1BVKA

Humanized anti-lysozyme fv complexed with lysozyme
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASGNIHNYLAWYQQKPGKAPKLLIYYTTTLADGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQHFWSTPRTFGQGTKVEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HULYS11
publication title Conformational correction mechanisms aiding antigen recognition by a humanized antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (humanized antibody/hydrolase)
total genus 24
structure length 108
sequence length 108
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bvkA00
5ACZB 3H9ZA 4J3UA 1UEMA 2YUWA 3CU7A 1IMHC 3L3JB 4WFFE 3TV3L 4OIIH 4M1DH 3H7LA 2VLRE 4PB0L 2NY6B 1E27A 5HVHC 1D5IH 1WTGT 2CD0A 4Z7WF 1C16A 3GIZL 2H2SD 1FNGB 2YN3A 1ORQB 3CFKB 3QIBB 4JKLA 4KZDL 3RVUC 4OIAA 3QIWD 2YBRB 3LN5A 3NCCB 2JIXB 5DEGA 2LFGA 2VDNH 1HH9A 1KN4L 4GRWE 5HVHB 2VSCA 1IKFL 2F58L 4X7FC 3NZ8B 3IDUA 5D2LF 5SWSA 1MRFH 2FHCA 3HZYA 1U6AL 2VITA 5BJTB 2PYED 3X14B 4GSDL 4WW1B 4Y5YC 2FATH 5F1NA 4JQIL 4KHXL 1T20B 4AEIL 4X8XA 4WEBL 2B1AH 4LLUA 4NCDA 1IKNA 3D0VA 5D7SH 1UXSA 3QUKB 2O5YL 4F37F 2FLRT 1YY9C 1DQML 3PWPE 4GMSH 4Y5YB 1MIEL 3ZTJH 1A7PL 4HDIB 4P23A 5EUOE 3OJ2C 3FRUB 1KG0A 2CO7B 5MEQA 5JPMA 3F5WB 3ULUF 1ZLWH 1CFVL 4F8QA 4WJ5B 3RWIB 3DMMD 1U8MB 4JFDA 5D70H 3ULSB 5HDQH 5T33L 5GXBB 4QHKJ 4RWYH 3ZE1E 3OB0K 1Y0LB 1MELA 4KTYA 5DJ8B 3MRBA 1FFNB 4Y2DA 1TZHB 3MGAA 1IAOB 2A73B 5EU5A 4H5SA 3T65B 1F13A 2C3VB 4DKFH 3AGVA 5TQ2L 1CGWA 4P2QA 5TFSH 1AJ7L 2BNQA 3U4EA 2H1PH 2IH3B 4G7YL 2ITDB 4PRAA 1G9EA 4LFHG 4S1QH 4A6YH 1XR8A 3H9SD 2R29H 3VH8B 4M7JH 4ODTH 3QRFM 1ZLSL 1AR2A 1X5LA 1HHKA 4L4VA 5H2BA 1I1FA 3D2UB 5IT2H 2DQJL 1JPSL 2W65A 4X5WA 1T7VA 1HZHL 3FAWA 3VXME 5F7WC 2DYPD 1TFHA 3WEXA 4PRBA 5EA0H 3V6OE 4MNGE 3S97C 5HI5C 3PHQB 3RU8H 3AS1A 2HWZH 4XWOD 3NABL 4I4WA 3VG0H 4X6CF 5DYOA 4AQ1B 4ERSH 5IB3A 1QSFD 4C83A 1KEML 3K2UH 4RFOL 4ZSOE 5K59E 4G9FD 3IDNA 4CL7A 5IM7B 5D1XA 3QZWA 4KKBC 1GAFH 3MRGA 2EDBA 4ODUA 4Y1AA 4ZPTB 1W0VA 2AI0H 3QUXA 3B9AA 1K4CA 2AXFB 1FIGH 2VIRA 2I60L 2G5BB 5E6YA 3VD3A 2GFBA 4JVUA 4OLZH 4XAKE 1A4KA 2E3VA 1K2DB 5F21B 2RHEA 4GRWF 1CGSH 4BSWA 3BZ4B 3MXWH 2R0KL 3KPRE 3BZEA 3L5XH 1CU4L 4EXPX 1ZHBB 3INUH 4DKAA 2JLLA 4GRLA 3WIFB 3DROB 3HR5B 5CP3H 3RKDC 3ARDA 3QDMA 1WISA 4TPRH 4GW4B 3WS6A 2DS4A 3MJ9A 2A1WL 4R96B 2ZOKB 1A47A 1G7LB 4MMXC 5C3LD 3CDCA 3IETB 2HFEB 3LB6C 2IG2L 5EORL 2NY7H 5IEHA 4DW2H 1GL4B 3V0VA 8FABB 2CIKB 1K8DB 4N9GB 4WDIB 2OK0H 1UC6A 4L8DA 4U1KA 1HK6A 4HS3A 4IMLB 1GOGA 3BKJH 4NQED 2JTDA 1X5XA 3MRPB 5DGQA 2ZOLB 1TCRA 5IIEA 1MI5D 1F4AA 1RZKL 2AEPL 3RNQA 3VFOB 4EBQL 2FR4B 3O11A 1ZSDA 3KDMB 2F54B 1DZBA 4M3KB 2ZUVA 4L9DA 1J1XH 2ZCLL 3G6JE 4WVRA 1KJ2A 5KJRL 3HPLB 4O2FA 5CKGA 2PYEA 3JXAA 4NHCH 3TZVC 1NGQH 4JAMA 2ZCKL 3BEWA 3L1OH 4HIEA 4JKPH 1HCVA 1A7QH 1QOKA 2GK0B 3EYQD 4XCFL 3KXFE 1Q94B 3HAEA 1Y6MR 3OR7B 4OGZA 4NP4L 1T2QL 2P8PA 4N90D 4GAJL 5ANMA 3TZVB 3TPKA 2IADB 4KKLD 3CC5A 4NQDA 3QDJB 1O7VA 5DDHA 5DWUL 4TTGA 2XFXA 4JLRA 3QXAB 3CMGA 4U7SA 4TN9A 3DMMA 3VDBA 1NC4B 5BV7H 5HHMD 3MLSL 4S1RH 5K59F 4NFDA 2AJ3B 3UJTH 1QFWH 4P2RD 5H8DA 1JHTB 3VDAA 4EN3C 2PKDA 2O61A 4P9MH 5GPRA 4KRLB 1U8LB 2ATPA 4CADB 1LO2L 2N7BA 4N0UB 1U3HD 4JY6A 1Q8MA 1BGXL 4HGMA 5ITBH 2A0LC 3O4LE 2V5TA 2DDQL 4AL8L 2EE2A 4CGTA 4OSUH 4EN3B 2COQA 3GHBH 43C9A 1RAMA 4PBVC 4QF1B 3HI1A 3IU4L 1GGCL 3SGEH 1HI6A 4C56D 2FX8L 2X09A 4Z77A 5EOCH 3NVQA 4ZUVA 1PD6A 5TE7H 2WV3A 4JDVB 4YDKL 2VJXA 1JYXA 5I19H 4L8SC 2X4TB 3QPQD 3OJMB 3V2AR 1JWSB 5HYSB 4UINH 1SEBB 4I9WD 4OZFA 4PJGB 3HC4H 4G8GE 4OQTH 5IFAH 3FO2A 1JPTH 2YD8A 3ZYJA 2R1WB 4QXTA 4HH8A 5I8OL 4CAGA 4CN1A 2X4UA 5EOTB 4KY1L 4L8SB 1ONQA 1CR9L 1DQJB 3MGTA 2YUVA 3OKYA 3MLZH 4G6KL 4R3SA 1INDL 4L3EE 5BOZG 4XBPA 3EZJB 1RVFL 3GMPB 4WFHE 3QQ3B 3BP7A 3TCLB 5IMLA 1YMMB 2R2EA 1E0OB 3G6JF 3GMOB 4PJ5E 5JW4M 3T77A 2R0LL 1MLCB 5E8DH 1BQHA 2O5ZH 4G42A 3ZE0F 4PY7B 5EZLB 2WZPD 1FYHB 2P5EA 4KKAC 3RIAF 5AWNH 4J8RB 5GSRB 4EUPB 1XAUA 2ADJB 1YUHB 4LFHD 3RJDA 3M1BA 5AUMB 1WF5A 3QWRD 1MJ8L 5JXEC 2A6KB 3P0VH 3FRPG 4KKCC 1IFHL 3O9WA 1NCBH 4AIOA 4EDXA 1S7XA 5B21A 1DLFL 3IDIB 5ELIA 1FVEA 1FNHA 4J3TA 3GJEB 5L2KE 1N64L 4F37K 2J4WH 3VGHA 1F6LL 4AQOA 2UVEA 1JNNL 3CZJA 2VXQL 4YFDB 1AQKL 5TGBB 4MDIB 2X6MA 5C08D 1P2CB 3VRIB 4IDJL 5J6GB 1DBKL 1NANI 2E7MA 3MA7A 4R7NA 1BIIA 1OF2A 2EE9A 3X12A 1E6JH 4P9HL 4NQEA 5T1MB 4PJIF 3LRHA 2VDMH 2IH1A 4V1DD 1H8SA 1G7JB 1LO4H 4I0PC 3HZMB 3SDXB 1FJ1A 3E8UL 2QR0B 5DVLA 4IBLT 3RY6A 1NCCH 4NO5B 5I73C 2MHAB 1XGRB 4ZTPH 4N0FA 4ZUWA 3DUHA 1T5XA 3I6GA 2NY5L 2DQTH 1J87A 3SGJA 4ZOCA 3U0WH 3PGDA 5E4IA 3RWDB 3U0TB 1T03L 3WHE0 3BQUC 4HJGA 4I0PB 3HNSH 2PO6C 5EO1A 3Q5TA 1SJXA 2MCPH 2A6JA 4YDJB 4NQXA 1NFDA 3B83A 3MRLB 4NZUH 4HC1H 5I73B 3IAGC 4TTDC 5B22A 5JORA 5GIRA 1IARB 1YN6A 4DZ8A 4RCAA 5DD3H 3QNZB 1WGOA 1NLBH 1DUZB 4JANB 3MROB 2XN9E 1GIGL 3BQUB 1FN4B 4RISH 4Z7UA 2PO6B 2AXGB 3D39B 4NDMB 5IFJB 2IBZX 3NCEB 4JN2B 1S7UB 2J8OA 3OHXA 5I6XC 4LASL 4ZOAA 1X44A 3C09C 4NC2B 3BYTA 2VR9A 3SBWC 4P2RA 5CBAA 3ZTNL 2RB8A 3W11C 3LN4A 3RVTD 5SV4A 4F2MB 5CSGA 1QEWB 4JPWL 1Q38A 4M6OH 4EQ2A 3P4LA 