2PTVA

Structure of nk cell receptor ligand cd48
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
96
Chain Sequence
GSIPDINAYTGSNVTLKIHLGPYRRITWLHTQKILEYNYNSTKTIFESEFKGRVYLEENNGALHISNVRKEDKGTYYMRVLRETENELKITLEVFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CD48 antigen
publication title Structure of natural killer receptor 2B4 bound to CD48 reveals basis for heterophilic recognition in signaling lymphocyte activation molecule family.
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 96
sequence length 101
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ptvA00
2V2WB 3BZFA 2AJYH 2HFGH 3PWNA 1S7VB 4S2SA 1OY3B 1ACYH 1AE6L 4QTHA 1MFBL 2DM7A 1LE9A 2CUHA 5MENA 4LASH 2AJ3B 3ZKQD 4UDTA 4FQHA 5ISZA 5FCUH 2BFVL 1A7PH 1ZV5A 5HDQL 1DBML 2XV6B 2ORBL 1JHKH 1WZMA 3OG4B 3RP1A 2IALB 1INEH 4LLAA 1GSMA 4D94A 3CH1A 3GSOA 1AI1L 4WV1A 1IGIL 2ICWJ 5KOMC 3ZZ1A 4LPVA 3T08A 2BNQD 4IIQC 1HHIB 3ULVF 3RGVD 4PJCB 3PP3K 2YMXL 4UB0L 3O6KL 4WTZA 1ZLVH 1OW0A 3DVFA 4JM2B 5IHZA 4GRWB 4OLVH 2DBJA 3TYFB 4KVCL 4HZAA 1ZT4B 5ALBH 3D39E 1HHHB 1UVQB 5JIIA 5LGKA 4C56D 5GIRA 1KB9K 2MFNA 5DJ0B 4M7LT 1SEQH 3K81A 1RIUH 4KK5C 1F97A 3VW3L 1DUYB 2ITDA 4ZXBC 3JSSA 1NCWH 1HCVA 1AXSA 4GT7A 2HKHH 2APBA 4HUWB 3V5KA 4JPIB 5ESVB 1I1FB 3MXWL 3QAZC 4LSPH 5FB8A 1CGTA 4LVOC 5DSCB 3F58H 4NNXA 4AEHH 4IOIA 2EH7L 3K80A 3HPLB 2YEZA 1SY6H 4KK5D 4M8QA 4GSDL 4XPTL 1JYXA 3T3PE 2MPAH 3T0DA 4LCCA 2MNUA 4NN6B 1NGYB 3DO3A 1RJLB 2HN7A 3FOLA 4J1UA 4H8WH 1AP2A 1NGPH 4LHJB 4OM0L 5DQDL 3O3BA 5IW6A 2XTJE 3TN0A 5KVFL 5F1OB 5FGBA 5FK9B 4YR6B 4YDJB 2DLFL 3KPSE 2DYPD 2BDNH 3D39A 3ES6B 3Q2CA 4KUZH 4KJWC 3ZDYF 4AK1A 3N06B 4ALAH 3MJ8A 5JDSB 3BXNB 5D2LB 5IBTL 3V6ZA 2A2QT 3KXFA 3WDHA 4OFYD 2BY2A 4OF8A 4XCCL 5C09E 1IM9D 2NW3A 5FECA 4CNIA 2D0HA 3LVEA 4YO0A 4Q0XH 1HHKA 2FX7L 4JKPH 3C8DA 4OCXL 4OD3H 2WINA 5E8EB 4NQEE 3WL9A 1CK0H 1XGRB 2I07B 2Y07H 3MRQA 1XGYH 4Y5YC 5HDOA 4K3DL 4OQTH 4PY8J 2WUCL 4XP9L 2R1WB 2D7QA 3RZCD 1SHMA 4KI5C 5D1XC 4P4KD 1RZFL 2WIIB 2YD6A 5J1AB 1IQWH 1A3RL 2FD6H 4OCWH 1YPZB 2C1PB 1QOKA 3RWCA 3CLEH 3U36B 3ZDZE 1ZT7A 2ZCHL 3PL6A 3L1OL 4TSAL 3TBWA 5DDHB 5DF0A 1FLRL 3CZJA 2AJXL 1F4WH 2X70B 3LRHA 1T0NB 3O2DH 4KI5D 3UTTA 2F19H 4RA0C 2DTMH 5D1XD 1B4RA 3JWNC 5IEHB 1I7ZB 2NXYB 1NEZA 1WBZA 3MLWL 3GSVB 5DHXB 3ZKMD 4U0RB 4OCRL 3TWCH 5MHSE 3BKML 3V95A 1RK0B 1RMFL 4AYFA 2APWA 2NY3D 1FO0B 2FHFA 3NA9L 4K94H 1CFTB 4HCRA 4HWZB 1L9MA 1I85C 2XZQL 4CMMA 5F6HJ 4Z7NE 1LDPH 3BD5A 3OXSA 4NQEA 4QCIA 1DBKH 4P3CH 5JPMA 2ZG1A 5JIPA 5CGYD 5HHME 1SVZA 5BXFB 1OWRM 3DYMA 4GRLA 5I0DA 3S4SA 3TO2A 3O2WL 4Q6YA 3MBEB 1JGDB 4D9QE 2ATKB 3GSNH 4JG0H 2BP3A 5ESAB 4DAGL 2KZWA 2QQKH 4IMKA 2J7LA 5D1ZC 3KPLB 5DD1L 5EC1A 5FA3A 4K07A 1AHWB 1CN4A 4FFZL 5IBUB 4OZ4B 2OL3H 4PGBA 3STZB 2X1WL 4LASL 1MQKH 4OTXL 3WIHA 4LGPB 1FL6B 4LNRB 4PV8B 3KR3L 4PJXF 4DJMA 3MPCA 4KROB 5I8OL 4X5XA 3RPIB 1I1AC 5C0DA 1RQ5A 1ZHLB 1X5LA 3W81A 5ESQB 3RY6A 4RCAA 3LHPH 2BVPB 5TQ0L 4LIQE 4C59B 3LN9A 3ARTA 2NY6D 1W8OA 3OX8B 1EO7A 3WN5B 3ARUA 3MGOA 1HH6B 1UXWB 3B9KB 3IGAB 3WNLA 2A6KB 5M7QA 1KACB 2FR4A 1LO0L 1U8IA 2VZTA 2BXZA 1NQBA 2VDML 4NBYB 4OGYL 2EYRA 1R3IL 3IDXL 3AU1B 1UC6A 5IFAH 3IJSA 2DQGH 2AXFA 2A9NL 1GIGH 5TE4H 4QHUA 3TCXA 2ADJB 2QEJA 5C0AB 2A0LD 4U1MA 1VACB 5IVXB 5LWYH 1CLYH 5EU6E 3WS3A 2R0WH 5JQ6H 4HKBA 1RI8A 3DX6A 4NKMA 4WWKB 4U1KA 1JPFA 1KULA 5IVZA 1H5BC 1P7QD 3V6FA 5GGUB 4YHIB 3Q5YA 2R0ZL 4LBEB 3VFPB 4LSPL 3LD8B 1DBAL 5I8EA 2VXQH 4AEHL 1FYTD 2FECL 4ONOA 5DC9B 1AQDB 3DVNB 1JGEB 2GJ6E 4LFHG 4UV4L 4HKXA 3GMRB 1JWMA 2OTWA 3GM8A 1FIEA 1RUPH 4S1RH 2B1AH 3WFBH 4P5MA 3X11B 3HAEB 2VZVA 5FO9B 4TVSa 4NOBA 1JRHI 1BQLL 1HCFX 5BMFL 3P9MB 3TESA 4D0BA 2NTFB 3REWB 1A7QH 2W60A 3EDKA 4HEME 1C16B 3W5MA 2VRAA 5DJ6A 3MLTA 4MNQB 3MGAA 4U6VH 2Q8BH 3QIBD 4CVXA 4KFZC 4Y7MA 4DZBA 3ZKXC 5GSVA 5F3HA 5KSVB 1CE6B 4MD5A 5ICXA 4WTWA 1UQSA 3CX5K 2H2PC 3B9EA 4HFUL 1KIRB 1P2CB 1KTLB 5AUMA 5E4IA 4RMSA 5F89B 4WEBL 2EH8H 3KG5A 3T2QA 3BP5A 5K9QG 4JFFA 3MOBH 5BRZD 1FBIL 3C87A 3P9WB 4R3SB 3ZSSA 4PJ8D 4MB4A 4G6JH 5KSAB 5GGQL 1U3HB 1T03H 1K2DB 4M5YH 3LEXA 4PRHE 3M17A 2IQAA 4OBSA 2FD6L 3QWRA 3P0VL 3T65B 2HKFL 5IB1A 1KPVB 2BOBB 2CXGA 3EYQD 3WMSA 4K3GA 2Q3ZA 5DGRA 1WVZA 5HYSG 4BQCA 1F4WL 2VZUA 1UEMA 5DMJB 3BRDA 1F6AB 5JLZA 1NDGA 4X6EA 4X9BA 4ZFGL 3TO4C 3A6BH 3BMVA 5D96B 4PLOB 3H3PL 2EDXA 5BJTA 1S7UB 3PNWA 5DK0B 5D7IF 5DJCA 4W70A 1LNUB 3BUYA 1JCKA 4YE4H 2GK0B 4WHDA 3RWJB 1LDPL 4TOYH 3WIFB 1D6VH 4Z77A 5IWLC 2A38A 5DURB 3SDCD 3HZMB 5F71A 1UWGL 5DQJA 3T0XA 2R2EA 1NL0H 1J86A 1GAFH 1CGXA 5AG9A 4YQXL 3O45A 2P5WB 1V7NH 2CO6B 2VERN 3KS0J 3LN4A 1E4XH 1Z9MA 3L7FA 3DETC 4U1NB 1CTNA 1IAII 2FX9L 3J7HA 3EDEA 4LLUB 4P3DA 5CD5D 5E8NB 3O3UN 2R8SL 3VXQA 3CFJB 4OGZA 2IADB 1PGRB 2GKIA 2O5ZH 3C60C 3IDUA 4JN1H 1A6AA 4IRJA 4M7LL 3AREC 2CK0L 2BNUB 4M9PA 4BH7B 2Z8RA 4F3FB 5HI5C 2W91A 1I8IA 3IDNA 5ALCH 2BVOA 3ULSB 3PWPD 1HSAB 2AEQH 5CEZH 4HPOL 2Z35B 3ARED 5I6XB 1T89C 4R4FH 4E0RA 1WBXB 4JY6A 2DL9A 4K8RD 4QYOB 3GZKA 2A6IA 4TTDC 3D85D 5E5UB 2DAVA 1S7SB 3S34H 3BVNA 2Q7YA 5HYJB 3ARDD 3VCLA 4U49A 1T22A 3GJFH 4MDIB 5I71C 3ARXA 