3NRPA

Crystal structure of 'as isolated' uropathogenic e. coli strain f11 fetp recombinantly expressed in the periplasm of e. coli bl21(de3)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
152
structure length
152
Chain Sequence
GFKEYPAGEPVTMNEMELAAVYLQPIDMEPRGMGLPAAKADVHLEADIHAVEGNKNGFGAGEWIPYLTISYTLVNNDTGEKQEGTFMPMVASDGPHYGANIKMMGVGNYKVTYHIEPPSKAGMHRHTDSETGVGRWWKPFDVSYEFKYVGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Periplasmic protein-probably involved in high-affinity Fe2+
publication title Characterization of a Dipartite Iron Uptake System from Uropathogenic Escherichia coli Strain F11.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3nrpA00
3PJLA 2O6EA 3NRPA 5I0VA 2O6DA 5I0YA 3PJNA 3LZQA 3LZLA 3LZPA 5I0XA 3LZRA 2O6CA 5I0WA 3LZNA 3NRQA 3LZOA 2O6FA
chains in the Genus database with same CATH superfamily
3QEUB 4NC1E 4AEHH 3GK8L 2QKIA 4GY4A 4NUMA 1CFNB 5BO0D 3UACA 3WHXB 2XNAB 4ODTH 5HYSG 5CIPA 4W9GC 3ZO0A 3HMWH 1U3HA 4MCZA 3NGBB 2XN9B 4TULL 4PSRA 2QV2A 2YD6A 2XC8A 1TTBA 4TSCH 4L0YA 2XICA 2HVJA 5DUBB 1W80A 4JHUA 4R8WL 4YWGL 3Q3GA 4B0MM 3MV8B 1AXSB 1MW2A 3ET9F 3ARBA 4QGTA 3E6HB 3FSZA 1B6UA 4QNPE 3OJDB 5IG7A 4OV5A 1XCXA 2V5MA 4KH2A 5JW5B 1YEFH 2D03H 3MHZA 4XN8A 1Z2KA 3BWZA 1IJNA 1PYWB 3W11D 4DCQB 2MQ3A 4MAZA 1TJGH 2B15A 5DRZB 1X5HA 2F74B 5EN2B 4KVNL 3W3BA 3SDAB 4QRAA 2G75B 2IALB 3WFBH 4PJBF 1LYQA 2W0KA 4JUSA 4YDMA 4ZPTB 3QEHB 2J1XA 1PBYA 4M62L 4FZEH 2C34A 4F3FB 1JV5A 5I1LB 3BZEB 4B9JA 3Q5OA 1X5MA 2Q2EB 4XPBL 1MJUH 2VN7A 2Y3AA 3O2DH 1JOIA 2ZWYA 3NSYA 1BD2D 5BZWB 2I26N 4Y16D 1CTNA 2Q5BA 3NJLA 3QUKA 1OAQL 1JERA 1NEPA 3FQWA 1G7IB 3RIAF 2MOGA 4L4VD 2J1KA 2R2BA 4WW1B 4Y5XA 4ZPVA 2K3HA 4HKZA 3RNQA 4BH7A 4C83B 1SMDA 5LAXB 1TUPA 1BD2A 2P8MB 4BQ8A 5HP5A 4ABQA 2BVTA 1HEZA 1A7OH 1AIFA 3P0VL 5B39A 5I6KA 4L4VA 3F6LA 3ZE2E 1DSFH 2BH0A 4ZUVB 1GVIA 3QAZC 1LGVA 5ADOH 5C9KA 1LDSA 2YBRB 1ZJAA 1DLFL 5CJBA 3DOIA 5HY9A 4WJ5B 4JUTA 3LAFA 2A83A 4NO2B 1Q0XH 4ADGA 2FDBP 3HHSB 4FJZA 2VTFA 5TQ2H 1SYVB 2GC7C 2XZCH 4NKDB 4F7KA 3B9KC 2WWNA 1JTTA 4KMTL 1T1YA 5FYKU 5CSZA 1HYSC 3W1ZA 3C08L 3GDBA 1P7QD 3CX2A 4M7LT 1UWXK 3BZFB 4LLWA 3A5VA 3WY2A 3NIGE 5A16A 3RWCA 3BC9A 3N06B 5ID1A 4MDIA 2AJVL 4WFFE 5I0DA 4ELMA 1MI5E 2NYZA 3IDGB 4K71C 2YD7A 1U9KA 2WVUA 3HFFA 4GAJH 5LQBH 1LE9B 1U92A 4HIIA 3LMJL 2NDFA 3RL1B 4FLOA 3JZ7A 2E4FA 4PJHB 3WCYA 5EU3A 4M5ZH 3QQNA 1FLTX 4JG9A 2WBXA 5HGAB 5GZOC 1HEJC 2F58H 1CDJA 2XA3A 2KERA 1FNHA 2GY7B 2IGTA 4YHKH 4CRPA 1W0WB 5FS5A 4HH8A 4KI1A 1OKEA 1QNZL 2XZAH 4HPOL 1IAII 4YVUA 2J25A 2V17L 1AGDB 4QRTA 4B95C 5GS0C 1K8DB 4NJ9H 2RFXA 5AOMA 1I3RA 2ZOUA 1J8RA 3BPLB 3IKKA 1Q9LB 3PNRB 3LX9A 3NCJH 3HPLB 3I74A 3IMSA 1IIKA 3IWVA 4WO4D 4J28A 4YHLH 2RHEA 1XH1A 5BCAA 3CPLA 1KLFA 5FYKH 2YZ1A 4HG4K 2VERN 4ODXB 4K2UL 5F1IA 2YKLH 2H9GB 1JHLH 2K0RA 2KPNA 2EICA 3R8QA 4LCCB 4D8PB 3B56A 5DR5H 2J6EL 2NY0C 4WO4A 4F91B 3TEYA 2MQ0A 2GT9A 4GSDL 1T66C 3FPXA 4MX7B 4J3TA 4QPEA 1UD3A 4QXGH 1HE7A 1IFGA 1UKTA 3L45A 1JGVL 3D18A 2NY3C 2D7PA 3S96A 4CVXA 2FVNA 1ZGLP 3FH5A 4G3YL 3GZKA 2QVIA 4UBDD 2R27A 4J3OD 2CHDA 1IX2A 1JNHA 3AGWA 3ILQD 2E7HA 1EEQA 3QUZB 2B1HH 3QZWG 5J8OA 4R7NB 3E9UA 1LP9A 1QLEL 1WE5A 1UB6B 3HMXH 4G8FA 3QE5A 1TZGL 4YXKH 3CLFL 1HILA 2ENYA 2M83A 5IUCA 1UD5A 4IRSB 3MLYL 4XCNA 1JE6A 5IB4B 1JGDA 5T3ZH 3GO1H 3UJIL 1S8DA 3IDYB 4JANB 2XWTB 1F56A 4HCRA 4KVPA 5BJTA 5DJ8B 3C8HA 3GSNL 3HC4H 3KZ8A 3VSVA 1NUGA 2DKUA 3NCBB 5T5NG 2X41A 2ZP0T 2GI0A 4YSOA 5LBVA 1X9QA 4EI0A 1ETA1 3ARDB 3IDMA 3M1OA 1EA9C 1JMZA 1ROCA 4LLYA 1E2ZA 4XC3H 5I1CL 3V0VA 4P2OC 3RWFA 3VNYA 4RA0C 2GJ6A 3OKOA 1SHWA 3AFLA 3QUML 4H40A 5EOCJ 3PAUA 5CZXD 3V8CA 5IJVB 4V1DD 1PZ3A 1CYGA 4R7DB 1O6SB 1IARB 1WYJA 4JRXE 1OW0C 1OD9A 5I8CB 1T7VA 1A9BB 4DUVA 4FTVD 3ZDWA 2W9LA 4O5LL 1WZKA 2HJLB 1G4RA 2CLVB 3O4LD 1RUMH 4WU7A 3CN2A 3VXSB 3UTSB 4A37A 2W65B 4UINL 2OW7A 4APXA 5HI3D 3ZW3A 1MQKH 3IPBA 4WHDA 3MNVB 4ZRGA 1IGJA 4F7PB 4ZMVA 2EJ1A 4ZFGH 4JRWA 3RZWA 3U0PB 4NUQA 3X2QB 4OJFH 3MUJA 2R56H 4PS4L 5AYUH 2XXFA 4JAMB 5BV7H 5JOPE 4HMCA 3RYMA 2D9CA 1QLFA 3GB7B 4YSDA 4EI6B 2VABB 3CK0L 4PG9B 2HN7A 5HHOE 1I9IH 3EGDB 5HDQH 4BQBA 5JPMA 4QHMA 2VC2L 1QFUH 1W72B 4OLVL 4JLRB 1AO7D 3EUDA 2WYZA 3VRIB 2JKWA 3WE6B 5HVFB 4X6CE 2GUOB 4TQHA 3ZMNA 2L7UA 4OI8A 2AJUH 1KACB 2QHRH 4MXWL 4FQIH 5EIIA 1NBQA 3ZR6A 3UEZA 2AV1B 3LSOB 3SE4C 5ACZB 7TAAA 4NNXB 1MIEH 3OKMA 5C1MB 1ACXA 3UGXA 1G0XA 3D39D 3K4AA 1UEMA 1JV2A 1S5HA 4F1ZA 2IWEA 3ZQXA 2CBQA 1QASA 3V4VB 4L5FE 1FFRA 2FHCA 4QY8A 5IT2H 1RUKH 1EXUB 1F2XK 1R3LA 3ATBA 3B2MA 5CZRA 2YAQA 5K9KB 3CQQA 4GSXA 4S0TD 1MCKA 2FD6L 2E7CA 4XZUB 43CAA 3FCTB 4W9IC 1QI5A 2NUTB 2DQJH 5GHWL 1QSFD 3ZKNC 3LQZA 4WDIB 4QHLB 3K71A 1MCCA 4NO0A 1DBMH 1KIUA 4QT5B 3VXRD 1ILUA 3JWDL 3VD2A 3VD3A 1MH5B 3D3VD 3QJRB 1DEDA 3KPOB 1BVKB 1KV7A 2YGVA 4UQ2B 3PWPE 3B2VL 1WCBB 5E99H 4CW1A 4EN3B 3H3BC 1DBBH 4FJ6A 1IAIM 3V5KB 4B5EA 4D0BA 4HS6B 1ETJA 4TSAL 2P48B 4Q6IA 1N64L 2DQTL 2OQJB 9PCYA 1XB6A 5K1NA 2B3RA 2IJ0C 4I9XA 4MB4A 1XD0A 3EBIA 2Z31B 1A6TB 3GINA 1PJ9A 1VZHA 1RP8A 3NCYP 2EE2A 4HFWA 3BCDA 4R7LA 4H25A 4BFGA 3CVHL 3I75B 5SX5H 4F5CE 5I1HL 1MNUL 3NCCB 