2UY7A

Crystal structure of the p pilus rod subunit papa
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
216
Chain Sequence
AVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords PERIPLASMID CHAPERONE PAPD PROTEIN
publication title Crystal Structure of the P Pilus Rod Subunit Papa.
pubmed doi rcsb
source organism Escherichia coli
total genus 41
structure length 216
sequence length 216
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uy7A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uy7A01
4F7PB 2F5AH 4IIQA 4RAUB 2BNQD 1I8LC 1A6UH 5D5ME 3SE8L 3LDBB 1J1OH 3AY4C 4NFCA 4YK4B 2JJSC 5LCVL 2R56L 4L4VB 5JW3L 4A2LA 4OGXH 3PHQA 1J1PL 4Z7NF 3EYQD 2PYEA 3LKRB 3VRIA 1ZS8B 2DICA 4KROD 2ED9A 5ID0A 3UX9B 2QHRL 5EU5A 2DLIA 5GGTL 3L3DA 4HIIA 1R5VA 4KKBD 4KDWA 5EU4B 4ZFOB 3L3HB 5EN2A 3SDXF 5AZEL 3LKNB 3NN8A 1T83C 4OLYH 3AAZB 4LVOB 4P57A 1H8SA 1DBBL 5C0AB 2R2BA 1F3DH 5C0DB 5K9KA 1TVHA 3REWB 4OSUL 3VRJA 3U46A 5KN5B 1AKJB 3MRLB 4Z7UA 4Z95H 2B1AH 2VAAA 4WU7B 3RU8H 3RWIA 1F8TL 3SO3B 5JUEH 3MGTB 2YK1H 4Z6AT 2CLRA 4JHAH 3GUTA 1GGBL 1HKLL 2AXGB 3B5TA 1CDHA 3ARDB 5FGBC 3STBA 5DRZB 1QR1A 3GMRA 2E27L 4WFFD 3SEPA 1BPVA 4PJFA 1NJ9B 5EUKA 3RVUD 4TQEL 4FQXD 1R5WA 3V6FA 4NHUB 3MO1A 3OQ3B 1NKOA 3ZYIA 4DZBA 3CFDB 5FCUH 1GH7A 3EJYD 3IF1A 4R4FH 1CF8H 2YKLL 2Z8RA 3S37L 4QRRA 4U3XA 3NTCH 4CMHB 3MRFB 1WEJL 4NZTL 1RVFH 4ENED 5IIEB 1WC7B 1HHIA 5J6HA 3U36A 2FATL 3VXOB 3SDCB 3FT3A 2EYTB 4LRIA 1XR8B 3VE0B 5T3ZD 2FGWH 1YEFH 2W60A 3ECBA 5A3ID 4OQTA 4H1LH 4FQXA 5CUSH 5KVDL 4NNYA 2HVJA 1QRND 4JREB 2RIKA 3PWNB 2IFFH 2G5RA 2XZQH 3O0RH 3GI8L 1NBVL 2VXUH 1NC2B 5HDBE 1OGAA 1N6QL 5DEFB 4EUPG 3G6JE 4PJBE 4XRCB 3HB3C 4K7FA 2OP4L 4NGHH 3RFZC 4LCWD 4H25A 2GQHA 1AY1L 1E6JH 3BKYH 3CCHA 3IFPB 3FB6A 3ZT5A 3LKPB 2AJZB 4LLYA 1EBPA 1T21B 2G5BB 1YYLH 2QSVA 4S1SH 3SN6N 4M7LH 3RUGF 2GY5A 4Y1AB 3O3UN 4WU5A 2NR6D 2C26A 3FFDA 1RURH 1UC6A 4D9LH 3MRJA 1HSBB 1RULL 3NPSB 4UTBL 4GMTL 4MB3A 1JGDA 3BW9A 3KJ4B 3O3BB 3QJFB 4CVUA 4ETQA 5F7EL 1K4DB 3VXUA 3DHMA 1U58B 1X7QB 2R69L 2W65B 4DKEL 4AIOA 1FDLL 1RQ5A 4AM0B 1OTTC 4KKCC 2A2QT 1QSVA 5T1LB 1N59B 5JLZA 4MQSB 5I16B 1I9IH 4F7PA 3OR6B 4YLQT 2XV6B 5I19H 2R2HB 4KTEH 1ZGLB 1MIEL 2BCKA 4X9IA 5D2LA 1FFQA 5J13B 4OCYH 3ZE0E 2ICEA 4RAVA 5FOBB 3DETC 2DL9A 4DN4H 4UMGA 1NEZG 5C6PB 1B0RB 1OP5K 4KI1A 4ZOEA 3GRWH 1VEPA 2R0WH 3M45A 3ILQC 2NTSP 2APWA 1Q72L 4XPTL 1MCRA 2BOCA 1I3GH 2VXSH 4OFPA 2VE6B 1CICD 5HJ3A 3LN4A 4AIXA 2B7DT 3D3VD 3I6LD 4TSCL 1IEAA 1EHNA 2ICES 2IGFL 4LPXA 1J11A 3BWAB 3QI9B 3QNYA 3LKNA 5T33H 4I13B 4HIHB 5C0RL 3AAZA 5ITFA 4QOKB 2R1WB 1HK6A 3QFJB 5F7DB 2Q7YB 5C0AA 4MCYB 3BDBA 4NNXB 3KPOB 5IHBA 5C0DA 1FG2B 4J8RB 5J57B 1J0JA 3K46A 4MA8H 4HUXB 3SGJA 1WAAE 1JV5B 2DQGL 2BFVL 5IM7A 4W6YB 3U7WH 4L8SA 4PRNA 3C60C 1A3LL 4HG4K 1CICA 4LQ1A 5IQ9B 4TNWK 5GGVL 1KPUA 1AGCA 2YD6A 3X17A 2BDNL 3BKMH 1ZHNB 2FLBT 1JRHI 3X11A 1RK0A 5DRZA 2CDFA 3IU4L 5KSUB 4NKDB 1SY6L 3MRMB 4GKZB 4KWUA 3T0WA 1FL6B 5I75C 3LPWA 5ICZA 3KPPB 1XAUA 1A6AB 3UJTL 1KG0B 2CR6A 1F42A 3QG6A 1FL5A 1GRWA 1HQRB 2HMIC 2I9LB 2HFTA 3LZFL 1IGYA 4LLWA 1YJDC 3FN0L 2M2DA 4AEHL 5DQ9A 1B4JH 3UAJC 1XR8A 3FO0L 3WUWA 4IMKA 4R4NC 1A7QH 1D5XB 1UQSB 4G6JL 2OXHA 5FGRA 1ORSA 4BJLA 3QH3A 4DEPC 1UGNA 1I1AA 1SYVB 4NOBA 2NLJA 3TBTA 5I8EB 5E70A 2HFEB 2X1QA 3HZYA 4QHNB 5LAXA 1NC2A 3G5VA 3EOBA 2X2YA 3EGSA 3MYJA 5B38A 4XAKE 4LVEA 4YDKL 5KSVB 2HAZA 5FHAL 3U9PH 4K7PX 5BVJA 4LLUB 2OQJA 3IFPA 2LU4A 4KVCL 4PJGF 5JHDA 1A2YA 2AJZA 4YZFF 4ODWA 3HZKB 2Z0BA 1ZHLA 4G8GD 4DGYH 3ARPA 7FABH 2Z4QB 2VXQH 2GSIB 4HC1L 2W91A 1OP3K 1T1ZB 2IAMC 2PF6A 2VXVH 4KJWC 4QNPE 4CVXB 3IKKA 2R29L 3GKWH 5D7LA 2H6PB 5HI5D 1X7QA 3MLRH 4G43B 3L3IA 5FUOL 2W65A 3LOWA 3UTOA 1PY9A 5IWLC 4U1MA 5BZDB 5ESVB 1FGVL 1DQDH 1OAQL 5BQ7B 2XNAB 5L2KB 1MI5B 2X10A 5DJ8B 12E8H 2BXYA 3OR6A 4K07A 5A43C 2Y7QA 1AGDA 5J3HD 3P30L 2DLFL 3O81A 1KTKE 1HWHB 2DM2A 3EFFA 5JHLL 5EWIH 4Q0XH 2B5IC 1RY7B 1VA9A 4M93B 1A21A 5DLMH 4ZNCD 3SDDC 1OF2B 2EE9A 4X7TA 3UTSB 4MJ2A 4GAJL 5ICXA 1NAMB 2VDKL 4XMKH 4HJGB 3HUJF 3TN0B 3MFGB 1V3JA 2R4SH 4G3YH 4ZDHB 1T0MB 2EDXA 4UU9A 3OKNA 4EDWL 2HRLA 2J12B 2R1XB 4YBLB 1X44A 1U8QA 2VE6A 5E8NA 2OK0L 4LPYA 2DQDH 3DVFA 4I18A 4IDJL 1IEHA 5TE4H 1WGOA 2OZ4A 4LLVA 2HWZL 4N68A 4KKCD 3LKSA 3ARGA 2AV1B 2R1WA 3ME0A 4QOKA 5F7DA 3TVMC 1XCTA 1Q0YL 5D2NC 1LO5A 5DURD 2D2OA 5EO9B 1FG2A 3D25B 1ZA6A 2Z92A 4J8RA 2AI0L 1JCKA 3I50H 4HUUB 5DC9B 1JPFA 1JPTL 2IH3A 5HDOA 3W9EA 4PV8A 5IQ9A 4JHWL 2HVKB 3G9AB 4ERSL 3VI3F 2OSLB 3QDAA 3FQXB 2CUIA 3SQBA 1YEEH 4UILL 4NKDA 4R7DB 3S5LA 3KPRD 2ED7A 4PJHF 3V4UL 2VLKA 1FL6A 3LKOB 1IJ9A 4UV4L 5C2BL 4HXAH 1Q9KB 4NO5B 1JYXA 2GK0B 1YJDL 5E4EB 1HQRA 5BO1L 2OTWB 4JFXB 1G6RA 2I9LA 5DGRA 3TPUA 3WIHH 1FN4A 5CEZL 3BIKA 8FABB 4YHKL 3HMWH 1HZHL 1AHWB 2MOVA 2E9IA 3T3PF 3OKOB 3VFRB 1I9RH 3PIQA 4HS6B 2WBWB 2AW2A 5HYFA 1NDMB 4HSQA 1QSEA 1CDGA 3C60D 3NIDF 4Z7WB 1OB1A 1UM4L 5DVKA 2YA2A 4HJ0C 1OSZA 4AT6A 4MX7B 5I8EA 3V6BR 3ZYZA 2R1YA 1A64A 3V9FA 3MLUL 1LEIB 2YBRB 4UBDC 1A6VL 4L3EE 1UCBH 2CIIA 3MA9H 3OAZK 3QNZA 3WFBH 2DQTL 3BP5B 3MNVA 1TJIL 1T1WB 3C8KB 