3NRPA

Crystal structure of 'as isolated' uropathogenic e. coli strain f11 fetp recombinantly expressed in the periplasm of e. coli bl21(de3)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
152
structure length
152
Chain Sequence
GFKEYPAGEPVTMNEMELAAVYLQPIDMEPRGMGLPAAKADVHLEADIHAVEGNKNGFGAGEWIPYLTISYTLVNNDTGEKQEGTFMPMVASDGPHYGANIKMMGVGNYKVTYHIEPPSKAGMHRHTDSETGVGRWWKPFDVSYEFKYVGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic protein-probably involved in high-affinity Fe2+
publication title Characterization of a Dipartite Iron Uptake System from Uropathogenic Escherichia coli Strain F11.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 24
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3nrpA00
3LZLA 2O6DA 3PJLA 3LZNA 2O6CA 3LZQA 5I0XA 5I0YA 3PJNA 3LZOA 5I0WA 3LZRA 3NRPA 2O6EA 3NRQA 3LZPA 5I0VA 2O6FA
chains in the Genus database with same CATH superfamily
1UENA 5I8KL 5HDBB 2AERT 3RX9A 3LDBB 2Y1ZA 1P4BH 3CWGA 1BIIA 3MV9E 3R06B 1KIRA 2OL3L 2CXKA 3ARDA 3EBAA 4YSEA 1T80A 1BOGB 1FYHB 1XF1A 3CFNA 3K4AA 4KKBC 3V6BR 1TMQA 2GB2A 3NIDE 5DFVC 5EG6C 3H6AA 2SODB 5HDWA 35C8L 1OP3K 4HIEA 1LYQA 1CD8A 3EG9B 4M7LL 4G6FB 5KTEH 2HRHA 2JTYA 2GTZB 2P52A 4IEFA 4KH9A 4FFVC 3UJTL 1HIMH 4L9LB 4XVUC 2P5WA 3SKMB 1XSOA 3E9TA 2WXFA 1TETL 4AZ8B 5JZ7D 2UZIH 1JRHI 3TYGL 3U7WL 4WEMB 3VG0L 1KB5L 2P8LB 3UC0L 4E9XA 1NDTA 1C5CL 4AQ1A 2OBGA 2ZG1A 2B8OT 3AZUA 3QT2A 1IIIA 1HILA 4LSUH 4NKOA 4LKCB 4LQFH 3GZKA 2WTRB 4Q52A 3HPJA 1H19A 5SX5H 3BSZL 3FUEA 4H25B 3BP4A 1F18A 2FEEL 1M42A 3SYPA 3D0AA 3ZE2B 1SYVA 1CFQA 3MUZ1 5GJSH 3NJGA 5ABAA 1HH9B 2VC2B 4HCRH 1SJEA 1M3IA 2I07A 4EUPA 1AQ8A 1DJXA 3SO5A 4QRRA 5L6YH 4UZUA 3DXAD 4ETQA 1RZ8A 2DM4A 2HTKD 3CZNA 3MKGA 7FABL 3BUYB 3DPBA 4XMUA 3R8BB 4WU5B 3FOLB 3BKML 2WNKA 3R0MA 4HS6B 4I48B 5CJXC 5BZZA 2JWYA 2YFNA 3O9WB 2EYRA 4RSVA 1MJJA 1EAOA 4ZSOE 1GW0A 3BPNB 4FULA 3TO4C 4AE0A 3QXDA 3QDAA 3KLAB 3LKQB 3MREB 4HC1H 3VSUA 3JWDL 4EF3A 2IBGA 1TF4A 1H3GA 3NPSB 1HXYB 2R9HD 3AMKA 4UDTA 5TH2B 3PAZA 4FFTA 4KC3B 3U6RA 3L45A 1TNNA 4ZAKC 4U7SA 4YHMH 1BBJB 2C9XA 4XP9L 4KRNA 1KGJA 1YQVH 3L9BA 5BZWB 1PX8A 4KOBA 5ICXB 3VNYA 5A43C 5GJTL 2ICEB 2ZKXA 3C5SA 4Q0XL 2V9TA 3II1A 4A66A 4PI0A 3DOSB 4FNLH 3LXCA 5L8JB 1JYNA 1WBXB 3C2AL 5AKVA 1INDL 1S5HB 3PABB 4GIAA 1QBBA 1DBKL 1QTPA 1TQUA 3ZE1B 3H9SB 4B0MM 4TKWA 2FD6L 1B6DA 1EANA 2XI9A 3NCJH 1T3FB 4P2RA 5JR1H 4HP5A 2WUBH 4W9EC 3KH4A 3DLQR 3QIUD 3RTQB 2R27A 1BM7A 4BEIA 3FYEB 1CC3A 1DQLL 2AV7A 3DSFL 4WQOA 5ETUB 4HV8A 2W0FA 1OTSD 2X2JA 4AENB 4KO5A 4B50A 1KB9K 4EI5D 4A55A 1KTLB 2FB4H 4FXKB 4MQSB 3EJSA 4PRPB 1PCXA 2NX5D 4G7QB 3GSNB 1VACA 1QA9B 3QQ9D 4LAJH 1CTOA 1CFMA 1XIWA 3DX9B 4LPVA 5EO9A 4MJID 4U0QB 1DQVA 3FF8A 3D0LA 4OF5A 4DJMA 4NPYB 2P3YA 3FF7A 4AOFA 1LWHA 2BJML 3L3OA 4XMTA 3BH4A 2VDKH 1AKJA 1WD8A 3CFDA 2J2ZB 4MBOA 4H1LB 3G5VA 4M7KL 4F9PA 4K8RD 4FE9A 3S2AA 1FQ9C 2FATH 4ZX3A 3S3CB 1F11B 4BELD 1IC7H 4XPBH 3F6LA 3TO2A 1KPUB 5BOJA 3EOTL 2NY2C 4JHAL 4HT1L 1YRKA 1SHWA 4BSWB 4IBSA 5ADPL 4JPWL 2P24B 4UTCA 4NZJA 5KBMA 1WAAE 4BRVA 1RAMA 3VI4B 3G6JB 3ZGIA 5A16A 3HC3L 3L5IA 5CKGA 5K39A 3ES6B 1WFOA 2VLRE 1KCLA 4P46C 4Y9EA 3ZO0A 3WNJA 1CK0H 1A3QA 1FNEA 1WS8A 5ENWA 5AAWC 4FFZL 5CJBA 5TE6L 1E5ZA 2IH3A 2DMCA 1IM9D 3IGFA 2FLMA 2HT2C 4R2GB 2VWEE 1CGUA 2XLLA 3CUPA 2VSKB 3CFMA 4QR7A 3SDYL 1IGFH 3BT2H 2PWFA 4X6EB 3QQXA 4RBPK 3WL9A 2VZ3A 4OLUL 1NFKA 1NANI 4HU8A 4OI7A 3TVMA 2YAPA 4M6AA 4MQXD 4UMSA 3MBEC 2OMTA 4CKVX 2PF6A 4PREA 2JK5A 1WZKA 3D3VB 4JN2A 4MNHA 1RZ7L 5CLZA 2ZSWB 1S46A 4AQEA 3QJVB 3UIZA 4GJTB 4M5SA 4AEHL 2JB6B 1G7QA 2KZKA 2CJ3A 4K7PL 1SYSA 4GRWF 3ARSA 2CO3A 3E6HB 3GIZH 4JZJC 3HS9A 3STLB 3TXAA 1TQSA 5J12C 4P4RB 4XCNB 1N8ZA 3HI1B 3FN9A 2PWHA 1MQ8A 1U9KA 2IQ9H 4P5MA 2EXWD 3OPZH 4CUCA 2VXVL 4F80A 4NQDD 1V3JA 3QP3A 4HKBB 4A6YB 3ULUD 4UZSA 3BIKB 1A7QH 3P0GB 2CE6A 1DVFC 1AOHA 5AFAA 1UD6A 1G5GA 4OCSL 3GHEH 4MXWH 5FF6B 2BVPB 4OM0L 4BFKA 3KCWA 1UXSA 2DQJL 2XQBH 1X5FA 5J6HA 2MNWA 1NL0H 1XCXA 3TJHD 3UAJC 3VRLF 5BV7C 4BK8A 4ILDA 2V5MA 1HHHA 5C0RL 3ZKXC 1BQRA 5MEQA 3J2PA 2DMHA 4RAUB 4BFFA 2MNUA 3NIDB 3MX0A 3D48R 3NTCL 3EGXA 1Z0MA 3N43B 3F01A 2XIIA 1H3TA 3AREB 5JPMB 4HWEH 4YJZL 3OAZK 2NRDA 3QIWC 4LLMA 3CFKA 3FUNA 4GRMB 4H4NA 4IRJD 4JREC 5DC9B 2OSXA 4UWQB 3QIBB 2ZCHH 1RV6X 5EU3A 4HOXA 2EXTA 4QDGA 4Z5RA 2YKLL 1QP1A 4JMXA 3MJ9H 4JS7A 1HSAB 2A74B 4LCYA 1WISA 1ZSDA 2M2DA 3K7UA 4UF7C 1Q0XH 3I75A 3QH3B 3VFWA 1OQOA 2X4UB 4ZX6A 1UM5L 2WXLA 3NFNB 5IQ9B 4G8IA 2DN7A 3T09A 3TF4A 1CYWA 3MNDA 2XPZA 3WS6A 1WE5A 3P9MA 4FTVA 5BVPH 2OJ1A 5C08E 3VG9C 3D7PA 4D94A 5EUKB 5F9DC 3SB3A 5C0BA 2NW3A 1J8HE 5I6MA 4U2YA 4P07A 4Q6IA 1MCIA 1XCQB 2P7TA 1T5WB 1ZWIB 1MY5A 4GI8A 5ERWA 4URTB 5TGBB 4J5VA 2O1AA 2EC8A 5F89B 2BMKB 2Z9TA 3GMPA 5IWLA 1Z9MA 1CFVH 4XBEH 2CBMA 3DYPA 4HIXL 3ESVF 5C0AD 1G6RB 3WXVH 3IMUA 1PVHA 2VOTA 1JNNH 5F6HJ 2Q7YA 2K70A 4AGMA 2J8HA 1HQ4A 3BAJA 5FKPB 4GQ9H 4AYDC 3BP7A 1J10A 1YUHB 4FX5A 4UOW1 3FTXA 4ZSOB 3P2DA 2ZOKB 3TT3L 3RDTA 4XNXL 1J9CT 1UOWA 2BS8A 2I24N 3WTYA 1U95A 4AH2A 2YBRA 2D2CC 1ES0A 2LTQB 4JKNA 2L8AA 5ESQA 1TJMA 2AMUA 3QVAA 1DP0A 2XBDA 4BUGA 2ZOOA 1KT2A 