2M8XA 3QFJB 4DKTA 1F41A 1JNNL 4XOCA 3EHBB 1CLVA 2WKLA 3TZVB 4HK0A 4OD2B 3MJ6A 2DKMA 2WAHA 5A2LH 3MV9E 3W9EA 4AQ1B 3IKCB 4EUPB 3MRLB 3NN8A 4TQEH 4PCKA 3GRGA 4Y1AA 1FSKB 3IAPA 4RMTA 4XTRD 1YY9D 1QBMH 3NCWA 3NJJA 3UYPA 5DHXB 4G6ML 1KB5H 4NCC2 2VDPL 3V0JA 2BMKA 4KK6D 5DK3A 3GUTA 3PF2A 5E56A 4MJIB 4M6AA 3BRGC 3BP5B 2IH3A 1ZS8B 3G5WA 1PEZA 2CK0H 5HYQB 1RJZB 3BOVA 3D05A 1FF5A 4NSKB 1ONQB 3WO4B 2BVUA 2HT4C 5K9QG 4NM8H 3M1CA 4H8VA 5DRWB 4M8VA 5DMGC 4WSGA 1UENA 4A39A 2APTA 3FB8A 1CE6B 4MQXD 4N0UA 1PDKB 4QRUA 1E8WA 3BUDA 2CG9X 4PJ8C 1BOGA 1FNLA 3VCLA 2X4UA 1LNUA 3AB0B 2ZIDA 4NLAA 4UZSA 1RMFL 4X9HA 2OPCA 3U0WL 3A0OA 1MG2C 1BF2A 2VAAB 1HVXA 1ADQA 2QBWA 3BEWA 3CSTA 4M6NH 1XXDC 5DUPL 1EXHA 4JE4B 4PGCA 2DTML 2KLSA 4ZFFB 2XN1A 4KROB 5GZNA 3IJHA 2X89D 3O8XD 2JI2A 3PREA 4H1LA 3V6OC 5J56B 4FLHA 1CN4A 4GLRI 3SDXB 1YY8B 2BVYA 5AB9A 4XXCA 4KJQD 2WLNA 2X6VA 4GS7B 2YIHA 4Z0BL 1U8OB 2IQAA 1T89A 2ARJA 5FUCE 1FIEA 4A38A 1DVFB 2OMUB 3HA0A 4IQHA 4X50A 3BISA 4ONOA 4KWUA 4TPRH 4F8OA 3SDCD 2X89A 1R5IB 3O8XA 5H4YA 1E2WA 1NZRA 4F20A 3MUZ1 5IOPB 1JBJA 2XV6B 3W39A 1JDDA 2I7SA 5AKVA 5B7FA 1KCRH 4M3JA 5CU5A 1UASA 4HD5A 4J4PA 3PY9A 5INCB 5C0DB 2VZTA 4DP9X 4TUUA 4PGBA 1KENH 5E6YA 4MCMA 3SDCA 1K2DB 4QJ5B 1A47A 4H8WH 4DO4A 4LVOB 3ZVVA 1RZFH 4LOFA 4AOFA 5JOFA 1N0XH 2NUPA 4AYBA 3TO4B 3UOAB 3WAJA 4YDLB 3FO9B 4RIRA 1X7QB 2DL9A 4YN3A 1CTOA 1LE5B 1MCQA 3MLWL 3STLA 3OKNB 1YNTB 1MCPL 5D70H 1EAPA 3A67H 1BCIA 3MRMB 3T0DA 2BP8A 1T0NB 1A6UL 1X5FA 4A2GA 1AR1C 1ZMYA 3UG3A 1ASPA 3N1PC 4PBXA 4HXAL 1OGAD 2KH2B 1INEH 3CXFA 1R0AL 5HI5D 5C07E 3QDMB 2GJZA 1GGYA 5EZIL 4FX5A 1KN4H 4HC1L 3WNMA 1YN6A 1A4JA 5EUOA 4P3WA 1TU2B 3FOMA 5KJ4A 5BRZE 2XFXB 1DQML 1REIA 4KGLA 4N9OB 3O9WA 2R15A 4DKFL 4ZMLA 4NGHH 5EEUA 4LLQB 1S9XB 4HPHA 5AAWA 3QPXH 3AU0A 5FFLA 4DEUA 3U6RA 4AL8L 2PPAA 4XN2A 1I7TA 1XVSA 1YEEH 3LPFA 4JKLA 1OD7A 4FXTA 4OIAA 3L6FA 4GYBA 3MRJA 5DJCA 2BNQA 1G9NL 3BZ5A 4HD9A 3DIFA 3EOBA 4G6JH 4WUUE 2GVYA 3MLXL 4YLCA 3HW7A 4Y8DC 4CNIB 3EXLA 2EUZA 1YNTF 4NUPA 4K9JA 3GXDA 4U33A 3EGXA 5GRUH 5ACLA 2ZJSL 3RVVC 3DETD 4LBEB 1IM3B 4FXKB 3KPQA 3LNFA 1UWYA 5JTWA 5C0EA 3VW3H 3OR6B 1HYRC 3B1UA 4NO3B 4PJIA 4W9CC 5C0CE 4WLCA 2BJMH 3BD3A 4JN2A 3IMTA 5LBSH 2J6WA 3V0HA 3ZL2A 2LTQC 3HBZA 5DHYA 1F6LL 3QRGL 1DJZA 5KVGE 4YAQB 1EERB 1EZVX 4EVNA 2DWTA 2N59A 2ZXBA 4XNUL 1MLCB 5F7FA 2Q86B 5J89A 2EKJA 2W0FB 4TUJA 1JGLH 25C8H 4PY7B 1AOHA 1WTLA 4X6EB 1IEHA 2HXAA 1SDYA 3RWGB 4NNPL 3OWEA 3RBGA 2DM7A 1OP5K 2AHIA 2XV0A 3HZYA 1BECA 3BSGA 3WKQA 2ROXA 4XNQB 1RHFA 5BRQA 3WYRA 2ICES 2QTVA 4JPKH 2PYEB 5K1VA 1CTMA 4UILL 2BWIA 3VXME 3GSUA 4FN0A 5DHVA 2NQCA 3U6XS 4BFIB 1JZGA 5D1QD 5IM7B 1GJUA 3AAZB 3FQXA 4PJGA 5FLUA 5E2WH 3TYFA 5MEQB 1R3IH 2J72A 2VDMH 3FULA 4H44C 2PCPB 1IFHL 5I0WA 1CICD 1KTKE 4AEEA 2CGZA 1AXTL 1FLRH 2NY4D 3KPTA 4CBZA 1KSRA 4QRSB 4U3HA 4MJ6A 3CBJB 4GG6B 2B8OT 3MRNB 3R19A 5A2CA 3SZ6A 1YVLA 4Q6KA 1DR9A 3IRPX 4NJAL 4U1HA 3QUXB 3CTTA 1E2VA 1U2HA 3DJZA 1CICA 2GK0B 5JHDE 3ULAB 3VI3F 5BMFL 5IGXH 4N90D 1RURH 2BC4B 3GJEA 5EZPA 4X4KA 3WHXA 4KNUA 2V2TA 4NS0A 1OSZB 2JKLA 2OX5A 5ALBH 1AIZA 1PZCA 1OOWA 1URZA 4U1GB 2BSCA 3BIKB 4WCYH 5DC2A 3INUL 5DK2A 3RVWC 4AQ8A 3GS7A 4HMEA 3FT1A 1CFVL 4S1RH 1T6VN 2FK9A 4Z8FH 5FW6A 4DSYA 4J12A 5JR1H 3RZCB 3K6SB 4ZMYA 3RUGE 5I30H 1I1CA 2D7OA 3ME0B 4WW2B 3SDDC 4KRLB 2AJSH 3E6HA 4MA7L 4NQXB 4LPYA 3LXAA 5DA0B 4N0FA 2HRGA 4LGSB 2UZIH 3BAYA 4Q9RH 1ND0A 2Y7LA 4JJHA 4LIQE 4OZHB 4PH8A 1J9SA 2VH5L 2BW5A 4X98A 5GQBA 1OL0A 2DW5A 3IFNL 5I6PA 2E6JA 1JCVA 4MDJB 4E41B 4UIMA 1NAKL 3EYUL 2CCLA 3QEQD 3WY1A 2R9HC 3WKMH 1PFOA 2XWBB 1DE4A 1P4BH 3RU8L 4QRRD 2N3JA 4TLTA 1ZVHA 2YHGA 2YPVL 3J2PA 3C5ZD 4DGYH 1FFTB 4I3RL 3U46A 4ENED 4JO5A 2GTQA 4H8QA 2I07A 2PR4L 5C2BH 1KCSL 3ZL4H 4OLZH 4LLDA 4WW1A 3QEQA 1I85A 4WW2F 2A3TA 1VJSA 5FGSA 5IB3A 3BSZA 3K2IA 3GEFA 4NZTH 2SEBA 1AZBA 2B59B 1LD9B 1GMEA 4M6OL 3FCSA 1X5AA 1U8QB 4JZJC 2FQEA 4OZHF 3L54A 2IAMC 1BBDH 2WY3B 3B3IA 2B16A 3QYMA 1BZDA 4HAKA 2JKXA 4OM0H 2NQDA 1HOCB 2YBRA 3L5XH 2FBRA 4ZXBB 4L23A 1MCNA 5HYEA 4NO2A 1YNLH 2F61A 2CLRA 2IEPA 2VLME 4B3VA 4WEEA 4U3XA 3S4SA 5ANHA 3IFLH 3SE9L 4P5TD 4F27A 3BEVA 4NO5A 1A7RH 4JFXA 4K8RC 3G7TA 1RZJC 5KSUA 5IVXE 1N8ZA 5EEVA 5F0LB 2Y1ZA 3VO0A 2CPCA 4L1TA 4E0RB 3IGLA 2F0CA 3K91A 1BV8A 3EOYG 2P49B 2BRQA 2LVCA 3TTYA 4P07A 1UD8A 5KSAC 4HSAC 1MAML 3DSFH 3MV7B 4FG6D 6PCYA 4YDVA 4P5TA 4PRHD 5D7LD 4N8VA 4ABVA 3TBWA 3NH7H 1GKEA 1LL1A 3IDGA 3WJJC 5I8OL 4ZS6C 2LW3A 1X4XA 1LE9A 2DYPD 1W6WA 4F2MB 5ALCH 3WMPA 5I5JA 4AXWB 2F8IA 4K07A 4DOHE 3H0TB 3QR2A 1ZSHA 3D5OF 4L8BB 2XVGA 5HGAA 1JWUA 1KTLA 3LPPA 3LKNA 5D7LA 3LRMA 3K1DA 1KGCE 5C0RH 4BWTA 2DLTA 4GFXA 2JMRA 1AGDA 1VERA 3OPZH 1K8DA 3VG0H 4KKLD 4CC0A 3FUMA 2UY7B 2VQ1A 2X09A 2HFEB 3CZJA 4JPVH 5C7ZA 1OAXH 5FA4B 3M07A 3FSWA 3WLBA 1KOAA 3L3IA 3NACL 3A4AA 3H54A 1HSBA 3I3EA 1B2WL 2EO7A 4F7MA 4LU5L 1NGPH 3REVA 4IRZH 1MFUA 4RGMB 3ESNA 2ATPB 2H9GA 3PXLA 4XPFH 5L4FA 3TURA 2AJ3A 3OGOE 2LFEA 3Q9QA 2F8XC 2A9NH 4DPCX 5FWRA 2FB4H 3L5WB 1RVFL 2A99A 2YOCA 1K8IB 4MX7A 1AHWC 4PJEA 1QEWB 3FMGL 2A9MH 2UUDK 1Y18B 1R3HA 2Q8AH 2C3HA 4U1IA 3NZHH 1OB1A 1JJUA 4XVJL 