2IH8A

A low-dose crystal structure of a recombinant melanocarpus albomyces laccase
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Laccase-1
publication title A crystallographic and spectroscopic study on the effect of X-ray radiation on the crystal structure of Melanocarpus albomyces laccase.
pubmed doi rcsb
source organism Melanocarpus albomyces
total genus 184
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A03
1XB6A 4YVUA 4F7KA 3H4FA 4DP1X 1DZ0A 4A67A 4E9WA 3OMNB 1HAUA 4YSSA 5FC9A 1OE2A 2YARA 1NWPA 5I6MA 1UATA 3FYEB 1PMYA 1ZDQA 4HCFA 2HX7A 3AY2A 4HCGA 2R7EB 4DP7X 1BQKA 1ETJA 1GYCA 3RYMA 3EF4A 1W6LA 1CC3A 1TEGA 2Y1AA 3PAUA 4M3HA 2IH8A 5A7EA 2P80A 4DP5X 4YSQA 1PLBA 3IE9A 2DYSB 2VW6A 1EZLA 1M57B 3IN2A 2HLEB 2IDUA 5F7AA 1URIA 5D4HA 4BXSV 3IN0A 1IBYA 2LLNA 3QQXA 1JXFA 1QNIA 4DP0X 3S3DB 4BWTA 2HX8A 3ERXA 4HHGA 9PCYA 2VSKB 4AKOA 3X2QB 4YSOA 1PLCA 1RCYA 1FFTB 4Q8BA 1X9UA 4E9XA 3OQRA 3FU8A 3X1BA 4KO5A 2Q5BA 2ZOOA 5B3SB 3ZDWA 1OCCB 3NSYA 1AZBA 1KGYE 1J5CA 2YAHA 3UAEA 3V9CA 2EIJB 2OJ1A 4UANA 3PCYA 1ET5A 1AIZA 2XXGA 3DIVA 3EH5B 5I6NA 2WSDA 1JZJA 2UXTA 1J9SA 4HCIA 1E30A 1NIBA 1A8ZA 1GW0A 4K9JA 5B1JA 1IKOP 1WA0X 5F7BA 2VM4A 3QJQB 4DP4X 4NB7A 5I5IA 2DY2A 4KO6A 3SBRA 1AZNA 3ABGA 1SJMA 2EIMB 2UXVA 3AG4B 4DP8X 3FSZA 6PAZA 1GY1A 2HXAA 3QJRB 1AQ8A 1NIDA 1AZUA 4GP5B 4G72B 1PCSA 1M9WA 3U25A 1ADWA 3UADA 1L9RA 1HAWA 4A66A 2GB2A 4DP6X 4YSUA 3NSFA 5B1KA 3PAVA 1FA4A 4W9ZA 2FWLB 3NJHA 2WO2B 4KO9A 1F56A 4NERA 2Q9OA 2IDFA 4A2FA 2GC4C 2EIKB 3UABA 3H56A 4GXFA 1WAEA 2EILB 4EF3A 2J5WA 3ABLB 5I6LA 4A2DA 1J9RA 1OF0A 2J56A 1AG0A 3EH4B 2VSMB 4WKXA 1R1CA 4W1TA 5TK2A 4P5RA 2XWZA 1SF3A 4QLWA 4E9TA 2QDVA 1OE1A 2YXWA 3FQ1A 3OM3B 1IBZA 2AZUA 2BW5A 3PPSA 1JERA 1AANA 2XXFA 4F2FA 5I6OA 4YL4A 1AZCA 3T6VA 4DP9X 4FAAB 4ENZA 1ZV2A 1PLAA 5B7EA 1JZFA 3NSDA 1BQ5A 4A2EA 3KW7A 2YQBA 2FQGA 2H3XC 1NIEA 5TK4A 2BZ7A 4PAZA 1PNCA 2XV2A 2YAFA 3ZIYA 2FQDA 4HIPA 3X1EA 1A4BA 2HRHA 4AKQA 2IAAC 3FQYA 2B3IA 1WA2X 1ILUA 2PPEA 3MBWB 2DWTA 2FT8A 1JXDA 4G7RB 4YSRA 2IDSA 3OMIB 4F2EA 2I7SA 3UACA 1NIFA 2QT6A 1V54B 5B1JC 2PPAA 4UF7C 2IH9A 4A2GA 4BDVB 2PPFA 2Y69B 1A4AA 2GIMA 2FJSA 2YAQA 1WA1X 2YAEA 2FQEA 3CDZB 1EHKB 2E86A 1QHQA 4BK5C 2ZONA 5D4IA 2IWEA 1KYAA 4YSAA 1A4CA 1AAJA 1BXVA 1JZIA 1BXAA 2PPDA 2YAPA 1MG2C 2UXFA 4YSEA 3QJSB 4E9QA 1E5YA 1L9TA 2BWIA 1PAZA 2OV0A 1AZRA 3ZBMA 2J55A 1ID2A 3AG3B 2YAOA 3WKPA 1OE3A 2BHFA 1JVOA 3NSCA 1SFDA 1V55B 4JHUA 1AS7A 3T71A 5I6PA 3T6ZA 3T6XA 1PZCA 1NICA 3GYRA 2BP0B 2QPDB 5B7FA 1SDDA 1BEXA 1JXGA 2EINB 3D12B 4AKPA 1VLXA 3C75A 3PAZA 3OMAB 3AZUA 4BDVA 1IUZA 2VMJA 3CDZA 1KCWA 1OCRB 1YLBB 3L45A 1OOWA 3UAAA 1NPNA 3TBBA 2YAMA 4G7SB 1GS6X 4HAKA 5IY5B 4DP2X 1ET8A 2PCYA 1JVLA 2XV0A 3V9EA 1GS8A 4BWUA 2DYRB 3NJNA 5I5MA 3N2JA 1XMEB 1E65A 4KOBA 1J9TA 2XX0A 2AANA 5AKRA 1T5KA 1PNDA 2IDQA 1W8EA 4GP4B 4AZUA 4G7QB 4HALA 2ZWNA 3TA4D 3FPYA 3NP3A 3CVDA 3WIAA 3NJLA 1J9QA 1NINA 3NJFA 2B08A 1ZIBA 1QLEB 3H4HA 2BP0A 1MG3C 3ABMB 1AG6A 3SBPA 4A68A 3HEIB 3SQRA 2H5UA 3NJKA 1BAWA 2PPCA 3ABKB 3QJUB 1KV7A 2RACA 5D4JA 1L9SA 1SHXA 4YVNA 7PCYA 4GP8B 1MZZA 2VN3A 3QJTB 4AX3A 3EH3B 1SHWA 3T9WA 1ASPA 3N55A 4YSTA 5B1BB 6PCYA 3WNIA 1NZRA 1WS7A 2ZXWB 3NJJA 1MDAA 2I85A 2GHZA 1W6WA 3KW8A 1ZDSA 2IWFA 2JFCA 2PLTA 2BW4A 4NAJA 3AW5A 3OD3A 1KCBA 2TSBA 2FT6A 1AOZA 5B1AB 3S3BB 1SFHA 4JHVA 2J57A 2PP9A 3NJMA 2HX9A 2WO3B 3JTBA 1KDJA 3X1FA 2AFNA 4G71B 1BQRA 1L9QA 2VW4A 3FSWA 3GXUB 2BWDA 3UGEA 3JT2A 