5IJVB 1U3HA 3C09B 4J2XA 3O3AB 3F58H 5K9OB 2UWEF 2FGZA 5CP7A 1DL7L 1ETZB 3T3PF 1U2HA 4YO0B 3H9HA 5DEFB 1NSNH 1YY8B 4QKXB 3EFFA 4ZFOB 2DBLL 5KAQF 12E8L 1BQLL 2IAND 3C2AH 1EXUB 3EGSB 3U9UB 4EI6A 4PJXF 1KULA 1QSZA 3WDJA 3MJ7B 4DZBB 3TA3C 2GSIA 2J88H 3JTSB 1YN7B 1YEDB 3TT3H 3C6SB 2IWGA 1AIFA 1DN0A 1HN1A 2R15A 4Z7VB 3ME0A 5DJAA 3PDDA 4RAUA 2X44D 4TVPL 2HTKC 3NN8B 2YD4A 3FO1A 4HXBL 3S96A 2WBJD 3TA3B 5L9DH 2LV4A 4YAQA 5E24E 1EJOH 3H9SB 1RFDH 3QRGL 2FJFB 1LK3H 3SEPA 3SKJL 2ADFL 1S3KH 3UAJD 4TUOA 1DDHA 4M9OA 5FK9B 2BNUB 2Y7QB 1NMBH 2ZUUA 5FHBL 2MWCA 4K94H 4OCYH 2BNRE 2D3VA 3L9RA 3BDXA 3S37H 3WNPA 4U7KA 3S8WA 4ZFZA 5TPWL 3A6CH 4O58L 4XPTL 1P7KA 2GITA 1D6EA 1QSFB 4X6BB 4DK6A 1FNSL 4G9FB 5HVWA 5LCVL 3BD5A 5LBSH 2XKNA 4PJHF 3NACH 4G7VH 3JV5A 1S7QA 2BSED 2FSEB 5FYJD 3GB7B 2VZSA 2B1HH 4QRSA 3CFBB 4PGEA 3BVNA 4YHPB 4YXHH 1BECA 1BFVH 4LU5H 1JYNA 1NH6A 4XMPH 5C08A 4Y5VA 3DJ9A 3WIIH 3P73A 2VNCA 5EZOL 1IAMA 2IF7A 4PLJD 5DJ0A 3FCTA 4WO4D 2WLZA 4V1DA 1A1OB 3PWVB 1CK0L 2F19H 4MD0A 4LARH 3NPZB 2NYYD 4L1DA 5DRZB 3TVMA 5EO9B 2F8OA 1KN2L 1R24B 3JWNC 4RRPA 1KXVC 3DX9A 3WHE1 3W5NA 3FN9A 5DJ2A 3WFZA 4HCRL 1MCSA 3HB3D 3QQ9C 3QFDA 4H8WC 4DUWA 1INQA 5JOFB 3CXDL 3PNWA 2ZP0T 5A3ID 2D7OA 4JKMA 3BH9B 3JWDH 3WUWB 1IGML 1AY1L 3JWOH 1DQQA 5FUZL 2F53B 3N1PC 1MY7A 1A5FL 3C8KB 5C0IB 4ORZC 1ZANL 4P5KB 3IDJB 2VLLB 2XWJB 3D3VE 1KPUA 4XBEH 1HHJB 3QEUB 2C7UA 1PVHA 1WITA 4NKOA 5AAMA 1W72L 3MRCA 5F6HI 1I9EA 1TVBB 3BN9C 3DUUA 5EIVA 4ORGB 3EOTH 3HUJB 3UO1H 4ZMAT 2XOTA 4JJHA 1FVDA 5DRNA 4ODXA 1ADQH 2X7LB 3BEVA 4UTBL 5C0GB 4AMKL 1JGUL 5MERA 3F7YB 2L7UA 1BM3L 4HMCA 4R0LA 2DQFB 3MXVL 3RL2A 4Z9KB 5I0ZA 5K9KA 1FZMA 5IROA 4HQQH 5F7EH 4OLEA 5B8CC 4HD9A 1FYTB 1RZ7L 4ZUTB 1CD8A 3BW9A 4DJMA 5A1AA 2EDQA 5DUPL 3HG1D 4YDLB 3KYAA 4FZ8H 3WFDL 1PLGL 4YZFF 1H3VA 5EC1A 2MCG1 4Q9CA 1ZA3A 4JCMA 3RIAK 4KUCF 5HHMB 5KW9H 5CJXA 4M7KL 2R56L 5B8CB 3C5ZD 5DI8A 3PIQA 3KNBA 2BVEA 5JW5B 2AVGA 1NCDL 1UB5A 1AHWC 3BPOC 4MQ7A 1G9NC 4JQVC 3HNVH 4EVNB 4XRCB 5HHQA 2XNAA 2WBJA 3FJTA 3RAJL 1X4XA 2F15A 3LV3A 1AR1C 4AH2A 1WUNT 3HPJB 4HK0B 3GZKA 3M17A 1AHWB 3BPOB 3TO4D 4JO4L 5ADOL 4NBXB 4E5XA 4XI5C 2JCCB 2PCPB 4P2OD 3FQNB 4PJFA 2F5AL 4PUBL 2FX7H 2DJUA 5D71H 1H3UA 4JZNB 1KTLA 4WHYH 3TBWB 5IBLD 2HFFB 1DCLA 3VE0A 4F58H 3VXPB 2UYLA 4UT9H 5D4QA 3V52H 1K8IA 3FO0H 3UX9B 1N0XH 3BJLA 1X3DA 5KOMC 3RA7L 4IRSC 2YOCA 3ZO0A 3VXNB 2VKXA 3QQ4B 1UFUA 3R06B 2BDNL 3B9KA 4NRXA 4HUVA 4LCIH 3PP3H 3ZDXE 4BZYA 5E08H 2XRAL 2KQNA 1VKXA 3ROLB 4Z5RA 3RDTC 5IV2B 2MQ3A 4OUOA 4IRSB 4UT6H 1MFAH 4XMLH 2DI7A 1BWMA 5HGGS 2EH8L 4MQSB 3Q6GL 3VFNA 3L3KA 2DQEL 3PV6B 1KC5H 5I1HL 4HGKC 5JZ7D 5MEOB 1FV1B 1BJ1H 2FD6L 3ZYZA 3N0PB 4HKZA 1QBMH 4X6DA 1NKOA 3MV7D 3QPXL 3CCHB 1FZKA 4KMLB 3PHOB 5E7BA 3CX2A 1A4JA 4U1HB 3RDTB 1UQSB 3IXTB 1D6VH 3OR6A 2MTPA 2ICEB 2O5XH 3FONA 4RAHA 1YEEL 4ZYKA 3QNXA 3GI8L 1XF1A 1RJZB 4Q9QH 5GJSL 3MACH 1P7QD 32C2A 3PWNB 4YK4C 1REIA 4NBYB 5E1HB 3ULVL 1U8OA 2EDEA 1CG9A 3BKYL 1D3CA 2XKUA 3H7BB 5FIEA 3UBXG 1ZHLA 3VFVB 4WFED 2OLDA 2DRUA 1QSVA 2J7LA 4K23L 1AD0B 2IPTH 1XZ0B 4PRNA 5HGDB 4YK4B 1J05B 4RQQA 5T5NF 5EU6E 1OTTD 4DKEL 4TRPL 3C60C 3FRPA 2DTMH 3B3IA 4HFWB 5EFIB 2FHBA 1R3LA 2AJUL 4RFNC 2AGJH 1P4IH 3N1QC 2Z8RA 5I8KL 2H32A 2CPCA 1T04B 4A2LA 1S9XB 3WHXB 4X0KA 5ID1A 4ONHB 4MA3A 2AK4E 3C5SA 4L1HA 1H15A 1L7IH 3C60B 2A83B 4OJFH 5ACZA 2NW2B 4RFNB 3GMLA 4PJEA 1SMAA 3L3JA 1FLTX 2BXYA 2BRQA 1F2QA 4XTRC 3PQYE 4X4YA 3JTTB 3LIZH 4JB9H 1I8MB 1LO3L 5EBWA 3ARSA 4OV6F 4HWZB 4LCWE 3MFFB 3ULVD 3HG1A 5FDWA 1AXIB 3W9EA 4HMEA 4F33B 1P9MC 3ZKMD 3N85L 2FEEL 3T2OA 1UH3A 3RX5A 2FBJH 3VFGH 4XNXH 2P48B 2C4FT 4N8CL 2FZ3B 4LIQL 3T08A 3D9AL 3NZ8A 2YKLL 2ZSWA 3HNTL 4J3OC 4D94A 2K9UA 1W72A 1ZHKA 3NIFE 2BVPA 1HKLH 2A38A 3MLPA 1RZFH 1IAKB 3UZVB 1QPPA 4XB8A 1OAKH 1EO8L 1IC4L 1KENL 5F7NC 4HUWA 2VQ1B 4UDUA 2Z92A 4NHUA 2XY1A 4Z0BH 5C8JB 4WUKL 3HZKB 1N7MH 2QADD 4I2XE 3TO4A 7FABL 1CFSB 2IANB 5IGXH 2HJKB 2B0SL 1RULH 5T1LD 4YC2B 5GZND 4LPYA 1DN2A 4LP5A 5I66A 5HYIA 1AGBA 4PRHE 4JPIB 1QKZH 2UZXB 4MQXC 5D7KE 1L6XA 2HN7B 4I3RL 3F5WA 4JFFB 1VFOA 4P0DA 4RBPH 3MLXL 4WJ5A 5A16A 2EH7H 5AYUL 3OKMB 1X9QA 2VDOH 2YXFA 1KCSH 2H6PA 4PJDB 5HBBA 3I75B 3CSPA 2OZ4H 5JHLL 5LWYL 4G6MH 2E7LA 5E1AA 2RFXB 3TBYA 3DYPA 4OCXH 4PJ7A 1EEYA 2Y6SD 5CZXC 1R5VA 2XQBL 4TNVF 1IAOA 3VJ6B 3MO1B 5IW1B 5D5MA 3LKQA 1UYWH 1WIUA 3I02B 2AABL 1A6TB 1T66D 4QRPD 5D6DA 2R39A 3BFOA 3DSFL 4L4TD 5BVPL 9CGTA 4MDJB 3S3SA 5DD0H 4AEEA 3CSYA 1RJYB 4U6YA 2WWMD 5FGBC 4OD3H 1MREL 1YPZE 5F44A 3I50L 5EZJB 3MJ6A 5I17B 5TF0A 5C0DA 4ODHL 1CS6A 3MOAH 2FIKB 1T0MB 2IQAB 3PHQA 4LOUD 4LSVH 5F1SA 1WVZA 3V8OA 2WK2A 3LPFA 4LSRL 4XCCH 4LHUG 4KVNL 1I85A 1UA6L 1E4XH 4CMMA 3EAKA 4WO4C 1IGJB 2P45B 2YXMA 5IW6B 2OTWB 3VFWB 1U95B 3O0RH 4U6XB 5HYFA 1U41A 5FGCB 3U6RA 4E41B 4PP1D 2AXFA 3PXHA 2HH0H 4I48B 3CXHJ 4WO4B 5CKAA 1K6QH 4I3GA 3U48A 4QOKE 1K2DA 2NTFA 3J8F7 1MFDL 3HE7D 4O51A 2AJVL 3QG7H 4RMTA 2P8LB 4N0RA 1JV5B 2KUTA 4JRXD 4DUVA 3IFPB 2HTLD 1DJSA 5FM5O 1T0NA 2FB4H 1KPVB 3GSXA 1A7OH 4X98B 5GGRB 3ZSSA 3EYFA 3UCRA 1L0QA 1XF5B 3SDDD 3DROA 3HR5A 2DJSA 1LILA 1FNEA 2AQ3A 1MHCB 