3IRCA 1IVTA 4N1HB 4R3SA 4PJAF 4RETB 3F3HA 4F8PA 1KYFA 4PFEA 5DVNA 2Y7QB 5DT1L 5A2IH 4G5AA 3QUZA 1IGYB 4Y4FB 1S7SA 2FUQA 4HUVB 2ALAA 3TONA 3FTGB 1RSFA 1W0VB 4ZSOB 2X4RA 1FQ9C 1L0QA 1JZ6A 1AE6L 4HEPA 4XODA 5LCVL 1I8AA 3KVDD 1G6RL 1CK0L 1JL8A 3DXAE 4Z18A 2Z93B 4U6XA 1T7XA 4YHYC 4QTIH 4IRSA 1W6LA 5BZDB 3VX1A 3K5SA 4EN3A 1GW6A 2XWTA 2R0LH 2VR9A 4TSBH 5DJ8A 1IAMA 2EEAA 5JXEC 1UZ8B 1ZHLA 3BAJA 4LMQE 3QXUA 1QLRA 1IBGH 4GO6B 3MGTB 2ZT9C 4HA1A 1ACYH 4I89A 1D6VL 3SO5A 1BVNP 3LKRB 3P4NB 5FGBA 1MJ8H 1I1AD 2CR6A 1GA2A 1UEYA 2FYVA 3KBFA 4RMWA 3UJTL 2R8SL 1EVTC 1JPGB 3CFIC 4CSZA 1TQSA 1K5NA 3ZJAA 2QSCL 5CEZD 2APSA 2BNUB 3P9LB 1HAUA 3WL9A 1MFCL 5D55A 3PIQB 3QZMA 1QKZL 1UA7A 2CLVA 4UAOC 5C0ND 3QCTH 1E3XA 3N04A 4QAMB 1M2OA 2W65A 1ETZB 3K7UA 1JGEB 5C2UB 4PCTA 4DW2H 1TTGA 2F5AL 4ORGA 1G7HA 2H1LM 1SVZA 2MPVA 4JFFD 3NBNA 1SEQH 2PWHA 2VXQA 4W4NA 3SZKC 4F7PA 2GSIB 4G9FE 4QYOB 4PHXA 2VN6A 2XQ0A 3VXQB 4O02H 4R2GD 3VVWA 4FCHA 5FCUH 3OKLA 2IGFL 4I85A 3BH9A 4FNLH 5IB1B 4JFFA 4ZUSA 4EI6A 2VM4A 2ZYSA 5C0JB 3PJNA 4PG9A 3N91A 2NNCA 3RPKA 4XBGA 3WMSA 5T1LB 1W72A 2R0ZL 4FRWA 4JLRA 4ODVL 3UPCA 2FAUA 1S78C 1YQ2A 3PU7A 5EBMB 3WE6A 3FSOA 5KSBF 3UTQA 3N42B 1E5CA 3QAZB 4NP4H 3US1A 1Q1JH 1UFGA 2GUOA 2RA1A 2YGNA 5D71H 5C6WH 3S97C 4PYGA 2X7LA 5L9DL 1KXQE 1UYWH 3MRKB 1YJDL 1WFIA 2GHZA 3GBEA 1J11A 2AV1A 2K7PA 3E0GA 3LSOA 3GIZH 5A2JH 3ASNB 1OIOA 3BQVA 3AU1A 3FL7A 3MFGB 4M1DH 4NNXA 3B9KB 3LD8C 5FYLD 2WLKA 5BO1L 3ZE2F 5I1KL 4MVBD 3V4VA 2JFCA 4V2BA 1ZIAA 3ZLQC 5KS9E 5DD3H 4AH2A 5JPNC 1ZXQA 1DQDL 1G9ML 5HJGA 3VXOA 5ES4B 2CO6B 2GITB 3LDBC 5BXFA 3R1GH 4R4FH 2V5YA 2R2HA 2WOBA 1PD0A 3FCTA 1QFWI 5CWSB 2NUTA 1IGML 3NEEA 4NOBA 2ED7A 3ABGA 3BN9C 4WDIA 1ANUA 1P4IH 2A1WH 4HLJA 5AOIA 4HLZG 5DFVD 5DD5H 5DURD 1MH5A 1E27B 3EYVB 3NIGF 5ISZD 2MQGA 5CUSL 3MXWL 3V9EA 3I50L 3NFPB 3SQBB 4HALA 2QDWA 4LEOB 4P9HC 3ATAA 3RGBA 1E9PA 2HH0L 2YMXL 1ADQL 3JWOC 4LQ1A 4XMKL 1C08A 4MCNA 3V5KA 3MZTA 2YA0A 1WEJH 2YEVB 2QPEB 4WFGD 5FUOL 1Q1PA 5H35B 4BHUI 2OQJA 3J07A 2AERT 4GFTB 1TJHL 1C16B 3PWLA 3DRQB 4NYLA 4KNTA 3EUUA 3MGOB 3F65A 3UAJC 5EZJB 1GIGL 3BH8A 3S2AA 1A6TA 3HLAA 4FXGC 5E9NA 3UBXA 3STZA 2FX8L 1DBJL 4K3DL 1XSIA 3UPAA 4I8DA 3I75A 4AM0B 1XCTA 4PRIB 3HG2A 1AGFB 4XBEL 5D2NA 1A3RL 4M43L 3TN0D 2OSLB 2Y5QA 1OOAA 1E6JH 1OEZW 3VFVB 3X14B 1QSEA 1PAMA 2X0VA 4OD2A 5B3SB 1J8HB 1IAOA 2VSCA 3KLKA 1RZ8B 4AQ1A 3HS0C 3GSXB 4HAFA 1NBCA 4I0PC 4UWQB 2ZQKA 4M7JL 4JREB 4KNQA 5I19H 4QOKD 2NY3B 3TN0A 1T21B 1NA8A 3O3AB 2AGJH 4EMZA 1JHKL 2MOVA 4JPWH 1CBVL 3JVFC 4FQQB 1F3JB 2XQYA 2X2HA 1IJ9A 4FQCH 4NRXA 3C2SA 4QOKA 5HDWA 5I5RA 1ONQA 4M7ZC 3BP6A 2EUWA 2CGRH 4BD4A 1GZPA 2OSYA 5KW9L 5DRWA 1TIUA 4LZKA 1FPTL 5CSBA 3ATDA 4WGKA 1T6BX 3R18A 5DJDA 2EYTB 32C2B 4OT1H 4OF6A 1VFBB 4J8QA 3ARFC 3KPMB 4HWUA 4GSQA 3TWYA 2WWKO 2K4WA 1NFDF 3Q6FA 2B4CC 4YDJA 1TCMA 3EO9L 5HPMB 1IBDA 1ZT1A 2D7NA 1IT9H 4P2OB 1L0XA 2FEDC 3CHQA 4DHLA 1OGTB 5I1IL 3O6KL 4UF7C 4ELDA 3WFHB 3U4AA 1CE1L 2QSVA 5EIIG 4HZAA 2YJQA 3SDXA 1F4XL 1D5ZB 1MW3A 4BFEA 3APCA 4GAFB 4KZEL 4YS4A 3DWTA 3TBCA 4AT6B 3P73B 2R7EA 5MERB 5C0BA 2P1YA 3H9HB 4A1RA 3C60C 1EGJH 4Q9CA 4G8IB 4RNRB 4MLIA 4X4YB 1TXKA 2MNJB 1AD0B 4OFYD 5KVGH 1JI1A 3CN3A 1IQWL 3KLSA 2LU5A 2YWZA 4NPYB 4YDIL 1X6LA 3HN8A 2NOYA 4KTYA 4XNDA 5INCA 3I02B 3MRRB 3BAEH 4TVSa 4U2ZA 2P45B 4NKIH 4QI3A 5LGHL 4RQQB 1MHCA 5C3TA 4AEIH 4WWKC 4YGVA 4OFYA 1D6EA 4PLNC 2BVQA 4NQTA 1M71A 2X12A 1WA2X 3MCG1 3HG1D 2VZ1A 5DS8B 7PCYA 3SOTA 3VM7A 5BUGA 3S6CA 2IDUA 4H26B 4KDVA 2BP3A 4YQXL 1LE5A 3OKNA 4XO9A 4Z3EA 4HUWA 1NIEA 3FHAA 1BP3B 1CF8L 1JWMA 3P9WB 4HHWA 4PP2A 2HLFD 5FYJU 4BKTC 3HG1A 2JTDA 3EDKA 4LSDA 1P9MA 2X2UA 3WKNA 3DV6B 1U4EA 2VGLM 1ES0B 1SQMA 3MBXH 2NYYD 1A65A 5KUKA 3M8OL 3KL3A 4XVSH 2EE3A 2GBUA 2P7TB 4X6CF 1TU2A 3T9WA 3PWPB 2F53B 3LQAL 1GRWA 2BSED 2ENJA 3NK4A 1LWHA 4JFHE 4QIRA 4WV1A 2CBTA 4HX1A 1MXGA 2C3WA 4LESA 3ISYA 4PV8B 4YDKL 4XO5A 1IKNC 3O6FD 3O0RL 1NIBA 3GSQB 5ID0A 4G6FD 3ZT7A 1VFAA 1N12A 4NWUL 1GGCH 2J8UE 2BSEA 3O6LH 4QEGA 2J73A 1EANA 2CE6A 1UA6L 1H5BC 2FX9H 7FABH 5EORL 3O6FA 1KXTA 4LBEA 2WQXA 4C4BA 4LIQH 3CZGA 5PCYA 4A6YB 3HG5A 5KVFE 5LNEA 4TLUA 2VDLB 4O02B 5EBWA 4G7VH 3L7FB 4J7RA 3MV9B 2WKOA 2FSEB 1IC5L 5FF6B 1KFAL 1FE8L 2I69A 5JOEA 4WKXA 3F04A 4BKSC 1QX1A 4N2DA 2XQYK 2XKNA 5MEPB 3QRLA 4YAQA 3P3TA 4IS6A 3KLHC 4M6MH 3GBML 2Q86A 3MXVH 2WBWB 2W0FA 2XWEA 4PD4J 5AKRA 1ZLSH 1EHXA 2E76C 1MW1A 1T1WB 4WEUD 1J0ZA 4BK4A 1M1XB 1BFOB 2DIAA 3QIUC 4XNQA 5GJTL 5KVMC 4PGDB 4LSTL 2PYEA 3F7YA 1ZGLA 1QG3A 5IVNA 1SHMA 4BFIA 4N2FA 2BXZA 5IM7A 5CJ8A 3S35L 3A6CL 3AAZA 3WFDH 3WN5C 2YPLE 4J5VA 4M61A 5DEZA 2XIIA 3BP7A 3KDPB 1BFTA 4GXVH 1L9OA 5L8JB 2PCPA 2QQNH 2WXRA 4KQ0A 4XB3A 2R1XA 2J12B 1T22B 3H6JA 4KZDH 2YEZB 4GW4A 2CIKB 2H6UA 3G5XA 5LNGA 5F71A 4GG6A 1WS8A 3I6SA 4RGNC 1ZE3C 5JORA 4JN1L 5BOZG 1WFJA 3ZMRA 3EFFA 3NAAL 1RULL 4JFTA 4ZJ9A 2DWDB 2IXQB 3FAXA 5TH2B 3WMQA 4Y0GA 1XSKA 5JW4N 2EIZA 4JB9L 4FQ1L 4LT7A 3Q5TA 2CJTA 3ZDXF 4PJ8B 4K23L 1WRFA 1XWVA 2FT8A 2NNAA 5TDNB 1OSZA 5I8KH 2P8LA 1NOLA 2CQVA 4MAUL 5C3LD 4X99A 5IMKB 2B0SH 2BCKB 2KS0A 3BIKA 1AMXA 3ZRCC 5JHMA 5DQ9B 5KWYC 4H2AA 3BFWA 