3NRPA

Crystal structure of 'as isolated' uropathogenic e. coli strain f11 fetp recombinantly expressed in the periplasm of e. coli bl21(de3)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
152
structure length
152
Chain Sequence
b'GFKEYPAGEPVTMNEMELAAVYLQPIDMEPRGMGLPAAKADVHLEADIHAVEGNKNGFGAGEWIPYLTISYTLVNNDTGEKQEGTFMPMVASDGPHYGANIKMMGVGNYKVTYHIEPPSKAGMHRHTDSETGVGRWWKPFDVSYEFKYVGLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic protein-probably involved in high-affinity Fe2+
molecule tags Transport protein
source organism Escherichia coli
publication title Characterization of a Dipartite Iron Uptake System from Uropathogenic Escherichia coli Strain F11.
pubmed doi rcsb
total genus 24
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3nrpA00
3LZLA 3NRQA 2O6FA 3PJNA 3PJLA 5I0VA 3LZPA 3NRPA 5I0WA 2O6EA 3LZRA 3LZQA 5I0YA 3LZNA 3LZOA 5I0XA 2O6DA 2O6CA
chains in the Genus database with same CATH superfamily
1RH8A 2ADGA 1U2CA 4NAQA 1IV8A 4KJPD 5HGHA 4MXQC 4FA7B 1IVLA 3LN5B 3D3VB 1JZIA 4L3ED 1J5OH 4MD0A 1A0QL 4HCRH 4JM4L 2NTSP 4J12A 4MHHG 3WY3A 2WQXA 4NM8H 4YDJB 1NUFA 2W0LA 1L9NA 4K3JL 1JGUL 2PTUA 3HUJF 4JFEE 3ZE1F 1AO7D 2C34A 2Y7MA 1Y07A 32C2B 3JWDL 3CWGA 4HLZG 1T5KA 2F6AA 1IAOB 4N24A 4Q58C 3CMOL 2BNQD 2X1XR 5IFAL 4F1ZA 1OTTC 4F33A 1QZNA 5DQ9A 4QYAA 4PJ8C 1SOSA 3NIDF 4WY7H 1MAKA 4KJWD 1BM7A 4HKZB 3I9GH 2QVIA 3TPKA 5D1XB 5F9JB 3HIZA 5DS8B 1A4JB 1EAPB 4FQIL 3SQOL 4UM9B 1Q1JH 5ITFB 5CCGE 4UUJB 5IP4A 4U1HB 2WWMD 5D71H 1NCBH 3MRCB 4LP8A 3QZMA 2J1XA 1U8LA 5DEZA 2PETA 4GO9A 1N5YL 3OKEB 4BQ8A 5I1CL 1QLFB 3WSQH 3MBED 5TFSH 2VR3A 2D8KA 3AY2A 3DV4B 1IKFH 3PP4H 4K3GA 2VR7A 3IRZA 4NLAA 1MREH 2X0VA 3KS0H 1M42A 4LLWA 4CVZA 4ZMXA 4LKXA 4NS0A 4TYUA 2LLGA 3T0AA 4R0LC 1I3UA 1W72B 4AG4L 3SPCA 2Z93B 4Y4KB 5AZEL 3TO2A 5HHPA 3ZMNA 5K9OA 1VENA 5CWSB 3B1UA 2EO7A 1WFOA 4HBQA 2R2EB 1OSEA 1F3DH 1PYWB 4H0GA 2K9FB 4JFVA 2ICWI 3FRPB 1DANT 1P84J 5E8NB 2EUXA 2WXOA 4X7FC 1LILA 4ELMA 1RUKH 3ARPA 4K3EL 3AG1B 5ECJE 1R5WB 1FGVL 3AREC 3HBZA 2V6HA 5EZOL 5IROA 4L8CA 4XX5A 4W9ZA 2JMRA 5IFJA 3G5YA 3I6KB 4R7VA 3NIGE 3PLYA 4PWHA 4ISVA 3REVA 1RSYA 4EVNA 1U0QA 4XBEH 2OMYB 4RDQF 1CTOA 5I6OA 5C8JA 3VXUD 3CZFA 4PY8J 3HMWL 5TQ2H 1H3WM 4WGKA 5EA0H 4Z7QE 1BFTA 1VA9A 4PVBA 3MV9A 1WWWX 2VT0A 4N68A 4CSPA 1A6AB 2AABH 4IMLB 5HVFB 4IRZL 1KYOK 1PDKA 1EXUB 4KKAC 1FL3A 3EJTA 3X11A 3BE1H 4AT6A 3QJUB 1YLBB 1M7UA 4PLKC 2OSLB 1RUAH 4XP1H 3MLPA 3AY4C 1YQ2A 3KDPB 3OHXC 1LHZA 4BFIB 5IB3B 4PY7A 2OMNA 4EI6B 3UACA 4KPHL 3RGVD 1Z9MA 3QS3A 1OGAA 3FQWB 4AL8H 2FO4A 4NQEB 3L54A 1BV8A 1A7QL 1BLNA 1G7LA 2ADJA 4LSUH 3ZZLA 5EFIA 4G7SB 3RA7L 4MSWA 5AD0B 2EVJA 2J1WA 1TNNA 3LQAL 2N1TE 3FU8A 4HZ1A 4OCMC 5E1AB 4JK0D 4X83A 5LO7A 3CLEL 2GUOA 3KLQA 3CSBA 3EOBB 2VQTA 3FYEB 3FTSA 2OZNA 4F58H 2QPUA 4S1DD 5JUEL 3QEQA 3SGEI 3B9VA 1XGYH 4TXVB 1X6NA 3BWZA 1IMHC 4WU7B 3P2BA 5C71A 1FWXA 2OMZB 4HSCX 2QADB 5IM7B 3U2SA 1EERB 1I4FB 3GM8A 1J8HD 3OZLA 2BSBA 2XKSA 3ZE2F 3EDJA 1P4LB 2WZPD 3ML8A 3TL5A 2YMTA 2ZG3A 1XGPB 4R7NA 3TA3D 1MQKL 2EZ0C 5HHOD 5JQ6L 4P5KA 4RAVB 5H4ZA 2ZYSA 1JWSB 3S35X 3P3RA 4Y4HD 2ZT9C 2DTML 4S10A 4YN3A 4APQD 3LSOB 3ASNB 3CSTA 3S5ZA 4TLUA 5A6MA 4U2ZA 4JPVH 1O7VA 1GKEA 3ARSA 1MW3A 2ITCB 2LW3A 4R8WL 3VFOB 4A39A 1DZBA 5IBTH 4CADB 2TSBA 1YEGL 1U8JB 4N5ED 4XMPH 5B3JF 5K9JL 1XZ0B 2AV1B 4YPJA 1YYMH 5I82A 3BUIA 4CN6A 3KGTA 5JIHA 5CD5D 3WFHA 1BQ5A 3VSUA 5CLZA 4ZO7A 2F5BH 2GJZB 1JGLL 3SN6N 4ONGH 5FIEA 4XCEA 3M46A 2G4GA 2XRAL 2JIXA 2BOCB 3FBKA 3HEIB 5ECGA 3NG5A 3ABLB 3PY9A 1T1ZA 4ORZC 2DQDL 4MDIB 4TNGA 4W70A 1THAA 3RL1B 3KYNA 3LCYA 3VXRA 4LEXH 2NUTB 5F1IB 1AHWA 2WOBA 2OMVB 1WT5C 2XSKA 1JK8B 3GMOB 4JDTH 1KB9K 1V5JA 1MRDH 3H2PA 4DP9X 2YD0A 1MVUA 3U36B 2H2PD 3HC4H 2VQ1B 3GGWA 4FC3E 5IR1B 1Q94A 1PNCA 3G08A 1CYWA 2WMPA 4F2EA 3CFMA 1J9TA 3L4CA 1ZHLA 4Z7OB 2OW6A 3RZCD 3EGXB 4UM9D 5JZ7C 3KHQA 3MNVA 1ZPLA 3IMTA 3NJIA 2AXGB 2BLFA 1OGAD 2C1OA 2HJKA 3ZSTA 4XZUB 2WBKA 5BCAA 4LKCA 1AJ7H 1KBVA 1XCQB 2HMIC 2BX5A 3Q01A 4BKLA 1DQVA 1NBCA 3QNFA 3IFPA 4HLJA 1AZNA 4PR5B 1A7BA 1F4AA 2LVCA 3B3BA 4OIIL 2XN9B 3U7WH 2VXQH 3QJZA 5DVKA 4PRIA 4JFXB 5FYKE 4KROB 4YHKL 4D0BA 5J6GB 1OB1A 1FE8H 2FQEA 4Y9EA 1MI5A 1U3JA 3ETTA 1B2YA 4HYTB 4GJTB 4F7TB 1MHEA 1BF8A 4TVPH 3OTTA 4A7VA 1QKZL 3NZ8B 3OJMB 3F7YA 1F1AA 2E74C 4K23L 4ODBD 4NFCA 4PRHB 4UQBA 3T09A 3LAFA 3HVDA 3O81A 1KEMH 4JM2B 3BEVB 3CFEB 1JXGA 1IFRA 1MFAL 3OLGA 1YEKH 3O8XB 5AZUA 3HBQA 5AVWB 1SEBB 5KOMC 4AQ1A 1XF1A 1YO4A 4GFXA 5DJXA 3US0A 1KXVA 1AKJA 3QAQA 2M8XA 4P4RA 5KSVA 3UTSB 1D6VH 3WKNA 1S9YB 4YSUA 2AXFA 1HL9A 1QW9A 4M02A 3EGSB 4Q2ZA 1JYWA 1BAWA 5D2LE 1B2WH 4J6RH 2DQCH 3MRGA 3BP5A 5FYJH 3HB3D 1DQIA 3B6SA 4B53A 2WVUA 1ZY9A 3P3TA 3KLAA 4WU5B 4GUQA 3P4MB 1E4WH 4DUVA 1E2WA 1R1CA 2NX5D 3ZU8A 1ZVHA 4GRLB 2JH2A 2XTJE 3M88A 1BXXA 5E5UB 5TQ0L 3OZ9H 2JJVA 2IPUK 4HMEA 3H4FA 1WZ1L 2EIZA 2J44A 3LB6D 4EIZC 4U31A 3ESNA 4UZUA 5JMOC 4HPOL 3SSGA 1ORQB 4XNQA 2PCYA 35C8H 1NOAA 4POYA 4MKMA 2ADGB 4UI2A 4P3CL 2BIQA 1RZJC 3FQXA 1KPVB 2WLLB 5DXWA 2W91A 4Y0GA 5DMGC 3FW6A 5HI5C 1SDDB 3QHZH 2CKNA 2CR0A 2QKIC 3VTMA 3DO7A 2PWHA 2DLIA 2YKKA 4OCYH 1RZIA 