2OJEB 4UT6H 1T3FA 3BDYL 1MPAL 2G60L 1LE5B 3K80A 2DN7A 4RQQA 3MBXL 4MNGB 5E94A 2HMID 5E5RB 2XWTB 5KZCD 4BFEA 1ZWIA 2DQCH 4N8VA 3FO2A 2IC2A 2UWEE 3HZKA 1YY9C 5GISL 1R3JB 4Y4KA 2OR7A 3QPQC 4ISVB 1OAZL 2Z4QA 4OZGF 4MNQB 1LDPH 3ABZA 2Z31A 3CX2A 3JTSB 3ZTNH 1BQLH 2PO6B 1J7VR 1NMAL 1V7NH 3INUH 5D6DC 3CC5A 4CVXA 2DTSA 5CILH 3MRIA 3QDMB 1LO4H 4PRHD 5DD3L 4QRTB 1RMFH 4OZFH 5DVLA 1TCRA 5HVWA 1MI5A 1MFCL 3RPIB 1MAML 5DJ8A 3G9VA 5DD0H 4EDXA 1KJMB 5BMFL 5C70A 4A6YB 2AS5M 1OTUD 4KJPD 3PGFH 2X4TA 4JFFB 4U1LB 2EC9T 3UBXG 3LQAH 1UWXH 4GKOA 1BIIB 1RZKC 2QKIA 3HKFA 3FT4B 3RGVD 3RWFB 2AEPH 1CGXA 4I3GA 4NPYA 1PKOA 4XXDB 5DMGD 4PTTB 5IT2L 4PRHA 4GW4A 2QQLH 1AI1H 4JZOA 3G08A 1A9EB 1B6DA 1UYWL 1WFNA 3UTPD 1LEKB 4HJGA 4JB9H 3VD3A 3PL6C 1C08B 1ZLUK 1T0MA 3MRPB 1J8KA 2VERN 2P8MA 1T7ZA 2A1WL 2ILLA 4AIZA 3H9HB 4LGSB 1IARB 4RGOH 1C1EL 25C8L 4DW2L 1XGYL 3GK8H 3WIFA 1NCBH 5EU7E 2YD7A 4NZUL 2DQJH 4UV7L 3DYPA 1JZ7A 4WI9A 1X5ZA 4HH9A 3QDJB 3T4YA 5JW4R 1X5FA 4XNZC 5HVHC 2IF7A 4RDQG 5C0NC 1UEYA 4X6DF 1A6PA 3MOAH 4M6OL 1RIUL 1PSKL 2DRUA 3ZO0A 4HV8A 3WIIH 1AGEB 2YZ8A 1D6EA 3ULVH 2HVKA 5IMKB 2FZ3B 1CBVL 1QSFE 3SDDD 1EVUA 2X9XA 4UOW1 1AGFB 3DTXA 1NC4B 3JV0A 4OUUB 3K8KA 2VN7A 3TO2A 1J0KA 5I71B 5DUPL 1CE6A 2PW1B 3UZQA 3HMXH 4L29B 3ZE1E 3V52H 5AYUH 1KIRA 1BOGB 3E6FB 1QHOA 4LASL 5IQ7H 3HPLB 3HI6H 3RHWK 4M5YL 4JFXA 1RUPH 2JK5B 1B6UA 5ACZB 2NCMA 4LLQA 1AHWA 2C1PA 1IKNC 1MFAH 3AREC 4JZJB 5BS0A 5HYJD 6FABH 4MHHI 3OKOA 2ARJB 5JDSA 3HCVA 4OCMC 5FYJD 3KPSB 1IGMH 4OGAD 3S36L 1DVFB 3SCMD 5CGMA 5GRVK 1MIMH 3NZHL 2ZCHH 3VWJA 3DJ9A 2F54D 2QQNH 3GSOB 4JO4L 1EFQA 3MJ8B 3D2UA 1MRFL 3IXTB 3TWCH 4N8CL 3NMEA 4JANA 4X8XA 5GSRB 2VZUA 1K6QL 5IJKC 3N85H 2W07A 2VLLB 3B9KC 2NY7L 1T1WA 5CP7A 4KKNA 1U3ZA 1LE5A 2E5EA 2FR4A 4LPVA 1TJGH 2FO4B 4PS4H 1G9EA 2XWTA 2F54A 3CXDL 5D8JH 1LEGB 1FNGB 2BVEA 4XP4H 4WHYH 2EYRB 5E56A 4PJAB 3V4PH 4GJTB 2DMKA 4LEXH 1J0YA 1EHLH 5KAQF 5I1DA 4P5TD 2HG5B 3O8XA 2HKFH 1P53A 2WP3O 2PTVA 2H2SD 3BAEL 3VFSB 3EZ8A 4BM7A 4MXQC 1R3LB 4LSRL 1ODAA 2LV4A 3QIWA 3QDMA 5GZND 3C6LC 1H5BC 5IFJB 3T1WA 3FTGA 2VWEC 4FG6C 3TT3H 3TESA 4PYGA 5F9AC 2B1HH 3CSBA 2WINB 1FIGL 1PGRB 3EO1B 2GEEA 2EE3A 4LLDB 1KJMA 2DJUA 4L8CA 1S7RA 1RZKL 1W0WA 2Y5TB 4HWBH 4G6MH 4ZS6C 3WUWG 4JFFA 2Y5EA 1U6AH 2H32B 4OZHA 3I3EA 4L4TD 3GSVA 1U92B 3SJVB 1BP3B 4JY5L 3VXRA 1N7ML 3G6AA 3Q1SH 4FFVD 4ONGH 2GT9A 4XXDA 3DOSA 4PTTA 4N0FB 4XPAH 5TDNA 5C0CE 3KPTA 1JMXA 1XFPA 2ICWB 5ICYB 2DD8L 2VDRL 4KRPC 4M7ZB 4EOWH 1WT5C 1C08A 1YNTB 5HHOB 4XVSH 3BRFA 3H42L 4U05A 1EFXB 2OL3B 2FHCA 3X3FH 1GC1H 4RFOL 3MV11 4PJEF 3R8BB 2AERT 5CZVH 1EEZB 3G5ZB 3MLYH 4E41D 1KJ3H 3PXHA 2HLAA 5EU6A 4MJID 3QDJA 4DWHA 3TIEA 1GZQB 4Y4HC 3FQUB 2R4RH 4JFEB 2Y4SA 4AL8H 3MV8E 1YNLL 2BX5A 5ALCH 1GZPB 3V5DB 2A0LD 1TJHH 1LO0H 5T1KB 3DI2B 4Y16C 1BMGA 1A4JA 1JZ4A 4R9HA 1HE7A 3QRFM 1MLBA 2VLJD 2DWEA 2WLYA 1NC4A 4E41A 2C3XA 5FO8B 4ACPA 2BY1A 1FRGL 4HUKB 5HBBA 2VLMD 3GHBH 3HI5H 3PP4H 3ARUA 5KJRL 3KWWB 4MD5A 5JQ6H 2XRAH 4BSVB 1D5ZA 2XN9D 3RZCA 1X9QA 5KTEH 1QFUL 2VNCA 2V2TB 3NFSL 3W9DB 2JK5A 4HFUH 3OAYH 3CZFA 3QEUB 1DN0A 4WENB 4JZJA 3FONB 1ETZB 3UZVB 5HTSA 3WNMA 4WTZG 5JPNB 5I8KL 4HJJL 3SQOL 3VXNA 3A6BL 1KLGA 1MCEA 2Y23A 3KPSA 1XGPA 1Y6MR 4YHML 5MERA 4Y2DC 3ULUH 3SPVB 4F15B 3VWKB 4F58H 4LHJB 4R3SA 3ROLA 4JRYD 1UEMA 4MA1C 4KJQD 2ADIA 1WBYB 3C09B 2EO1A 1DBAH 5H8DA 4AYFA 4GW1B 4R4BA 4XP6H 1JPGA 5GSRA 1OW0A 3QG7H 2RGSA 3QUYC 2FIRT 5D7IF 3RY6A 5ADOH 3QSKB 1E28B 2NXYB 3HG1D 2VLLA 3MRDB 2WK2A 1UACL 2K1MA 2YWZA 1NBZB 1NGPH 2A74B 4J6RH 4RGMC 5JIKA 4Y5XC 4D0CA 2XZAH 2BERA 2O5XL 3IDJB 4MAYC 5F9DC 4XT1C 5D1QC 3H7BB 3MJ9H 2MCG1 1A7PL 4GXVH 4ELKB 1FO0L 4FQIH 4YNYA 1BX2A 5DJ6B 2ZUUA 3PHSA 4R8WH 2DOCA 4PY8I 3MV7B 4WI8A 1X5LA 5D5MF 3TFKC 2DBLH 4FTVD 3VFSA 3GIZH 2HKHL 4R0LB 2IG2L 3GBML 4X0KB 2DTMH 2MMXA 4ODVL 1CD8A 3O2VH 1QFWM 5TH2B 4NKMA 2ITDA 4FXLA 1EEUA 5E5UB 4M43L 3D85B 1OSPL 2J88H 4BSWB 4LAJH 2IQ9H 1IGCL 1BZ9B 4HHAB 4TOYL 3TCLB 5I66A 3B9KD 1F4XH 1FAIL 3C6SB 3D0LB 4LKCA 1Z9LA 5E99H 5EU7C 4PJCF 5SWSE 2MWCA 3HE6D 1OHQA 1U2CA 4R2GB 2F53A 3BIAX 3W0WD 3BUYB 4P9MH 4LDOB 1A22B 4XAWL 5ELIA 3CVIL 2D03H 4NQEE 5A2LH 3MUJA 3MUY1 2Q6WA 5K9QG 4S1RL 4TUKL 2YD3A 5FFLA 3P0YL 1QP1A 2ICWA 3VFTB 1HI6B 3EJZC 3STZB 2ATPA 3QPXL 4C58B 5HHOA 2VDML 4GBXC 1EFXA 1DBJH 1KN4L 3T0EB 3ZDZE 3MACH 1IEBA 1KN2L 3T65B 2A6JB 1EEZA 3GSNL 4OCXL 4LIQL 4ODHL 4JO1H 3MA7A 1CGTA 2FWOB 4V2CB 2BNQB 3ISWA 4H20L 2X6MA 4ZS6D 1C8PA 5EBMB 2CDGB 3P77A 4Q6IC 1NAMH 4ZFZB 1ZMYA 2VXTL 2W0FA 4OTXL 1QKZL 4LSDA 1F97A 1GZPA 1AXSA 4BQCA 2RR3A 1ZT7B 4WJ5B 3UJJH 3N1PC 43CAB 1R0AH 5E8OB 1UFUA 4ZYKB 3OKMA 3H9ZA 3TJEH 4RZCA 2C3GA 2EH8H 5FO8A 4KROB 3OGOE 3VFUA 4NQDE 5MHSD 1FHGA 3DVGA 4X80H 1L9NA 4PTUA 2YC1A 4R96A 4KTDL 4PRPD 1U8PB 5T1DH 4GRWB 4BSVA 3OKDB 1BVKB 4XMLL 1KJ2B 1X3DA 3W9DA 5T3XH 1HILA 4XWOD 4PJXB 1BGXL 1KENL 3QA3B 4PJIB 5JPNA 3SE4C 2E9JA 2RAMA 2NX5B 1J9CT 1MH5A 5SWZA 3MV9B 4MA7L 4IMLB 1VACA 5K9OB 3L1OH 5CJOH 3E8UL 2XG5A 3QUXD 1BQHA 4JAMB 1F4YL 3VMPA 2AEQL 4WWKA 2VLRA 4YC2B 1P9MC 2B2XL 4KUCF 3QO0B 1BZ7B 4KDTA 5J12B 2NY3B 3DO7B 