1EZVY 4RDBA 1LK2A 4G82A 3RZCA 3K6SA 1AZNA 2PW1B 4NIYE 3ME0A 3X12B 5CJXA 3PWUB 5LUMA 5SWSD 1L0PA 4W93A 4N2MA 4X7DC 4WVRA 5LKNA 4S0HA 2VE6B 4L8SC 4ZS7L 4AVHA 1XGTB 4JY6B 3FB5B 4X5XB 4KOCA 1CGXA 1O9ZA 3G08B 5D7JD 4MAYD 3F05A 4IU2B 3MNDA 3LKQB 1H8NA 1SLVA 1NPJA 2G9HA 1H8SA 4O58L 2PWGA 5SWSA 2OK0L 2AEOA 2GY5A 2D3VA 1U3NA 2P5EE 1RZPA 4MDJA 4E41A 4FFZA 5J3HD 1VACA 2ETWA 1ED3A 3IAQA 2W9EL 1FZOA 2EKSB 4WKZA 2BDNH 1J8SA 2A7BA 2JXMB 5GS3A 5C07B 1NH6A 2D8KA 3ILDA 4M4PA 2Y1AA 4J8RB 1BZ7B 3NG5A 1I1YB 4PRNB 4RA3A 4ACTA 2IAND 2NY6C 5BRZB 5G2NA 2VDNH 1HE8A 4G8GE 3V9FA 4ZOCA 1WGOA 5L7XH 4LCIL 5HJBA 4ZG1A 1WBYB 2B59A 3IXAB 5EEWA 4ZZKA 4R5VA 3FCUB 3H2WA 3CMGA 4YH6A 2X1QA 5T33H 1QTSA 4TQ8A 1GC1H 5F7EH 3L95B 1AR1B 2WTPA 1O7SA 1HOEA 3E38A 2Z1PA 4J3VA 4X4ME 1S7TA 5DTFB 1J05B 5E8EB 1J5IA 4F37F 3LHPL 3D50A 3GBDA 2JJVA 2JWYA 4WUUB 4UB0L 4X5WA 3MRGA 3AXLB 4WI3A 2KYIA 1DJSA 3UO1H 3SCMB 4J6RL 5EO1B 2JB5H 2Y5TA 4DGVH 4N1CA 3I3DA 4OGYL 3S8GB 3VGDA 4OCRH 2WQAA 4RGOL 4ALAH 4UOQA 1MNNA 1Q9KA 2WYIA 3S5ZA 4O00A 3MACL 1M7XA 5I1AB 4JM2C 4UV4H 4N25A 4X8XA 4JM0A 2C9PA 2FEEI 3SKUD 1QZ1A 1OSYA 2FJHB 3MV7A 5C0CB 2NTSP 3WDIA 2XY2A 3TEUA 4UNVA 4CJ0A 2EE0A 2KLRA 4Q4IA 1YECH 3KGUA 3T3PB 4KXAA 1EO5A 1TNNA 3ARPA 4L8BA 2A2QT 4LASH 3IFPB 5E6ID 1Q72H 1V3KA 3DX6B 1TMCB 2E8ZA 1M3IA 1XF5B 4X6DA 1TYJA 2EDEA 3T2NL 2EXTA 3SDYL 2YR3A 5E2VL 1CGVA 2YBGA 2YFOA 5DA4A 2OSWA 5HGBA 2Z4TA 2Y6SD 4ICXA 2Y2TA 3QT2A 4OZFH 3VXMB 3V6FA 2UY7A 2L7EA 3ARGC 3CBKB 1CDCA 5ESQA 3TBVA 1WA0X 1B9ZA 3WTXA 4P3DA 2LTQB 1BYPA 1RUQH 4PV1C 3GI8L 5E6IA 2K6WA 3NJGA 5FA4A 1CVSC 2ROYA 3ML9A 3LB6D 5F70A 1A0QH 1FC2D 1LEIA 1E4XL 4FKHA 4NFCA 1U3JA 1C5CH 3VWJC 5IF0A 1KIPB 1KFGA 5IJKA 4WSJA 1ZVYA 2JELH 1T83A 2B7DT 4E9QA 3BQUC 2BIOA 4PJ9C 4ZBJA 1KIRA 1G7PB 2BOBA 5CEZL 2EIJB 4XR8C 4RSVA 1K8IA 3TIEA 1LWJA 1TJMA 3K72B 1QEWA 4H0HB 5JHDB 2VL4A 4ZMTA 3NPSC 1XD1A 5K59F 3KVQA 4OZGE 1R1CA 2YD5A 2N0MA 2Z4QB 3GS4A 5AWNH 3EYQD 3DGCR 2DLEA 4R90L 1T5XB 4HOZA 3HFMH 3DI3B 3NJKA 2Y7QA 4E36A 1G7LA 2ICEC 2EYSA 3FQRB 3FTGA 1W0VA 2AEQL 3BLBA 3HBGA 4ZSOA 3LRGA 2ATAA 3RUGB 1MY7A 5C0AD 3T0EE 2VZOA 1AQHA 4Q9QL 3QXAB 9CGTA 1HINH 3D85D 1YRKA 2Z93A 3O2WL 2CIIA 4NC0B 2E9WA 4PI0A 2HFTA 3QG7H 4Y19D 2Z7UA 2P8PA 4FYRA 1QABA 3TPKA 3QO1A 2DDQH 1YUHA 4M4RA 5C0AA 1UZ8A 4XCFL 5D1XD 2OZ4A 2WB1A 4AX3A 4LLVA 1NBVH 4N9GA 1I31A 4N4YB 4JMNA 5MEOB 1U8KA 4GAGH 4HWEH 4KK5D 4Y19A 3E1ZA 5ADPH 3SDDB 4PJFB 1NM4A 3P4NA 3NA9L 2H2PD 3DPBB 1E65A 1FRGL 1MKFA 4FABH 5FYLL 1JPGA 3SKJH 4OUUB 5EPMA 3MMEB 5I6NA 3QG6B 2DEXX 1JZ5A 2BNUA 3K4DA 2JLPA 3PV7A 4XNYL 3PIQA 3RUGF 5KYNA 5ICXB 2I60H 2QMKA 4QCIA 3AS1A 3DGGB 5EO9A 3IK2A 1HXMB 3CZFA 3RIFK 2VZVA 4JFZH 2MMXA 4OD1L 2DQIH 4EI5C 3WXWL 1NLDL 1SXNA 2QR0B 3GKWH 2C3VA 5KZCB 4AGNA 3CU7A 2W07A 1NBYB 3BD5A 3A22A 2PTVA 4N2CA 4OCYH 4QYOA 3MLVL 1OM9A 1UXMA 3CC5B 4BH8B 2DPKA 1E3ZA 4HXBL 1KF9B 3EBHA 3N50A 3P9MB 4G8AC 4NRZB 4LFHG 3HN5A 3H55A 4UQAA 5IB1A 3Q43A 1A7QH 3T2LA 3KR3L 5C0IA 1NAMB 43C9A 4CGTA 2XX0A 2CDFB 4FQJH 4B96A 4UQ3A 5CLXA 3LH2L 1N3NB 2NY2C 2EDRA 4MS8C 3MLZL 4JZJB 4MWFA 2LV4A 1M2VA 4LOVA 1QUNB 3DX0A 3QK0A 4M56A 4LHUB 3WEXB 3K3QA 5J1TC 5EBMA 1IEAB 4MXVE 4I1PA 1Y6KR 1PX4A 5KJRL 3B2PA 3KPNA 3MYJB 5CZVH 4BFKA 1DFBH 3QUYD 2QFRA 1CIUA 1AGEB 3N9GL 3B9KA 1B0GB 12E8H 4AMKH 2VDOL 2YUVA 2OSXA 2NSMA 3DPDA 1H3PL 4GXUN 4P5KA 1WWCA 4ONGH 3AY4C 2XA8L 3D06A 3ZZ1A 5CBAA 1GY1A 1C1EH 2CO6A 2GITA 4A68A 5GZOD 5KSAB 2UXFA 1WFNA 4TMPA 2N56A 3IN0A 1ZTXL 5CWSA 5DC0A 2ZUQC 4IOIB 1TSHA 4MSWB 3T8MA 1QFHA 3CMOL 1HFUA 1OZUA 4HGKC 5IVXF 1WITA 2OL3B 2EYRB 1AYOA 5HDRA 4YPJA 1MCWW 4M03A 2WXOA 3EYVA 5GZOA 2OMWB 4IHOB 4RFEB 2P44B 5LWYH 3NFPA 1JNLL 3CLWA 4K9EL 1CD0A 1SNRA 1GH7A 4Z3JA 3FO2B 2ZUSA 4DKEH 4HEPG 15C8H 1NCAL 1FN4B 4YBHA 1ZA3B 1C16A 3UL4A 1FI8C 3GIVA 4A2EA 3N3EA 1MCFA 4Y1TA 3MGOA 2DOCA 1E90A 4ZQKB 5BVJB 2ADFH 1HHKB 3JWDC 1PTZA 5JIKA 4R97C 5G4OA 1I4FB 1Z9OA 2BNRE 3UJJH 3II1A 4UT9H 4L4TE 3UC0H 4PRIA 5HYFA 4F57L 1AGFA 2RAMA 5L2KE 1OP4A 1NSNH 4JZNB 3VFVA 3K81A 5DUML 4ODHH 1OK8A 1KIQB 3QDHA 4XN4A 3LZLA 1J8HA 5ESAB 4ZX5A 4QRQB 4Y4KC 4XHJC 3WI9A 1WZ1L 1EZSA 5DFWH 3GSXA 2AK4E 4XGZB 3T4YB 1T21A 1UCBH 3GRWA 4ZQTA 4Y2OB 3ABMB 1N6VA 3RBSA 3BDYH 3EYFB 4NRYB 3QHZL 4FQQA 5E08L 3QI9C 3KJ6H 4IDLA 1F3JA 4JO3H 1ACZA 1FGNH 2A73B 1RCYA 4GRWE 4QGYA 5MENA 1A7PH 4NI3A 4UNUA 5DO2C 1KJVB 4YHYB 4GO9A 5HJ3B 1RZKL 2M2DA 4GG8A 4XAKD 1SJHB 3G6JB 3KPLA 1Y0LB 3BKML 3REWA 5EF3A 2EYTA 4DGIL 1VFBA 3KPMA 2VMJA 3GMPB 1UXSB 3GJFH 4F9PA 1SMOA 4LQFL 2XV2A 2GAZB 3MJ8B 3OQ3B 4Z7UE 3QXTA 5HPMA 5ANME 3OSKA 4TLSA 4ELKB 1ZRUA 3MLUH 2MCMA 1F2QA 2PCXA 4JCMA 4P2OA 1IM9D 1K85A 3EFOB 2MNUA 4OCWH 3W2DL 2V7HB 3QORC 3U0TB 4G9FB 5LNDA 5GGRA 1XF3A 4N26A 5KVFH 3GS0A 2DMGA 4K3EH 2UY6B 4NHCL 5C9JA 4AGOA 1N10A 3HNVL 1CUOA 3V0WH 3LRSA 1OE2A 1MRDL 3ISRA 5D1ZC 5DCCA 4UAOB 2YOAA 1IM9A 4Z7WA 5AYQA 1FL3A 2VQUA 4JY4B 2GI7A 5MERA 4DT2A 4JG1H 5CU9A 3JUYA 1N70A 1QRKA 3KCPB 4DAGH 4X4YA 1DYZA 2B1AH 4H0GA 1MIMH 4AK2A 3QS3A 4G5ZL 1FYTD 4XNMB 4G9DB 5FKAB 1JF5A 1TENA 3BAIA 3TCTA 3FS9A 3GMNA 4NQVA 3IETA 1JPSL 2GSMB 3UYRH 1W8NA 3US0A 3BVDB 3HUJE 1R3JB 2F7IA 1RERA 5ECGA 