5MHSD 3HRZC 4HC1L 3K2UL 3D0AA 3BP6A 1ZGLA 43C9B 2OJZL 4UANA 1QBML 5FV1L 3OKOB 4XE5B 3RL2B 5DDHA 3QXVA 5EZPA 3WEXB 1EUUA 2GK0A 2NXYC 4I48A 4JJOA 1I1FA 4L3CB 3DUSA 1P4BH 1N6QL 3G5XA 1BJ1H 3D2UA 2AQQA 3GI8H 3K74B 4NXSA 4Y16B 4CVXB 4GT7A 3SE6A 4FAAB 3T0EC 2EILB 3OD3A 3EJCA 1E9PA 3JV6A 3QCUH 2OQJA 5SX5H 3DSNB 3WENA 1EZVX 1CFBA 1FG2B 3U7YH 2FJFA 5IMLA 4AEHL 4YHYC 4FNPA 3QQXA 3IGFA 4EF3A 4I1NB 3MLYL 2Y36H 1KYUA 3DJTA 4EUPH 3Q2VA 1IGIL 2JKWA 3DHJA 4K3JH 1MLCB 3TH2T 3PIQA 1J0HA 5E2TH 2AXWA 3RWFB 3QUMH 4OGXH 4JHAL 2XFGB 1AQMA 5JIMA 2V5TA 3JWDH 3U4EA 5J7CC 2K3HA 1UA3A 1THCA 3HS9A 1QSFA 4YC2C 4MAUL 4AMXA 3K5RA 3ZPDA 4G1EA 4F5CE 1FNHA 1AGCB 2IAMB 3V4VH 5SWSB 3LQMA 3MOAL 3TWCL 3FUJA 5GS0C 1O7DC 4G7YH 1OD9A 4JG1L 5INDB 3KZ8A 3MR9A 1W0WB 3VMPA 5IJKA 5DURB 4GMTL 1ZSDB 3I84A 1UWXH 4LASH 4X98B 3BAWA 3BZDA 3F7QA 1EZLA 4B60A 2F5AL 4HG4K 5AQ0A 1B3IA 1G7HA 1SFDA 4LRNL 3OXSB 1F41A 3AB0B 2E8YA 5J13C 1I31A 5DJYA 2ARJQ 4WO0A 3ROLB 1DO6A 3FZUD 5KAQG 4KVNH 5KSBA 3IDJB 1T0NA 1X9UA 3OJDB 5FK9B 5GS0L 1QUNA 1JS4A 1TTAA 4UU9A 3W81A 2FJHB 5DWPA 1GOFA 5C70A 4BKSC 1J12A 1DSFL 4X4KA 1HSAA 4N2GA 3NJKA 3RDTA 1KPUA 1R3JA 2YAEA 5DZPA 4FFWC 1N68A 3GQFA 1X4YA 1D9KA 2Z9TA 2X3CA 4JLRA 1IGYA 2XU9A 3VNYA 5C0NC 2NXYD 4RMQA 5BZDB 3VD2A 4JHBA 1JI1A 4S2SA 5ENWA 2PXYB 2CO2A 4HG4J 3DUHA 1T03L 2VIRA 4ZMWA 4G9DA 2DJUA 2BC4B 5BZZA 1IAIL 2FATL 2DH2A 3E1ZA 2Q8AL 1HHJB 1NIAA 4PBDA 2FEEI 1ZDSA 4GXFA 5FYJE 2MWCA 2VLKD 3JTTA 1U6AL 4OJFH 4N25A 4OM0L 3U2JA 3VYPA 1FLTX 2W07A 3HZVA 4FX5A 3QWOA 3SD5A 3Q9QA 1HWWA 2OV0A 1A2YA 1JDDA 4FL4B 2NSQA 1QPKA 3ILEA 4KK8C 2A83B 4QGTA 3SDXF 4J3TA 1RK0B 2X1OA 4NBXB 1G84A 3S0PA 4PGBB 1VGEL 2ZPKH 3CX2A 4MQXD 1N8OE 4Y8DC 1GZQB 3BH4A 3G6DL 5EPMB 5ESAB 2P44B 2B1AH 2W95A 5JHDA 4KKQA 2IQAA 4HJ0D 2FEDC 4BCXA 1JZ8A 3LN9A 5IB5A 3PE9A 4QWWC 3W57A 3OPZH 2EE2A 1TR7A 3VXRD 4DGYL 5AYQA 5H2BA 5IEKA 3BESR 4FI8A 1I3GL 2VLJA 3A6OA 4LHUD 1BVNT 3ZZQA 2R4SL 4PRAA 4XP5L 1CXFA 2YGVA 2YUZA 4DZBB 1KEGL 3VA2C 4XP6H 1O6SA 1ERNA 2B20A 2WBJD 1I53A 3BT2L 2HFGH 4JHZA 3DX9A 1J9RA 1G0YR 4K3DL 4MXWL 2JLLA 1UVQB 2B0SH 1ECZA 3SQRA 1S8DB 4CNIA 4FNTA 4N0UA 5EZLA 5B3SB 5SX5K 1FGNH 3H9SE 2KKQA 4N0FB 3QBTB 5F6IC 4F8PA 3NAAH 4IOIA 2KBGA 2DWSA 3WXVL 4E41D 1NLBH 4JFED 4CA4A 2DOCA 2ZXAA 1BIHA 5EBWA 3HPJB 4GH7B 1HHIB 4PUBH 4YGVA 1MHPH 2E7LC 4H26B 5ELIA 4DSYA 1ETZB 1FFNB 1X9LA 4FYRA 3SBRA 5DRZB 1MFNA 2A9BA 2VDRB 2P24A 3OKDB 3QJXA 4JM4H 4X9GA 4XNZB 3RJDA 4JG0L 3SO5A 4MQTB 1S6NA 1YPZB 3DTXA 3UYPA 1KLUA 3KYNB 3GBEA 3OAYH 2DQ6A 3I6LE 1C08B 1I9JH 2I24N 4MHHI 5ISZE 3SO3B 1MCHA 4N2EA 5B38A 5JHLA 4YLBA 4XX1E 3HR5B 3OMAB 3MRBB 1E5UI 3LZFL 5C0JA 2IGTA 1FAKT 3FB5A 3D4ZA 3LS4H 4X6FB 1NCOA 4HALA 4QHUB 4NAJA 1FI8C 3VSQA 1DVSA 3MRMB 5ADPH 4WY7L 1J05A 4PJXF 1M7IB 4EMZA 1JPSL 3S36H 4AV0A 4OF6A 4PRDB 3UDWC 1GJWA 2CALA 2IFFH 3VFUA 1CXLA 3MX0B 1T0MA 1GL4B 4WNQB 5C3TA 2UX7A 3HE7A 4XZUA 3TO4C 1P7QB 1JFQL 1TZHA 4LKCB 5AWNL 3WTVA 4XAKE 3FO0L 4PI0A 1AMXA 1F00I 3GMPB 3TBWB 4GG8A 4APXB 1A3LL 3OG4B 1HKFA 5C0BB 5IFJB 1B4LA 5TK4A 1MRCH 1VFBA 5CIPB 1K8IB 2R59A 3ARGB 2YJLA 3AACA 1RZ7L 3U0WH 4PRHE 4AG4H 1WAPA 1TT6A 2KUTA 3VX1A 3KM1A 4X6EA 4WI3A 3B83A 4OB5H 2CBOA 5AOZA 4G6KL 1WA1X 4A68A 3TYGL 3O8XC 1KIRB 5D7IA 2CGRL 1X5JA 1L6PA 4M6NH 5AVYB 1NH6A 5IG7A 4JM2C 1KCRL 4B3VA 3MBWB 2CUIA 4FYQA 5J1AA 1QATA 2ZUTA 4JM2A 4PJGF 4YHOL 2W0PA 1SVZA 2L8AA 5DJXB 3MRQB 3CDGB 4YSSA 4TMPA 3QC6X 4ZMOA 5TPWH 2HKFL 2RD0A 4PI2A 2A0LC 2CBTA 2V7HB 3O3BB 2UWEF 5ILTL 1OM3H 1Q9KA 1N0XL 2D31B 2ZWSA 1BLNB 2ADJB 2K4AA 4MD5A 4XB7A 3C6LD 2NY4B 3BEWB 4N85A 5TQ2L 3VM7A 1GCFA 4KZEH 3NA4A 2XV2A 4E5XB 4K7PY 1U8QB 4NO5A 2K7PA 4TVPL 3W2DL 4JZNB 1BBJA 2NDGA 3P73A 3EO9L 4OKVA 4XMUA 1T6BX 4UQ2B 4LU5H 3DIFA 4JW3A 2JELH 4KGJA 1HNYA 3AUVA 2GY7B 4DN3H 2WTOA 3AXHA 1P4IL 3LKNA 4N28A 1WBYB 1OB0A 2W80C 4OFQA 2R15A 5DD0L 1AGBB 5ESQA 3SBQA 3CZNA 1Z9SA 2EEFA 2P46B 3TBTB 4NNPL 4QHKJ 3C2AL 5DZJA 1KJVA 1TZIB 1N5AA 1S7XB 2R56L 3NGBB 4OBRA 2K9UA 1IM3A 1N7ML 1SEQH 4YHIA 1A9BB 1B4JH 4B96A 3LEVL 2LLNA 3GT6A 4FE9A 1XGPA 4X8CA 5ESVA 1UWFA 3SDCA 4ZDHB 2J55A 4PAZA 3RA7H 5CLYA 5IF0A 4XMWA 1HH9B 4UTAH 1VESA 1NJ9A 3ARDD 3FN0L 2BNUA 3DRTA 2FIKA 1YC8A 5JZ7D 3WAJA 3DGDA 1U21A 3HZMA 5A3IC 1K3IA 43C9A 5E1QA 3ARFB 4RMBA 3WEOA 2J73A 4U6YA 4KZDL 5JXEC 2DQIH 2CO6B 3MXWH 4P3WA 4P5TA 3OZ9L 2V0AA 4P9MH 3BO8B 5TQ0H 4WKXA 4ZNCD 2DIJA 1GRWA 3D2UB 1YUHB 2A4ZA 4HHGA 5IB4A 3WFBL 1ZV5A 1Y18A 5I0DA 2GSGA 4KXZI 1YMME 1KYOJ 2HRPL 3UPRB 3ZO0A 2H32A 2H3XC 3VU2A 1I3RA 2IPUG 4BFFA 4AY0A 1UD8A 2WINB 2ILLA 3GMQB 1G7PB 4LF3A 3UC0L 3F7LA 2X4UB 5I75C 4QRSB 1A9EA 3IFNL 5B7MA 5DMKB 2NPLX 5JOFB 3IMSA 1S78D 2X40A 5AW3B 4HC1H 1XR8A 2UY6A 1IQWL 4EZJA 1UWYA 4X4MA 4JPIB 4JPVL 3A6CL 3ROOB 2VLRA 3QJFA 5C7XH 3D87B 2TRHA 2UZYA 5LBGA 2CCLA 2GHZA 3LKRB 2P5WB 4FA8A 2XFXA 4Q4EA 4P23A 1G0DA 1D5BB 2FLBT 3PWJA 4OZGA 1GGCL 4R7XA 3S37L 4NUJB 1JNJA 5KVGE 4XCYA 5EBGA 2FE0A 3T3PE 4KNUA 2HX8A 1DEEB 3BUQA 1MELA 2QADC 2YA1A 4H8QA 4O9HH 1FAIL 2FD6L 4L8BA 4DGWC 1BGXL 1Y6KR 1CD0A 3D48R 3FUIA 4IGBA 2W92A 4KI1A 5GSVB 1RZFL 1KIPB 2B4CC 4KI5F 4ODTL 3SDAC 2CUAA 3INOA 4V1DB 1E6OL 5TDPA 1URLA 5GGUB 4YNYA 