1CU4H 2IV8A 5IB4B 4JO3H 4JL2A 4YVNA 1EJ8A 1KIQB 4UOJA 2RQEA 4KDTA 5F6HI 4OD3H 1U8KA 2GJ6A 1QEWB 4OZFA 5DUML 3D1MC 4TL4A 4B0MB 4RMSA 1S3KL 2OXHB 1WWBX 2BO0A 3WLWC 4QO1A 1HCZA 3M1CA 4V1DD 4TOYH 2KI6A 5F7EH 4Q6YA 2EXYD 2R0KL 4PRNA 3DHPA 4N6QA 4Z77A 1U3HB 2C7FA 2ZKHH 1S4IA 3SDXF 1C16B 4MS6A 3WNIA 1OGAA 1CL7I 4XRCB 3EYQD 2QEJA 2G60L 1TZAA 3T3PE 3QUMB 5CKAA 1MEXH 2PNDA 5EORL 5DMKA 2ODIA 3VVWA 3BWAB 4U49A 1SBSL 2AK1H 4Y8AA 1FNGA 4Z7WA 2NY5C 1BAWA 2OYPA 1CLZL 43C9A 2O72A 4FQHA 3RGVB 3UL4A 3OZLA 1DZ0A 4I77L 3F7RA 4UINH 3QPQC 2BIQA 1T66C 2GHZA 5CINL 3VCLB 3ATAA 4HAKA 4CU7A 2IANE 2NLJA 4IRZL 1F5WA 3NJFA 3D4ZA 1XH1A 3D09A 4LHQB 3SGDI 3OAYK 5K1JA 3HHRB 2YD3A 4ZYKA 1TEGA 4OBRA 4B53A 3LEXA 5F72S 4MVBC 3WEMA 4G7YH 4L5FE 2COQA 1QW8A 3V9FA 3AAZA 3FO2A 1J05B 3FQYA 5BPPA 1MRFH 3UEZA 4Y2LA 2Q9OA 3CFBA 1QFWH 1IUZA 3ASWA 3DUHA 3DV6A 4NQQA 3UTTD 3S8FB 1H8SA 3ULVC 1OP5K 4NZDA 3ORJA 3BVWA 4PJBE 4KXDA 4PUBL 4TULL 3G6DL 4EO5A 4JRWA 5EUOA 5C9JA 1V7NL 5TJWK 1BZ7A 3JWNC 4XMLL 3QJOA 5BRPA 4L29B 5KVEE 1EXHA 2G2PA 4M5YH 3V6ZB 1Z66A 4HJSA 3VXUE 1FC2D 1KULA 1GGTA 2Z8VC 3ZQWA 5ADOH 3U1SL 5IBLD 2IPUG 3AM8A 3FCTA 4IBTA 2DTMH 3D0VB 1QI5A 4NQVB 3RX5A 4JFTA 1JFHA 3I74A 3BMVA 1U8PB 5DD3L 5D2NC 1TDQA 5ICUA 1MCOH 5CEYB 1E6OH 5AVQB 1BEYL 1TQCC 1EJFA 3QC6X 4LBAA 3KLHD 3GGWB 7PAZA 4JO1L 2X4PA 4PEEA 3GSXB 5HYEA 1D2OA 1U3YA 3TT1H 3Q2VA 3L9RB 4ZTPH 1LDSA 1RZGA 6FABL 5ELIA 3BPOB 4J6RL 2HMIC 2PO6A 3QUYD 3D39E 2D0GA 4GKZB 3BVXA 4I3GA 3T65A 1N2RA 2EACA 3O6FC 4ODWA 3QZWG 4FKHA 1QSFA 1N4XH 3WNMA 2XFGB 4NN5C 4HD5A 1YY9D 1KXQA 3UTSE 4P23A 1YYCA 1WWWX 4CU6A 1N0XH 2XKUA 2NNAA 3A6BL 1U8MB 3IDNA 4UTAA 4P2OB 5EPMB 3WLBB 5SWZE 4S1SH 4GAFB 5A2LH 2J6EA 3SKUD 5JZ7C 3T5WA 3C09C 5DJ8A 2PYFB 3RWHB 5EFIB 1GY2A 4ZW3A 1D5IL 2Z4QB 1B4TA 2D03H 2WZAA 3WNPA 1I7RA 4YGAB 5GGRY 5L0QC 1OCOB 4Z3FA 1OW0C 2JJUA 1KBBA 2VZOA 3NIGF 3CFEB 5B7MA 1RMFH 4XCYA 1ORQA 3P73A 4RDBA 3K6OA 4JM2C 2GTWB 4BKTC 1E4KA 5FUOH 3Q6FB 4XP1L 4GAJL 3ZHLA 2W65A 3OKKA 5E4EC 5I1KL 2DYPD 3OR6A 2R8SL 1YNKH 4X99B 4UNVA 3QUKA 1HHJB 3RVVD 1JYXA 3WFHA 1YNLL 2ADJB 5H35A 1XGPA 3S0PA 1HSBB 1NGZB 1SDAB 1WEJH 2NY0D 3R0NA 3RB7A 1NGPL 1YNTB 2BP0A 2IH1B 2XC8A 4M00A 5C08B 3GEWB 5H8DA 2LV4A 4NQEE 3FH7A 1J8HB 2BVQA 4DP1X 2J5LC 4KTGA 3GBNL 4WNSA 1NMAH 3R1GL 1QVOB 2EC9U 1ZTXH 2PW1A 2BIMA 2BSTA 4U3XA 5AOJA 4KJYB 2HFEA 3VDBA 2OSLB 3EF4A 4WTZG 4ACPA 1YEJH 2H6PA 3P4MB 5EZPA 2WSKA 4POUB 3QUXA 3OVUB 2R9HC 4FQCL 5FO7B 5E2JA 2ZYIA 2BNQA 1E27B 2ILLA 1FLRL 1OP4A 3OKNA 2IGFL 4KMTH 1OARL 4OW6A 4WENB 3B5HA 1DBBH 2EVHA 4P3DB 1BQLH 4DQOH 3TESA 1G7JB 4JR9H 2NNXA 3MI6A 1YEEL 1MFDL 1T2QL 4U1MB 3EH5B 2ZCZA 3NCXA 3UPAA 3BE1H 2D9CA 1JJUA 2AABH 2X4SB 2MCPH 3U0PA 1C7SA 3L4UA 2D7TH 4G9DA 5KANI 3HFFA 3EOBA 3MJ7B 1E9PB 2Y2TA 1MFBL 3DVNA 3EADA 5DQDH 3D05A 4OUOA 2XWXA 2EDRA 2C9AA 1OTSC 1FZMA 3ROOA 2ED7A 2IPKB 1IT9H 2X3CA 4JFDE 1RJYA 2ODHA 4QF1B 1JWMB 1Z3GL 5E95B 1U8HA 1Q9LB 3QQ9C 4DERA 1X6LA 4DQAA 3OLIA 2JB5H 4UT6H 3UFIA 4E5XG 4F1ZA 4AWJC 1EV2E 3LQAL 2X2IA 1A3RL 1QQDB 3GO1L 3JT0A 5LDSA 3SY6A 3EXJA 3IK2A 4CC4C 3IETA 3M6DA 4HHAA 4WJ5A 1SDDA 4OZ4A 4L1BA 3N9GL 3MRGB 3TZVD 2XN9A 3T3PB 4PRPD 1NINA 2YAEA 4U3HA 4P59H 3GMRB 5F7HA 2HLFC 5B7FA 1KG0B 1DQIA 5EZLA 2G0LA 3RIAK 4ECNA 4AK1A 3MHZA 4K8RC 3EZ8A 4CNIA 1ZT4A 2PYEE 3N3EA 2HXAA 3PE9A 3QJHA 1E0OB 2OP4H 1U58B 2LAAA 4XNYH 2XA8H 2UY6A 2NDFA 2YPKB 3D08A 2IBBA 5BXFA 7CGTA 4NWUH 1FNSH 2E7DA 2QGDA 4NQCE 3QEUB 3DX0A 3ZT6A 2AEQL 3IFOA 1MIMH 2IANB 1MRCH 5ID0A 1QD0A 1MCPL 2LFEA 4CJ1A 5D9SA 1TO5A 2VXQA 1G7PB 2P9RA 1W8OA 3LRLA 2IJ0C 3SDAC 5D1XD 4H8VA 3F05A 4PJAF 3VA6A 3T3ME 5AVRB 2OR7A 2R0WL 3KYAA 4CC0A 5DQ9A 3HTLX 4M3HA 4H20L 3ZDWA 4UQBA 1T1XA 2ZP8A 5DD6B 3UYRL 2X9XA 2CBTA 3DWTA 3EIFA 4I1NB 5IFAH 2EH7H 3LKOB 4PJBB 3CSPA 3ZY7A 4X7SL 3SKJL 1QBLH 3NUKA 1I9JL 2H2PC 1KCUL 2J12B 3I6LE 5JXAL 4KKZA 4MJ2A 3QUZA 3SKNA 3H2PA 3MV11 1RPKA 1RJCA 2E8YA 2Q8BH 3MTRA 4G6AC 1FAIH 4HEPA 4R2GD 4HFUL 4HS8L 3VXUB 2GSGB 4ODXA 3C60D 4NI3A 1BVKA 2QTVA 4M5TA 3F6JA 4CVUA 4JAMA 3KDPB 1KTBA 4FCAA 3VXRA 4LGRB 3X11A 1AE6H 4GG6A 1NCCH 2Y4SA 1NC4B 2J4WL 5KVFH 3TCTA 3P40A 3D3VD 1SM3H 2EXWC 3DC0A 2JXMB 4HA1A 2B3IA 2W5PA 1GGCH 4Y4FD 1Z5LA 1CFNA 3HR5A 1ZLVK 3KNBB 2FNBA 4LCWE 3ISRA 4G2AA 4LHJB 4P2AA 4PJCE 3BH9B 2Q6WB 5JPNA 3C6LB 1X7SA 2HB0A 4RFOH 1FFTB 1WFJA 2HJFA 2XHNA 4UQIM 4BWWA 3U30B 2QQLH 3D39B 2DW5A 3VD7A 4CDHA 4HIIA 4QWWD 5A7EA 4Z78B 3IN2A 2VZTA 1CWVA 1T1YB 1IEAB 1A7PH 3ARPA 4HX1A 3N55A 5F44A 4NNXB 3UTSB 4XN4A 2AFNA 1PS3A 4Y2NA 4MJ4A 4W6YB 5CNHA 3FU8A 4GP8B 1H5BB 2WTOA 1IM3A 1B90A 4HPOH 1HJCA 4FNUA 2R2BB 2HJKB 5SWZB 4QRTA 1QRNA 2BSEA 4J39A 1VEPA 4KZDL 4NDMB 3MV9D 5AAMA 2F08A 3ABMB 3X3GL 4IRJC 2R1YA 5SV3A 1QLEB 4MCMA 4LU5H 5GGUA 4FQ1H 2ROYA 4L8CB 5D6CA 3O3BB 5D2LA 1M2OA 1NCAL 2WQUA 4ZBJA 3WN5C 4YMPA 1NEZG 3VWJA 3BZEA 1S7VB 5CN3A 4AMWA 2TAAA 4HCIA 4GP5B 4MSWB 4O4YL 4N1HB 3OKEB 1DN0A 2XU9A 4AYFB 1CXIA 4LPUA 2CO7A 1ND0B 1KOAA 3CHXA 3DI2B 4GS7B 5DRZA 5K33A 5I1AB 1A25A 3FBQA 4W4OC 5EBMA 5I5RA 3RIFF 5EU7C 1DBJH 2XWJA 2C9RA 3PGFL 5DJDB 4A2HA 5E1HB 4TUOB 4R5TA 1LJMA 1F6AA 4NAMA 2XVLA 1MG3C 5EOQL 5J1SC 1IGIL 2ZUTA 1HTYA 5FOJA 