96B 4XBPA 5D7SL 4QOKA 4WI2A 2LFGA 5HD8D 4P4KD 3TO4B 4PR5B 2EIBA 2FX9L 1C1EH 2VISA 4HX1A 1Q72L 3O45B 4UAOB 4JHAH 4PGJA 1AY1L 1IEAA 5KSUB 3D25A 3HNVL 3C5ZD 4ZMAT 5C0IA 1IGYB 3AREA 1OB1A 3U30C 3QCUH 1JYVA 2P1YA 5BRZD 3TN0D 2R2EB 3OR7A 5AUMB 1H5BC 4G6KH 1X5ZA 3NABL 5EUOA 3SE9L 5D1XB 1JNHA 1YNTA 3EJJX 4KMQA 5I8EA 3OAUH 1UGNA 3CPLB 3I2CL 3MCKB 2VQ1B 1NL0H 1WFUA 5DJCA 4M5ZL 5J89A 3MLZL 3WFBH 4LLUA 4OUOA 1PFCA 3T3PF 4TNVF 1S9XA 3O4LE 4G9FD 4OCRH 4AYFA 3QI9D 3DX6A 5JHDD 1WIUA 3W5NA 1OP3H 25C8L 4RQQB 1IAII 1C8PA 4LSPH 2PO6D 3QDME 5IMLA 1NEUA 4HF5H 1IILE 4DOHE 1I9IL 4OI8A 5DHYA 5SWZA 1EGJL 2V9TA 3WS6C 2IBBA 4XPFL 4PJBF 5GRYA 4OQTL 4OLWL 4QTIH 3WKML 3QUXD 2E9IA 5CSZB 4OUUB 3KPSA 5GGUA 1KPVB 3MYJA 1J86A 4L3CA 1MRDL 3NZHL 5BVJB 4UINL 2VZUA 4DAGL 4Y4HB 3KNBA 3VFWA 3VFUB 3WLWC 3BZEA 3B8YA 3MRRB 4N1CA 2APFA 4HWBL 2D7TL 5DFWH 2FWOB 2X40A 3B5GA 1LE5A 4JN2B 4JPKL 5ALBH 3UYOD 1FDLL 3DX7A 4DUXA 3L9RA 4OGYH 1WV7T 2ZZUT 4K8RD 1GGUA 3M45A 1MCIA 3SE3C 2J5LC 1U2HA 3PWUA 1MFBH 1JRHH 1HOCA 3TJEH 2NXYB 3N1FC 3VXME 4RFNB 4POYA 4X9BA 4KI5F 3QUMA 1E27B 3VG9C 1F13A 1JPTH 2EDTA 4QRTB 4NHUA 3GBNL 2DLHA 2E9WA 5JTWA 3VFNA 2ESVB 1Z2KA 2GFBA 4LP4A 2DDQH 3B9KA 1RY7B 2DL9A 2GT9A 4JFEA 4JFXB 3QG6B 2HVKA 1DUYB 5T1LD 3ROOA 1ITCA 2O5YH 5EIIB 1S7UA 3RVTD 3ZDXE 2CDEB 2ICWA 5EZJA 4ENED 1QSVA 2P8LA 2GTZA 4WFEE 1FFOA 1A5FL 1LO0L 1IKFH 3BZDA 5DSCA 2GY7B 1DQMH 5HHPB 5JZ7C 4H25A 2QSCL 1ZAGA 3OJ2C 2E7LA 5HHNB 2QQNL 3E2HC 5E24E 4ZNEE 5DD3H 3R1GH 1A21A 1QSFA 5HHQA 1KEML 1E28A 1F4YL 3SN6N 5F8RC 2PN5A 5L6YH 4X98B 2W38A 1IM3A 1JFQH 1MJUH 1BHGA 4ZQKB 4OLXH 2GJ6D 4JFFD 3FB8B 1KCRL 1I8IA 5L2KA 2GK0A 2ICES 3NFPB 1ZHLA 1C12A 4H0HB 3HRZA 1V05A 3WO4C 4XNXL 4RFOH 4IBLT 4XX1G 1QUNA 3RDTC 3MRPB 4F37K 2MQ0A 4JDTL 2WAHA 2PXYB 3PL6D 4XCEB 1M7XA 2MMXA 4HIEB 3QIWD 2VDNH 5DJYA 1PGRB 5CIPA 3GMQB 1QLEH 4MCZA 1SYVB 4NKIL 5JNYB 1IGCH 3A67H 1UM6L 3QZWB 3AB0C 4O51A 2I60H 3NCBB 5HBBA 1OSZA 5BMFH 1NFKA 5I18L 2GITA 2ZSVA 5TQ0L 1JP5A 1S9VA 4EI5C 1AGFB 2EE2A 3SQBA 5MEPA 2I26N 1PEZA 3TYGL 1J8HB 4LLWA 4ZUSB 1E6OH 4PLJC 3KLHD 2ZCLL 4HKBB 3CVHA 5ESAB 4PJ7E 2DM4A 3FAXA 4FG6C 3T0EB 1A9EA 2HJKA 4J3XA 2EYTB 2FLBT 5ICXB 4XNMB 1SYSB 3VWJB 4FQXC 4LASH 5F9OL 5C0ND 3HPLA 1AIFA 32C2A 4CADA 5L8LB 2BNUB 1MHPH 5HD8C 4K7FA 1W72L 5GGTL 5DJ8B 3STLA 2ZOKA 4QF1B 4XP5L 4TOYH 1GGTA 4PJAA 3UYPA 5K9KB 3FOMB 1YEDB 5DJXB 2BNRB 3RNQA 2KQMA 3MRBA 3LKQB 4G7YH 2DI9A 3RIAF 3O2DA 1R3JA 1CG9B 3MFGB 3QEQE 4UDUA 4QRQA 1FNFA 4A6YH 4L9DA 4PLKC 5HDBF 2A77L 2DQDH 1YEEH 4PJCB 3PP3H 4JPWL 4PJHE 1A02N 4JFQA 2X2YA 3TBWA 3VFTA 3Q6GH 4H1LH 3GRWL 4MZ3A 1P2CA 1U3HB 3IDXL 4CVXA 4I9WD 2W1NA 4N8VA 2EDBA 5IB1B 4DZBB 1F4AA 4LVNC 2CLVA 1NCDL 3X12B 1MCOL 2V7NA 2DQCH 2VITB 1L7IL 3NH7L 3CZFA 4J6RL 4QXUH 4L4TD 4XB7A 4TVPH 4L8CB 2J7LA 4G6AD 4PJIF 2BMKA 1NGXB 1CIDA 5A2JH 1IKNC 2P46B 3IFPA 1NAKH 4XP4L 3DVNA 1MJ8L 5D7IF 1GXEA 1CQKA 5ID1A 1N3NB 1QKZH 4W81A 2D9QB 3OGOE 4W4NA 3HB3C 4D8PB 2ADIB 5D71H 5EO0A 5F7DA 4MMZC 4JFYB 4MAUH 5HVFB 5I8OL 1U3JA 5I73C 4S1SL 1OTTD 3MTRA 5CEZE 2FIKA 4MA7L 1OT1A 2VDKH 2HG5A 1IC4H 5C6WH 3QIBC 3I9GH 5EOCL 2IPUG 3KPMA 4JHZA 1YEJH 1NDMA 1NUDA 3FO9A 5E94B 5BOPA 5F3BB 2CK0H 4LKXA 1PZ5A 5E5MA 2Z31D 4NO5B 3KXFE 1MCHA 1QHPA 1XGYL 3RIFK 2XTJD 4K8RC 2E8YA 2QR0A 5E2TL 3RA7L 4I0KA 3MRFB 1RZKH 3UYRL 4NJAL 1L6XA 3WL9A 3AC0A 1N4XL 4XCFH 1WIOA 3PWNA 3D2UB 1T0PB 5F7NC 2F5AL 1FYTA 4KK5D 3P9MB 3MNWA 4K3HA 3BKJH 3FZUC 4RAUA 5I1AB 4JY5H 4P99A 5C0CE 4JZJB 1OAXH 4FQCL 4HJGA 3T4YB 4PTTB 2VZ3A 3CZJA 2XN9E 3VFMB 3ULVL 5TE4L 2FBJL 4A2MA 3DXAB 1C7TA 2BHZA 1A0QH 3MYZA 3DX9A 2H32H 4ENEC 2CK2A 4OQ1A 5FM5M 2C26A 3V0VA 3BPCA 1RJLB 3MGOB 2BRRH 1HK6A 1U9KA 1HWHB 4X6FB 4XNYH 4RMWA 5FECA 2Q3ZA 3ARDC 4Z0BL 1JIBA 3QIUD 4U0QB 3JTTA 1MFNA 2QLVB 1GL4B 1OAYH 1N26A 4JKPH 3VD5A 3KAAA 3VRLE 1CGWA 4R4BA 1CDUA 5SX4H 1H8OA 5C2BL 5CFHA 1CF8L 1FGVH 2RB8A 3UO1H 1GJIA 1GC1C 4HMCA 3D39E 1FNGA 4NQSA 3QXAA 3IXAB 3PL6C 4M1CD 3P9WB 3VFSA 5BXFB 4ZUUA 4PGEA 4WJ5B 1JZ7A 4PRID 5EOTB 1NBZA 4UZGA 4KI5D 5D8JH 3X3GL 5FYJD 4HIIB 1RU9H 3HC4H 4NRZA 3MV7D 3SKNA 4JHWH 3PHOA 1XF5B 3KPRB 3PE9A 5GISL 5JR1H 3GM0A 2E9JA 3TBTB 4M6OL 4GMSH 4FQQB 1YNLH 3QBTB 