3PHQB 2DQGL 4GG6B 4BYHA 1MI5E 5FOBB 3CFDA 5IG7B 1J0JA 2JF1A 4U7MA 4NDMA 2HFTA 1N4XH 3GMNA 2E9WA 4M6OH 5C86A 1OQOA 2CRYA 5I9QC 3ARFC 3B2VH 4DEPC 3OGCA 2NX5D 1S9WA 3QXTA 4JG1L 2OJZH 1TJGL 4ZUWB 4ONFL 1NLBL 4EUPH 4S1RL 4MJID 1GGIH 1D5IH 2A73A 3VFVA 4RFEA 2AKRB 5T1LA 3BWAB 1CQKA 4FFYH 4KTDL 2E7LC 4D9LL 1MHHA 4TRPL 5CEXB 4MZ2A 3WHE0 5SWZB 3PWLA 5EA0L 3B6SA 4RFNB 1JGUH 3BRFA 2VDRH 1MRFH 2ED9A 1HXMB 5IVOA 5EORL 3OJDA 3UYOD 8FABA 2Q20A 5FOJA 4HK0A 3PV6A 3QDJA 2DI8A 5AD0A 1FFNA 3VMOA 4JCMA 3O6LL 5JZ7C 2XG5A 3CGTA 1XZ0A 2CLZA 3D2UD 4RFOH 3IRPX 1MAMH 1K6QH 4NJ9L 3BZFB 3OPZH 2EDKA 2JJWA 3PWNB 3EBAA 1MJUH 1MNUL 3VGAC 4S2SB 3VXNA 3G08A 4I3GA 4QTHB 3LS5H 2OX5A 1F4AA 4LLDA 1LE9B 3MACH 1YEKH 1F8TH 2Q76A 2XZCL 4R9HA 5MENB 1FYHB 1MCHA 5TF1H 3WXWL 3TBVA 5F7YC 3GDBA 4UDTB 4FQHB 5CWSA 3T2NL 1OAYL 5ISZB 3DHMA 1MCNA 1GXEA 3HI5L 2YUWA 4JHBA 5FYKD 3P4MA 1FVEA 4C55A 1JMZA 5HI3C 1IKFL 3N85L 1LMKA 4Y2DA 1U6AH 2I5YH 1I9IL 4NSKA 1I3VA 4Y5XC 1QUNA 1BQHA 4W4OC 2NY0B 1EEYA 3WE6A 3P0YH 3CH1B 3GSOB 4JFZL 3NTCL 4ZUTA 3HNTL 5LQBL 3ULVE 1KLUA 3NIDF 2Z8VC 4XB8A 4Y19A 1T5WB 5HYQB 2VN7A 5SWSE 4MAYA 1CIDA 5IHZB 1WFOA 2R0LH 1ZWIA 3L3KB 1T0MA 1QFWH 4F15C 2YUVA 5L88H 4JFHE 4U1HA 2W1NA 2J8UF 3P11H 4EQ3A 5HGHA 3B3IA 4HWNA 1OCWH 1H15A 4TOYL 1D6VL 3RX7A 2V5YA 5IGXL 1DDHA 2ITDB 1S78D 2FHCA 5J13C 4ERSH 5IVNA 4KQ3H 5GZND 2R29H 1FE8H 3CFCH 4XC1L 5FB8B 1YZZA 2VWEC 4C58B 2P5ED 1IZKA 1QYGL 2ICCA 2YPLD 4IOIB 3VA6A 2I27N 1KB5H 2YEZB 3EZ8A 4M8QB 4I0KA 1FNHA 1YMMD 4TNVF 1CLCA 2BSSA 4Z7OF 2Z4QA 4KAQL 3RNQA 4LCCB 1X5JA 2HN7B 4GXVH 5D93C 1LO2H 3FOLB 4J1UB 4L4TD 3VXRD 1G9ML 1AP2B 5IW6B 3O3BB 3DROA 3C5ZC 4KK8D 2I9LA 1S5IL 3TN0B 1Z2KA 5GHWH 3TH2T 2CRIA 4UILL 4N8VA 3D39B 3W2DH 4ZS7H 3WJJC 1BBDH 1IAIH 3V6ZB 5IHLB 3FB8A 5IMMA 2J5LB 3O9WB 3CSBA 1A9BA 3SCMD 5D71L 2NW3B 5FECB 4CNIB 2EDRA 2I26N 4YO0B 4N8CH 2DDQH 2AW2A 4X98A 2J6EH 4TNWF 5I1HL 1K4DA 1YDPA 1V7ML 3WL9B 5T3ZE 3OKDA 3RZWA 3MRQB 1TJHH 5FYJL 3PWJA 5DUMH 1A6UL 2HJFA 4J6RH 2V17H 3NGBC 2DWEB 5AZEH 1CGUA 3T0ED 2QTEA 3MODH 4OF7A 4OLYH 4APQC 3RWCB 4NO0A 4TSCH 2XICA 3OQ3B 1IC7L 1ZT7B 3PL6B 3KHQA 4FQLH 1BM3L 4J3VA 1GCFA 1FSKB 3TBWB 2G5RA 4ODHH 2XTJB 1TTUA 1GGBL 4NCC1 3RWEA 1BZ7A 1MCSA 1I8LC 1ACZA 4HD9A 3DGCR 1WBZB 4N90E 2VKXA 5HVWA 5IQ9A 1IGTA 5IKCB 4J2XA 4TSBH 3S88H 1F6LL 3ULUH 4MQ7B 1ZA6A 4KKBC 3MA9H 5JIHA 4F7TA 2FIKA 3UJIL 4BH8A 5C09B 4XNYL 2ICWI 4LKXA 4PG2C 1P7HL 4CMMB 2DQHL 1JGUL 1P4BL 2HLFD 1IEHA 1KIQA 3OXSB 3ZTNL 2MQ0A 3MNWA 4NQEB 5GISH 4QCIB 3P3YA 5JPMB 2EKSB 4UDUA 4KKBD 4OF3A 3CU7A 5DRXA 2F53A 3D18A 2ZUYA 1YEFL 4NZRH 3S4SB 3TO2B 1JRHL 1MAML 1HXYA 1WCQA 3D0VB 4H25A 4JKKA 5FHBH 4W68A 1ZHNA 4KJYA 1EV2E 2ADGA 4GKOA 3WSQL 5EZOH 5EC1B 1MCBA 1JGLL 2DKSA 2GAZA 3VXOA 5CSZA 1T7ZA 4HUUA 3AS0A 4PGBB 4JM2D 5GRUH 2B1HL 1E28A 3AUVA 5CHNA 4PJXE 4KJPC 4JM4H 1JNLH 4U6YA 4U33A 1H3VA 1UT9A 4OSUH 4X5XB 3ILPB 4YBLB 3PGCA 5C0DB 4QRPE 1JNJA 2RIKA 4KWUA 5LGJB 5JXED 1Y6MR 4L4VE 5A2LH 2AK4E 4PLJD 5HHVL 2ZWLT 3MRKB 2WAHA 5E70A 4Q9QH 1UACH 3U4AA 1RUKL 5DD0H 5K9JH 5E6ID 2WLZA 1QR1A 3MGOB 3QG6A 3QHZL 5FYLL 1U91A 1QD0A 5J3HC 2FR4B 2NXZB 3G5ZA 1U8IB 5IESL 1LP9F 1R3LA 4MA8L 4LHUD 2EYRB 4F57H 1FIGH 4JGJA 5J4MA 3IJSB 1WUNT 2ZUUA 2AXFB 4QHMA 3ZO0A 3G6DH 4MD0A 4QHUB 1RIVL 3BP6A 4U1MB 2LU4A 3MJ9H 5SX4I 3WS3B 5I1IH 5C07E 4WGWB 1R3KA 2AJSH 2D7TH 3DX6B 4HKBB 3X3GL 4NKMB 1P84J 5ID1B 4Z76A 1JPFB 1S7XB 5IVZB 3V6FB 3O8XD 4HJ0C 4PBWD 4C83A 4GLRH 4AY0A 4PY8I 3VDBA 1BPVA 1NPUA 4PJXA 5I8EB 4ODSL 3ZKSD 4A6YA 4IDJL 1GC1L 4UIMA 1KB5L 4HKXB 4JREB 4DUXA 1HILA 1JWMB 4QRPA 2OTWB 2VLMD 4EN3C 25C8H 1LO5B 4P5MB 2EO1A 1MQ8A 1N5AA 2OR8A 1X5IA 5GS1A 2VXSL 3SQOH 4D0BB 1KOAA 4CAGA 3GI9L 4K71C 2W60B 3SBWC 1OP3H 2ZUQC 5DJ6B 3MLTB 1I3RA 5F7MC 4CDGC 4CVXB 1R3JB 3LDBC 5E2TH 2EECA 4ZPTA 2IH3A 3F8UB 2Z8SA 3TT3H 4DZBB 1X44A 3EO9L 3BGFC 5F3HB 4MD5B 5ICXB 5T5NG 1UQSB 3BJLA 3HE6A 4NNPL 5EU6B 3MLXH 3SJVA 1VFMA 5DMIH 4GBXA 5F6HI 2L7JA 1HH9A 5AUMB 4NZDA 4QY8A 3KYOA 4K9EH 3RDTC 4HJGA 4P59H 4XBGA 4L5FL 3BP5B 4JFFB 5F1NA 1F02I 1QHOA 3C8KA 5A2FA 2NXYD 4R90H 3BKYH 3JTTA 5F72S 2NY1B 2CIIA 4YHKL 5ACMA 2V17L 5CGMA 1QFUH 3LEXB 2VLJD 2FB4L 3HB3D 3M17B 2IQAB 5LJYH 4K7PH 4KXZI 1EEZA 2AEPL 1RAMA 3MBEC 3LN5A 4FQLL 1QVOA 5IB1B 1HZHH 4FQ2H 2YD7A 4YDVA 1OLLA 3FZUD 3O81A 1IC4H 5JLZB 1NDGB 4X6EB 3WBDA 1AHWC 2MSPA 3QH3A 5LXGL 4L8DA 1G9MC 5DWUL 3MBED 1YEJH 5D7IE 5BJTB 5KTEL 2VDPL 3AROA 3MGTA 3PNWB 5DJCB 5GSRA 5GGSA 5A2KH 5HYFA 3BUYB 2W9DH 4XAKD 3VH8A 5ELIA 4Z77B 4LVNB 1JGVL 3MTRA 3SGDH 3ARGB 4FG6D 1DLHA 5DQJB 3QUXC 4ELME 3WN5C 2NY7L 3HI6L 3ARYA 4KROD 4NRYB 3MLSL 3O45B 4HAFA 1FJ1A 3D5OF 4X6DF 3BPLB 2F5BL 4PRHB 1OSPL 3LN4B 3GRWA 1R24A 3L7FB 4QRRE 1C7TA 4EQ2A 1AGFA 1EK3A 2ENSA 4KJQD 5I15H 1I3UA 4P3DB 3WFCL 3B9KD 3VXQB 3LZFH 4Z8FH 3QDGE 3E6FA 3HMWH 3H9HA 1YNKH 4IRJB 1N64L 4PRPE 3LD8C 1H3TA 1I7TA 5KVGL 1TZHA 3VXSA 1ZHBA 4JFPA 5C0AD 2Q87A 4N8PA 3I02A 3HRZA 1I8IB 1T1WA 3IDNB 3ZE2F 5JW3H 5CJXA 2BVOB 2MTPA 5IK3A 5ADOH 5CINL 2X2YA 5D8JH 4WWKD 2JJTC 3EDJA 2HFFA 3LKRA 1S9YA 5K9JL 1YJDL 3BE1H 3EOTH 3K4DA 4HUNB 4JY6B 4XVJL 3BIBX 2A6IB 1QQDB 3VMNA 3NCMA 2VLLA 