2EIMB 4TL5A 1P5VB 2MCAA 4HUXA 3QYMA 2CUHA 3MRNA 1SXAA 3CLFL 3ZE1F 4ENZA 2OV0A 1RUPH 2QQKL 4Y4HD 3NBNA 4XC3H 3NSXA 3F00A 3PU7A 4NQEB 3V0IA 5I9QB 4AYMC 1JHTA 1AFVH 4WV1A 1Z9LA 1I85C 3CFUA 4ODHH 2R2CA 2OS7A 5AL0A 1PEZA 3FU5A 4BWTA 3PHOB 3VB9A 2Z4TA 3EJJX 4NB7A 3SDDD 3IDIA 5BJTA 3N42F 3T0EA 4B9IA 1BJMA 1P4BL 3ML9A 5E0QA 4JE0A 3CLEH 1GHFL 2QGEA 1BMWA 3GQFA 4E5XB 3SDCA 2FECI 4NJ9H 3QDME 5LNEA 1ZD6A 3P9WB 2CMRH 4FD0A 3UBXG 4OFVA 4JFEA 4P5RA 1SOXA 5EB9A 1JZ8A 3P3RA 1CMOA 1HIML 4OZGE 3HG5A 3OJVC 1RZQA 4RAHA 2UZIL 1F2XK 4IBQA 3VXOB 3RQ3A 1G1YA 1FL3B 5ICZB 1J1XH 3DRTB 2DIJA 2GSMB 2F1BA 5I2IB 5EF2A 5I28A 5H37G 2OMYB 3SPVB 4LSUL 3H3KA 1QFUL 4PJEF 4LVNB 1A6AB 3EYQC 3DJ9A 1ORSA 5KWYC 2O61A 3VXNA 4S2SA 5JO5B 3TNNB 1WZMA 2AJVL 4ZG1A 5JLZA 3ZZ1A 1RK0A 4R4ND 3GSRB 4MNGA 5GJSL 4G83A 3R8QA 5HHOA 1U3HD 1W0VB 5HGBA 3ESNA 2OMXA 1KFAL 4HCRL 2QKSA 1KCWA 4DVRL 1XF4B 4DP0X 4I9XA 2F5AH 4PS4H 4C4BA 2CKNA 1IKNC 2YO3A 3LN4A 5GZNC 1VEOA 4UDUA 5CJ8A 4OCWH 1T20A 5BS0E 5SWQB 4MNQA 3NDYE 4R5VA 4Z7NB 2XZZA 3O3DA 1UACH 5T3XH 3WS3B 5CBEA 3K4DA 4KKCC 1UH2A 1L5GB 1FN4A 1QWUA 2PYEB 3QJQB 1NBZA 5DSCA 5HI3C 3K5SA 1COBA 3T4YB 4JFVA 3FCGA 4OF8A 4NQCB 4X6FB 2H3KA 4KI5F 5T1LA 2VQTA 1AZZC 4Z7WF 2NTFA 4HDIA 2M83A 1KCVH 1C5DA 4G43A 1PJWA 4XN8A 4F7MA 5MHSE 1FPTL 1IC5L 4YHML 1CICD 3V10A 1SXBA 5K1VA 3KPSA 5FK9A 1YQVL 4LSVH 5E99H 2XIBA 3P4NA 3T3MB 1J8RA 3KE0A 3NCYP 4YE4H 3Q43A 5DC0A 5E5LA 4BWUA 3KL3A 4OUUA 3CC5A 3Q48A 4FNLL 4LSPL 2CIIA 2I85A 1JWUB 1UFUA 3W9EA 4MJ6B 4EDWL 1BLNB 3KH3A 4ZXBB 3NCJL 4MMYA 2VLRD 4XNDA 3QHZH 5JR1L 5IFJB 2VSMB 2WUBL 5E2VH 3ARBC 2XY1A 5AVVB 4LSDA 1WGVA 3FPXA 3VE0B 2WUCH 2SEBA 2FB4L 2ADIB 3NYKA 1BF2A 2B7DT 2ZOUA 2GIMA 1SXNA 2BP5M 4ZFGH 2CDFA 1AGFB 5EUOF 1U33A 5KSAC 1JZGA 2E27H 3Q0HA 1A3LH 4XP5H 3GPSA 2DQDH 2VERA 5HGGS 2QFPA 3HN5A 1EHNA 3B9KA 4KJWD 1LO5B 1O6SB 1BFOB 2NNFA 4C83B 1B2YA 1EGJA 2W60A 3QUYC 3IF1B 4P48A 2BP8B 3QARA 4GIPD 5FB8B 3W39B 3QO1A 4LFHG 2VDKL 4MLIA 2F68X 4FQQA 4MJ5B 5AB9A 5CEZD 4GT0A 3VQMA 4XX1E 1NEZB 3S3JA 2AJYL 1ETJA 4HLZG 2A9DA 4LLQB 2VN7A 3DGCR 3S35L 2FATL 3UERA 4DTGH 2O4EA 4LCWB 1MFEH 4PJCB 3U9UB 1IC7L 4XPBL 2P43B 1G9NH 4MA7H 3OKLB 3KR3H 9PCYA 1T22A 4NO0B 3D33A 2J20A 4S1RH 3RX7A 1DVUA 3HZVA 1QFHA 2X40A 3FSZA 3G6AA 1RZKH 1EFQA 2AAVA 2G75A 1UD5A 2J88H 4W81A 3ECBA 3IJSA 1JTPA 3BD3A 5CP7B 1BECA 4Z95H 3VI3A 3KPNB 5ACLA 1OPOA 1IGTB 3IKCA 1CK0L 3RL2A 43CAB 5H94B 4F58H 2UWEA 4XMKH 1M71B 3QORA 3NJKA 2HKAA 4B9YA 4DN4L 3FQ2A 3PWVB 5JW3L 4O2EA 1HNGA 3HKFA 1E4XI 2XETA 3FB8B 2XNAA 4AJYV 4OSUH 4XX1G 3H2WA 3BT2L 4IKNA 4LKXA 4KPHL 3HG0A 3U9PH 4NRZA 3SGKC 4K3EH 2CLZA 1A2YA 5IREA 3OGCB 2LAGB 2IQAA 1DJWA 3CHRA 1H9DA 5ES4B 4ZMYA 2IGLA 4N2HA 1F4WH 5KEZA 1J5HA 4HUVB 3EO0B 5JDSB 2X70B 1LE5A 5HJ3B 5BQDA 1D7CA 3WDIA 3UBXB 1VA9A 4J3BA 3PWNA 3COOA 5HHNA 2YGOA 2QKIA 3GIZL 3LD8C 3WHE0 2EVJA 4JDTH 2Z6FA 4HBQA 4KHTL 5AW6B 5E08L 3V5DA 4W9ZA 1HOCA 4PW9A 4HBCL 4HEME 3HZMA 5C08D 4A1RA 3OPZL 4KZEH 1F1DA 5JW5B 4MZ3A 1J8HD 3IXTA 2NY3B 1OTUD 3KS0H 3CDGA 3GKWH 4UU9A 4XO9A 4Y5YA 2V37A 5EMYA 4Y9GA 3HI6H 4H7VA 3K72A 4CVWA 3GHEL 4MXWL 1PD0A 3BXNB 1JGVH 2H0FA 2CRYA 2XQBL 4WGWB 4LLWA 2J72A 1NL0L 1RP9A 2GQHA 3MV7E 1G1OA 1QLFB 3NPSC 4PGCB 4JG9A 1LILA 4PJHA 5LBSH 3WFBH 4PVLA 1GZPA 1HCYA 1PLGH 2R56H 3VXTB 3QDMB 5FA4A 5FYJU 5EF1A 2G5BA 1BF5A 1FNHA 1I3RA 1NMCB 2NXZD 3IAPA 4HWEL 2ICEC 3VFNA 5F96H 1XGUA 4OZGB 3V2AR 2ZCHL 1NFDB 3UG3A 3RURA 3KPMB 1VDGA 5IF0B 1GYVA 3GMLA 1A8ZA 1SJVA 2WQWA 2H9GB 4HK0B 3C8DA 4I2XA 3RTQC 2JCCA 3T6QC 4FQXA 1NC2B 3G3LA 1Q0XL 1R3LA 3DJRA 4PJ8A 3WIFB 2B9AA 2DH3A 1UXWA 1WHOA 4QIRA 5E6ZA 1JTOA 2CDEB 1GGYA 3QDJA 1A7NH 2ZWNA 1D7FA 1MCKA 3L6FA 3ILPA 4KXZH 4L0PB 4FXKC 3UEQA 2MIZA 3TZVC 4MB3A 4DK6A 4Z8FL 4IRSD 5F88A 3L1GA 5EV7A 4P5TD 4FZEH 4CMHB 1QLRB 1VZIA 1U4FA 1WIUA 1RK7A 3FU6A 1CFVL 4XBEL 1KACB 2X4TA 3FTUA 3HUJA 1KEML 2YEZB 4I0PA 1YEIH 1T2XA 3FUIA 3WEOA 5BS0B 4JJHA 5LCVH 2BNRD 4AQAB 1T0OA 1DO5A 4YSAA 4RNRB 3SYOA 5D7IF 4OI8A 1EH9A 1MHCB 2VL5A 5T5NF 3QO0B 2ICWJ 4XNUL 2Y36H 2EDJA 4MKMA 3E6FB 3LPPA 1ACYH 2DBLL 3L9YA 3VRJB 3WTXA 2IAND 2DF3A 4LZKA 4S1QL 2CUAA 1ZLEA 2BZ7A 2PPAA 4G1MA 3P3YA 3FDWA 4ZW7A 1CU4L 4I5BA 2GT9A 3FCSB 3MJGX 5HHMD 5HGDB 3WIAA 3SPCA 5FCUH 3AUVA 4OVUA 1H3XA 4Y19D 1I9RL 4EIZC 1QNZL 3NAAH 3K3QA 1YMMA 4R2GC 5E70A 4ANUA 2GC4C 3GJFH 3O2VL 1W72B 1KYFA 3KLLA 3UP6A 2ICWI 4AIZA 3J7HA 5F7EL 3GK8H 3AT0A 1F2QA 1MN4A 5K9QI 2ZKHL 1L9SA 3ARRA 5JMOC 2WO2B 4C58B 2ITCA 2YD5A 3OD3A 4X6CA 4HG4J 1MEXL 4XO3A 3BP4B 5FGSA 2YEQA 5FFGA 5C0BE 4KDVA 3UBGA 2AK1L 2H32H 4UIMB 1L6ZA 2LE9A 5C1MB 5INDA 1NC4D 2I07B 2YMXH 4OT1L 3O41A 1NUNB 5E6IA 5CZVH 1RZ8B 4MAYA 1SY6A 2FK9A 4I13B 3NCMA 1QW9A 2BSRA 2V9UA 1IBFA 1FIEA 1IGYB 1GAFH 2K6YA 1DJIA 2EYRB 3HAEH 4G9FE 3C6LD 4L3EE 3L3KB 1E4HA 5I76A 4GG6F 1GTNA 4CN1A 2YFOA 3B7RL 3D39D 1ZLUH 2ENPA 4R97B 2VKWA 1KGCE 1S9VA 1I1YB 1QBAA 3VFUA 1MRFL 4X6BA 5EBGA 4RGOH 1QFWL 2KERA 1J0KA 5KN5B 1EEZB 1NWOA 3Q6GH 3P54A 4J3VA 2YXMA 5DK0A 1I9IH 3EOAA 1FV1B 3B5GA 1BXUA 1KJVA 2A9NH 2EIDA 2K8MA 1M4KA 3HMWH 5B8CA 5CF3A 2ZNXA 1I1AD 2C1PA 3AREC 5JPMC 5K93A 4M8QB 4I18B 5F3FA 1D9KD 1CGSH 1HDMA 1SVCP 