5HHXL 3F00A 4OCMC 4ACPA 4IRJD 3OX8A 1H3WM 4PQXA 4HULB 4HKBA 4OFVA 4F7EA 2EEDA 2XPGB 3GBNH 3O41A 1QRNE 4AGQA 5TJWK 2O6EA 3AABA 5KS9B 5I0VA 1KCWA 4H26A 3IU4L 4TVPD 4A66A 1PKQA 5ENWA 4QXUL 1SOQA 1NDMB 1YPZE 2MCPL 2ZX7A 4CMHC 3WTYA 3JQOB 4UI2A 5D7SH 2HKFH 3IJ7A 4QHUB 4Y9BA 3BGMB 1BZOA 2DLFL 5KVEL 3AREC 2FT6A 4J39A 3SE4A 1ES0A 2C26A 2EDBA 1AS6A 2UV3A 3LJ3A 3LD8B 3IAGC 2AANA 4EIGB 2P24B 5EC2B 1UVQB 1DBKL 2A77L 4XWOD 5HHNB 5EU6D 1G1OA 2F53A 1OTSC 3SE3C 5JPNB 2O61A 1LO4H 2ESVD 4O9HH 5F1KC 3SQRA 3LDBB 3RVTD 4KY2A 1FWXA 3HB3D 5FHBH 4B9CA 1LDPL 4EUPG 1OLZA 4Q7DA 2CDEA 3HIZA 2MTPA 2R4RL 3LH9A 4PIBA 5D6CB 3SY6A 1HH9B 1EHLL 1MFDH 3GSQA 4OTXL 4N2IA 3X1EA 3T09A 4ZNCD 4KUCF 4P5SA 5IMLB 2ESVA 1QHPA 5EO0B 4GUPA 4KX8A 5IBTL 4LSUL 2AKRA 4WI2A 1RP9A 3SGJA 1YYLL 1DBAL 3PXHA 1YEJL 4UOW0 1BX2B 4TNEA 3QAQA 2VDKB 5TE6H 4A6YA 1ZK5A 2G4GA 1INQB 3L7FA 4AL8C 1UOWA 5IQLA 4P2YA 4PRAB 1Y07A 2HZHA 2YK1L 2FSEA 1RKRA 3NTCH 3WS3B 1BWWA 3I9GL 4PLJC 3APMA 2R4SH 5EUKA 1FBIH 1G9NC 3FDWA 2VLJE 3MRPB 2QKIC 4FXGB 1QHOA 4YL9A 5B22A 1SDAB 3IT8D 3TJPA 2GIYA 5MEPA 2XACC 4ZZFA 3TL5A 4JPIA 2CUAA 5CGYC 4GSRA 2B20A 3EF4A 4EOWL 3HZ3A 4JFED 3PDOB 1XEDA 3U36B 4JDTL 1OSEA 4ZW6A 5E1QA 4FEMA 3GSVA 2J1ZA 4A7GF 3L17A 5DYFA 4FFZL 1BFOA 2B9BA 2Y4SA 4IHBA 4JO2L 5SV3A 4PGDA 5ILTH 1XGQB 2G3MA 3TT1H 3JVGC 4I0PB 1TF4A 4KI5E 2LU3A 5HD8D 5HHPB 5EMYA 1OP3K 4UTAA 1RH8A 5F9OH 4L9LC 3TH3T 1SOKA 3JTBA 5H94A 3DECA 5DMGD 1XF4B 2RCSL 3KBHE 1WVZA 2AQNA 2EDQA 1URLA 1Q94B 1T22A 2BWDA 2CIKA 4HOMA 2ODIA 1CR9H 4M7ZB 5D2LF 1BXUA 1DDHB 1BFSA 2V9QA 1GGBL 2YAFA 4JKWA 3ML8A 3MA9H 1L9RA 4JG0L 3W11C 2DI8A 1HZHL 2IXQA 2ZCKL 3N6YA 2DQDL 4NZRH 4OCSL 5HGGS 3H7LA 4HGWB 4EKXA 4PTTB 3MFFB 5IVZB 3ARFB 2JJTA 3H8NA 4FZ8L 2HX8A 1OM3L 5TDNA 3CDZB 3O81A 4HJGA 3R7RA 1MCJA 2YXWA 3QPKA 3Q8AA 1HL8A 1FNGB 2D3JA 2HFFB 4ZFOB 3BFQG 2EZ0D 3V52H 4JFPB 1BGXH 2MFNA 4Y16C 5GGVL 2EIMB 1KXVA 3N2JA 5K93A 3MRIA 3D0AA 2PW1A 2XDHA 3S36H 3KNBB 1DANT 4Z95L 3V6OA 3PWUA 1J1XL 1KBGL 3A21A 3MJ9A 5DEFA 4C4KO 1L6PA 2XIBA 4JQIH 1XGTA 3O3BA 4X5XA 4LPVA 3G08A 2WWMC 4NQCB 4XN1A 4HLEA 1Z0NA 2X88A 5GSRA 1KJ3H 3JV4B 3LKQA 4I7ZC 3C60B 4AQAB 1I3GH 4Q74A 4YHNA 1E6OL 3S3PA 1UWFA 3KW8A 1HH6B 5D7KE 3EJYD 3B7UX 3VGAC 4CGUB 2Y24A 1ZLUK 2CO7B 1UOVA 4EE2A 3ZSSA 3ZQ9A 1FFOA 1SY6H 4L4VE 4UDUB 3WELA 3SY0B 3BT0A 3P4OB 3U4KA 5SV4A 3S8FB 1Z5HA 2EKSA 3RWDA 4ZTEA 1G7MA 1WBXB 1ASQA 5HHVH 3V4UL 2FJSA 4WWKB 4LMQI 3FH7A 4OB5H 2Z8RA 2VKWA 3QEGH 4W1TA 5T1DL 1O7VA 4GAAA 2ISDA 1FA4A 4J8RA 1BZ7A 2ZYIA 1SJVA 4PRNA 5F1NB 2UXTA 4PR5B 4BA8A 2ED6A 5KG9B 1RK1A 1DN0A 2R39A 2YD2A 3IXAA 1CVRA 5DC9B 2AQ3A 3BHBB 3GSOB 4AV5A 4BQ9A 4LK4A 5CD5C 1F8TH 2HG0A 3L95A 4WO0A 5J7CC 5E2JA 4U3SA 2H3NB 3NJMA 3A6BH 5E94B 4N24A 5E8EA 4ELME 3BVXA 4N20A 1J05A 4DF9A 2WGNB 2J8UB 1NEZB 3MZGB 1MLBB 3CHXA 1XZWA 3I6KB 3T4AA 4X8JB 2VLKD 3LN4A 3MOBL 5DZPA 3TGXA 4LARH 1CD8A 2QQLL 2GJPA 5AW9B 2X5PA 1ZCRA 4L3CB 2X4NA 4DQOL 1MVUB 2LQRA 3F58H 3F84A 3FQ4A 5I1AA 2Y72A 5CHNA 4WO4C 4K2UH 1RFDL 3CFKB 2P52A 3TWCL 1QYGL 3OAUH 2FWOB 5JMOC 2VLKA 1YEDA 2LHAA 3IM1A 4JS7A 1JWSB 3KMDA 1AR2A 1KG0B 3W82A 1FNSL 2JI1A 1WHOA 4GRMB 4I3GA 6CGTA 1I9JH 1AAJA 5E8DH 3OJ2C 5F9JB 1TETL 2UZYA 2ZCHH 1M6OB 1E4HA 1KC5L 2R2EA 2CPUA 2OZ4L 1L9QA 3IFPA 2Z35A 1I8LC 4WY7H 4AG4H 1XF5A 1IGCL 4AUYA 4MBRA 2R1WB 5DXWA 2HP4A 4W70A 1MPAH 1N5YH 3HG3A 4GP4B 2VYRE 4GSUA 3N1FC 2WN2A 1TFPA 4UBDC 3L2LA 4J3OC 4OAWA 1O5PA 2DQMA 3ILQC 2J88L 2H32H 5DJ6B 1COBA 4LSPH 4KBPA 4IKJA 4Y4HD 3FU5A 5CR1A 2QGCA 2PTTB 4E2OA 4M9OA 3IYLW 2X4TA 3NRFA 4W9EC 1X7TA 1LP9E 1LVEA 2MRYA 3D69B 2FYYA 2LABA 4WF7A 5J12C 4R26L 1BQKA 2J2ZA 5FA3A 1XQ4A 1PGRB 2QQKL 4Y4HA 4BZ2A 4WSKA 4G7RB 4KTGA 3K74B 3QULB 1HT6A 3VGEA 2OAAA 3DK2A 3WN5B 5EWIH 4UAHA 4L3ED 1UACL 5I71C 1JPST 3ROOB 2OKMA 4MNGB 1DLHA 4PSPA 4LOUD 1KJ2H 2CD0A 4XMLL 5I8EA 5HGHA 4TOYL 2L04A 4L1LA 5JW3H 4UDTB 1VZIA 3FOLA 1XGYH 4OFQA 3ZDZE 1XEUA 4E42B 3QC6X 4OFPA 3T3ME 1Q9OA 4N6QA 1XTMA 3N43B 1ZT7B 3QO0A 1PCSA 2P4AB 2GK2A 4O5LH 4RGNB 4ZO8A 5CZXC 4E5XB 4OCXL 3ZDYE 3LEXA 4L3EA 4R5TA 3K2KA 2FBJL 1U21A 2GJ6E 3QXAA 3ZMEA 3WY4A 3A47A 1TVHA 4IMKA 1J9QA 3G6DH 4JDZB 3OKKA 1WAPA 1VLXA 2FO4B 3V5DA 1V05A 4LEXL 4NM4H 5HI3C 2AEIT 4NBYB 3WY3A 4AJVA 3BX7C 1NUDA 1PU0A 5GSVA 3X1FA 1ZKAA 4GBXD 3RIAK 1AMYA 2ADGB 3S5LB 4W9HC 5JPMC 1Z3RA 2ZOLA 5MEOA 2P5EB 2X4PB 3R06B 3CFJB 3OHXC 3PWVB 4OLUH 4PJFA 1K4CA 3QJSB 4Q14A 1NCOA 2DQCH 5C92A 4P3CL 1E9QA 4YHPB 3UGEA 1QPPA 3DPBA 2XOTA 4GBXA 4L8SB 3MRBB 3MRFB 3T65B 2MIZA 4F80A 3N43F 3IMVA 3QG6A 3H4FA 1J9TA 2OR9L 2QPUA 2ZX6A 3E3QC 4W9ZA 2APWA 1GHFL 4L48A 5E51A 1NGYA 4Y9EA 3WENA 1BIIB 4LRIA 1HXMA 4YR6B 2DYRB 2E27L 2QVKA 4RFOL 2IMMA 3NIDF 3V6ZB 1NBYA 3FRUB 4RLDA 3SBPA 3KYOB 5BOPA 1RJCA 1GOHA 1PG7H 2ZOTA 4BZ1A 3BE1H 3BO8B 4N2LA 1I9RL 1L5GB 2OJEB 2MPAH 3KWTA 3VJ6B 1T4KB 2CNYA 1DQKA 1MEXL 4M1GL 1HL4A 3CC5A 4BH8A 5KYYA 2IAMD 5IB5B 1VKXB 1JMXA 5IV2A 4FDWA 1HHHA 2MOQA 2H8PB 4JY5L 2X1WL 3DTXA 2NY6B 4N0CD 4UUJA 4UU9B 3BKYL 4KKNA 1G1YA 2AMUA 5H8DA 4P2AA 1K5WA 5HTSA 5IFJB 1HZKA 4JZJA 1QUNA 3RX8A 2IAMA 3D0VB 2X0WA 3B2VH 5JO5A 2FX7H 4Q6IC 1UWGH 3RY5A 3UPRB 4YXHH 2CNZA 2B2XH 