3UJIH 3UBXB 3F7YA 1UWEH 2VSDA 1U3HC 1OAKL 3CX5K 1RHHA 5EUOA 2HT4D 3DMMA 1MCFA 3MRDA 4PLJD 5GJSH 4YFLI 4G8IB 3T2NH 4KK6C 1IAOB 1NBZA 1OL0A 1LP9A 3QBTB 3BDXA 1UB5B 3OXSB 5GHWH 1BJMA 2FEDC 4IS6B 5EIQA 3RDTA 3GJEB 3DYOA 5IR1B 3C2AH 1HCVA 1EDQA 2EO9A 3G5YB 4H0GA 3FCTB 1LD9A 1FPTL 1C7TA 2XZCH 3NGBB 4NP4H 2NYYC 3ARBD 2CPCA 4LSPL 1T66D 4ZUWA 4Y4FC 1DFBL 2NY0C 1OP5H 1CD9B 1IC4H 1Q0XH 1FZJB 2MSPA 4ZD3H 3T0AA 1QG3A 3QUYD 3GJFA 2V5SA 4BSWA 4O5LH 4UTAL 1CQYA 3DXAA 4WI7A 3O6FA 3MR9B 3U7AA 2ZUTA 1MCIA 5F6HI 3HC4L 4PJ7A 4WW1B 3TBSA 4NKOB 5JMRA 2R0ZL 3DPBA 3QUMB 1SJXA 2JLLA 3FKUS 5E7BA 1JP5A 5C8JA 1RK1A 4JM2F 1RFDH 5L88H 4HKZB 4WI2A 4K71C 4AK1A 2OR8A 2CKNA 3RVTD 2Z8VC 3CXHK 4U31A 3O6MH 3ARSA 4ZSOB 4HIEB 3KYAA 3OKEA 4CAGA 1EMTH 5L6YH 2KH2B 5DDHB 1XH3A 3SDAA 3LS4L 3VFTA 3WFHA 3U4EA 3QEGH 4X7DC 4DKAA 4PRIB 5C9JB 3O2DL 4JR9H 2YPVL 1NGYB 4A6YH 3T0EA 4KMTL 2KZWA 5DK2B 1WSST 1RUQH 3MMEA 5L9DH 3X13B 3MRQB 2A6DA 4RMQA 5AD0A 5CJQH 1A4KA 3BISA 3WSQH 4DZ8B 3FT2A 1OWWA 3K8MA 3NCJL 1MJUL 4EI5C 4U1KA 3BOVA 3B2UC 2D31A 3LY6A 1VDGA 4DUVA 1WQVT 2PYEE 2NTFB 3NFPA 5E7FA 3F8UB 1RUAL 4POZD 5J06A 4LSTH 2GJ6D 5ITBH 1FBIH 2PXYC 3BZDA 43CAA 5D9SB 3D39B 1SEBA 4ZYKA 4P9HL 1WIPA 1IAIM 5T1MA 5F89B 3LQMA 1HXYA 3CPLB 2Y6SC 5C08E 2HLFC 3CMOL 2QL1A 2DM4A 1ZLSL 5CZKA 1DQTA 5I18H 3D3VB 2P5WA 4JQVC 3EBAA 4MQXC 2N7AA 4FQ1H 1MFNA 4R6UA 5C0BA 2DQEH 1AO7D 4GAFB 2H1PH 2HFGL 5DFWH 4X4MA 1GL4B 4LSSL 1CK0H 2KBGA 1MQKL 5DQJA 2NX5A 4X8JB 2VDNH 3LIZL 2IJ0C 3MV9A 3LEYL 4IMLA 3U0WH 5CBEA 1H3WM 5FB8B 2VDPL 5E8PB 4M8VA 2B8OT 4O9HL 1M7DA 3DGGB 5BRZB 3QWQB 3RWHA 1HYRC 4APQD 5HVGB 1D9KC 5CGYD 4OD3H 3D69B 4K7PH 4Z18A 1OP3H 1FFOB 4P23D 4M62L 2K7PA 3O9WA 2BSED 3BPCA 4OGYH 1P7KA 2R23A 1Q8MA 4G8IA 3A6CL 3KDMA 1K3ZA 4NQCD 5C09A 2F5AL 4ETYA 1JYNA 1RZ8A 4ODUA 1A6UL 5GGTA 2KDGA 4JFHD 1J1OL 3OKLB 3GJEA 4WW2F 4OLVL 4N5ED 5D7JD 2CDEB 5IJVB 4OF3A 4CW1B 4APQA 4OZIB 5IB3B 4H5SA 5ESAA 1KIPA 1CIUA 3FCTA 4OGXL 4ZOCA 1DZBA 5DJCB 5GIRA 1N2RA 2BSSB 4X7FC 4V1DD 4Y19E 5CP3H 2PKDA 3DROA 5IW6B 4Q2ZA 3UDWA 5KSBF 2FDBP 1AC6A 1N6UA 2PNDA 5CMAB 5D7KD 1J87A 4QCIB 1U8KB 2E6JA 1DQLH 2LTQC 5IUSA 1H3XA 1FCCA 2DM7A 4OLYL 5ISZE 2Z91A 2P8LB 1MHEB 4NN7B 2XXMB 4NKOA 4Q6YA 1FNEB 2YUVA 4HPYH 3OPZH 4Z95L 1PDKA 3S9DB 3GGWB 2B1AL 4MS8C 3RU8L 5L0QC 3T4AB 5JUEL 2EKSA 2X70B 1JGUH 1DP0A 4HIEA 4JHAL 2QADD 3RP1A 3RVVD 3B2VL 4Z7VB 1NL0H 3SBWC 4MA3A 3FZUC 3CH1B 4RWYH 5LBSH 1IKFH 3QDGD 4PREB 4PRIA 3U0PA 3PWPD 1UB6B 4ZMAT 4UDTA 4HGWB 2DQUL 4R26H 1HN1A 4YE4H 1NGYA 3S4SG 3CAFA 4ZUSB 2H32H 3MRKA 2AJVH 5FCUL 1PFCA 5HD8D 4MLSA 1QA9A 4F57L 3X13A 4KPHH 4ZFFB 5D2LE 4R4FL 1CF8L 2F19H 3BE1H 3NTCL 3K4ZA 1RVFL 2IBBA 3Q48A 1KT2B 2R2EB 4IRSD 4L4VE 4YDJB 5DJDB 3RNKB 4BUHA 3BH9B 5LGKA 1O5DT 5GQBA 2FGWL 1YEFL 3EOAA 3QDGA 4ZPTA 1YEHH 3AS3A 4NO0B 1K8DA 4MD4B 3E3QE 1NFDB 4JY4B 5CUSL 5LKNA 3ULUF 3ULVE 2BOBB 1R3KA 2OL3H 4CU7A 2IBZX 4XBGB 2LVEA 2IFFL 4ZNEA 2XZQL 4GXUM 1MCJA 3O0RL 5I1LB 1INDH 2VXUL 3BMWA 5MEND 4F8TA 4ZXBD 3WE6A 5C0AE 3GB7B 2B0SH 4F8QA 3FQTB 4OT1H 3P4OA 4URTB 2NY6D 2FYYB 4JO3H 3RIAK 4NGHL 1E6JL 3BKYL 4IOIB 2YRPA 2FBJH 3OAZH 2V2XB 4KRMB 3VW3L 5GSVA 4P4RB 3D18B 5LGJB 1CGSH 5DURB 4EI5D 1YYLL 1I8LA 4S1SL 4F7MB 4M7LL 5MEOB 4ONOA 5L8KB 5FGSA 3AY4A 5TF1H 4JO2L 1RURL 4D9LL 4TVPD 3U9UB 4L9LC 5A16A 5KVGL 2JJSA 2DLTA 1TZIB 5D96C 4L8DA 4L5FH 5I1IH 4PJDF 4KXZH 4P4KC 2E6PA 2QTEA 3WBDA 3RWGA 5CCKH 4J3VA 4FXGA 4IHOB 1DBKH 2X1PA 2Z35A 3BZ4A 3G5XA 1HH9B 4Q9BA 1F90L 3KPRB 2Y6SD 2YD5A 3T08A 1SYSB 4XTRC 4YDLC 3QYCA 4KK8D 1FV1A 2H26B 4N0UA 1WBZA 1I9IL 3HC3H 5E2TH 2HJFB 3VXTA 3QXVA 3C2SA 5I19L 4KTEL 2YEZB 2ZUYA 5DUMH 1VKXB 4XHJD 2E7BA 3VI4E 4EN3C 1U42A 2E3VA 1T83A 4OCYL 1XZ0B 4HKJA 5IJVA 1HDMA 1JFQH 4OZIA 4GO6B 4DN4L 5AG9A 5EFIB 5B8CC 3IFLH 1JWMB 3GRWL 4X5LA 1JWSB 3WO4C 1ITCA 3C60B 4GW5B 1MCWM 4ZUUB 1QLEL 3KPLB 1I3GL 5I2IA 4AQOA 2VXSL 4D0BB 4ODBD 1TZGH 1CLCA 5E9DD 5A2JH 1FH5H 1I75A 1ZLUH 5JR1H 5FKAB 1QFOA 5T33L 5JHDE 3V5KB 5I75B 3CVHB 5GRYA 2EEDA 2AV7A 2E7LC 1SY6A 3EJJX 3MNZB 1R5IB 5KZCB 4Y1AE 4MA8L 1XIWC 2Q76A 1FZMA 4BH7B 4QF1A 4MJ5A 1ORQB 1BQHG 3U7WL 9CGTA 1AC0A 3GGWA 1QLFA 3NACH 5D7LE 4Q74A 2PETA 3Q6FA 3BKML 4PJ9C 2R9HD 5DSCA 2VABB 5ETUA 4HWNA 3F5WA 2UVEA 5IESH 2C4XA 4OV5B 1KYOK 4I8DA 1U8MA 5CZXD 4JDZB 5D1ZC 4ORGB 4L3CB 4OBRA 1NAKH 2DI7A 2K9UA 4CADB 4ZUSA 1G7LB 3WFDH 5IEKB 5D72H 4AH2A 5FOJA 2BNUB 1KTDA 2DQHH 1U95B 4O2EA 3RNKA 5D1XC 1S9YA 1FFRA 2YPLD 4FQCH 1B4JL 4G6AC 1QVOA 5F7LB 3ZE1F 5KS9B 3T77B 4Z7OE 1A7QL 5EOCJ 1NGZA 5EU3B 2JJUA 2HN7A 2MTPA 4J3OC 1CGYA 4LLMB 3ARWA 1OWRM 5C0FB 5C92A 2GITA 4MD0B 4S1DD 3DX8B 3BZEA 2Y06H 3ZYOA 3NCMA 2RFXA 2IAMB 1FZOA 3OJ2C 4QOKE 3QFJE 1JGVH 5F3BB 4HC1A 1I1CA 2YPLA 3GB7A 3BP7A 5IGXL 3FQTA 4U6VH 3U9PL 2FYYA 2O5ZH 3FFCD 3FQNA 4MNHB 1RHFA 3ZKXC 2XWBB 3HR5A 5FM4A 3H9YA 1HQ4B 5B3NA 4P4RA 4U7SA 3KGRA 4P3DA 2NY4D 4DGYL 3PG2A 2FECI 1JNNH 4JJ5A 4L8BB 2ESVB 3VH8A 2VXQL 4Z78B 2CSPA 1CFVH 2CRIA 5HGAA 1F3RB 2B5IB 4OGZA 2VLKE 2VXVL 1TZIA 1CFBA 1EXUA 3QQ4B 3SDDB 3GKWL 5HYIA 1Z0NA 3NIGF 5J6GB 1PX4A 2V17H 4GRWH 3MLRL 1DUYA 2MPAL 1DCLA 4RGNC 1VFAB 1KJ2H 