2DYPA 4YGVA 3L3HB 5JIPA 3DBXA 4EDXB 4LNRB 3LQAH 3OKDA 5L0QC 3ES6B 3HS0A 3PGFH 5TE6L 1YEFH 2DBLH 2Q6WA 1HHHA 2RFXA 3CCHB 3AVEA 1TJHH 5CHNB 4LRNH 2Y6SD 4NC1E 1ZMYA 1EO5A 2AXJA 5D7LD 1D9KD 4UOJA 3KPPB 1LILA 5SWSB 1UM4H 1TJIL 2BC4B 3WFCH 4DGYH 3ZKMC 1HH6A 1FL6A 3P73A 5C6TL 3MC0A 4YEEA 4LLQB 4JFDD 1HHGA 3GSQB 2YD2A 3B83A 4ERSL 5DHVH 4MD5B 4ZO7A 4D0DA 3HG1D 2DI7A 4WFFE 3V5KA 2V7HB 1NC2B 1JWMB 3DRQB 2XA8H 5IM7B 1ZLWK 1KXQE 1OTUC 3K4AA 3V52H 1OD7A 2NY6B 5JDSA 1LO3L 3MLVH 4XCYB 4K7PX 3WLBA 5BZDA 4M02A 2AERT 1FO0H 4I3SH 5EBWB 4E41A 5DD0H 1JZ2A 3IDYC 5F1KC 3L5XL 1IGMH 2W0KA 4JGUA 3IF1B 2DQEH 1Z5LB 4MAYA 3MBEA 2P24B 4ZAKD 2OK0L 3T8XB 5BO1H 2Y06H 4Z7VE 2JJUA 4U3XA 4HSQA 1EMTL 3RGVD 1I8KB 1T0NB 2CRIA 2DQTH 1D5ZA 2W65B 1R3KB 4M43L 4UQ2B 5FYKU 2YRPA 2B4CC 4G8EB 1RIUL 1AJ7L 5I74C 1GGCL 3O3EA 3HC0B 4R3SB 3LSOB 3QNYA 1I7TB 1SJHB 1A9BB 3VFRB 5C0JB 3AM8A 3OKLB 4JFZH 1LP9F 1OARH 4G6JH 1MIMH 5TF1L 3IFOB 5JW4N 4ONHB 4RIRA 5C1MB 5ADOH 3IGAB 1ROWA 1EXUB 1B3JA 4G7VH 4ZSOB 5EULV 1BFVL 4Z6AT 1MAKA 2AK4A 4L5FH 4JB9H 5F96H 2OJEA 3FT3B 3TESA 3MGTB 2XTJC 3CFEA 4HZLB 2ZUQB 1T2JA 5HYQB 1IC5L 1NMCB 1SBSH 3IFNL 3G6JA 3NAAL 3HMXH 2BDNL 4DN4H 1QNZL 5D72H 1TJGH 2YMXL 2X05A 1Q0YL 3OAZK 3UTSD 4KMTH 1F90L 1GPOH 5GGVL 1T22B 1UCTA 2Q8BH 3UC0L 1HH9B 4M5YL 4Z7OE 2FJHA 3UAJC 4XPTH 2Q3AA 1S7TA 4FZEH 2AJSH 5FUZH 2FBOJ 1LO5B 5KOVC 1NMAL 4NNPH 1AD9A 1QG3A 1NSNH 5DTFB 1E4WL 3OR6A 3PQYE 3ROLB 4C59B 5JOFA 5JPNB 2YS4A 1KCUL 2VLKA 4RAVA 4PS4L 2UWEA 1CFSA 3BE1H 2OTUA 2NY7H 2E5EA 2X4TB 3HUJA 4I0CC 4PRDA 5DEGA 3JV4B 3QFDB 2FX8H 2Z92A 1KULA 2W0PA 1HQRB 2YWYA 3K0WA 3QIUC 1TVDA 1A7OL 3RTQC 4P2OA 3MA9L 1CLCA 5BCAA 5IVOA 1UYWL 2Q87A 1T21B 1IBGH 2VLJD 1MSPA 3BP4A 3ARGD 3RWFA 1RZGA 5J9PB 3UTTB 1M05B 4OZFB 2KL6A 3QUYA 5DK2B 1URLA 2VE6A 4BFIB 3ULUF 3MLSL 1T04A 2IFGA 1F3DH 3C8KB 3CU1A 4Y2OA 1IM9A 5JUEL 1CXFA 3OAYK 4GAYB 2VLRD 2AJVH 4DGVH 2IMMA 2XKNA 5MEOA 3LKPA 3MLYH 3RUGB 1YEGH 2R0WH 4QHLA 2CUIA 3V6OA 5MEQB 4H8WL 4Q9RL 4M1CC 1J7VR 1FZMA 2R2HB 3HR6A 4FFYH 5KG9A 1SY6A 4KI5C 1F3JA 4OFYD 5K9JL 4QRRD 4Z18A 3RWDA 4KV5E 1ZHNA 5FYLE 5GJTL 4PJ9A 4Y4KD 1RHHB 3U79A 3L3DB 1DEEA 4KPHL 3WD5H 1YN6A 4ZD3L 1WQVT 4QHMB 3E8UL 4WUKH 4ODXA 4ELKB 3QAZB 5KS9F 1X4ZA 3B3IA 1ZA3A 3D9AL 4G9DA 3DTXB 3N06B 1L6ZA 3H2WA 2OZ4H 1JGEA 3F7VA 2NPLX 2QQKH 4YAQA 5SWQB 4XCNA 4HLZH 3VFOA 3ILPB 3QQ4A 1I85C 2R2BB 2F19L 15C8H 1DBKH 4KKBD 4JFPB 1QO3B 1ZSDA 3DUSA 4DJMA 2E7BA 1QVOA 3SDXB 2NX5D 5GGRY 4QYOA 4IRSC 1CGTA 2Y6SC 1BFOA 4K7PY 1DQQA 2Y4SA 5KN5A 4QXWA 1RQ5A 1HINL 3VFGH 1FNEA 2YPVH 1ZLWH 4DN3H 5HGAA 1IAKB 3FKUS 1T1YA 1JPGA 2YA2A 4GKNB 1FZOB 3SKOA 1BQUA 3QDGB 5HPMA 1A7QL 4U1GC 4HPOH 2C1OB 3KPNA 2ATPB 4HEPG 1G7QA 4X4ZA 4KROB 2A6IB 5C3TA 4NWUL 1TCRB 4RFEA 1NUFA 1J0ZA 1YNKH 3NZ8A 5D1QC 3RI5K 3WFEH 5T33L 3DPBA 3F7YA 3GK8H 1ZVSB 1X5KA 2OP4H 3AS1A 3MJ7A 4F8TA 2WP3O 1XGTA 1FIGH 3FO2B 4R4NC 1B90A 1BX2B 4LLYA 2EDHA 3QJHB 4XVTH 5GZND 4L29B 4BFGA 1BGXL 4LGSB 3L3JA 1OGAD 4O2CB 3C08H 4HGWB 1XR8A 1OSPL 1BF2A 5D5MB 1MJJB 3T1WA 1JPFB 2MHAB 5FO9A 2AXGA 2Y7QA 2AJYL 3QISA 1DQDH 4ONGL 3TO2B 5FA3A 4NZRL 4ZAKC 2NTFA 5F1NA 3S7GA 3NACL 1BP3B 4R96A 3FHQA 1P5VA 5D2NE 1MEXH 3RGVC 5F9WC 4E0RA 1QRNB 1C5CL 5BOZG 4X6CB 1QFOA 3WJJC 2B1AL 4LCWB 1RK1A 3U30B 4ODWA 1HI6A 2EC8A 4XWGH 1N59A 2IG2L 4MA8H 4FP8L 2ERJC 4NKDB 3C6LD 5AYQA 2HKHL 2XWBA 4GW1B 2H1PH 4PG2C 2AK1L 3GMLA 4PJAF 5IT2H 3B9VA 5E5UB 4OKDA 4S1RL 5GSVB 1KJ2B 3ME0A 1IL1A 4YH6A 3SQOH 1N5YL 5DD5H 2JIXD 2FR4A 1LO4H 5DVOA 3HI1B 2ATKB 4U31A 1I3GL 1UG9A 3BZ4B 4GSDL 2W0LA 1H3PL 4LEXL 1ZK9A 3H8NA 4WO4B 4Y5XA 5EC2A 4U33A 2I24N 3EHBD 4YXLL 1DTUA 1X5HA 2VL4A 4TSAH 3HE6C 1VACA 2ESVE 4X8XA 2VSDA 3FB7A 5MP6L 5C07D 4LVHB 4R7DA 3A6BL 4FNLL 4M6NH 4OZFH 1PX4A 1OAZL 4FXGA 5HXMA 4M8QA 2AS5M 1CT8B 3PNWB 4M7LH 2FGZA 1IGTB 3EGSA 2X4QB 1KFAH 2B1HH 1UZ8A 4OCLC 1Y6KR 1WJ3A 5GPRA 1QOKA 2GI7A 3BAEH 1OM3H 1I8MA 4Y1AB 3H7BA 4PRNA 1M6OA 4N8CH 3QEHB 4WTWA 1U92B 2XZCL 2DKMA 4L4VD 1ITBB 5HVGB 3EYOB 5IHZA 4LCCA 3TCXA 3MV01 1G7JA 4OM0H 4OCNC 4ZDHA 4PJXA 4N8VG 3ARGC 3LS5L 3IXTB 4OF7A 4QOKD 2NYYD 4AT6A 5JHLH 2J5LB 4H26A 4FXLA 3VXUD 2CRYA 3U7WH 1H0DB 4P9HC 3WS3A 2XNAA 1I7ZA 6CGTA 