3FFCD 1R5VB 4M5YL 2VLJA 4LOEA 1PCSA 2P8MB 3HC2A 4PV1C 4KO6A 3FB6B 3TFKD 2A74C 3WDJA 3SGEI 5FYJH 4G1EB 5J6GB 3FQRA 4RAVA 5GRVL 1S7QB 2P4AB 4ZDHA 2QLYA 2WWKT 1G9MC 1UWGH 1FG2A 2QMJA 3S3DB 4LVOB 2Y7QA 3REVB 1AY1H 1NAMA 4WI3A 3OLDA 1OGAE 3BUTA 4YHLH 4WDIB 1E6OL 1ROWA 1MZZA 4WI5A 1QBMH 1JP5A 3H4FA 4JL1A 3TT1L 3P02A 2V5YA 4ZFOL 3VGEA 1I1RA 5L4MA 4KZCA 3EDDA 2D4DA 3F83A 4JFPA 2F5BH 2G9HB 1A1MB 3G5YA 4ZOEA 3DO4A 5C0NC 3MRQA 3RUGF 2VISB 1MHHB 3BAYA 1TYEB 1U6AH 5HJBA 1AKJB 4QHKJ 1WTGT 4OZFG 3H0TA 1N4XL 4TVPE 4W6WB 1UZ8A 4L0ZA 3CZUB 4X7DC 3VFRB 3Q2LA 1N0XL 2CG9X 4HQQH 2E7LA 4TQIA 4AG4H 3HG1A 5IMMA 1WBYB 1EVTC 4S1SL 4NM4L 3MV7B 2WZPA 4PD4J 2LTQC 4OLVH 2LVEA 5AW5B 5T3ZH 5CJ5A 4PV9A 1X6NA 5BRZD 1BD2A 3M46A 2VABB 3Q44A 3TH3T 4FYTA 5J8OA 5KJRH 1MJ8L 3L9EA 1B4RA 2D03L 3F5WA 3D2TA 3UAFA 5IW1A 1R5WB 3S3BB 5C07A 4QAMB 2BRRL 5EUOE 4QHKI 3GSVA 3MNVA 1RMFL 4JFOA 3RI5K 3KGTA 4H13C 2OMNA 1A4AA 2IH3B 1EZVY 5FUOL 1OP3H 5F1NB 2FYYA 4IHOA 4YFDB 4FYSA 2C9VA 1YNKL 2Y3AA 4JQIH 1MF2H 3CUPB 4MXVE 2HWZL 1BFTA 4R4NC 4XHJD 3WJLC 2AQRA 3WL9B 1U3HC 2BC4B 4BQ9A 2H6OA 5FECB 1I7ZA 1WEJL 2NY4D 4JFDD 1OZTG 3RWEB 4GXVH 4TPRH 4DZ8B 4DN3H 1JXKA 4PTUB 4PREB 2JK5B 3A47A 4R26L 4XPHH 5DFAA 2NYYD 3NGBB 4JN2B 4MNHB 4NCC2 5I5MA 2VXTH 4AQEB 5DD5L 3EBIA 1IGML 1JF6A 1NMAL 4RQQB 5D6DA 4BZ1A 2AQ2A 1ZTXL 1RIVH 4TMPA 1Z5HA 2Z0UA 1IZJA 3OF6D 4Y4KA 4B6ZA 1HS6A 1RPQA 4R96A 1OY3B 1OSZA 3G5XA 4JPSA 2A6KA 2PABA 3TS8A 3O3UN 5HYFA 1P7KA 4DEUA 2PCFB 1LO2H 1GA2A 12E8L 2PYED 3GMOB 5HHPA 4K7PX 2E86A 3X13B 1D5MB 4EN2A 3BQUA 4UQ2B 1S7WA 1X5AA 2V0AA 1ZS8A 4KMTL 3SIKA 2V2WA 1AXSB 1DBBL 5CMAB 3WNNA 1BQLL 3DROA 1UXSB 4JR9L 1TXKA 3KPOA 5J6HB 1DQQA 1G87A 1BVLB 4FJYA 4R4FH 1KYDA 4F3FB 3KLSA 1MG2C 4OFPA 1S7TB 2K3TA 3BE1L 4ODSH 5L2KA 2OK0L 4BQBA 3KW8A 1V3KA 2YA0A 2MCPL 3ZOAA 5HYIA 1UASA 2D7TL 2RIKA 2RR3A 1KCKA 5DQDL 3UG5A 4QJ3B 1W8NA 3GXDA 5JIKA 2VERN 3SPHA 1AO7D 5CSBA 1LL1A 2VN5A 1IT9L 1XH2A 2VWEC 3CFKB 4PH8A 2P44B 4HETA 4JRYA 4L9DA 5TQ0L 2JB5L 2KBGA 3Q1EA 5INCB 4BFJA 4HAGA 1IL1B 4WW2B 3I6LD 5FUZH 3WTVA 4OGAD 4JY4B 4ZPVA 3VWKB 4P2YA 1AZUA 1L9QA 2QGCA 3UZVB 4D7PA 4YXKH 2DL2A 3TA3A 1ZV2A 5I1LA 1MCBA 3BRDA 3C6EA 4P59L 2QVTA 3OKMA 2OI9B 4M3KB 4DGVH 5EC1B 5C0BB 3H9YA 3GSQB 4AUYA 4FJ6A 1KBGH 2OP4L 3BPOC 3BHBA 2XA8L 5AWNH 4XN1A 5ESVB 4MAUH 1B3IA 4DKFL 3MCLL 4BD4A 4H5SB 1MIML 4YFEA 1MRCL 4PCTA 4JG0H 5IT2H 1GYUA 2IOIA 1K2DA 5IKCA 3VU2A 7PCYA 1HQ4B 1F3JB 3TONA 2H1XA 3BP7B 3IMTA 3KCPA 4FL4B 4FXLA 4G9FB 3PWUB 4L3EB 1WK0A 4LCVA 2XFXB 1ZLWK 4W9DC 4P2OC 3RDTB 4PP1D 1EUUA 3I9AA 3BMWA 2VQ1B 4Q58C 2OCJA 3TNMB 4ZNCD 3JV6B 1U95B 1P4UA 3BPLB 4K3DH 4Z7AA 4AH2B 5GGRA 3CDCA 2YBRB 1SQMA 4Z7VE 1ES0B 2XKNB 2CKBH 3DURB 2EH7L 3MRBA 4Y0GA 2M1KA 2IPUK 4NZFA 1RURH 4K73A 2PPFA 2WMPB 3NQIA 3WTUA 4D9QD 3ZKND 3BRGC 3KYMB 3L1FA 3FKUS 1NCNA 2Q8BL 3FFOA 5E8DH 1U8KB 2JNZA 1WZAA 1FAIL 4JHUA 4M1GH 1R47A 5B3NA 3DV4B 1VRSA 3TBYB 1J9TA 2E56A 5TDOB 3HS0C 3EW3B 3U2SA 3HZ3A 5ECJE 3B6SB 2UWEF 4ZPTB 1RK1B 2ED8A 1AE6L 4KK6D 2WCGA 1NCCL 2NPLX 3WIHA 4OLZH 4J4PA 4NX0A 5HDOA 1OGAB 4GUOA 4RBPH 1SM3L 4WWKD 4N87A 3TBVB 1BHGA 2XQYA 1GGCL 2QQQA 5DMKB 1E7VA 3FRUB 1CGWA 4FLRA 4RFOL 2Q87A 2QQLL 4KRPD 3FTYA 4XXWA 5J7CC 5DK3A 4HIHA 4HYTB 3WTWA 3GMQA 3MRHA 1LWJA 1A7PL 4WI6A 4PGDB 4PS7A 3LEXB 4RGND 5KYNA 1CZ8H 1KJMA 3WUWG 2KDGA 3CDZA 4HXAL 3IBEA 4PB0L 4FERA 2EO1A 2BWDA 4HPOL 3UOAB 1E4JA 1PX3A 1Y18B 4Z7UE 4BZ2A 3FRPA 5EU4A 2F74A 4HWNA 2DIEA 1VADA 3DV6B 4LU5L 1NSNH 1Z6JT 4FQ1L 4MQTB 4OKVA 2NY5H 4BJLA 2FR4B 2HTLD 2YIHA 4LIQH 5E6RB 5JHMA 1J5IA 5CLTA 3O0RH 3EH4B 3L2LA 1BSIA 4HKXB 3EBHA 1YHPA 2R69A 2VJXA 4FMVA 4PJHF 4DP4X 4NP4L 2IAMA 2BWQA 5IB1B 1GYCA 1NGQH 3IJEB 2TSBA 4LL9A 4IRSC 3H53A 4HFWA 5DHMC 2CLVB 4DUVA 3OAZH 3LRKA 1TTUA 2GAZA 1E5YA 1JK9A 4PMFA 3K1KC 3MODH 3VXRE 2WVVB 4GUPA 3ULVH 1T89A 1L3WA 1KZQA 3HVDA 5ALCH 4XE0A 2ZAIA 1CE6B 2EADA 4XC3L 2ZD0A 1L4IA 2JCCF 3A67H 2OMUA 3EF7A 1AFVL 2YSSA 1WH0A 2Z31D 5A2FA 2WP3O 4ODHL 2X4PB 2XWCA 4UTBH 3JWNH 2NW2B 2XSKA 3HZYB 3A22A 2MPAH 2O6CA 2PO6B 5I1IH 3EGSB 4J3OF 2DYSB 4IBVA 3IRZA 4EZJA 5BS0D 1JFQH 4NKMB 3CLEL 5KUMA 2I26N 3RHWK 2XJKA 1QYGH 2XVGA 5CN2A 5D4QA 5DRXA 5HYJD 2WGXA 2EKSA 4IJ3B 4HEPG 3B4NA 3WMPA 3GSOB 4JDEA 4D0BA 4XMPL 1FDLH 4IBYA 4YHKH 5KS9E 1W6WA 5KVFE 3EJUA 1KMGA 2N1TE 3LH2H 3IDNB 3TIEA 2ZUVA 2AKRA 1QRNE 2GJZA 2EEBA 5T1KA 3BFQG 1JGEB 3ARDD 2QV2A 1JD7A 2D3VA 5MHSD 5E8PA 3RWJB 1Q4NX 2E6PA 1M6OA 1J1XL 2VMJA 5D2LE 8FABA 1Y6KR 3QNYA 1ITBB 5JHLA 1GTFA 4LL1A 3U4EA 3LV3B 5GS0D 1T0MA 2Y6TE 4P9HC 4ALAL 2O6PA 5HJGA 3ZR5A 3VD4A 2BM3A 2XN1A 4OQTH 4N6RB 3WHXB 4A37A 3HHMA 2ZXAA 2P5WD 4YDJA 4X83A 4FP8H 4RX4D 4X98A 3KPLA 2BCKB 3OKKB 1MVFA 4IJTA 3OR6B 1U8OA 4XNZB 4EDXB 1XCTA 3NEXA 1Z1WA 3VDCA 4M6NH 1XXFC 1IAII 2QFRA 3SYQA 4PS4L 3JQOB 1LNUA 1VAHA 3V6FA 1CGXA 3U4AA 2DQFA 4GH7B 1NIFA 2QVFB 4OCWL 5FCSH 3VH8B 5C0IA 5JTWA 1AH1A 2BP0B 2IVFC 1UACL 5T3XL 1GS6X 4BCXA 2QPSA 1RKRA 4M93B 1XEUA 4AUUA 1MREL 3C6LC 3A24A 4L8BA 1T1WA 3KW7A 2BSTB 4QRRD 3JBG7 1E43A 3T0EE 3VMPA 1PPIA 2AJ3B 1X7QB 3GD1C 1XTLA 2H6PB 3SE4A 4AJ0A 2UVEA 3QBTB 3QUXB 1KCVL 5CJQL 4FJZA 2BFGA 2QL1A 2ZPKH 3GDBA 3L5XH 