5H94B 2UUDK 1WIOA 2WIIB 2DLGA 2M8XA 1ULVA 3V4VH 12E8L 1XGRA 2C7UB 1U8LB 3KHQA 3F12B 2AK4D 4ZAKC 5DRWA 3ZKND 5EWIL 4KI5E 4Q0XL 5J4MA 1H3TA 3CSGA 5IG7A 5D2NB 4HLZG 4JKKA 3LQAC 5DLML 5HDQH 5HYJB 2ID5A 3CLFH 3EHBC 2YXMA 3JV5A 4XMKL 1MCLA 1KLUB 5KSAC 2BSTB 1KGCD 4WEBH 4G3YL 4QRUB 4YHYC 4D0BA 4XXCC 1BWMA 5TE4L 3ULSA 1FNHA 1KIQB 2AGJH 5IB5A 4YPJA 1AD9B 4JVWA 3BPLC 4NO2B 1G9MC 3WXWH 4WNQA 3LDBC 4NKIH 4QT5A 2J7LA 4WFHD 4YK4C 5T3ZH 4GS7B 1J8HB 1PQZB 3QULB 3I50L 3JV6A 5F7YC 4JN2A 4EN3D 5JZ7C 2GJZB 1M1SA 4WUUD 4H8WH 4D2NA 3AUVA 3MUHL 3C5SB 4PGDA 3HZVB 1JMZA 4OFVA 1VGKB 3O4LD 3JWOC 4TSBH 4P5TB 1L7IH 4PG2C 1TTUA 1P4IH 2PYFB 5IOPB 1DE4B 5L2KE 2YS4A 1MI5E 3FB5B 4K3DH 2JCCF 2IALB 5E8EA 1CIDA 1F6AB 4ONHB 1BVLA 3UYOD 4HXAL 4L3CA 2X7LB 4LVOC 1RZIB 4CADA 1UENA 3RVWD 3QUMH 1G7LA 4HZLA 3UTZA 5K59E 2GTZB 1W8OA 3C5JA 4ZPVB 2NY5C 3WIHL 4LPCA 1CWVA 2CRMA 3HMWL 1XMWA 3VFGH 4JQIH 2P5EA 5HVFB 2WZPD 3VFPB 4XCEB 3QUKA 1I9RL 4X5XA 1T22B 4L4TB 4N9GB 3SO3C 4JPIB 1BEYH 1FVDB 1F58H 2A77H 4XCFH 1FSKB 3ARDC 4XH2B 3RX7A 1Z9OA 43C9B 3V6ZB 5F9OH 5HSFA 4KQ4H 4PJ5A 1EEYA 1ZVHA 2ZZUT 1U91A 3BGAA 5EZOL 3R1GH 4MD0A 4LP4A 4Z7QF 3BZFB 2A6KB 5GRJH 1UCBL 3MA9L 3WFBL 1LE9B 4U1HB 4UT6L 1NBQA 3V8OA 4MNHA 1HXMA 5IWLA 1N8ZB 2EXWC 1JNHA 1JHTB 2DQCL 2IPUK 4MJIB 2GUOB 2C1OA 4TNVF 4F3FB 3QO1B 4PGCB 1MHHA 4NCC1 1T20A 2ESVA 4MCZA 1MEXH 1LDPL 4Z78A 1Z2KA 3OGCA 3ZTNL 1PYWA 1BQLL 1L0QA 3FOLB 4I2XB 5F88A 4F2MB 2F8XC 4JREC 2AKRB 3PWUB 4P2OD 1BZQK 3QQ4A 1V7NL 3INUL 1TTGA 2VLJB 5CILL 3ZKSD 1Q94A 1LO4L 1LO3H 1RMFL 4WEUD 1FLRH 2BC4A 3L6FA 5DJXA 1XGQB 1JGEA 4K55A 1WTLA 3VXPB 4OFYD 4LBEA 1A7RH 5DD0L 3BXNB 2OR9H 1OPGH 2XN9B 4FQQA 4F7EB 1ZHKA 4PJAF 5DR5H 3PGFL 3HTLX 3F6IA 3LQAL 1S9VB 1IM9B 2OTUB 3SDXB 5FDWB 3TVMA 2AEPL 2BJMH 2VITA 1PD6A 4Z7WE 1BVZA 2XXCB 2WBJD 3OF6D 5HVHB 2QQLL 1AI1L 4FFYH 3NPSC 5IK3A 3S4SB 1IT9H 3KJ4C 1YMMA 4JB9L 4NJAH 4GUPA 1S7XA 4MVBD 3RWEB 4JRYB 1JZ3A 5FM5M 4FP8H 4RGOL 1A1OB 1IAMA 1QBBA 1U8IB 2WSKA 1XF2B 3GK8L 1NCBL 4MNGE 4BH8B 2EC8A 3DO3A 4HBCL 3HG1B 3L3OA 4IJ3C 4KUCD 1QEWB 2DQJL 1GC1C 4PYHA 4NO2A 3UPRA 1T5XA 5DVNA 4ZQKB 3OKKA 4JGJA 1D5MB 1G0YR 1CFTB 4JFQA 4PB9H 3EOTH 2A83A 3IRZA 5I1EH 1J8HA 2X4UA 4MNQE 3AVEA 1MFEH 2EDFA 2Y72A 1DR9A 3V7AE 3MOAL 5C0JA 2C4FT 3QJHB 3WIIL 1ZE3C 2ZUXA 3ULVL 4X6CF 2DJ4A 5CD5D 1DUZB 1VPOH 2EDEA 4U0QB 3QDME 1VGKA 4QRPD 1MRDH 4ZFOL 4CJ0A 4FXKA 2DLHA 5ESQB 2XKUA 3FO1B 1RSFA 4X9BA 4XNQB 4FTVB 1IGTB 4YGVB 4GRMB 3MRHB 3HMXL 3T1FB 5FUZH 3MREA 5EZIL 1Q9OB 5DJZA 4PGBB 3V52L 5AYUL 4HXBH 3F7RA 3RI5F 5IQ7L 4JFFE 3PV6A 4PRBA 3HI6L 4CNIA 5JOFB 4LVHB 1RUPL 4JPKH 3VXRE 1T0NB 5F7UA 3B9KB 5IBTH 1EGJA 5FYLD 3P9LA 1MFAL 1JUFA 4J1UB 3DX7A 1N0XH 5H2BA 6FABL 4NRXA 1KV3A 3HE6B 4U1JA 2YPKA 3TV3H 1P4LB 3P4MA 1IGML 1P6FA 3QEHB 3W0WB 3DV6A 3PGDB 2VDOH 1G7JB 2L4OA 1MIML 1JWUB 2ZCHL 4Y88A 2QQNL 3LMJH 4JM2D 3RKDC 3DLQR 3ULUC 1A7NH 3CSYA 4ZO9A 2DIJA 1YMHB 1IQDA 3TWCL 1K8IB 3RUGB 4HK0B 4U1GC 5CSBA 3N85L 2IANB 5D6DA 5JW5B 3MYZA 1HHHB 3HE7C 1E6OH 3QDJE 4M6MH 3C6LB 4XNYH 1CLYH 2O61A 5LQBH 4PS4L 5TE6H 1Z5LA 2Z93B 5DYOB 5D8JL 1JHTA 3L5WA 1SVCP 5LG1A 3IJHA 3W5MA 4XP4L 4AQ1B 4NOFA 2SEBA 4QHUB 4TVSa 4NZRH 1RU9H 3V4PL 4Y5YC 4LEXL 3EYUH 3ZHKA 5IV2A 2OI9B 1EHLL 3L3KA 4HFWB 3F6LA 5CBAA 1N64H 2FJGB 2HKFL 4QHMB 4QYOA 4I2XA 3FOLA 3C5ZD 3FHAA 1YEGH 3EYVB 4FQPA 4G6KH 1ONQB 4LMQI 5HYQA 3ZZ1A 5EO1B 2KUTA 3AROA 3PHOB 3CFEB 3NABH 5JA8B 3ARVA 1XGQA 2XQYK 3PL6A 4J3TA 2Q8BH 3BVNB 3AB0C 2B1HL 3R0NA 4YXKH 1VFUA 2VL4A 5I76B 4PRPB 1OQOA 1DANT 5HHME 3L5XH 4AY0A 4HWBL 1W0VB 4G6ML 3LN9A 3QIBC 1WZKA 3KPSE 5KAQG 1IM9A 4FABH 4BQBA 3Q1SL 4FQHB 1B9ZA 4ONGL 3EDJA 4I4WA 2YRZA 3A6OA 4Y4HB 5BZWB 1SEQH 5FDYA 3U7YH 5E2WH 5DHYB 3V0WH 4XAKD 4FS0A 1DLHA 2CKBB 4EOWL 3QUXB 5MEPA 1A6ZA 3RBSA 2HJLB 3TZVD 4LMQE 4XVSL 1KCUL 4Y16B 5AEAA 1BWWA 2P24B 2EDKA 3P0VH 3X3FL 1ND0B 4WUKH 1GC1L 2N7BA 1CT8A 4KZEL 4JKMA 5CZVL 4XPGH 3MLYL 3WUZA 2DQIH 1KJ3L 1QEWA 1UKSA 1I1YA 5T5FH 4BKLA 4ZQKA 5HHPB 1HIMH 1D5MA 1TXKA 1BHGA 3VCLB 4JHBA 2R4RL 3HNVH 1S5IH 1QQDB 2AJXH 4M93C 1C5BH 4YDVA 4AL8L 3TZVA 1ZVYA 2HFFB 2ICWI 3CFBB 3L3JB 5ALCL 3GMNB 3QJHA 1IKNA 1TJHL 3AREA 5JO5B 1LO0L 1DUZA 1H0DB 3O2WH 2ATKB 3TN0C 1XGTA 4DVRH 5INCA 3N9GH 3ARBB 5I1GH 1R24B 4YBLC 4Y2DB 4XNQA 4KVNH 3OZ9H 4YGVA 4PIRF 1H3VA 3HI5L 3NIFF 3O41B 3PP4L 2ZP0T 3CVHH 4NQUA 4BQ9A 1I7UA 2WWMD 4J4PD 1IAKB 5JQ6L 2XRAL 1CZ8H 1BJ1H 3OJDB 3RWCB 5KTEL 1I1FB 3QUYB 4RNRB 5IJKA 1OD7A 4HFUL 4WI4A 3O45B 1E4XI 4YHIA 4QHKI 5KVEH 4J1UA 3T0XA 4FFWC 2Q87A 5IVXA 4I0PC 3QUZD 2MKLC 3RNQA 1IC1A 4S10A 1I1RA 1D5IH 1P4LA 5IF0B 3UCRA 5D1QB 3RWDB 2ARWA 2KL6A 1QD0A 3MRNA 3ULUL 4XBEL 5HHOE 4Z7UF 4C56D 4F58L 4PJGB 1B4RA 1KNOB 3LRGA 2X41A 4OM0H 3OXRB 4XNMA 4KXZI 1VENA 1FC1A 1FO0A 5I1CH 2XKSA 1DBAL 3SKMB 3DIFB 4XP6L 3NCEB 3SE3C 3QG7L 4G7YH 4QRQB 2P42B 4D3CH 5ADOL 1AQKH 1EAPA 2IANA 5E4EC 1HHHA 4OB5L 4PJFF 5IVZA 3L7FA 1NGPL 2BY0A 1TETH 4J6RL 1H5BA 4G8EA 1UZ6E 1F2XK 2XZAL 4N90D 5F1SA 4M6NH 4Z5RB 3MJ9L 3L7EA 4GXVL 1GGCH 4JZNB 2UY6A 3FL7A 4FQIL 4NDMB 3BEVA 1NFIA 3ARFD 3F65A 3HS0B 2EC9U 1ZKAA 2FECL 4R8WL 2PTTB 3RWJA 3MJ7A 