1IC0A 1GS7A 2UX7A 3FSAA 1AACA 3PLYA 4JKNA 2HRGA 2PCFA 1SDDB 3FS9A 5E9NA 2YXVA 2A3TA 1DYZA 2PP8A 1CYXA 1AS6A 3WG7B 2BZCA 1OCOB 2W88A 4RH4A 1NIAA 1NPJA 1TEFA 4E9SA 2GI0A 2CAKA 1L9OA 1ZIAA 3ASNB 1B3IA 4X4KA 2CJ3A 2MRYA 5B7MA 3BQVA 2BO0A 3NJGA 3DTUB 3FPXA 1JZGA 1GY2A 4AI7A 2DV6A 1X9RA 5PAZA 3IBOA 2GSMB 4YSPA 4KNSA 1MZYA 5PCYA 3WKQA 2OCCB 4E9YA 5AFAA 1GSKA 2HZHA 2NRDA 3X1NA 2IDTA 1N70A 3S8GB 2VW7A 5I28A 4FA7B 3IEAA 1I53A 3CZUB 5ANHA 2I7OA 4KNTA 1A3ZA 4N4YB 2GC7C 4YSCA 5EHFA 3NYKA 1CUOA 2CUAA 8PAZA 3ASOB 3NT0A 3FU7A 3PXLA 4KO7A 1HFUA 2CBPA 1N68A 2CCWA 2VM3A 1KBVA 4G70B 1KBWA 1ASQA 4N8UA 1BXUA 4WTQA 3NJIA 4GY4A 3CG8A 4DPCX 1TKWA 3WNJA 1XB8A 2X88A 2FNWA 5AZUA 1ET7A 2FTAA 3S8FB 2QPEB 1JZHA 4KOCA 7PAZA 3FQ2A 1AS8A 2FQFA 2PP7A 4E9RA 4A2HA 1M56B 2JXMA 3DKHA 3HB3B 5I6KA 3TU6A 1PZBA 2XX1A 1V10A 4GYBA 4ZK8A 1ILSA 2XYBA 4CSPA 4DPBX 2AVFA 4TXVB 1ZPUA 4BWWA 2R7EA 4P5SA 3ZX1A 1RZPA 1GR7A 1NWOA 2CALA 2FT7A 1SNRA 2IWKA 4UAHA 1NDTA 1SF5A 2BP8B 1OCZB 1NTDA 3FYIB 1TU2A 2XUWA 4CSZA 4HHWA 1CURA 4DPAX 4QKTA 3TBCA 4YSDA 1E5ZA 3NP4A 3FT0A 2UXGA 3T6WA 1J5DA 4BXVA 2AZAA 3EHBB 5LDUA 1PZAA 4Q89A 1JZEA 2DWSA 2W8CA 4PCYA 2GBAA 5I26A 1BYPA 3AG2B 1BYOA 1JOIA 5I5JA 3QPKA 3FSVA 1L9PA 2UX6A 4KNUA 2QDWA 3SBQA 3CVBA 3G5WA 3TASA 4L0PB 1FWXA 3S3CB 1PF3A 1RKRA 3FU9A 2TSAA 4MFHA 2MTAA 1E67A 1WS8A 2XU9A 1RZQA 2BP8A 2XVBA 1PY0A 4M4RB 2JKWA 2XLLA 2N0MA 2X87A 3FU7B 3X1GA 3CVCA 3GDCA 1KDIA 1OV8A 4E9VA 2P80D 3QJVB 3WI9A 1CYWA 1AR1B 1A65A 3BVDB 2H47C 1XB3A 3MX0B 4HZ1A 2XV3A 3AG1B 1ASOA
chains in the Genus database with same CATH superfamily
5BCAA 4B9JA 4X9IA 1FVCA 4QCIA 1DLFL 2QV2A 1HEZB 1EAQA 2J21A 4KDWA 2VWEC 4LBEB 3L3IB 4QY8B 2DLIA 4HOMA 3VG9C 1OP4A 1HDMA 5I6MA 1UATA 4OLEA 1GRWA 1LJMA 4X5PA 1HYSD 5BNXD 1Q0YL 4HS8L 4HCGA 1QRND 3B9KB 4X80H 4PJXA 1CC3A 4BQ6A 2WBKA 4TTDD 1NCDL 3KZ8A 1WWCA 4E68A 1Q0XH 2RD0A 4Q4IA 2WIIB 4A6YB 1EZLA 3HMXL 3P69A 4LQFH 1MY7A 2WLLB 5E8NB 4J3OD 1UENA 3ZO9A 2JKRM 3T0XA 1I8IB 2WP3O 4NM4L 5KAQF 4BXSV 5GZNA 2CIIB 2EADA 4LSUL 4NNPL 1IFRA 1OP5K 3QQXA 5C9KA 5BUGA 2VAAA 1NFIA 1SYVB 2DM7A 5IV2A 2F8XC 1GIGL 2EKSB 3D85D 4J39A 2VSKB 3MRGB 3VXMD 3TN0C 2W9EL 3APFA 4KKLC 1CF8H 4Q8BA 3C6LB 1E4XL 2WYTA 1N6QH 5IGXL 3GLEA 3IAPA 4CMHC 1ZSDB 1U93A 4M8QB 3V4UH 1CFNB 2O5ZL 4JO5A 3QXVA 4AYSA 5LGHL 2W0FA 2V7HA 3NSYA 4KK8D 4L4VA 4AEIH 1MAMH 1UWXH 2QELA 32C2A 2HJLB 3DRQA 1G84A 2K7PA 3MBWA 1YMHB 3OJDB 4BE5A 1CFSB 1YEEH 2YA1A 3OKDA 1CXLA 2J6EA 1U8JA 1FVEA 5IK3B 1PVHA 2VLKD 3BDBA 3GRBA 2FLBT 5C6TH 4PVNA 1RI8A 2LTQB 2FEEI 1SHSA 2ZTBA 3QJFB 5BVPH 4Z7NF 5J89A 2A1WH 5KJ7E 3DX3A 4QRUA 1ACZA 4Z7WA 4M93B 3G6JA 4O9HL 1BLIA 1SXBA 2DY2A 1LDPL 1MCWM 4OKDA 2H2SC 2UXVA 2VMCA 3GRGA 3MRPB 5JXEC 4HD9A 2YIHA 4XBPA 2IGLA 3FULA 4KZEL 3LEXA 1NCHA 5T1MA 1K8IA 5DEFA 3TYFB 2VMEA 3I6LD 4ONHB 2EC9U 5LNGA 1JNLL 4JVPA 2KDYA 3PABB 5I5RA 1JCKA 4OGAD 3QWQB 4PRBB 1G7IA 1DVSA 2WYHA 3MGOB 1PJ9A 4N2KA 4PJIF 2Y7OA 1T5WA 3H9HB 3ETSA 1J9CT 3ILPB 3AS3A 3AAZB 4ANXA 4FHBD 2X0VA 4UOJA 3NN8B 4D9RE 1BIIA 1J9RA 1OO2A 4GRLA 3U7AA 1MCEA 2CO3A 2C8NA 4Y4FD 1O7VA 3AS0A 4HJGB 5DMGD 3MROB 4JO3H 4KTDH 2Y36H 1S7QB 3ZTNH 4LLUB 1V5JA 5G4NA 5F1SA 3UTPE 3J2PA 1NBVH 3SKOA 4OQTH 1EQWA 1BYNA 1FLTX 2HWZH 2LLGA 3MODL 3RWCB 3V95A 4AYEC 3NRFA 1CT8A 4LIQH 2WXMA 4G9FE 5F8RC 4NQDE 3ZPDA 1NSNL 3DX7A 4ENEC 3VFSB 3X3GH 1BQ5A 1DL7L 2GK2A 1NIEA 4HZLB 4MLIA 5I30H 3CSTA 4YHML 3O6LL 3EO1B 4URTB 4K71C 3X1EA 1Q9OB 2A38A 5FYKH 1VFUA 2ZF9A 2CNYA 