1SQ2N 2AK4E 3N04A 1TKWB 2AGJL 2F1AA 2RD0A 3OXRA 4TUUA 4PJDA 3IM1A 5FOBA 5FAAA 2PXYA 4LSVL 1Z9PA 3U0TB 4K5MA 2H41A 2MQ0A 3OAYH 3L81A 3SCMA 2CNYA 4FA7B 1D9KC 2D4FA 4FHJA 2C3GA 4POZD 1ZEAH 2JCWA 3L95A 3UGEA 1S9XA 3CHSA 4Z7VB 4AGPA 2YAMA 2XTSA 3WJJA 4KTDL 5D1ZA 3TFKC 2NNRA 4TSBH 3W56A 3QHZL 5D1QA 1MWAL 4AXWA 1BQHA 1NGYA 4FC3E 4G9DB 2QADD 1IAKA 3ZMNA 1OP5H 3KLQA 3TN0D 4BH7A 2EDWA 4WK2B 3MRJA 3BIBX 1CDCA 2BY0A 4GS7C 2JJWA 2WUCL 4DK5A 3ROOB 1FZMB 3ECWA 4LSTL 1RJYB 5IJDC 2WLNA 2N56A 4I0CC 3KLDA 4ZFGL 4PHXA 4JGJA 3WUWB 4P2RD 4MXQD 4XP5L 4E68A 2DQDL 2YQGA 3NP3A 1NANH 1R3IL 2Y3NA 4N0CD 5HHOE 3VFOA 5AZEH 4XNBA 3U36A 5B1JA 3MZTA 4ZFFB 1JNHA 1WCBA 1NFDF 1KGXA 2M8XA 4OZ4B 4YSOA 4DHLA 1OP9A 1ZJBA 3WEBA 4P4KA 1E28A 5I9QC 4Z7QF 2RAMA 3D4GA 1EXUB 4KXCA 1XIWD 1NCDH 4DTGL 4L4TA 3T8VA 4ZMPA 1S3RA 2LU3A 3T2PA 1FZKA 6PCYA 3PPSA 4MA7L 3ZIYA 5E4IA 3KR3L 2HFGL 1KIPA 5IVNA 2R4RH 4S1RL 1AKJD 5IMLA 1RZKL 3KVDD 3O11A 3APMA 2H0EA 5M94B 4HWUA 1DVXA 4MQ7A 4RESB 5AG8A 4CW1A 5FX3A 2W94A 3G9AB 4Z95L 3IFPB 2DWDA 4O02H 3MU3A 4F58L 4Z7UB 4XMKL 4E9RA 2ZOLB 1ED3A 2F53A 1NBQA 1KXVC 4LLVB 4K8RH 4RFNB 5FS5A 2EIZA 5DEZA 2VR8A 4KAQH 4QXGH 5DJ2A 3HHSB 1J0YA 1DHKA 1MIEH 3U9PL 3S37H 1THCA 4LVNC 2NY4C 3QUZB 3RWDB 3BWSA 4PVBA 2WYZA 1JZIA 1IBHA 4G8EB 2X7LA 2EDYA 3DBXA 1HEZA 1N0LB 3IYLW 3MBWA 1MLCA 3J8F7 4ODXB 1IBYA 4LBEA 4BFGA 1BVKB 1AQKH 4PTTB 4OVVA 3QPXH 1CBVH 2J56A 5I1JH 1JGUH 2WLLA 4S1DD 1BGXH 4LSSH 2LW3A 4Q4IA 4PVMA 4AC4A 2F18A 3K6FA 3VXRB 4MA3A 3WEAA 1UA6L 4JDTL 4B97A 3TVMD 3AXLA 5GGTA 3Q2WA 3WFEH 2VIRA 4LVHB 4OAWA 4OFKA 2WV3A 3CHQA 3GKWL 4M61A 1UB5B 1R3JB 4HJGB 3HR5B 1YUKB 4RGMB 4MX7A 4X6DF 3HE7A 3OR7B 3ARFB 1KJ2A 1JGVL 3BVNA 3E8UH 1N64H 5I8OL 1H0DA 4KK8D 2HX8A 4LOUC 4ISVB 4F9LC 5FKAA 4ESKA 3W0WE 3KWVA 5E23A 4J6IA 2EDTA 3WFBL 3H9HA 3MRIA 2R56L 1PLGL 1BVOA 2BY1A 4OR1A 2ZF9A 1XSKA 5K9KA 5KS9B 1YDPB 2ITFA 3E38A 5DA0B 2ATAA 3OKOA 1CF8H 1FF5A 3VI3E 2CD0A 3KLKA 3KYOB 3W9DA 3ULUH 1U2CA 2X38A 4XPTH 1QRNB 1TCRB 4GSRA 1NUDA 1OK8A 3LHAA 3TV8A 5GGUB 4QYAA 5TD4A 5HVFB 4PJFA 2UVFA 4XI5D 2BVUA 3DYOA 5D2LB 2ESVB 2VDOH 1B0RB 1UWEH 3BUIA 4NSKA 4H0GA 3EJCA 1CB4A 1O9ZA 4U1HA 1A7NL 1DN0B 2O5ZH 4OCYH 1MCNA 3RBSA 1U91B 2FX8H 4HWZB 5ID1A 4FOMA 3KBEA 4G7SB 2X1PA 5DRZB 1NLBL 3M86A 5HDRA 5E0FA 1E5AA 3NJLA 5GQBA 4FZEL 1JV5B 5IQ7H 5K9JL 4EKXA 4QJ5B 5DYOA 2XWBA 2BOCA 1KTRL 4E41E 4C4KO 2AQ3A 2V7NA 3O45A 3DOIA 1E5BA 4FTVD 1VHPA 1YEIL 1HYSD 4NLHA 5DZNA 1NLDH 5M7QA 1WP6A 3UDWC 2TSAA 2NYZA 2JKXA 4DUXA 2OMVB 3BYTA 4FFYL 4S11A 4NJAH 2RH0A 5AG9A 2Y36L 3QEHB 1SN2A 5BJTB 2J7LA 4PP1C 3IDIB 3GDCA 5GS1A 1HKFA 4PRHA 5DJ0B 4J23A 5B1AB 5B38A 4OGYH 1KELH 5CLYA 3NESA 3AS3A 4YGVA 2CK0H 3DIFA 3D34A 3SGDH 4PRDA 1I8IA 3LKPB 3NJHA 4M1DH 5HYSA 3EHBB 2QBWA 4Y7MA 2AK4B 4YFLI 2D7PA 3TWYA 2R23B 1TTFA 5I71B 3ZKNC 2K7QA 4YC2B 3RDTD 1KGCD 4TQ8A 3OHXB 4YHIA 2A99A 1YMHA 4JFYA 1DSWA 1F42A 1GC1C 4GAYB 4PYGA 4U1LA 3NAAL 2AEOA 3CFJB 3N41B 5IB2A 1JPTH 1E2WA 2IDCA 1F4YH 2YA1A 1X4YA 5LGJA 5CIPH 1A9BB 2CIKB 3LHPH 4NZRL 4PP2A 1MI5E 1Q94A 3CIQA 3GK8L 3L4TA 1MCQA 4DCQB 5J06A 1FA4A 4I2XE 5EOTA 4XCEB 2HG0A 1ZSHA 1SXSA 1TR7A 3KL0A 5IVZA 3V0WL 3VNZA 1L3NA 2GJ6D 3QHFH 4N0YH 3QQNA 1OM9A 1C9SA 1ORSB 1ZHBB 3STZA 1BMGA 5C0AA 4IM8A 5DGQA 3RWIA 2W8CA 4DO6A 3OXSB 2XTJE 1D6VH 3KJ4B 1ILUA 3KDMA 2WKOA 5B3JF 3TWCH 3CPLB 2YMXL 3NVQA 4NBXB 1OGAD 1OXYA 5CLWA 2VDLL 1LP9A 5CZVL 5KYUB 3LN4B 4XHQA 2AV1A 3HUJE 2GSIA 4R9HA 3CVHA 3VXMA 1FC1A 3PAVA 4KI5D 3MKKA 1QZ1A 2P48B 1MNNA 1LEGB 1U3ZA 1NBZB 2VQ4A 3DJZA 5I15L 4K71B 2W92A 2MTPA 3MFFB 1OE2A 4RGOL 1ZLVH 2AZUA 3FOMB 3CC1A 3LQZB 5FHBH 2BIHA 3VTTA 3IE9A 3BWUF 3NRQA 2HPOA 4F8QA 1H3WM 3LN5A 5D93B 5I18L 3US1A 1I9IL 2BP3A 4P05A 1BG9A 1HX0A 1L0XA 2HTLC 2M26A 4HDIB 2F19H 3MCKB 3TU6A 4QRQA 4GKLA 1NGWA 1NMCC 3GB7B 1NDMB 5BVJA 1CGSL 2I60H 2YPLA 4OUUB 4B9FA 3CC5B 5I0ZA 3HG3A 5I6PA 5DHVH 3RE0A 3W9EB 5I0YA 1AR1D 4K15A 3PF2A 4Z0BH 1M1SA 4HGWB 3NSYA 3NZUA 1ZVNA 1UWGL 4IOFD 4Z3EA 3W5NA 4LLYA 1AY1L 3LY6A 3D85A 1CF1A 4MFHA 1PD1A 2C1OA 4UM8A 4N2EA 3PNWA 4JPIA 2D9QB 2FJFB 4ZZKA 4X6CE 1M9SA 2WQAA 1BPVA 4DP8X 5F0PB 2WWOA 2CDFB 4G8FA 4KMLB 4CMHC 1HNFA 1X5ZA 2YC1A 5D70H 3VD1A 1CDBA 1NBVH 2BVEA 2F5BL 3QFDA 5G4OA 4F24A 2APSA 3IDYB 2H1LM 4P2QA 3ARVA 4KHXH 3WO4B 1FLTX 2R29A 4X9FA 5MP6H 1UEYA 1U6AL 2X53A 4XB3A 3QO1B 2IADB 3F58H 5F1KC 4NAQA 1N5YH 4R83A 3ZZQA 4MYWB 4JM0A 4AQ8C 3BFWA 5KSVB 3RZCB 2FL5B 4DFHA 1JZHA 1VF5C 2DEXX 4L3CB 4AG4L 2PO6D 3GUFA 1SLWA 3ENEA 1U8IA 2IO5A 1JIBA 2X3BA 4OLVL 4WEBH 4AQZA 4PLJD 4X4XB 1B88A 2UYLA 3W0WB 2NUPA 3ARDC 3S35X 9CGTA 5KJRL 1QSFD 1IEBA 1A21A 1WITA 1YPZF 3GHPA 4OD2A 1A3ZA 1P2CA 4P23D 3IJSB 3OAWA 1VGEH 5CEXA 2VO5A 4XWGH 1F3DJ 3EFDH 3VI3B 2KZWA 4OBSA 3IKCB 3OAUH 2DY2A 3NIFE 5FHAL 4JANA 2IDUA 4HK3J 4M4RB 5I66B 5DDHB 2NCEA 5GGSY 4QNPF 1N68A 5CSGA 4QTHB 1QACA 4NO5B 4JQIL 4AQOA 1MF2L 2XNAB 3OSKA 4BZYA 4WUUE 5CD3A 5FGBC 4RMUA 4AQ1C 4GW4A 4NKIH 3IDGA 3M7FB 4NRZB 1XD0A 1XGQB 1AGCA 2FQFA 3IMWA 3VDAA 3QULB 4GXVL 4IS6A 4TPRL 3F7YA 1KBPA 1OAXH 1G0YR 4ENED 4UNUA 2HJLA 3FT1A 2VXTL 1G5AA 1HK6A 3HW7A 5J89A 2BW4A 5E1AB 2H3XC 4F2FA 5TF1H 2OJZH 2X42A 3RBGA 2ZXQA 1R5IB 