4M5ZH 4NM4L 1N0LA 1ED3B 3BVNB 2Q7YB 4R7DB 4K8RH 5B39A 3VCLB 1FIGL 2D2OA 1QR4A 4Q6IA 4M48L 5IJVA 3RKDC 4JRYE 1A4JB 3FN0L 3TYGL 5CD3A 1QA9A 1NLDH 1DANU 4UIKH 3CVHB 15C8H 4NDMB 4LU5L 43CAA 3QDGA 3GMNB 4M8VA 5I1EL 3QCVL 1RZ8A 5I1JL 2RCSH 4FQPA 4U6XA 3OGCB 3SGEI 1U8LA 3N1MC 1KCUH 4M6NL 3G6JE 5KSAC 2A1WH 2A73B 3VFVB 4RFEB 2V2TA 5SX4H 5KOVC 4DTGL 5T1LB 3HHRB 4RBPH 3SDAA 1FVDB 2BNRE 1MHHB 3QP3A 3JV5A 1NUNB 2BX5A 1KPRA 4H88H 1FDLL 4H0GA 3PWLB 1SM3H 4PRAA 3B6SB 4AMKL 4OM1L 1TQCC 3T1FA 1JN6B 1FVCA 1HI6A 3H9ZA 3HMXL 4H20L 2XG4A 3OJDB 5CZVH 5JA9A 8FABB 1U3HD 2EIBA 2ESVE 4HK0B 1AQKH 5J12C 3PV6B 5E2TL 2YZ1A 4JFYB 3GK8L 1MI5B 5AD0B 1FFNB 1Z9LA 4C54A 3W9DA 3Q1SL 5DRWA 3V79C 2CLZB 2JIXA 3ZT5A 3TP4A 4XXCC 4R8WL 4XBEH 3UTQA 1V5JA 1U2HA 1CICC 1U41A 1YY9C 4M43L 3LEVH 4GG8A 3P4LA 3VXNB 3G08B 2IG2H 1QRNA 3QZWG 3TBYA 1EJOH 1OTSD 3BKYL 1QSEA 4PRBA 3CXHK 2Q76B 2ZKHH 4LSQH 1EXUA 4UV7L 1AGDA 2HRLA 2YC1A 1MCEA 3TBVB 1CZ8H 5L9DL 5CWSB 5IJKA 3P4MB 2VAAA 1FVEB 1E6OL 3MXVH 4UMGA 1NCBL 4PB9H 4Y2DB 1GC1C 4NSKB 5A16A 5ANME 3HUJF 5FYKH 4E9LA 3MZTA 5DURD 1OVZA 1BQHB 4HKZA 1BAFH 2RBLA 1EEYB 3WE6B 3QHFH 4JQVA 2P47B 4IMLA 2VDOL 4ZUTB 4FQIH 4UOW1 2C3VA 3ZL4L 4M9OA 1KLUB 2JK5A 1NC4A 4Y19B 2P5WD 1Q1JH 4MAYB 3MV8D 4AEEA 3MUGA 4QHNA 2DLGA 3SKOA 1ZWIB 1UENA 3QQ9D 4JO3L 3QI9B 1T0MB 1NH6A 4PD4J 3V4PH 5HGHB 3B3IB 4OGAD 4HCRL 1HDMA 3I50H 3BO8A 1H15B 2ADFH 1I9RL 2Z31A 1DSFH 1DDHB 1E4KC 3QUMA 4GOSA 1QACA 2KKQA 5AZ2H 4B41A 1EFXA 1IQDA 2APVA 3W11C 4NGHL 5I6XC 4ZOEA 3HZVA 5EPMA 1JK8A 3FRUB 4Y4FC 3VXTA 5EZIH 3LKOA 4L29A 2DQTH 3FAXA 4DFIA 3V6OA 2NZ9C 2HLAA 2JJSC 1CLOL 1DANT 4Z7OE 1T7XA 2BSSB 3W11D 3QRGH 5I15L 3DSNA 3RNKB 2Z4QB 1JZ3A 4Z8FL 3M8OL 1AKJA 1LK2A 2ITCA 5HYJD 2IAMA 3BRGC 2I9LB 3BDXA 5C2BL 4A2MA 3CVIL 3K1DA 1D5ZA 1RK1A 3R06B 1Q9KA 1YMHA 2J8UA 4N8VB 3KLHC 4LPCA 4Z7WF 3PQYE 2UWEF 1BJ1J 5D8JL 2CIKA 1T2QL 5IMMB 1UJ3A 4I4WA 4RMUA 1A9BB 1Y6KR 4POZD 3O6FB 1PY4A 4KGJA 1FG2A 3K4AA 2N7BA 4PYHA 5FM8A 2EICA 4RFNC 4UQ2A 1K4DB 1YDPB 2B7DT 3OKDB 2GCYA 4YBHA 3MRIB 1F58H 3PWJB 2MMXA 3I6LD 5DD5H 43C9A 3QXVA 4MVBD 4F8QA 3TFKD 4U7KA 3MJ6A 1LVEA 1KPUA 4KY1H 1JZ8A 4MZ3A 1DBJL 4R2GC 3I3BA 3B5TA 4NO0B 4WFGD 3AY4A 3RWEB 5DQ9A 3K4ZA 1GOHA 1X5XA 4XX1G 1ZGLM 3S36L 1FP5A 5IQ9B 1IGTB 3ZKNC 4MWFA 4XNUH 2WIMA 3MFFB 2Y23A 4LIQL 1I7RA 1ZA6B 1GL4B 4F7TB 4IHOA 4YFEA 4ZFFA 1OP3K 2FIKB 3K74B 4BH8B 2NY2B 4U3CA 4H88L 4KKAD 4FP8H 5DEZA 3SE3C 3JV4A 1KIQB 4DZ8B 1OLZA 4EBQL 3QO0A 5MEND 3BW9B 3MNWB 3IKKA 3LMJL 2NY0C 1QKZL 3RAJL 2AXGA 5ISZD 1YJDC 4D8PA 4F9LA 5DRXB 2F53B 4UT6H 3D18B 3P73A 4WY7H 5CP7A 5JIKA 1OW0C 4RRPA 3EHBD 1HXYB 2A6DA 3UDWC 3ALXA 4H25B 1V3LA 2NY0D 1FLTX 2M1KA 1ZHNB 4KJYB 3H8NA 4ODVH 2OXGA 1JZ7A 2GAZB 3VXOB 2JLLA 5CSZB 5LGHL 4HUUB 1F42A 1A14L 2RR3A 1E28B 2FWOA 1CZ8L 1MCPL 1MHCA 5CHNB 2OZ4L 1W0WB 4YHMH 4ZNEE 2EKJA 4OFKA 4U6YB 4ZFOL 4GRWH 4HC1H 3MXVL 2MWCA 3IT8D 3H0TA 3VGFA 3SOBH 4RMTA 2AP2A 4LARH 1D6EA 1W0VA 2CD0A 5FF6A 3DJ9A 1QR1B 2UZIH 5TF0A 3QG6B 4JCLA 1U91B 1WITA 1FGVL 1OTTC 1LP9E 5FA4B 3G5ZB 2GITA 3VI3F 4G5ZL 1R3LB 2F15A 4ZD3H 4Y89A 5AAWA 4YDIL 3ZYZA 1PEZA 3H42H 4EOWH 3THML 4QHMB 4MD0B 3CIQA 2MCPL 3BP6B 3MNVA 5CFHA 1R3KB 4OKVA 3GSRA 1TJIH 3KLAB 4GUPA 4RGND 2P8MA 2HMIC 4LHQB 3L3JA 3O9WC 1ZAGA 3TN0D 4IEFB 4K9EC 2PR4L 4C83B 1F4XL 1L6XA 4P2RA 4WU7A 4EIZC 4PJXB 4WHYH 1IGFL 3SEPA 1KBGH 4G6KL 2OK0L 4A6YB 4I8DA 5BO1L 3GJEA 4UIMB 3RKPA 3M45A 1WICA 1HILB 2ZCLH 1OAXH 2J8HA 4QRPB 5T1KA 3BESR 1H9VA 3KXFD 3RWHA 3QUYC 4CVUA 1QG3A 3CDGA 5BOPA 4LP4A 1N5AB 3FQXA 5C08E 5GS1B 4OIAA 2QR0A 3HZYA 5D7KE 1FNSL 2FX8L 2HJLB 2E27L 2MQ3A 5DK2A 1UM6H 3L3DA 1ULVA 3PL6C 4PJBE 3ZE0F 2XTJC 3BDBA 2B5IB 3SKNA 1TETL 2DB8A 4HBCL 4ZPTB 2IH3B 4TPRH 5HGAA 3WJLC 1MCIA 5L2KE 1K8DA 5A3ID 4IRZH 3CFIC 4J7RA 1NCAH 3S37H 4I48B 4GBXB 3PL6D 5DLMH 2H26A 1BQUA 1HH9B 3NPSC 1BFVL 1KB9J 4HJGB 4XBGB 3U7YL 3ZHLA 4IOFD 4NRZA 1MCLA 4XNXH 1CTOA 3UTTD 5JW5A 4M1CC 3C8KB 1JZ4A 4N5EC 4AIOA 1XEDA 3JTTB 5I73B 4KRNA 2DJSA 2CIIB 1UJTA 5DD5L 1CD0A 5C0CA 2WBJC 2JB5L 4CL7A 4S1QL 2L7UA 4JZNA 3QXAA 2VNCA 3NZHH 1VGEH 3QQ3B 3CVHL 5C08A 4R96B 1EEZB 4XNZC 1FO0H 3VJ6A 3LN5B 4R0LB 4NQED 5EFIA 3WFEH 1MREL 4YDVB 5MERA 2G5BA 4XH2A 2EYTA 4WW2F 2DJ4A 1OP9A 1ONQA 2K1MA 5CJQH 3C5SA 4FQ1H 4L8CA 3JWDL 4RBPK 3ETBF 3JV6A 3WLWD 4GRLD 5L2KA 3QH3B 3DX7B 4L8DB 2M26A 4ONHA 2COQA 2AQ3A 3F7YA 5HHOE 4FXLA 3TIDA 1NGWA 3MGTB 5GSRB 5GGSB 4X6CF 4FP8L 2DD8L 4XCFH 1YECH 4YBLC 3VH8B 1PY9A 4OCYL 3RY6C 4FMFA 3EOYG 4DW2H 5C0RL 2IGFL 5ADPL 5TQ2H 5D2NE 4LLQA 1MIEL 4IIQA 2X4NB 5HVHC 5SWQA 5MHSD 4PJAF 1FZJB 5JA8B 2VYRE 4LQFH 3M1BA 1FJ1B 1KG0A 5A43C 5I2IB 1NMAH 2NXZC 1BOGA 5ILTH 2F8XC 2XWJA 3VG0H 1R24B 3T77A 5D7SH 1DQQA 1AGFB 3F65A 3HR6A 1N6QL 4LAQH 1BVZA 1MHPH 4PJHE 2P1YA 35C8H 3NACH 5BVJA 3KJ4B 2NXZD 3E6FB 3IETB 2WNGA 3H9HB 1J1PL 4ZXBA 4PLNC 2LE9A 4KQ4L 4O4YH 1EGJH 4YHML 1I7TB 1Q0YH 1TZHB 4JHWL 4D9QD 1ZHBB 4JFPB 5D7IB 3VXMA 5SX5H 3I02B 3HRZB 1T1WB 5BZDA 3KPTA 1N8ZA 5IK3B 5H37H 4P48A 1FH5H 3HG1A 1NCCH 2HFFB 5LAXA 2FNBA 1S9YB 2R1YA 3ZDXF 4K7PX 4O02H 3QEQE 1BFOA 5ITBH 1E4WH 2YN5A 3DBXA 3MZGB 3K8MA 3ABZA 4LMQE 4X6DA 