1DVXA 1MJUL 2VABA 4XE0A 5DC4B 2DWTA 4LO9A 1MFEL 4PJ5B 4I2XA 4JL1A 5CXPA 1F6AA 3TJHC 1BF2A 1E6JH 2QGBA 2ZKHL 4MLSA 2CHWA 3KBEA 1IBGL 3V55A 1P69B 2NY2C 4TQEL 3MA9H 2FDBP 3WY2A 2C3HA 2PPAA 5JQHC 2P24B 4WSJA 1OP3H 4RAUB 2J25A 4XGZA 1K85A 1GA2A 3ZE1E 3A0OA 4JM2A 1PDKA 1BAFH 1LO4H 5F7DB 3LIUA 2DQFA 2UY6B 4PP1C 1JFQL 5F96H 4AV0A 1NFKA 3IMSA 1QP1A 2YAPA 1J1PL 4X9YA 4QT5B 4FYRA 1J1OH 5ISZB 2Y22A 3KCPA 4HT1L 4HW6A 4JVWA 5HDQH 3D39A 5C0AD 5D7HA 1QFWM 2QR0B 4XI5C 2AJVH 1MY5A 3SBWC 1JVKA 1BF5A 5AVYB 2WO4A 4QOKD 5IROA 5CEXB 4OZIE 4F15B 1CFQB 3U2SB 3NESA 1M42A 3KWTA 5I6PA 1AD9B 5MHSE 3T6XA 5IESH 5IEHB 4AYGA 5LUMA 4MAUH 3L1FA 5KVEH 4XPFH 1RZFL 1QLEH 5D7IB 4PRPE 3F2LA 1GOFA 3UP6A 2NY0C 2MFNA 3Q8EA 2Q0ZX 3KPSE 3PWJA 3QUKB 5JDSB 1TJIH 2VJ0A 3FZUC 4LSSH 2F1EA 3TT3L 2OR9L 1KTDB 4HEMA 3VFUA 3CDZA 3L3KB 2YD3A 2OMTA 3VB8A 1ACYL 1Z66A 3VGDA 1IVTA 4XX5A 2XICA 2X3BA 3ARBC 1MLCA 3UL4A 3QR0A 4Q0XH 5DRXB 2ZWZA 1KN2L 1U2CA 1DFBH 1DJWA 5E8OB 2H8PA 5GIRA 1DP0A 2X6MA 2VDMB 4O02L 4GO9A 2Y23A 4OR1A 3INUL 3VD7A 1MCOH 2QVTA 5T3ZE 2AJXL 2YPVL 2AABL 4HF5H 5B21A 2RQEA 1MLBA 3U1QA 2VGLM 2Z92A 3L2NA 5CLWA 3NIFF 4FLHA 3L8QA 3X11B 1NINA 3ZRSA 1Z9LA 4FG6D 4CU6A 1QLEB 3II2A 3MBEA 3H4HA 3T3MB 1D5IH 5E9DB 4XNQA 3TO2A 5J1AA 1AG6A 4NUGH 4E42A 3TO4A 1AXTL 2K78A 1T1WB 2N01B 2F5AL 4NN5C 3NJKA 4RZCA 2KUTA 2JCCB 4NC2B 4L1DA 1FRGL 2PYEA 1LHZA 4OGYH 2GTWA 4M7KH 2ADYA 4ZUWA 1MREL 4DO4A 5F6IC 1M9SA 3IM1A 3FTSA 2X1PA 3RKDC 3S97C 5EBWB 3GUTA 3NIGE 5HP5A 1P84K 1OTSD 5D1QC 4ZPVA 4QRQA 1EDQA 1DN0A 3P4LA 4FL4B 2I85A 3GK8H 4K3HA 5IW1B 1CGXA 3CAFA 4IDJH 5CZKA 1NKOA 2K3TA 3BHBA 3H55A 3RWDA 2G9KA 3SJVB 1SFHA 3UEQA 3ESVF 3GD1C 5EBMA 1U41A 4DZBB 1KIUB 2WO3B 1NUNB 3P0GB 3IDIA 4W81A 2C9VA 2J2ZB 4PBWD 1TJGH 2VW4A 4OIAA 2VQ4A 1UD4A 4KTGA 4NN6B 3T5WA 1IC0A 4YHLL 5IQ9A 4UYPA 4NRZB 4HU2A 4IU3B 5I6XC 4KHXL 1CS6A 5L2KE 3GXFA 1E0OB 43CAA 5DHVA 2GABA 5DZAA 2E4TA 3DC0A 2DBLL 2AK4A 4JN2A 2F19H 5DK2A 1EUTA 1MELA 4TQHA 1NIAA 1RK0A 4WDIB 1BREA 4XBGA 3Q48A 1L0YA 4FP8L 5IQLA 5HYJA 2AERT 3OKEB 4P5MB 5B7MA 2OXHA 5D9SB 1A47A 2XN9E 4U1NA 1WPCA 5DQDH 1NFAA 4IOSD 3S4SB 2W95A 3T2NL 2IEPA 1EBPA 4R4FL 1JNJA 2VL4A 2R0WH 1KJ2B 4MJHA 3IBOA 5JUEL 2A9ML 2IPUK 4X99B 3VWKD 1V3KA 3D0VB 3S96A 5I0WA 3GSNB 1TITA 4LPYA 5HHXH 2AJYL 2YXFA 1KGWA 2VDQB 1F4AA 3HI6L 3EJYC 1UFUA 3VTTA 4JKMA 4JFDE 5EU7C 2BSBA 2WXPA 2OMXA 2ZCKH 4YDZA 3ASOB 3NGBB 2RFXA 2CCWA 4KAQL 3PQYB 2OS7A 1QFPA 1KBVA 3PHQA 2VAJA 3OG4B 1CDCA 1MIEL 2XZCH 4LKCA 1IM9A 4ODVL 4Z7IA 1GGCL 3UROR 4OV5A 1OTUD 3X13A 4YX2H 3G5YB 4HKXB 4KV5E 2H32A 3PHOB 4PJ7A 3HBZA 1ET7A 3IRPX 1IZKA 4PLKC 4PJIA 4BZ2L 3H6AA 1D2OA 3KCWA 1FYTA 4MMZC 4GAAA 4Y2LA 5E6IB 3VD5A 4A2HA 1CL7H 3B56A 4CBZA 5F1NB 4QEGA 3VI3A 2XYBA 1RQ5A 5ITFB 4X8CA 2R7EA 3TX4A 5F7HA 2F7QA 1ZKAA 1V3LA 2GTZB 5IB4A 4OSUL 3VNZA 4PJ9A 2AXHA 2JIXB 2X4TB 5F6HJ 4BRVA 4NRXB 4Z5RA 1FL5B 3DECA 3KGTA 5DJ6A 3PFQA 4JGNA 4I3RH 3LS4L 3WFBL 4N20A 2JJSA 1QR1A 1SF5A 3KXFE 3ECBA 2XUWA 2QFPA 4BA0A 5LBSL 4D0BB 1AC6A 1RZ8B 4DQOL 5D5MB 1A1OB 4K4KA 3PGCB 4L37A 3DWTA 3B7YA 3LQZB 2X4QB 3UO1H 2V3FA 3QNYA 5EU5B 5FO8A 5CD3A 3X14B 4S1SH 5CGYC 3TN0A 4MJ5B 1ZXQA 1KN4H 1A9BB 4HSQA 4KTEL 1XGPB 4JRFA 1P7BA 2WUBL 4WI3A 5GJSH 3MLPA 2GITB 2Z93A 3QULA 3WIFA 5IFJB 2IANB 2WMPA 3U7WH 3QPKA 4XB3A 1L9PA 5FWRA 4GSDL 3MJ9L 1COBA 5KW9H 4MB3A 3T0EB 5C3LD 5FB8B 5DZLA 1BGXH 1FPTL 1FWXA 2BMKB 3FN0L 3DV4A 2WKOF 3EJJX 5FYKU 1P9MC 3WE6B 2EDQA 3OF6D 4KDVA 1FE8L 3DJRA 4NLHA 5I19L 