4GAGL 4KVCL 4X99A 3S96A 1IE5A 3VG9B 3SGEI 5LGKA 3ARED 1OTSD 3HI5L 1MHHA 1HNGA 4JQXA 3U36A 3ZKQD 4NQEA 1ZEAL 4YWGL 3ZTJG 3MRKA 4HFWB 1RJZB 3VGFA 5CEZL 4PTUA 1CR9H 5HY9A 4ZUWA 4YQXL 2VERN 2OYPA 5ILTL 2EXWD 3RWEB 4OKVB 2XPGB 4Y4KC 5FGBA 1CXEA 4Y2DA 3QDJA 5GRJH 3DV6A 3EJYC 1WBYA 2AJUH 4PV8B 2HYMA 1FFNB 3L5HA 3RL1B 1J8HE 3R8BB 2PR4H 8FABA 2R1XB 3EYUH 1EBAA 1DBML 5B38A 3BYTA 4PLNC 1CS6A 1EGJA 1LHZA 3T0EE 3UTPD 4I5BB 4HS8L 5B39A 1KIUA 1YA5A 4OQTA 1A7RL 4HV8B 4X6DA 5DRXA 1XT5A 5DMYA 4FA8A 1DVFC 3RKDC 4HK3J 1I3RA 2IPKA 2X42A 4N0UB 1EIBA 4OGAD 5SWZD 3IDIA 5DD6B 2NW2B 1CFVH 4K3DL 2BNRE 1S7QA 2J12B 4PJFA 3MRMB 4HWBA 3HHRB 3PJSB 3OXSB 1FZJB 3TNMB 1I1AC 1QFWH 2R56L 5IV2A 3FQXA 3KPSD 1T1ZA 3ULUD 3VRIA 4PJCE 1BWMA 3RX5A 3GHEL 2MNUA 3VXSA 1KTKE 5HI3D 5JIHA 4LF3A 3CK0L 1TZGL 1ODAA 5JIKA 1YUHA 3PGCA 4MD4A 3TZVC 2H6PB 1U2CA 4XVJH 3O6ML 1YJDL 5I8KL 1I9RH 1JGVL 4H20L 4MNQA 2OQJA 3VA6A 2I07A 3SPVA 1U8QA 4WV1C 2RIKA 3HTLX 4FRWA 3K2UH 1U3ZA 3FO0H 1CXIA 4X80H 5ENWB 1G7LB 2IH1A 5EBLB 4RISL 2MCPH 4FQXB 4O5LL 1MREH 3GIVB 3HKFA 4M1GL 4S0SD 4H88L 4ZFOL 5C6PB 4OT1L 2ZUVA 1W0VB 2AI0L 3ZTNH 4XP6L 1TQCB 3GHBH 2QADD 4JG0L 4JFED 4B50A 1NBQA 3REWB 1KPRA 3RX7A 2FO4B 2VOTA 5E99H 2G75B 4PG9A 1QQDB 1FP5A 1I1YA 3JWOC 2OJZL 4YPGB 4LBEB 2VABA 3N9GL 3NFSH 4GXUM 3RWHB 5IMMA 4ZPTB 1ULVA 1Q94A 4HJJH 1BFTA 1XGPB 2LU3A 1NFDF 3VMOA 4EXPX 5IJKC 4KK9C 1VKXB 3G6AB 4YHIB 1LNUB 4G6FD 4P23A 5KVDH 4AIOA 1WZ1H 3P4LA 5INDA 3FQUA 2E9BA 4F15C 5K9QG 3SE4C 2OMNA 3OJDA 4JN1H 1A2YB 1QSFD 4HIHA 5H8DA 4LVNB 3JV6A 3C5JA 1OF2B 3H9SB 3NCYS 4XMLL 1XGQB 2CIIB 1JF6A 4ALAH 5B3JE 5GZOC 4PP2B 3KYKL 4ZFGH 1VFAA 1ED3A 4KKCD 5E2UL 3HZKB 1R3LA 5I66A 4HUUB 5IIEB 5CJBA 1LK3H 3LEXA 1BQHB 4V2BA 3MMEB 5DR5L 3UBXB 1UJ3A 4BSWB 3EFDH 2A2QT 1XH3A 2KZWA 4JFDE 4MXWL 5IQ9B 2X4OB 4I18A 4PBXA 3HG1E 3GO1L 1JK8B 4BZYA 4M4PA 3TLRA 4K3JH 2MQ3A 5I73B 2P43B 1CDYA 2F5BL 4OI9A 3DXAE 4O2EA 1E4KA 1EO8L 1PEWA 4XMPL 4R8WL 4PRAB 4WW2A 1KBGH 3C2SA 4XT1C 2DQGH 2Q7YA 3QIBB 3PHQB 1W72A 5GGTA 1NLDH 4IS6A 4KQ3H 1C1EL 1J1XL 5I9QC 4OLZL 5JOEA 1IRAY 1M7IB 4GUPA 1IEHA 4LHUB 2XY1A 3QCUL 5A3ID 3OB8A 3BZFA 1FG2B 4W6WB 2DQIH 4ZODA 2NY4D 3C60A 4FXKB 1WUNT 2GJJA 3GRWA 4N8PA 3D0VB 3P4OB 4CAGA 1ES0A 3AREC 5LCVL 1CQYA 4D3CH 1FJ1B 4ETQA 4L3EB 4P46B 3O2VH 4XNQB 1IAIH 1MFDL 4P2QD 3ARZA 4JLRB 4JGMA 5ANMB 4F7EB 3WNPA 2EXWC 1N5AA 4OCRL 4HIJA 1F4XH 5GIRB 5CJOL 3I85A 2ICWI 3O3BB 3TYFA 3V8CA 3BIKA 5DUPL 2I9LA 4GG8A 4R97C 1SM3L 1FBIL 1M1SA 2JTDA 2EIEA 35C8H 3KPRE 3S5LA 5I30L 3MRIB 1S9WA 3ARDB 3FN0L 3LKOA 4QTIL 2F54B 3GUTA 1JGDB 4OZHE 3NGBC 1QSZA 3JWNC 2FB4L 2A6DB 4XAWH 2IEPA 2UWEF 2JB6A 4MD0A 1VFMA 3VGBA 3HUJF 1XF2A 1PKOA 3CSYB 3MBXH 4J3TA 4P5TA 5I15L 2NXZC 2OR9H 4KKAD 1AH1A 5CJ5A 3FQRB 4HS6B 4TQEH 3ULUC 2V2XA 3F5WA 1GZPA 2OBGA 4HH9B 4P57A 5HI3C 4ELMA 1BZ9B 4I3GA 5FXCH 1ZT7B 1MFBL 4HWNA 5F7KC 3TJEL 4Y5VA 2X1PA 5DJAA 4ZXBC 2MKLC 4I3RH 3UPRB 2PYED 2HKFH 1CTOA 4LPWA 1JN6A 4MNHA 4PJ5A 5CBAB 3GI9H 2NW3A 2R4RH 2ADGB 4OM1H 2DWDB 3GNMH 4YUEH 2J8OA 4JG1H 2H8PA 1MFCH 2H3NB 2HFGH 2O5YL 1FN4B 4TUOB 3VXNA 2G9HA 1YEKH 3PDOB 5L0QB 4Z76B 3FMGL 3ESVF 4P5MA 4BSVB 5C09B 3FB5A 4O4YH 5JQ6H 3B9KC 4OFKA 2QADC 1KJ3L 4TULH 5I1DA 4NOBA 1P53A 5I1CL 2BVYA 5GHWH 4PJEB 4L9LA 2PTTA 4XHJD 3WUWA 3MJ8B 2PTUA 5DD3L 4B5EA 4MZ2A 2X09A 5FYLL 4LCIH 1P69B 5L6YL 2D31B 1FFPA 5E00A 3CH1A 2WWKT 1C08A 4OLXL 5EPMA 2IQ9H 4QHNB 4JKWA 3BI9X 4P3CH 4U1HB 5DJDA 5GXBB 4ZSOE 3CFKB 4Q6YA 4M7ZC 4D9LH 3WHXB 3MLRH 2M8XA 3KHOA 4HKXA 5JPMB 2HJFA 3ZKND 3DARA 2C3WA 3PP4H 3FOLB 4KKCC 2L0DA 2VDNL 5CWSB 4UB0L 1QLEL 3SGKA 3T2NH 4HGMA 4KZDH 4WHCA 1IGCL 4QGTA 4U4BA 1Q9KA 3IU3B 4WHTA 3H0TA 2I60L 5BMFL 3RWGA 4OLVH 3O6FC 1U41A 2KDGA 4NO3A 5E9DB 3ULSB 5GS0D 4I4WA 4XZUA 4KY1H 3LZFH 3P9LA 1C16A 2W9EL 4IIQA 1E6OL 1NMBL 3MRNA 4K8RH 1AHWC 3NCFB 4BQ6A 2BOBA 4PJDA 3KYMB 2OCFD 5BS0B 3Q3GA 3OXRA 4Z7NE 3KDMB 5FCUH 1EDQA 2MTPA 4NC2B 5I74B 5H2BB 5F1IA 4WNQA 4KJYA 4LASL 1T3FB 3H6JA 3KWWB 3AAZA 1TVHB 3BEVA 4TOYL 2GUOB 1FPTH 5DDHB 2VDLL 4L8BB 2DYPD 2CGRL 4J3SA 2F53B 1PQZB 4DVBA 4HUNB 3L3IA 1FYHB 1LEKA 4QT5B 2DQDL 4CVZA 3UTTE 3QRFM 2P4AB 1UT9A 4NFDA 4R6UA 3Q6GL 4YDKH 1ZVYA 4LSTH 