4MD4A 3QG6A 3QXUA 5ILTL 4ZO9A 1DFBH 1CXFA 2FEDD 4BH7B 2B2XH 2DQUH 2HFEA 1NCTA 4OZ4A 2K7PA 4U1SA 4WCYL 4MA8H 1CYGA 1NCAL 4YDVB 3ROOB 1VPOH 4YH6A 2Q6WB 2VYRE 2VUYA 2CIKA 3O2WH 3QQNA 4DTGH 1G9ML 4N1HB 1T89C 3LS5H 4IM8A 4IMLA 1MCLA 4KUZH 3BJ91 3ARYA 4I18A 2BRRL 5BS0B 5D7IF 1YECL 2ZOLA 3W9DB 4HBCL 1VSCA 1MCPH 1SHMA 2LABA 2VLME 4FG6D 4QHLB 3ZTJG 4RZCB 4NJAL 5C7XH 3U1SL 3KDMA 3BIBX 2F54A 3MYJB 3R0MA 2DQCH 2Z35B 1OTSC 4MCYA 2EDOA 3KYKH 4KHTH 4LDLB 5H37H 1FL5B 1GZQB 1VACA 3W5MA 4PP2B 4XWGL 5DQJA 4YHNA 1KTRL 4NRZA 1AO7E 3MRNB 4K8RC 1M7XA 3OZ9L 1LNUA 1S5HA 4PJBA 1U93B 5CINL 3EHBD 5CMAA 5BW7A 3MLWL 4X4XA 3OR7A 4XAWL 1KSRA 3D85B 4UILH 4YE4H 5EBMB 1P84K 3L3IB 3IDGB 4KK6C 1HHIA 1QVOA 3MUZ1 1CDCA 5D7JC 4QWWD 3SE3A 5MEPA 1XIWC 4G6AC 3RTQD 3OKOA 2WUCL 3C5ZB 3QDJA 5TE6H 4XH2A 3V5DB 1Q9WB 3WFEH 3ALXA 4XZUB 4KQ3L 2Q8BL 2J8HA 2FBOJ 4DCQA 3MOQA 1FZJA 5GS1C 4H1LH 3GSRA 3S5LG 4JG1L 5C2BH 1LP9F 4P3WA 1T4KB 5D7JB 1XIWB 3MRIB 5SWZA 3HN3A 1UM6L 1BX2B 1AE6H 3UTSE 1DBBL 5F6HJ 5CLWA 3KWWB 1A2YB 3UTTA 4CADA 2A74B 4KK5C 3L3OA 1BQUA 1DEEB 5GJTL 4NO0D 5AZEL 5GS1B 5L88H 1D5BA 2EC9T 2X4QB 4M1GH 2ZKHH 2VQTA 5AEAA 1I8KB 2R23B 4AIZA 3I2CH 3JV4B 1SYVB 2VDRH 3IDXL 4IEFB 6CGTA 4MNHA 1P4LA 5EO0B 3V4UH 4BQ8A 2WW8A 1WCBA 2D31A 5GGVL 3VFSB 5E6ZA 4ALAL 2C1PB 5C0NC 4TUKH 2Z0BA 1MWAH 1FPTH 3L7EB 4FQQA 2X4TA 4M6ML 2DTSA 3EYUH 3I6KA 4IIQC 4WFFD 2BY0A 1H3PL 1J0ZA 3JVGC 1CD1B 3BUTA 4OFYA 2YD7A 4MWFB 1E6OL 2VLRD 3D1MC 2R1WA 3PWJA 3LKNB 4X99A 5SX4H 2EXYC 4L8SA 1NC2B 3OKDB 4N1CA 5L2JB 4IIQB 3SKMA 3MLRL 3WO4C 4YFLF 4PJ9D 2H26A 3RWJB 3KPQB 4DEPC 2VERN 1JZ5A 2APFA 1IBGH 3LEXB 2Q3ZA 1W8NA 2IPUK 1B4RA 1MRCL 3S6CA 2AJSH 4OIIL 4M1DL 5GSRA 3VGFA 1MCJA 3WO4B 3SDDA 4HXAH 5AUMA 1KTDB 1D5IL 3VXSE 4HIXL 4X9IA 2YA2A 4DEPB 3FB5A 1F4XH 3NMEA 2JJWA 2XTLA 3EDDA 1CVSC 1FLRH 5FUCC 1OGAE 4HZAA 2WP3O 1IM9B 2HG5B 3PWPD 3TGXA 5DRWA 5E9DE 5FUOH 5DQ9B 3T8XB 5TGBA 1JI2A 3FQTB 1P2CA 3VRIA 3C5JA 5J6GA 1N6UA 5KZCD 4LL9A 1R5WA 4LHUD 4UV4H 2G2RB 2ZNXA 3UYPA 5JR1H 4J6RH 4EKXA 3HC3H 4XMKH 2FATL 3HR6A 3ALWA 1G7JA 1N6VA 1C1EL 1JZ4A 2LAAA 1AC6A 2B1AL 4TNVK 5DUBB 3M8OL 3QO1B 1DR9A 1QBAA 1V05A 2CDEB 1N8ZA 3UBXA 3OAUH 3I9GL 2DM4A 1N26A 5IQ7H 5D7LB 5L8LB 1YEJH 1FNFA 5CIPB 4K3JL 2NY4D 3MREB 3RWDA 1UH2A 2APVA 2HT2D 2OL3B 2I5YH 2NY1D 3MRLA 3V5KA 1TVHA 4FFWD 1EZVX 5F7FA 3VXMD 4WUUA 2BOCB 1FL3B 4I0KA 5D70L 5HDBE 3G04A 3KPMB 3RY4A 4BFBD 4RWYL 1EFXD 1CN4A 3QNZA 1DBMH 4Z78A 3MROA 4EXKA 5LGJB 4OLYL 4AK1A 2CLRB 2AXGA 4OV5B 3HS0A 4DKFL 1KIPB 4N1EA 3TPUB 3ZE2E 2Y5TB 1ULVA 5TFSL 4XPFH 3WFBH 2H1PL 2R2HA 1PQZA 4WWKC 5C07B 2HT4C 2FHFA 1FG2A 5HHPB 3UPRB 2HVJB 3JV0A 3PP3K 2R29L 3JSSA 4M7JL 1YA5A 4ODTL 5EPMA 4J23A 5DSCB 1WZMA 2EDWA 3X3GL 2NX5D 5IESH 5IT2L 4GG8B 1CE1H 1FO0H 1QPXA 4F7CB 5HY9B 2APTA 4O5LL 1R3KA 4XAKD 3C08H 2DD8H 1N2RB 2H41A 4WWKB 4E42A 5K9OA 5T1LB 3HI5H 3SBWA 2HWZL 4HJ0C 5GHWH 4L5FL 4MA7L 2AJZA 3VG0L 4S0SD 4ERSL 3GSNB 4M61A 4FZEL 1P4BH 4X8JA 5T1DH 1EXUA 3EGSA 3K2UL 2DQIH 3SCMC 4ZPVA 5DJYA 2Z91A 4PR5B 1UB6B 1GAFL 2AK1H 1YEDA 1YEHH 2VXTL 4FQ1H 4LAQH 4YXKL 4QHUB 2AI0L 2NNAB 3H3KA 5T1KB 2WWMC 5CGTA 4ODWB 4GG6A 2GJZB 1FIGL 3DLQR 4OCRL 3G9AB 3ARVA 3K2MC 4M43L 2VLRA 3BHBB 3SCMB 1RU9H 3ARBD 1PG7X 5FA3B 2WSKA 1RHFA 2VXSH 4FTVB 1IC7H 3BISA 4HMDA 2Y25A 1CGSL 1EFQA 1JHKH 3MXWL 3BZFB 4X6EA 3CPLA 2DLFH 5DJZB 3OTTA 4PJ9A 3INUL 2NLJB 4QYOB 2GQHA 3C6LD 4PGCB 1B6UA 2QTEA 2VDPH 1R5IB 2BSSB 3ILQD 3O2DL 5ESVB 4EDWL 1ZGLP 2EE3A 1KB9K 3O3EB 4UOW0 4QTHA 1NBZA 3EO9H 3MV8B 3O6FA 5E8PA 4Z7QE 4K9EH 2PW2B 2Y07H 3RZCC 1F5WA 3KXFD 3LEVH 1UT9A 2FSEA 4D0CB 2OK0L 4ELKB 1JBJA 3LQAH 3CFBA 2YC1B 3PWPA 3LMJH 5EUKB 1FGNL 5EUOA 5HDBF 5I1IH 4P46D 3CFJB 2ATKA 4LHUA 3RZCB 5LKNA 4LRNH 4JRXB 3ZYIA 1TLKA 3ZE2F 4NHCL 4JFPA 3IS1X 2YZ1A 4HZLB 2VWEC 3L1OL 3CFDB 1A1OA 3BKMH 3PWVA 3FQXB 4JKPL 5AZ2H 3V7AE 1A7QL 1JYVA 5HYQA 3WYRA 2CK0H 3B6SB 2XQYK 4LPXA 4CVWA 1MLBA 3FTGB 4HPOL 3P9LB 1I9IH 1CF8H 1H3TA 5K9JL 2DBJA 3MRHB 1YDPB 3UDWA 2WBWB 4N0YL 4N5UA 2X1PA 4M5ZH 5BO1L 3UXFA 4DGVL 2DWEB 3G5YA 1WAAF 2I07B 3IGAA 4L8BA 4Z7WB 3WCYA 1XGQA 1QFOA 3FOMA 2EXWC 4JFDE 4S1DD 1LK2B 2YSSA 5JOFA 1M7DB 5GZOD 5A40E 4ONGH 5BV7L 4WTXA 2E8YA 4S1RL 4M3JA 2XWTA 4XBGA 3UJTL 5DD1H 4P2QE 3IDJA 1LMKA 4UTAL 4TSBL 5D2LB 2OTUA 2VZ3A 4ZSOA 2HKHH 4P9ML 3OKNA 4FN0A 2VH5H 1V5JA 4G8GD 2HJFA 1KT2B 4B41A 5IVZB 3HUJA 4M7LT 1NAMB 5ITBL 3ARGD 4BZ1H 3RTQC 1N59B 2NX5A 2VISB 2CDFB 3LKSB 2VZUA 3ULUC 3K1KC 2GTZB 3GHBL 4JM2F 4MXWH 4N0CD 3V0WH 2XPGB 4ZO8A 1OSPH 3CLEL 5E56A 1H0DB 5EBLA 5AG8A 4DN4L 2XKSA 5F8QC 1CFNB 1FYTA 3MUY1 5HHNB 2APBA 3RTQB 2BVOB 5TE7L 2R8SH 5KSUB 5DJDB 5I19L 1WIPA 4PJ5D 3QO0B 4R7DB 3F6LA 1TJIH 4CVXB 3HAEH 4L9LA 1LO5A 2XG4A 4WU5A 5F9OH 4OQTL 3MRRB 1JPTL 3WFHA 1CLOH 1IGYA 3NTCH 2X4SA 2EE6A 4Z7QF 3PF2A 3TV3H 2V5MA 1WLHA 2A6IA 4MMZC 5JW5A 5L2KD 1MAML 1XH3A 1CGUA 3GBLA 3MLZL 1XR9A 3ARBA 3N9GH 3X13B 2V9RA 2YPLA 3SJVA 5C6TL 5TDNB 3TN0D 1DE4A 4I3SL 4HK0A 1KN4H 3JV6A 2GY5A 1IKFH 5E8DL 2F58H 5A2FA 4JQVA 2O5ZL 3RUGE 4ETYA 3OAYH 5CJQL 4EQ3A 2BMKB 5J3HD 4Q9RH 2GI7A 3G6AB 4XXDB 2ICWI 4UOW1 4QCIB 3P0VL 3Q48A 3CDYA 2HRLA 4X6CB 