3W0WE 4NFBA 5B39B 4XMPL 1GOGA 1SJHA 4Q6IB 5C6TH 2QBWA 5HD8C 5IJVB 3FO1A 5E94A 3Q5OA 5CD3B 3LS4H 1LGVA 2WMPA 2YPKB 1QA9B 3PP4L 4QRUB 3U30B 2QQNL 3D3VA 43CAB 7FABH 3QDGB 1MAKA 3QFDA 4CRPA 1HYSC 1DJSA 1JWSA 1EBPA 1RZ8B 4OF0A 4U6XB 1RU9H 2FBOJ 1G7HA 3U9UA 1U8LB 3UPAA 4M93B 4KZEH 2ZUXA 2VXUH 3MCLH 1NFDE 2YSSB 4M4RA 1QSFA 2V2TB 2CLVA 3SDAB 4U31A 3S97C 4JFFD 3ULVL 1KPRB 2QSCL 1HNGA 4PRAB 2Q86A 2YHGA 4HGMA 5DJYA 3T1FB 4E5XA 1FVCB 1HI6B 2EDEA 2NY1D 1DLFL 1WAAE 4ZTOH 4ZG1A 4WVRA 4X8JA 5EOCH 3GFUA 4B50A 4HV8A 3MRBA 3QQ4B 2OR9H 3OR6A 2V2XA 4L9LA 2AXJA 4JFDE 3QWRD 4ODTL 4JRXE 3W9DB 2E6PA 4XTRC 5D5MF 1MIML 5DRWB 4ZO7A 2JIXB 1FNEA 1WZKA 4M62L 4YXLL 2BOCA 3ARZA 3UTQB 4F7CA 2Z9TA 3K8KA 5JOFA 4GG8B 4HEPG 1I85A 4BA8A 4MNGE 4KDTC 4OZGE 1QRNB 3TBYB 1FCCA 4PRBB 4YHLH 5D70H 1EXUB 1AGDB 2YC1B 3ARGC 4MJ5B 3K2UL 1P4LA 1CL7H 2FGZA 4DKEH 2EE6A 1G0DA 1HHGA 2VAAB 1TZIA 3OKEA 1VGEL 1ZSDA 4OI8A 2H32B 3HUJE 1UKSA 1QFOA 5A16B 3SE8H 3OTTA 2Q3AA 4HKZB 4DGIL 4AG4H 3RU8L 2X4TB 5D1ZA 4MSWB 4IMLB 3C08H 1F3DJ 2C3VB 4N0CC 2ESVB 2I60H 2J8OA 2IMNA 2JK5B 2ZOLB 1RUAL 3L9RA 1NC4B 1PG7H 4MA7L 1T66D 3MUGB 4MXWH 5C0BA 3G6AB 3SKOB 3A6CH 4P99A 3LQAH 1OF2A 2DQUL 4RAUA 3EOAA 3CX5J 3TH4T 1YEDA 1FFPA 1FFOA 1BZQK 3BO8B 2BMKA 2VZ3A 2Z31B 4DW2L 1A5FL 3DXAA 3QUMB 2MCG1 5T3ZL 3AXLB 1AFVL 4IRJD 4M1DH 3FN9A 1IQDB 1EFXB 3O6MH 5KVEH 1TQBB 3HZVB 4CBPA 5EPMB 4YWGH 2CLRA 1LEIA 1JK8B 3VXTB 1IGYA 2CDFA 1B9ZA 1B3JA 3LKOB 4L29B 1P53A 2HLAB 3HUJA 2Y6SC 3ZSTA 3R0MA 4POYA 1R5WA 4JDTL 2YD2A 1AKJB 1LK2B 2ITCB 3EYUL 5H8DA 1C1EH 1FORL 4JVWA 4KDWA 4PY7A 1H5BA 2IAMB 3BEVA 3TPKA 1CG9A 4MGXA 1Q0YL 2DI7A 4XP5L 1D5ZB 1RK1B 4HXBL 4Z7WE 1YMHB 2J8UB 2UWEE 3BH8A 3RVVD 4WWID 32C2A 3JWDC 5F9OH 3C09B 1G6RL 1UJ3B 4XP4H 5IFHH 3LEYH 4ETQA 4O02L 3RVWC 3HC4L 3C2SA 3MLZH 2D0GA 4XMLH 3KYKL 5HHQA 3U4BH 1FG2B 4PS4H 4J4PC 4ZFZA 1Q9WA 4UQ2B 5JNYA 4E42A 2FBJL 2GCYB 1R3HA 4NKIL 1FAKT 1QBLL 3BOVA 43C9B 5AWNH 2NR6C 5T1LD 2AI0L 2DQIL 2ZJSH 4KKCC 1KPUB 3RWGB 2GIYA 2KQNA 2GSGA 4JFEA 4XRCA 5CUSH 1GZQB 4Q2ZA 4YDKL 2VDLH 3O41A 3SDDB 2VLRA 4DQOH 1G0XA 1PSKH 4Y1AE 5DQ9B 3QDJD 5T1DH 4DFHA 2BVYA 1ZTXL 3P9LA 2D7PA 1BQSA 1GGYA 5E5MA 5MI0B 2UWEA 4OAWA 4ONGH 5HYSA 4MWFB 4NQCA 3U1SL 3KWWA 1KCRH 1MUJB 5TDPA 4IHOB 3MLRH 4LAJH 4ZFFB 3I6GA 2HT4D 2VH5H 3TCLA 1N5YH 1ZXQA 3UBXG 2XKNA 2JELH 4M7ZB 3JV4B 1KLGA 2Y5TA 3QO0B 5I16A 1NGXA 3NZ8A 4DGVH 2C4FU 1MJ7H 1JPST 1VFOA 4LSUL 2AXGB 3KPPA 4HDIA 4YXHH 4PJGA 4QF1A 4D8PB 3WFDH 1BX2A 2HVKA 1MJ8L 3P73B 1JFQH 3QDHA 3TO4A 5CP7B 4MAYC 3WIIL 4Y2DD 3ROOA 1AJ7H 2A6DB 2IWGA 4OZHF 3UO1L 4ENED 3QJHA 3QI9C 2EXWC 1UKQA 2CDGA 1VEMA 4MQXC 3UP1A 3O3AA 3MLUH 3BN9D 1S7RA 4Y19D 5IWLA 2BVQA 4LL9A 2AAVA 4MAYD 3WXVH 3AMLA 1KF9B 3VRJA 1NKOA 3RPKA 2FWOB 1U93A 1DFBH 2WQ8A 4FA8A 1MHCB 4XP6L 3AB0B 4MQXD 4LHUG 5LBSH 5INCA 4HXAL 4OCSL 3H0TB 3PJSA 2R56H 2IFFL 1A7BA 1V3JA 2Y72A 1OB1B 1K8IA 5SV3A 3T1WA 3TJEL 3EOBA 5L8JB 4XCEA 5FGSA 3L6FA 5EIIA 1D6EB 1FL3A 1W0VB 5FF6B 3WEXA 4JHAL 4O58H 1IGML 4D0DB 5AYUH 1D5BA 5E4EC 5I66A 3WDIA 2C3WA 3ULVC 3VI3E 4WHYG 1A6WH 3MRFA 3C60A 4MXWL 3OKOA 3EYSH 1H3XA 1LK3L 1IGJA 5TJWK 2PYEA 3VFGL 3ZYJA 1YQVL 2WW8A 4ZNCD 3MSPA 1HYRC 1KXTB 1RFDL 3H9SE 1VPOL 5HI4D 3LRSA 3ZE1F 1BJMA 1A22B 3D25A 5JUEH 3MNVB 4OKVB 3GSRB 4GUPB 4LLMA 2P8MB 5D7LE 5I8KH 1RUQL 3L3JB 4BQ9A 3HPJB 5I30H 1T89A 3O6FC 5HGGS 3V6BR 3O4LA 4P2RB 4WU7B 5DA0B 5GGVH 3GJEB 4KKNA 4HGWA 3RX5A 5D4QA 5T1KB 4NO2B 3RWHB 3B2UC 4P3WA 4K3JL 4X7EC 3NABH 3CDGB 2G60H 5DMGD 2FLBT 3V5HA 4KTYA 2YD1A 3FQXB 2QR0B 2W0PA 1G6VK 1ORSA 4G8GA 5DVLA 3ZYIA 2PW2A 1DN0B 2PTVA 5SX5K 1RVFH 4XPBL 4OZFA 1LP9B 5DK2B 3ZE0E 2VC2L 1L7IL 3TA3A 1CT8A 2WQRA 1I8MA 2A77H 4ZTPH 3ARFA 3SKNB 1UWXH 5FKPA 4YUEH 5DZLA 5HGAB 1XF2A 1YQ2A 1K8DB 1JI2A 1FZMA 2PETA 2XN9E 5E2VL 4NO0D 5F7EL 5T3XD 2QQLH 3IRZA 3LEYL 2H26B 2NLJA 5F1SA 2DQDH 5D7LA 2WK2A 2E7LA 3V8OA 3KJ6L 4NRZB 2C4FT 4P57A 5JW5B 3E3QE 3MRJA 5I74B 4C57C 1QZ1A 2R9HC 2A74A 3ZT7A 5C0CB 4H1LA 1PX3A 4V1DA 3DYOA 1UWEH 4UT9L 1EO8L 4JZNB 3FO9A 1UH2A 3QXAB 2NY2D 1ADQH 1CGSH 5C08B 5GRXG 5K33A 1S9KC 4RISL 4IRSC 2X1XR 4HUXA 3VJ6B 4KGLA 4LDEB 1FRGH 3R1GH 4GRMA 4X6FB 4X9FA 5JW4R 5MERB 2G5BB 4XH2B 2EYTB 5IBUG 4G3YL 1ONQB 2F53D 3C6LC 1TNMA 3C5SB 4YHPA 4L8CB 5E9DA 3JV6B 4I3RH 2V9QA 2X41A 5L2KB 3TBTB 3ARSA 4ONHB 1L7TL 3TIDB 3BFOA 2BSED 4HT1L 4X6CE 1MRCH 5FKAA 2X7LA 5FHAL 8CGTA 4OZIA 2AVGA 5JORA 1MCWM 4Y5XA 5HHXL 1H0DA 1MCKA 4PJ7E 4XVUD 4GAGL 3WUWG 4WI3A 3OR7B 4UOJA 1PD6A 4WUKH 4J12A 4IIQB 5EUOF 4DKFH 5SWQB 4PJDE 1FPTL 2C1OA 3M1BB 2MOVA 4WIQA 1RULH 3LB6C 3QWOA 4X4YA 1KG0B 4YHOH 3WIHH 3E1F1 1F90H 1OM3L 2DLEA 5DRZB 4XWOD 1BOGB 3B5HA 2XWJB 4PUBL 3Q6GL 1CF8H 5H37G 3T77B 3C9NA 1UXSA 3B9VA 1GGCL 4E41E 2B2XH 3HTLX 3S37X 4WW2A 1NCDH 1M1SA 1BFTA 2D7NA 1U8NA 3MRCA 1YEGL 2FEDD 4MMXC 4FZEL 1B0RA 3T3MF 5BVJB 5IBLC 2DI9A 1BOYA 3ULUF 5CKGA 4ZXBB 1X4ZA 3QAZB 5DR5H 2DQCH 4HS8H 5INDA 1HKLL 3BP7B 5LBSL 2P45B 3VXMB 3IYLW 1UCTA 1MRDH 4X6CA 2OM5A 3U4EB 5D6CA 3BISA 3TZVA 5GZOD 2EEAA 4G7YH 2WM0A 4LPWA 1QNZL 5FO7A 1T83A 4OQTA 4RAHA 3HG1B 2VDQH 3ROLA 3ZDXE 5LAXB 5GGVY 2R1YB 1CS6A 3UTSE 1P1ZA 1BFOB 