4NWUH 2RCSH 2YOCA 4Z77B 2GJ6B 3TNNB 2DBLL 3WJLC 1LDSA 1LNUB 4CDGC 4P2RD 3Q2CA 5GZOD 4OI9A 1JHLL 2APFA 5EO1A 2DTML 3MOQA 3O2VL 2R39A 4LCCB 1LK2A 4MQ7A 1NANI 1N3NB 2J88L 1WT5A 5JOPE 2IQ9L 5FYKU 2EYSB 3HUJB 1X5AA 5E99L 5CD3A 3HE7D 5IB1A 3KYKH 1S8DA 4UOW0 2VN4A 1YQVH 4OCSH 1XF5B 4X6BA 4BQ6A 5I8CB 5SWZE 4UAOB 4P9ML 4CU6A 1QFHA 3IJSB 5AUMA 3GM0A 2W92A 2D03L 4YDIH 3GSNA 1S9WA 1UM6L 1F02I 4FZ8H 4I3RH 2D0GA 4LCYA 3QWOA 4DVBB 4Q6IB 2VLRE 5FO7B 1CQKA 2A6IA 3DURA 1OT1A 1I8IB 4X6FA 2VC2H 4Y5VC 4PG9B 2OS7A 2QR0A 4RDQF 5EUOE 4Y16A 1IMHC 1A9BB 4M02A 4AEEA 3QCVH 1DBJL 3MACL 3TBWA 5F7FA 4P23B 3MLTB 2ZKHH 4JO1L 4YHNB 4LFHG 4BQ8A 1JZ8A 3HPJB 3GHEH 3LRSA 4NQCB 4QO1A 2B4CH 4PJHB 4CBPA 4FQLH 5I6XC 3P11H 5DRXB 4L3EA 5FYJH 1NAML 3MV7E 1NGWA 1A6TB 3QIBD 3QQNA 3RAJH 2X4SB 5D7JB 3CFBA 3L3JA 5FGCB 5F1IB 5D2LF 3UJJL 1NMBH 1R0AL 1VB9A 1XGUA 2G2RB 3IT8D 2I9TB 4NRZA 3V5HA 4FHBD 1IZKA 3TJEL 2EH8L 2UWEA 1H3UA 5JXEA 1RZ7H 4JEGB 1UZ8A 3VXQB 3MXVH 4X80L 1M71B 3AXLA 4B53A 5T1DL 3OJDA 5EO0A 1KB5B 1JN6A 5T3XL 4LCUB 3O45A 35C8H 3I84A 4WTXA 4YR6A 4RMWA 3CFJA 4Y5XA 1PKQB 4JDVA 4JY6B 32C2B 4MAYA 4JRXA 3RWDA 4QTIH 5HPMA 1A14L 3L1OL 5CJOL 4D8PB 4HMCA 4PJGA 4X7EC 5CSZB 5IROC 3OXRA 3SE9H 4JFDA 3T0EE 5HHQB 4TSAH 4ZG1A 1MAKA 1WWCA 2A9NH 3MRRB 3UJIL 4QRQA 3VRLE 2XTJD 1UWEL 1WZLA 4OZGB 1UVQA 5FK9A 1LHZA 2DWDB 3MRBB 3PWPB 4JFZH 3S98A 2NY0B 4HX1B 4N0CC 5GJSL 1TVBA 3T2NL 3RX8A 5GHWL 1H8NA 1XF4B 4YPGB 3LPGA 4ZOBA 3S34H 1P6AB 5FA4B 3MFFA 1S7VA 1QSFD 3HLAB 5KW9H 1FIEA 1U3YA 4IRSB 4PP1C 5F3HA 4Z8FH 3R0MA 1KCSH 2V2WB 1IE5A 5E6ID 5C7XL 1H15A 2VKXA 1JIBA 1F4WL 2HJKA 1DBMH 1JK8B 2XZCL 4G7VH 2ORBH 4NP4L 4O4YH 3TNNA 3MNWB 2FL5B 3UBXI 4P59H 4EI6A 2YUXA 5I1KL 2K7QA 3L95A 2PCPB 5I8OH 3TA3C 1IC4L 4IDLA 1Q0XL 2P5WE 2JJWA 2HTKC 2H2PC 4ZD3L 4YEEA 3B9DA 1YY8B 1N3NA 5D4QA 3LV3A 3WS3B 1S9XB 5C0BE 1SM3H 1BF8A 1S7TA 5C6TH 1I3RA 4ZXBB 3HUJA 4GBXA 4X4ME 1CXKA 3GSQA 2NY6B 4QRSB 3QIUD 1YEIH 2NX5E 3O2DA 3MV9E 1UWGH 1KTLA 1RFDL 3IJSA 1PBYA 5L88L 1CFQA 3IDIB 4EI5B 3P9WB 4KJYA 4X5WB 3O6ML 1IFHH 4ODSH 3BYTA 4Q6IA 1T7YA 1TQBC 1EMTL 5L6YL 1F3JA 4N5UA 3GSRB 3TO4D 4U6YA 4JFPB 1MJJB 3BHBA 3QEGL 4X6DB 2NZ9D 1UXSB 4JR9L 5C09E 4U1NA 4A6YL 3DSFH 2VR4A 3CFKA 4PY7A 4YQXL 2Q7NA 4CVWA 1RUQL 5L9DL 1EZVX 3MLTA 1VGEL 3GI9H 5C3LD 4YHNA 5CJQL 1KTRL 3WSQL 3WL9B 2H41A 1GGYA 1OM3H 5I74B 1J05A 4O00A 5HHNA 4YIQB 4J23A 3MCKA 1Y0LB 1J0IA 4LVNB 3WNNA 3H9SD 3NAAH 2IPTH 4O02H 1U8NB 5ABDE 4LF3A 4MYWB 4LPWA 4LSTL 3IDXH 2GCYA 3I6KB 5ITBL 3T3ME 3W39A 1FBIL 2FRGP 2KQMA 4QXGH 4M7ZC 3SE4A 5H37G 5I1JH 2NXZD 4LDEB 3TC9A 3CUPB 1T04B 5D6CB 3PGCA 4M5ZH 1IL1B 1PZ5B 3O3AB 3NH7H 2GSGA 4Z0XA 5I18L 2I24N 3VJ6B 4NZJA 5DC4B 5E9DB 4HDIA 1P9MA 3PWJA 4FQ1L 1U3HA 1ZA3B 2DQEL 2H1PL 2AJ3A 1WFOA 3MCLH 4QTHB 2XT1B 1P7QD 1RJYA 1WWAX 3CIQA 4W4NA 5BJTA 3RL1B 3RTQC 4JY6A 4TRPH 2NY1C 1ZEAH 1M6OA 3VXSB 2VDNL 4YO0A 3UO1H 4NIKB 4D8PA 3BKJH 4PRIE 4GG8B 3QWRA 4FZEH 1O0VA 5C0IA 5IBLC 3MROB 4OD3L 4K7PL 1GYAA 5EBLB 3V6OC 1YEKH 5C0CA 4Y4FA 3DX6B 3GDBA 1KB9K 4OGYL 4NQVB 2YWYA 5DJ2B 5DK0A 4GSDL 5KG9A 3MV8D 2M26A 1SHMA 3I02A 3HAEG 4GRLD 3JV4A 1BD2B 5F97E 2NW3A 4W6WB 5I0DA 3DX9B 4XWGH 3D39E 3ZE2F 1KCRH 2YSSB 1OT2A 4F15C 5EPMA 4E5XA 3MZTA 5CAYB 1JK8A 4G9FB 3WHXA 3NCBB 1JF1B 4OFIA 3B5HA 5FF6A 4Q9RH 5B4MD 3DRQA 5FKPB 1I7RB 2P43B 1GOGA 5DD6B 3ES6B 2ZOLA 4HWUA 1MY5A 3GIVB 3D3VE 3I6GB 1XCQB 4P46A 1DQLL 4WO4C 3T8XB 3SGDH 4N8PA 3N0PB 4NHCH 1H9VA 5DFVD 4W70A 1CXEA 2A73B 3U1SH 3KNBB 4F7CB 5IW3A 5C07B 1S78C 3FFCB 1NDGB 3KXFB 1MCPH 3P2TA 4HPYL 4PJEB 3OPZL 3O6LH 2PW2B 4H26B 4RRPG 4PP1D 2R2CA 3IDIA 1KEMH 5BRZE 1A7OH 4E0RB 3EYFA 2FNBA 1WVZA 5GGQH 2VL5A 1JGUL 1ZT1B 3UPCA 1HYSD 3VFMA 3VFWA 2QHLA 1UXWA 1NL0L 4CMMB 5LBSL 4RWYL 1IKFL 1NLBH 3QXAB 1A1NB 2ADGB 2PXYA 4N0UE 1I4FB 4R26L 4YE4L 3TA3D 1KPRB 4H1LA 2L0DA 3PDOA 3THMH 2HTKD 5SX4I 4N0YL 5FEBA 2AJVL 2J3SA 1DN2A 4NQSA 4KPHL 1MVUB 2F19L 3BE1L 5EBWB 1TNMA 5ERWB 1T1XB 2X4RB 3MCG1 4OZIE 3WLWC 4XGZB 4K23H 4DUWA 5KANG 4JQVA 5H35A 1Y0LA 2ZJSH 4P2YA 3W11D 2AK4B 5HYSA 3BP4A 5HGGS 2WAHA 2CKBH 1YEHL 4IIQC 1B0GA 3I6KA 4DFIA 4EZMA 2OL3L 3BFOA 4LQFH 2MKWA 3CUPA 2UY7A 4CRPA 4UIKH 4TUJB 4L9LB 1INDL 3ZL4H 3O3AA 4P4KB 1D9KA 2B0SL 4OT1L 3N1GC 3BIBX 1Y6KR 3BGMB 4JO3L 3TIDB 1JZ6A 3S88H 2FBJL 3QZWG 4B41A 2N4IA 1RIVH 3B83A 3QNXA 5D7IB 3VXMD 2YN3A 1IC7H 1VEOA 2BNRD 1MWAB 3TNMA 4RMUA 4JVUA 2VR5A 3P73A 4HKXB 3LQZA 4I77H 4M3KB 4U1SB 4Z7VE 3VXSA 4EN3B 2GAZA 5TF1L 5SWSA 4F7TB 4WUUB 3O3EB 4JJHA 2J4WH 4L5FL 4I1NB 5I1IL 4KROC 1C5CH 2CK0H 1FZKA 3O4LB 3E6HB 2OCFD 4LHUA 4NQEA 1GAFH 1GOHA 3GSWB 5DUBA 3BUTA 3WO4B 1CU4H 3BQUD 4KKBC 1SJHA 3GRWA 5D5MB 5DMKA 3HC3L 2DB8A 5E2TL 2H9GB 1A3QA 1S7UB 1A1MA 2LAAA 3JTTB 4MZ2A 2ITCB 5DUML 1BD2A 1RJZB 2AABH 4MGXA 1ZLVK 4D9QE 1YPZA 1XF3B 5M7QA 1JFQL 5GS0C 1EBAA 2YSSA 1CGWA 5B3JE 3IFLL 3X14B 4PJCB 4X4YA 4NQDD 1VADB 2CR3A 4HCRH 2V5YA 4JPWH 3LEVH 5J8OA 4PR5B 3GIVA 3C8HA 4HLZH 2E7MA 1TZGL 4C57C 1S7SA 3TBYA 1MHCB 4FQXC 1RJLB 4IRJA 3WDHA 1DJSA 1FH5L 4UT9H 3SBWA 5JR1L 5DEZA 1P69B 3T8XA 1L7TH 1T1YA 3FB7B 3EJYC 2NY2D 2FO1A 4PJ8A 1HH6A 3IB4A 3F7QA 3PQYB 