4KHXH 3VU2A 4PRIB 4JZNA 1IAIM 3WDHA 1JHLH 1ZT4B 4MSWB 5HYJB 4TUJA 3SE4A 1IEHA 2OQJB 2ZUWA 2FL5B 1JF1B 4BYHA 3KXFA 2YD2A 1OWWA 5I71C 1ZVYA 5KG9A 4EI5D 4JDZB 5EU4A 2C4FU 5E5MA 3EJZD 5FKPB 1E6JL 4Z0XB 3TIDA 3NIGF 1VFMA 2VLJA 3VG9C 4H20L 1O0VA 4HGWA 3OX8A 3ZDZE 4U1IB 3QUMB 1AXSB 3TBTB 3BIKB 3IFOB 2PYEE 3DV6A 2XN9D 5CEXB 1EHNA 4GRWB 2H2PD 4P46A 5GRYA 1ZLVH 4ODVL 2EDYA 4IRSA 5ADPH 5E6ID 1NCCL 4Z76A 1SJEA 5I71B 4JY5L 4G6JL 4ZTPL 4QT5B 2IBBA 4UNVA 3PV6A 1PEWA 2DQTL 2GIYA 2YEZA 4LDEB 3TCXA 5MEOA 1KEGH 2JF1A 4WRLA 3U0WL 2JJSA 3VG9B 1Z9MA 1AJ7H 3KHOA 1BF2A 3HNSL 4P5MA 4G7YH 1AC0A 2ERJC 5A2KH 3O2DA 1XF2B 1YQ2A 4HC1L 1KIQB 2GKIA 1U8PA 1NEZG 4NQDE 4NNYB 4UQ3B 1G6VK 5DD3L 1EUUA 3SHSA 1FRGH 1NLBL 5FF6A 4ONFH 3O6MH 1HZHH 5EIIB 3K4AA 1WC7B 4JREC 5HDLA 3FMGH 2ERJB 4KI5D 2IPUG 1I8LC 1MCNA 3VFVA 5J13C 1WBXB 3D48R 4GKSA 1MRDH 3LH2L 3MRFB 4U1NA 5BVJB 5C92A 3VGEA 1KEMH 2NY4C 1HQRA 3OXRB 4OF5A 2VO5A 3JUZA 2HT2C 2EYTB 4HFWA 4LBEB 4UT7L 4JREB 5EFIA 3BO8A 3ARXA 2LU7A 3VXOB 2X4RA 4M6OL 5J13B 1OAQH 4NN6C 1T04A 1M1SA 4DFHA 4XCEA 4MAYC 1F97A 1LEKB 2NY4B 1UKSA 3AU1B 2UVFA 1NSNL 3O8XC 3H3PH 4U1JB 2NW2A 4PBXA 2X70A 5IQ9B 2NY1B 5C70A 2QLVB 2YD6A 3C2AL 4OFPA 3KG5A 2IPKB 2J88L 2R0KH 1ACZA 4NN6B 1N6QL 2APXA 5IB4A 4X7SH 1CU4H 1SJHB 1EFXB 2BNRD 4MNGB 3KLAB 3VWJC 4MAYB 4UU9A 4PJ5A 3O8XB 1HSAB 5J9PA 5KSAD 5ID0B 5IR1B 4KUCD 3DX8B 3OKEA 1U8HA 3L5WA 4XB7A 2A1WH 5L9DL 1EJOL 1K4DA 2I9LA 1J1PH 1RFDL 1JZ2A 3VWJB 2RCSH 2FZ3A 3ZKND 5C9JB 4UBDD 2IG2H 5EORH 1T7XA 4I5BA 3L95A 2CIIA 1S3KL 2GW5A 4WHYG 5FA4B 5J56B 4QRTB 1NMBL 3MCG1 3ZDZF 2DJ4A 3F7VB 4K94L 1HDMB 3REVB 1RZKH 3TN0A 4O4YL 2P5EE 2SEBB 4Y16D 5C8JA 2CKBL 4XHJC 5GS2H 5IB2B 3SE9H 3KPRB 4HEME 4QY8B 4FQXD 4WW2F 5KJRH 1BPVA 4K07A 1SYSA 5LBSL 2ZCKH 4GXUM 3NACL 3UEZA 5D6CB 4PREA 2Z8VC 4J3VA 4G7VL 1E4KC 1MJJA 5J4MA 2YWZA 4JFFA 1XCQA 1RUKH 5E2VH 1YMHB 5F9JB 2B1HL 3DIFB 3HC0B 4XCFH 4YHKH 3MRJB 3T4AA 5F1IA 4YXHL 1JP5A 4OQTA 1X4ZA 2D4FA 4YDIL 5B3JE 1NDGA 3WIIL 3KPNA 3U36B 2WWKO 5ISZB 1TJHH 1DUYA 3GSQB 1G7IB 3D25B 1FFRA 3P4NB 3DXAA 1BEYL 3D3VD 2F19L 4HFUH 3S5LB 5E6IA 3MZGB 1I1YB 4HS6A 1FQ9C 3RNKA 4NT6A 3G6JB 3Q6FA 3SGKC 3S4SB 3F65A 1CQYA 2NZIA 3CFEA 3MUHL 2P42B 1IC5H 3G5VA 1GJIA 1NFDE 3NBNA 2WQ8A 2FIKA 1T0MA 4R8WH 2H8PB 1KJMB 1KLUB 1LO2H 4XC3L 4LNRB 1BGXH 5FGBA 3JWDL 2DDQH 4J3SA 4AL8H 3G5ZB 1C7SA 1IGJA 4Z95H 3VA2C 2E8ZA 2FYYB 4OGYH 3IU4H 3SDYL 1GGCH 2OTWA 4JHWL 1X5IA 5C0CB 1A6VH 4NZTH 4U6XA 1F3RB 1V8HA 3CK0L 4LPVA 2PXYC 4E41A 5FO7B 4GXUN 4PJIB 3REWA 4YDKH 5KVFH 1VHPA 3VW3L 1ZOXA 2A9MH 2QEJA 1C08A 1OL0A 1HHHB 3EOYG 3VXTA 5ALBH 5CILH 5ESAB 1CL7H 1GHFL 1GGYA 2PXYB 1B88A 4LPCA 4FXGB 1JUFB 3RVXC 4HQQL 3DO3A 5F7EL 4KY1H 3B4NA 3T0EC 3GKZA 1DLHA 4G6FD 1MHPL 1UVQB 4GBXD 3O4LB 1A7RH 5H94B 1MHCA 4FZ8L 3DO7B 3WNKA 2NCMA 5C09B 5C0FA 2PW1B 3EO0A 5DXWA 3TLRA 1XF3B 4HC1A 4LQFH 5GGSA 3NCYS 4BH7A 4OZIA 4Y5XC 1P7HL 5KW9L 1OOAA 3T0EB 1RIUH 4B7IA 1FNLA 5DQDL 5J1TC 1XFPA 2R4RL 1JGVH 4OLXH 2G75A 5KSAA 1KFAH 5C0EB 1MJ8H 3HNVL 4RIRA 3IKCA 1G7PB 1DLFH 1I3UA 1Q1JH 3C9NA 4XT1C 2GJ6A 3QDGB 4QHLA 1N64H 5LGHH 1IAII 5D72H 1T1ZB 3N1GC 3ARGB 5FYKU 2KPNA 2CDGA 5AG9A 2W60B 1KUMA 5I30L 2VXQH 3QI9D 4IDJH 3ZHDA 1DBKH 2F74A 1HILB 2P24B 5DMJB 2UWEB 4L3EB 4YGVB 4F57L 1S78D 3MRNA 4Y16A 3AMLA 2FX7L 4F7MB 1L0XA 2I24N 2DMKA 3KAAA 5D71L 5IMMB 5M94B 4PJXB 3E8UH 3BXNA 5I8EB 3AM8A 3WMSA 4F58L 5J1AB 4UT9L 3NAAL 5TH2B 1MQKL 1S7VB 3CGTA 3FO0L 3TIEA 3QEHB 4XPAL 1N0XL 3IU3B 5E8OA 1NFDF 2NY5H 1QR1B 3SKNA 1CLYL 1Z9OA 4PD4J 3MNVA 1VERA 3AY4C 1CL7I 4KV5E 4IS6A 4LCIL 4MS8C 3QFJA 4HKBA 4RGNE 5F97E 3FQUB 4X7CC 4BQ9A 1QHOA 2DN7A 2EYRA 4AM0A 3HE6D 4Z7UF 4GJTB 2AEWA 5T5FH 4N9OB 1QLFA 2VQUA 1ZMYA 3MRIA 1P1ZB 4WV1C 4XNQB 2E7BA 4UT6L 3RI5F 5JLZB 1BX2A 4ZOEA 4RMUA 3KWWA 1VEOA 1A2YA 1U58B 3LZFH 5L8JB 3BGAA 1DEEA 1CTNA 1QBML 4PJAA 1KXQE 2NZ9D 5EU6D 3D3VA 1BF8A 2DIJA 1EO5A 5C0AB 2GT9A 3CDGB 5C0JA 4GW5A 4KMTL 1LEGA 3I84A 1D6VL 3FQWB 4YWGL 1OP5K 1KLFA 1RI8A 4WV1B 2O5XL 5F9WC 1IGIH 3ZTNH 1I8KA 2CKBA 2YHGA 1Y18A 3H9YA 1QP1A 3JV4A 4Q9QL 1SYVA 1MJUL 3MACL 25C8L 3U7YL 4HULB 5H35B 4JPWH 2X4OB 4PJHB 3HRPA 4XP5L 2C1PA 1LEIA 1OAYL 3IT8D 2B4CH 4POZD 1ES0A 1EEZA 3SY0B 1DL7H 2X4PB 1NFIB 1MHEB 3CDFA 5C86A 3PQYD 3RWEA 5HD8D 1U91B 4ZDHB 4KJQD 1BQLH 1Z2KA 3S36X 3H0TB 1JL8A 4LCWD 5I76A 4PLKD 2DTML 3LKNA 4CVZB 2XN9B 4JRYB 4MD5B 1CFTA 2ED7A 1LE5A 1NC2A 1P4IL 3OKDA 5L2JA 2AJXH 4RMWA 3UTQA 3MRDB 3QJFA 1NBQA 1IRAY 4XPHL 1OSZB 2PTTB 3K0WA 3MV11 5JPNA 1GZPA 2HKFL 4TVPH 5J0BA 1OP3K 4OJFL 1ZXQA 2JKXA 1FAIH 2VZ1A 4S0TD 4Z7OF 5FO9B 3SKJH 4TULH 4C4KO 1TETH 2ADFH 4K3DL 1I8IB 4JB9L 4L29A 3T4YB 3WS3A 2ICWJ 1K85A 3VGGA 4Q2ZB 3O41A 1MHHB 4OCLC 5EU3B 4LLMB 4JN1L 4XNUH 4LCUB 1PEZA 1P53A 5H37G 2FBJL 3VFGL 1RZGB 1TVDA 3CH1B 2J8UE 4O58H 2ICWB 5CUSH 1I4FA 3T8XA 3BP5B 5B38A 2DIAA 4PRHD 4J4PD 5D7KD 4NNPL 4KWUA 2W9EH 5HTSA 3U9PH 5JHDB 3VXUE 3GSVA 2GJJA 4YHIB 2CRMA 1NEZA 1HKLL 3HTLX 3NA9L 1RZFL 3M45A 3IF1A 2EKSB 1OAKL 4P48A 3QUZA 2AKRA 5FECB 5DJXA 4Z0BL 3ARRA 5LAXB 1OD9A 2ZUXA 4LSSL 2YUZA 3QI9A 1NJ9A 4KXZI 3VGAB 1D5XB 2PUQT 4GAYA 3S34H 3VRJB 4RAVB 3HA0A 