5JMRA 1Q9LA 4QRUB 1OAUL 3MV9B 5CKGA 1VA9A 4S2SA 5E2VH 2P5EB 1JHKL 4YFDB 5CMAB 3ZT7A 3RUGE 2FECI 3HRPA 4GO6B 2FATH 4J8RA 4U6XB 5I1HL 1Q1JH 2AJZA 1B0WA 2H9GA 2DQCL 3HFML 4JRXB 3WIIH 5I6XC 1JZ8A 3S35H 2QHRH 5IROA 3UROR 1G1YA 4HUWA 1MFAL 1RUAH 2APBA 2EEBA 1GC1H 5BQ7B 3LKNA 5CEYB 4R7NA 3SCMA 3QQ3B 1EEYA 3MLUL 2A6KB 1DSFH 4JPIA 4PRBA 4PJBB 3HZVB 1N0LA 2GW5A 1YEHH 4HAGA 3S36H 3S35X 1DL7L 3RTQB 4E41D 4EI6A 3OKMB 1BQLH 3RQ3A 5F88B 3X14A 4JO3L 4KMLB 5I2IA 1CXLA 4GRWF 1UXSA 1Z9LA 2E27H 3LRSA 4GRLD 4MAYD 3MBED 2EYSB 4NHCH 1DBAH 1HDMA 4EUPG 4PY8I 5AAWA 1D6EA 5AAMA 3EOAB 3SDXE 4MJID 3BO8A 5IW6B 3MOQA 2EYRA 1UZ6F 4F8QA 1T4KB 1QPPA 1YEJL 2CK0L 1I7RA 5TGBB 3HI6H 5LQBH 2R0LH 2OXGA 2NY5L 5IFJB 3DVIA 5K9QI 3QDGE 3DUUB 3O2WH 3Q5TA 4D9QE 1NGWB 2AK4D 2FRGP 3L5WB 1SJEB 5TQ2L 3VXUE 5B8CA 3S4SG 1LQSR 3MO1A 2EXYD 3GJFK 2YC1A 1ONQB 2BOCB 1CICA 4LSVL 5TDPA 2AVGA 1WCQA 1H3UA 3RY6A 5CD3B 5D5ME 1S7RA 3TIDB 3LMJL 4BUHA 2OTPA 3FFCB 3OX8A 5IMOA 3WIFA 1NCCH 1U8LA 4YDJA 4BFBD 1FE8H 4IRSB 4XXDA 1R6VA 5D2LF 3BW9A 5IB2B 2C7UB 3SDDC 3DHJA 1QRNE 1PX3A 4GXVH 1KB9J 3KLSA 1HWGB 4X6CE 3T0VA 5ERWB 3CLEH 2VLKD 3OPZH 4LCWE 3O4LA 4CN1A 2LTQC 5H94B 1UB6B 1BF8A 1HN1A 1AGEB 5JO5B 4JKPL 1A7BA 4U2YA 4U1GB 4X6DF 5EU6D 1XZ0B 2OLDA 5TDNA 3SDAA 1FGVL 5HGDA 2QQLL 4EBQH 3TVMA 2GCYA 3NMEA 3QDMA 2YEZB 4JO1H 4P2OD 5D1QB 3B2VH 1GGBL 4JCMA 4ETYA 3GSNB 4JDVB 4PJFF 3ARPA 5E8OB 3KR3H 3JSSA 2M1KA 5IHUH 3KLDA 2HFFA 5IW1B 3NCYP 4UMGA 2C5DC 2IQAA 4GAJL 1HHJA 1IM9D 3WHE0 3G5YB 1RU9L 3O6KL 1P4BL 4M7JH 2ICEB 4OSUH 1T7YA 4UTAL 3IETB 1QTYT 5C70A 5GS0C 5D6DA 5JR1L 4G5ZH 4N9GB 3U6RB 1G9MC 2GYSA 4U7MA 3R4DA 4HKJB 5FK9B 3BH9A 3PHSA 1KTLB 4PJ9D 4YZFE 3RIAK 1OWRM 4NT6A 4RA3A 1RUKH 3LQAL 4M93C 3EOBA 4RBPH 1BIIB 3GMPB 5T3XE 3ZDYE 3VXMA 3BJLA 2VZ1A 4BK5A 3BVNB 5FYKD 1JZ4A 1IC1A 4NNYA 4Y1AE 4UOW1 4XNUL 2GSIA 5KJRH 1BLNB 1TJHL 3GJEB 2JCCB 1GIGH 1RI8A 2BP3A 4FMKA 3Q1SL 3PXHA 1P6FA 3BKYL 5DUML 5IVZA 3BUYB 1YN7A 3D18B 1UM4L 3V8OA 4DGYL 4I2XB 3MV8B 4U7SA 5C0EA 4WEBL 3GGWB 2ADFH 3MZTA 3VD4A 1KXVC 1NANI 5ICYA 2VR4A 1LDSA 4WFHD 3WE6B 4PREB 4XGZB 1ZE3C 3LKSA 2DD8H 2DTSA 3HE6B 3V52L 4ZNEA 2YZ8A 3SY0B 4JM2A 3OKOB 3U4BH 1VADB 3MLVL 1AQKL 3REVA 4FTVB 1F6LL 1XFPA 3VWKB 3BKCH 5DD0L 3QFJB 1XIWA 3TCLA 1IGML 4P9ML 3P0VL 3D85A 2Z4QA 4WW1A 1DE4A 4WIQA 2Y06L 5DMJB 4YDLC 1JNLL 1REIA 3M8OH 3U1SL 5C3LD 1BOGB 4YBLC 1JWSA 3D69A 5FB8B 3IDJA 5FYJH 1VESA 3BUTA 2VDRH 4HXBL 5JW3H 3HLAA 5KTEH 4AIXA 3NIDE 2D9CA 3PV6A 3DROA 5A16A 4JRYB 4BYHA 4NC0B 1T66D 1VFUA 4WW2F 5JLZA 1MQKH 4N0UE 1NAMB 4G7VL 3EYFB 3TBSA 4AIZB 2WBJB 2XXMB 3TT3H 3MUY1 1A6WH 4JB9L 1JHLH 4XAKD 2VZVA 4PJ7A 3AM8C 1A6UL 4OFVA 2VWEE 3P4NB 4M6MH 1EEUA 2IANB 3VXQA 3GMRB 1SBSL 3QXTA 4XBGA 2DL2A 5CINH 4JVUA 1MCWM 4DN4L 1J8KA 5GGQL 5KZCD 4KMTL 1GPOL 1OWWA 1QP1A 3NN8B 3FQNA 3M1BB 2DB8A 1ZS8A 3AMLA 3WDIA 2EXYC 3WDHA 4XPTL 3P77B 2AJSL 3HAEA 5FUZL 3TT1H 3MRGA 4NZUH 2R1WA 1WWCA 3VDCA 3TH2T 1H15B 1B0GA 3LV3A 1NSNL 1RJCA 4PJHA 5C9KA 4HFUH 4XXCA 4P2QE 5ICZB 4AJ0A 3BOVA 3OG6B 1DVFB 4UNUA 3K8KA 3BQUB 1ACZA 4X83A 2NY7L 3RAJL 3G5VA 3PWVB 3STBA 5LGHH 4GRMB 2Y36L 5IMKB 3RHWK 3RVWD 3WFHA 1I1AB 4F80A 3FO1B 4NUJB 1NKOA 3EFFB 1WBXA 2D7OA 3Q0HA 4J12A 2W60B 2CIKA 3QT2A 2C3GA 3RWCB 4ODVL 5LWYL 2F8OA 3IVKB 2R29H 4HS3A 1LVEA 4P2OC 2X5PA 3TZVB 4F3FA 2AJVL 2VDPH 2GEEA 4YDIH 4YEFA 5KVEL 2BVOB 1MVUA 2PYFA 1N2RA 3H9SE 2AW2A 2P7TB 5FM5O 3QO0A 3QUYC 3CFCL 4PY7B 1J0HA 2D0FA 2IFFH 4HLJA 4JM4H 5EN2A 3TC9A 3IJYA 3ARRA 2VL5A 1SEQL 1SQ2N 4NGHL 4ZS7H 4HUMB 5LBSH 1QA9A 1KCSH 4YNYB 2ZUXA 3MROA 4F37F 5A43C 2CR6A 5EU5A 4JKKA 3KXFA 4G6MH 3EDFA 4P4RA 2PYEE 5EO1B 4PJ9C 3HE7A 3U4AA 5I1IH 3RJQB 1K8DA 2G5BA 4Y2DD 5GSRA 1LO2H 3L3GB 5C7XL 3WXVL 3ULVF 5HDQH 2EZ0C 1DBKL 3CC5A 4BZ1L 4WHDA 3STZA 1KNOB 4HBCL 4F15B 5C0CA 3AS2A 3NPSC 3NA9H 5T1MB 2XN9A 1T5XB 3UJJH 3RWIB 5IWLA 1S3KL 3ARXA 2CJUH 2R23A 4AG4L 4U1IA 1V5JA 2WK2A 4OTXH 2FIRT 4R26L 4NNXA 5D9SB 4HPOL 4OCYH 1W0WB 5C0BB 1KN4H 4R90L 5JXAH 5DZLA 3Q6FB 3TBVB 4YK4C 3WFEL 3GK8L 4Z7UF 1MI5B 2OP4L 4BH8A 4KUZH 4AL8H 4WWKB 1KELH 5ANME 2LVEA 2R39A 5F89B 3VXSD 5A2IH 2VN4A 4CU7A 2ZSWA 3V6BR 3C08L 5I1KL 5E8PB 3ARUA 1X4XA 2D0GA 4P9HH 