5D2NB 5GS1C 3LKQA 1BJ8A 4PJAA 3OKLA 4HG4K 3NA4A 4X0KB 5ICYA 1OPGL 3IKCA 4X6DB 1A3QA 1B2WH 4FOMA 5CIPA 5BVPL 4HWEL 3C5ZA 2F54A 4QRPD 1SJHB 2XA8H 1GPOH 4YHZL 3FO1B 5E94B 2NY5H 4G6MH 1S8DA 3WJJA 2O5YH 3CFKA 3CJJA 3OAYH 2VDNL 4MHHG 3D3VB 3RUGF 4GBXC 3QFDB 1MWAH 1QLEL 1Z3GH 5BS0E 1JWSB 1VEOA 1D9KA 2P8PA 3ME0A 4LMQI 2VLKE 3A67L 1G7HB 1I7UA 3U9UB 3RX8A 5I1DA 4F33A 1RURH 2ERJC 2E8YA 5F9JA 3HE6D 5I73C 3SJVD 4FZ8H 4DCQA 1QSFB 5F7FA 1SMAA 2CLVB 5TFSL 3FFCA 3QCTH 3MMEA 4APQA 4N0YH 1N0XL 4MA3B 4RMQA 3EAKA 4FQJL 5DJYB 4E5XB 5EZLB 4R0LC 4RMVA 1YNLL 3BPOB 2AABH 1RIHH 4X8JB 4NCC2 2HYMA 4HV8B 3MRBB 1I8LA 4ZSOE 1HK6A 4FS0A 1GHFH 3LH2L 3H7LA 1EHNA 2OL3A 2V2XB 3KGRA 4L9LB 3QNZA 5D5ME 2PNDA 5EOQL 5I18H 3FFDA 1JZ5A 3VFUA 4GH7B 4MAUL 2QQLL 1S9VA 4M6MH 3KYNA 5EWIL 2HT3C 2BOCB 5T33H 4F7CB 2P8LA 4WO4C 3WNNA 5JOFB 1AR1D 1UADC 2HTLC 4JQIH 4PG2A 1I3GH 2EC8A 2R0KL 4FQXC 4ODUA 1TDQA 4OLZH 5I1GL 2YKLH 5JW4N 1B4JL 4LNVA 4QWWC 1YEHH 3ELAT 1P4LB 2ARJQ 3U0WH 1HHGB 2IANA 4AEFA 1JPSL 1ADQL 1TZIB 3OKEB 3FHAA 3DSFL 1EO5A 4KK6D 1S9XA 4DWHA 1FRGL 3SKJH 1DEEA 1BD2E 3HS0A 1EAPA 5D1ZB 1HHHA 1L4IA 3QT2A 5E2JA 5KN5A 4JVPA 3RWFA 3L9RB 2X42A 2HFEB 2Y06L 4S1DC 3MA7A 1A2YA 5C92A 1CXIA 4WI5A 3BSZL 5D5MA 5J11C 5C0BB 3B83A 2D0FA 1IAKA 3RBGA 1DTUA 3OKYA 4LGSB 4Z0XA 4RAUB 4Y88A 2XRAH 2H45A 3EOAB 4I0PA 1F3JB 1FFPB 1U0QA 1FFOB 5CJXC 2BMKB 1WGOA 2VZ1A 1UCBH 4XXDA 4NHUA 3DXAB 2GI7A 4KH2A 4BQ8A 1VKXA 1KJ2L 4OJFH 5GRJH 3T3PF 3VD9A 5D1QB 3VXSD 1EMTL 3GM0A 2CLRB 3E8UL 1LEIB 1IGYB 5GS2D 2CDFB 2XOTA 2AJUL 4TUKL 3QHTC 4UAOC 3HUJB 1L9NA 2FHBA 1ZT1A 4YDJA 1BD2A 4RGOL 2E9IA 2DLHA 4P9ML 2YPVL 1EZVY 3BXNA 2K3TA 4B7IA 3U30C 5KS9E 2RB8A 1A7RH 1UM5L 1LEKB 3CPLB 3X17A 4M7KL 3BEVB 1UFUA 3FONA 2K7QA 2DMBA 3DUUA 4F58H 1CG9B 5FM5O 3CK0H 1MCOH 2CGRH 5JHDE 2HH0L 1MRDL 1NGZB 3I2CL 3UJJH 5K9QI 1CFBA 1FC2D 1HNFA 3TIEA 1HINH 2N7AA 2R4RH 32C2B 3HC0A 4WRLA 3QFJA 4EN3A 2VDQL 1NJ9A 2EDNA 3QDGD 4NKQB 1MVUA 2HT2D 2Y25A 5CCKL 2W38A 5FCSH 5E08H 3QISA 4G6AC 4CJ1A 1IARB 3O4OB 5HHQB 2C1PA 1L0YA 4TULH 1B2WL 1ZS8A 1Q9WB 4ZFZB 1YYMH 3SBWA 5JNYB 3ZDZF 4E42B 1CDGA 1JV5B 2BK8A 3INUL 3NCYS 1GPOL 1R3HB 1FV1A 3LKNA 2ZUSA 4NT6A 1PG7X 3QO1B 5DUBB 3SDAD 2NY5L 4G6AD 3V4VL 1FFRA 2GSGB 2EE9A 3ET9F 4LSSH 4JFEB 4XRCB 3S35L 2P48B 3AMKA 1NKRA 3O41B 3GKZA 3RDTA 3IJHA 1WZ1L 2VLRB 3HC3H 3KPQA 1WWBX 1BEYL 4FQCL 5JXAL 1OAZL 3P9LB 3SDYH 4JO2H 5E5MB 4Z7WB 5HGBA 5IW1B 2UWEB 4TUJA 1I9JH 4ETYA 5HYSB 4FZ8L 4NQCB 2JIXD 3KWWB 1KNOA 5TDPB 2HWZL 2N4IA 2GEEA 3I6GB 1XF5A 4X9GA 4I2XA 1DL7H 4RDQF 1WTLA 4WFHD 1QRND 1J7VR 1PLGL 2IFGA 1QSED 2ATKA 1KLGB 2Y5TB 3GNMH 5TE6H 1NGXB 1EEQA 3NZ8B 4NFDA 2J4WL 3KPLA 3KPPB 4XPFH 3PGFL 5I1LA 4WTZG 3UAJC 5IROC 2A83A 1BX2B 2HVKB 1GVIA 1PVHA 2DQJL 3TO4B 1P4IH 5DHYA 3X14A 3ROOB 3OGOE 3EDDA 2Z8WC 1Q9LA 2EIEA 4XVTH 5EB9A 1J5OL 3QJHB 4NHCL 1EUTA 4W6YB 2LVEA 3ECBA 2BRRH 4LRNH 2CDGB 3DMMB 3RPIA 4NQXB 1I3GL 1NC4D 1S7RB 2Z31C 4TN9A 2BVQB 1OGAE 2AJZA 4YBQC 3X13B 4PB0L 5IF0A 3GHBL 3VRJB 4OLZL 3GBMH 1U93B 3QUXA 4XHJC 3WN5A 3GEWB 1KIUA 1JPTH 3KPRE 3KAAA 4LEXH 3TNNB 3TT1H 5INCB 5EO9A 3UX9B 5IB5A 5A2IH 2OP4L 3H7BA 3PJSB 1MFCH 4XMKL 2Z31D 4YXKH 3QPQC 5ICZA 2GTZA 3U7WL 3EOBB 3WD5L 2H6PA 4BFBD 1NMCB 4DGYH 3L6FB 5EIIB 1E4JA 2ADJA 3TJHC 3WEXB 4H0IA 5DT1H 2HRPH 4D2NA 3HFML 5F7NC 4G9FE 2V9RA 4OT1L 3MRFB 1KN2H 3C60B 1IFHH 2HTKC 1ROWA 3OKOB 2IAMC 5BQ7A 1IGJB 2PYEB 3WDJA 1PJ9A 1KFAH 1MVFA 4OZHA 2ZUTA 1PZ5B 1INQA 3ZE1E 5L2JA 2MKLC 4KMTL 3LRSB 3VG9C 1AQDA 3DVNA 2ZOKB 3D25B 6CGTA 1A7NL 2BVTA 3BKJL 2JJTA 1AKJD 4EUPA 4LLMB 2IAMD 1NMBH 4WFFE 3X11A 3HAEA 1OGAA 3UC0H 1QFPA 3P30H 5GRJL 3KPOA 1ZA3A 1SYVA 4HJJL 5L6YH 1M6OA 3P9MA 3CXHJ 2XNAA 1OAKH 2X44D 3DV6A 3KPRA 3UZVB 2DTSA 4JPKL 4HGWB 5I71B 2XI9A 1DBBH 3RVUC 3EFDL 4X5WA 1HEZA 1DQMH 3GI8H 4X80H 2W0KA 2A9ML 3V5HB 4AJ0A 4LOUD 5KSVA 1MCJA 1ORSB 2BNQE 4G8GB 3GBNH 3TM6A 5C7XL 4G9FA 1Z9OA 2PW2B 4OF5A 4RWYH 1WISA 4OZFB 4RX4A 1F00I 4X4ZA 2PKDA 3RVUD 4R4BA 5E8DH 3SDDC 1CT8B 3TA3B 5I9QB 1I8MB 4NQDA 3ARFB 1ZANH 3AY4C 3V2AR 5JW4Q 3B9AA 4DEPB 2VO5A 1NEZG 5FKPB 3UJJL 2KZ1B 2F58H 1XF2B 4C56E 5FUOL 1FZMB 4PJIE 1NUDA 5KSAA 1MF2H 2NLJB 4UBDC 2UVEA 5D7LB 1UEYA 4WCYL 1YEEL 5T3XH 2E7BA 4HIIA 3AFLA 1QRKA 1KCSL 1C7SA 3VFWA 2E5EA 2PCPA 3HRPA 1B6DA 1JPGA 4QGTA 4P5KA 3OAYK 4H1LB 3WNKA 5M95B 2DF3A 4LGRB 1S7TA 5E8OA 3QZWA 3FO9B 3S4SG 1FHGA 4ZO6A 5JW4M 5KJRH 2FYYA 2ZG3A 4OB5H 1Q8MA 1ETZA 4MXQD 4XXCA 1EDQA 4HUXB 4QEGA 3U2SA 3W82A 1CICA 1NEUA 1K4CA 3VGAB 1B0GA 1J8HA 2GK0A 2C7UA 3CH8A 4GQ9H 4YHPB 4KVNL 4JB9L 5E9DB 4RA3A 4HLZH 4RZCB 2DQEH 1CFVH 4JQXC 2XN9B 2DL2A 3O2VH 4EEEA 3PGDB 4HK3J 1J18A 5FKAB 4X6BA 4OI7A 5JORB 3IU4L 1JIBA 1KB5A 4EIGB 1UM4L 5IM7A 4Y5XB 1H0DB 4U1JB 4U1NA 5DD3H 3WNPA 1X5AA 3FQWA 2VTFA 4OI9A 2FZ3B 5EUOE 1AO7D 2B4CH 1XGQA 2X1QA 3I85A 2FEEI 5D72L 5E8NA 4JY5L 2C1OB 1ZLWH 4LSRH 4QXGH 2DM2A 3QWOB 4IBLT 4JO1H 4X4YB 3TBSA 4IJ3C 1S3KL 2H1PL 2LU3A 3BIKA 2E6QA 3G5VB 3CMOH 2WUBH 4F3FA 3C9NB 4F15B 3RY5A 1UXSB 2BRRL 4LRNL 5EO1A 3VFMB 2E9JA 2DS4A 3LQZB 4PGJA 4WW2B 2NY5C 3RA7H 3IS1X 3GB7B 4UNUA 3T3ME 1CBVH 1U8NB 3MRCB 1B0RB 4G6FB 5TE7H 3ULUE 1E4KA 