5HHNB 3IDJA 2YS4A 1Q1PA 5AZ2L 5TK4A 3PREA 1OGTA 4E41B 3IJ8A 3ZDYF 4X8JA 2OTUA 3HZMB 3SBRA 1A1NB 1DSFL 1NFIA 2HSIA 5EO1A 3NMEA 5FYJE 1MHEA 5B1KA 2FH8A 3HAEG 5AD0A 2APBA 4PJ9A 2AP2A 2IBZX 1ZANH 4YPGA 2HVBA 2YGQA 5CD5D 2QSQA 4UU9B 3V0EA 3LH8A 4YBQD 3MRLA 4JFQA 1RJLA 1U2HA 4R97C 1TQVA 3FTWA 4ZFZB 4YHNB 4NO2A 5KAQG 3MRFB 3CXHK 1DL7H 1DQKA 4POZC 2CXGA 4F37K 2F7OA 1AP2A 1URIA 4BDVA 3QUXD 2CR6A 1FL5B 2VC2H 1R3HA 4ODSL 1MUJA 2BNQD 1ZY9A 5K59E 2X6CA 2BS9A 3WYRA 2GK0B 3SJVA 2QADC 4ZNEA 2HT3C 4I18C 1EIBA 4E0RB 2E7CA 1DBMH 3SSGA 2F58H 4MDRA 3VFNB 2V9QA 4PY8J 2ERJB 1AD9B 1U8CA 1XGUB 3PL6A 3ZDZF 3BEVB 3B8YA 2AXGA 4WFEE 4PJDF 4NUGH 3L4VA 3DMMB 1MI5B 4IMLA 5EC2A 1NDGA 3K6SB 1TJHH 2FJGB 3DX7B 5FUZL 4I2XB 1CYXA 3ZTEA 5BV7L 4FQXB 1TJGH 4WHYG 5E1IA 3RIFK 3S8GB 3AQDA 4LVOC 4PJ8B 4C55A 5T3ZE 3AY4A 1JF1A 2R2HB 1Q9OA 2Y0SA 1IFHH 2G2RB 3VQ2C 3WD5H 3ILPB 2I5YH 1Z2KA 2EYSA 3UCQA 4DGUA 3I2CH 1TCMA 1HZKA 4DGVL 4G7RB 4FKKA 4PSRA 1MW3A 1JZ5A 4PJIA 4R6UA 2XTJB 3TV3H 5IVOA 3N40F 1OL0A 3DGGB 5DJXA 4PY8I 1P9MC 4NXSA 5BUGA 3HN3A 5AWNL 2Y1AA 4NQTA 4LEEA 4MAUL 3SY0B 3UP1A 1ET8A 2XN9D 5L88H 1TZGH 3PPEA 3HUJB 1MWAA 4JG0L 5IT2L 3P4LA 1P7QA 1E3FA 2GFBA 2VRAA 1PG7H 4F9PC 4NN6B 3T4AB 1A9EA 3V6OA 4EIUA 3EZJB 4DETA 2ZUQB 2A73A 1RJZA 1WSST 2RFXA 3SPIA 4HS3B 2A3TA 2OJEA 4JJ5B 4PW4A 5DRNA 1MH5A 3KD4A 4YAQB 4E9SA 3FHEA 2OYMA 4K3DL 1CYGA 6TAAA 3NCBB 2RJMA 3HC0A 3MLPA 1BX2A 4WTXA 1KLUA 4H26B 4L8DA 3CSYA 3GHBH 1RURL 2LQRA 4WU7A 5MEOA 4IGBB 2FWUA 5CJOH 2GT9B 2YD4A 4CGTA 5HXMA 2XWEA 4XZ4A 5MI0B 3WCYA 1C08A 3UGUA 5E8DL 4GRLD 4FYQA 3M7OA 3WHE1 4CMMA 5IEKA 4M1GL 4JFZL 4P49A 3MJ6A 1AGEA 4JRYE 4W9FC 4OJAA 1A1OA 3MJ8B 1ZTMA 3G5ZA 5KVMC 4ODUB 1TZIB 2FEEI 1HHKA 3Q1SH 5B3SB 3QUZD 1DO6A 3QYCA 4U6XA 3BYYA 5E5MB 3MRCA 4OLZL 3O8XB 4WKZB 4J3WA 3WJMA 2ZG2A 3FCUB 4OLWH 3FUMA 1AJ7H 4Y2OA 3NGBC 2ITCB 4X6CB 1Z0NA 2G5RA 1J0ZA 3TPUA 2Y2YA 4YSTA 1TVHB 5IJKA 4BK5A 3GXFA 4BQCA 3QJFB 5HDQH 3VXRD 5CCKH 1KB3A 5AQ0A 5D1XA 1MCRA 4KK8C 3EO9L 1QNIA 3BN9D 4A2GA 5KSBA 4MAYB 4OZHA 4RZKA 4U0RC 4FQPA 4DT2A 2IH9A 1A02N 5MERB 1W91A 1CZ8L 5LAXB 3N6YA 4JQVA 2X1QA 4JO4H 4LMQI 4LRIA 1RULL 2P8PA 1LO3H 1S9VB 2Y07H 3VFUB 4EQ2A 2C4XA 1HWHB 1DQJA 4Y5VB 1VKXB 1NSNL 1DUYA 4MLSA 2NY5L 1VGKA 4UT9H 1A7RH 1HH6B 4HWBH 3LIZA 4LIQL 3EOAB 3LKNA 4NQXA 3BP5A 5DK0B 4EI6B 4GKOA 3O0RL 1RUMH 1J0HA 4BUHA 3V4VH 2W07B 1G7IA 4HJ0C 1IM3D 3PHQA 4JHWH 5SV4A 4AY0A 5EZOH 3NIFB 2BSED 3ZHDA 4ZO7A 1NGQL 1TNMA 3HAEB 2C34A 3LB6C 1UWFA 5BZDB 4OCXH 1EAPA 1ZJAA 2E9JA 3ERXA 3LEVL 4WUUB 2E3VA 3VWJD 3S3SA 5DHDA 1E9OB 1I1FB 3FQRB 1K5NB 3VWKC 3MODL 3N0PB 3ULVL 2AANA 1FG2B 2LLLA 4PRBA 5CZKA 2FT8A 1DTUA 5ALCL 4MKTA 4WFHD 1MCWM 2Y06L 3WS6C 3SOBH 2OI9C 1HYSC 2X09A 2CRMA 3VB8A 1EPFA 2G3NA 4UNTA 3LNFA 4PN6A 2IALB 1UT1A 1INEL 2VTFA 2EXSA 5I1CH 5DMJB 1IBZA 2MPAL 3WELA 5IWLC 3LSOB 4ZMTA 3V0VA 5I1IL 3TO4B 2CUMA 3IS1X 5D7JB 1JFQL 4NBZB 4PG9B 1AGDB 3UH8A 4R84A 1H3PH 3MLVL 4GUCA 4QUOA 2I32A 3JTTA 4WJKB 2Z0BA 1G9MH 3FMGH 4FL4C 1FDLL 2AHIA 1J87A 4YHKL 2HRLA 2BXZA 3RDTC 3UAAA 1ZVSB 1IARB 4EBQH 2CGRH 3T0ED 3LH2L 3BPLC 4KROD 1F58H 5AVUB 4GMTH 3B37A 2L7EA 1KC5H 2A0LD 2J1YA 2ZWZA 3SDCD 3MFGB 3EFFB 3OQ3B 4PV9B 4LXFA 3GMNA 1DBAL 1KENH 2XQYG 3RLSA 1LLAA 3L7EB 1WFIA 3L7FA 1XR8A 1HZHH 1G6RH 5JOFA 1VFAA 1JN6B 2WLYA 4KNSA 5IW1B 4JFED 4KDTC 5DLMH 1J1PH 4QHNA 4UUJA 2VCOA 4JFOB 4JHBA 4TSAH 1JXDA 4KWUA 4FFYA 2HUHA 4UM9A 1B0GB 3SZ6A 3NP4A 1A4CA 1TU2A 5DUJA 4IHOB 2E0PA 1CDJA 1BF8A 1JL8A 4HHGA 4I9WD 1AIFA 3IJYB 4I85A 3HMXA 1BA9A 4NPJA 4YDZA 2DI8A 4ONHA 5PAZA 1E40A 1ZA3A 4OIBA 2KLSA 5F7FA 2XG5A 4PJXA 3M88A 1PKOA 5HHOD 2GIYA 4TSCH 5J1AB 3AB0B 3VJ6A 3HNVH 3VFGL 5G4NA 4WO4A 2OX5A 1FVDA 2EKJA 2CR3A 4GKSA 1HKLH 1DUZB 5F3HB 2UV3A 5JYMA 1BQKA 4QXUH 4F7TA 3SKOA 2E9GA 3MNZB 4MNQD 4PAZA 1K4CB 3MLTA 1YN6B 2NNCA 2ZPKL 3L5XL 3ULVE 4PJGE 5HHPB 1QEXA 4FLOA 3W11C 1JK8A 1S7WB 1MVUB 2FJUB 3QUMH 1ZS8B 1BFSA 2ATKA 2OFQA 4XOCA 3VGHA 4DUWA 3DROB 3CX2A 1U92B 3KPOB 2DQTH 4QRSA 1ZEAL 3RTLA 5T1LD 1PU0A 4KFZC 3G08B 2GBAA 1AR1C 1SFDA 3KPRA 4TSBL 3I3EA 5FDWA 1PDKA 3KPSD 2IWKA 1XF3B 4G6JH 4KO7A 1KF9B 1HE7A 1IV8A 2V7HA 3AC0A 3AS0A 5LBVA 4NT6B 2DYRB 2VN3A 1N70A 3C5ZB 2FZ3A 1E4XH 3DTXA 2JKNA 4XN5A 3RVXC 5BO1H 2DKMA 2WINA 4JRYB 1ZV5A 4QY8A 3ZO9A 3AM8C 1T7XA 4K7FA 4WHTA 1PZDA 3I50H 5I8EB 3K2IA 5AZEL 1T0NA 2EUZA 4ZPVB 2OSWA 3K80A 4J8RB 4AL8C 3MA9H 3TA3B 4HU2A 3JXAA 4RLDA 3O2DA 1MNUH 1NCDL 4E9WA 3KBHE 4BSJA 3K6DA 3QJZA 4YSPA 4FCHA 3B9KD 3FONA 4KQ0A 5SX4I 2EDXA 2J3SA 3OJMB 2PO6C 4P57A 5I6KA 3PHAA 2WXKA 5EIIG 1WZ1H 2R4RL 2BOBB 3S96A 2HRPH 2ZXBA 5DVMA 4HGKC 4MWFA 2A6IB 4FDWA 4W68A 4IJ3C 4RA0C 3ARGA 4F27A 4D0DB 5HGHB 4EQ3A 2JKTM 1KYOJ 3ARYA 1OZUA 4NRXA 3ZDZE 1DR9A 3EYOA 1HHGB 3Q01A 1JGLH 4O02L 4ZAKA 3TTSA 1D5BB 4M9OA 5CEZH 3WAKA 2BHUA 3DUSA 4ZD3H 2JTDA 1G1CA 1LWRA 4K8RL 3GS7A 1GZHC 3TCLB 5AZUA 2Z93A 4U6HA 4EZMA 4X0KA 3MGAA 2WNGA 4JREB 2QJDA 4PCKA 1CT8A 4TQPA 1NKGA 3GIVA 2J8UE 3PQYA 4BE6A 1MIEL 5D1QE 1U8JA 5IMOB 1KPVB 4Y9BA 3QORD 1FSKB 4DK3A 4OF7A 4ADJA 1N6QL 1ADQL 4UYQA 1A4KA 2OCCB 1ZA6A 1IQWH 4L3FA 3QCUH 5D5MA 2ZIDA 3CXDH 4XNZC 4E42A 3V5KB 1AQKL 1M2VA 3CE1A 3QPXL 