3WTXA 1MFEL 5F0JB 4Y9CA 1WFTA 2J1YA 3VCLB 3SDDA 5HHQB 3HLKA 2BVUA 3ILPA 1ED3A 2P3YA 3G7TA 1GTNA 5J6GA 3K6FA 4WTWA 3TTYA 1M6OA 4G42A 1UACH 2C4FT 4Z3EA 1UB5A 1SM3H 3V4VL 2ZCHL 4YE4L 1DJHA 4MTMA 4LEOB 4EN3C 4F7TA 1OO2A 4G7YL 4PG2C 4I2XE 3IXAA 4Q74A 4AIZA 5J9PA 2P42B 5EZJA 4GQPH 1W6LA 2Q6WB 3MLSH 1ND0A 3KLSA 4U1KB 3US1A 1DN2A 1XGUA 2WVTA 4MNGA 3VFTB 1UASA 4JFQB 1XCTB 3FKUS 1OCZB 3L5XL 1IBGL 1QSEB 4HIQA 2YZ8A 5CU9A 5K39B 5J11B 3NJJA 4GG6A 1XBDA 4AM0Q 4UQ9A 4OCWL 5GS0H 1O5PA 4XPTH 2Z8SA 5TK2A 2IWFA 3O3DB 4HF5H 2FGWL 2ZJSL 3PGFL 5DEFB 4GP8B 3KWUA 3V52H 5JHLH 3L6FB 3EFOA 2X4OA 4UDUB 1PGRB 2NY0B 1SXSA 4ZTPL 4CBZA 4ZFOL 4JVWA 5ISZD 4OIFA 3QRFM 4XC1H 2I9TB 3T2NL 5AOKA 3D25A 3SDDC 3AREB 5I75B 4NQDD 5FHBH 3NK3A 2LAAA 3UTQB 1FRGL 4R4ND 4ETYA 4GLRH 4NUQA 2NY7L 1TENA 3A6BL 3QUYA 4YL9A 5BUGA 1CE1H 1GZQA 3CN4A 5EPMA 4QPEA 2PP7A 3VDAA 1CGSL 3EH4B 4W81A 2APVA 4FXTA 1NCNA 1KCUH 5FW6A 3EF4A 5LBSL 5KYUB 1D6VL 4HCRA 1T22B 4LCWB 1BQSA 1OE2A 2J88H 1T66C 3FQUB 1YRKA 1BD2E 4I3SH 2BSCA 4R4BA 4URTB 5KWYC 2AEPL 1VPOH 2ZYHA 1WBZA 4LFHG 1P7KB 4P2OA 5BO1H 4MJID 2CHWA 4CVZB 1ETA1 1FFOA 1I7ZA 1MI5D 4P3DA 3VJ6A 1HDMB 4G6FB 3UTZB 3Q3GB 3ESOA 1JXDA 1I9RH 2Y7SA 3RIKA 2MQCA 1JE6A 4YXKH 5LHDA 4Y4KA 5DK0A 1WFJA 2V7NA 3PGDA 5M7QA 4TTDC 5CZVH 3AAZB 1AS7A 1J0KA 4FLRA 5DYOA 3WYRA 5KVMC 4LB8A 4YXHL 3NFPB 1PKQB 1TETH 1E4XL 3TZVD 5KS9A 1CXEA 3QNXB 2CDGA 2ZKMX 1R5WA 3II2A 5BQDA 1G1YA 3IKCB 2FQDA 5I5JA 4LL9A 4KXBA 2VDQB 4ETQA 1WDAA 4A66A 5KSAD 2WXPA 1U95A 1EQWA 3BVUA 1QEWB 3G5YB 3MHZA 5AAWC 2K78A 4LCWE 3QHZL 2H5UA 4X5RA 4GKSA 4KV5E 1NWOA 3NIGB 4OQ1A 2HB0A 1F90H 4RDBA 1J9QA 2R1YB 2GSMB 4I18A 3F83A 3H42H 2FNBA 5IMMB 1IBFA 3FT1A 2DQFB 2JB5L 4L4TA 5FF6A 1QFHA 2E9JA 3F7KA 2VN7A 1P4BL 3P3UA 4AYBA 3CU1A 3ZIMA 1G7JB 1UD5A 1OSYA 1VZIA 3GI8L 1H3UA 4HHAA 3X11B 5SX4I 4V11A 4AT6B 2X44D 3H85A 3APFA 5KYWA 1PG7L 5I73C 3LD8B 2YPKB 2PO6B 3T3MB 2IAMA 2R2CA 3QH3B 4BV1A 4EI6A 5I17B 5FDWB 3UBXI 4PEEA 1YN7B 1UENA 5BMFH 4TVPD 2Y36L 2GITA 2EADA 2PUQT 4QGYA 2EDBA 4IQHA 1C1EH 2EACA 4KZ0A 4A7UA 2VDMH 2QLVB 4YQXL 4X7CC 1SYSA 2P26A 1W6WA 4ATWA 4CMHC 3V0HA 2J43A 1W16A 3QUML 4AITA 4DJMA 5GZOD 3DBSA 4X5QA 2RR3A 2G2RB 4XVJH 5EUOF 2VDKL 3OKMA 4Q97A 3VXPA 1G7IA 3TIDB 3QDGA 3VQ2C 1K8IA 3QZNA 4EN2A 4MB5A 1CYGA 5D1ZI 1SOQA 2ZYRA 2A9MH 2P47B 5I66B 1L9TA 1WFUA 1MWOA 1RFDH 4RLDA 3TO4B 2Q5BA 3DROB 4MB4A 5B39B 1CTNA 1UC6A 4UTBL 1NFDF 2YGOA 2YKLL 5E6SB 4ZX4A 2AS5M 4NQVB 4ZS7H 4NGHH 1UXMA 2HN7A 4L4JA 4NIKB 1EEUA 3O6FD 1BZQK 1XTMA 1V55B 4Z8FL 1IU1A 3D3VA 2B5IC 4Y1TA 3BQUB 3CVHB 2JKIS 5CLTA 3FTUA 3SGEH 1T1YB 5GJTL 3LIZA 4F7EA 1M1XB 4QRQA 3E2HC 3H7BB 3F7VA 1FYTD 4TVUA 3AFLA 4EI5C 3TYGH 3U6RA 4BFIA 5J0BA 5IB3A 1DHKA 1X9QA 2Y69B 1EEZA 3GJFB 4A2EA 1W2KT 4U1GC 5GGVH 1UOLA 1OE3A 4C4BA 4PJEF 2OTWA 2DDQH 1UZ6E 1WBYA 1UWEL 2HVBA 1UWGH 3GMLB 4HUVA 4FQ1L 4NOBA 3CZKA 3HE7C 3JV0A 4ZAKD 4AVKA 5D1XA 1A4JA 1AE6H 1EAPA 2BZDA 3UAFA 5B4MD 3RWIA 1QR1B 4MLSA 4D8PA 2DKMA 1N5AB 1S7XA 3TH4T 5F97E 3V0VB 3TS8A 2EDNA 4HJGA 1EGJL 5GJSL 2YPLE 1UFUA 3NCWA 4JL1A 4MYPA 3OM3B 5F3HA 4KTDL 4J39A 1ZTMA 4BFOA 1U8OB 1JPTH 4FXLA 3IJ8A 4UWQB 2OMVA 2DBLL 2WSPA 2WW8A 2WN2A 3U2SB 5AOIA 1QG3A 3G6AA 4AIEA 3RU8H 3UCQA 3W2DH 3B7SA 3PQYE 1SUHA 3QIWC 4BYHA 5KS9F 4ZXBB 1BAFL 2PNDA 1P4LA 4Z7UB 2CGZA 3VQ1C 4MA7H 5MEOB 3KE0A 4RWYL 5F7FA 1RHFA 1CF1A 2AJVL 5D96B 4AMWA 3FUEA 5HGHB 4HIEA 2XYBA 3RY6A 1YMHA 3V95A 3KCPB 4YIQA 3MYJA 4I5BA 3QJHA 2DWDB 3TVMA 3E3QE 3EYUH 3TLRA 1HK6A 3DPBB 4WUUA 4G3YL 5AOMA 4E9WA 4Q8BA 1RJYA 3HI6H 4R83A 1HHIA 5SWSE 1TUPA 3U4BH 3FN0H 4LT7A 3X3GH 2ZICA 3CFCL 4NIYE 1ICTA 5PCYA 5T1LB 4NHCL 3KBEA 3SBPA 3CMGA 2KI6A 2QGDA 4HSQA 4S0SD 1AACA 3N44B 3OKDA 4KKBC 2I07A 2Y6SC 4J8QA 3PHAA 3PXHA 3IJSA 2X05A 4S1RH 4I3RH 2NTFA 5FW7A 4XCCL 4F20A 4JZJA 3QC5X 4WI2A 4Y4FC 1A6WL 4Z6AT 1E7UA 2E5EA 2VN4A 2X3BA 1SHWA 1HAWA 2NOYA 4QI3A 2EVGA 2HFFB 3MNDA 3S48A 1NLBL 3QSKB 4XMTA 3OZKA 4UTCA 2DIAA 2WIIA 2IALA 4U3CA 1KZYA 2HJFB 4UILL 5HD8D 4XCNB 2VR6A 2DIEA 4JO3L 1AHWB 5DCCA 2WC7A 2IQ9L 2NY3D 3CDCA 5C6TH 2FWUA 4OD2A 5FCUL 4M8QA 1ADQH 2H8PB 3PAVA 1T0MB 3PWVA 2AXFB 1JGVL 2WLZA 4MS8D 4ZAKC 3THML 4ZW3A 1SGKA 3GS0A 5GZNC 1XF5B 2DB8A 1HINL 2Y2WA 3B9EA 2Z31B 1V3LA 4DK5A 3MBXL 3QQ3B 2VLJE 4AQAA 5TE7L 2CHNA 3BP5B 1ID5I 3L9BA 5EULV 2DYPB 4XMLL 5E1AA 5K59E 4H0LC 3ILPB 1T2XA 5E56A 1JZEA 3B2DC 5IQOA 4H88L 4BRJA 2H9GA 3AB0C 4PJFF 4DP8X 1NIFA 1UB5B 2GJ6E 5ALBH 2WB7A 4AYFB 3LKOB 5JHAA 4WV1A 4K94C 5IMOB 5AW7B 3P30L 4OZFG 1O9ZA 3CGTA 4A2GA 4AIZB 4OZIF 1I1AD 5B1JC 1VIWA 1ULVA 4P59H 5EF3A 2VRQA 4Z7VA 5EZIL 4PRIB 4OW6A 1HEZA 2CM5A 4EUPG 2VL5B 5I8CA 5C9KA 3M7FB 4B7IA 1MG3C 3TNMA 5BS0D 1HEJC 1JV2B 4PGJA 3OC8A 1A3LH 4YC2B 4AEIL 3J8F7 1TO4A 3ORJA 1PTZA 3Q48A 1NSNH 1DJXA 2K6YA 4PVLA 4NFBA 4FFVC 4I9WE 4IMLA 1E4XI 2XIBA 3J07A 4MRCA 4BSJA 3NCBB 4BSWB 3QUZA 2QVKA 1XF4B 2C7UA 5EU7C 3RTLA 2ZCHH 4YE4H 3TEWA 3QDJD 3SE8H 2ITCA 1TJGL 2VMCA 4GKZB 4Z76A 1LDPL 3KWWB 1U8HB 4JREC 1BBJB 3WNJA 3M86A 3UTSE 2X1WL 3CN0A 4DEPC 2WZ6A 4KQ4H 3BT0A 1PY4A 2X4SB 3LKNB 1UB6A 1RZQA 5FGSA 2YD8A 1BEXA 1JGDB 2VISB 3T0EB 3QCTL 4XO3A 3KCWA 4YX2H 1CL7I 3BGFC 5T5FA 4D8OA 2BOCA 1J1PH 