3KR3L 4Q74A 4UT7H 2W1NA 4N2EA 4B9IA 4DETA 2ZWKA 2IF7A 3MOAH 3BP5B 3VXSD 1KENL 2N59A 3BT0A 2VIRB 2Z8RA 1MAJA 4P99A 5BZZA 4NYLB 2DQHH 3O3DA 4KXBA 2L7EA 5JXEA 3ATEA 1I9EA 1T7VA 3ARFC 4JFPA 3MRQA 1JHKL 1DQDH 3JVFC 3E2HC 4GB9A 3LRMA 5F0PB 3LV3A 2ZP8A 4Y1SA 3KPMB 3HAEG 4JFFD 4KZDH 5KSBE 1N67A 3RVXD 2JKJA 4KDTC 3LQMA 1BZ7A 2BVUA 5GGRY 3MCKB 4JGJA 4XHJD 3F6IA 3TIEB 3FT9A 1TTGA 3AY2A 3FMGL 3KLHC 3NUKA 2VDKH 1KBPA 1DDTA 1SOXA 5BRZD 3PY9A 3ASWA 3K8LA 4PWIA 4L8SB 2MCPL 1UH4A 5CD5C 5JR1H 5M95B 2XTJD 2BFVL 4MA3B 3V79C 4YHYB 4NFBA 4EI5B 1M57B 1N2RB 5C0GA 3MLZL 3IJHB 4DTGL 4JFZL 4YDJA 3N41B 4GMSH 4MCYA 3GBLA 2ZF8A 4ZJ9A 1F4XH 4K7PH 3KDMB 2Z91A 4BFEA 1G7HA 3FB5A 3IWVA 2ATPB 4OVVA 5HVHB 1EBAA 3MLVL 2FRGP 3K6OA 4Y5VC 4Z3JA 2XBTA 2FB4L 1H8SA 2OQJB 3E9TA 3T8XB 3P9LA 4L3CB 3U30B 3I6KB 4ZZKA 4JKKA 4CVZB 4DVBB 4UV7L 2BK8A 1IGTA 3VD2A 1FNFA 2XKNB 3VGGA 4HUUA 4KRPD 5IQ7H 2EIZA 2EAEA 3V9CA 5EOTA 2VDKB 4ETQB 2YUVA 3EOTL 3HMXA 5CIPH 1EFQA 4EZLA 5GISH 5I1AB 4L3EE 4QRRD 1B9ZA 2F5BH 4N90E 4S0HA 3V0IA 4OZIF 3UX9B 2ZKYA 1EJOL 2H6PA 1EGJH 4TL4A 4AH2B 1MRFL 1G7LA 5DHEA 2EQDA 1YAZA 4PG2A 2OL3H 2VJXA 5JIHA 3L3GA 3WHXA 3SE9H 1WA0X 3POHA 3V6FB 3UAJC 2Z4QB 4LCCA 5A2IH 2RB8A 2WLHA 2ITFA 1S7WA 3NA9L 4H8UA 4UNUA 5D1XE 4KROC 1P7QA 2JE8A 1MNUH 3ABGA 1QKZH 4PWFA 1UJ3B 4RBPK 4GUCA 1IRAY 2VDRL 3MV01 2FECL 5DRZB 2XY1A 1OAXL 2Z64C 3K46A 2F1BA 2QEJA 3KLQA 1M9WA 2CMRL 3IFLL 3MZGB 5DLLA 4N2NA 5D7JC 2WXRA 1HAWA 4G8AC 5C2BH 4Y5YB 5B1KA 4P9HH 4AQEA 1FGVL 4PUBL 1F8TH 4X6CA 4OIFA 3MR9A 4K8RL 1L5GA 3WLBB 2EZ0D 3EOYG 2ZCLH 3IJEA 1Y07A 2W0PA 2QVMA 4U6XA 3SBWA 4CKQA 4KVNL 3ALPA 4DGIH 2BLFA 1D5RA 5KVFE 2WCGA 1E43A 3H3PL 5H4YA 1LO5B 3VSVA 2J56A 1N8ZA 3ZKSD 3PWVA 1PG7W 2D7MA 3QXAA 4YE4L 1MKFA 1U3HD 4H0IA 3ILQC 1RUMH 3C2AL 2QSCH 3AM8C 2ZXAA 2DWDB 2GT9A 3BUTA 2YD2A 1G7QB 3HUJE 5IW6A 1WD8A 4NZ8A 3EO9L 5C0CD 3H2PA 3B83A 5IHUL 4H88H 4Y19E 5BV7L 3DHJA 4HSCX 3MO1B 1CFVH 4ENZA 4CNIB 5CILH 4OM1H 3ARBA 3NIGF 4PJDE 5I23A 4XMPH 2WTRB 1QW9A 3QIWD 3ZT6A 5L9DL 3NCBB 4PAZA 4M43L 1KZQA 2E7HA 2FQDA 2ODHA 5IG7B 4XC3H 3P02A 2HFEA 3RVUC 4A38A 2X4OB 1AQHA 2NX5E 1FORH 5I15L 1N0LB 3O9WC 3DVGA 4KK6D 4MSWB 5LHDA 4N5EC 1A7NL 5AW3B 2C9PA 4PW3A 3UACA 4I1NB 2BIMA 5DZVA 3SDCC 4HVBA 4NHUB 1EHXA 3ROOB 2RGSA 5ICZB 2B4CL 1L9NA 3BWAB 1A4AA 5LN8A 4R90H 4A55A 3K71B 3IKCA 2P5EE 3FKUS 1W72L 4ZSOB 2AQNA 4WFHE 1MW3A 1ROWA 4BKLB 3QQ4A 4PY7A 1IL1B 4YHPB 3AACA 3O41B 1VENA 1RU9L 3MRFA 3RGVB 3VSQA 5D1QA 1SM3L 2AJZA 3V4VL 5EEVA 3CWGA 3WEXA 4LFHD 1W9XA 1SY6H 3TESA 1OZTG 2EABA 2BWIA 1OSPH 1ZJBA 2VLME 1WZ1H 1C5BL 1WT5C 5EZJA 1JWMA 3ZBMA 1BSIA 1X5ZA 5EZOH 3VGAB 3QUYB 4IMKC 2A0LC 2NDGA 2VXUL 4LASL 5KVFL 3KLAA 1H3TA 1VCBC 3PF2A 2APSA 3F84A 4WLCA 2OULB 1FO0B 3SQOL 2FIKA 4LCUB 4XC1L 4XO3A 5FFLA 2B15A 2BP0B 5JW3L 3ZIMA 2CRYA 4AK2A 5B7FA 5T1DH 1TQWA 1I9JL 3M1OA 3QEQA 3U6RB 4OFYA 4EN3C 1FG2A 3F6LA 1A7OH 3DOSB 4JPIA 1QLFB 1LK3L 4PSRA 5L8KB 4L1BA 5C09B 1UWFA 1WV7T 1MFBL 3DDGA 4GG6B 1U8MA 1EPFA 2FLRT 3TA3D 4JDTH 4JR9L 4OI8A 5EF2A 3PPEA 3TBBA 1BHGA 2G3ZA 2WQXA 3V0WL 4K8RC 3K74B 4JX0A 3T4AA 4P4KB 1U95A 5E4IA 4LRNL 2WKOA 2PABA 2XWRA 3D07A 1JF1B 4M3KB 5KJRH 2E7MA 1T4KB 3CFBB 4I9XA 3FQTB 3GJFB 4NZTH 4HFWB 1N7ML 2YKLL 1WAAA 1FCGA 3DX2A 4U4BA 3WL9A 4AY0A 5DJ0B 3K2IA 5D6CB 3V7AE 2BNUB 2ZXBA 2Y5QA 4ZX5A 5DZJA 2HG5B 4N8VG 1HHHA 1ZGLB 4RMWA 4M1CD 4LB8A 4I88A 1IBHA 4RA0C 1ACCA 3NJFA 3L81A 1QA9A 2WAQA 3G08A 3CN0A 4Z7UB 3VFTB 4HC1H 2K6ZA 2W60A 4FNUA 