2M8XA 3VFMA 4PV8B 4ISVB 2Y06H 4H1LG 2H32H 3RJQB 3MREA 4FQHA 3QJHB 4ZAKC 3HRZB 2QSQA 1QKZL 3MV9E 1A8JH 2FJGA 1CK0H 2QHLA 4UBDC 3SO3C 5BQ7B 5GSVA 3D87B 2OZ4L 5J89A 3OWEA 4U3HA 1OTUD 4H26B 3TWCH 2WINB 4G6ML 5GS0L 4OCXL 1DQLL 3V95A 1OGTB 4ZAKB 4TVPE 1TNMA 4WU7A 3SO3B 3SDAC 4XCNA 1G0YR 1Q72H 3CXDH 3AB0C 4FQXC 3HE6A 1IGMH 4YQXL 4FMKA 2C3HA 5DD0L 4RNRB 4Q58C 2X1XR 5E8EB 2I9TB 4DOHB 4OD3L 4PIRF 2YK1H 3ES6A 1WQVT 1ZANH 2JK5B 3KPSB 4X6DE 2QQNL 1OAXL 4GOSA 4Y0GA 3D0LA 3FN3A 4XVUC 3SDAB 5A43C 5CD3A 1TTFA 4QOKD 1PX4A 3AB0B 4FQXB 1N2RA 4HG4J 4JFEE 3FL7A 4M6AA 4RGOH 5HHOB 1UWXK 1D5MA 4XCCL 3B2UC 1ED3B 1E4XL 3ARFC 4F7TB 1YYMH 1BM3H 1RPQA 1TQCC 4PR5A 2V9TA 5I75C 3R8BB 5ETUB 3CVIH 4LKCA 3PWUB 1UWEH 2NNAA 1W0WA 5GS0D 4M5YL 1JNHB 3IJHA 1MF2H 5INDA 2XTJE 4U0RC 2OR9H 1BD2E 3AREA 5INCB 3QEGH 3EJJX 3ARFB 4ENEC 2YR3A 3PQYA 1T21B 4XXCC 2GTWA 1K6QL 1PLGH 1TQCB 43CAB 5I75B 3N1FC 4KU1A 1F8TH 1QA9B 4OI7A 1Z5LB 5FA3A 1D7FA 1NCUA 4K7PX 1QLEH 2NW3B 4CDGC 5HGBA 1FIEA 3MOBH 4WHTB 4KPHH 3EYOA 2XWBA 5I8CB 4QYOA 2VLMD 3CJJA 4HWBH 1DANT 5EG6C 2KKQA 1FCCA 1RHHA 3GBNL 1VEPA 3U46B 3RAJH 1OW0A 1KXTB 3WV0A 1UZ8A 4WENB 4KDTC 2X42A 4PJFF 1UKTA 3GSWA 2HFGH 3DVNB 3L3GB 4Q6IC 3HG1E 1N5YH 5DJCA 2VUOA 3MV8A 2R2BA 2R9HD 2E27L 2PW2A 1AO7D 4MA8L 4NM4L 2BSRA 1VPOL 1IL1B 3VA6A 4DGYL 3GUTB 3O2WL 4I2XA 4D0CA 4P49A 1PSKL 1T2XA 2VN7A 3LS5L 2YD1A 1WT5C 1A1MA 3ILPB 4ZD3H 4Q6IB 1MCPL 1QFPA 4LLAA 4POYA 5C0BA 4NSKB 5C7XL 1M71A 4PRHA 3UTOA 5HGHB 4XC1H 2DQCL 4KGJA 3TBSB 2Y5EA 4GMTH 3RA7H 4UNUA 2CUHA 3KYKL 4TYUA 4KHTL 5ECJE 4HZLA 2QL1A 5GGTL 3UPCA 4YBHA 3DX6B 5FHAH 1ZTXL 4C59B 2BFVL 3RWHA 3P9MA 4YEEA 4IJ3C 3B6SA 4U3CA 3VI4E 4OM0L 2I25N 3FTGA 2E9WA 3NCMA 3RI5K 3P9LA 4YLQT 2ARJA 3UTSD 4X6DF 3UJJL 4UILL 4YE4L 3Q6GH 3VMNA 2DWEA 5BZWA 1Q9LB 4ZUSA 2P7TB 2FD6H 2VLKB 3P30H 5TE6L 4IJ3B 1LK2A 4HKJA 1U8QB 1AGEB 4M8QB 1P69B 3I3DA 1ZT7B 3QXDB 1YEEH 1CT8A 5C2BL 1IJ9A 3WJLC 4APQD 3GI8H 5GJSH 4Y4HD 5TDPB 4ETQA 3HCVA 4Q9BA 4UNTA 1FE8H 3BKYH 3D18B 1FNAA 5AD0B 3LKPA 2DLGA 2IMMA 3V7AG 4NQUA 4KJPC 1IGFH 4JJ5A 3BGMB 3MRKA 1NAMA 3OG6B 3RHWF 1N59A 4K23H 2VISA 3LKSA 4XGZB 1AGCA 1MFBL 4M1GL 1MPAH 4L8CB 3LRGA 3Q1SL 1I7TA 4JFYA 1RD6A 5JQ6H 4DKEH 3TNNB 4TRPH 3KLDA 5TE4L 1WJ3A 4BSVB 3BPLC 3I2CL 3IDYC 3MNZA 1NBYB 2VDRL 5IKCA 1KYOJ 1J0YA 1AGFB 3S35X 3MRQB 4TUKL 4BELD 2Q20A 4PJEF 3O3DB 1MWAL 1PKQB 3QDAA 1FPTL 4MX7A 4X9FA 3EYUL 1BIHA 5IMOA 1BBJA 2WLYA 1R6VA 2W92A 3BPLB 3IDYB 1CXLA 1YQVH 2OZ4A 3LKRA 3VXSD 3TJHD 1WFTA 4YHLH 1LO3H 5DJ6B 2DLIA 3MLVL 1OGAD 3TJEL 4HUUB 3DBXB 1N5AB 1HYSC 1RJLA 2DLTA 4UIMB 4I0CC 5E9DD 3SKOB 2EECA 5IHUH 1X7QA 3WKNA 1J1OH 1FAKT 1VADB 2GCYA 5EU6B 5TDNA 5DGRA 1IBGL 3WNMA 5BMFH 3K4DA 5IWLC 5DO2D 1RV6X 3BP6A 4N8CH 4LIQH 1OD7A 2YPKA 3D9AH 2AJSL 2YKLH 3HNTH 3T0DA 2QQKH 2WBKA 4HXAL 1JPFA 4MJ6A 1QFUH 2AK4B 4BFIA 3VI4F 1U3ZA 4HK3J 4JFQB 1FLRL 2V2XA 1TDQA 1ZT4A 3A6OA 4MSWA 5HYJA 4NIKB 3STZA 4QRRA 2C3GA 3SPVA 1I1CA 4DVBA 3DETC 2EZ0D 2OQJA 1MCBA 4LCWB 2OCFD 3MJGX 2AV1B 1A1NB 3WO3B 5CJBA 1H8OA 4UV4L 1NDMB 4PJ7F 5F89B 5JR1L 2F54E 4J6RL 4I3RH 4O2CB 3HC3L 4YHZH 4XMKL 5AYUH 4U1IA 1CBVH 3BIKA 4YHYB 1FVCB 4JGJA 5CEXA 5D5MF 1T1YB 3PL6D 4MNQB 4U1MB 4NYLB 5CJOL 3DWTA 4PG2C 3OAUL 5DHYA 5DFVD 4HH9B 2BVUA 2Z8WC 1YEIL 2GSGB 4KROD 3NIDE 5IQ7L 1Z9SA 3RGVD 3F7PC 1B0RA 4JFHE 3DSFH 1N3NA 5BVPH 2D03L 2I5YL 2C26A 1JPGA 3UTSA 2XZCH 3EOBB 1JE6A 5ICYA 3B8SA 3KYMB 4QXUH 2HLAB 1MREH 2V7HB 3QDJE 5C6WH 5J12C 2NR6D 4H25B 4IRJD 3I50H 4S2SA 4GUPB 1DBML 3VFRB 1UEYA 4EUPH 4S10A 3BP4B 3IJYA 5GGVY 1T6WA 1KCVH 3C8HA 3TEUA 3LHPL 1ZVSB 1FFQA 3WFBL 1WBXA 4LSRH 3RKPA 2G9HB 5D7IB 5SWZE 2OBGA 5FDYA 3WNNA 5J12B 2YUXA 8CGTA 4LIQE 1M7IB 3FT3B 1JGLL 3RVWD 1ITCA 4Y4HA 2OS7A 3UTTE 3EBAA 4NQCD 4ZS6D 4BJLA 1CE1L 1FO0L 1IM3B 1JWUB 4PRPB 3C08L 3Q3GB 2VAAA 4UB0H 5I18L 3HAEG 2DWDA 4M7LH 5GGTA 3OF6D 4P3DB 3HI5L 1MUJB 3EDJA 1PYWB 4HUXA 3OG4B 4HUNB 4JM2D 4G9DA 5FO8B 3AU1A 4M1CC 1P4BL 4U1JA 2JJTC 1P5VA 5CEZL 1Q9KB 1J0KA 2V5RA 4XP1H 1MEXH 5D96C 3PJSA 2AK1L 1YEHL 1GC1C 3BKCL 1KB5B 1UJ3C 3QCTH 3W0WB 1MCWM 1NGXB 5IR1A 4BFEA 4ELMF 3ULVF 4OZGA 2BVYA 2M26A 4NKDA 2Z4QB 3VXSA 1A21A 1OPGL 4H1LA 5D96B 5ILTH 1QO3A 1LP9B 2BOBB 4FNLH 3WXWH 4MXVE 3DGGB 1UJ3B 5D1QD 4UIKH 3VWJA 3DECA 3VWKC 4W68A 4YBLC 1OGAA 1JHKL 4N5ED 1NCAH 4FFYL 3OKLB 2WQRA 3MBEC 4R97C 5E9DA 4JR9H 4Y4FD 2DLFL 4MJIA 1CIUA 5MENB 3GNML 4S11A 2Q86A 1YMME 2NY3C 1IGTB 4J1UA 2MJWA 3BUYB 1A6AA 4UAOC 1I7ZB 4HEPG 2ZSVA 2F8XC 6FABL 4NJAH 1QSEB 3VWKB 1DQTA 5CWSA 4YBLB 2EIZB 3RPIB 3R4DA 4HUKB 3MBEB 4R97B 4M9PA 3NIDF 3ABZA 1WBYA 3EO9L 1SMOA 4LLVA 5DD6A 3SOBH 4ZFFB 1MCFA 4PJBF 2NY3B 3KPOB 2AV7B 5KANI 3LCYA 3RL1A 4FQ2L 4UAOB 3LEVL 3WL9B 3ZYOA 4XWGH 2Z8SA 1Q9OA 4P23D 4D0BA 4ZQKB 2D7MA 1G0DA 4PRDB 4MB4A 3DIFA 3VD7A 3OZ9H 4LF3B 1UCTA 3GFUA 4TSCH 1NGWA 5CINH 3KPPB 5DA0B 2QSTA 3OJDB 4XAWH 4QHMB 4LKXB 4JFDD 3BWAB 5ISZA 5BRZB 1JTOA 2WUCH 2W07A 3TFKD 1U8NA 3SDXE 3V0AC 3D25A 3BKML 1I1AC 3FKUS 5AZ2L 5DRXB 4GXVL 4KQ3H 1BQHG 4P2QD 4OD2B 3MLTB 3PL6A 1BVKA 1R3JB 4FFVD 1I1YA 5IHZA 5CJ8A 1Z0NA 1LE9A 4AENB 3MFGB 1XGTA 4F7PB 1IQDA 3S4SA 5L6YH 1T5WA 5KSBB 1G7QB 