2JCCB 2O61A 4Y19D 1A6VH 4KJYA 4HWUA 3V7AG 1P7KA 3ESMA 1DQQA 4MS8C 1YC7A 4PRPB 5I1EH 3VE0B 2GIYA 1TVDA 3ECUA 5AB2A 5F1IA 1S7SB 4MX7A 4N6RB 1YJDH 1BVOA 3UTZA 3GDBA 2B4CL 4FHJA 1QSFB 3ULUF 4KQ3H 1X6LA 3NRQA 3GKZA 4YSQA 4XNDA 3JWNE 1KXTA 3OWRA 2M2DA 1O75A 3R1GL 2YAQA 3P9LB 4IMKC 4FQXD 1BF5A 2EE6A 5D1ZC 2X6BA 2R0KH 3FQXB 2Y5TA 4PV9A 5TTRA 1H5BA 3SE4A 4AENA 4C47A 5A2AA 5C0EB 4DVRL 4M1DH 2VGLM 5L7XH 1ZLUK 2HFEB 2FYVA 3IGAA 5E9NA 1UM4H 3HW7A 3BVDB 1IZJA 3C60B 3DJSA 5EHFA 1Q0YH 3ZDYE 2XIIA 1T20B 2J88L 3CCHA 3MV9D 1DR9A 4FG2A 3T6QC 4G59C 2FLMA 2E27H 1GZPB 4X5XA 4GRLC 4W1TA 1VDGA 3GUFA 5T3ZD 1CDHA 2FYYA 5KVDL 4EI0A 1ZLVK 3ZK0A 3OJDA 3CJJA 2R0ZH 1I9RL 4BSVA 3MLZH 1E65A 5I23A 3QJRB 3RTQA 4QRFA 2AK1H 3GDCA 3PFQA 4R90H 2KZWA 4GG6F 5KVEL 2WCGA 2WKOA 1MFUA 3MXWL 2FJFB 3LXBA 4C4UA 1E4XH 1XSOA 4XN5A 3U9WA 5IW6B 2AQRA 4UT9L 2ODHA 1ET8A 4LQFL 3HG2A 4HOMA 4XPHL 3JYCA 4PW4A 2IDTA 5EOTB 2BVPA 1GGIL 2GTZA 5C08E 4PJEA 5I15H 4HC1A 1JIBA 4W9FC 1MCPL 3CPLA 2BOBA 4WDIB 4TUOA 2H2SC 2NLJB 3DVNB 4PGZA 4CGUB 3IM1A 1A1NB 5E9AA 5DQDH 2NW2B 4KROC 2Z6FA 1M7XA 4ALAH 1D5XB 4NJAL 3WNIA 1VSCA 3STBA 4XVTL 5H37G 3U1SL 1S7QA 5DHVA 3VI3F 2V2TB 3O45B 3BZ5A 4ZBJA 1BEYH 1QLRB 4P57A 4IKLA 4TSCH 1YN6A 4L1BA 3WE6A 3IJHB 1GGCH 4XWGL 1PKQE 4NC0B 4PGBA 3S2CA 5C0DB 4FKKA 3CDZB 1PAMA 1VGKA 2QSQA 2OYLA 4I89A 5F0PB 2Y0SA 1JNHA 2R1WA 2JCCE 4ZT1A 2CLZB 1FAIH 2IC2A 1EHAA 3N42F 5L4JA 4EKXA 1A4AA 2HLFD 4OD1L 1GGBH 1T5WA 4ODTH 3V0JA 2GC7C 3UAJA 2KYIA 3AWGA 4PRAB 1E6OH 1P7BA 3AQYA 1SBSL 1KIQA 3FQTB 4PPTA 5E5RB 4P46A 1OL0A 3T8XB 5T1DH 4FDWA 4Q9RL 3ZE0B 1OLLA 3KLKA 5I19H 3IXTA 3MXVL 1BG1A 3L3KA 5GS1A 4OLXL 2AEWA 4L8SC 4N2FA 2XWJA 2WD0A 4F2FA 4MAYB 1A02N 4XBMA 3OR7A 3W56A 4FQIH 3QISA 2E76C 3FS9A 1AYRA 1U3HA 2H3KA 3T0ED 2JKLA 2D4DA 4GW4B 2X12A 2ZIDA 4ZS7L 1UA7A 2F0CA 2X28A 2Z4QA 5F1NB 4AC4A 3HPJA 3W3BA 4B7LA 2XA3A 3MACL 5F9OH 3UJTL 2XZQL 3MNZB 2WNXA 3D1MC 3DDGA 3U46A 1A2YB 1U2HA 3ZTCC 1JHKL 5E2UL 4FTVD 1A6UH 2OJEB 3QPQC 2H1PH 4HKBB 4I1PA 1QAWA 3SE3C 1OKEA 1N9PA 2Z31C 4LPYA 4FF9A 4OBSA 3BPOB 4H1LG 3HG4A 4P5MA 4HKZA 4P3DB 1A4KB 3VJ6B 4BHUA 4JQIL 3AY4A 3OHXA 5HJ3A 5MEPA 3T2NH 5HGGS 1OK0A 1FL5A 3C5XA 3GIZH 1AHWC 4QRRD 4F37K 1E27A 1DVUA 4LPTA 4ZQKA 5FHBL 5MEOA 5EEWA 3ARGD 2VLJB 2ICWA 3SHSA 2F7PA 3QUMA 1ZSHA 3I6GA 3JWDC 4Z0BL 1UJ3B 2KPNA 3BW9A 5D7JC 4PS3A 3NFPA 3NBNA 1I75A 5D7LE 2D7TH 1JK9B 4X9HA 1H3VA 2VDRH 3WIIH 1IL1A 3MREB 1W80A 3GMPA 2PR4H 4UQ3B 1BJ8A 1DVZA 4MJIA 2OW7A 1VPOL 5HBBA 3D6GA 1LGVA 4RAHA 5JQHC 1ZLSL 4AL8C 2WYTA 1EUTA 1ODUA 4K7FB 1LD9A 2Y7OA 5KVDE 3IDJA 1JBJA 3OWEA 4BWUA 1EBPA 3NYKA 1BAFH 4GBXA 2WXNA 3B8YA 3QP3A 4X6EB 1ADWA 4WJ5B 4ADIA 1XGZA 2WAQA 1VACA 3FFCB 5CZXD 3GSQA 1A1MB 3VXTA 1V7ML 4WLCA 5K9KB 2E8ZA 4MBOA 1OD7A 5IG7B 1QFWH 1LDSA 2NY3B 3HR6A 4CJ0A 4F9LA 1GIGL 4OY9A 5BS0A 1U41A 1GS7A 5FOJA 1SY6A 4M62H 3ULSB 2GEQA 1AIFA 1BQUA 1SJMA 4OUOA 2ZXBA 3HNVH 4KK9C 4UTBA 5DZAA 4JKPH 3ETSA 1HX0A 4Q6IC 1GVIA 5CGTA 5DRNA 3HAEH 5IBUB 2FX7L 3ME0B 3QIWB 2X6UA 3BH9B 3CHOA 1YMMA 3T1WA 5I16A 5D70H 1GCYA 2PPEA 4KGLA 7PCYA 5T5NG 3GD1C 1RQ5A 1WIOA 1F90L 3GZOA 1ASQA 1CU4L 3FN9A 3N3EA 4Z3FA 1JZ2A 3BEWA 3Q44A 2V9TA 4QRPD 2Z8RA 4WI6A 1V7NL 4G1EB 1G9NH 4TVPE 5B4MC 4Q9QH 3SDDD 1DEDA 5AAWA 2W60B 3OKMB 1TJHL 4JZNA 2Z31D 3HG1D 3CIAA 5CR8A 1AR2A 1LP9F 2WLYA 3APMA 3IDNB 3M07A 3K8LA 2DWTA 2EXWD 4UILH 2VDMB 3B4NA 3TJEL 2QQKL 5E6IA 2JJSC 4F57H 2LGNA 5FCUH 4WAFA 3BGMB 4MJ6A 1DJSA 2VMFA 3KWVA 3ATEA 2WZ5A 3KH3A 3CE1A 4PJAB 4WEBL 1GXEA 4MQ7A 4NKOA 1DQLL 2BS8A 3OQ3B 2Q3AA 2QMKA 5J3HD 2BDNL 3AUWB 4ODSL 3MV8B 4Q9BA 3US9A 1TYEB 3I3EA 1J48A 1NAMB 4R8WH 3DGCR 2VQUA 2WBJC 3HZMB 1E5ZA 1TOXA 3QUKB 1DQKA 1MW0A 1QQDB 1WS8A 2NY2B 3FMGL 4N8CL 4PJHA 1USQA 3LZRA 2WY3B 4RBPK 3KVQA 2F8OA 3JSSA 1F6LL 1M1XA 3IMRA 2X0WA 3CMOH 4QRQB 4W6WB 2CO6A 1XB8A 3CVBA 1WTLA 2OLDA 3K0YA 4Y7OC 5C07A 4UDTA 2F1AA 3HN3A 5KTEL 4ZI8A 3WS3B 4ONGL 3LPGA 3VWKC 1XGTB 1PCSA 3BSGA 3OSKA 2BIPA 2YKLH 3TBSB 2OXGA 1MIMH 2F53D 3K91A 3P4OB 3SCMD 2AVGA 3WSQL 5L2KB 3T0EA 1T6WA 3DX6A 5HVHB 4NKIL 4B0MM 4QLWA 4IDJL 1PZ3A 3VTAA 4JFZH 3EFFB 4D3CL 5I6PA 1FZKB 3FCBA 4TL4A 4KKCD 5DF0A 4ERSL 3FOMA 4ZZKA 2ERJB 5D4JA 1TQUA 3BZ4B 2XFXB 4JL2A 1NBYB 2CIKB 1RJLA 2DMCA 1CFQB 3ZL1A 5JHDB 4OIBA 3D4GA 2I9LB 2ZKHH 1L0QA 3QORD 4PP2B 1L4IA 2JKRM 4R3SA 3WUWG 1NBZA 5CINL 1NCCL 4EQ2A 4PJHE 2J4WL 1JVKA 3H9SB 2FBJL 4NEHB 5FGBC 1DBMH 2ZAIA 4ODVL 4HKJA 3CZJA 3KPSE 4U6VH 4LCUA 2VXUL 3MMEA 2A38A 1FC2D 4PJFA 4ADGA 1ZV2A 3GTTA 4HW6A 2QZQA 4RISH 3UOAB 2VXQL 3WL9B 1ASOA 1M7DA 1CLZL 2K4WA 3QJHB 4ZUTA 5JIPA 2ED7A 3Q2LA 4AQZA 3MV8D 4U6YB 3CFUA 3LNEA 1A8ZA 5E5MB 2F19L 1MCLA 4V2BA 2WAHA 3BDYH 4FQCL 1IKNA 2PW2B 4PREB 5D2LA 1OGAE 1UOVA 3W5NA 4NT6B 4N0FA 5CIPH 1YDPB 2IGFL 2Z7UA 1ET5A 2G5BB 2IBGA 4UOJA 3L48A 4YSAA 1KEML 5JPMC 1SVCP 1EO7A 1ZT4B 3PWNB 1XCQA 3CN3A 4L3EA 3OV6A 1NUDA 4JCLA 4AGLA 2X4PB 4BE6A 2DLFL 3V55A 5FYKD 3QUXB 3TNNA 3BPLB 3JZ7A 3KLLA 3O2DA 4RFEB 2JI2A 3ZTJH 1LE5A 5AL8A 3O6FC 1ND0B 1NMCB 2CUMA 3W37A 4LSUL 2C1PB 1WCQA 2BVPB 2GTZB 3P0VL 4MA8H 4RQQB 1HTYA 4PW3A 4CC4A 2EDEA 1AKJD 1KBWA 4OJEH 2VN5A 1BBDL 3KPLA 2BIHA 3IDXL 1E4WL 2E86A 1MWAL 