5K59E 3CUPA 4UT6H 5J6GB 3WUWG 1F11A 1HXYB 1NAMH 3CDGB 5FM8A 4LHJB 3GSRB 3D39A 4AENA 1PG7L 4ZFOA 4HXAL 5ISZB 2PW2B 2HJLA 4FFZL 4OGZA 3U4EA 3O81A 2MPAL 3T77A 4PRHB 3ZE0E 1B6UA 4ODUA 3T65B 1BZ7A 1LP9B 2X70A 5IJVB 2BNQB 4RA0C 5ACLA 4NDMA 3EDJA 1F58H 2F54E 3S3PA 5FAAA 3BP7A 4TSCH 4XWGL 1T66C 1P1ZB 2C1PB 3T04D 2AJ3B 2EECA 4DQOH 1MLCA 5DYOA 3MXVH 4M62L 1YY9D 3D25B 5IT2L 4M4RA 3KGRA 3VG0H 1LMKA 4YHPB 4QNPF 1MOEA 3SDYH 4I0PC 1RFDL 3BH8A 1ZHBA 4P23D 2BRQA 4PGCA 3U0PA 2X4UA 3C09C 1JNHB 1XMWA 2IC2A 4P5KA 2YK1H 1KLFA 1OGTB 1EHLH 4RZCA 2A9NL 1PG7W 1DANT 1NGYA 4IJ3C 5ECJE 2VAAA 5GRXG 4TSAL 1JZ5A 4HT1L 4E5XA 3RIFF 1SMOA 1FGNH 2EO9A 3H42H 5DK0B 5LKNA 4BQ9A 1NC4B 4KRLB 1BVLB 3KPTA 4M7LL 5JXEA 3V6FB 1KJVB 4Y19B 3NGBB 2B1HL 3IDMB 3RBGA 4HWZB 3O9WA 2P48B 4X5XA 3VXPA 2B2XH 5C09E 1GZQB 1HKLH 1NGQL 1S5HB 3TA3B 3LEVH 2XOTA 4TRPH 3WUZA 4MA1C 4ZUTB 1SHMA 2YSSA 1T0MA 5EZLA 4JQIH 3OMZA 4Y16A 2NXZB 5DURD 2GSGA 3WMSA 4QRSA 2PNDA 2GKIA 3MFFB 2NY0B 2FNBA 3MYJB 3SGEH 5KSAA 1DBJL 1FFQA 1MCFA 1WTGT 1KB5L 2ZPKH 1T20B 3QEUB 4F7TA 1J1OH 4JY4B 4LCCC 1QEWA 1INDH 3UTZA 4F2MA 4ZXBB 1IQWH 3WJLC 3DX7B 4Z7VA 1UJTA 1J10A 5IVNA 1TPXC 1FV1B 1T5WA 3JWOH 1X44A 3V6ZA 3CFJA 1FSKC 4QXTA 1JYWA 2XWJB 3VH8G 3VGDA 4M3JA 5IEKA 2Z91B 3S37L 1MHEB 2HT2C 1WCBB 5DVLA 3I6LE 1S78C 1FC1A 3C60D 4KQ4H 3VCLB 1KIPB 1K6QL 5KS9B 2O61B 1EEZA 3LB6C 3OB0K 5ETUA 5GRJL 2P45B 3W39B 4FQHA 4JQXC 3FQWB 4YO0B 2VXSL 5EC1A 3B9KB 2AJUL 2V2WB 4FQJH 4JE4B 4P2RB 3ZE1E 4M9OA 1WLHA 2YD1A 1W8NA 4OCWH 3F58H 1J0YA 1N0XH 3LDBC 3U7YH 4BKLB 1K4CB 1CI5A 2PR4L 3S9DB 1S7UB 1NDGA 5F9JB 2J8UE 4Y2DC 5BS0E 3FL7A 4LARH 5J3HD 1G7PA 1PYWA 5IG7B 4OZIB 4ODHH 5IBUG 3IT8D 5DSCB 1DR9A 5GS2D 5TE7L 3IJSA 3TN0A 1DCLA 1KIRA 2A9MH 1U95B 1DN2A 1CFVL 2NLJA 1INEH 1E28B 4KVNH 3ZT6A 3RU8H 2F53E 3PQYA 2BVTA 5L2KB 5L2JA 1G7MA 4N0RA 1EFQA 4X7TA 1QLFA 2OR7A 3I75B 3QCVH 3K46A 4Z7QF 1J12A 1NGZB 4UUJA 4LK4A 3QDAA 4P5TD 3C8DA 3QI9A 4F7MA 3MV9E 2WNGA 2YPKB 4NRYA 4XVJL 2P5EE 3O6FB 1TZIA 5EU6E 3T3PE 1MCEA 3ZHLA 4WDIB 3QUZC 1AHWB 3AXLB 1F2QA 2ZCHL 1LEIA 2H2PD 4GOSA 4RGND 4JRXE 3K2UL 2ZCKH 1JF5A 2R1YB 3FO0L 1OSZB 5HHOB 5HHXH 1S9VB 4OLUL 3QJFB 4PJ5D 3V5DA 3MRHB 4HMDA 1FVDA 1U6AH 2A74A 3GHBL 1KJ2L 2Z0BA 3C5SA 5FO7A 2F15A 2HJKB 3D0LB 5E6ZA 4DKFH 3ULVD 4W6YB 1AIFB 2XRAL 1HXMA 3PGDA 4HJJL 5AD0B 2I9TA 1CZ8L 1Q9OB 2CD0A 1JZ3A 2O5XH 5F7YC 4PPTA 4X9GA 3G08A 1GGIH 2EDQA 3MRBB 4XC3H 5GGSB 3BHBA 5T1KA 1YY9C 2OM5A 4L8SB 5KOMC 4IMKA 4JN1L 1AXSA 3QWOB 4B7IA 4UDUB 5HYJB 5EA0H 4P2CG 3TH3T 3MQIA 4CJ0A 4XVSH 2YD4A 2P5WB 3N85H 1I9EA 3O41B 4UU9B 3D87B 3TBWB 1KB9K 5T3XL 1RJYA 2WLYA 4P59L 5CJ8A 2G60H 1P2CB 3BDYH 5D70H 4UIMB 2IGFL 3L3KA 1F2XK 3KYNB 4N8VB 1LK3L 2APTA 5HHVH 3I50H 1A7NL 4K23L 4GBXD 1AXTH 3TO4A 4PR5A 5EORL 2AP2A 2QQQA 2O26U 1R5VA 4XC1H 3O45A 3U0WL 3CZFB 2XG5A 3ULUH 3VE0B 5CP7B 2V17H 4JM2F 1IGYA 5GRUH 4WFHE 3X11A 1UJ3C 4XX1E 1BJ1H 3GDBA 2R2EA 3BGMB 2NY3D 3DVNB 5AUMA 3MODH 5ID1B 4I18C 1S9KC 2OL3B 3OKKA 4WFGD 3FFCE 1KBGL 5AG8A 1WICA 1ZV5A 2DQGL 5DO2D 5EWIH 5D1XA 1QBBA 1EAJA 1V7ML 3V5HB 5CGYD 5HJ3A 3DSFH 3CPLA 43C9B 3MCKA 5HYSB 2FIKB 4LEOB 4G3YH 4WW2C 1RURH 3GSOA 3QUMH 4EZMA 4BA8A 3MR9B 1R5IB 4TPRH 4V1DB 1V7NL 3JBG7 4TTGA 4RQQA 1T89A 2FGWH 4U1KB 1D7FA 4JO4L 4AH2B 2IPTL 4DK6A 1JYNA 1GHFL 4LKXB 2DQIL 2FO1A 1DLHB 3H9HB 5J12C 5D2NA 1AKJD 4D3CL 5TFSL 3JZ7A 1ZLUK 5DVKA 1RZFH 3WL9B 3K8MA 4PJ7F 1HSAB 3MV11 5JOPD 1QD0A 1MF2H 1FYTB 1FAIL 3EYSH 5CSZA 4OUUA 3IJHA 4KRPD 4HC1L 1CLZH 1QR1B 4XCCH 3VJ6A 5BVJA 4Y4HA 2EH7L 5FF6B 4D9RD 3IU4H 4GG6B 5I1JH 4CNIB 4ZS6C 2AEPH 2VXVH 2FWOA 5CP3A 1JE6A 2YD6A 2J4WH 2DLTA 3SDDB 2EDOA 2D03H 4JANB 3TM6A 1E6JH 1RIVH 3V0VB 3GI8H 2FX7L 4F57H 1F3RB 2LTQB 3SCMD 1D5BA 4LIQH 4DZ8B 1R24B 2V2TB 5DQDL 1E27A 5IGXH 1I9JL 4QRTA 1CK0L 3JTTB 1F6AB 1NEZA 2JCCE 5CIPH 1UACH 2ESVA 5HDBE 5CZVH 1S8DA 4JFXA 1T2QH 2FEEL 1DUYA 5DEFB 4TQEL 3QEGH 4I2XE 5DA0B 5EIIA 3WDJA 1AE6H 1YQVH 2CDEA 1WBZB 3HAEG 1BBJB 2DQJH 1FVEB 4PP1C 3CVHH 4BZ2H 4NQSB 1JL8A 1ZHKB 4PRPB 4Z8FH 2ENSA 5HHPA 1PZUB 4RWYL 3IRZA 3VFSB 2Y5TB 5HHNA 4OD3L 1YECH 3CMGA 1JF1B 2APWA 4IRJC 4YUEL 3HZMB 3QHZH 4FTVE 1EX0A 1MVFA 5AWNL 4X8JB 4M93B 3QFJE 5IOPA 