5GXBB 4MDJB 1A7OH 1KEML 1DP0A 5J13B 1NAMH 5EDXA 3ORJA 4GQPH 4LLWA 1ZVYA 1WIOA 1WBXA 4O5LH 2OLDA 4G8FA 5INDB 1J1XH 2XZAL 4HS3A 4Y4FA 4M6AA 1GYAA 2LFGA 2J6EA 4ZUVB 4X6CB 2NY4B 5MP6H 1DEDA 1AD0B 4JE4B 4BZ1H 5D6CB 3TZVB 4X8XA 4YXKL 5FO7B 2JJSA 4XX1E 3ROLB 4DGYL 4XAWL 4GAYA 5CJOH 1ZEAL 5FUCE 3FQUA 1Q72L 5DT1L 5FOBA 4PRIA 4M7JH 5EUOA 4P2RD 3LKQB 4PJAB 3OKLB 5ICYB 3BGMA 2X4SA 4FFWC 3C5ZB 2F54B 5T1KD 4Y4HC 1CFSA 4FABH 4A6YH 1ZLUH 3NFSL 1FAIH 5DXWA 4XC3L 3V0WL 1S8DB 4PV9A 3CFKB 3QUZC 3RUGE 4ZDHA 3S6CA 1NMBL 2X05A 4FFWD 5E24E 2O5XL 5D6DC 4QXUL 1O0VA 2XWBA 1D9KB 2P8PB 3N9GH 3EFFA 4XPAH 4P2CG 4R4ND 1I7UB 1XF1A 2X5PA 5IMLA 5HPMA 2UVFA 2J12B 1BBJA 5L7XH 4FTVE 2YK1H 4K3HA 3TF7C 4DCQB 2J88H 4UI2A 4Q97A 1AC0A 2APTA 1N3NA 1LHZA 3MMEB 4OCNC 2GUOB 3C8HA 4JEGB 4F2MA 5H2BB 4KZDL 4ZOAA 3U9PL 3VMPA 1PQZA 4LQ1A 4RWYL 2BERA 1QBBA 2EZ0D 2PXYB 4JO4H 2V5MA 3GSNB 2C3GA 2FRGP 3V4UL 2DMKA 5C0CD 4EDWH 3QG7H 5J1TC 1NAKL 1YNTB 1MPAH 2CK2A 3JWOL 2IBZX 1IGCH 4BJLA 5CZXC 2OL3B 4FN0A 1OHQA 3QNZB 5C08D 3FFDB 3VFUB 1S9VB 1F4YL 3KYNB 1RV6X 1IC5H 5BS0B 2P8LB 5DI8A 4OGXH 2BVUA 2HAZA 3SE3A 2VLKB 1FYTE 4HMDA 4ODUB 1C12A 1B90A 3L95A 5L2KD 2AQ2A 2X40A 4FTVA 5CZKA 2NQCA 3I9GH 4QT5A 3UMTA 4ODXA 1NANI 4Q74A 1A6VL 1BP3B 3ZT6A 1T5WA 2IANB 5BOZG 5HYQA 1UYWH 2AV7B 4XPHL 1CLZL 3OBAA 5KJRL 1KJ3L 1S9XB 6FABL 4HPYH 3UDWA 1CE1L 3L3KA 3MV9A 2XT1B 3NBNA 1DEEB 3HS0B 4JPWH 4NZTL 2PN5A 1C5CH 3LPGA 1EAPB 1MEXL 4KRLB 1XGUA 1HIML 1NBVH 5C0IB 5EBWA 5KN5B 3RWFB 3S35X 2VQTA 3MA7B 1A2YB 1U2CA 1XAUA 4EI6A 5LCVH 5D5MB 4ORGA 4F7MA 3MRLA 4O2EA 5B38A 1U8KA 2F5AL 4I77H 2Y7QA 3FQRA 1IAKB 1Y18B 4Z0XB 3GRWH 1F2QA 4I0PB 2G2RA 4F7EA 1OAQH 5BRZE 4L4JA 4XXDB 2ID5A 1WQVT 3FCTB 3PE9A 2EDTA 1OT1A 4NHUB 4K3EH 2Y36H 4QNPF 4S1SL 5BV7L 4ZXBD 1S7QB 1VKXB 4K2UL 3C2AH 1KN4H 1RZ7H 3MR9A 1JHLH 3F7VA 5D2NC 3VXMD 1YUHB 1RHHA 4NZUL 3SE9H 3UZQA 1TMCB 3HMXA 3HG1D 4CN6A 1MFEL 3D87B 1JF5A 1ZT1B 4KHTH 3IDMA 1BD2B 2HG5B 2B0SH 1JZ6A 4YX2H 5DVNA 1A7OL 4UINL 2D31A 2GY5A 3O9WA 1NAML 5GJTH 3FONB 2LAGB 3LV3A 5TH2A 3DUUB 2IQ9L 4KPHL 4RAVA 2G75A 4Z9KB 5C3LD 4KJWD 3NAAL 4FXKB 3TIEB 3HC0B 4U1LA 2E6JA 4HH8A 1RZJH 3QFJB 4EN3B 4HIXL 1C5BL 3D3VD 1NJ9B 3QUYA 4W81A 4NM8H 1MVUB 2VUOA 4CKVX 4TQEL 2P42B 2DWEA 1QBAA 4XT1C 2G9HA 1KCVH 2X10A 4K71B 1ZS8B 4DN4L 4RNRA 3OJVC 1A6ZA 4JR9H 2ZUQB 3BPOC 3FTGA 5B3JE 1H3PL 1FV1B 3LKNB 1QSFD 5FYJU 4Y5VC 4NT6B 1FAIL 3LDBB 2Q8AH 3O0RL 2FATL 3BD4A 4NUGH 3WJLA 3KPSA 3BGFB 4NO3B 5I1KH 3EJZC 4L9LC 3U48A 5IKCA 5DO2C 3CX2A 1E6JL 2C26A 4ZAKB 4MQ7A 1E4XI 1GOFA 3RDTB 4XPGL 3N9GL 3IJHB 3KPQB 5C09A 2BZDA 5E56A 3A6OA 1Z0NA 5HSFA 4P2OC 5L7XL 2AS5M 5HGBB 1SBSH 4TUJB 1F4HA 3PWPE 4ZS6C 3T09A 3VFRA 5IT2H 2UY6A 2EKSA 1T6VN 2WBJA 1KNOB 2CMRH 1CFQA 2GSIA 4HS6A 4WFED 1XF5B 3U46B 1RJZA 1MCCA 2PTUA 1A9EA 4I2XB 2XZZA 1HQRA 3DVIA 2VR9A 1NGQH 4P2QE 1YYLH 3B9DA 3D0VA 4Z7UF 3NFNB 4UOW0 4NOFA 4ZS6D 3T4YB 2AJYL 4MS8C 2HFGL 2ICWA 3GHEH 4YC2C 4ODWA 5GRVK 2VAJA 1ACYL 1MPAL 1T3FA 5I1LB 3B5GA 5GGSY 2A83B 3QJFA 4ZOCA 5DHYB 3X14B 4Q9RH 1U8JA 3OKMB 2MQCA 1Q9LB 3N1FC 1ND0A 3CLFH 1AGCA 1IC5L 3RWIA 5FCUL 3ECBB 4WU5B 1A7PL 5D1ZD 5JR1H 3BKCH 3AAZA 5HPOA 3ILPA 1VFAA 5LGJA 4AEIH 2NX5E 4NJAH 1JHKL 4GMTH 3EYFA 3BT2H 3L5XH 1INEL 3MRKA 3RTQC 2AJZB 5DZOA 5IF0B 3VWKB 4Q9CA 1F11A 1MY7A 3DNKA 4K23H 4NN5B 5C0BD 4MJIE 3QUXB 4TVPH 5E2WH 4EI5B 4KHXH 3F12A 5E8PA 5D1QC 1BGXH 1I1AD 5I1AA 3IDYC 5IB5B 5EO9B 3Q48A 4IOSD 4OLVL 3H7BB 1EHLH 5ICZB 2GTZB 3DXAD 4P2QA 3R0NA 4KC3B 5ALBL 2H6PB 1KYOK 4HX1A 3PUCA 1R5VA 3QUMH 1A0QH 4QHLA 1SEQL 5ID1A 1RIUL 4BZ2H 3F7QA 3OKNA 1S7XA 4OUUA 1NCWL 3DX8A 1NANH 5BQ7B 2HKHL 4GXUN 4OZHB 5EU5A 2RGSA 1FGNH 5FM4A 3HR5A 4OLWH 1INQB 3F58L 3ALWA 3VFSA 5L2JB 3QBTB 1G7MA 4LFHD 1JYWA 3JWOC 1SY6L 1D5MA 4EUPB 3Q3GA 2VZOA 4FFVC 3PABA 2W92A 1LO5A 2VB5A 1OGAB 3C2AL 2MPAL 4X7TA 3KPOB 1ZA3B 5C0JA 3BHBA 4X5LA 1SYVB 5ACLA 5BCAA 1M6OB 2VE6A 1DQDH 3O4OC 5FYKE 2XNAB 4H8WL 1NGPL 3CXDH 3DV6B 3KPRB 1N2RB 3L7EA 5C0NC 4CU6A 5T5FH 4U3HA 1SJVA 3BZDA 2EE2A 3QDME 3BIAX 4X5WB 4IS6A 1HEZB 2BDNL 1N7MH 1R3JA 1T20A 4KUZL 3FN3A 4ALAL 5EU6A 4ZUSA 3H9YA 4XBPA 4WI8A 1L0QA 4G9FB 2QJDA 2YA0A 2FEEL 3UTZA 3DIFA 3MV01 4MCYA 4R4BB 1ITCA 12E8H 2EC9U 4NQDB 4LEOA 4Q0XL 4BELD 4JKPL 4H26B 4PTUA 4OD3L 4OFPA 1CK0L 2Y07L 1XGYL 1CDUA 2GJ6A 4JFED 4OQTL 2H2PD 1CWVA 1VDGA 4NM8L 1DQLH 1WWAX 3IFLH 2OZ4A 3F7RA 2VLRD 1TXKA 4ZFOA 1IQWL 1QFWI 4OCWL 1NSNH 4HIIB 4OD1H 4PP2A 3CLEL 1ZLUK 3VFWB 1A3LH 1TQCB 2YPLE 4HLZG 5BV7C 2PCPB 4NQCD 1JPGB 3DVGA 4YDLC 4P5KB 3O2DL 5J12B 2F19L 1YMME 3QDMA 5TPWH 2DTML 3VFTA 1S7TB 5E8OB 3EO0A 3QZWB 2DBLH 1X9QA 3E6HA 2EEBA 3TWCL 2FYYB 3MV7E 4L4TE 3RHWK 3QDAA 1ETZB 4KUCF 3U2SB 2D4FA 5KAQG 2XPGA 3VWJC 1CICB 2EDDA 3IAQA 1K4CB 4K94L 4WJ5A 4B0MM 3DMMC 1KC5H 1B0GB 1J8HB 2C7UB 4KDTA 3AVEA 1Y0LB 3TO4D 1MFAH 1DBKL 5J8OA 3ARGA 4P3CL 4JZOA 4UTBH 4N0RA 2F8VA 2QADC 4ELMF 1WK0A 4NRYA 5FGCE 1KTDA 4LSVH 4PRHA 4X6BB 4R6UA 4G7VH 1OAUH 2P24B 1KB5B 5IM7B 1SYSA 2KBGA 3GSNL 4JG0L 5CSBA 5DGQA 2QQKL 3FQWB 1NMCC 1ZKAA 4KRMB 5KG9A 1XGQB 2BRQA 1H3WM 4PG9A 2XKUA 5M94B 4KTEH 2OL3L 5HGDA 2DWDA 3QCUH 3T0EE 3TBSB 5B4MC 