2QKIB 2OMBA 2P8MB 3IB4A 4M5ZL 3C8DA 3RGVA 1VFBB 3QIUD 4QTIH 1I1AB 4X7DC 1CFQA 3RHWK 4IDLA 4WUUE 1DVFD 3P4OA 4LNRA 5CEYB 3UZEA 3N50A 1YEGH 5K93A 3DURB 4OIBA 1MCIA 4IRJA 1CICC 2FYYA 3D39E 5CD5C 4MJ5B 5C0CA 4MLIA 2D0FA 1AKJA 1VB9A 4XCYA 3IDXH 4WIQA 5CGYC 1UZ6F 4WI5A 4X9GA 2BC4B 2CXGA 5HHVL 4POUB 2HJLB 4UDTB 5I1JL 2HKHL 3VFPB 2VH5L 1JGDA 1ZV5A 3IVKB 1T3FB 4KJYA 4XNMA 4M6MH 1CICB 1HHHA 4BZ1L 1E6OH 5B39G 4NQCA 4ZXBD 3HZVA 1BFOB 3V0WL 5F8RC 1OSPL 2NXYD 4FQLH 3Q5YA 2VABB 1HSBA 3ZKQD 4R90L 2BSTB 3OF6A 1KTKE 4GLRI 4APQC 4HAGA 1ZAGA 2R8SL 5H94A 5DMKA 3TYFA 3NCJH 3PGCA 5C09A 2PW1A 4KZEL 2IQ9L 5F9OL 4GG6E 4M7ZC 3K46A 5GRJL 1CLOL 3KVQA 4Z7VE 3SQOL 1MRCH 3NTCL 4APQB 1XMWA 5TF1H 2NY2D 3F7QA 4JZJC 4O02H 3QUYC 4BKLB 1K3ZA 4HIXH 4P4KC 1KLGA 5I1EH 4NQVA 5D8JL 3N9GL 3MR9A 4Y5XA 2IAMD 5SWQB 4M7ZB 4U6HB 2UUDK 5D1QA 3MJ8B 4PS4L 4KVCH 5HI4D 3GSOB 4JZJB 3QUYB 3LQZA 4H8WH 3NFPB 1FO0A 4Y4FA 4P4KB 3KJ4C 4P5TD 4YNYB 5DK2A 1INEL 4U4BA 1I7UA 1ZT1B 3Q0HA 3GM0A 4PJ8C 4Q9RL 3MNWA 3VFTB 5I1CH 3QNYB 1QBBA 4YGAB 4PG9B 5FYLH 1C1EH 5F7KC 1JHLL 4NZJA 2YD5A 5I8EA 1E28B 1NUDA 3M8OH 3KJ4B 3I9GH 3GRWH 4M4RA 2YA0A 1EK3A 3IU3A 4PJ8B 1ZS8B 1HEZA 3IXAB 1R0AL 3WLBB 4K3JH 1G0XA 5MP6L 1BZQK 2AXJA 3FHAA 4NQDD 3FFCD 5F3BA 3QHFL 2XYCA 1QACA 2JB5H 4C54A 5IEKB 3GMRB 5ADPL 4G8EB 4RDQF 3EYSH 1UENA 5JLZA 3FT4B 3HKFA 4HIIA 2V2WB 4GW1B 3CNKA 3EDKA 1IT9H 2HLFD 4OLYH 1FFPA 3FB7B 1KEGL 1UACL 3AS3A 2NY0C 2BK8A 1MVUB 1PFCA 4W4OC 1QYGH 3QEQB 2FWOA 4KJWD 4JFOA 2B7DT 3X3GH 1RURL 4WTZA 1K3IA 1S8DA 3QWOB 1CVRA 4QEGA 3UYRL 1G9NH 4ZUUA 3QIUA 5H35A 3CMOH 3RWGB 1FRGL 4O5LH 2NY0B 3O6ML 4ONFL 2RR3A 3AAZB 1TXKA 1EX0A 3MRMA 4PPTA 1DVFA 5DMIL 2F53E 3FMGL 1EGJA 4UQ2A 5I9QC 1PZ5B 4PV9B 1AXTL 5HJ3A 1NFIA 1OAUH 1MFEH 4QRQA 4L5FH 4MA7H 1MRDL 4FFZL 4MCZA 1F6AA 3DVGA 4FZEH 5EC2B 3WNLA 2DM2A 1A22B 4GG6F 1N4XH 1F3JA 2WNGA 5F3HA 1KCRL 3WLWC 4LLYB 4JRYA 4X83A 1C5DB 2MSPA 3HUJE 1JVKA 2VXTH 4YXKH 5I9QB 2NX5E 5FYLE 3FB6A 1OAQL 1UXWA 5HPMB 1HH6B 1OSZA 3D69A 3RVVC 4OCRH 3O3UN 4PGDB 2KBGA 5IFHH 1FL6B 5HXMA 2H9GB 4M43H 4RRPG 4ZXBA 3KLHD 3F12B 3OGCB 3H3PL 4EZMA 1FYTE 1QRND 1MVFA 2GAZA 5E8NB 5IB1B 4NGHH 4OB5H 4FQJH 1U92A 5DD5H 1BLNA 1UCBH 1IQWH 5D1ZC 4X7SL 4FABL 2P5ED 2IJ0C 3W39B 5E99H 2OR8A 5B4MD 1FZOB 3RUGA 3CLFH 4LCCC 2XXCB 3O2DH 4EDWH 5J06A 5IHBA 3O9WD 1ZA6A 4JZOB 4U49A 2ICWA 3L3HB 1X5YA 5DTFB 1SY6H 4HF5H 1XCTB 4QHNB 4HKXB 5D1ZB 1J1PL 1EEQA 4JM2C 4NCC1 3ZT5A 2RCSL 3S37X 3DTXA 1I7RA 4JPKH 5EUOF 4OKVB 1G7MB 2YPLE 3SJVE 4IOIA 1HQ4B 3WJJA 4LCCB 1KCUH 1WBZB 5C0RL 1HHGB 2IAMA 3V6FB 5HHXL 1ZWIB 5FKAA 2PETA 5HI3C 2VE6B 1FGNH 3ARWA 1J86A 4FXKB 1DANU 4JM2B 1UKQA 3VFUB 1NCWH 5KVGH 3MODL 3ZE1F 5K9QI 1OAZH 3SE9L 3CVHB 3BYYA 3FO9A 5SX5H 4ZFGL 3BT2H 4P5TA 1WEJL 1OB1B 5ERWB 4QLRA 3QH3A 3VRJA 2WIIA 2BHZA 3T0XA 3NCYP 4G3YL 5DZOA 4G80B 5I1AA 1RUKL 5E2VL 3VXQA 4LGRB 4HAFA 1M05A 1E27B 1NFKA 4HPOH 4YHKL 5GGSY 1JYWA 1C16B 2CRIA 1BVLA 2D9CA 5K9JH 2C9AA 5LVEA 1TITA 4N0YH 4HPYL 4QXGH 4DGVH 3LN5B 5BO1H 4K55A 2VLJE 1TJHL 5DEGB 1HH9B 3FFCA 3QP3A 3BPNC 2C1OA 2DM7A 3IKKA 4JM4L 1VGEL 2AERT 3CIQA 1TPXC 3RPKA 5SWSB 4MYWB 4HFUL 4YFEA 1G7HB 4AIXA 3HZYB 2P49B 2VITB 1CE6B 3BH8A 5KVDH 3S88L 4P23C 5IOPA 5F1NB 1R3IH 4NKMA 1AI1L 1ZK9A 4FXLA 5DFTA 5GS2D 4UTAH 2FX9H 4TSBH 3BPNB 4DUXA 1IAIL 3SDAA 4OGXL 5E00B 4LLUB 1NEUA 1IC5L 5JO5A 3D0VB 4R8WL 5IVXA 1UXSB 1TPXB 3ARZA 5D9SA 5HHOA 1NANH 1ED3A 1JGEA 4P23B 4F7TA 1HXYA 4Y2DC 4Z95L 1KG0B 1H3WM 4JDTL 4URTB 3KYNB 3SQBA 4OGYL 5MEQB 3BESR 5JPMB 1A6VL 4Y19D 3CLEH 4NZTL 4NQSA 2P5WD 4F3FB 4DN4H 5JW3L 1RIHL 3K80A 4MJ2A 5FM8A 1ZLUH 1SM3H 2Q7YA 3IFLL 3ARFA 1T0PB 3MRBB 5KVFL 1T21A 4HT1L 4Y2DB 1S9WA 1NMCB 2A9ML 5EU5B 3WXVL 1QRKA 2FO4A 4H5SB 1IE5A 5ALBL 5CILL 3K1DA 1CL7L 5DVNA 2BNQB 2NW3A 1KELL 3G6DH 3U4EB 5EOQL 4LQ1A 4PRAB 1XR8B 2W59A 2VL5A 2HT3D 3GJFA 4R2GC 1BZ7A 2X5PA 1HHKB 4L4VB 3MYZA 3LQAC 1I1FB 1MAMH 4UV7L 1JN6B 5EULV 4FA8A 2CR6A 4KK9D 1RUQH 1A7RL 2W65B 4X5WB 4DVRH 5D1XC 5ACMA 5IJKA 1QRNA 3WEXB 4PRBB 5C6TH 1IGCH 1I3GL 1EEUA 5F7HA 1L9MA 3QUXC 4LQFL 3DVNA 4I3SH 5I1KL 4R2GB 4I4WB 5DYOB 4JHAL 1RIUL 4OUUB 5IB3B 1D5ZB 5CJQH 1IL1A 1JGVL 1F4HA 1J0HA 4OLXL 3IDNB 2Z93A 5D1XB 3QZWB 1KFAL 3MRGB 1RZ8A 4K3EH 4ODUB 4Y1AB 5J6HB 1A9EB 3ILPA 3QUXB 2CLZA 1Q1JL 5E94B 3LQMA 3ZSTA 1K4CB 5LGHL 1D9KA 2V5SA 2VIRB 5D72L 4JO3H 2GFBB 4N8VB 3O6LH 4GRLC 4YPGA 4LLQA 4RGND 3ARDC 1EAPA 1H9VA 3ISWA 1WT5A 4JO1L 2D7TL 4HHAA 3WS6C 4BSWB 1F11A 1X5KA 4PJCA 3BZEB 4H20H 5HVFB 3BSZH 4NWTL 3LS4L 2X9WA 5FEBA 3AXLA 4GRLB 1K9TA 3QT2A 1ORSB 2H2SC 4ODVH 2XA8H 3ARDB 3QDMB 3TVMD 5I16B 4JY5H 4LLDB 4G6JH 3BDBA 4JFFE 3QIWC 4OTXH 3L3DA 4XVTL 4M62L 4MZ2A 4HX1A 5B39A 2AJYH 4PJDE 4R4FL 5EZIH 5IEHB 3FB8B 3QXDA 5JDJA 3V0VB 1AGDA 5T5FL 5BZDA 1V7ML 3J7HA 2WUBL 1GC1L 4L8DB 1A6WH 3QIWB 4U1KB 3VRLE 4HS3B 4YHML 5TDPA 5JW4N 4LRIA 1TCRB 5IIEB 4OGAD 3RNQB 5I2IA 4NO2A 3DXAE 3O11B 1T7YA 4WW2C 1ZSDB 3LZFL 4Y8DC 3TO2A 4JGMA 4PTTB 2DI8A 1KJ2B 1BAFH 1CLCA 3LH2H 4O2FB 1Z6JT 3B9VA 5KVMC 2PYEB 4U05A 2J5LC 4JAMB 2V9QA 4KK8D 4G8IA 1IGIL 4HIEB 4KTDL 2E6JA 2FECI 1J8HA 4KRPD 4UT7H 3V4VL 4WW2B 1NBYA 1CDYA 2W0FA 