5T1JA 3IJSB 5AOJA 4GRWH 1D7BA 3JZYA 1K4DB 4G42B 5DMKA 4D9RD 4UQBA 1BZ9A 2ITDB 2YN3A 3GRWL 4LLUB 1BMWA 1AGEA 3LN9A 2GBVA 1MWAL 1AY1L 3Q1EA 4TKWA 1HJCA 2AXJA 4BV1A 3BUQA 4ZS6D 4YHMH 4KGJA 2DQUL 4LCWD 3I6LD 3ECBB 2WAQA 4KV5E 4JM2B 2JCCE 5E9DD 2AABL 3THML 1TKWB 2NDGA 1S7UB 5KEZA 2YD4A 1JNNH 4R6UA 4NQSB 2EVFA 1NCBL 1UJTA 3GXIA 1AH1A 3EDFA 2Y2YA 2J8OA 3ALPA 1AFVL 5L2JA 4K7PH 1YJDC 3CHSA 1H3GA 3N1GC 4F7CA 2OL3A 2ADJB 4LCWA 2EYRA 4Z77B 1N6QH 3GD1C 3T0BA 2FO8A 4AVJA 4KPHH 3QFGA 3F7KA 2LLLA 5FKPB 3V4PH 4Y5VA 4WTZA 5ITFB 2OMWA 4RFEA 2CR0A 3EJQA 3HNTH 4PGZA 1FVCB 2AJXH 3TNMA 4Z7VF 2AJZA 3JTTB 3L1GA 4MJHA 4B9YA 1ML0A 1G9MC 5L88H 2Y7NA 3JT2A 4QWWD 4WUKH 2W9DH 2V3FA 3ARGB 1J5DA 4W6XB 1AANA 1YY9C 4XTRC 4BM7A 1FN4A 4KO9A 2D73A 2IH1B 1UH4A 4J2XA 3P02A 4KK6C 3RJDA 2W59A 4LVNC 5M7QA 4Y1AE 5JNYB 4OZGB 1UM4L 1HHKA 3VWJB 3NFSH 4Y5YC 5B1CA 4BJLA 2QL1A 1BW8A 4I5BB 3T2PA 3BQUB 4PJ9B 1ZVSB 3AWGA 2CDGB 3RVXD 1KYDA 4MQXC 4F58L 7CGTA 1A1OB 2W5PA 3UTTD 3L1FA 1SM3L 3RY6C 2XWRA 3POHA 3HZKB 1AHWA 4UQ9A 5IBUB 2MJWA 1UCTA 3NPSB 4N0UE 3SJVD 1AKJB 1IKFH 4MQTB 4UZGA 4XXCC 3QCVL 3L9BA 4Y2OA 4FADA 4KRNA 1SDDB 2VLLA 3TZVD 2ICEB 3EYFA 4NRYA 1JZ4A 1T0MB 2FH6A 3EH5B 3HKFA 1D7DA 4KU1A 1O7DE 4BSVA 4Y9CA 2ZUXA 3KLAA 2TRYA 1QA9A 4GKZB 2A73A 1MJ7L 4OZGF 4NUJA 3ULUH 4KJQC 2AXHA 1QZNA 4OLXH 2PN5A 3HS9A 5KBLA 1AKPA 5HBBA 3CFUA 3G6JA 4I2XA 2XXCB 4UTCA 3PUUA 5JXEA 5GRWA 1IAIL 1KCUH 5DZNA 2OS7A 2IG2L 3MJ8A 2O93L 1QLEB 2H26B 2IBBA 2E0PA 1MCLA 4ELKA 2OMXB 2P26A 3BWUF 1HSAA 3H3PH 3L3JB 4MJ4A 1QW8A 4HUNB 1IIIA 3GC3A 2JNZA 5DYOA 4D9QD 3OR7B 1Z3GL 3NVQA 3VFNB 1MCPH 1OF2B 2EDJA 2JQMA 2R29L 2O5XL 5MP6H 2Q6WA 1GAFH 2CWRA 2UY6A 3ES6B 4RRPM 3GSNB 4HXAH 2Z91B 1AI1H 1R0AH 3BPOB 3D7PA 4JY4A 2HT2D 5ACMA 1FGVL 1V7NH 1B88A 2XTJD 3KCPA 4LPTA 2PW2B 2HAZA 3MVSA 3LZFL 1EEYB 1ID5I 2C1OA 5HI5C 5FYKD 5AAWC 2JKSA 4NC2B 3P77B 2MHAA 1INDH 5EU7E 2NX5D 3CFCH 2NT1A 4ONFH 3P3RA 3QUMB 5FO9A 2CUHA 3HNSL 3RX9A 1J7VR 2AQ2A 1PZSA 1DVFD 2F54D 2D7TL 4HYTB 3KGTA 3NCYS 3S2CA 4EXPX 1NMBL 1R47A 4OZ4A 2ORBH 3CUPB 3FONB 3DX8B 2A4CA 2OM5A 3TJHD 5SWZE 3IFOB 2XPGA 1KYUA 1CU4H 2NY2B 4E9SA 4NBZB 1TYRA 5I17A 3KBPA 1UWEH 5CIPH 2GCYB 4QR7A 5A2BA 2F54A 4G1EB 5GGSA 3L08A 1CMOA 3O3EB 1NCTA 1WWBX 1NIAA 1MREL 3CZLA 3T0AA 4NKOB 3TYGL 1YSOA 2DF3A 4QHUA 4YFDB 5IHZA 1DQIA 2BNQE 2X6CA 1IQDA 5I0ZA 3DETC 3WEBA 5GGUB 4UTAL 1L7TL 3Q6GL 1OTUD 5DVMA 5E4OA 3NP3A 2R83A 1B4JH 1EV2E 3I3BA 3VFSA 5J9PB 3SYPA 1JZJA 5EC2A 4IDJL 1UVQA 2VC2B 3C9NB 5HHNA 3G3LA 5T3ZD 2HWZL 1NL0L 2YGOA 3HMXA 3BN3B 1EDQA 3T8XA 3UZVB 1BEYL 2OYKA 1MHPL 1DVUA 2AEWA 4JM4H 3ZKSD 5CGMA 1C8PA 4PJIE 3BJLA 3QDMD 4JRLA 3ZZSA 2ZUQB 4FP8L 1XGUA 4AGLA 4GO8A 2HTLD 2DWXA 3FQNB 3MLPA 1NGQL 5F1OB 3OMAB 1TZHB 5EO0A 4YJZL 3BVNA 1PD6A 5BUPA 5JDSB 3WU1A 4UM9B 4I77H 2J20A 1SF5A 4LL1A 1SMAA 1ZEAL 1CT8A 1I8IB 4L4TB 1VESA 4ZMXA 4HQQH 3LQAC 4PWJA 5L2KB 3OJMB 4H5SA 5D1QC 4Z9KB 4X83A 3V79C 1Y6NR 1INQA 3OF6D 4XMPH 3UAJA 4PLOB 1M7DB 4PJGE 3WS3A 2Q10A 1CICC 3BKJH 3MJ9L 2NY4C 3AT8A 4FXGA 4C55A 2BY0A 3MX0A 4R97B 4NXSA 2CHWA 1C12A 5F7WC 3D12B 1GZHC 1WFMA 4DN4L 2VISB 2W94A 2A38A 2X9XA 4GXFA 2AI0H 3L3DB 3TESA 2DIBA 4M5YL 2Z92B 2Y7SA 4AQ8C 3CXDH 1R33A 3ZY7A 5AZ2L 1N6UA 4AZUA 3FQYA 1V7MH 4JFDD 3KE0A 4A7QA 4XB8A 4HSQA 1HESA 4X5PA 3W0WB 2IBGA 3BMVA 3HS0A 3MLRL 4UT7L 4DKAA 5F9WC 4C8XA 2IDQA 3QNXB 5K69A 5HHPA 5BVPL 2ERJC 4K7PY 4Z3HA 3O3DB 2GBTA 1NMAL 1PNCA 1XF4A 4RCAA 1WAAA 4X7SL 1CL7H 3UC2A 4WEBL 1CLYL 5AVZB 1VB9A 1NFIA 1RUAH 4HJ0D 4FFWD 5ANMB 4BRVA 1CGYA 1OHZA 2DZEA 3AW5A 4WGWB 3ZTNL 2VCOA 1DDHA 2IF7A 1MFAL 1UM6H 4XCCH 5IHUL 4G6KL 2A9CA 2ZSVA 1JZ8A 1OAZL 3OXSB 1FO0A 3JXAA 3KXFD 3QJQB 4QTHB 1VEOA 4HIHB 2VDQL 4PG2A 3VSUA 2FEDD 3KGSA 4PD4K 3ARFA 4HPYL 1HL5A 4WQOA 2DRUA 2ED8A 3E2HC 4XT1C 5D9SA 5EOTB 2GC4C 4GRWF 1TZIB 3KPPB 1I85C 2K7QA 2OMBA 4YPGA 1RUPL 1GGIH 2W8CA 3N41F 2PR4H 4NQDD 2IQ9L 4DUWA 5HVHC 3KXFA 1XIWD 3RL2A 2ICWI 4JFPA 2P80A 5JQ6H 3C5ZC 3TBSA 4PGEA 4ENEC 5K9OA 1WISA 3H9SB 3P30H 4NDMB 3SGDH 3QORB 3VFWA 4CSSA 4KY1L 3KNBA 2BPBA 2P5WD 3TM6A 2NY5H 3UAAA 3U2SB 3P2TA 3V6BR 2EXYD 3VE0B 3HUJB 4NQDA 4Z7UF 1XCQA 1IGIL 1XIWA 4IOSD 3C6SB 2VLRD 3ULSB 1M6UA 3QEQE 1W9XA 1R75A 3DX9B 4YX2L 2F19H 1FNEA 4AQAA 5AUMA 2Q20A 2P5WA 2ZG3A 1QRNB 2FLMA 3PWNA 2UWEB 4X8GA 2WLLB 4YOKA 2X2JA 4HLZH 1PZUB 3LV3A 4WI7A 1A5FH 1PZ5B 4RMBA 3ZN6A 3VI4A 1YPZB 4IOSA 2VLRA 4YEEA 4XVTL 4NEHB 4M8RA 2H1XA 3IDNB 3QDGD 4FLSA 4P5TC 2Z65C 4WNQB 3DMMD 5F9DC 4LGPB 3UTPD 4WWKA 4DVBA 2EE6A 1AZZC 1P7HL 1IC4H 3D52A 2AXGB 4ZUTA 5I73C 5CKGA 3I9PA 4B53A 5F1NA 4YHZL 1XGPB 5M95B 1CD1B 2AJYH 4PJXB 4FG6C 4HCRH 1FNAA 1GYWA 5E2TH 3HUJF 4FYSA 4KK8D 1Q0YL 3BHBA 3GSOA 3L9RA 3TTSA 3VFOA 5IMMB 3ZUNC 1LO5A 2BVOB 1U91A 5DZLA 3WUWB 4BZ2L 3WSQL 1TFHA 2NW2A 5C6TH 3AREB 4OLYL 3VB9A 3X3GL 4JFQA 3B7YA 5DJ2B 1GL4B 3ETBF 1CZ8H 1ZXKA 1MLBA 3CFNA 3KAAA 4P2RB 3VFGH 3I6KA 4U05A 1X9LA 1PSKH 1YN7B 1KB5A 2H7WA 1HHGA 2R0KH 4X0KA 4IEFA 2DBLH 2Q76A 4KKLC 3NACH 4OKDA 2H45A 1LEKB 4L3CA 4UNIA 5D7LE 4NAJA 4NNYB 3ALWA 3L2NA 4FL4C 3NIFE 1MVUA 2H1PL 4GUCA 4I3SL 1NDGB 1IBFA 1PF3A 1IKNA 2Q8BL 3L4VA 5AVTB 4Z3FA 4YBLC 4K3GA 2FWOA 