3M7OA 3FONA 1FZMA 5FB8B 4JO4L 2C8NA 2HKHH 3L5JA 3EDDA 4PQXA 4X6FA 1TO5A 4HIHA 3I3DA 1WHOA 2E7LA 5E0FA 3PAZA 4GAJH 4JQVC 4L8BB 4O02A 3QZBA 3UZEC 3K2MC 3QXAA 3RGVC 3SYOA 3WFCH 4PRDA 3BSHA 3DIDA 4DHLA 1PLCA 1BHGA 3UTQA 2WQ8A 4LQFH 4DO4A 3F12A 3QQNA 3WS6A 3HG1B 1NWPA 1T04B 4F3FA 5EFIB 2VDNL 5EF1A 5CBAB 3TZVB 2JKSA 2Y3NA 3FHQA 4J3OG 3Q1EA 3SDDB 1JV5A 3B37A 4MJIE 1YEFH 2DQGL 3I85A 4XO4A 4K8RH 1ZLUH 3M1CA 1FCCA 3KL5A 2WQAA 1NDGB 1KTJA 4L37B 2WUBH 5FGCE 4LCCB 5F70A 1J5IA 4BUGA 4HUUA 1NL0H 4PVMA 2EIJB 1I4FA 4GXUN 1IC4H 3X1EA 5JPNC 5FYLD 1IZKA 3VQMA 1E5CA 2Q6WA 3GSUB 4WW1A 5EC1B 5GGTH 2PPFA 3SKJH 3TCLA 4NUGH 2KDYA 2BJMH 3WLWC 4WJKB 3QR2A 4DKFL 3HB3B 5AAPA 1BD2A 3CHRA 3QIUD 1DBAL 1IM9D 1CD1B 3FH7A 3KPNA 1U33A 1GGBL 1RZKH 3AGWA 4RGMB 2YC1B 3UPRA 2GSIB 1G9HA 1HHKA 3OKOA 4ODHL 2O5ZL 4XBPA 1CS6A 3MV7B 3ZRSA 3TBVB 3KEDA 3D18B 4OUUB 3WAKA 5EUKA 3FO2B 1VEPA 4PS8A 5BVPL 3M8OL 5I0XA 4LDOB 2JCCA 4HFUH 4ZUUB 4JDTL 5IW1A 3O2DL 2D03H 3KD4A 1A7OH 1DDHA 2FH6A 2BNQA 3CH8A 4M3HA 1A4CA 1NDMA 1UD3A 4X99A 1INQB 1LYQA 2NSXA 3VRLE 5KW9H 4NENB 2FHCA 1EFXB 1PFCA 1TJGH 4P48A 3FN3A 5DR5L 3ZN6A 1OTSC 1OVZA 1P84K 2BP0B 4YDLB 1Z6JT 1KXTB 3RWJA 5BVJB 4GKNA 1XR9B 2VKXA 3PWJB 4MAYD 4OZGB 3HKZA 4QRRB 4HZLA 4XAWH 2NZ9C 3V4PH 3V5HB 4ANXA 1QEXA 4X42A 1NPJA 1SVBA 2VLKA 1QFUH 2IDFA 3CVIL 2K45A 3V0AC 3KL0A 5IFHL 3DI2B 1G5AA 2E7MA 3QAZC 1KJ3H 1WFIA 5AKRA 3H9HB 3VWJB 4NQDB 2HTKD 3QNZA 4FTVB 3BRGC 5DK0B 1EAQA 5E6UB 1TQCB 4CC1A 1RK1A 1I9IL 5ISZB 4KXAA 1J18A 3UGUA 2C3WA 3RG1C 5INCA 3KHOA 1N3NB 2KH2B 3H9YA 4TQHA 3WTWA 2HWZH 3V7MA 3VQLA 2VXTH 1T83A 1IGCL 1YY9D 1OZUA 4EXKA 2DD8L 4B9KC 1CC3A 1M6OB 4G42B 4HJIA 4XNBA 4OQTL 2XG5B 3D51A 2WKLA 1SZNA 5JW3H 2WO4A 4M93C 4PSRA 2ZQKA 3BAEL 2AMGA 15C8L 1RUPL 3EKCA 4LEOA 5IJCC 3MOQA 5GGSA 5DZNA 3E80A 4JFSA 1CDJA 1XF2B 4NQVA 2ZOKB 4KK6D 1CJYA 4OM0H 1S7WB 1BFSA 3MJ7A 4WFGE 1MCBA 4WI9A 4XWOD 3N43B 3TVMD 4LLDB 1YNKH 1B2WL 3IPFA 1U36A 1KTLA 2Y9RT 2AJXL 4M5ZL 1FZOB 1JPFA 4Z77B 3GSWA 2F8VA 3CFNA 1IBZA 2ZSWB 4FGMA 4HUWA 5TDOB 1CZ8H 1KGXA 4KWUA 3POHA 1OOAA 4TUOB 5KJ4A 2O93L 4NERA 3FXIC 2FB4H 4RFOL 1UQSB 2Q87A 3UG4A 2CPUA 2P1YA 4LLUA 5LQBH 3CSYA 4C55A 2ZAGA 1V7MH 1V3KA 2FWOB 3DX8B 5HI4D 4HX1A 1DEEA 2QHRH 3NFSH 5DUMH 2J71A 4HEPA 4QHNB 5HGDA 3BN9D 1CK0L 3FU0A 4ZNEE 2JXMA 3LN4A 1K9TA 1NCAH 3NFNA 3PP3K 4GI8A 4NQSA 5DA4A 3CDZA 1OIOA 3AU1B 4P3CH 3ZQWA 4Y4HB 3PXLA 2C3XA 3R19A 5D7KE 3CIQA 3C09C 4JFDD 5L0QC 2VDLL 3VFWB 2UZIH 3GM0A 4R97B 2Y2TA 3OX8B 1NC4A 1L7IH 2XQYG 5E8EA 5C0RH 5JW5A 2B1OA 4ELKB 2NY4C 2WBWB 2GC4C 1G1CA 2DQTL 3VFRB 1KJ2A 3ZTDC 1FNFA 4L3AA 4YHZL 2BNQE 3RUGF 2P43B 1FFOB 3K8KA 3NCYP 1R19A 2G2PA 2BSRA 4J23A 4JNXA 2EIZB 1YCSA 3RJQB 5EIIG 2CKBB 2HT4D 1RKRA 4M61B 1PF3A 2C9SA 4AQ1C 1ZANL 2V2WB 4UNVA 3F6LA 4I3GA 4YLQT 3RX7A 3N5AA 4M5YH 2KLSA 1T5XB 4HIJB 3DX7B 5FO8A 1XH3A 1KXQA 4XX1G 4FTVE 5FYLE 3V4PB 1QSFD 3G04A 4PV8A 5DWUL 3I2CL 3DO7B 1CLYL 3LEXA 4U1NB 4XVUD 4I5BB 2DWDA 4MA1B 3TVMB 1RJCA 2CDGB 4PJBA 4MJ2A 4R97C 1R3HA 5TE6L 5DJCB 4G70B 2QPFA 4RGNB 2YD5A 1QEWA 2X4OB 4UDUA 4Y4HC 4IJ3C 1RU9H 4YXLL 1DZ0A 1JHTA 2BZ7A 3G5XB 4UINL 1G9ML 1ET7A 5HYQB 1DVYA 3QJTB 1NEZA 2NXZD 1G4RA 4J2XA 1L5GA 3KLDA 3WS6C 4HP5A 3MRKB 4K07A 4OFYA 2CR6A 1CLVA 1I8KA 3DETD 3LS5H 4OV5B 2D7OA 1OLZA 5DVLA 1XL6A 1UKQA 5HJ3B 5MEPB 3UO1L 3VU1A 2GFBB 3PQYB 4JO8A 2X3AA 5A6IA 1F13A 4HKJB 2ED8A 3E6FB 4A6YB 1RI8A 1R5VB 4C54A 3QH3A 3ZKXB 1JP5A 4AI7A 5B38B 4IDJH 2NYZA 4NAMA 2A7BA 2OP4L 4JPKL 1UG9A 4X6CF 1RHHA 3ZE0E 1JK9A 1DVFB 5L6YL 4PB0L 2HX7A 1CCZA 3P4LA 1AG6A 1BCIA 3CFBA 1A6UL 4K5PA 4EN3A 4MRBA 4PRBB 4M93B 4GUOA 3MRPB 2QSCH 3MLRH 5SV4A 1Z9OA 4U1MB 5SV3A 2J6EA 3EYFA 1KENH 4HBCL 4YOKA 5T1MA 1AVAA 3AS1A 4P99A 1WICA 5TPWL 1O0VA 3B9KC 4H25A 1WC7B 3QEGL 1T89A 1UD4A 1G6RL 3GMMA 4Y19E 3HUJB 3ZE1B 4B5ZA 2VDRL 1J8KA 2HMID 4ELMF 2G3NA 4X8GA 1DSYA 5L2JA 3WHE1 4OSUL 4O2EB 4X9FA 2J20A 4YSTA 2KS0A 4IKKA 2EIEA 5GGRB 3IVKA 4NLHA 4H20L 4G6JL 5J1SC 3FT3A 2X6CA 5DFTA 3UFIA 1YMMB 5I16B 4P5TD 5K9QI 4GP5B 1MSPA 1N4XL 3F8UB 3DTDA 3H9ZA 2PXYA 4YDLC 3QZPA 1VB9A 5DI8A 5HHVH 3N85H 4RMRA 1MJ7L 4I0PD 5MP6H 3F58H 4UM8A 1C5BH 5AVSB 4DWHA 1X4ZA 3OXRA 5D7SL 1HH6A 2FJSA 2GJRA 3EYOB 2IIJA 1GIGH 4FXKA 3OPZL 5F0LB 3BD5A 1BZEA 2NQCA 3U0PA 3L7FB 4F3FB 4K55A 3ARZA 4CILA 3BZFA 4QOKE 5FWRA 2C3VB 4DFIA 3Q2WA 1QVOA 2L4OA 4JGMA 1H15B 2Y5QA 3SYQA 4LO9A 3HZ3A 1YEJH 2O61B 3ECBA 3WUWA 4F93B 1OM9A 1AD9A 2HFGL 3ZO9A 3MA7A 4PJIE 4FFYA 4IOSD 1IAKA 3G5VA 4HMCA 2HVJB 5HDWA 1FFTB 2V17L 4WV1B 5F0MB 3ARBA 4NQEE 3WUZA 1KC5L 4AKQA 3NIFF 1XHHA 3RGBA 1ZS8A 5I1KL 1AD0A 2A6IB 3O3EB 4FXGC 4GSUA 4Y2DA 2H41A 2VZ3A 4HWZA 1PCXA 3C12A 4YHIB 4EBQL 4CGTA 4X0KB 3TP4A 1RULH 2GIXA 2PPAA 3IJEA 3QDJA 4K8RD 3W0WB 5FYLL 1TFPA 2H0FA 3GWJA 1FIGH 4L29A 4F27A 5C1MB 2PXYC 1EHLH 4PUBL 3KG5A 1VCAA 2YXMA 2H3NA 2GI0A 3IFNH 4OCSL 1KTBA 3QDMA 3OLEA 1DLFL 4U7MA 2DQGH 4Y5VA 2AV7A 2XZAH 1T3FB 1J88A 2YPLA 4UOZA 1U92A 2C7FA 2YFOA 3UZVA 2OBGA 3SKUD 1HHGB 5DRXA 3VD0A 4TUKH 2YQ3A 4BQCA 3SKNB 3CHSA 3F7VB 1PZUB 2D9CA 3F85A 4FLHA 3LKQA 5TF1L 2ADIB 3DVGA 4FQLH 2YAPA 4N8CH 3PHSA 4K71B 5DGRA 1E90A 1EEZB 3IE4A 5I30L 3PREA 4HA1A 1YG9A 