3LKNA 3SDXB 3L3DA 1IGFL 2R29H 2ADGB 1ED3A 4I48B 2QV4A 5BV7C 1G0DA 1ZHKA 4B3VA 2JI2A 1CLYL 1XO8A 3KWVA 3AB0B 1IFHL 2R2BB 1QUNA 3QPQC 4ZI8A 4EI6B 5B38B 2NYYD 1X6LA 2QKIB 1YNTB 3U7YL 4M5ZL 4MMZA 3RPKA 3E9UA 2I9TA 1MZZA 3M17B 2XZZA 4O02A 3CC5A 2YOAA 5HHPB 1BQLH 3CZFA 3DIDA 4TSCH 2CHNA 1BD2B 2YPVA 2HPTA 1NGQH 5JA8B 5DWUL 2J8OA 3TLRA 4FEMA 5FDWB 3E8VA 4KI5D 1BG1A 1KCBA 1FZKA 2HAZA 1FIGH 4XCYB 2P5WB 4WWID 3S3BB 3OKNA 1FUNA 2J57A 3IGAA 3CVIL 2VUOA 2NLJA 3D4GA 3QG7H 4PJHA 4WJ5A 3HLKA 1ZA3A 1TQVA 1ND0A 4NJ9L 3MNZB 3RIFF 3QNZA 3S9DB 1MQ8A 1MCWW 4HOXA 3HAEA 2EYRA 6FABL 1T1XA 2DIEA 1OPGH 4QXUL 1N64L 1B9KA 3LZPA 2IH1B 4FQCH 5CSZA 1A7QH 2OK0L 2A3TA 2AI0H 4N9GB 1CZ8H 1B0RA 3V6ZA 3QEHA 3WG7B 4IRZL 1ZSHA 1G7PA 3B1UA 3BXNA 3I85A 1U9KA 3PNWA 3U9PL 2AXFA 4P23D 5HYSG 2EUWA 1JPTH 1NCBH 1NKRA 1WBZA 1S7VB 5IFHH 3P0VL 1NH6A 2Y5TA 2BSED 2IJ0C 1MH5A 3B6SB 4P59H 3FFCA 2PR9A 1BFTA 4KZ0A 4RX4A 5DZPA 3GTNA 1AD0A 1AHWC 1N3NB 4IEFB 5KANI 5KSBF 3H3BC 5PAZA 1RVFL 3L9RB 3V7MA 3EJZC 5FK9A 2Y4SA 3EFFB 4UZUA 4ZT1A 3SGDH 2WYIA 5I74B 5AFAA 1P9MA 4FZEL 1B4TA 4I0PD 4Y7OC 3X1NA 4F3FA 4CC1A 5FV2A 4IBSA 4MDIA 4L18A 5LWYH 1G0XA 4JGUA 1FZMB 3DROA 1TU2B 3CK0L 2CUAA 1ZTXL 5IF0A 4PJ5D 3MV7A 2VISB 3FU7A 4Y4KC 1CGTA 4PS4L 3BJ91 1LP9B 1BWMA 4FYTA 4YXHL 4MMXC 5IMKB 1IAKB 4CL7A 3RDTC 2R8SL 4MQXD 1D6VL 1AIFB 1KJMA 3MXWL 3RWEB 4AE0A 1E9PB 1H6FA 1YNKH 1DBBL 1SXZA 2VZ1A 3P11L 4FNSA 2GEQA 3ARFA 3LHPL 4GT0A 1UKQA 4R2GC 2XNAA 4IRSC 4UILH 1A4KA 3R06A 4OZHE 3BUYA 2M1KA 1KYOJ 2AGJH 5E4EC 4PRHB 5I6KA 3EZJB 1KXVC 4Z7QB 5EA0L 1BJMA 4KDTA 5IHLB 3WO4C 4LHQB 4ZDHB 3RX9A 2YN5A 1WZAA 3KBHE 1KC5L 4H44C 3GI8L 3NCJH 4RFOH 2FT7A 3PFUA 5EEYA 4NQCA 3WHE1 2EACA 2VN5A 4WF7A 1SXAA 1NDTA 1TFPA 3FUDA 3KVDD 3N42F 1GYUA 3ET9F 1XZ0B 3GIZL 4NQSB 5GS0H 3SYOA 3KYKL 3W56A 2X40A 4HK0A 1R3JB 4DK3A 2HT4D 3GNML 3UP1A 5F7EL 1BBJB 4BZ2A 1OGAB 1VFMA 1XD1A 1NA8A 1AYRA 4FADA 3JTTA 4QRSB 2D73A 2BM3A 3IFNH 2F7PA 3MNVB 4G80A 1NBZA 2X1QA 3AQYA 1D3CA 4Y5VA 2AQ1A 4MAYC 3LKPB 3W0WA 3UCQA 2BH0A 2BVQA 3S3SA 1KLGA 3WE1A 5F88B 3QZOA 4JJ5A 1ZLDA 3L5WA 4M7LT 3K6FA 5AVXB 2OPCA 4O2CA 4PY8I 2IV9A 4ZTOH 1JNNL 3UERA 5IBLC 1EZVY 1HDMB 2QLVB 2W0LA 5C86A 4F37F 3RU8L 4H5SA 2JELH 3B34A 4PJXB 1E5CA 1MFAH 4L0PB 5E8EA 4C8XA 2X3CA 3MRJB 1FQ9C 5F7FA 4M03A 5LBSA 5ANME 2J6EH 1F00I 4CSTA 5JIMA 3JV6A 1E28A 1P4BL 4N8PA 4XHQA 3QNFA 1X3DA 3BAEL 1VF5C 4TUJA 1Z1WA 5D7SH 4NO3B 1XF4A 3KGRA 2HRPL 1OT4A 3GSQA 2VAAB 1NFIB 4MA1B 2YBGA 2Y7QA 5IV2B 3TFBA 2E8ZA 3HW7A 1I8KA 1YMME 4HSAC 3PIQA 2ZCHL 1S9YA 2XZQL 4NRYB 3WELA 1AR1B 1C5DB 4AQAB 4NIKB 1XB3A 1KGCD 1U93B 2WUCL 2EC9T 3MJ9A 1IBDA 4JB9L 5D7JA 3B3IA 3MAWA 4DP1X 2P8LB 3CZNA 4XNYH 1H9VA 2W0FB 3ARVA 2BVTA 4L4TB 4MRCA 4WHCA 1OK0A 5I1JL 1Z5LA 1Q9WA 32C2B 5TGBA 3ZW3A 3CZGA 1ZHNB 5FC9A 1OE2A 2YARA 4RDBA 4KKCD 4HUKB 2ENSA 3HNSH 5KANG 1PMYA 3FCSA 2GW5A 1UYWH 2FHCA 1U8JB 1GYCA 2NUPA 1W6LA 4CADA 1YEWA 1K4CB 2NYKA 4R8WL 1BQUA 2IH8A 4KKPA 5MEQA 2QKSA 4LSVL 5IVZB 3GJEA 1Q9LB 2IPTL 2MKWA 2NY5L 2X6BA 4GAGL 4XVUD 4MXWH 4W68A 3U1SH 4BSVA 4Z7WB 2V3EA 3G6JB 4HKJA 2V17H 4YWGL 3WFDL 4IIQC 4ZX4A 2IXQB 1XTMA 4DEPC 4XRCB 4BRJA 3D51A 3VWJD 4XCEA 2F0CA 4OFVA 4R97B 1RJLA 2Z34A 1UXWB 4ZUSB 3QNXA 3GEFA 4H20H 5EEZA 3LEXB 5FUOL 5I8OL 1TZGH 4NT6A 3JWOH 4YSOA 5ADOH 1FL3A 1K8IB 5DEFB 4ZYKA 5E2TH 3NOIA 3B1TA 4W9KC 3W38A 2XWEA 3HE6C 3HLAA 4XP6L 3CXHJ 3L4TA 1G7IB 4XP5L 4X8GA 2K4AA 2DTSA 1HILA 1T5WB 4G7YH 4DKEL 2F8IA 2G5BA 3QFJB 2NZIA 2KPWA 4BBWA 