2VL5B 3M88A 3RP1A 3GPSA 3ULUF 1JWSA 4D9LH 5FDWB 1EXGA 1I7UB 2VLJB 1S7XA 1V3LA 1H19A 2V2WA 3HBPA 4U1NB 1HU8A 3U9PL 3WDHA 2VQ4A 2C3GA 1SXBA 1H5BA 4JDEB 2BY3A 3FMGH 5F9JA 2YD0A 1JN6A 1M6OA 5G4NA 5T5FA 3AMKA 1HQRA 1AJ7L 3WNLA 3S48A 4NWTL 1F18A 5TDOB 1ZANH 4U6YB 4MA8H 3RGHA 4G7YL 3QCUH 5TF1L 1G9EA 3GHEH 1MRCH 2MKLC 1A6WL 1JPTH 1JVKA 4HIEB 2XLLA 3H3KA 4OQTA 5F9AC 4PRPA 1E5BA 3GZOA 4PJEE 2KZBA 2QKIB 4EZMA 5AZEL 2X1PA 3HAEB 1M42A 5DJ6A 3AY2A 5CIPB 4HWBA 1Q9WB 5D72L 1BYNA 4HBCH 5E5MA 4PB0H 3NJVA 1NCWH 3BT2H 3UAEA 4H20H 5FB8B 3O2VL 2HVJB 1T0PB 3Q3GB 2VDRL 3MLSL 3QIUA 1HWHB 3HI6L 3ZHDA 3WIHH 2ALWA 3P0YL 5FGBC 1HCFX 3QULA 1I1FA 2ZUUA 4BZ1L 4EDWH 4OV5B 4O2EA 3WN5A 1GTFA 2CRIA 3LZPA 4JL2A 4PJAA 5B8CC 4L9LB 3E7JA 1J5HA 5LXVA 4DERA 3ILEA 3NABL 2XWDA 4UDTA 4AYFA 4UT6A 4E42A 3V7AG 4BE6A 2A6KA 1I1AC 3IDJA 4KI5F 1CF1A 2WZ0A 4J3XA 1EAQA 4KITB 1WD9A 2YRBA 3L3HB 1KCVL 4ONHB 1M4KA 3ZX1A 4Y2DD 3RHWF 2OCJA 3LN5A 1RQ5A 3JYCA 1NQBA 4A67A 1OWRM 5C0NC 4FE9A 2BS8A 2EECA 3QUKB 2F6AA 1ROWA 3WS6C 1DZ0A 4NN7C 4Y4FD 3GM0A 2IPUG 4ZPVB 3RKPA 3UIZA 1TJXA 3QJVB 4HKZB 4YE4H 3FO0H 4Y2DA 4YFLF 4WFED 4PM1A 2F15A 2ADGA 4YHIB 3CFDB 2EXWD 3RNQB 3S5LA 1BD2B 1J0JA 5DQDH 2VXUL 4Y16B 2OYLA 2CRMA 3KM2A 2EH7L 3OMNB 1HEZB 2F1BA 3P11H 1AIFB 4XVOA 5B39B 5CEZE 4R2GC 1RIVL 3CFJA 3PWVA 1RZQA 3MOAH 4L4VB 1KGWA 3DJTA 5SX5K 3U48A 1G94A 4UV7H 3EJRA 2P5PA 4LSRL 3QRFM 3VH8A 1CFSB 5HY9B 4L8SA 3MRBA 4LEEA 4AEHL 5LJYH 3EW3B 3ULVE 1ITCA 2A83B 2Y07H 4A2DA 5J57B 4ODTL 4WHYG 3CBRA 1SN0A 4JFFE 3HMWL 2FHBA 2DMHA 1T1YB 4LP5A 1OE3A 4XH2A 4YC2C 5CSZB 4YSRA 3VGAB 4TSCL 5IEHA 3WXVL 1BVNT 3AQDA 1NGZB 5AYTA 5HDBE 4LLWB 1H15A 1VPOH 3ZTDC 4DH2A 4DPRA 1FZMA 1SGKA 3FRUA 4JG5A 3KYOA 5ID1B 4P06A 3V9CA 5ITBH 4MDIB 4ELMB 1L5GA 1T4KA 1S3KH 4MVBC 4A04A 1YEFL 1U92B 2D03L 4HIIB 2IPKA 3KDMB 1DEEA 1P7QB 5A7BA 1MRFH 2XI9A 1P4UA 5EU3B 1PY0A 3MCYA 5TF0A 2NPLX 2IV8A 4LEBA 1YHPA 4NPKA 4O51B 3WFBL 5KBKA 2WLIA 3GWJA 5KSBA 4CILA 3QNFA 2EABA 5IFJA 5T1KA 4FZEL 2RFXB 2WW8A 3D0VA 1U2CA 4JFYA 2MTAA 4GKNA 4JKPH 4OUOA 4ZODA 1ADQH 1MAKA 1KUMA 1MJUL 5DFVC 3O2DL 5FYLE 4YLQT 3HHRB 4HJUA 1IO4C 4JNXA 5IIEB 1T0OA 1WUZA 2VM3A 5IY5B 2FRGP 1K4DA 5JUEH 5I15H 2ITDA 3CPLB 5L6YH 4FG4A 3ETSA 5F1IB 3TXAA 1IGTB 4ELMF 3PWJA 4M48H 1CFQA 3SE8H 5D2NC 3ECBA 3VWKD 3ZUCA 4JM2A 3IDUA 2XKSA 4WO4B 1A7OL 3S37X 1MI5D 4XNXH 2NRDA 1Z66A 3TEXA 1A3RH 3OG6B 1KLUB 2OW6A 4M43H 1JXKA 4DEWA 3EFDH 5ADOL 1X5LA 3JWNE 5B21A 4AYMC 1HWWA 1Q0XL 1IZJA 2BP5M 3IJ9A 3TN0C 4FQXD 4Z77A 4M3HA 3CAFA 3SD5A 4F15C 4ZT1A 4NQQA 3U1SL 1JNHB 4JRYD 3OB0H 5HHQA 3RFZA 1OCOB 5D2NE 3CN4A 1LO2H 1IBBA 3TJEH 5EN3A 5F3HA 1E50A 1QSEE 3JTTA 1JHKH 4HU2A 2A6JA 3NT0A 2DWSA 4FQXA 1HILB 3KH4A 4BINA 4JX0A 3NJHA 4M3KB 5TDPA 4JRYA 1QD0A 3MAWA 3IE9A 3VA2C 4XCNB 4GAJL 5LQBL 2AMGA 5BJTB 5KW9H 1OQXA 3VWJA 1G4MA 2N1TE 4BXSV 1JHTA 3PGDB 2FR4B 4M5ZL 2QLVB 3NQIA 1SJXA 2NR6D 4JJ5A 4K73A 3ZDZB 2F58L 3T3MB 2AQTA 4EZJA 5CJ5A 4K9EC 4YHKL 4CVZB 2EP6A 3IDMB 2JJSA 4I5BA 5CNHA 1ITBB 4PJ9A 1U8JA 1XR8A 2XZAL 4LLYB 3ZDYB 5J12B 3IBOA 4QOKE 3V0VB 3DYOA 3LHAA 3RWFB 4U7KA 4NJ9L 3AG2B 3OKOB 1ZTXE 5DSCA 3AG3B 4A7VA 1LP9F 1BSIA 4YHLL 2FECI 3EG9A 4DEPC 3KD4A 1IKOP 5E1HB 4WU7B 5FYKL 1GS8A 4N2BA 5E1AA 2K9UA 1AC0A 2ICEA 4APXB 2VMFA 5IJCC 1T0MA 2YKLL 3EBAA 3QZOA 1JHLL 4V1DB 3KHOA 4Y9GA 1T4WA 5FHAH 2J6EA 1E30A 1FHGA 1A8ZA 4WFHE 4UIKH 5DR5L 3HE7D 4KXDA 4HHAA 3U6XA 1GGUA 2N1KA 5CMAA 3QJTB 1IGJB 4LLAA 1O75A 3JTSA 4FTVB 4KZCA 1YAZA 3QQ3A 4PY8I 1C5BH 5DQJB 1LXMA 1VENA 4QXGL 1DZBA 5KYWB 5J6GB 4EZLA 2CJUH 3BWAA 3SDXE 1URIA 5J5EA 4FQ2H 3X3FH 3ZDYF 1QLFB 5E0QA 3DJ9A 3LVEA 1NFDA 3HE7A 4A7UA 5EULV 2HX9A 3NRQA 4WZ9A 4XRCB 1E3FA 5C0BE 2HN7B 2NNFA 1OPGH 4PWFA 4W68A 4Y7OC 4XMUA 5JPMB 1GOGA 5C09D 1CBJA 2H26A 2H3XC 4GMSH 3HMXL 2A4ZA 3OHXB 1FAKT 4LHUG 4ZFZA 4CAGA 3CFBA 1BMZA 1U8CA 4P46D 1G6RB 3VQMA 1AHMA 1TOXA 3ARQA 4YXKL 5I9QC 1EDHA 1MJJA 3OR7A 4JRXD 4YQXH 3QH3A 2CHNA 4RX4D 5HDOA 4N2AA 1DUYA 2OMNA 1I7ZB 1SJEB 3GO1L 3HC3H 4JL1A 5C09A 1AO7B 2COQA 5T3ZL 1CF8H 3OKMB 4XE0A 3ZXAC 4MMXA 4KZ0A 5DHVH 2Z91A 3HC4L 5DDHA 4CU7A 1JV2B 1S5HB 4P46A 1S46A 1U4FA 1UADC 2I5YH 4XB7A 4JRXA 1SBBA 4EI5A 4OJCA 1R3LB 2E5EA 2HLFC 4OIFA 3B6SB 4YFLI 5I75C 1EEYA 4JO4H 4XC3L 1ZSDB 3T5WA 2WZPD 4LSQL 3T0XA 1P6AB 2NYYC 3WUZA 2G5RA 3D39B 5JOPD 5CEXB 2RMNA 3HG1E 4U6VH 4ZAKD 1T20B 1M56B 2J4WL 3LQZB 3K71B 1TMQA 2QVFB 2UZXA 1B4LA 1KIUB 5ETUA 5HHOD 4K15A 1JVLA 2X53A 2YQ3A 3CUPA 3CVBA 3FONA 4WTZG 1RUML 4NWUH 4AWJC 4DFIA 3TV3H 3IFOA 2FE0A 2WBKA 1QSFB 1RZIA 3O6FC 3O3UN 3AC0A 1XH3A 4ZAKA 4CW1B 2CCWA 2EDNA 3L4CA 1MQKL 2IFFL 4C58B 5F7YC 2K3TA 3P54A 4YK4C 4Q6IB 3VXRB 3P3UA 4ZFGL 3D3VB 2A4EA 4OJFL 2R56L 2ICWJ 5AYUL 5BV7L 2NXZD 4QHPA 5GGUA 4Z7QF 1Y6MR 4HFWB 5EOQH 3WTTA 4H25B 4KO5A 1E4WH 3NCFB 1NC4D 2E6QA 1I9IL 3ISWA 3QYCA 2ZWSA 4Q58C 1RU9H 3RWJB 3AY4A 3U82B 5E6RB 1QFUL 2XU9A 3SKOB 1U33A 3OZKA 3DBXB 4LVEA 4B3EA 2FIKA 4N5ED 4HK0B 4OSUH 3GBMH 4ZMAT 2KT6A 5JQIB 3LIUA 3W9EB 4XCYA 1PLGL 4JMXA 4U1SA 1XCWA 2AJUL 2QHRL 4FQIL 1NC4A 3NN8B 3X1BA 3ZYJA 4ERSH 1FDLH 3RTQD 5F89A 4KV5F 2YMTA 3OQRA 1TZHA 2JCCF 1JXFA 3UYPB 1MIEL 4RWHA 2NCMA 3B1TA 2LAAA 