3RI5F 3NFPA 2VDQL 3L6FB 1U91B 4LRIC 3RVXC 4NQVB 4YGVB 1NJ9B 1CICD 4CN4A 2BSTB 3L3OB 1L7TH 3MRPA 1J0JA 5IF0B 1NFDB 3WKNA 3ULVC 2PXYA 3OKDB 4XCEA 1QSEB 4HIEA 3W9DB 2RFXB 3GMQA 1SYVA 4APQB 5JNYA 4JRYE 1MQ8A 3H3PH 2RJMA 3QZWA 5B21A 4FFWD 2LVCA 4L9LC 3QG7L 4HGKC 4KUCF 4WTZA 1AGFA 1MCDA 4OF6A 2L4OA 2VXQH 1J8HA 4ZUSA 4DUVA 2X10A 1FL6B 1TQBC 1CDJA 3O4LD 4X7SH 5ESAA 4P48A 3ZTJH 3T0EA 4XPGH 3DO7B 2OL3H 2EYTA 5ICXA 4XNMA 5I1GH 1SYSA 2IANE 1W8OA 3VWJA 3SDAD 2BNUA 1NCTA 3T2NL 3TVMD 3QDMD 5BW7C 1UB5B 1DJSA 2J88H 3QULB 4QF1A 4NQUA 4NCC1 5K9KA 2IADA 4LQ1A 1YEDA 4OLVL 5DJXA 2HMID 2BNRA 3WLBB 4KY1L 3LZFL 3LKQA 5T3ZD 3ISWA 5EOCJ 4JR9H 1CG9A 4YBLB 1KJMB 1MFEH 3SGKC 2X41A 3PWLB 3B2UC 2XZQH 4NN5B 5F7UA 4PJCA 4R2GD 1DQJA 3SDCB 1B0RA 1U3HA 5DO2C 4IIQC 4N0YL 3AU1B 5KVFL 5T5NF 5KSVB 5IK3B 2Z8VC 4RMTA 5CGYC 5IB1A 1FPTL 4DZBA 5IB4B 1P4IH 3JTSB 1IAMA 4OD1L 1NCNA 4OD2B 2VN7A 3O3EB 5FHBH 3VXOB 4MGXA 3RVUC 3QNYB 1ZLUH 3A6CH 2VITA 4RGMB 3VXMD 4L8CA 4LSSL 1R3IL 1JZ6A 3VGAC 5C0GB 1NGXA 2ORBH 1VFBB 5DWUH 2WZPD 4YDKL 5E4EC 3GSXB 4NKMB 1N3NA 2C3VB 4UT7H 2BX5A 2EEAA 4PGBB 5DRNB 4D8PA 1KN2H 2ADIA 3CFEB 5EU3B 3CMOH 2EDFA 1TVBB 5IQ7H 5C0AB 5T5NG 2X4PB 1ZLSH 5JMOC 4QHKJ 2BVQB 4WFED 3WIIL 5F7HA 5FGRA 4KRPC 1DQTA 3DX8B 1RUAL 1WGOA 3FQTB 3IDGB 1H3VA 5HVHC 4JM2D 5F3BA 1U36A 5E94A 3I6GB 1YEHL 1EERB 4WI6A 3S36L 2IBGA 5IROC 1YY8A 1Q0XH 2QSTA 1XIWD 1AI1H 3MRFA 2UWEB 3TBYB 1CFSB 1D9KA 1T80A 2AEIT 2AQ1A 2GJZB 3CSPA 4HPYL 4KHXH 1QLRA 4W68A 4LGPB 1FZKB 3D2UA 5GS0H 2KPNA 1CDBA 4C56B 2HLFC 4JFDA 4C83B 1G9MH 5I1AA 1DLFL 3HG1A 1NCAH 4JZJA 5K9OB 2V6HA 4PTTA 3VFMA 5LQBL 3DETD 2R0LL 2Q8AH 4X6EB 3DXAA 3QUYB 4G8IA 2VE6B 1UVQB 2CMRL 4MCYB 2KZ1B 1U8OB 1FORH 3R0MA 2XKNB 4UDTB 1RJLA 5MEOB 5C0BE 4H5SA 3MOAH 5J13B 3LQMA 3MGOA 1CLOL 2ZNWA 3BFOA 3N1GC 4D0CB 4QLRA 1FZMB 4Z7VF 4KRNA 1MI5E 1I8LA 43CAA 4RX4D 3PV7A 1E4JA 4X7FC 3OV6A 1DEEB 3QNZB 2HH0L 3MSPA 3TIEB 4NQCB 5B8CC 4XTRD 1N6QH 2ITDB 1DEDA 1TTUA 1PY4A 3F7QA 4N68A 5DJZB 1JGEB 1FE8L 3ZE2E 3QEQD 2B8OT 4XMKH 5ISZE 4WCYL 1T83A 3VFOB 3RNKB 3IXAA 4LSQH 4PRHE 5KVMC 3B6SB 5BXFA 5M94B 1LP9E 5E8EA 3CLEL 2BNQE 4WJ5A 1INQA 1GOHA 4JKMA 5E8NB 1LEGB 1F8TL 1QVOB 4HIIA 5ESQB 3MUJA 1BFOB 1L4IA 3MCLL 1HHKB 1DQQB 5DJ0B 1U8HB 3P30H 4DKDC 1XF5A 4ZTOL 4YK4B 3B2VL 3VI3F 3TBTA 4TNWK 2D7PA 4FQQA 3UTSA 3V4UH 4KK8C 4BELD 3L3HA 5IHUL 1NBVL 4KJPC 4OZHA 4EDXA 4LNRA 4AQ1B 3C87A 1RSFA 3ES6A 3TVMC 3BP6B 4Y88A 1KYOJ 4HULB 4M7JL 4K9EL 4LPYA 3KJ6L 5CHNA 3MOBH 4H8WC 2RAMA 5BJTA 3BYYA 1MNUL 3FTGB 4G5ZL 4PLOB 3KPPA 1XR8B 5CEZD 1NLBL 2BC4A 5HTSA 5FO9B 2AXGB 2E6JA 3O0RL 1HZHL 3EOYG 4LLQA 1O7SA 1EVUA 3GSQA 4MD5A 4Y19E 3OBAA 3RVVD 5FKAB 1AR2A 1AR1C 5D7JC 3KXFD 3VU2A 5EZIH 2V7HA 3W11C 3CAFA 1NC2A 1JWMA 1G1CA 4Q0XL 4DEPC 4YPJA 1DBBH 3HE7D 3I6KB 1RK1B 1NANH 4U6TA 2Q7NA 1KC5H 4XCYA 3KJ4C 1N59B 3MLWH 2BZDA 3B5TA 4I0PB 3LS4H 3X3FH 1TENA 3KG5A 2ADFL 5E6ID 3C09B 5JW5B 2E8ZA 3ILQD 3IF1A 5C0CD 1AGDB 3BWAA 1PLGH 4WHYG 3DMMC 2H2SC 3RPIB 3SGJA 3T8XA 2XN9D 3LN5B 4EUPB 2C3XA 2UV3A 1T0NA 2DD8L 1H3GA 1ZT1B 4YXHH 4M48L 2DWEB 1R3KA 2W65A 4M9PA 4CDHA 4TUKL 3U7AA 4G8EA 1IARB 4KAQH 4M7LT 4DUWA 3HC0A 4R3SA 2JELL 3LSOA 1I7TA 1SJHA 1A9BA 4LSUH 3VFRA 5C0JA 1BZQK 4EN3C 3OKLA 3BKCL 3IFOA 4UT9H 2VIRB 5KS9E 4ONHA 3HCVB 1UEYA 3DURB 3IGAA 2XTLA 1EXUA 4RMRA 5A2KH 4JM2C 5L88H 4ZSOA 3JWDL 2HFTA 4M61A 4P2RE 4MA1B 2VDOL 1KLUA 5AZ2H 3FT3A 1T03H 3FRUB 4UV7H 4GW5B 4GRWB 3V4VH 4HZLA 2WUBL 3EGSB 1YEIL 1JGLH 1UXWA 1XIWC 3LEYL 3S4SB 3E6FB 4Q2ZB 2VDRL 1FRGL 5HYQA 5JW3L 3P11L 5IUSA 5EBMA 4HG4K 2VR5A 4OZIE 3D39D 2OI9C 4D0BB 2ZOLB 5IHZB 4LDOB 1EFXB 2P8PA 3CDFA 1VFOA 2B7DT 3P0YL 1T22A 1IGJB 1SY6H 1M7DA 1VENA 5DQJA 4F9LA 1N6UA 3WXWL 2JK5A 1LO5A 1JHLL 1A64A 4OF8A 1A1MA 5MENB 5DTFA 5HGGS 2BSSB 3ROLA 4Z78A 5FYKH 4YFLI 1RZ8B 4FHBD 4U1SB 5JPNA 3S96B 1CD9B 4CMMB 3JUYA 3MXWH 5LJYH 3BMVA 4ZYKA 2X4TA 1I1FA 4LIQE 4NQEB 3JV4A 1Q9WB 2DQFB 4Y7MA 3NCJH 3RZCD 4PTUB 1JHTB 4WWID 3TJHD 1HQRA 5FDYA 5J1AB 3LDBB 2ILLA 4WUUB 5FGCB 2ARJQ 1M4KA 1T21A 1C5BL 2L7UA 2OS7A 3FRPG 4KKLD 1CD8A 2HTKD 4JREB 5E1HB 3QDJB 3UCRA 3CLFL 5J9PA 3UTTA 4LAQL 1M05A 3DV6B 3T0DA 4OZFA 2X7LA 5IESL 3F65A 5HHOE 4FQ2H 