1MQKL 1XR8A 3BIKB 4FXGA 3DETD 4A2LA 1EFQA 5GGTH 3DGGB 3MRDA 3MV7A 5EO1B 4Z7VF 1KJVA 3CDCA 3V0VA 2AQ1A 2IPTH 5EH1A 2D03H 3LHPL 1CQYA 4GJTB 4O9HH 4UU9A 3C60D 4GMSH 1B6UA 3RVXC 5E2UH 1ZLVK 4OQ1A 3GSWA 2PYED 2XACC 5KSBF 2R69H 4LLWB 5HI5D 1G7JA 1QQDA 1D5XA 4G8FB 4HS3B 4Y4FB 1ED3A 1QTYT 3MBXH 3HNVH 4R7DA 2FLRT 5IFAL 3RVXD 1GIGL 5TE4L 4GAYB 5LWYL 1A4JA 3FQUB 3L3GB 4CVWA 1CLYL 2YD9A 3OMZA 2R0WL 4PRIB 4TTDD 3BAEH 5EUOB 3O4LD 3H2WA 4YEFA 5JQ6L 3CVHA 3MJ7A 2EC9T 3HZKA 3BH9A 1S5HA 3BGMB 2X4SB 5CBEA 4Z6AT 4CN4A 1TTFA 3TA3C 1CFSB 2O93L 5FIEA 2VXQL 2E7MA 2FGWH 3HNSH 4HIHA 4PV9B 4G8GD 3BDYH 4R26H 4PJCE 4BUGA 1RUPL 4ZDHB 4ZMAT 3W5NA 1NFIA 1T04A 2B1AL 3TEUA 2HVJA 3WFBL 1S7WA 3VFOB 3G6JF 2X4QA 4GRWE 4I3SH 5EU7E 3TA3D 1FVDA 2XWBB 1LO4H 1CD9B 2CUMA 3ARFD 3EFFB 4LCIH 1HQ4A 1A7QL 4J4PA 4URTB 5IMLB 4EVNA 3JUYA 3VXUE 5HPMB 1JN6A 1ZLSH 1BBJB 4HUMB 3SDXF 4U6VL 2Q8BL 5ERWA 5D7LD 4JFYA 4J3UA 1W72H 1N3NB 1QLRB 1MI5A 3BZ4A 4MA1C 2NYYC 4R2GB 3D69A 4F2MB 5GS0H 1PQZB 4OLUH 4O00A 1Q0XH 2EH8L 3BYTA 4NO5A 3IFNH 3MOBL 3D9AH 4V1DD 4D3CH 3RVTC 5JZ7D 2JKXA 2NYYD 2VXVH 1G1CA 4G6JL 1T03L 4RIRA 5DRNA 2FIRT 4M5YL 1CVRA 4HC1A 5DI8B 5F88A 3ESUF 2YRPA 4HAGA 3RRQA 5ETUA 5E9DD 1C12B 5IQ7H 3E3QC 3L95B 4NYLA 1T0PB 3VXUA 4NKDA 5D2LE 1HSBA 4FTVB 2VLME 3DUHA 1JP5A 4QT5B 4ODXB 2ZCKH 3PXJA 3QPXH 2W59A 5HI3D 4GLRI 5DMYA 4DOHB 1IBGH 4NUJA 3A6BL 4H8WC 3PF2A 1MFDH 4ELKA 3TV3H 4KKLC 4NRXA 3MV9B 3QI9A 4LSTH 5L0QC 4Z95H 1EX0A 1KC5L 2VDKH 3J8F7 1XGUB 4M00A 4QGYA 4WW2C 4YE4L 3WO4B 5EBWB 1QEWA 1CU4H 4QRSA 1MFAL 1INDH 4MQTB 1P9MC 5HJ3A 4EI6B 1R0AH 1YPZE 4ORGB 2CKBH 3MRLB 4F7MB 4O2EB 1NL0L 5B38B 1U8KB 1WEJH 5DTFA 2Y7QB 3FQRB 4PJ9C 1GAFL 3LIZH 2WZPD 3FRUA 1NCUA 1V7NL 2UUDH 2G2RB 2NY4C 5B22A 4GXUM 4F7EB 1E4XL 3TZVC 4G6FD 3FO0H 3W39A 2C5DC 2X9YA 5F96H 4QNPE 3CD4A 1RZJC 1T83C 2IPKA 1FYTB 3MX0A 1TCRA 5DJ2A 3MC0A 5F7DA 3VU2A 3WFHA 4LSDA 3RNKA 3MR9B 3F7VB 4HHAA 2KL6A 2YZ8A 3TC9A 1RHHB 2O5ZL 2NY4D 2VLJE 4F8TA 1OARH 4JN1L 4X99A 5SWSA 4Z0BH 4O2CA 3NCJH 2ZPKH 4X7SH 3T0AA 4U4BA 3DX9A 3AM8C 4HIEB 4BZYA 3R06A 3IDMB 5ALCL 5JPNA 4JZJC 4EZMA 2AEQL 5CEZL 2QHRH 2D31B 3C5ZD 1IMHC 2F54D 4Y0GA 4R4FL 2YN3A 5DFVC 3LV3B 4N0FA 3O6FA 4P9HH 5TH2B 4B5EA 1P6AB 1D9KC 1QPXA 1NBQA 4K94C 3VRLF 4RAVB 2G75B 2R39A 5E99H 1V3MA 3HNVL 3S34L 3PDDA 3TNMB 1FNAA 4U1LB 5ACZA 5TDNA 3MRIA 3QUYB 5EOCJ 4XWGH 1D9KD 3BAEL 3Q6FA 4UT7H 2G9HB 4N0UE 3OZ9H 1Z6JT 2EDYA 4LRIC 4OFDA 4QRQA 1N4XL 3AS2A 4RNRB 3V7AG 2PXYC 4M6OL 1A6ZB 3FTGB 3GKWH 4X4ME 3B2VL 3SGDI 1IKNA 1MCQA 4JHZA 2YWYA 3FFCD 4WGVB 3QEGH 2OJZL 3KPSB 4BM7A 4APQD 5J57B 1JJUA 4ZO8A 1T2XA 1GGIL 1D5IL 3MFFA 1TLKA 3NPSB 3KHOA 4I3SL 4FFYL 1LO3H 4M1GH 4HIJB 4IM8A 2CH8A 1NC2A 5IVXE 5C0AE 3GIZH 3W9EB 4JFOB 2H2SC 1QLFA 2GYSA 4DZ8A 2VDRL 1MRFL 3BW9A 1U3ZA 3VFRB 3GSUA 4G9DA 5KW9H 3HI1A 2WBJB 1W72L 1CFQB 3SDCB 2GSIB 4HS6B 1RJZB 3SKMB 1A9EB 3MLYH 1HQRB 1EA9C 1XCQA 4RFOL 2E8ZA 4XNZB 4Z7UE 1OTUC 4IRSA 5F9WB 1K6QL 1Q0XL 5CP3A 3WKMH 2BC4A 3OPZL 2ICWB 1TNNA 4ODWB 2EIDA 1MJUL 4HG4J 1T3FB 3EYOA 3C6LA 3MCG1 3LS5L 2IAND 1CR9H 3QJFB 2EDFA 3MACL 1YEKL 1F8TL 1R6VA 3WUWA 2NPLX 3AS1A 2H9GA 5TF1L 1U8JB 1JVKA 1ND0B 1W0WA 1EGJA 2AJVH 1AGCB 4HWBH 3RWIB 1V3KA 4U1IA 3AAZB 3MOAH 4I0PC 1RZIA 1VFAB 1U6AL 2I5YL 5F7HA 3K1KC 4DVRH 3EYFB 3MFGB 4QOKE 1G6RA 3P0YL 4B53A 1F11B 2XQBH 3I6KA 3RI5K 4KJPD 5HVHB 5C6PB 2AGJH 2W9EH 1HHJB 2ZCKL 3CC5A 3F12B 1T7YA 3NPZB 5E8PB 4YHNB 5HHMB 1CD1A 5MEQA 1VEPA 4I0PD 5FA4A 3UYPA 5I1AB 1JNNH 4XVSH 3QRFM 5FUZH 2R0LL 5C0FA 2YBRA 4LSTL 1QFWL 4Z7UA 4P2QB 5L88L 4KK9C 5LKNA 4JVUA 3G5XA 3P11L 4KV5E 3JV0A 4RMRA 1BIHA 3LAFA 4HX1B 2P44B 1R5VB 1OCWL 3UYRH 4BK5A 4NP4H 2VXTH 4QHLB 3MRPA 3B8SA 5J3HD 2IPUK 3KLAA 3SHSA 3OKNB 3S5LA 4OUUB 4ERSL 1CDCA 3DX8B 4KQ3L 2R2CA 3QEHA 3RY4A 2R29L 1FE8L 3CFCL 1NFKA 5EU5B 4KK9D 1SEBA 3HR5B 1WTGT 2WLYA 5HVFB 1BD2D 3VFSB 1G7MB 4HLJA 1SMOA 2QQQA 3MV11 4OLEA 1D5MB 5DEFA 3Q3GB 3DRQB 4L4VA 2WWMC 2AK4A 3PABB 4HJ0D 4QOKA 1H3UA 4X7TB 1U3YA 4WI6A 3PHOA 5C0JB 3BHBB 1IEAA 4MJIB 4GXVL 5CILH 2VE6B 1B88A 1LO2L 2HJLA 1KSRA 1EJ6A 3L7EB 3NCEB 4PGEA 2A6JA 3QFJD 4X7SL 4EN3D 5GHWL 1AE6H 4PJBF 3BP4A 4IS6B 1MFBH 1MELA 2LVCA 1T20B 3W2DL 3ISWA 4ZS7L 1BBDL 2ADIB 3CFEA 2PW1B 4JLRA 1IAIL 1M05A 1JI1A 4ZUSB 3NVQA 5C07A 5C0GA 4XBPB 2P5WE 1J9CT 4CMHB 4I48A 4ZAKC 3MV8E 1KGCD 5FAAA 2BFVH 3HN3A 4P9HL 5HDQH 3UTZB 3DIFB 1DBMH 4MCYB 3GJFK 2ORBH 3D2UB 4GKSB 4LEOB 4N8CL 2DDQL 4QO1A 4PTUB 2J6EL 1A21A 2AK1H 1ZVSB 1SJXA 2JE8A 1TJHL 2GJ6B 3NN8B 1CXLA 5DUML 1KXVC 4J6RL 4S0SD 4XNMA 2YMXH 4UB0H 3O6KH 5AZEL 3RDTD 5IV2A 4XI5C 1MLCA 4HUVA 4ZFOB 2FL5A 5MEPA 3MODL 4OLYL 3QQ3A 4KVCH 4LP5A 4PP2B 4R96A 2VQ1A 3EW3B 4TSCL 3RQ3A 2EIZA 3WS6C 2ICES 4EXPX 4R0LA 3ARBC 5JOPD 4ODHL 2NNAA 3DVGB 4OBRA 3DYPA 1LEGA 1WC7A 3QDMB 3VFTB 1N6VA 3VW3H 3EO0B 2IPUG 1CIUA 1VADA 3DX7A 4TSBL 4M02A 3S88L 3E6HB 3ULUL 3MXWH 1P6FA 1WT5C 1M7XA 3MA9L 5HYJE 3REVA 4W6XB 2XPGB 2EH7H 3FOMA 4WO4A 4FRWA 4WJ5B 4M3KB 4XPTH 4FQXA 3SO3B 3QXWA 5EULV 5GISL 1F3RB 3VWKC 4NN5C 5KW9L 5EBMA 4YFLI 4JZOB 5C6WH 2X4NA 4EI5C 3O3DA 1FZJA 4OM0H 5DQDH 5I2IA 5C0EB 4NZRL 1KTDB 5F97E 1I1CA 5KVFH 