2BMKB 3A6CH 3GUTB 3RAJH 3VTTA 2HRHA 1I8IA 1OANA 4WI9A 2B4CL 3BW9A 1G5GA 5IT2L 2NZ1A 1M7UA 2WXMA 1CLOH 1CQKA 1CL7I 1UT2A 2X2IA 4BKLB 2PYEE 3BSZH 4TN9A 4IJ3C 1ULVA 2BSSA 4PJDB 4YL4A 5TE7H 1T2QH 3Q9PA 3S3SA 5KVEE 3FB8B 4LVNB 1M7DA 5FFGA 2AXFA 5CBEA 1HC1A 3P4MA 4PREB 4QRUB 3NAAH 1DBML 1FAIL 2NNRA 3S5YA 1BOGB 4HOWA 1NUFA 4Y5YB 2X4UB 4Y4KD 3VCLB 4W9JC 2VJ0A 1W15A 4IGBD 2PKDA 1FH5H 5F7NC 3BEWB 1G87A 3Q1SH 1L9PA 5E99L 4GG6E 1DBBL 3CZUB 4CN1A 1XMEB 3MBED 4XP6H 4PGCB 2FGWH 3EH2A 2G0KA 4Y4KA 3W0WA 2NXYD 4H1LB 5CJXC 3FN3A 1JF6A 3DDFA 4IGBA 3U9UB 4MZ2A 3QNXA 3SGDI 5KYUB 4JQXC 4KKAD 2IQAB 1JGUH 1OQOA 2ARJB 3L4ZA 3BIAX 3MBEA 5DO2D 5FO7B 2Y0SA 3TIDA 3CVHA 2WXLA 5F7UA 2ZSWA 3MO1A 1VHPA 3QI9A 3O8XB 2CXGA 1QFWL 1AZVA 2EAEA 4IBSA 4BWWA 3SKNA 3CDFA 2L8AA 3T2OA 1N5AA 2CHZA 5CEYA 2OK0H 3UBGA 1TCRA 1CYXA 5D7JC 4MAYC 4JEGB 2WSKA 4OD3H 3OXSA 4PGBB 4QAWA 4TXVB 4QTHA 3DC0A 5FM8A 3SDCB 1OLLA 4HZLA 3BRFA 2ZOWA 4TQEL 1J1PH 4GOSA 3FZUD 4JHBA 3AQYA 5EEZA 4PS7A 3UIYA 3WHE1 4XP9H 4A7TA 1QBML 2FWUA 3LTVA 5HYJD 1J0YA 1ZVNA 1KB5L 5DJYA 5J3HC 3KPPA 4RIRB 3AQXA 2WZ6A 3FU7B 1ZPLA 4JGNA 5SWSE 5ELIA 4MASA 3WV0A 2CK0L 4N8CH 3STLB 5AB1A 4E41E 2OTUA 1EAPB 2BP8B 3H9SA 4NDMA 4NM8L 3L4XA 2EE9A 5D5MF 2IFGA 1QOKA 1QVOA 5HYJA 1BZEA 1FZKA 2QGBA 4MQ7B 4AIZA 3VE0A 2FZ3A 2GJZB 2YD8A 5AD0A 4HVBA 4I13B 5D1ZA 1I53A 2V4LA 3NJFA 4PB9H 1ZHNA 3C6SA 4M8QB 3ULSA 3AMLA 3DX9A 5EUOB 1G84A 3FOMB 3QA3B 3O9WB 1JZEA 1EZUA 4M6NL 2UWEA 3GTVA 3LS5H 3V0AC 3GF8A 1CD9B 2DL2A 1CG9B 5E2UH 4IBLT 3U6RB 1P7KA 1SFDA 3D34A 5AEAA 4TNWF 1I7TB 1DTUA 2WNWA 3WFEH 2CKBA 3MRJB 1AQDA 3DLQR 3DIFB 3EOBB 4WNQA 1A6ZA 4PV9A 1JP5A 5KOVC 1RLWA 3O11B 3X13A 1S7QB 3EGXB 1QR4A 4IBWA 4ZW5A 2ZXCA 4TPRL 4UTBA 3ZK0A 5I5MA 1V27A 5GXBB 1WIUA 4PJXA 5DWUH 2CBMA 1XF1A 4HS3B 3IBEA 5IMMA 1SUHA 5B1KA 4JFWA 2OR7A 1BHGA 1OTSD 1GJWA 3MV7E 5JYLA 1CLCA 3EYSL 4ZMQA 4JN2B 1KENL 1ZDSA 3GMLA 2EUVA 5E6IC 3N1MC 4FFVD 4OGXH 5EFIB 4H8WL 5DHYB 1NCDH 1NOAA 4P2RA 1RZFL 2EDMA 1N0XL 4EVNB 3JV0A 1Z32X 3QISA 4RRPG 2Y6SC 1TQVA 3U79A 2WUBH 1G7JA 2IOIA 4X6DE 1P4LA 2PO6D 1IEBA 3JUZA 3ARYA 3HZYB 4KMQA 1MF2H 3KPRD 1FHNA 1HWGB 4DP6X 5JZ7D 5D70L 3CQFA 1NDGA 3V4LA 3LB6C 3S37H 4ZNEA 4M29A 3BVTA 4IKNA 3FQXB 1VAHA 1INEL 3F01A 4J6IA 4PJGB 3SCMD 5FDWA 1I7UA 5CEZH 3TYFB 1V3MA 2VXQH 4U1NA 3SGKA 5KVDH 1MQ8A 3KPRA 3UZQA 1KN4L 4JDEA 4NX0A 3PG2A 2X87A 2IH9A 4HS8H 4PEEA 4PJIF 4LHJB 3ULVH 3O45B 5D1QB 3UAFA 5TDOA 1U2YA 4NGHL 4HU8A 4WTWA 4K7FB 4PP1D 3QPXL 2WYHA 4IK7A 4HW6A 4U1HB 1XF2A 3TBYB 3EYQC 1W72H 3LKSB 1CICB 1YEEL 1PS3A 3QIWD 2NY4B 4APQC 5KYXA 3OHMB 4Q9QH 4G6JL 5LHDA 3GJEB 1JFHA 5SWQA 2V2TB 3HAEA 3R7QA 2Z8VC 2VSKB 4MJ5A 1Q9WA 2OX5B 3IE4A 1U41A 3OB8A 3WIIL 4RSYA 1H9DA 4BBWA 1EGJA 5DK2B 3G5ZA 5FB8A 2F2HA 2F8OA 1TITA 4DGWC 4ZSOE 5JIQA 3DGDA 3VW3L 4ODWA 1EH9A 3V4VH 2HTKD 2IADA 3JVGA 5F9WB 2XPZA 3DROB 2CCVA 2QELA 1C9SA 4N0FB 3KLQA 5D1XC 2EO9A 3P69A 2BJML 5DEJA 1UH2A 1J1OL 5LBSL 2ERJB 5FM4A 4BSWB 2A74C 1ND0B 4L9LA 3D4CA 2PCFA 2Z9TA 4KK5C 2FQDA 2KQMA 2QADB 3DOHA 5FYLH 4XXWA 5C0AE 4FG0A 4Q9BA 2AFNA 4X98B 5TGBA 3QS2A 3FBKA 1JGLL 25C8L 2H2PC 3LKOA 5EF0A 3NSDA 4Y19E 3VD1A 4UIMB 2E59A 3ETBJ 4BXVA 1SLWA 2F1AA 3PL6D 3L3HA 4JPKL 4ONHA 1DE4B 4P2QD 3QW9A 3KWUA 1KDIA 1PL3A 1HJBC 3U46B 5E2WL 4N68A 1OO2A 2I07B 5K1JA 1NKOA 2K78A 5EZOH 4F2EA 4DUXA 3VTAA 2VDML 1E7UA 4LLDB 2XWJA 3QEQB 4N0YH 3HEIB 2Y7MA 3PL6A 5I6XC 3NCMA 1DSYA 4K5LA 5IB3B 2Y6TE 1FLRL 3JWNH 2SEBB 3R4RA 4P2QA 1UZGA 2ODHA 4OJEH 3CFDA 4QRRB 4FOMA 4YHIA 3FCSB 3C5ZB 2WWMD 4Y16A 4Z76A 1OXYA 2OMYB 5INDA 2DQHH 2AK1H 4OLWH 1FCCA 5CJOL 5F97E 5DZAA 2APBA 3B3IB 4YUEH 3ROLA 5HHMD 3PRZA 5DD1H 1CFSA 1PY4A 3CN1A 4X7CC 1NEZG 4TUKH 5IGXL 1RURL 1HXYA 5FYJD 3J8F7 2CLRB 4MB5A 4IYKA 3EADA 1RAMA 5SX4H 4F37K 4PPTA 4EUPH 3M17A 5ALBL 3S4SB 3BEVB 4NO5B 4JFXB 2J7LA 2QVTA 3ZE1E 4D3CL 5KSUB 2WQ8A 4R0LA 1PY9A 1N8ZB 1SEBA 2E56A 3BZ4A 4L9DA 5FR3A 2X4SA 4Z8FL 3OVUB 1NGZA 4V33A 1CS6A 2DJ4A 5I30L 5IMOB 1U58A 1FJ1A 3MJWA 3QUYC 2BP0A 2AJSL 3AADB 3NDZE 4S1QH 4YDVB 4P5TB 4N8VB 2EDOA 3TBWB 2CM6A 2MQCA 2PP9A 2I9LB 3JSSA 3M45A 3RX5A 2UZIL 5CD5D 4Q9RL 3KDMA 1P7QA 1ZTXH 2IC2A 1S9WA 1VDGA 5I73B 5F6HI 2VXVH 2ZUWA 4PY8J 1GOFA 3SOBH 1JWUB 1KTLB 6PAZA 3LKNB 4M02A 1F4WH 4O51A 2EEBA 4PRHB 1FFPA 4R5XA 3HG4A 5D7LB 5DZJA 1FL5A 4NHUB 3NIFB 5CFHA 2DYPB 1XZ0A 2PMZA 1CC3A 2EVJA 1DCLA 3WKML 2VJ8A 4RZCA 1JF1A 2M1KA 2VQ1B 5D96C 3IDXH 2XWXA 3A4FA 1P4BL 5EU4B 1BF5A 4KX7A 2VLMD 2YPVA 2W1NA 3WFCH 4PLKD 3WLBB 4DGYL 4HH9A 5IIEA 4PVMA 3L3IB 4XP4L 5FO8B 1RPUA 5C2BL 1NC2D 3ZL4L 2N7BA 4ZOBA 1HSBB 4OLZL 4EIUA 4LSSH 4F7MB 5E03A 4B27A 2GW5A 4MNHA 3REVB 3ZRFC 3FQ2A 2JV6A 3EZJB 3GM8A 4NZTL 1VGEH 4OFDA 4XP5L 1IGTA 4FL4B 3RA7H 4AJ0A 5JIMA 1DJHA 4XI5D 2AJ3B 1TVDA 2X6UA 5ECJE 1NKGA 4YBLB 3KHQA 1NC2A 4PJHF 1BBDL 5EC1A 3HR6A 3IGKA 1KLUA 1M9WA 3K1KC 4PJEB 4OGAD 1M1SA 4OM0L 3KH3A 1R3HB 3L5XL 4XXDA 5GISL 4U1IB 1RHHB 1OB1B 1YNLL 2PPFA 4R3SB 4OR1A 2PF6A 1HNYA 4YDNA 3IFLL 1E67A 1GYUA 1KGCD 1A7RL 1GKOA 3DVNB 1I8LA 1S7SB 4PRIE 5AW4B 5T1MB 4E5XG 2V6HA 3PHQA 3QQ4A 2R1YA 4Y2NA 1P1ZA 2X4RB 3B2XA 3MBWA 3ZKMD 3RI5F 3APNA 3KPSD 2HLAB 5GS2H 1J8HE 3DJSA</