2OJ1A 2ZUQB 5JQ6L 4TVPH 4W93A 4NKIH 4LEOA 5I1GL 3O9WA 1BIIB 5CBEA 4PGDB 1I7UA 1XDTT 2PNDA 2FUTA 4E5XB 3CX5J 5CBAB 4WY7L 3FO1A 4J3SA 4GRWB 5T5FH 4OTXH 2ZOTA 4R5XA 1L6PA 3SDCA 3RWIB 2UZIL 1I75A 3POCA 4OJFH 5CN1A 1E9QA 3SKOB 2VR3A 1HWGB 1KELL 1YYLL 1UXSB 3AQXA 1FV1B 1CTMA 2DBJA 3NK4A 3E1ZA 1UWYA 4N8VA 3WAJA 5DMKB 2JKXA 1EZUA 2BNRA 4JRYD 4N0YH 1A0QH 1WZMA 4KX7A 3DX7B 5GRJL 3W82A 2C9XA 3AS1A 4JZJC 5HGBB 4YSUA 2FWLB 5CJBA 3NJHA 4H8HA 1MJ8L 3AQDA 2GEEA 4Z7VA 3FQNA 5K9QG 4PFEA 3L48A 4J6RH 1WT5A 2EIKB 3E7JA 5J1AB 5A6MA 1HL5A 4IMKA 4APXB 5L6YH 3H56A 2M8XA 3CN2A 2PMZA 1JV5A 1G6RL 4I2XB 1QG3A 4JM0A 3UTTA 1CR9L 2B1HL 2V5TA 3OHMB 1AG0A 1ZHBA 1UVQA 3CH1B 2Y3NA 2W65B 3O45B 1INEH 2JIXD 2PO6C 4HGWA 4KXAA 3ARXA 3QCTH 5A2CA 5I75C 3I6GA 1EMTL 2Z31C 5D96C 4OUOA 4ZW6A 5T33H 3NRPA 4XGZB 1BQHG 4JM2B 1PDKB 4G6AC 2R1WA 2O5XL 2YFNA 3O4LA 5JHBA 3KLKA 1AANA 3B9VA 3U4EA 2FSEB 1IV8A 2GBTA 4Z78A 4C83B 1I3VA 4LLYA 5SWSE 1ROCA 1WGVA 4U1GB 4OH2A 2JB5H 3PHAA 3A6BH 1YUHB 3AADB 3KPRA 4ZXBD 3LPFA 1ETA1 3MREA 7FABH 4N2MA 1E5AA 2VUKA 1PLGH 1KBBA 2IMMA 3I6LE 3RB5A 4HUMB 2F58L 5LXVA 1KJ3H 1T66D 2XFXB 1MRCH 3RVTD 4GUOA 5IVNA 4NENB 4AKQA 1ZCRA 3FQYA 3JWDH 4RSYA 3ZYZA 3H1ZA 1A6UH 1YY8A 5HYSA 1IJ9A 3S88H 1ANUA 5ELIA 2VDPL 2NDFA 2OMWB 1ZANH 3V4PL 3VXOA 3HMWH 4Y8AA 3OMIB 1C12A 4F58L 3WTYA 2NY4B 2DQTL 2ZYRA 2E76C 1RERA 3F58L 4X4MA 2ED6A 3D4YA 2DEWX 4RIRA 4UWQB 4ICWA 3F64A 5L2JA 4RAVA 1ORQA 2NT0A 3ZTJG 3VFUB 3CDZB 1R3KA 2F53E 4POZD 1DBMH 3ZR5A 5D2LB 2GHWB 2E86A 4XVJH 3W5NA 4MA8H 4KUCF 2K9UA 2XRAH 1IAOA 1WFMA 4PB0L 3R8BB 1JBJA 4WW1B 1KLUA 1SMDA 3HJEA 3WLWC 4JMXA 3CSPA 1MLCB 1B0GA 2YPLA 1V05A 1IAIH 3H8NA 1LEKB 2DD8L 3UYRH 3QYNA 2H8PB 5GIRB 3NJXA 1D2PA 2O6EA 4WUKH 4XPHL 4PJFB 4PHZA 1IQWL 2J73A 2I25N 3EYSH 2HMIC 1FNGB 3I50L 3QYMA 2OV0A 3CFEA 3BZFA 4NO5A 3C9NA 2IOIA 1WLHA 4N2IA 3ZYJA 4P5TD 3MV9D 4K3EH 1CB4A 3T0WA 3T6ZA 1TFHA 4U3CA 5EN2A 3ATAA 1LMKA 3MBEB 5EU3B 5JIKA 2A6IB 4HJ0C 4IRJB 3VXTB 3IU3A 3TO2B 1WCQA 2QTEA 2HFFA 4KVPA 4PRIA 1JPSL 2NY7L 2ZP0T 4NOFA 1XCWA 1G1YA 2V2TA 1KCUH 2E5EA 2PYEB 5CUSH 3FRPG 3PWNA 5FHAL 1PZ5B 3V4VA 2LABA 2E3VA 5JMRA 1NPNA 3W11C 3BI9X 4ZPVB 4WI7A 1DN0B 1M3IA 4PJCF 3ZKXC 3STZA 1AHWA 1QQDA 3ZKND 4F27A 1TZIA 1YEKL 4KKAC 3JV4A 5FUZH 2NR6D 3BHBB 4OM0H 4CVUA 1J9TA 1VZIA 4IKKA 4IS6A 5HGDA 1MFNA 1FSKC 4MZ2A 4N8CH 4YDKL 5FKAA 4JKLA 5C0AE 4AZUA 4OLVH 2EC8A 3DTDA 3C6SA 4G7QB 2JF1A 4MZIA 2VCOA 3IDIB 3WJMB 3BESR 5MENA 2G3MA 1M05B 3CBRA 5IQ9B 3FH7A 3FF8A 3TCLB 2OYLA 3G5XA 4Y4KA 5KYXA 5FW6A 5SV4A 4WVRA 5ITBL 4MMXA 4O5LH 1IGCH 3ABMB 43CAB 5DHVB 3RDTA 3RTLA 5DK2B 2XQBH 2PPCA 1GVIA 1CI5A 4Y1AB 2CGYA 4XWGH 4ZO8A 3JUYA 4XBGB 4RGNC 1YQVL 5ESVA 2H32H 2NXZD 4YVNA 4IRSA 3AGWA 5HYJB 4LKXA 2X7LB 3IDJA 2G60H 5AYTA 3I9GH 1YDPB 3UJJL 3WNPA 4P2RD 1DJHA 4OZFA 1KXVA 5IP4A 5D8JH 3WD5H 4FQLL 1R5IB 1RK1A 2F54D 2N4IA 4TQPA 2GJJA 4Z7NB 2AMUA 1IEHA 2ITDB 5DHDA 1G6VK 3DGGA 2BVPA 3S96B 4FHJA 1B3JA 2Z8SA 3EXJA 1WFNA 2J7LA 3TZVD 3US9A 3HI5L 1IM3A 5EO9B 4EZMA 5EULV 3NJMA 4FLQA 4JQVC 4YZWA 3KMDA 3X1FA 3LPOA 2DWEA 2OMXB 4NIYE 4G8GD 1JIBA 2JTYA 4LLWA 3V52H 3DIFB 3SCMD 2OZNA 3HTLX 1OCWH 5I1CL 4FMKA 3PHQB 1B2WH 2FH6A 4FG0A 1ONQA 1MAKA 4UBDD 2NXYD 3ZDZF 1L7TL 4XH2A 1OM3H 1X5XA 2M26A 1JZ5A 5FA4A 4N6RA 4XXDA 4OV5B 4LEXL 3X13B 2IQAB 1U8CB 3RY6C 3KBFA 1XIWC 2FWUA 4HG4J 1TJHH 1TQTA 4PJIB 4MAYA 2C4XA 1FYTB 4XAWL 3CDGA 4XP9H 5LCVL 1B3IA 4JPWL 4PJGF 2ZKMX 2WKGA 2CA4A 5CCKL 4Q2ZA 3GMOA 3MLXH 2WJ5A 3QHFH 