1CBVL 3QPKA 4X7EC 1JGUL 5I1JL 4LSSL 4BXVA 5B39G 1I9EA 1INQB 1V05A 4NZUH 5D72H 1UQSB 4U2ZA 2FO4B 2CKBB 2W38A 3QFJA 4ZO9A 1E9QB 2HH0H 5IHUH 3WFEL 2V8MA 1GR7A 5JHBA 3P1VA 1XGZA 4BKLA 2CA4A 1GVIA 3THMH 2CDGA 4M93C 4APQD 5CD5C 1ICTA 3CK0L 4ZRGA 4YBQC 4L4TE 3CZFA 5T5FH 2CO2A 2TRHA 1BQHG 1N64L 2P28B 1E8WA 5E00A 3UPRB 5F9JA 5HVWA 1JWSA 2X0UA 2EDFA 2DJMA 3QUXC 4LT7A 2CQVA 1JMXA 1VJSA 3GMQB 3MRHB 2HVJA 2KQNA 4G70B 4LGPB 3B2UD 1K8DA 4MDJA 4UIKH 4F7EB 4NRYA 5JDJA 1KEGL 3LKSB 5T1DL 3ZL4H 1D6EB 1CF8L 1KJMB 1F56A 3AG3B 3DRQB 1QHQA 3RWGB 5E94B 3CDZB 4PGZA 2RHEA 1X5KA 1MXGA 4XPTL 3ZDXE 3ECQA 1A5FH 1D5XB 2D0HA 3C2SA 1K6QH 3T6VA 4G42A 5JOPE 5DQJA 5BQ7B 2RBLA 3LZQA 3ZKMD 1VADB 3T8MA 2RACA 4QYOB 4OKVB 2AZAA 2VDOL 5AW9B 1UWEL 2XWTA 2VLKA 3U9WA 3FN3A 4NQSA 3IRCA 5EF3A 2O5ZL 4MJIE 3BCDA 4JCWA 1FH2A 2FX8L 3EJZC 2KPNA 3BGMA 1P6AB 4K9JA 5IW6A 2Z65C 1ZDQA 2F8OA 2IF7A 3ZPDA 2DWYA 4Y2DB 4FQXD 1JK9B 4PJ8D 2NCMA 3ARWA 4W9HC 3QDJD 2GYSA 4GUPB 2DLIA 1KNOA 4L8SA 2VMDA 4JZJA 2YOCA 4WI0A 4CN6A 4LEXH 5IQNA 4K5PA 3HBQA 1J5DA 4J3OD 1MQKH 1AD0A 3GLZA 4OM1H 2BIIA 3KGSA 3QC5X 2JIXB 2ICWA 5IGXH 1DVFA 2AQSA 1T03L 4OGYL 1KELL 4I0PD 3EYFA 4NNYB 3TP4A 4FABH 3WTSA 3W2DH 2CK0L 4PJIF 4DGYL 2BLFA 1S5IH 4M1DL 1I82A 4FGMA 5DRXB 2WLIB 1DE4A 4PJGB 1SDYA 5IMKA 3OWRA 4W9IC 4XBMA 1Q9KA 4XPFH 2WSDA 1VSCA 1UOVA 4HOMA 3TIEB 1C12B 4RFNC 4O51B 1ZLWH 4HVBA 2Q10A 2AKRB 4AEEA 3QIWA 2R15A 4LCUA 5DWPA 5T1KB 4JO2H 1WHPA 2I25N 3LX9A 3RFZA 4DKEH 1ZS2A 5CWSB 3LHPL 5LVEA 1L9OA 2ADGA 2GITB 2IPTH 2MHAA 3QZPA 4PJFE 5F7MC 1VENA 1T21A 5FYKE 3OLEA 1MAMH 1YC8A 4H0HB 4U3SA 5EIIB 1S7XA 3DVGA 3QUZC 2VITB 1WUNT 2W9LA 2Y25A 4R7NA 1Q0YH 3QHFL 1M6UA 1YMMD 4FFWD 4ZI8A 5IM7B 1P84J 4F2MA 2OMZA 4L5FH 4PRID 3F7VA 4A7SA 4DPRA 4K23H 1D6VL 3IEAA 3PG2A 3U7YH 1JMZA 1U8OB 4NQDE 5I6LA 1ETZA 3ULUE 1XCTB 1SFHA 1X7TA 2OZ4L 4NHCH 3IMVA 3TWCL 4PBVC 1YYLH 1J86A 5C97A 1LNUB 4LVHC 2BVYA 5DJ6B 1FFNA 5C0IB 3V52H 2B59A 3O4OC 1I7UA 1IBDA 1NOFA 3VO0A 4JRLA 4RGMC 3KZ8A 2O93L 3C8KA 5KVEH 3ARFC 2KH2B 2Z8SA 5K5YA 5BMFH 1UUNA 2F54A 3ECUA 5I16A 3LAFA 4YPJA 3QS2A 3X14A 3A5VA 3VFPA 3FB5A 5E6ID 2MH4A 3FUHA 3RIKA 1CLCA 1JXGA 2EYTB 2DQHH 5DUPL 1FJ1A 5E8OA 2F19L 3FU7B 3GBMH 5B39B 2FO8A 3F7PC 3PP4H 4X9IA 5C0GA 3ZMRA 1AC0A 1MHPH 4O2CA 2ENSA 1TO4A 3GLAA 3C87A 1CGVA 4XMWA 3BUBA 5KSBF 2YZ8A 2FHFA 2QT6A 2X4QA 5KOMC 4RMQA 5G2NA 4Q9BA 5F1OB 5AVZB 2CPUA 1N67A 2FWLB 4M62L 1DANT 5IB3A 1GOGA 3LRSA 4L4VA 2VZUA 3IRPX 4GO6B 2EABA 2J8UB 3KPQA 3VWJC 4F7KA 2FGWH 5H4YA 5D1QB 1BQHB 1NGYB 3WAJA 1L0QA 1A6ZA 2XZQH 3T2NH 1FVCB 3T8XB 3Q8AA 3MRKA 5DEFA 4KVPA 4LDLB 2VLJD 4RMWA 2MQGA 3DXAB 4XTRD 2L04A 4AMKH 3GZOA 5C0AE 3GWJA 5FYLE 2V2XB 4JLRB 1NBVL 2NQDA 5HYSG 2WD0A 4OCRH 2A2QT 2WXPA 3U6XA 3O3EA 1J9RA 3UTQA 4JFHE 4HGMA 3C5XA 3WIIL 2BHZA 1CGTA 1JPSH 1JNHB 2NY6B 1CE1H 1TG8A 5EO0B 5EU5B 4A7GA 3EJRA 1LP9E 4MDIB 4P4KB 3RFRA 3WKNA 4HKJB 5AL8A 3U46A 5I6XB 1JZ2A 1ZT7A 5AKTA 1A7OH 2AC0A 1WZLA 3VFSA 4L4TB 3GMMA 3N44B 3F04A 4O2FA 3BAXA 4HCFA 3CDYA 3LNEA 3T0EC 1B9KA 3VXSD 4YXLH 4KROC 2C3VB 1FORH 1KIPB 3FQUA 4KX8A 4WEBL 3HIZA 1OM3H 3GXPA 3SZKC 5E6SB 1U8LB 1WICA 3FFCA 5I1GH 3O11B 1ZLSH 3VM5A 1S2EA 5I71C 4JFXB 4BGDA 4CW1B 1Z9OA 2PPCA 4YC2C 5AW8B 3EKCA 2J57A 1HXMB 3HG1D 4V1DE 4XWGL 3EFDL 2DWDB 3KWWB 3OAUL 1BZ9A 3QIUB 2MCMA 2WZPD 3ZDXB 2Z92A 4NM8H 32C2A 3QZNA 4N2GA 1BD2D 4EI5B 3ULUL 2WLHA 2Y5TA 4HUUA 1FVEA 2GI7A 4MHHI 1VFBB 2NX5B 4NKIL 1T7YA 4G11A 3PDOA 5C07D 1JZ3A 4MJIB 4UI2A 1I7TB 1PYWA 3DA0A 4ZOCA 5EIQA 1RERA 4Z7OF 1R9FA 3CZLA 4N3UA 4WFED 2G3MA 1OAXL 4XVJL 1KIUB 4PSPA 1TYRA 3T0BA 3U0WH 5LNDA 4IU3A 1BVNP 3V5HB 3TBWB 3DBXB 4DEWA 1EDHA 1MLCB 3KJ4C 1NGXB 5HTSA 1G7MA 3ZE0E 2OJZL 2X4NA 3P69A 2WLLB 5I0XA 5MEPA 1R46A 3AGVA 4EOWH 1FO0H 1S9WA 2WYIA 3UTZB 5HHVL 2A4CA 4N85A 4QTIH 4LSQH 4OAWB 4CDGC 3A21A 1ZANL 3P4OB 4BINA 3MBXH 3PGDB 4J7RA 4K71C 3DX6A 4MX7B 4Y4KD 4Z1PA 1X5MA 4H88H 4YVUA 5FV1L 5I26A 2FWOB 1THAA 3CCHA 4IBZA 2FBOJ 1DL7L 4PJXF 3UJIL 1CD1A 1WFMA 1DLHA 4LEOA 2VC2L 2AEIT 3WEXA 4KVCH 3SD2A 2XQ0A 5KZCB 1IM9B 3U25A 2VLLA 3BQUD 5KVGE 3VRIB 3TIDA 4ODTL 2Q8AL 1DBML 4KQ3H 3H4HA 2Q86B 1OW0A 3RL1B 3HNSH 4PRAB 3B5TA 4PV8B 2R1WA 5GS3A 1T83A 2P1YA 3TBSB 5L2KD 3LRMA 3D52A 1HCFX 2FIKA 1JPGA 4NUGL 2WP3T 1L6PA 5MENA 1JERA 4JM2A 3LNHA 1M7DB 4PJFB 5EULV 1TJHL 3EH2A 4YHPA 4ORGA 4Z3HA 1YEDA 4NSKB 1TJGL 4IU2B 5C86A 4MD0A 2A6DB 5M95B 4JDZA 2YUXA 5HI4D 2PMZA 2DLEA 1N26A 2CM5A 2I5YL 3K71B 3I2CL 1G9HA 1UVQB 4JRYD 2VDPH 1KY7A 5L9DH 1UUSA 3ZT5A 3GEFA 5FO9B 1DJZA 2EDOA 4FMFA 5CCJA 3TV3L 4NQDB 4PLOB 2AXWA 4YO0A 1BAFL 4K55A 2FBRA 4ELMA 2YGVA 3M17A 4ZW8A 3PAUA 1H15A 3WO4C 5AEAA 2EEAA 3SE8L 1P5UA 5L88L 2V7NB 1TZGL 2ROXA 2VDOB 2AF2A 2VRQA 3O45B 3AWGA 3J27A 3NG5A 1H9VA 4QRFA 5A2CA 1PG7L 2KUTA 1E2VA 1W80A 2EP6A 3NK4A 3TX4A 2HG5A 3RZCC 2I9LA 4UQ3B 1NKRA 3D06A 2KZ1B 4NYLB 7TAAA 3CBRA 1ECZA 5GRZA 5JA9A 2DD8H 3GSNL 1A4BA 5ITFA 3BVTA 1URZA 3BESR 5FW7A 1DJGA 3RA7H 4JKPL 1HCVA 5ANME 3D69B 5E2TH 3VFTA 5KYXB 1XB3A 1I8IB 3GHBL 4IRJB 1NBYA 4OD1H 4PR5A 5IB5B 5CJOL 5GGSA 3TYFB 2R7EB 5H4ZA 2LU5A 4JFYB 4HMCA 2VDMB 3AU1A 4K7PY 3PHSA 3QORC 2VZVA 2ARJA 4HH9A 5FA3B 1HEHC 