2VSDA 3LY6A 5GRVL 3DMMC 3L6FA 2XI9A 1AGFA 1C12B 1AD9A 1NQBA 2B4CL 2J5LB 5ANMB 5E2UL 5HGAA 3CC5B 5BOPA 1T1WB 2L7JA 3DVIA 3CZFA 4R4BB 5JXAH 5FGCE 4KI5E 5DDHB 4Y19A 3O3BB 4E41E 1DQDL 1PX3A 2X4NA 2XFXB 1TZGH 2P5WA 1OCWH 1PJ9A 3DMMB 1N6QH 3DV4B 3BRDA 5DJ6A 3BRGC 4K8RH 1AP2A 2AJXL 4KAQL 4UIMA 4YIQA 3ZMRA 4R26H 2O61B 4ZO6A 2JJUA 3B5TA 2ATPB 5C3TA 1FAIL 3VXUD 4RSVA 4JY6B 4XWOC 5DS8A 4G43A 1BBDH 4BSJA 4TULL 1TETL 2NXZD 3O45A 5E2WH 43C9B 3BRFA 3HI1B 4YBQD 5AYQA 4OZIE 1TCMA 1BZ9A 2DYPB 1A02N 4XNUL 4Z77B 3H3BC 4NPYA 4O4YH 3BI9X 4ZUVB 5IWLA 1H5BA 2CKBH 2ESVD 2Z31D 3DX7A 3MX0A 2FJHA 5CUSL 1SEQL 4G8FA 4MGXA 5BXFB 5E4EC 3MV9D 3L5IA 5BS0E 3T3ME 1L7TH 4OZFB 4HWNA 5GGUA 5I1GL 2GJ6E 2AV1A 2W9EL 3GMQA 3FO2B 3U9PL 4GS7C 1C8PA 1NDMA 4QXTB 1DBJL 5JQHC 2JE8A 4O2CA 2X4UB 3B9KD 3VRLF 1RUPL 2EIBA 2ZUQC 4TVPD 4UUJB 5E4EB 4O9HH 4R3SB 4IHOA 1WZLA 4NYLA 4U1MA 4YDIH 3FT2A 4XBPB 3T1FA 4GS7B 2X05A 1S9YA 4IOFD 2GSGA 3BP7B 3SDCD 3S34L 3U0PA 4YXLH 2Y06L 5IMLB 1G1CA 3V5HA 2R2EB 3T77B 1RQ5A 2J6EH 1BQHB 4G42B 2ZUQB 1KJ3H 1BEYH 1U36A 4L3CA 3EOBA 4HV8B 3U30C 3M1BB 5KS9B 4PG2A 3NFSH 3GMMA 3TWCL 4H25A 4JFED 4GUPA 4Y88A 4EDXB 2ICES 1FVEB 3QFJE 3BZDA 3OB0H 3TT1L 3KYOA 3O2VH 3EYVA 2CQVA 3V9FA 5GS3A 1MCRA 2A6DA 4XC3H 3U30B 2G9HA 1A6PA 1KJVB 1Q72L 2XY2A 3RY6C 3C2SA 3MA7B 4V2CB 4KI5F 1BIIB 1OF2B 4U2ZA 3X12B 1M7IA 3WSQH 4HIJB 1ZLWK 4NQEB 4MB3A 2YK1L 3SDYH 2YN5A 3SGJC 2XTJD 4JHWH 4Y4KA 1MI5B 1UWGL 5DURD 1BD2D 5GISL 4AY0A 4PJAE 2IH1B 3QAZC 2VDQH 5HYEA 3EYQC 4PYGA 1S7WA 1F42A 3CK0H 1FJ1B 2B20A 5T3XL 4K7FA 2V7NA 3ZHLA 4C55A 1I3RA 1QNZL 4X7TA 4HSQA 3VW3H 1PYWA 3DUSB 4RGOL 1T5XB 5F88A 3I6GB 2G60H 4LSQH 4KKLC 4O2EB 4CW1A 3PGDB 4YDLC 1OT2A 3QAZB 1GHFH 1M6OA 2K3TA 2XICA 1YYML 4YR6A 4HJGB 4OFDA 5EO1B 3G5XA 1S7TA 2A6JB 3CVIL 1NFDB 5EBGA 2K7QA 1UWEL 2UZYB 4OFIA 1U9KA 1MHPH 5GIRB 1MF2L 1HNGA 1KPRA 4OZIF 2NY6D 1RZKC 2OR9L 3W0WA 2OL3H 4DZ8B 3T0WA 3QEGL 1U0QA 4X5LA 2YRLA 3QIBD 4Z7UB 5D2NC 2R4SH 3B2VH 4P4RB 1F8TL 4KRNA 3ET9F 1LP9A 1TZIA 3VDCA 3OHXB 3QB7C 1QLEL 1U3HC 3MOBL 5DQDH 1CXEA 4KPHL 4QNPE 4P2RB 5CBAB 3GMNA 3F6IA 1FDLL 2R4RH 1L9NA 2J8UA 4HWBL 3TH2T 5D2NB 3RVUD 4BA8A 5FYKL 1BFTA 3E0GA 3VXUA 1U3HB 3MQIA 3VXRA 1ND0B 4LK4A 5CP7B 2E7CA 2OI9B 2HFGL 5I30H 1N5YL 3UPAA 5JIKA 3QPQC 1S7SB 5HYSG 1JRHH 3EFFB 4OCWL 4OM1H 4C56B 2OJZH 2GSIB 1KBGH 2VL4A 4F57H 3NH7L 4ZQKA 2R1YA 3GSNH 2ESVA 3UZQA 2VB5A 2RAMA 2Z31A 4ZD3L 1ZGLM 1AIFB 1DN0B 1T22A 2PYFA 3NAAH 3MV9A 5I1LB 1MQKH 4LKXA 4RAUB 4XC1L 1WTLA 4WGWB 4XPAH 3FO1B 4IRZH 3S96B 1YY9D 4GMTL 4AEHH 1X5HA 1CLYH 4HLZH 1NCNA 4YAQB 3R1GL 4I8DA 5FHAL 4WNQA 5ITFA 4JKKA 4GQPH 1JK8A 4KFZC 2BCKB 4TUOB 1ROWA 1BOGB 4EUPG 5FYKD 2EEDA 4LLWA 1V3MA 3OPZH 4PJAF 1EBAA 3SDCA 3RBSA 2OSLA 5KSBA 1G7QA 3D2UD 1ZHNA 4GKNA 1VFBA 2V2TA 2QBWA 4JG0H 4ZFZB 5KANG 3UTPD 4HWEH 1P7KB 2ILLA 1D6EB 1NGYB 3P30L 2BJML 5CEYA 2Q76A 4H0GA 2WWKT 2LAGB 4KMTH 4FP8H 4QXWA 1V3LA 3O6KL 5ESQA 2XKNB 4YWGH 3DURA 1MNUL 2YMXL 4JFEA 1S7QB 1ZVHA 4LCYB 1XF4A 4ODBD 4D3CL 1MJUH 4Y7MA 25C8H 3U7YH 4QRSB 4D8PA 5A2LH 4JFXA 5C07E 1VGKA 1FE8L 2HJLA 4XP6H 4XP5H 2FGWH 5HI5D 2CLVA 5C08B 1OAYH 1I1RA 4U6VL 4BH8A 4KQ4H 3P73B 1IGFL 4P2CG 1VFAB 5FOBA 4L4JA 5DK0A 5DJ0B 3FCTB 1JRHI 1BD2A 1JCKA 1MPAL 4JCLA 1BFOA 4V1DB 1T6VN 1CGYA 5JQ6L 1QLRA 4KKBD 1B0GA 5B3NA 3L7FA 2LQRA 2ADIA 4MD0B 1OM3L 2VABA 4NO3A 5C2UB 4NN5C 4DGIH 2A9NH 4XPHH 4F9PA 4TSAL 1A6ZA 2HVKB 2HA1A 5DJ2B 2HKFH 1LD9A 3DRTB 3V6ZB 2AAVA 3AC0A 3MMEA 2K1MA 3QFDB 1YQVL 1HYRC 1INQB 2XZQH 3PNWB 2VXVL 4RDQG 4NN5B 3P2TA 5IP4A 2C4XA 4K3DH 4P9HC 2C5DC 4YHLL 1DQQB 3KPLB 4C57C 1GGBH 2CRYA 5I0DA 2EKJA 1FNGA 3RVTC 2Y72A 5LXGL 5JIPA 1ORQA 3CFKA 1RMFH 3RKDD 5CJ5A 3QIBA 4EOWH 1KPUB 4FTVE 1ZLUK 2C7UB 1J5OH 1FH5L 1MJ7H 5IHUL 1J1OL 4JN1H 4R0LC 2YBRA 4NKOB 4XP9L 3U83A 5IROC 3H2WA 2OMNA 1ACYH 2JIXA 2DAVA 3PWLB 1JNLL 2NY5C 4NUGH 1OQXA 5I1DB 5BMFL 1EHAA 5DMGD 1FVDB 5DRNB 4ODXB 4S1SL 3LB6D 2F54D 3BEVB 4P4KA 2ZJSH 4NNPH 5MERB 3ARTA 2QQKL 5BJTA 4G5ZL 1OHQA 4R0LB 3X14A 4WWID 4WW1A 3ZDXF 1EHXA 1QFUL 3NA9H 3RL2B 1P5UA 5K9KB 1NAMH 4YC2C 1YJDC 5EB9A 5IMKB 1T20A 3MV8E 5CJXC 4N68A 4Q0XH 2CGRH 4LSUL 4LSSH 4WI7A 4K2UH 1CGVA 1ERNA 4GT7A 3QUKA 4K7PH 4JFHD 4YUEH 2DB8A 3TZVD 2WBJC 4Y5YA 1ZA3B 4HDIA 1LDPL 3FRUA 5C0BE 2CH8A 3ULUH 3QDJD 2MKWA 5DI8B 1I9RH 3PIQB 4YHZL 3KNBB 1T83C 2WANA 3UAJC 1UB5B 3GDBA 3SN6N 3RWIA 1CBVL 4MQ7B 4TVSa 1U8MA 3ULSA 1W0YT 5HHQB 2WBJB 3E2HC 5GS0H 1Y0LA 3B9DA 5DJ8A 1DQLH 1FFNA 3LV3B 1YYLH 3BDYH 5SWZD 1TZHA 2A73A 3T65A 1TJGL 2C3VA 3VGDA 3NGBC 5FV2A 3M17B 4HWBA 3UTTD 4ZTOL 2IH3A 2ITDA 2CJUL 5F7DB 4RMVA 4E5XB 4YQXH 3VH8A 2VWEE 5FB8B 2XZCL 3E2HB 4QXUL 2E9BA 1IZJA 4PJFB 1TENA 4Z7WE 3D2UA 1YNLH 3GI9L 2LU4A 4OFVA 2QQNH 1V3KA 3RWGA 3B9KC 1OAXH 3EZ8A 3NGBB 1E4WH 3CXHK 4DFIA 3VE0B 4UI2A 2UYLB 1KCVL 1K8IB 1T1XB 2WM0A 4OCMC 3BPCB 5CZVH 1WZKA 4X9BA 5EC2A 3BOVA 3B43A 5D2LE 4PLJC 4P59L 3E3QC 3B9KB 4NRXB 4HUVB 4OFYD 4JVPA 5IM7A 4LLYA 3CD4A 1QTYT 1F90H 1VKXB 4ZPTA 3GO1H 2W0PA 4M5YH 2NYYC 4UB0L 1JIBA 1A3LL 2G5BA 4M7LL 3BAEH 3ZZ1A 1MOEA 3MUGB 2OJEB 4JPVL 2VDLH 3F12A 5L7XH 3HB3C 4HKZB 4X6DB 1FZKB 1A4JB 5A3IC 4XP1L 