4YHOH 5D2LB 4BFIA 4IOFD 3C8KA 4R0LA 1RUPL 2R9HD 5ITFB 1BBDH 3GSNL 4GAYA 4V2CB 5ABDE 3G9VA 1RVFL 1Y6NR 2VXUH 4PB9H 3RUGA 5MEQA 1CFNB 4UTBH 2YRLA 2EKSB 4XXCC 1KGCE 1FNSH 1RULL 2R2HA 3LH2H 5JXED 4X6DB 3KPOB 1J05B 3UXFA 4JO2H 5SX5K 5EU7C 3O9WD 4WFFD 2WSKA 2HWZH 1KPUB 4NZTL 4U6HB 4PUBH 1IQDB 2JIXA 4WEMB 3CFBB 5C08B 1KB5A 3ZT5A 4QHMA 3LD8C 2WUCL 4ELKA 4Y16D 3Q5YA 1OP5K 1MJ7L 4R4FL 3DTXA 5HYJE 1T1ZB 3CXHJ 5KSAD 2K7QA 2P5WE 3QUZB 4Z7WE 4DTGL 3ILPA 4WU5B 12E8H 2LV4A 2R2BA 3KS0H 5DRZB 4EKXA 4YE4H 3PGCB 2DM2A 4JM4L 4IM8A 4JFPA 1QO3A 3SDXA 4MNQB 3T2OA 2NY1B 4ZS7L 2I07B 1U8QB 4UIKH 5IP4A 4ISVB 4G6ML 3CH8A 3LHPH 5EU4A 2HAZA 1IAKA 3UDWA 4GKNA 4L4VA 1NEZG 1G6RB 5I19L 5ALCH 3QDGA 3T0AA 4XPAH 1LDPH 2C1OA 2ATPA 4KJWD 1KPRB 2A6IA 4J23A 4EUPH 1TCRA 1HYSD 1JNJA 1MCWW 3VXUA 3MLPA 1ZVSA 5DI8B 3BGFC 1I1YB 2VABB 3GSWB 3U9UB 4XPBH 4C4KT 3FB6B 3KLAB 3QJHA 5F7EH 4L29A 4Z95H 2VQUA 3UJJL 1ZLVK 1XGRB 4O2CA 4HGWA 3EOTH 1NFIB 5D5MA 5FO8B 1KENH 1JPFA 2MHAA 4V1DE 2VDMH 3BIAX 3ILQC 1TZHB 1EAPB 4YC2C 4OCYL 3TO2A 2HTLC 3D5OF 3JV6B 4F7PB 4GRWH 3IS1X 5DZNA 4QRPB 3ZKXC 1OY3B 1QRNA 3BRDA 2HLAB 5HHMB 4NWTH 4AL8L 1SEBB 3PQYD 4Q6IC 1QYGH 4JQVA 1PY9A 4K3EH 2WWMD 1KELL 3GKWL 4L8DB 4X6CA 5I76B 4LCWA 1OHQA 4YHYC 3BXNB 5JIIA 4Y8AA 4P9HL 5E03A 2BFVL 4NKDA 3A6OA 3QUKB 1AP2B 1NAML 3ZHDA 5I8CB 4A6YB 1MCRA 1Q72H 1DN0B 5I0DA 2DF3A 1AY1H 2R15A 1YJDC 4GG6E 2CQVA 4KTEH 1MRFH 4H1LB 4N0CC 3QNXA 3C9NB 2YUVA 1BEYL 5GSVA 1KJ2A 2X1XR 1HILB 1ETZA 4QY8A 4WTZG 4KC3B 2IH3B 3HI1A 2ATKA 3NABH 3SOBH 2YPLB 5T3ZE 3BZ4A 4NO2B 5T1DH 3SE9H 4WO4A 4M7KL 4N0FB 3I2CH 1A1OB 4DQOL 4ZO8A 3MXVL 5FUCC 2GHWB 4M5ZH 5J12B 3UPCA 1NQBA 3VG0L 5CUSH 4U0RB 5JDJA 5FYLD 25C8H 4NSKB 4UBDC 3QB7C 4Z9KB 3BZFB 1FL5B 5DFVC 5ADPL 1EUTA 3AMKA 3PNWA 2R4SH 1IGTA 2IAMB 1FG9C 5T1KD 3SKJH 4Y1AA 2YK1L 4PRPE 1EGJH 1GVIA 3EYOA 3QA3B 4OLWH 4CMHC 2NY2D 3WKMH 4J3UA 3V0WL 3HZYB 2VLLB 2DOCA 1B4JL 5LGJB 2HTKC 2MWCA 5DMKB 1MRDH 3NZHH 4UINH 3Q5OA 3TYFB 4DAGH 5E56A 5SX5H 1MH5B 1QFUL 1UM5L 1J88A 3VGGA 4NC1C 1D3CA 2HFEB 1H0DA 1HSBB 4HWBH 4QHUB 1E0OB 2D7TH 3TO4D 5F1SA 3QH3B 2R9HC 2B2XL 3O8XB 3IS0X 4JPKH 4Z5RB 2UYLB 4TRPL 3QRGL 3BKMH 4WI9A 4JQIL 1OP5H 1NFDE 1RJZA 4HFWA 5JXEC 4G8GB 2QJDA 5B3JF 2R0KH 1KIQB 1QSEE 3RWEA 4XVUD 4OKVA 1TDQA 4Y4FB 5D1XD 1UH3A 1EHXA 1AD0B 1J1OL 4NN7B 1TNNA 4Y16C 3ECBA 1IZJA 1IQWL 1FFNA 2H32B 4Z0XB 4KTYA 4J4PD 3CX5K 2QHLA 1MCKA 5KSAC 3BPOC 3OHXB 1G6RH 2R1XA 5DRWB 3VDAA 4IRJB 4I5BA 4NM8L 4HV8A 1LO0H 5HI4C 5DMIH 4ODTL 5F3HB 4MNHB 2QSCH 4N0UA 4HC1A 4MX7B 3PF2A 5DD1L 2EE3A 3SO5A 5DK3A 2NW2A 1H9VA 1RUQL 1KEMH 2H8PB 3HMWL 1N0XL 3LVEA 3U7YL 4QKXB 3PJSA 1JTTA 5FDWB 3OXSA 1FZJA 3SJVB 3TNMA 3VXNB 1P7QB 4LQFL 2R0ZL 3W9EB 2CRZA 5IFHL 1KCRH 5J8OA 4Y4HD 4S1QH 4LARL 5GS1B 5SV3A 3RKPA 5I1DB 2YRZA 4XNXH 4L3AA 1HYSC 4HD9A 4KGLA 3S34L 3EIFA 4P4KC 5FEBA 2PTTB 2H6PA 2BJML 3WUWB 3PWPB 1Y18B 2B5IC 1Z3GL 1XR9A 5KAQF 1SVCP 3NFNB 1YYML 1TQBB 3C5ZC 5K33A 1NCWL 4NKIH 5I71B 5E00B 4Z77B 2NXYD 5CILH 4HEME 4KZEH 3MRJA 3TN0C 4GKZB 4O58L 5ENWA 4P2QA 1G7LA 5EBLA 4FQXA 5TQ0H 1N7ML 4Z7UB 3GIVA 3TYGH 1CFTB 1W0VA 2ESVD 1A3QA 5GRVL 3REWA 4X9IA 4U05A 2FO4A 2C4FT 1EHNA 5IBLD 3D3VB 4GS7B 2VQTA 1QQDA 4POZD 2EDKA 5C0AE 4YPGA 4LBEA 3RWHA 4WY7H 4ZPTA 2EC9U 1HHIB 4NQDB 3HNTH 5KAQG 1YMMB 5GGTH 1XGPA 1VKXA 4WHTB 2ZCKL 4OZHF 1PD6A 4XP5H 3QI9C 4YHIA 4X6BB 1LNUA 3W0WE 5HHXL 4NO3B 2FYYB 4I4WB 3BRFA 1S7XA 5GGRB 4PB0L 2PO6C 1U6AL 4XRCB 1EJOL 4ORZC 5DHVB 1A2YA 2PF6A 2BY3A 4FFVD 5I1EL 4OZ4B 1OF2A 3H9SA 1U8MB 1XGQA 4U3HA 5AZEH 2CIIA 3EDKA 4JPWH 4DKFL 4KJYB 1S7SB 2COQA 4G80A 1Y0LA 3HZKA 3IDXH 2R69L 3K1DA 4HUUA 5IIEA 3QUXC 5F7MC 3VGAB 1BQHA 3ARFB 3BEVB 3MMEA 3UBXA 1IKNA 1FO0B 2EC9T 4MVBD 1I3UA 3BEWA 1GGIL 4C56E 3F8UB 5IQ9A 2X4OA 2FJFB 2PXYD 2AABL 4Y5YB 4J6RH 1L7IH 3NH7H 1A6TA 1JK8A 4WI8A 3D1MC 2PYEA 4OAWB 3N85L 5CBEB 3RL2B 3VRJB 3X13B 4FS0A 4RRPG 3MREB 1MJ8H 5C0RL 5GS2H 4HHAB 3TNNB 4PRAA 2PCPB 3T1FB 1J8HD 1FNLA 5I8OH 3PHQA 2NY2C 4LGRB 1OCWL 3BPNB 4S1SH 1HIMH 3T0ED 1RHFA 3UJTL 5T5FH 5DFTA 2O5ZL 3P2TA 3VWJD 4DW2L 5E08L 4LHUA 1CGUA 2JF1A 1I1CA 5D96C 1MRCH 1IEBA 3JV0A 2DM7A 3QXDB 3RVTC 3K3QA 5D93C 4ZTPL 1YDPB 2CLZB 3VH8B 4NQCE 