2QL1A 4LDLB 1SYSB 3E0GA 5CEZD 2PO6A 1J0KA 2DLFH 5FHBL 5F9DC 1OT2A 4P23C 3QUXD 1J88A 3QA3A 5EZOL 5KG9B 5E95B 5IBTH 4PG9B 5IB2A 3G5YA 4OV5A 2VMFA 5HGDB 4PJHF 3IETA 4XCCH 2DWDB 2ED8A 5GRUL 4PYGA 1XR8B 4FXGB 5FYJD 2FX7H 3MRDB 3MV7B 1JNLL 4JM4L 1VGKA 2ZSWA 4Z7VE 3VI4E 5D7IA 5D7JC 4OSUL 1KJVB 3QR2A 3T2PA 3V0VB 5EU4B 4NPYA 5JQHC 4N5UA 4K3DH 2WUCH 4XP9H 4RWHA 2GT9A 4UU9B 4Q9QL 1U3JA 1UACL 3MREA 1JHTA 4Y4KC 3VXPA 5DD0L 5KSBE 5ECJE 3GSWB 4D9RE 1RZFH 3TH3T 1A3RH 1G7JB 1D5XB 4ELMA 2ZCHH 1JNNL 1YN7A 3L1OH 4TSAH 3SCMB 1OWWA 4F57L 1FLRH 2AJXH 5I75C 2PUQT 3CU1A 4QRRA 1OGAD 3G6DL 3MLWH 3BD3A 3MJ9L 5I1IL 4OCRH 3U6RA 2AJSL 2D7TL 2YPKA 4YHYC 3BKMH 4QRUA 3MJ7B 3FRPA 1RMFH 2R4SH 3BH9B 1S5HB 3HZKB 4U0QB 4C4KT 2UUDK 2VOTA 3NA9H 5CBEB 4MNQD 1D3CA 1YC8A 1SBBA 2XZQH 3RKDD 4PRPA 4HIHB 1AXIB 1U36A 5CBAA 25C8L 1NFIB 1T04B 4G9FD 1IT9H 2HVJB 1S7WB 2YSSA 1DCLA 4DVBA 1VSCA 2X4QB 3NCCB 1NFDF 1T80A 1CXEA 5KSBA 4NQDD 5T1MA 3SQOL 5I17A 3O2WH 5E03A 5KVMC 1HQ4B 2K9UA 4OZFH 4EVNB 3DHJA 2ZUWA 3UBXI 3N1PC 3SDXE 3WLBB 4DAGH 4O51A 4YH6A 5DD1H 5KSAD 2R2BA 1WAAF 4FFZH 5ERWB 1YC7A 3QQ4A 4Q7DA 3TT3L 2ILLA 4WFFD 5IHBA 2IBGA 3BZ4B 4JRYA 2EO9A 4OTXH 3BUTA 1EPFA 3MLXL 1T7WA 3D69B 4LPTA 5DMIL 3KR3H 4J3WA 3CFBA 3RGVC 5I8OH 4K9EL 3WHXA 4P59L 4NO5B 2QKIA 1XF4A 3UBXB 3JZ7A 2AK1L 5TQ0H 3EJYC 5FYLD 4R90L 3WKNA 4OZGF 4H1LH 1EH9A 3L3IA 3SN6N 5I1CH 1D7FA 1V8HA 4RIRB 4RGNE 4RGMB 5DRNB 3EZJB 4MJ5A 9CGTA 3G6JA 2WBWB 1QFUL 4KMLB 1LO0H 2YS4A 1CICD 1YY9D 2VDMH 5F88B 1XH3A 4OGYH 1J8HD 2BNRA 1R3IH 3IDXH 4K7PL 2H32A 3EJYD 1EBAA 5ETUB 2A9NH 1HZHL 2XIDA 4FQ2L 4NYLB 1M7DB 3VXUB 3SDXA 4NKDB 2X4TA 3PXHA 4QLRA 1HSBB 1IC4L 4MSWA 3KXFE 4MNHA 2ESVA 2ZOLA 5IROA 3D1MC 2RQ8A 1N59A 4NUJB 1CYGA 4RQQA 5E6IB 2R0ZH 4ELKB 1YEJL 2BSRA 1ODAA 3G6AA 4NRXB 1DBAH 2W0FA 5DFTA 4LHUB 4UV4H 2W9DL 4NN7B 1QEWB 4QRSB 3MRNA 3D6GA 5HJ3B 3AXLA 1BQLH 5CJ8A 5BMFH 3MRGA 2SEBA 3G04A 2EDHA 2OI9B 4P9HC 5DTFB 4P49A 3O8XB 2JJVA 3UTTE 2FH8A 4YLQT 3W39B 2BHZA 2VABA 4QXTA 3MROA 4WEMB 2IPKB 5ANMA 5F7DB 1TCRB 5DJ2B 5DJZA 3WFHB 2V9TA 2FJGA 1NDMA 3V5DA 3DUSA 4HHAB 5E4EB 4HFUH 3LZFL 4Y4FD 2QSVA 5DJAA 3HMWL 1YNKL 1J05A 3RZCC 4WEUD 2ZSVA 1AR2A 4WEBH 4X99B 5SWSB 2NZ9D 4P4KC 4O2CB 1FBIH 4L1HA 5GRWA 5DUPH 3DX9B 4F9PC 4G42A 1M7IA 3E2HB 5JW3L 5JPNB 3T0VA 4PRID 4Z7QF 5J6GA 5ADOL 5GGQH 3EKCA 2W0LA 2KQMA 2EDQA 1JWUB 4PR5A 3ULUC 3BE1L 2N1KA 3EOTL 2H41A 2CO7B 4N0FB 3ZKMC 3VRLE 3FAWA 3P0VH 2MJWA 2HKFH 4AT6A 4M5ZL 3B8YA 5CIPH 1M4KA 4NZJA 3KLHD 4WW1A 4K8RL 2VUYA 2NY3C 5ACZB 5KAQF 3BX7C 1ZHKA 2FSEA 2XY1A 1X6NA 4OD2A 5CS7A 5TDNB 4TTGA 3ULUD 5CAYB 4ZFGH 1AXTH 2WWKO 2RJMA 3Q6FB 3RWGA 1ADQA 5FUCC 1NLDL 4UIKL 15C8L 5SWZD 3H3PH 5JDJA 2R4SL 4BK4A 2KH2B 4QRQB 4HQQH 1XCTA 5CGYC 5EN2B 1GZQA 4QRTA 2VLJB 1TITA 4L8SC 3SDDA 2RCSL 1YY8A 1ZK9A 1QHPA 5JMRA 2XFXA 1KCUL 1UWGH 4R2GD 3PQYA 3RFZC 1IT9L 2A1WL 1QSZA 1MUJA 3IB4A 4YQXH 4YZFF 1LWRA 3A0OA 1NC2B 3VGGA 1SM3L 1RSFA 2FX9H 2BY3A 1QLFB 3UZEA 3ZKND 4LCUB 2Q7NA 5CZVL 3ESVF 1KJ2A 3GSUB 4G9DB 1AQKL 1JE6A 3HI1B 2R8SH 2XY2A 3MCKA 2L0DA 4BSVA 2NY6C 4M7LH 2CK0H 1XCQB 1PG7W 4ZPVA 1FQ9C 4N0UB 1I1RA 4BFGA 4IRSB 1DQJA 1E27A 4ZQKA 1K3ZA 2BC4B 4XBEL 3DARA 3ARQA 4FTVD 3SGJC 3LEVL 3WO4C 3EYOB 3C6LB 2IG2L 4HPOH 5GGRA 1EJOL 4YK4B 2ZKHL 4LSQL 4R97B 3WUWB 2A0LC 3KPNA 2OS7A 5I1CL 4JQXA 2H9GB 1CDYA 3UTPD 3K8LA 3MV9D 3JXAA 4U1IB 3RHWF 4X4XA 3UROR 1X5KA 4PB9L 1RZIB 5FYKL 1BLNA 1OB1A 2M2DA 2OQJA 1BAFL 1G6RB 3QHFL 5GS3A 3I6KB 4U3XA 4FQIL 4D0DA 3CC5B 3EIFA 3RJQB 1U92A 1CD1B 1Q1JL 5MEQB 4NC2B 4JFFE 5KSUA 5EC2B 4BUHA 5C0FB 2YBRB 4Z7UB 3BQUA 3G5XB 4JG1H 3V4PL 2BXYA 3QXUA 1TJGH 4GO6B 1G7QA 3I50L 4ONFH 1NLBH 2ADFL 1DSFL 3MRPB 4G80A 3QIBC 1OTTD 2IC2A 4L1DA 4MX7A 5AZ2L 4KTDH 1L6ZA 3S5LB 4D9LH 4MHHI 1MWAA 3HPJA 3QEHB 1NUGA 1QO3A 1OSZA 4TRPH 5J6HA 4L8BA 1XF3A 5EA0H 1SEBB 5EZIL 3IFOB 5F6IB 2DIJA 4ZNEA 3D39D 2DQTL 4Y16A 5EORH 2APXA 2YR3A 4NO2A 5DEFB 2HMID 4L4VB 2AK4B 3O9WD 1MJJA 3BPCA 3QRGL 4QOKB 3O6LH 4PJ8C 3PHOB 1IEAB 1KELH 1VB9A 2OMNA 4OUOA 4OV6F 4CW1A 5IIEA 4NJ9H 1DN0A 1LP9A 4PGEB 2A6JB 5B8CA 5H35A 4Y4HA 4X83A 3QSKB 1MNUH 5DUPL 3QUYD 2O61B 3OB0H 3BP4B 2XTLA 3EYQC 2XZCH 5C3TA 1MFNA 3CFEB 2AEWA 4JLRB 4WENB 1CL7I 1M05B 3QUZA 3WXWH 5C07B 3T2NH 5C0GB 1OAYH 2E7HA 4NQVA 1LD9A 3HI5H 3I3DA 5D6DA 1H8SA 3OF6A 1IKFH 3N85H 2XTJD 5J89A 4NWTH 4HUKB 3X3FH 1I9IH 5EBLB 3WV0A 1RD6A 3S96A 1KEGH 3KPSD 2ERJB 5DMKA 1TPXC 4JFZH 3NTCH 3PWVA 3HNTH 5LQBH 1F58L 1JNHA 2NZIA 4XNMB 3FL7A 3GGWA 4BQ6A 1AXTL 4ORZC 5IV2B 4KY1L 3SDCC 1MLCB 4HUVB 5C09D 2FL5B 5MEPB 3U7AA 5HHNA 4M1CD 2VQ1B 4HQQL 2EIZB 4N5ED 2P49B 5F9WC 2CJUH 2IBBA 3QXDA 4K55A 4X6FA 2NNAB 2WBJD 1LEGB 1CI5A 4PJBA 1Z5LA 1WC7B 5IGXH 1JMXA 2LV4A 1AGEA 4S10A 3OHXB 2QLVB 4J8RB 1VADB 4WI9A 5DJDA 4XNUL 4MXVF 3RIFK 3TBTA 4XC1H 4PFEA 5CD5C 1DVFA 3JTSB 1A1MA 3REVB 4HWUA 3MV8B 5HXMA 1QYGH 3FOMB 4WO4B 5FM5M 5DC4B 3FMGH 4FQXB 3BN3B 2ATPA 3RWDA 4U1SA 2F8OA 4GAJH 3EYVB 1JBJA 3OR7A 4PJ7F 4KAQH 5EBMB 3QUKB 5FFLA 3O3DB 4UT6L 4M03A 1PBYA 1G9MH 2EDBA 4PJDF 4WY7L 3CCHA 1S5IH 3KVQA 5DRZA 4YPJA 4K8RC 2PO6B 4KDVA 2W9LA 4LVHB 4UILH 1VFBA 4ODVL 3P4OA 2X4OA 4M3JA 1ZGLP