3MBED 4NQDA 4ENEC 4DK3A 5C07A 3KXFA 3FOMA 5F44A 1QFWH 2VZ3A 3OR7A 5E5MA 5ID1B 1XR9A 2PW2A 4HWEL 5DRNA 2B39A 2H8PB 5A3IC 3LHPH 3NACL 3NGBC 1DEEA 1NBYA 2E9WA 3FAWA 4UQ2B 3DVNB 4L4JA 4H8WC 4QHLB 3IDGB 4P2OB 1I85C 3QXAA 5I1AA 1A1NA 5IW1A 1I4FA 2VDQH 1FFNA 3SKNA 1CXFA 3Q6GH 4WDIB 1NAKL 1KJVB 3HRZA 4LLAA 1VESA 1TIUA 4HBQA 4BZ2H 3WFDL 4PP2B 3JWDH 4HUVB 5D72L 1X4XA 3IJYA 2DQHL 1VFMA 3BJLA 4ESKA 4XGZA 1YUHA 2ZUSA 3ORJA 1A47A 3KYMB 5CEYB 4FQCL 3R8QA 3P9MB 4WVRA 4LU5H 1AGBB 4R90L 2CJUH 4OZHF 2VIRB 1S5HA 2NR6C 1G0XA 1AP2B 3G04B 5D70H 5GRVL 5IHZA 4LARH 2Y06L 1CD1B 3G6JB 4S2SA 4PJBB 4BZ1H 3IETA 2MHAB 4NC0B 1JGVL 1I8MB 4P4KA 3MUGB 3QRGL 5E4IA 3K1DA 3LCYA 4AZ8A 4U6VL 4MDJA 2O5ZL 2I27N 3TIDA 3OAYK 1ES0B 4KK5C 4QY8B 3S97C 5DD1L 3B43A 4NBZB 1T5WA 5FUCC 2WIMA 1JNNL 2ZSWA 4ZAKB 5FYKE 2O93L 3QQ3A 3WS6A 5IMOA 2X4QA 4M9PA 1CFVL 2YN5A 3IVKB 1PAMA 5B8CA 3SGKA 2YKLH 4QRPB 1BM3H 3SGJC 1U41A 4L8SC 1JNLH 3BT2H 4KU1A 3BRDA 1CICC 1KJ2L 1JHKH 5ILTL 1KB5H 4K8RD 5F1NB 4JE4B 1P2CB 4YHYB 4Z76B 4JGUA 3V4VL 4OLEA 2PYED 5SX5H 2AJUH 7CGTA 1N26A 3H0TB 3OX8B 1KXTB 3MODH 5KS9E 4XCYA 2IH1A 4ZUTB 2X5PA 1T4KA 1SVZA 2WWKO 4M4RA 1C12A 3BPLB 3U0TA 2DQFA 3GMLB 3KYOA 3VFNA 5HDQL 4S11A 2VISA 4PJ5E 3UTPE 1A0QH 1KOAA 2H3NA 3X14A 5B39G 1XIWA 3VGDA 4AENA 1UKQA 3LPFA 3FQRB 4WEBL 1G7QB 3ZLQC 2P8PA 3H6JA 4OZ4A 1F00I 4JM2B 5DJ0A 4AG4L 1U8OB 4PJ9A 1MHCA 1F11B 1IGJB 1WBXA 2IWGA 1CLOH 5JQHC 4MQTB 1U9KA 1CDJA 4QGTA 3C9NA 2GFBA 3KPMB 4M61B 5C08A 3WXWL 3GSXA 5DI8B 5D1ZA 4NKIL 1F6FB 3PABB 3PQYA 5HI3D 5SWQB 1JYVA 3NCYS 5HGDB 4KHTH 2ESVE 3BESR 1XF1A 4U1IB 5JNYA 3JWNC 1T80A 5D7SH 2V5MA 3OMZA 1MCHA 1HHKB 4JFOB 1FAKT 4H8WL 5EIIA 1BLNA 5GS0D 5D1XA 3WIHA 5CLTA 3V0AC 1NH6A 4ODTH 4QRRD 4TSBL 2EXYD 3I75B 1L7IL 1NGXB 4O51B 1P4IL 3C5ZB 5DTFA 4K3DL 3REVB 3STLA 2RBLA 4M00A 5J1SC 3A67H 3TJHD 1V7MH 3U48A 1A7BA 1QO3A 3QUML 4D0DA 1KJVA 4U3CA 4NN7C 3IAPA 4UZGA 3VFGL 4RMTA 4JQIL 5D2NE 5HYJE 4KRLB 3IFNH 5CEYA 1OLLA 1OGAD 1CE1H 2IPKB 2XKNA 5FO9A 3BEWB 3NZ8B 4TVPH 1YMME 3SKOA 3HC0A 1F58L 2A77L 4IBLT 2AEIT 5I73B 2FD6H 1ED3B 4D9RD 5F9OL 5AZ2H 4KQ4L 2Q20A 1AP2A 3R1GL 2NQCA 5HI5C 3HAEB 2BSRB 1NCCH 1TZHA 2NNAB 4GMSH 2GY7B 5GRJL 4XB8A 4RX4A 3ROOB 2ZSVB 4J3XA 5J9PA 3MUGA 1GGIH 2CUMA 2XWJB 4JRWA 4Y19A 1OP9A 1J8HE 4ELMA 3I9GH 1IAIH 3O11A 2FGZA 5J3HC 3PJSA 3VXUD 4I18C 4JFYB 3WXVH 2YD1A 1G7MB 1WCQA 1UJ3C 1AD0A 1OAXH 4OZFA 4X4XB 2R8SH 2W9DH 5ISZA 1R3HA 2V9TA 2X4NB 4ZAKA 1CYGA 2EDRA 3RX5A 1MEXL 2AQ2A 4I3SH 4YAQA 1UZ6F 5I30H 4G5ZH 2J8HA 4EQ2A 4R7NA 4U0RB 5LJYH 4WW2B 3EFDH 1KUMA 5TQ2H 2NW2B 1LO3L 3N1MC 4N1CA 4HD9A 3QHFH 5EC1A 3H3PL 5KSAA 3P4LA 1FLRL 2FB4H 1AQDA 1E27A 1INEH 3C08L 3L3GB 4PGEB 4Z76A 1A7RL 5L2JB 4XXCA 1OPGL 3SY0A 5KSBB 1OARH 4FMKA 1T7WA 4L4TE 5E1AB 4RAUA 4IJ3B 4KK5D 1WICA 3A0OA 3IRPX 5K93A 4G42B 3AU1B 1AIFB 4WFGE 1HSAB 2EIZB 3QUZB 4TUOB 1VEMA 1IQWH 5GGRY 4FFYL 1IT9L 4L4VA 4DKFH 5TDOB 5C0AD 3FO9B 4NJAL 3ZDYF 1FLTX 2HTLD 4C56B 4DGIH 4MJ6B 3LKRA 3AMLA 2BVQB 2DMBA 1ZS8A 4Q9QH 4QWWD 4FP8L 4MXWH 1F11A 2FBOJ 3W2DH 4PG2A 5EU4A 1MCWW 4ZFOA 3L3HA 3QT2A 4M61A 2F9BT 4HS3B 4S0TD 4MJIE 3VMNA 3BD3A 1PEZA 5EUOF 1HHJB 3TYFB 4PB9L 3EOTL 1E4JA 5I1EL 3HMXA 1LP9F 2XY2A 5HGDA 4W4OA 1MFEL 4U1IA 4LKXB 1IM3B 4I2XE 3REWA 5DZOA 5KN5A 1AKJA 2A9MH 3MRLA 1VPOL 2VLJE 4NO3B 1T03H 3L5HA 1JF6A 4K3EH 4LHUG 4JKLA 4WU7A 1MRDL 1FJ1B 4IOFD 3MGTA 2AXGA 3ARDA 4CVZB 1NKRA 4Y4KC 3SDCD 5GXBB 4P2RB 5CJ8A 2VQ1B 3QZWB 3P30H 5FUZL 4YX2H 3NCYP 1NJ9A 1FYTB 3U6RB 5EORH 4GG6F 4AEIH 1NFKA 4NHUA 1K5NB 4U1GB 5IFAH 2B20A 4JPKL 1I1AD 3CFDA 5IBTL 4F33B 1JI1A 3HE7B 1N0XL 3MRFA 5IIEA 4PJ7F 1NC2D 3TV3L 1WC7A 1Z9SA 4NCC2 3T09A 2W9EH 3B3IB 3VXOA 2OK0H 4X83A 3SDCA 2VDOL 4WGWB 4HWZB 2EYTA 3VE0A 4JRYE 3LMJL 2EZ0D 1A7NL 4Y5YB 2XZZA 5JHDD 2BSRA 3OWEA 3GMMB 1JPST 3HG1E 2NNAA 3PWNA 4ZS7H 1VFBB 3GNMH 1FNSH 2MJWA 2ZWLT 1E6OL 4M6ML 2XWJA 2X4OB 4PJDB 4XNYL 1U36A 1CLYL 4KKAD 5DEFA 1OTUC 1EHXA 5LQBL 3WKNA 4KJPC 5TE6L 2HT3D 4XRCA 5ACMA 5CKAA 5D7LD 3AB0B 2QBWA 5FECB 3O3DB 3RGVC 2L7UA 4OCWH 1RU9L 3LKPA 5GGSB 5DMGC 1UT9A 3EYUL 3PWLB 3QIBB 1JGLH 1T21A 2XPGB 2G5BA 4I48B 4HWBA 1N64L 3CGTA 2WUCH 1ZTXH 1YEGL 4Y1AA 4G6KL 4LEOB 1QLRB 1QUNA 1HSBA 4FQ2L 3O3BA 3QJFA 1K4DA 2AJYH 3QFDB 1U58A 3NABL 1K4CB 3M8OH 3SGDI 2Q8BL 4YXKL 4AM0A 4BFBD 5T1LA 1CTOA 1N59A 1MWAH 5IVXE 3ZTJG 3BN9D 3DUSB 5I16A 4XPBL 2VMFA 1FCGA 4OCLC 3W0WE 1GCFA 3LN5B 4TNVK 4FABL 2R2HA 1ZGLA 2Q86B 5TGBB 3FRUB 1IGIH 5FOBA 5TDPB 2WM0A 3RL2B 1SEQL 3U7YL 1WWWX 4GAGH 2IFGA 4WHTB 3ARGD 2VZVA 4QOKD 5TDOA 3V0WL 2J8OA 4YJZL 3BH8B 1B0RA 3RUGE 1I9JH 2FSEB 2ZG3A 3NPZB 1KCVH 4U6XB 1J5OH 2IANE 2AXFB 1RUKH 4MJ6A 4U6HB 1UH2A 3VDBA 3FB8B 4FQJL 3P0VL 4W6XB 3PWVB 2G75B 4WUKL 1Y18B 1V5JA 1INQB 2GTWB 2Q8AH 3VWJC 2VWEE 2XTJB 4XPGL 2UYLB 2AJSH 1UJTA 3WEXB 5GISH 4OQ1A 2DIBA 2DQIL 1ZLWK 1OAZH 5T5FL 4HS3A 3BWAA 1ACYH 1HIML 3QI9A 1KC5L 4HIHA 4YUEH 3HNVL 2RJMA 2Q7YA 1S5IL 3QFJA 2V7NB 2AJXL 4MCYA 2VLKD 2B4CC 1C5BL 4NNXA 3KPOA 1TMCB 2G9HB 3DI3B 1QSFB 4YHOH 1YA5A 4OGAC 4NRYB 4HUXA 5IMMB 3SCMC 5E6IB 1JV5A 3BD4A 3O2WL 4NO3A 4O58L 2JELH 4I0PB 4DVRL 3N9GL 2DKSA 