4JPIB 1FG2A 2CSPA 3BP5B 2BNRD 4UAOC 4FXKA 1WT5C 4IDLA 4WI3A 5EWIL 1KYOK 1XGYH 3P4OA 5DMGD 1FJ1A 4P46A 3RA7H 3UYRH 1FH5H 5IKCA 4JLRA 5ANMA 1X5YA 1U8NB 5IBTL 3LY6A 5C0DA 4O9HL 3LRSB 4RNRB 5D1ZB 4PIRF 2DQHL 1U3HD 3V4PL 5GIRA 1S7WB 2ED8A 3BO8B 3O3BA 1ND0B 1NCUA 2FGWL 4EXKA 4DWHA 1NPUA 4FQCH 1I7RB 5F9AC 3MJ9H 5IBUB 1RUML 3O11B 3BJ91 3ULVH 5TE4H 3RHWF 1FCCA 3MRIA 3ARDA 5BZWB 1A6AB 1JUFB 1A3LL 3IDNB 4HZAA 1T89C 2QV2A 4ONOA 1MIEH 1S7VA 2NCMA 1N64L 2F54A 1MAJA 1JGDA 4B41A 5LXGH 3QIWC 1MUJB 2Z35B 2EEDA 3K7UA 2ITCB 2A6DA 1CLZL 5D2NC 1WIPA 3OGCB 5HYEA 4ORGB 4KDTA 1UWGL 3DIFB 4CDGC 3H3BC 3CSYA 2YC1B 2G2RB 2UUDK 4PYGA 1A6ZB 5TDPB 3JVGC 3FQRA 4X4XB 3KLHC 5I0ZA 4MSWB 4HS6A 2D03L 3PUCA 4NKOB 1V3MA 5C2BH 1RIVL 3ZKSD 4HH9A 1IJ9A 3GI8L 3WIFB 4F57L 1BZ9A 2GY5A 1ZT7A 3F12A 5C0NC 4LIQL 4JZOA 5TPWL 5TDOB 3EZJB 2FD6L 3FCTB 3UPRA 4IRZH 5IGXL 5CBAA 1U8PB 1JGUH 3RUGF 4AEEA 3EJZD 1UACL 2DWDA 4PBVC 5CZVL 5FFLA 1BVKB 2H3NA 4NP4L 2NXYC 2ZG1A 5FV1L 4PV9B 3QEGL 3D2UD 1FN4A 4TUOA 1YQVL 1F4WL 5HGDB 3GB7B 3PDOA 1J18A 5KW9L 4ZPVB 3OZ9H 2XZAL 1II4E 4K7PH 4S1DD 5GISH 5JW4M 2I27N 4BSVA 5C09A 5J6HB 2ED9A 4IMLA 2IF7A 4M6OH 3TWCH 4ZFZA 5ID0B 1BPVA 5IBLC 3WFDH 1LK2A 4BH7B 2LE9A 2VYRE 3WYRA 4S11A 3DXAD 1YECL 4F9PC 2NY5C 1HHJB 4YBQD 1FLTX 1OW0A 2XWTB 3T08A 3KPQB 2KH2B 1CDCA 2D31A 4LU5L 2VRAA 1WZKA 3LPFA 4G6AC 1CE1L 5L8JB 3EO1A 4QHNA 3O3DB 5D7JB 4U1HA 1ZT4B 1DP0A 4GRLA 1TJIH 3CFKA 4EVNA 3WCYA 3WHXA 4G42A 3VW3L 5C6TH 5JPMA 1GOGA 4NT6B 2CDFA 4MJIA 4GRWE 4ERSH 1XCTA 2NMSA 2EDXA 3QP3A 1OTTC 4X7CC 2DQUL 3FOLA 4U6VL 3VFPB 2K3TA 2EDEA 5CWSA 4PJ8B 1SMAA 2DICA 1PBYA 3BISA 5FKPA 4MVBC 3H3PL 3ARBB 3IU3A 3TV3L 4YR6B 1R0AH 1LO3H 1AQDB 2PXYC 3ULSA 3DMMB 1YN7B 2VXQL 3UJIL 2Z31C 3LQZA 4X4YB 2FJGA 2E7MA 1IT9H 4XNZC 3KYMA 3WHE1 5I16A 2J8UA 3L5XH 3QYCA 5BS0A 4F58L 3KDMA 2OL3L 5MENE 1X5AA 5H2BA 5D5MF 2OK0H 4J2XA 2F8XC 4EN3B 5L9DL 3HPJB 1T3FA 3KPRD 4KTDL 1CU4L 1I4FB 3KWWA 3OKYA 3LKSB 4KK5C 1TVHA 2GUOA 1YMHA 3GIZH 4L8BA 3QPXL 3CXDL 3T0EC 5EUOF 5GRZA 3ZLQC 1GGCH 4M1DL 3BX7C 1TLKA 4WUUE 3VWJC 4HUXB 5CS7A 5FGCE 2F53A 4X6CF 3TP4A 2DLFH 3G9AB 3H9YA 3VXTB 2H45A 4OBSA 3D85B 2JJVA 1BFVH 1U93B 4WW1B 3V7AG 5D2LE 1KUMA 4MXVE 5DUBB 4QRUA 3MV9A 2P5EA 5SWSD 5EU6A 5CMAA 1P4IL 4NZJA 3MUGB 4U6XA 3RP1A 3DRTA 3F62A 4NOFA 3PV6B 3IFNH 3NAAH 4X6DE 5KVGH 2BDNH 2Y07L 5M7QA 3JV5A 4JRXA 4XPHH 1QNZH 1OAKL 1J11A 1DFBL 1KOAA 2YMXH 1Q0YH 2APXA 3LRGA 2AXHA 2BY0A 1F90H 1JWUB 3UC0H 4C55A 1NC2D 2DTMH 5DWUL 5BQ7A 5CEYA 5IVXA 3G5XA 3QQ3A 5C08E 1ZANL 2UZYB 4MJ6B 2A6KA 2NY6D 1MCPL 3HZVA 4PJ7B 4UT7L 2JJSA 1P6AB 3TPUB 3CMOL 1E4WH 1F00I 3RTQA 4HWEL 1FC2D 1RZIA 3OKMA 3CVIL 5T3ZL 4OZGB 1KCUH 1ZLSL 4PS4H 2GTWB 4YZFF 5F88A 1OLLA 4XP1L 4JAMB 2A38A 2QKIB 2EYSA 3LIZL 1P7HL 1ZS8B 5MERA 3EOAA 2FSEB 3BN9D 1A7OH 5IW6A 4MNQE 3MA9H 1VPOH 1T4KA 1UYWH 3QXWA 3MRGB 1AGBB 2R1WB 5E2WL 5TGBA 1EO7A 1PKQE 5E6YA 3WNKA 2VLME 5IFJA 5M95B 2DKUA 2NNAB 2ADJB 5FM4A 5JUEH 4AEIL 3K2MC 3ALWA 3NVQA 1K2DB 4KHXL 4AQOA 3G5VB 5LG1A 1NGWA 4TVSa 4Q9RH 4H8WH 4HJ0D 5F6HJ 3L5WA 4L1DA 7FABL 1G9ML 1SJEA 4XB8A 1QBML 3EJZC 1D9KC 3BD4A 2WWKO 4K94C 5K9JH 5CZKA 5GJTH 2BOCA 1G9NL 4ZD3H 5CD3A 3TIDA 3E8UH 4QXGL 4CVWA 3EBAA 1OAQL 5DJ6A 3FFCA 3D9AH 4JZJC 2XQBL 4LOUD 3MOAL 3IAQA 2UZXB 4PD4J 1JNNL 4OF5A 5IB2A 1M71A 2C7UA 5CGTA 4QRPE 4K2UL 5C0FB 3G5ZB 1YZZA 5CJXA 5HHME 2ZNXA 4OGXL 5ERWA 5D7KE 1ADQL 4WU7B 3DVGA 3OKEB 5H94A 1UB6A 1AGEA 3NIDF 1FIEA 5JO5A 2VL5B 5DVNA 1XZ0A 3UTQB 4U2ZA 3ALPA 1A3RH 1N6QL 5EU5B 4YHNB 1HINH 3MJ6A 1KTDB 2YEZA 5D1QA 2XZZA 1Q8MA 3GSNA 4JDVA 4FABH 5AYUH 2XIDA 2AGJL 5FHAL 5GSRB 2DIAA 4LSQL 1NGPH 1A7QH 2VH5H 3UTTD 1A6VH 1ZGLB 2P8MB 3VXRB 5IW1A 2CO7B 3MCG1 3WO3B 2YPLE 1AO7B 5T33H 3G5YA 5H35B 4OLYL 4YC2B 3O3AB 3IETA 1H5BB 1T83C 4TVPE 1DQLL 1BGXH 2VZSA 4N9GA 3U6RA 1T7WA 3FFDB 1OSPH 3OAZH 4HKJA 3O6LL 5FK9A 3ZKXB 5IEHB 5BVPL 4NNXB 1MPAL 4Q6IB 3SKMB 2ZP0T 4ONGH 2GAZA 3VI4E 4YHYB 3EO9L 4NZRH 3F7PC 3VD7A 3WIHL 1BIIA 3GMPA 3NACH 1JI2A 1ORSB 3BVNA 4LDLB 2C3HA 2XICA 6FABH 4JPVL 2EICA 1BLNA 3GJEA 2JCCA 2YUZA 2B1AH 4YHLH 4NYLB 4F7CB 3IKKA 1NBYB 3BUYA 3MRLB 1H3XA 2IG2H 2EO1A 3D18A 4FP8H 3ARYA 1R5WB 2HKHH 4TYUA 1BD2B