4X99B 4K7PX 2E0PA 3L7EA 3LS4L 2WQSA 3NJLA 3W11D 3Q06A 2WO3B 1EZSA 2XJKA 4AGOA 4FZ8H 4I88A 2DEXX 4HUXB 4JFOA 5TGBA 5LGJA 1CE6A 5B7FA 3PGCB 4H26A 1NGZA 2BFVH 4YSPA 1X9RA 2IJ0C 5DGQA 5HI3D 4E9XA 4ZX6A 1WCBB 5I2IB 3FB7A 5FA4B 4ZXBD 5HD8C 4P2RE 4PRPA 4XCNA 4F8LA 1FBIL 4RGNE 2G30A 2FL5A 2NW3A 3OKLB 3FU9A 3FNKA 5BVPH 2BOBB 3QUGA 4WDIA 5GZND 1F97A 1ACZA 3ARTA 3HZYB 1A7OL 1D5BA 1NMCC 1UACL 1YEHH 4NO2A 4ERSH 3IMUA 4OLYL 3QORB 4FQXA 1SM3L 2WK2A 3MBEC 2B9BA 5E23A 1FYTE 1TU2B 2QQQA 5ITBL 4HHWA 3CBRA 5KZCB 5LNDA 5DJ2B 3C60A 1BIIA 4LBEA 4J3OC 1YYCA 3CLFL 4P07A 3RUGA 3MLSL 4BWWA 2OCJA 1FVCA 1ZT4A 4OKDA 4Z3TA 5GRUL 3LQZB 1IFHL 2YN5A 5GGUA 3ZDXF 1PKOA 1CUOA 4APXA 1Q90A 1PSKH 2W0FA 2W9EL 3WFEH 1CFTB 3HE6B 3EIFA 2PXYD 4Z7VB 3WO4C 1V27A 2NT0A 5DMYA 2IBZX 4W93A 3FUDA 2FGWH 4MMXC 2IFGA 3BKMH 4K94H 3MCG1 2F19H 2GQHA 1ITBB 4GT0A 1SRDA 3FZUC 3HRZB 2BW4A 1GPOH 1IC0A 1PY0A 3DTUB 1AZBA 4P46C 2NR6D 4JO2H 1SDAB 4ZMAT 1Z32X 2DQEL 3TH3T 3J27A 2IGFH 4BFKA 4AMKL 5JA9A 1WWBX 1M71A 2HJFA 3N41F 4TNWF 15C8H 1M4KA 5HJDA 4F91B 1TJMA 1BOGA 4GIAA 3W11C 2ZXEB 2BMKA 1A3QA 4J4PD 4GNKB 4M8QB 1F8TL 2H8PA 4KK8D 5IIEA 1JF1A 4W9CC 4WWOA 5AUMB 5BRZB 1B4JL 2UX6A 3D85D 3PWUB 4S1DC 1UB6B 1Q72H 3V9EA 3SGKC 4ACTA 3EFOB 5F7YC 3WJJC 2AJXH 4M5ZH 5SWSD 4AQAB 4L4TE 3FSWA 2F74A 4PCTA 4XNUL 1KNOA 1JRHH 2FR4A 1CFSB 3FB6B 1FJ1B 1U8KB 2EYTA 3SPVB 2MSPA 3HFFA 1CIDA 1GYCA 4BWTA 1MHHA 4Y2OB 5E8EB 1OPOA 4ZODA 5I28A 3JTSA 1JYVA 4KXDA 1S7TB 3CBJB 4OZ4B 2N01B 4G6ML 4PU2A 3RGHA 3FO1B 5D1QC 5C6PB 3CDYA 3IF1A 3MQIA 2GAZA 3RBSA 1F58H 2AQNA 1X5IA 4POZD 1OW0A 3ISYA 2VUKA 2WXMA 1RPQA 3B2UD 4XN2A 3C5SA 3WFCL 3BFWA 5KBMA 3F01A 1TZIA 3VXMB 3P11H 5HYEA 3RIFK 5BV7L 4D0DB 1I8MB 5DFVD 2NY2C 3QYCA 1L7TH 1P5UA 2AF2A 4JRXE 3IWUA 4JY6A 3VUAA 2EE9A 1ROCA 4JKNA 4NPKA 1GY2A 4MXVE 3CXDH 4MD0B 3O9WA 1SY6H 3OMZA 4HLZH 1A14L 1BJMA 4CC4C 1ZHNA 5AW6B 4GRLD 4MJIB 1QRNA 3BAJA 3CH1A 4LSVL 5IQLA 3GXFA 3A6CH 1R3LB 4KMTL 4DP6X 2BSSB 1TFHA 2C3HA 5KJ7E 1EHNA 1RMFH 4P5TB 4F5CA 1LD9B 2BVTA 1A4BA 1G1OA 3DX0A 3TXAA 4Z78A 3FFCD 1NL0L 1AXIB 4H5SA 4BSVB 4ZQTA 1NZRA 1NEZG 1X5YA 4O02H 1MDTA 5CXPA 2R27A 1UH2A 5E94A 3V5KB 2WYIA 1I8KB 2VC2B 4IBZA 4N22A 1RY7B 3GHEH 3Q9PA 1A6ZB 5DWUH 3VDCA 4E9LA 1CXHA 4M1GL 4NP4L 2YXFA 4NM8L 1YSOA 5HGBB 3LY6A 1SXNA 1B4TA 3N0PB 4HZLB 5LAXA 4Z7OE 5IK3B 4J4PC 4D9RD 4U2YA 2CKBH 4FP8L 2OTUA 4RMVA 3CXHJ 3AXLA 1LM8V 3C8KB 4P23C 3PL6C 2YLHA 5EC2A 3L4WA 2NX5B 1YNTB 3ETBF 4X6DE 5FM5O 3LTVA 4EZKA 1NGWB 4BK4A 2P28B 1A3RL 4HWNA 2N7SA 2PO6A 4QOKB 1AQHA 3CTTA 4BCZA 2ZWYA 4JCWA 4AYGA 5E8NA 5KSBF 1M2VB 5D71L 1AQDB 2O30A 3O2VL 4G2AA 5KN5B 2V2TA 5BUPA 3GXNA 4A55A 2YD4A 5B39G 2QGBA 4UT6L 3K6NA 1N5YH 1P5VA 5IHZA 1VHPA 4DPCX 1J9CT 2JKNA 4UQ3A 5HDBF 4P9HH 4GQRA 2ED9A 3C08L 1QFUL 5TDPB 1H6UA 4QKTA 3BGMA 2YQBA 4NKDA 1PLGH 4N0YL 5EIIA 3O4LA 3PDOB 2MCG1 4HISA 4DOHE 5HYJE 4LAJH 5BPPA 2NT1A 5IB2A 1E4KA 1S9XB 5CSGA 5D7JB 4F8OA 3FT3B 1QSED 4J1UA 3LZLA 2W65A 5DZ9A 1EMTH 4JFFB 4KFZC 3CZLA 4DQOH 3CAFA 5B39A 1O6TA 3MLRL 5CBEB 2EVIA 4OZGE 2ZAHA 5J9PB 4HU2A 3OAZH 3MUGA 12E8L 1BQHA 3FQRA 1DP0A 4X80L 4E5XG 1RSFA 5JW3L 5T3XE 4HX1B 1CB4A 1UEMA 1XGTA 3ME0A 4HUKB 2PWEA 3BH9A 3BLPX 4N20A 3T0BA 1ZK5A 1EGJH 4PWIA 4XBEL 1CD8A 2XV3A 3SZ6A 4BRVA 3LN4B 3NFNB 3AW5A 3FU3A 5KSUB 3V0FA 3U82B 5G4NA 2WQUA 4HPYL 1MVYA 1L0PA 4F24A 2YR3A 1J1OL 1P6WA 2G60L 4FERA 2YWZA 5GISL 3KVDD 2WLMA 4X4ME 1R6VA 4X7SL 2RJMA 2WVSA 3TGXA 5JOEA 3MA7B 3IN0A 3ZDZF 4Z3JA 3FCSB 4LSTH 4NSKA 3CG8A 3KYKH 4ZW7A 2DWXA 5DJ6A 4RFOH 2VB5A 4JFDE 2OSWA 4HXAL 2BVOB 2P52A 3HC2A 3V9FA 1ZT7A 4YXHH 5A3ID 4I9XA 2PTTB 3EHBC 3OPUA 4XXCC 5I1DA 2DQUH 2VDQL 7FABL 2AJUH 2RFXA 4ZUSB 1S7RB 2NSMA 2VXSL 3BVVA 2EH7H 3HC3H 1U8OA 5I6KA 2Y6TE 2H3NB 2IF7A 2JTDA 1DBKH 3COOA 3JWNH 2FX9H 4FABL 3PWLB 1CR9H 3C6SA 4U6HA 3Q3GA 2UZIL 4OF3A 1INDH 4MMZA 4XCCH 5IEHB 1YVLA 2HRLA 3C5JA 2X38A 2OXHB 3H42L 2V17H 1DJZA 4K9EH 1PPIA 4PJ9D 3TT1L 2DQTH 3L4XA 5DJ8A 4NDMB 2Q9OA 4UOW0 3SQBB 1B0GA 3A3YB 3IJYB 2E56A 3GSNH 1G4MA 4ZOCA 3BVNB 1JDAA 2HUHA 2ATPB 5JW4N 5FHAH 1MQKH 2YA2A 3TPUA 1CT8A 2GUYA 3HA0A 3UERA 3UJIH 1KFAL 4HUXA 5TGBB 3T3PB 4Y88A 5LGJB 2P5EE 4O51A 4OJDH 1HAUA 3D4CA 5E8OB 5C6TL 5F7AA 3T5WA 3EJYC 2ZOUA 1F0LA 1KYFA 2XTLA 2XZAL 5D7EA 3ZT7A 2Q76A 2YEQA 4W4OC 2GFBA 3AVEA 3Q1SH 4LLQB 1N10A 4CSSA 5A43C 3ULSA 5I18L 1MOEA 3FCTB 3QVAA 1JGUH 4JZJB 1KCSL 1QA9A 5JHBA 3NCJL 3C60D 1N2RA 2QADD 2N56A 2R0LH 1J8HA 3C75A 3I75B 5GSRB 5IBTL 1I85C 2APFA 1K3ZA 2DMKA 2FBOJ 4WWID 4GS7C 3V6ZB 4HXBL 5E2WH 1I85A 4FFZA 1YYML 3EJRA 2W59A 4K0OA 4TF4A 1JI2A 2XWBB 4UMGA 2XX0A 2Z93A 1G7QA 4AZUA 2I5YL 3PPEA 4WFHD 3VFMA 4FNSA 4KK5D 3GXUB 4FI6A 4OFKA 5D1QB 1NUGA 3ESVF 1AR1C 2CK0L 3EJSA 1FQ9C 1Q1JL 4LMQE 1W72L 2A3TA 1JZHA 2J8UA 2IV9A 1BX2B 3KH4A 4WTZA 2C1OB 4LLAA 4FLSA 1IEAB 1G9NC 4NGHL 1F86A 2MKLC 2CA4A 2B3RA 2X70A 4FI7A 1SYSB 1IKFL 1UEYA 3S88L 1JRHI 1Z3GL 4PJXA 2ZD0A 4PREA 5FW8A 4Y2NA 5DFAA 3S8WA 4G5ZH 4YVNA 4Z0XA 3FFDB 4UT7H 3EH3B 1NFIB 2ETWA 3FHEA 1KGCD 5C0ND 5J3HC 3V5DB 4PSPA 1Q38A 1RZ8A 5J06A 1PZBA 3LH8A 1P7QD 1SHXA 5ITBH 1FC1A 4UBDC 4PRPE 5GGRY 1G5GA 1NM4A 2WGXA 4HAKA 1QFWM 3X1NA 5FA3B 3HI5H 1IT9H 