1G7IB 4JN1H 5I1GL 5T5NG 5J1AB 1OGTB 1ZHNA 4KVNL 3OZ9L 2JJTC 4CVZA 1G7HB 4ZUVB 3MGOB 3CVHL 5KSUA 4PRPE 1WV7T 2EDHA 1TCMA 1U0QA 3F7VB 3P4NB 4GKZA 3MRMA 2J1KA 1FYTA 4EVNB 1CZ8L 4C83B 1QSED 3KPPA 3TPKA 2D4FA 2FJHB 4LL9A 1A6AA 4JM4L 3S6CA 1KG0A 3TM6A 3QIWC 5EZLB 4GS7C 2XFXB 3K2UH 2EDNA 3DARA 4IRZH 4Z0BH 4LIQE 5KVEL 5C0GB 3QIUB 4NKQB 1D5IL 5FYKL 4PBWD 3B5GA 1FVEB 3BO8B 4WV1C 5EIVA 1C1EH 5CSGA 1EERB 4P5TC 1K2DB 1D5XA 4WGVB 1UM5H 1UQSA 4OM0L 3MJ9A 2XI9A 2H2SC 5I1CL 3G6DH 4P5MB 3EOYG 3TO4B 4JQXA 5ACLA 4DQOH 5GZNC 4G7YL 1SYVA 3T0BA 4D3CL 3CMGA 2UZIH 1AQKL 3RI5K 3HNSH 4Y4KD 3JSSA 2HFEA 4QHNA 4M6OH 1TETL 2Z31D 4M7JL 5KSVA 2LFGA 1W72B 3MX0A 4RIRB 1CBVH 4OKVB 3K0WA 4M6NL 5B39B 5C0EB 1GGCL 4LLUA 3FQWB 1MHPH 3GMPB 4HULB 2VJXA 3M07A 4UDUB 4FFVC 1N4XH 1FSKC 3V8CA 3H9SB 4NWUL 1MI5D 1L6XA 2J6EH 3FMGH 3V2AR 4XP1H 5MI0C 3ZKMC 2GSIA 4M48H 1T1ZA 5IB4B 4LGRB 4Y5VB 4XC3H 2H6PA 2HT2D 3UTTB 4G43A 4X98B 4YXHL 4N1HB 5BZDA 5ESVA 4RFEB 5MEQB 5BQ7A 3KYKL 1WK0A 2XNAA 2FLRT 5L2KA 3QISA 3TT1H 1NCUA 1YQVL 4JRXE 4OCSL 4KMQA 4TULH 2W9LA 4NT6B 1P7QB 5E2UH 4YDIL 4PJGE 4FZ8L 4I3RL 5I6XB 4YZFE 4JFDE 2A0LC 3UC0H 3K81A 1CFSB 2APXA 5TF0A 2C4FU 1OF2A 2VC2L 2EICA 3UTSA 4TTDD 5CWSB 1NAMA 3LB6C 4OM1H 3TN0A 4ZDHA 3QCVL 1Y18A 2R1XA 4M03A 1NMCB 2J8UF 1WF5A 5FYLH 5GS1B 2ZKHL 1G9MH 1M05B 2F74B 1Q9WB 4OZFG 3GHEL 2B4CL 4NSKB 4FQLL 1EV2E 1OW0C 2CXGA 1I7TB 2JCCB 3QXTA 1LILA 3P11L 4JPVH 5HGHB 2AV1A 1KB9J 2HP4A 4GRLB 5EOTB 1EHAA 2V7NA 3BAEH 3RAJL 2G9HA 3DSNA 2GJ6E 5EO9A 3D25A 1RZFH 4BFIB 4HUUA 3M17B 1NMBL 5IMMA 4NUJB 4I0PA 1G7PB 1L4IA 3JWOH 2ZG2A 1AR2A 1FGNH 1G7IA 4DCQB 4XCNB 1MJ7L 1BIHA 1B2WH 3IDMB 2UZXB 3VD9A 4KJQC 2OSLA 3FQXA 2WQRA 3KS0H 4EUPB 5BS0D 2Z9TA 3Q5YA 1RZ7L 3MLSH 4OFKA 4WY7H 1G7HA 5IHUH 3GBNH 3HUJE 3MXVL 2ENSA 4M8QB 4ZUVA 1MJ8H 4OAWB 4R7DA 1SBSH 5EH1A 4CJ1A 5GS2H 3LKOA 3VWJD 2NY5H 3SE3A 5SV4A 3CLEH 4G80B 2I5YL 1Q9KA 4NO5A 1Z6JT 2C3VB 5EZLA 1DQJB 2GK0A 1P84J 1HHGB 35C8L 2OTWA 3D2UD 4XVUD 8FABA 3OL2A 1WUNT 5IFHH 1FVEA 3BO8A 3DRTB 5F7KC 3VFRA 2GK2A 4KAQH 4OIIH 1A6WH 4HS6A 1NDMA 3SE9L 1MLCB 3AM8C 4XPHL 3KPNB 4Z7WA 5HY9B 4TSAL 3VI3E 2FIKB 2APBA 2A9NL 1RJCA 3I2CH 4G9DB 2CLVB 4DN3H 4LOUD 4JFZL 1EGJL 4OLWH 4MX7A 4NQCE 3TA3B 4PJHE 1Z9MA 1LEIA 2WV3A 4LVHC 5DO2D 2YBRA 3O8XD 4O2FB 1WWBX 3TH4T 2PO6D 3WV0A 4JFHE 3BP5A 3Q0HA 3C8KA 1BQSA 1JRHH 2OJEA 5HGBB 3S34L 2E7CA 1TQCC 1DLFH 3HE6C 5KW9L 1NEZB 3QIWD 5F9WC 3QDMD 1DANU 1MCDA 4MNGA 3ZT7A 1KCSL 2RQ8A 1LVEA 2EH7H 1ZLVH 3T3PE 1I8KB 4LNRB 1DBML 4G7VL 1R3JA 2ORBL 3HAEH 4O4YL 3SKUD 2VR9A 4ISVA 4LK4A 4P59L 5HI4D 4MNQA 1YDPB 4JFFD 3JTSA 3NFSH 4K2UH 5I8OL 3NIDE 2PO6A 1TQBB 1GGUA 4OLUH 3VXRD 15C8H 5IB4A 3KS0J 5B3JF 4Y5VA 4XP9H 4H88H 1I7ZB 3AGVA 1UA6H 1SM3L 4QRTA 4P2QB 4RFEA 1YC8A 5MEQA 4J2XA 5IVOA 4I9WE 4XX1G 3RPIA 1PKQE 1YEIL 5DS8B 3QEQB 5F96H 1KXQE 1MF2H 4XVTH 4A6YA 1HNFA 3HFMH 4OD2B 3VXMB 4U1LA 1UWGL 2YA0A 1M7IB 5DEGB 5DMIH 4NT6A 2OI9C 5CEXB 1BIIA 1HEZB 2BNRB 3PDGA 3FT4A 1AR1D 3RWFA 1IFHL 1NCDH 4ODSL 4NWTH 4WHYG 3KYNB 1R3IH 4OZGE 5EU6D 1A9EA 3QDJD 1LEKA 3S7GA 3UYRL 3ZKMD 3JVGC 5B38G 3MRPA 4X6CB 5DK3A 2WW8A 2ICCA 1L6ZA 5E00B 3H9HA 3GI9L 4NCDA 3OB0K 2F74A 1VSCA 1OM3L 5DA0B 1NC4D 5KVFH 3LEXB 2ED8A 4OF8A 2DKMA 4XWOC 2LE9A 2XA8H 3DMMC 3NAAL 2IPTL 4O02L 3U2SB 2IG2H 1AXTH 2V7HB 4ODVH 3IDXL 1P4BH 5BV7B 3RZCD 5FV1L 6CGTA 4QXGL 3RTQB 3QUXC 5I1JL 1AGEA 3IKCB 2EECA 2NY1B 4OI8A 1H3GA 1CDCA 1O7SA 3ALPA 2FZ3A 1C7SA 3EDDA 2W1NA 4M5ZL 5IMKA 3IDMA 3X3GH 2YD8A 5DJYB 1AGFA 5HHMD 1EX0A 1M4KA 2C3HA 5LWYH 3NH7L 4OUUA 5IROA 5BXFB 5E08H 1E4KA 3LB6D 3KPSD 1CFNB 2HT4C 3MJ6A 4X9FA 4PLJC 2PW1A 2HYMA 3DHJA 2BMKB 4L29A 2D0HA 4XAWH 2MQCA 3B6SB 5FM5O 3P0GB 2FX7L 5DWUH 1BOGA 3TF7C 3VFVB 3E6FA 1IAII 3HPLA 3MCLL 3MBEB 1DDHB 2BVOB 5IKCB 5ACZA 2DS4A 2JIXB 1YN7B 4TRPL 1ZEAL 4U2ZA 2ZNXA 1KSRA 1C16B 1FE8H 3T2QA 3UO1L 2ARJA 3BKJL 3ZDXF 4X6DE 2I60H 3ARBC 2V5RA 1DVFA 1T66C 4OCXH 4NQXB 4FZEL 2CXKA 1T2XA 3GSOA 4Y89A 1F4HA 1YEKL 1J86A 3MJ8A 2N1KA 3IXTA 3KJ6H 2CUHA 3HI1B 3S96B 1TPXB 4DOHB 3VDCA 4CN4A 3RY4A 5CP3A 4WO4B 4NYLB 2DYPB 3NFNB 3ILPB 1WFTA 3CD4A 1NEZA 4CGTA 2FO4A 1U93B 3BPNB 3QCUH 4YHPB 4M7KH 4X99B 1KCRL 1LEGA 1FNGA 4O2CB 3RVTC 2EYRA 3D0VB 4PJAA 4Q9RL 1FFPB 2Y07H 1YDPA 4MAUH 3S5LG 2HG5A 3IU3B 2OMNA 3LKQB 4RA3A 5E9DE 2F53D 2VQUA 1R3LA 3UROR 2EIEA 4PRAB 4NJ9L 2MQ0A 5IFJA 3AMKA 3WNKA 4P2QA 2FJFB 1U8JB 3R06B 3AC0A 3U1SL 2WINA 3EO1A 1B0WA 3IGAB 5DS8A 4LLDA 1MCPL 5HHOD 3S35X 3VXSE 2Y5TA 1IC5H 4OD2A 3O6LL 1EFXD 1M7IA 2BVPB 3TBVB 2H32A 2B2XH 1KFAH 1KEML 4PUBH 1U92A 1A7OL 1J0HA 4POZC 5DHVH 3SJVA 5GGQL 1AJ7H 3F7PC 5EC2B 4F80A 4XZUB 4N0FA 1IQDB 2MCPH 4IIQB 1NLBL 4KH2A 1OCWH 4LCCC 5ICYA 3VG9C 3WJJC 4LAQH 1YNTA 3KPQB 2JKXA 1VCAA 2VDLH 3THML 4OIBA 5JIHA 1BD2E 2OL3A 5T1KD 2VTFA 4FFZH 4P5KB 4UI2A 1YPZE 3PHQB 1E0OB 2F8OA 3G5ZA 4N8VG 1PZUB 3VRIB 3U30B 4UAOC 4K23L 1G9NH 3JWDC 5ID0B 2MFNA 1DFBH 1QZ1A 4G9FE 3BJ91 1GZQA 3L3DB 2R0LH 3FQUA 4HIIB 1FG9C 2CKBL 3BKCH 4JFEA 3TYGH 5I17B 1R5VB 5EN2B 3VG0H 3V5DA 5J11B 3NN8B 3RTQA 4LQFL 4P57B 5JOPD 5T1KA 4P48A 4F37F 3BGFC 4APQC 4UIKL 2R2BB 5CGYC 3ZL4L 5IEHB 