4KH9A 3WGUB 1FP5A 1QSEA 4AQOA 1I3RA 1JGEB 1GY2A 3GLDA 2VLRA 4L2LA 4LLAA 2IBZX 4NQEE 1KY7A 5IB4B 1D9KD 3H85A 4KNSA 4PJ9B 5IBUG 3WKQA 3OC5A 1K9TA 4L1SA 1I9IL 2A4ZA 5AW6B 5FCUH 2IDTA 5E2VL 1FFPB 3CZUB 1KPUA 4N3UA 5C07B 4YPJA 3VTMA 1A3ZA 2JLLA 4N4YB 3ECBB 2FZ3A 3LVTA 4X4XA 4KITB 5B3NA 3FH8A 2ID5A 4S1RH 4IRZA 4FXLA 3Q01A 5E5RB 1J8HD 2YLKA 3HC4H 1RFDH 1JGVL 1YJDH 4QNPF 3QNYB 4N8UA 4TSAH 4HPOL 2FBOJ 5CD3B 3DURB 1K5WA 2QPUA 2J5LC 4A39A 2K1MA 4PJBE 4CMHB 3B3BA 4GBXB 1U8LA 3WIFB 1M2VA 4YHZL 4NC1E 2WMPB 2ZXGA 1B88A 2VLLB 2Y25A 2D7PA 2G2RA 3LXBA 2DJ4A 4QLRA 2H4EA 1UZ8B 4TXVB 2CLRA 4Z1PA 4MJIE 3DV4B 1I3GH 4HQQL 4Y4FC 4F5CA 3O3BA 2ENQA 5DJCA 3DX4A 2KDGA 3LKQB 5ADPL 4AJVA 5HHVH 3ELAT 3QUYD 4Q9RL 4G5ZL 1GXEA 3E0GA 1HJCA 1QR4A 1WG3A 2D3LA 4O51B 1YEHH 1BMZA 3QE5A 2WQRA 3Q8FA 4XMXA 5GGSA 4IIQA 2Q7YA 1A5FL 4CW1B 2XVLA 3C5JA 4J3OF 4M6MH 4C55A 3U4BH 4AL8L 3EJTA 1M1SA 5DQJB 4AITA 3D2UB 1KCLA 2C5DC 4PMFA 5HBBA 1GSMA 2A4EA 3WN6A 1DLFH 1J5DA 3MRQB 4BXVA 3PREA 1TCRA 5C09D 1RD6A 4PHXA 3UZQB 4C56D 2F1AA 5BS0A 2DICA 4UNTA 1S7RA 3FBQA 3L3OC 4ZOEA 4RMBA 4WCYL 3HE6A 3RI5F 4X6DE 5DZOA 3SDYL 3LOWA 4KQ3L 1JOIA 3BH9B 2QVIA 3HZKB 1RH8A 2AQTA 1A7RL 1BZ7B 1NCDH 4N2BA 3ARDD 4GXUN 4LARL 3HMXH 4F2MB 2B77A 2QHRL 3OMZA 1GAFL 3PWLA 3HPJA 1LVEA 4NM4H 3BRFA 4P2QB 2WBXA 5EU6B 1E8ZA 2ORBL 4LSUH 5IOPB 3B37A 5GRYA 1X4YA 5BQ7B 4HIEA 5SWZD 5CP7A 2E27L 3G04A 4MFHA 1OD9A 5C0GB 3Q06A 4KGLA 3K6SA 4RGOL 4P9ML 4G82A 1GIGH 2XG5A 3QEUB 3IDMB 4XNDA 3UTSE 3S48A 3MBXH 3CXDL 4AG4L 5FYJE 1E4XH 3L1EA 5IGXH 5E5MA 3EDEA 1GZHA 1G7HB 4GH7B 2O5ZH 3TJEL 5DJAA 1MHPH 2K0RA 5LGHH 2EYTB 4MJ4A 3P9LB 5GRVL 4WI4A 5J1TC 3ABKB 1XAKA 4WEEA 4F24A 4JZJA 4FTVD 4F7KA 3NIFB 2IFFH 5CSGA 3BPLB 1KG0B 4C4UA 1HIML 1TQCC 5EOTB 2BNQA 1XZWA 4K71B 4XPTL 1NDMA 1X5JA 5T1JA 1VIWA 4LAQL 2GUYA 2QQKH 2P43B 5I0DA 1QEWB 4JO4L 1I1RA 2H6PB 2NY2B 4O9HH 5E99L 5ACMA 1G7LB 2PO6A 3D69B 3P3SA 1UACH 3KLSA 3L3GB 3PNRB 4PD4J 3LB6C 4GAJH 4LCCB 5CM1A 2HLEB 4OGXL 4BZ1L 5BUAA 1S7WB 2H9GA 2Z31A 1AGBA 5C92A 3TPUA 1P7QB 4QWWC 2BHZA 1YRKA 3P2BA 2WZPA 3FK3A 3TCXA 3VXSE 2DH3A 4KZEH 4PJCA 1UOLA 3EG9A 4Y2DC 3JSSA 5DLMH 5ECJE 1YC7A 5EZLB 5K93A 4WJKB 2OW6A 4U1SA 1JNLH 3II1A 3QARA 1HX0A 2FJUB 4JRXB 5CZVH 2W9LA 2AEQH 1OALA 4AMKL 3L9BA 4AQEB 3RA7L 4XO8A 5F7LB 3MR9B 4J3BA 3IJEB 4LCIL 5DC9B 5CINL 1KB9J 4U6XB 1JZ7A 4AIEA 2EIJB 3FRPA 4HK3J 3LN5A 5FXCH 3M45A 1N5AA 4V1DE 3NAAH 4GQZA 4FG6C 1RIHH 1N8ZB 4R7XA 3QHTC 3PWVB 1WTLA 4KJWD 2JI1A 3DJZA 5ESAA 4ESKA 4YC2C 4AL8C 3RZCD 2QZ5A 4UM8A 4O2EA 1H3UA 2EXYD 2OJZL 1QI3A 2GT9B 2VR7A 3MODH 2NY0B 2EDEA 5FCSH 1JMXA 5T3XE 1V8HA 2N0KA 2VXTL 3Q6GL 1NUDA 3NTCL 1TNNA 1J5OH 1NSNH 3GMNB 3RGBA 2JKSA 2YN3A 3ARBB 4MBRA 3DXAA 2CKBB 4I1PA 3ML9A 4YHMH 3O6LH 3T6QC 4JFEA 3ARGB 3BYTA 1M6OB 3NSFA 3PAVA 4JY5L 4JY6B 4DK5A 1NAML 1MJUH 1MFEH 4PRHD 1WUNT 3BAJA 4NERA 5C0DA 2WJ7A 1E3ZA 1PD1A 1S9XB 1UEMA 1IBGH 4NFCA 3MSPA 4FYQA 4TQEH 1NCWL 3UJTL 2JSFA 3DVGB 2QL1A 1EEYB 4P2OB 4BCYA 5HGAB 4TS6A 3DJSA 3T65B 1X5KA 5ENWA 5AB0A 1S9VA 4TRPL 3CHRA 2IOMA 1JK8A 2AXGB 1DSYA 2C26A 5F1OB 2WZ0A 5DU7A 3KLDA 2QDVA 4JHAL 1EXUB 2YXWA 3C5ZB 3IKCB 3L17A 4PJGA 2FL5A 4DUWA 3SODB 3LZNA 5HHOE 5EFIA 2FCBA 3QQ4B 1OGAD 5LVEA 3MRFB 2L3BA 1UT9A 1ZV2A 4HT1H 4GUPA 1AXIB 1XL6A 3ZSTA 2VR9A 1S5HB 3NPSB 2WGXA 3VWKC 1G6RA 4PW4A 5EZJB 3QA3A 1JWMB 2HUEA 1PNCA 3HS0C 1M7IA 3RWJB 3KLAB 1DQLL 5AYUL 3RL2A 3OJMB 1RZFH 3MRRA 4JZOA 2FIKB 4NO0B 2EE6A 1JXDA 2BY1A 2KKQA 2EDHA 4PBXA 