1RD6A 3MGTA 4QMEA 2VL5A 3S5LA 1E2ZA 4QDGA 1YJDC 5F6HI 4OLVH 1QBAA 5ADOL 1UWGL 2OK0L 3T1FA 3MU3A 4FFWD 1MCKA 4JRLA 4PY7B 3QIUB 3D8MA 2X4QB 4YGAB 4JB9L 1KUMA 3OGOE 3EYOA 4FXKB 3WOVA 2YC1A 3A67H 1RPUA 2XWZA 2YRLA 5FB8A 1OF2B 5FS5A 3I9IA 4NQEA 3DWTA 2IV8A 1HSBB 3U79A 2IG2L 1DUZA 2O26U 5C0BD 5I9QB 1YUKB 4OUUA 2XLLA 4D9RE 4F9PA 2W60A 4LBAA 2NXZC 1OPGH 5F93C 2QVTA 4DGIH 5DVPA 3GJEA 5DVNA 3DK0A 1N4XH 3FOMB 4ATTA 3W38A 5DD5H 4ZFZB 4ZFFA 1OAJA 3D39D 4K15A 5E00A 4OGYL 5GGQH 4A2HA 4MB3A 3S97C 6PAZA 2OMZA 4M1DL 5L7XL 2CNZA 3MBEB 4LVNC 2DYPD 4U1IA 4GW1B 5D4HA 1F3RB 4E0RA 4Z7WF 4A04A 1S9KC 5D6DA 2ZUWA 4QRRA 5ICXA 1IGJA 3QQ4B 4IRJD 1XH2A 2FX8L 5T1LD 4KRPB 4NKMA 1T7XA 3AZUA 3BLBA 4J6RL 2YRPA 1HXYB 1OP5K 1GJIA 4LCCA 2CLRA 1NAMA 3QQ9C 1HILA 3FYIB 4Z7WA 5HYSB 5C0BE 1R3LA 1YAZA 2CJTA 2GK0B 3UTOA 1I1FB 1B0WA 4NCC2 3U7AA 2PW2A 1LO5B 2JB6B 4HEMA 4M29A 3RVTC 1N0LA 3FJTA 2ARJB 2J5WA 3KR3L 4HIEB 3ZSSA 4NNXA 35C8L 2O5XL 3GXPA 4ZUVB 4K71C 1L7TL 4GLRI 3MCYA 3FU6A 5K5YA 5AB0A 5CP3A 4N8PA 4LXFA 1T1XB 1SY6L 4OLZH 4LCYA 2VR5A 3MJ7B 3QPXL 6CGTA 3JT0A 3T0WA 5AOLA 4ABUA 4KC3B 3NPSB 4G9FB 3ZUNC 3O6MH 4Y2LA 5IBUG 2EDJA 3L3HB 1QTPA 4QXUH 4ELDA 5TF1H 1MPAL 1AXTH 4JPWL 5K1NA 4GKNB 2OYPA 1U8PB 3W82A 3EOTL 2ZOWA 4Y19A 5EG6C 3IYLW 3L9RB 3QW9A 1LO0H 4FLQA 4LLYA 3BJLA 5B8CB 5KN5A 3IU4L 1U8CA 5C0FA 4IU3A 5IJVA 3TWYA 5ICYA 5IVXE 4DO6A 3O3UN 1QPPA 4W9LC 5CR1A 3WL9A 1SLXA 1M7DB 4H0HB 1XFPA 2NY6B 4DP7X 3RWCB 3F3HA 3FF7A 5IHUL 2WVVA 5DJYB 2XQBH 1DN0B 4UAOB 5I0ZA 5JHDD 5KVEE 2C3GA 3MKGA 1OCWL 4F9PC 1QUNB 4XB3A 3WV0A 5I19L 3NTCL 3GSXA 4UAOC 3WE6B 2VZTA 5JORA 3MRRB 3M6DA 1P6FA 3WCYA 5C09D 1U4FA 3GBNH 2YEVB 3SE8L 1J5DA 5DURD 2QBWA 3A4EA 4NZ8A 3QZWB 4K8RC 5DHYB 5E8PA 5EOCH 5BZDA 1RJZA 4X9BA 4YSOA 5AW8B 4LASL 3RI5F 3LKSB 3QCVL 2E59A 4WWKD 1OE1A 1HHJA 1LK3L 3RWDA 3MACH 1T21A 4QAMB 3UJTH 1IFHH 4BK5C 5DO2D 4XN7A 3FQTA 2D0FA 2Y06H 3OQRA 5HPOA 2W9EH 3ZQ9A 3QB7C 3QXWA 3VFVB 4RESB 2MOGA 4PJBB 3QNYA 4R4FL 1IE4A 3A21A 2JKXA 3F7PC 2MCMA 4ENEC 1OSZA 5AVTB 1GY1A 4YHKH 1TDQA 4OQTA 1WFMA 3BKML 5JXAH 3QDGD 2ICEC 1OANA 2FWOA 3RHWF 4P9HC 1MWAA 1VFOA 1ZS2A 5D6DC 2C9RA 2G5RA 4GKZA 3W9EB 5IESH 3PAUA 1JPGA 2D7QA 3BUTA 1BVLA 3N41B 4LSRH 3SYAA 3QDGE 4L9DA 5IW1B 3CVHL 1ZT1A 1JF5A 3H54A 1TTUA 4QRTB 5EU6B 2V5YA 1MFAH 2ZF9A 4Z0BH 1EFXA 5CBAA 4NQDE 3GLEA 2UXFA 3DXAE 1NGXA 2WNKA 3GUTB 2JJTC 1KT2B 4LSQL 3MROB 2R9HC 2H0EA 5GHWL 3VI4A 3WIIL 2V4LA 3IGUA 2VM4A 1KTCA 1J9SA 2V5MA 3MRLA 4KJYB 3RPKA 3VI3A 4LOUC 1P5UB 4JY6B 1KJ2B 1WYJA 3BQUC 1J8RA 3IDMA 5IZ7A 2X10A 1MZZA 2DQCL 5DC9B 5FYJL 4AGNA 4YHMH 3M45A 1WRFA 2J12B 3NZUA 3RJOA 1DVFA 5AVXB 1QPXA 3AMLA 2PO6D 1ZJBA 1H3TA 2XETA 4ZQKB 4BUQA 1YNLH 4ODXB 4B97A 1P2CB 4JMXA 3MDJA 4YBQD 4K5MA 4M4PA 1UJ3A 1T89C 2WXRA 1QFWL 3FT0A 4KJPC 4Z78B 3MRIA 4Y16A 4CVXA 1D9KD 3NSYA 3LEYL 5FO2A 4HWBH 5D7IF 1I3GH 3E8UL 4O00A 4Y4FD 1ITCA 2VC2H 5L4MA 4PIRF 2AW2A 1FG2A 1BG9A 4IJ3B 2BP3A 2ZP0T 1XXFC 2ICEA 1CDUA 2XICA 3SDXE 2RTTA 4N4YB 4ONFL 3CXDL 3RTQC 3ZGHA 4TNVF 3OKYA 4FLOA 2OMYA 4M6OL 3VW3L 2Q0ZX 4MZ2A 4GBXB 3UEQA 1LNUA 5E6ZA 1MCRA 3OKKA 2B0SL 5D2NA 1QBMH 5EBLB 4Q9QL 3RX8A 4LLDA 1OARL 4Z23A 2NR6C 4PJ8D 5DEGB 5LN4A 3VGBA 1EFQA 3V6ZA 1L3WA 4Z7IA 3TJHC 2V9QA 4H8WL 2XWCA 5KJRH 1TEGA 2H45A 2I60L 1E7VA 1BEYL 2NY5L 1ZVYA 3QWRD 4FJ6A 4U05A 5L8KB 4MJ5A 5DUJA 2WWKT 2LU3A 3UJIL 2UZXA 4DKTA 3SE9H 4HD5A 3NPZB 1EEYA 4PRHD 2F61A 1HE8A 1VERA 2APBA 2WBJA 5EOTA 2XQYA 5FM8A 3N1QC 1KBPA 1M2VA 4OLEA 2SEBA 2WP3O 1PLAA 3MR9B 3OMIB 4WEBH 4JG0H 1DQJA 3VGAB 3DLQR 3HC0B 4BFJA 2NLJA 3VXQA 5L0QB 2X9XA 3S7GA 5EWIL 2CKBL 2JE8A 4FP8H 2CWRA 5F44A 3EH5B 4OGXL 1KLFB 1J7VR 1F6AA 1MUJB 3ULVC 4EN3D 1ZA6B 3AQDA 5BRZE 3ZZ1A 4P57B 2YJQA 1EJFA 3UO8B 4KUCD 5IB2B 2DH3A 1AS6A 3RDTB 1R3JB 2XA8H 2YEZB 3MRHA 4JHWL 2P7TB 2VDOL 1JNHB 4HIXL 2OR7A 1GHFL 2A6IA 4JG1H 2OMXA 3O0LA 2FSEB 1WC7A 4N8VA 1AR1B 3O2VH 2XWRA 4PJIA 4G83A 1U3ZA 4EVNB 4NKOB 2CCWA 2EP6A 3V8CA 1NGPH 1AG0A 4MCZA 3X1FA 2NMSA 5CJQL 5AALA 3UBXB 3U4AA 4YDIL 1XQ4A 5DTFA 4TN9A 1Z3GH 4OLWL 4FNQA 2LU4A 1ZE3C 2X4QA 3ZVVA 3R18A 1HQ4A 4QF1A 4UT7L 3NJNA 5TDOA 5JQIB 4XT1C 2BHFA 4FQHA 4H7VA 5DHMC 4OM1H 1LJMA 2WYHA 4ZFOB 5DI8B 5E9DE 4PLKD 5FGCB 2FEEL 2JI1A 4M1CD 2PCFB 4MAYA 1RVFL 3GK8H 3GLDA 1WZAA 4ANWA 4FRWA 5CS7A 1IGMH 1OGAB 2GEEA 2FGZA 2ZZUT 1DBML 1T66D 4ODVH 1W91A 3RZCB 4JCMA 3LKPA 4NQSB 1RZPA 2MQ0A 2YXVA 2MFNA 2VXUH 5E9DB 3KXFA 4MCMA 3FUFA 4LMQI 1TQCC 1QWHA 2K7QA 4HIPA 3VFWA 1U8LB 4V1DD 5I6NA 4NKMB 3SDCB 2YA0A 2AJ3B 3NA9H 4DKDC 1WAAF 5F7DB 2NUTA 3ZDZB 5KANG 2BSED 5C6WH 2W8CA 2ZG1A 3JVGA 2F8IA 5C97A 5I5MA 3TCXA 3L45A 1ZLSH 3RFZC 1CI5A 1AD0B 2YMXH 3EO9H 3O3EA 3EFDH 5AYTA 5E51A 3L4TA 2AEQL 4LSTL 1NPNA 4Y1AD 5C08B 5JXED 2Q7YB 5I6XC 1WJ3A 2WMPB 4ZW5A 4P5KB 5CWSA 4B9GA 3EBAA 4PJCE 1A6TB 1T4KA 2PMZA 3ARFD 1N0LB 1YEEL 3EHBB 2ITEA 3O6KH 4FZEH 2B1AL 2ODIA 3VXME 3LEXB 4U1NA 2R69L 1OTUC 2DJSA 1W15A 2EYSA 2HH0L 2X4TB 3G6JF 7FABH 3TPUB 4WUUD 5AVRB 5GGSY 3EYFB 5I6MA 5EBWB 2LOEA 3VXSB 5J6HA 1QABA 3MLTB 1DBKL 2EKJA 1MF2H 1ODAA 2D0HA 2ZKYA 1ZV9A 1EDQA 4AZ8B 5EORL 2ZP9A 1XZ0A 4WFHE 3S3DB 4BFRA 2G0LA 1JGEA 4JO1H 4JO4H 2UVEA 4K3DH 1RIVL 5L2JB 4HCFA 