3EO9H 3U4BH 2EDLA 5K9KB 4U4BA 4P23C 4ZODA 3VRJB 3U46B 4MWFB 4ALAL 4PD4J 5SWZD 4Z7UB 5C07E 3FFCE 3KXFE 3B6SA 2VAAB 3RWIB 3S88L 3IDYB 3VWKD 3KWWA 2UVFA 4PJEE 1RIVL 3VD5A 2V2TA 4WWKD 2VLRD 5JIIA 3LS4H 1QR1B 1IC7L 2X1OA 3GMRB 3OV6A 4N5EC 5D7JC 2JIXA 4PJFB 3QEUA 5HDBF 2NXYD 3DMMD 3FONA 1ETZA 4HAGA 1R5WB 3V6FB 3MO1B 4HT1H 3AFLA 3ARQA 3G6JF 1X6NA 1X4YA 4PJBF 2J4WL 3IF1B 2F5BH 4NQXA 3ALWA 3SPVA 1C5CL 1KEGH 2CK0L 4QRRB 3RDTD 5F8RC 3VWKA 4NNPH 1GAFL 3ALXA 5J6HB 1CU4L 1WBYA 3FT3B 3MV01 4GW1A 4OIAA 2W60B 4RCAA 3ECBB 4YHLH 5FA3B 2ZUQC 1E28A 4FQXB 2AK4E 4LDLB 4WO4A 1MOEA 2A74A 2AABL 4NNYB 4XHQA 2HVJB 4TN9A 4EEEA 3IDJA 1D3CA 4YHPA 2BZDA 4BA8A 3H7BA 4X99A 1TENA 4ELKA 1QPPA 1OGAB 4GOSA 3DXAD 3KVQA 3O6FD 1HOCB 5DJ6A 1EPFA 2QADC 3RVVC 4HCRL 4JPWL 2D7NA 3MV7A 3LEVL 4K7FB 5TJWK 4H25B 2FH8A 3CCHB 3FB6B 3CDFA 3LRHA 3ZE0F 2KZ1B 3ESUF 1W72H 3WKMH 1QRNB 4R0LA 4PRAA 4X0KA 1L7TL 5TH2A 5HD8C 2CO7B 4ZTOH 3D85A 4WFHE 4WU5B 3FFDB 3LEYH 3R06A 3SDAD 3MSPA 1BZ9A 2VDPH 4HHAA 3TCLA 3MRJB 4IRSC 3C6SA 3D0LA 1JGDB 3BW9B 4ETQB 1QFWL 1UH4A 3VXUB 4WUUE 5D71H 2BVPA 1PLGL 4LCWB 3T0ED 1DEDA 3LHPL 3BUYA 3O4LE 5DD5H 2VKWA 4L3AA 1LO2H 1CXIA 4KHXH 2BCKB 1HI6A 2VDQL 4HQQH 3STZA 4KKLC 5D2LB 3Q6GL 4OLVH 1Q9LB 1WAAF 2ICEB 3KPQA 4RAVB 4ZXBC 4BZ2L 2NY6C 4P5KA 3JWDL 3T65A 1FNAA 2A6JA 2FWOA 2BOCB 4PJCE 2BNQA 2AQ3A 2P1YA 1BQUA 4M1DH 5HJ3B 3LN4B 4LU5L 5EBMA 5I17A 2CJUL 2CDGA 5J56B 5F9JB 2ZUWA 2P5WD 1IEAB 3V7AG 4ZFZA 2K3TA 1NUGA 3QNYB 3S3SA 1ZT7A 2OXGA 4WJ5A 5D70L 5C0BD 3P3YA 5ITFB 2J5LB 1PW3A 5E8OA 5DC0A 4LARL 3ZSTA 5LGHH 5IEHA 4I5BB 4BZ1L 2NX5D 4MWFA 1EO8H 2UV3A 5GS3A 1N0LA 3PQYE 2EDJA 3MV9D 4KK8C 5IM7B 3HNTH 5CLWA 4L8SB 4PRNB 1CICB 5I74C 3DVIA 1KPUB 1AGCB 5IHLB 1U8PA 3OKDA 2XA3A 1BVKA 3B2VH 1KJ2A 4XHJC 4LVNC 3X11B 1RK0B 5TPWH 2CDFB 4MLIA 4MZ3A 2NY3D 1PG7X 3O9WD 1QOKA 4PJXA 2DQUH 3QA3A 4PJIA 5ICZB 4EUPH 1UG9A 5C09D 2Q3AA 4LRNH 3QG6B 1FL5B 4LSQH 4F57H 1QBMH 5K9OA 1BM3L 2D0FA 3ETBF 4HIXH 5EBGA 1QSZA 1IGYB 4LLWB 4JAMA 1JNLL 1L0XA 2VUOA 3BT2L 3VGBA 1JHKL 5E24E 4ONFL 1KB5L 4OLZL 4MSWB 5DQ9B 5F70A 3QO0A 1BZ7A 2OM5A 3DO7A 3WUWB 3UBXA 3QHZH 4KQ3H 2AJUL 5FA3A 1ORSB 3MODL 2D7TL 1IAOA 3QH3B 2FCBA 4QNPF 1UB5A 3OXSA 1I1AB 3GM8A 4K7PY 3OAUH 1MNUH 2ERJB 3MRCB 4IS6A 2NLJB 3CH8A 1S7QB 1CXLA 3NCCB 3TBTB 3HZYB 4C55A 5IR1A 5LAXB 1TDQA 4EIZC 3G5VB 3EOBB 1A0QL 3MYJB 3EGSB 5B38B 1HOCA 5IVXF 3G5YA 3RVXD 4PFEA 3TH3T 2R9HC 3SHSA 2CIKB 3WFEH 2Z8SA 8CGTA 5BVJB 2NZIA 3ZSSA 1QFPA 4XC1H 2OQJB 4LCIH 4HUNB 4RGNE 5JHDB 3VW3H 1A2YB 4ELME 5CZXC 1F3DJ 1CLOL 4ODWB 1QRNA 1KLFA 1ZHLB 3DV4B 1I85A 4GQPH 1FZJA 5GJTH 4JO2H 3MR9A 5KVGH 4PRID 1ZLWH 1P5VA 4ZTPH 4KHTL 4WW1A 5D7LB 2VZ1A 5D7SL 1RD6A 3L3IB 3ZT6A 3QUMA 4LCWA 5EG6C 1F90H 4U1MB 3U4AA 4QRPE 4HKZA 4ODTL 2YMXH 4X7CC 4G8GB 5EOQH 2BHUA 2YK1L 2V9QA 2P48B 4ZSOA 1YNKH 2Y7QB 1AGDB 4S1DC 5DDHA 5HPOA 4M1CD 3A67L 1V7ML 3EFFB 1Q9LA 5C9JA 1YECH 2WWKT 2E6QA 5F21B 3D39D 5FYLE 4X7TB 3O4OC 5DK2A 5ICXB 3MRQA 4DZ8A 5C6WH 3IFNL 1QLEH 4UU9B 3OKNB 3N1QC 1CE1L 2NY4C 4TVPL 1MSPA 1U8QB 5E8NB 1F2QA 4I18B 5F9JA 2FD6L 2NTFA 2HA1A 4P3CH 4QXTB 4WHDA 5K9JH 1UJ3B 1J1XH 4HMEA 4FNLH 5AZ2L 4LLVB 3LKSB 3WD5H 3ARGB 2CH8A 5D9SA 3D39A 1XCTB 1LO5B 1NCCL 1A5FH 1CDYA 5AG8A 4NFDA 1ZA6B 4GMSL 2Z92B 3CPLA 4I5BA 5F89A 1JPFB 2IH3B 1GGIL 4KKLD 3T0DA 3W9EB 1K85A 4PV8B 4EQ3A 3I9GL 4MB4A 1IAIL 3D3VA 5BRZD 1QBLH 3TEUA 2P7TB 5BV7H 4CN1A 4M3JA 3WXVL 3DYMA 2XG4A 2WUBH 3ZKNC 1OAXL 4WWID 2R8SL 2YD2A 3D9AH 3S5LB 3B8YA 2W9DL 5TFSH 4RISH 2VLKB 4I3SL 3ARRA 5I30L 4G5ZL 2WQ8A 1L0YA 4X8JA 3WHE0 5DQDH 5I1HH 1ADQH 3EFDL 5F6IC 1G6RB 5FB8A 5E8PA 3TPUB 1FN4B 5TQ2L 1KF9B 3BIKB 1X5JA 3DGGA 5JOEA 5BRZA 4B7IA 3QHFL 2UWEF 2FB4L 4MDIB 4MSWA 1INEL 3D69A 1JVKA 1FFOA 3PIQB 4LGPB 3BN3B 1T7VA 2LAGB 1QSEB 3WFCH 1OARL 1BAFH 4KUZH 4PY8J 4YHZH 1OB1B 3CK0H 3MRCA 3SOBH 5JXAH 1OSZB 4AT6B 1S7QA 3OKLA 2CDEA 2R1YB 1IQWL 4KGLA 3IAGC 5EOCH 4CW1A 3ZTJH 5IB3A 2CIIB 3QNZB 4DKFL 3MNVB 3HZMB 5IGXH 2CIKA 1N5YH 1T3FB 2NMSA 4J3WA 2R0WL 4DGIL 5DJCA 2V6HA 4RQQB 2OYPA 5E94B 4Q9QL 1ZWIB 2BSSA 5CIPH 4N8VB 3Q5OA 3FO2B 4DUXA 4MXWL 5IW6A 5JPMB 3W2DL 3UTQB 3Q5TA 3DV4A 5CMAA 3RVWC 4Y4KB 4QCIA 5FGBA 1U8KA 2Z31B 1EEQA 2P8LA 1MHEA 3CC5B 5I9QB 2DKUA 3HA0A 3MRIB 2MPAH 1FNEA 4OF5A 4OUOA 5F1OB 2A9ML 2JE8A 2ZOKB 4KY1H 1T03L 1TCRB 4K3EL 2BHZA 2IQAB 4NC1E 4G8GA 4PBXA 3T4AA 3LS5H 5KANI 4EDXB 1KBGH 4GLRH 2X70A 1RUMH 4XPFH 1IBGH 2X4TB 3OSKA 4Z7VA 3HB3D 4Y2OA 3CH1A 4YX2L 2QKIB 4PREA 1LK3H 1J12A 3LSOB 4UINH 1UB6A 4PB0H 4NO0D 4HGWA 5EORL 4NPYB 4D9QD 5KSBE 4GT7A 4LPUA 4AEIL 4JDTH 4WFED 3J8F7 4PRHB 4GW4B 5IFAL 4WTZA 4JZOB 3CFCH 3G08B 4UUJB 2FX8H 4ZFFA 1QHPA 4NBXB 1KT2A 2R2EA 4YDJA 2P8MB 3J7HA 5DJDA 2W9EL 4AIZB 1N6VA 3BH9A 4JKPH 4BZYA 4POUB 4C56E 4X6EB 1EA9C 2BRRH 4QXTA 3RGVB 1UJ3A 3WIFB 1GHFH 2E8YA 1OTTD 4KZDH 4NO0A 4P2OC 4MD4A 1NFDA 4JY4A 5CFHA 1NGQH 2BOBA 3M1BB 4H0IA 4KRNA 3SKJH 2JJVA 4K8RH 3SGEH 4HH9B 5M95B 3T4YB 3TP4A 4XBGA 4BUGA 5BVPH 4ZS7L 5I1LA 1CDUA 3GNML 1FNSL 3O6KH 1S9KC 3PUCA 2VAJA 4HV8B 3ET9F 1D6EB 4N90E 2ADFH 3DETD 1MFBH 4DK6A 1OQXA 2P7TA 1PVHA 1OAUH 2RHEA 3DTXB 3BPOC 3ILQD