1MEXL 3BZ4A 1YMMD 3OR6B 3ULUE 3NIFF 3FONB 4ZS7H 3MLYL 1ZHBA 2LU3A 3W81A 3QCTL 4ZYKB 4LSPH 2EDXA 4EEEA 3WIFA 1OQOA 32C2B 1CWVA 3GBNH 4CU7A 3OQ3B 3OXSB 4NKIH 4GW4A 4JZOA 1U3JA 4R96A 2ZOKA 3L3HA 3WXWL 4FNLL 5KSVB 1C5BL 1G7LA 2X40A 5D1ZA 4HW6A 1WWCA 4UIKL 3IETA 4KKAD 4OD1H 2E27H 4NM4H 5DURB 3UJIL 3ZL4H 3QCVH 4RQQB 3MV01 4I1NB 3QHTC 4DGYH 4JR9L 8FABA 1K8DA 4N9GA 4X7EC 4WDIA 5JXED 3S35H 1PSKH 1HIMH 4KKCD 3B3IB 1R3LB 2ZWLT 3V6FA 2X41A 1ZWIA 3MRPA 4P3CH 2H32B 3VFOA 2FR4A 1W2KT 3VFUA 3D5OF 4X0KB 5ID1B 1RUML 1GXEA 1SQ2N 4MA3B 4X6CE 3HPLA 3C5SB 1H15B 3NFNB 3SOBL 3LSOB 4PRIE 5L8KB 1A64A 3GMLB 4G80A 5GGTH 5IF0B 4PJEB 5KTEH 5HYJE 1ZTXH 1CGTA 1B90A 2BFVH 2F8VA 4QRRE 3C5ZC 4X4YB 2GK0A 5KOVC 4I0PD 1H8NA 4OM0H 2GUOB 5EBWB 4ZFOL 3ARPA 3AFLA 1Q94A 4Y89A 1HNFA 3HG1B 1U2CA 1YPZF 4TSCL 2D9QB 4QRUB 4KI1A 5FDWB 3W9EB 2BP3A 2HFTA 3UJJH 1EHLH 3TZVA 4WUUD 2BVQB 2QHRH 2IADA 3QISA 2F5BL 1WFOA 4OLVL 3BQUD 2ED9A 3D6GA 2PO6D 3D39D 4GQ9H 4OAWB 3QXAA 3DSNA 1NC4A 3TO4C 2ZSWB 1G7HA 1W72B 1ZHKB 2FRGP 4TTDD 2W9DL 1CE6A 2BVPB 2AW2A 1QFWM 2AJ3A 2IFFH 5K9QG 4P2OC 1DSFH 1JHTA 5L6YL 2W91A 3EW3B 4HUWB 4UDUB 2Z92B 5E00A 4NHUB 2Q87A 5IBLC 4QTIL 4B53A 2W0KA 1U8LA 2R0ZL 5JDSB 3TO4B 4D9QE 1J7VR 4N0UA 2Y4SA 4NC1C 4NJ9H 1WZ1L 2E7LC 4P2OB 1MFBH 1YEGL 3IFNL 5I66B 4EN3A 3Q1SH 3W11D 1AGBB 4QF1A 3KYNA 4EJ1C 1T2JA 5TE4H 3NA4A 5D6DC 1UH4A 5A16B 4J7RA 3NPSC 2H6PB 5EU7C 4F3FA 1WWAX 4OZHB 5E1AB 3TBYB 4PJ7B 1EEYB 4JDVA 4CUCA 1R5VB 2BY3A 1GPOH 3DI2B 1JWSA 5HYSA 1SEBA 3GEWB 5JZ7C 5D5MB 3DVFA 3LKQB 4PJGA 1L4IA 3NPSB 4HIHB 3TA3D 2ARWA 1FC1A 4FQLL 3CSYB 1G84A 5EOTA 1S5IH 4U6YB 3U4BL 3MLVH 3TJEH 1I85C 1JN6A 2YS4A 1DQJA 3DI3B 1P6FA 2ZG3A 2HTKD 4MVBD 5C0DB 3GMPA 2DM3A 3MV7B 3NCJL 3QQ3A 4LHQB 4RGMC 3TCLA 4NZDA 4NM8H 5KN5B 5DA4A 1YMMA 3GMOA 1MLCA 3T2PA 4OUUA 1D5ZA 4PY7A 5EZLA 5JIHA 4CMMB 2DIBA 4J8RA 2D2OA 4EUPA 2ADJA 1P7QB 4OZGE 1YUHA 3O6FD 5TF1L 4O02L 1OLZA 1OTTC 2E9JA 2A6KA 4RGMB 1VESA 5I1EL 5J6HA 1A9EA 3IDIA 5E94A 3U6RB 3WE6B 3N1MC 3GJEA 1A3RL 2G5RA 4KVCL 4MJIE 4N8VA 4MDIA 3RP1A 2EDHA 2NTFB 4H8WL 4O51B 1RUAH 5JXEA 2NQCA 1QG3A 2EC8A 4PGJA 1RZJC 5T1MA 1T0NB 3RY5A 5I1CL 3GSXB 2ID5A 5FYLL 3IDMB 1I9JH 1NL0H 3HZMA 2VTFA 3SDXA 3ULVC 3EYFB 1ORSA 2QR0A 3ETBF 4WI2A 1PG7L 4AT6B 3I3EA 4NO5A 1FNEB 5CJOH 5I16A 2MHAA 1XGRA 4LLDA 3ZKMC 4MD4B 3GRWL 3QG6B 1KIRB 2CUMA 3DRQB 3DPBA 1YEIH 3H42H 1BVZA 4I18C 5FCUL 3EJYD 3T2NL 4U2YA 3U0TA 5DMGC 3FQRB 4I0PA 4IOSD 3CX5K 2ZUYA 4OZ4B 1CIDA 2D03H 4U1SB 3QCUH 4ELMB 2QQLH 4YDJA 3TYGL 3FB8A 1K5NB 5ISZE 2JB5L 3QIWA 2MMXA 4GAGH 1J88A 2F53D 3EYSL 4I18B 2E6PA 4TQEL 4CN4A 1DUZA 3ORJA 2GY7B 4JANA 3BQUA 1IT9L 1FN4A 3QQ9D 2PO6A 3D39A 4NDMA 5IFJA 2QADC 5E2TH 1VFUA 3LHPH 4JN2A 4PTTA 1S7UA 5BW7C 4TOYH 4MCYB 1QYGL 3ZE0E 5DT1L 4QGYA 4ZNCD 5GZNC 3MA9H 3DARA 1VACB 1JGLH 3SE3C 2OM5A 4MHHI 1A3QA 5DQJB 5FYLD 4YHNB 4F2MA 2ZPKH 4NRZB 4WW2A 2BVTA 3P3YA 1G9NL 1QEWA 2OR7A 3CMOL 2QADB 1LNUB 1U8IB 1S5HB 4PJBB 1F3DH 5CMAB 5I18H 4X4XB 5IJVA 1S7RB 3BN9D 1C12A 3O3AA 1CLZH 2CR3A 1ETZA 1FYTD 1HHIB 1QVOB 2Y6SC 1OAUL 5C0CE 1MFEL 4YO0A 5SV3A 5MEPB 5DEFA 5IBUG 3OKOB 1T1WA 1YY8A 4W81A 4ZFOA 4R4BA 4E0RB 4XH2B 3MPCA 3O3BA 3U9UA 1N4XL 1ZEAL 1T66C 4FQIH 5DC0A 5CEZH 3MJ7A 4DZBA 4F80A 4PJIE 1NUNB 3T04D 3JTSA 4DCQB 3DV4A 1YN7A 1FZJB 4OZGF 3GSRB 3BKCH 3C6SA 2FIRT 1J12A 1LHZA 5ALCH 4BZ2H 3X3FH 1E4JA 4KRMB 4NQCE 5SWZB 4Z7VA 5CSZB 5IFHL 2BXZA 3NN8A 2VN4A 4QRPB 3UTTB 3TA3A 1OPGH 5M95B 4L4TB 3L3OB 5DZLA 4KDWA 4LOUC 4LGPB 2YPLD 3H9SA 3IAQA 3SJVD 1D5BB 1F4YH 2FJFA 4NGHL 4OB5L 4FQJL 5DD5L 4FFYH 1UCBL 2VKWA 1IQWL 1F4WL 5C09E 4U1LB 4AIZB 5FK9A 2BNUA 5E99L 2DQDH 2QQQA 3GNMH 1UM4H 2Y7QA 4JHZA 2DYPA 4MNHB 1P4LB 3T0EE 3CLFL 1WCBB 2D31B 1AR1D 2O26U 1SJVA 2RJMA 3KGRA 1EH9A 1MAJA 1PKOA 4LMQI 6FABH 4PP1C 4LMQE 1A6UH 2IGFH 3K8LA 4JFZH 4M02A 1SY6L 4HF5L 4HWUA 4FQQB 1QSFA 4X6BA 4CKVX 3I6KB 5BXFA 3P11L 1XT5A 4G9FA 3HE7C 5DVKA 4JPKL 4XI5D 3QDGE 1WWBX 1EGJH 4FQ2H 2HTLC 3PWJB 2EDFA 1KCUL 4X99B 3GB7A 1OVZA 4WI3A 4DQOL 3OMZA 3SKUD 2VLJD 4YHPA 3SKMB 4UUJA 5DF0A 1NCWL 5KVGL 3V6BR 1OAZL 4FS0A 3SDDC 2UWEE 3HE7B 2H26B 2DICA 3BT2L 3T3PE 4IRSD 1A14H 4WGVB 5E5UB 2VR4A 5GRUH 3DGCR 5DEZA 4ODSL 2FEDC 4PJXE 4U0QB 4PFEA 4GXVH 5CEZE 1IC1A 4HV8A 3SDDB 5KS9A 2AQ1A 3MLUL 3RDTD 5DRZA 5EO9A 1QFWI 3FB5B 4LP4A 4LVOC 1Y6NR 1R24A 4DWHA 4QXGL 1BWWA 2D0GA 3FOLB 4FG6C 5DRWB 1DBAH 4RMQA 1B6DA 1KJVA 3C5JB 3BH9A 5A2IH 3BGFC 3WUZA 1R5WB 3EDFA 3WUWA 1MY5A 5EWIH 4LVOB 3E1F1 4OLWH 4HIJA 2F53A 4RBPK 3C8KA 5C0IA 5KVDL 1MI5A 4P5KA 3U2SB 3SGEI 5AAWA 5GRZA 1NGPH 2VLLA 2XWJA 1R3IL 1JFQH 1HHJA 3QEUA 5C0AE 3HFMH 2FX9L 3VGBA 5HHVH 2EIEA 2X9XA 5I1JH 3EHBC 1TVBA 3BGFB 3BX7C 1N8ZB 3UBXB 3FFDB 4ORGA 3DUSA 2IBGA 3NOIA 2X7LA 4QWWC 4O2EA 1KOAA 4R4ND 5C0GA 1FHGA 1TQBC 4PJHE 2KZWA 3F7YA 3STLB 3C60D 2DQFA 5JA9A 4GH7B 3UC0L 2ZNWA 4O00A 1G9MC 3GRWA 3V5KB 2AS5M 1TVHB 1YJDL 4R90H 4WUUB 2ENYA 3G04B 4ZUTA 1SM3L 5KBNC 4Z78B 3I85A 1WWWX 1TQBB 4NCC2 3TM6A 4JRYE 2PN5A 1HWHB 4CNIB 3HS0B 4P4RA 4KZEH 2R0WH 5JNYB 2IQ9H 3G6DL 5GRJH 2R2HB 1PQZB 3SQOH 4XTRD 5B8CA 1FG2B 5KVEL 5EPMB 5FFLA 1Z0MA 3NZHL 4A2MA 1YNKH 4X4ZA 4EVNA