4K9EL 5G4OA 4IBLT 3GSVB 4N2AA 3L3HA 5DHEA 1OAZL 3FFCA 3BVWA 2Q86B 4L1DA 3TBYA 2TAAA 4G80A 1JYXA 1ESOA 5HHOB 1MZYA 2YWYA 3WXVH 4Y5YC 1U8PA 3MRCA 5L88H 5F9DC 3P3SA 4Q6IA 43CAB 2Y5EA 2CO3A 1DQDL 1KJ2H 2PW1B 4HH8A 4NQCE 4QXGH 5EEXA 1WEJH 5I8KH 1ZHKB 1OOWA 2GK2A 2HFTA 3WTSA 5IJDC 3M1BA 1S9YA 4HK3N 1Y6MR 4QXWA 3FRUB 4DUWA 5BJTB 1IEAA 2VH5H 3NCCB 4WTXA 5F21B 3BMWA 3QORA 4FQXB 2BDNH 3VW3H 3G08B 1I9JL 1ZIBA 2PTVA 1L9MA 3NEOA 3RI5K 5E95B 2VDPL 4QXUL 4GINA 1RZKC 1LO4H 3CVCA 4A7QA 3EOBA 3MVSA 3MRPA 3GSXB 4QXVA 4RMSA 2XWEA 3GTVA 4Y5XA 5IHBA 5AZ2H 2HVJA 3EO0A 1JMXA 2CHDA 2DF3A 3FRPG 1CG9B 1T04A 2G0KA 3NIDE 3SBWA 2A6JB 1CI3M 3EHBD 2FH8A 2LE9A 3AS0A 5CSBA 2YARA 5GZOC 1KXVC 5L2KE 1DBAH 1FNLA 1ZS8B 1WIPA 2LVEA 2B15A 3H1ZA 1XWVA 2YO3A 3HE6A 5DU7A 4ZMVA 4KZCA 4PH8A 1FF5A 5F7UA 2VDNB 4O5LH 4PJAA 5K69A 2WSDA 3WI9A 3RE0A 2X6VA 2XQBL 2P5EA 1X5MA 1KBGL 3VRIB 3QIUA 4G8EB 3BAYA 4Y5VB 1HXKA 1JJUA 2BWQA 1CBJA 3JWOC 1OT1A 1RZJH 3EH1A 2N59A 4HJTA 3UZVB 1HHGA 5DRXB 1N12A 3ARXA 2EABA 3U9PH 3WKML 1MWAB 2OSLA 1DSWA 5I8OH 1MQ8A 2VSKB 3RVUC 1IBYA 3LHAA 3QZOA 4G8IA 4YDNA 5AB9A 4KAQL 2BMKB 4I8DA 4ANKA 2NZ1A 5E99L 2L7EA 2WWKO 5ALCL 3DSNA 3RBGA 3U0PB 4N1HB 5BOPA 3FBQA 2PWGA 2RHEA 3A5VA 2IPTH 1U30A 1GZHC 4L5FH 4Z7UE 2VAJA 3BC9A 1E4HA 4AW7A 1NGZB 1MH5B 3CX5J 4OCWH 5IROD 3QXUA 5ETUB 1S3KL 2JIXB 4HQQH 4H8PA 5JXEA 1ZLEA 4JKMA 4FG6C 1OZTG 4DW2L 4XPGL 4G11A 5HDQH 3BISA 4J28A 3ULUC 5E2JA 1R3IH 2VITB 2O1AA 3RWGA 1KF9B 2CLRB 3WFDL 4IGBC 2XOTA 3BSZH 3IT8D 5DQJB 1TTGA 3HOGA 4LSRL 3SD2A 3JTBA 1CFQA 2BSTB 3IFOB 3CNKA 1NGWA 2IH9A 3WEAA 4BQ6A 2AK4D 5TE4L 4NQXA 4NM4H 5IR1A 1YHPA 3GLZA 3GRBA 1CGSH 1I8IA 4JRWA 4OGYH 4WRLA 2J21A 4WW2C 5GGQL 1LO5A 2JB6A 4AGMA 5SWZA 5IB4B 3O9WB 4E9SA 5LBSH 2G3ZA 3QDMB 1MY5A 4XRCB 1NFAA 3BAIA 3C2AH 1QI4A 2FX8H 1LWRA 3KPRE 2R29A 1RK1B 2XTJC 5ISZA 2Q3ZA 2W81C 5CU5A 3K81A 5DJ0A 3D0VB 1GAFL 3P0VH 4NZTH 2WV3A 2BRRL 4GMSH 4RA3A 1CFTA 2YD6A 1JHLL 3CSGA 2XN9A 5CEXB 4E9YA 3WN6A 1MCQA 5C2BH 4OCRH 4P2RD 5DS1A 2AZUA 3ZR6A 1T1WB 1KPUB 2OQJB 1CICB 1WZLA 1JL8A 3N40F 4HJSA 3VWKB 1AZUA 1EV2E 1D5MB 4FNUA 4DESA 3WIAA 3D3VD 3B9KD 4L3EB 4MNQD 3BH8B 4JFFA 2Z0UA 1TTCA 4JLRB 2HG0A 1CE6B 5GGSB 3C5ZB 3LPOA 3PGCA 4YHLH 1I8UA 3KYMB 1HIML 5HYJA 1U8NA 1AGEB 1G6RB 1P1VA 1FFRA 3W9DA 7CGTA 1FVDB 1JZDC 2YHGA 3KXFE 4HEME 1F4YH 3CFEA 3GEFA 1E5AA 4G5AA 3RL1A 4JJ5B 2WBJB 2VDNH 1MFDH 3QEUA 1D2PA 3E38A 1CWVA 2FL5B 1AFVL 4JFYA 3H6AA 3OKLA 1WVZA 2DL2A 5KSVB 3ARRA 2UYLB 3GMOA 4OLZL 1VZGA 1AP2B 4K8RL 5CJOL 2V2XB 1KY7A 5AG8A 5B1CA 3U48A 4IOFC 2A77L 2QQNH 2V3EA 4ORGA 4KH2A 3W39B 4F9LC 5I1LB 1JWMA 4D2NA 5BV7C 3ZL4H 2VXVH 1WAAA 2BCKA 3FH5A 3PDDA 4KY2A 4ICXA 5INDA 3VG0H 3PJNA 4AYMC 3HJEA 1UA6H 4XNMB 1IC4L 3QFJA 4PJDF 4W9KC 3SJVA 3VRJA 3Q7JA 4NRZA 1VKXB 4OF8A 4DOHB 2CHZA 5GGTL 2HPOA 4JMNA 4M5YL 5F6IB 4KUZH 4AYDC 2RAMA 1H9VA 1KJMB 1F4WL 1A0QH 4HCRL 2Z3FA 3R4DA 2W0FB 2KZBA 3OR6A 2ZCZA 1JV5B 1TPXB 3KWXA 1XX9C 1AGDA 3L3JA 5FLUA 5JW4R 2VDML 4V33A 1BXUA 5FOBB 2G9KA 4JQXA 3D9AL 4RAUB 1HSAB 3D85A 5EN2A 4PG9A 3QQ9D 5K1VA 1NDGA 1NIDA 4L37A 1ZDQA 5JW4Q 3PWLA 3DIVA 7TAAA 5FR3A 4YXLH 2ZKXA 1QSEA 3OSVA 3TEXA 1S9VA 1KCWA 4GG6B 2BSRB 1KXHA 4PJBE 4HUUB 4GRWH 3L1GA 4NZRL 1QSZA 1FYTB 2YBRB 3O3DA 1YQVH 4YPGB 1QRNB 2V2WA 2K0RA 4E41E 1UH4A 3BEVA 2KLRA 2VDOH 3LS5L 2P8LB 2DLTA 5BQ7A 5C9JB 5DR5H 3G04B 4PV8B 2UZPA 5I6LA 4HS3B 5I1JH 1CO1A 4NC1E 4XC3H 1TVHB 4EQ3A 1XSIA 2JCWA 2P80A 5KSUA 5DD3H 3V4PL 5TFSL 1BFOA 3SKMA 2WQWA 1MFCL 5LXGH 2Q10A 3MZTA 2GSIA 2N4IA 3MV8E 4BZ1H 2B08A 2PF6A 4GAYA 4J7RA 5DRZA 3QWOB 1KNOB 4I0CC 2ZOLB 2G75A 5EUKB 3GLAA 4L4VE 1NCWH 1X7TA 2X88A 4XPTL 3V6OC 4Q14A 2NUPA 4PV1C 5AZEH 3WMSA 1MLCA 2ZJSH 3JTSB 3PIQB 4WGWB 2CU9A 2YRZA 1I9IH 1OP3K 4E41A 5HI3C 4WUUE 2XWTB 3N40P 4C59B 1IIIA 3U4EB 1X7QB 3O2WL 1TZAA 1IGCH 1OY3B 2P9RA 2X0UA 4RZCA 1YPZF 4ZMLA 3SDYH 1FGVH 4L4VB 4LIQL 1MY7A 1FRGH 4IHOA 2VE6B 3LH2H 4PVNA 1CE1L 3GZKA 3QULB 4OFIA 5D1QA 3GXIA 2GG1A 3VFUB 4EUPA 3Q05A 2EIDA 4JRXD 2H47C 2D4FA 2ZYIA 5FFGA 1P5VB 2Z91B 5IHZB 4WV1C 2ALWA 3HMWH 4WVRA 5DC0A 1JZ6A 1ZGLB 5J6HB 1C7TA 3IBEA 3BRFA 4ABWA 5K9OB 5T1LA 5CEYB 3E7JA 4APQC 3KW8A 1UM5L 3RU8L 4I85A 2ZCKH 4YAQB 1ZXKA 1YEWA 2NY6D 4G6AC 5ANME 2AEQH 2DYSB 1Q8MA 5CJXC 4E42B 1GKOA 3BE1L 3EYSL 3ETBJ 3N85L 3SOBL 1SJHB 3ZR5A 3OAUH 1WLHA 5DRWB 5LQBL 2QR0A 1A5FL 4L4TB 4O51B 1KIRA 5D7IB 3RRQA 5E8OA 4HCIA 4Q7DA 5SX4H 4O2FB 1TITA 4KPHH 2DLGA 1P0SE 3T04D 1NGQH 2CSPA 1UD2A 4PP1D 2K1MA 1D7BA 5FA3A 1SXBA 4AL8L 3MGTB 3VGHA 2FT6A 1NCAL 2FT7A 4MMZC 3LIZH 1J87A 4ZMNA 1PZ2A 2VC2L 2QELA 3FAXA 5IVNA 2A6KA 1F4XH 3B7RL 5D4QA 1XSKA 4PJCB 3D08A 4NHCH 3AXLB 3CLEH 1FNGA 1MJJA 2IWEA 3C8KA 2E9BA 4OFYD 2Y7NA 1A6AA 1PEWA 3SGJC 4LVHC 1CTMA 1S5IH 5CP7B 2VERN 5C0JB 5F9AC 1H19A 4HV8A 1UQSA 2CQVA 3WNMA 4XOCA 4NO5B 4YHYB 3K1DA 2K6WA 3S4SB 3RDJA 4KVPA 2ZCLL 3B9KB 4MNQB 4UIKL 4M7ZB 2GT9A 3VXOB 1P7QA 2PP9A 4ZMZA 3MOBL 5IQ7L 2A6JA 4KH9A 4M6AA 4LCWD 2DMGA 3MCKB 2IQ9H 4TQEL 1H15A 4Q0XH 3ROLA 3AS2A 3I2CH 3DX1A 3VGGA 4QY8B 4PMFA 3N1FC 2YSTA 2Q7NA 2RFXB 4LDEB 4QIRA 4ZUSA 2DM3A 1QI3A 1IAKB 3G5VB 2DEWX 2QMJA 1URIA 5I1HL 3ARED 3B5GA 3AT9A 2VDKH 3HHSA 4FQLL<