1G9NC 3MV8A 3S3PA 1ZGLM 4U1JB 5KANG 5C09A 4H8WC 4LLUA 4UYPA 1BQSA 1T5KA 3MLRH 3JTSB 4PP2B 4FNPA 1Q94B 1YN7B 1DSYA 3MRRB 3Q1SL 3AT9A 4LDCA 3ZYZA 3AG4B 2ZUWA 5IVZB 4YZFE 4AMXA 4OLWL 1AJ7L 3LPFA 5CZXC 4BFBD 5GIRB 1A6TA 3ASNB 1B4JH 2IWGA 3AS2A 3RYMA 4Y1AA 5C0AB 4JK0D 5EZIH 3MUJA 4MRBA 5DEGA 5DF0A 5EEXA 3D6GA 1GZQA 2A9MH 4AYSA 5HDQL 1SMDA 3QQDA 5CCKL 3GI9L 4PGBB 3KDMB 4YZWA 3WFDH 3VW3H 4G5ZH 4J4PD 5CIPB 3V79C 4M03A 4I3RL 1S8DB 5D5MF 5ABDE 5I19H 1LP9B 1CIDA 2AV1B 2WXIA 3MYJA 5C0FB 4LCIL 4BFEA 2V2TA 2WWMD 2GSIB 1PKQA 3CVHB 4Y5YC 1UA7A 4AC2A 2COVD 1QI3A 4JO4L 3DHMA 3V6OE 1ADQA 3BZDA 3QG6A 1E67A 2Q5BA 4D3CH 3GRWA 3I02A 4LB8A 1LO3L 2IXQB 4A7TA 1CFSA 5EN2B 1C8PA 1NZRA 5CGTA 3ZKMC 4OZIA 3H8NA 5F7LB 2GCYB 1A7RL 1UJ3A 4HUWA 4LPTA 1RUML 4QRQB 2FQGA 2FT7A 4ZOBA 3V4VL 4V1DB 1S7SA 3ZHKA 1ID2A 2XDHA 5T33L 3FC8A 2XKSA 2ERJC 4DP9X 5BVJB 2IDFA 4WW1B 5H37H 3K8MA 3KL5A 1R0AH 4NGHH 2VR9A 3ARUA 3QQ4A 3F64A 3DMMC 3BD5A 3L3GA 5D4HA 2DWTA 3MUHL 1O9WA 2DI7A 4J3SA 3QDGA 4FQXC 3GI8L 1QUNB 2NSMA 2NZ1A 1SHXA 4PJ8C 4WWPA 3MROB 3AXHA 1GGIH 3D18A 4ZMWA 2IAMD 1VEMA 5CR8A 3ZTNL 5TK2A 5J0BA 4MTMA 2G3XA 1XXDC 4JQXC 5AUMB 2XTJC 3ZYJA 3KXFA 2O26U 2WQVA 3ZE0B 2YC1B 5I1CL 3EYVB 3QFDB 5D1XE 2NQ3A 3N0AA 4Y1SA 3HPLA 1KJ3H 4YL9A 4AT6B 4PW3A 1P6FA 2XYCA 3DECA 5JQ6H 1H3PL 5I1EH 5DS8B 1YLBB 4LDOB 4Y5XA 4OZHE 3IWUA 4YLCA 4M7LT 3IGAA 5ECGA 1JHKH 2AJUL 1G9ML 3FMGL 4GAGL 5GGVY 3UTTB 5JQHC 5JXEA 2HAZA 1JHLL 2DLFL 2G9KA 4LASH 1X9UA 3NFSH 4Z7IA 2CGRL 2DDQL 5GRWA 2X05A 2P80A 2ZP9A 3FO0H 1U8IB 1F58L 2EILB 5IEHA 3HLAB 2Z91A 1KC5L 2KLTA 3LZNA 1J11A 1XFPA 2ARJQ 2DM3A 2ZXDA 3I6GB 5GXBB 1QABA 1VPOH 3VD0A 1IEBB 1IQDB 5AVWB 1KENL 3V4PH 2HX9A 4IGBC 3TL5A 2GI0A 3O6KH 4F7CB 1HZHL 4D0CB 4OV5B 1G6RL 4FXGA 3WN5A 5CEXB 3PFQA 4G8GA 5DLML 1J1PL 2OYLA 4B7LA 1ZHKA 2DJ4A 5JIHA 3D2UA 5T1KD 1ID5I 4FFWC 2VE6A 1CDIA 5J56B 1XD1A 3BWZA 3LPOA 4JZNB 1IAOA 5IJVB 5CD3B 2Z31A 3RWCA 1FH5H 4HD9A 1SEQH 4B95C 4YHZH 1XH3A 4V2CB 3QYNA 3O8XC 1AQDB 5AOKA 4IIQB 3S5LA 3VMNA 2UZXA 3DX8B 4GEJA 3FHQA 3QUYB 5D7LD 2AJZA 4WNQA 3CVBA 4TSCL 1LK3L 2BVOB 4G6KH 4DKDC 4HLZH 3RPIB 3IDJB 1ZT1A 2WXRA 4QRPA 4XZUB 3II3A 1AACA 4CVZA 1HKLL 3SE6A 5IHZA 4X8JB 4QXUL 1LGVA 4MAYC 1S9YA 4BE5A 4D2NA 3NOIA 1HNYA 5EO1B 1XSJA 1MHEB 4YDIH 2AXFB 5D96B 4KNUA 5GRYA 3MQIA 4F92B 1MOEA 5CM1A 3MRLB 4JFQB 1RJLB 2IDSA 3QUML 4Z3JA 4YIQB 1DCLA 3AROA 5TDNB 3BW9A 4KY1H 3NFPA 1QPXA 2FGZA 3MOAL 4Y5VC 2DQTL 2WLJA 1JPFA 1WGOA 3MMEA 5ANMB 4M43H 4BDVB 3DETC 4UCFA 2OZ4A 5IG7B 2ZJSH 3MPCA 2F0CA 3L8QA 4EUPH 1TJIL 4RX4A 2VUOA 3GXUB 2PXYD 2DYPB 2L7UA 3AQZA 4N2BA 4G6JL 2WZ6A 2APTA 3SCMD 1A0QH 5IVXA 3AW5A 5TDPA 1ZGLB 2QR0A 3OTTA 1RVFL 4R7XA 2R1XA 1U8CB 3PL6B 4ANKA 2NY0B 3OQRA 3Q5OA 5BO1L 5D1ZD 5C0JA 4EZKA 4EN3A 1BFVH 4ONGH 2YQBA 5D1QD 3STBA 3I50L 1NCWL 1D2PA 5GISH 3OB8A 4NHUA 3S2CA 4C47A 4HMEA 2ITDB 1FGNL 4ZUSB 1JF1B 3FT3B 3LD8B 5KSUA 2DLTA 2WQRA 3PJSB 1AVAA 4RDQG 2OYKA 5JIQA 2J5WA 1PQZA 5GZNA 4APXB 1MNUL 2MRYA 4AW7A 2WBJA 5F9OH 2DM7A 3RU8H 3E8VA 2KL6A 5DJXB 3JVGC 4YE0A 3L3IB 1RLWA 5DHVA 2NY6D 1NM9A 1WZ1L 5D7JC 3M07A 5DUBB 4LCCA 1N59A 4QHUB 4P4KD 3IXAA 2E6JA 1OANA 3V8CA 3QEQA 1ZXQA 4MD4B 3LVEA 1WS7A 3X3FH 4XX5A 2H2SD 3ZMEA 2GFBB 4L4TD 3NSCA 1A9EB 2FRGP 3DJTA 4AVJA 1CFTA 4HSQA 1JGLL 4A7GF 1RJZB 3FFDA 3O4LA 2X4RA 3SYCA 5DK2A 2X88A 2FT6A 2OJEB 5DRNB 3OKDA 3MRPB 4ZD3L 3TN0A 3D4CA 3TURA 1TOXA 2V3EA 2H3NB 4QGYA 2ALWA 4X2UA 3WFCH 4IKLA 4F7PB 4OJCA 1IB5A 2DIBA 4N0FA 2XV2A 5DRWA 3UBFA 3CSYB 5K9OA 3KPRE 2DRUA 3EYUH 4X4YA 1QUPA 2ARWA 1JV2A 5CHNB 1QFOA 1SJMA 2OR8A 3MYZA 2JI1A 1NH6A 4UBDD 5JOPD 2F53D 3ARBA 3UCRA 3D87B 2XYBA 1R33A 2Q7NA 4CMMB 5IEKB 3TLRA 1W15A 2DWSA 1IQWL 4KBPA 4KKAC 3NJIA 3GINA 3QCUL 1TZOA 5I6NA 3TZVB 4UNIA 2DEWX 3CXDL 3OJ2C 5IK3A 3FZUD 1PZ2A 4KNQA 2B1AH 1A1OB 3D9AH 3KM2A 3AT8A 5EOCH 1HE8A 5KSAA 5EBLB 1Q9WB 5I74B 2FAUA 4GW1B 4M48H 3EFOA 2HH0L 5IHUL 3O6MH 2LLNA 1MAJA 4OF6A 5D1ZI 5EZJA 2EVFA 1EHKB 4PJAA 5GSVB 1JS4A 4X80H 3GSWA 5DHYB 3RJOA 1DQDL 5D6DC 2AVFA 3DVFA 5EEUA 4ICXA 5T5FL 3AB0C 4ELKA 1SJXA 4JJOA 3BISA 1U42A 5D1XB 1ASQA 1KXTB 4NOFA 3TBTA 1IC4H 4X5WB 5IOPB 3S97C 2K6ZA 2WZ5A 4OZHB 3R06A 1QFWI 2XQYK 4UOZA 5IUCA 4UIKL 4Z0XA 3ET9F 2X6AA 3BQUC 1BOGA 4BHUA 3ZL4L 3HE7D 4BCZA 3FU9A 3MDJA 2B77A 5F1IB 5CILL 2XJLA 1TZHB 3EG9A 5E4OA 1K6QL 3FTGA 4ZFQA 1DQJB 2GTZA 1A6UH 1MDTA 4PPTA 5KZCD 1D3CA 1DUYB 4L9LA 3SKMA 1AQMA 1IC0A 3MR9B 4AZ8A 1Y0LB 4GUQA 2PETA 3Q13A 4NQXB 3LKNB 2DQMA 2UXVA 5A3ID 3PQYE 3C60B 5AW3B 1H6TA 4JBSA 1G7IB 3PHQB 5HI4C 3RVWD 1ZHLA 4NUMA 2EE3A 3CSFA 4LKCA 3C5ZC 5H2BB 2WTRA 4ABVA 1JAEA 2AAAA 4YK4B 4DP7X 1BCIA 3QJSB 4H25A 1VERA 3T1WA 5FYKD 5CEZE 4M8UA 4Y4FB 2DJSA 3A4DA 4U4IA 3ZJAA 4BQ8A 4S0HA 5KVDE 1QTYT 1HH9A 4J3UA 3CZGA 5EN3A 1FYTA 4M29A 2K4WA 2C9SA 1GW6A 5I24A 3TA3C 1GMEA 2GVYA 4G7VH 1ANUA 4JM2F 4LEXL 2KT6A 1IEHA 3FN0H 2W0LA 4IK6A 3V4VB 4ZMNA 4WU5A 3Q9PA 3W3BA 4OM1L 3FOLA 3GXNA 4ZTOH 1EO5A 1XGYL 4I48A 3O9WA 1MPAL 3KWUA 3S88H 5B4MD 4PLNC 4U1NA 1ZVYA 2WJ7A 1V27A 1H8NA 3BEWB 2W80C 3V0VB 3KLAA 3LKQA 3MREA 5HHQB 4FABL 2MNJB 3FH8A 1S5IL 3MV9B 4MA8H 1REIA 2JQZA 2HFTA 1HXYA 4P2CG 4ELMF 5TH2A 1WWAX 1SJHA 1CUOA