4N26A 5JLZB 5IJVA 5DD0H 2DKUA 5I6XB 4ABQA 2OR9H 4GSXA 3QEQB 2EDWA 1FG2B 1KCVL 4JPIB 3CZEA 3DX6A 1ACYH 3MTXA 3AWFA 3S36H 3FTUA 1A21A 1U8MB 1AZVA 4XMWA 4K73A 3SO3C 1QO3A 1OZUA 3OJ2C 4R6UA 5CLXA 1KN2H 2OTUA 2IAMD 2ZONA 4MJ6B 1P4LA 3ECUA 4O02H 3T4AB 1U95B 4J4PD 3VD4A 3NJVA 25C8L 3INUH 2PPDA 3LSOB 2YPVH 4CU8A 2WGNB 2AABH 1QRNA 5CJ5A 4HZAA 5JMOC 2XPGA 2E9GA 3KL0A 3WL9B 3NEOA 3V4PA 1I1FA 2IV8A 3IVKA 4H1LB 4TKWA 3KYMB 5CGMA 1EHLL 1HHHB 4JQVA 4KJQD 3KPPB 4OKVA 4PI0A 4N6QA 5IWLC 4GQRA 1QA9B 5I16B 2F5AH 4ZMNA 1HOCA 1O0VA 1UQSB 3HAEH 4F8QA 3ULVD 1NCCL 4G9FB 1ED3B 4NQDB 1ZHKB 3D85A 2EINB 3W2DH 3VXMA 1S7TB 2BCKA 3QDME 3BD3A 3STLB 1SOSA 4GIPD 1Q0EA 1U2YA 2GJ6E 3RY6A 4JG0L 4DK6A 1QBLH 4PTUB 3O81A 1SDAB 2BX5A 2IALA 4O02B 3WNKA 1A6AA 3CZLA 4PJBF 2H41A 4QO1A 4ELDA 3CZFB 3ZL2A 5IEKB 3LPPA 4ZW8A 3GI9L 1R17A 3ZL4H 3V0EA 4RQQA 3T1WA 1Z9SB 5I5MA 5B8CC 1XWVA 4KOBA 2XX0A 2AANA 2VLKA 3H9SE 3OKNB 2C9AA 1P1VA 5DFAA 3IGAB 4Z7OE 1KPVA 5JPNC 1D5BA 3QNZB 1IX2A 2QBWA 4KHXH 3ZE1B 5E03A 3WIAA 3NJLA 5L0QB 3WIIH 4XZUB 2YA2A 1T1XB 2DBLH 2DTMH 2WVTA 3G9VA 1GGUA 2DAVA 3IETA 1HS6A 4XCFL 4DKAA 1CQKA 5CSZB 4UTBL 3RJDA 1AZZC 1BLNA 4FP8H 2P49B 1B0RB 3V6ZB 2Z35A 1G7PB 3BXNB 3PNWB 1KYUA 2AXFB 2BSRA 4BUQA 1NEUA 3T2NH 1FHGA 4NQVA 5LBVA 1DSWA 3RWFA 2ZUXA 5T3XH 3EH3B 3RVXC 4OZIB 1AD0B 3TBWA 3FU6A 2OMBA 4X6DF 3VYPA 3ECWA 5GSRA 4XHJC 2G4EA 4NAQA 3HI6H 2XTJC 1A3LL 2TSBA 2VERA 4PRPB 4Y4FA 4CMMA 4F3FB 4UT9A 4F1SA 3KPSB 4ZUTB 3DROB 2DW5A 3ARYA 1MIEH 4M6NL 1NAKL 2CM5A 5IBTL 1GGCH 3GJFK 1BFOA 3MV8A 4G43A 4UQCA 1JMZA 3V6OE 1ML0A 4QHUA 3G7TA 2WC7A 4BZ2H 1NC2D 4QDGA 3H3KA 3F6JA 1KJMB 2OP4L 1P5UC 3U4AA 4BFKA 4B50A 5I17B 1SOQA 1CD1B 1CYXA 1CICD 4GSQA 1NPJA 1JFHA 2L7QA 3MNWA 1A4KB 3R06B 3UIZA 2DPKA 1A02N 1ES0A 2NNCA 3L3OA 2DI7A 2XWJA 3ML8A 4OT1L 3BQVA 3GDBA 3FPXA 5ACZB 5E4AA 3OAYK 4LF3B 3TH2T 4TLSA 1KBGH 2IC2A 3AJ7A 3LS4H 5IHZA 1F02I 5D2NC 5JDJA 2WVVB 5D1ZD 5LBSH 3BVNA 3WEXB 4YUEH 4DQOH 4IBYA 1G9HA 1NMBL 3SDDC 5AAWC 5I2IA 5EDXA 3KH4A 5JHDE 1LE9B 2NSMA 1QTYT 2X4SA 3LNEA 5DJYB 2Q7NA 3NIGB 2W9DL 3KAAA 2J4WL 3VXQB 2WUBH 1TTBA 2YD0A 2DI9A 3JTTB 5LCVA 3S0PA 4GKOA 4G80B 1BX2B 4FERA 2EUZA 1NBZB 1XB8A 2HRLA 4XVSL 2X88A 3W0WB 2BVQB 2FNWA 1CGSL 4FFZL 5TH2A 4GSDH 4JJ5B 3L5WB 5FFOA 5F7KC 3AT9A 2EZ0C 4E41E 4DKDC 3HB3B 2HCZX 2WW8A 1FPTH 2EDXA 3FN0H 5L88L 4DGYH 1ILSA 4H5SB 4WHTA 4QOKA 4N0UA 2V5MA 1W91A 4KXCA 1SYSA 2AXJA 1F2XK 1YN7B 3IKKA 5DC2A 3AGVA 5IJBC 4LOVA 3U0WL 3VTAA 2GAZA 4AGQA 5L2KB 1SNRA 2EXWD 4Z76B 1KENH 5L7XL 5CJOL 2VDOL 2G0LA 4MWFB 4TUJB 1SEBA 3U46A 4P46B 2V9UA 1SDYA 3GSQB 3WFEH 3VQ1C 1FFQA 3PXHA 4IRJD 1CURA 1RURL 1JHKH 4Y2DA 1SJHA 4DGVL 4GS7C 2WN3A 3PIQB 3SE4C 2H0PA 1S9YB 4ZMZA 4XWOD 1RL1A 5D7JB 2OYMA 3B3IB 4OJEH 4AC2A 3WMSA 1XSIA 1Z32X 1Z5LB 5KOVC 1Q9WB 3FMGH 4OZ4A 3N1MC 1DQJA 2BFVH 3FCSB 1PU0A 4N0FA 4AK1A 2P28B 3RZWA 3LNGA 4P2AA 2NUPB 3GRWL 4PB9L 3C2SA 3RIAF 2LW3A 3TASA 4CADB 4JKPH 3FO9A 2WWKT 1YEIL 5GGRA 4DTGH 4OCNC 4JFZH 3EGXB 1JYVA 1SLWA 4BSVB 3WJLC 3V5HB 1DQQA 3D25A 2XTSA 2X89A 3LMJL 4Y9CA 2CK0L 5JNYA 1FBIL 2OMVA 3P4OB 4XCEB 1SXCA 4AM0B 3B2MA 3MLVH 1I7TB 3KDPB 4R7DB 1CD0A 4AGMA 1LTXA 1NM9A 4PVMA 4AQ1C 4UV7H 1HINH 3CE1A 2PWGA 3QCVL 5DCCA 4CJ1A 4RWHA 3H4FA 3EOTH 3ME0B 5HI5D 4X5XA 2R0ZL 4E9WA 4K9EC 2EUXA 1SOKA 3IJ9A 2VRKA 5ABZA 1JI2A 4LEOB 5AOIA 1UUNA 2G9HA 4FRWA 1HSBA 1I7UB 2X44D 3MKGA 4WTZG 4WSGA 5BO1H 1L7IH 2JKNA 2WQUA 2XJKA 3NA9H 4Y7MA 1I8MB 1RP8A 4OLZL 2OJEB 3CPLB 3NSJA 1G5AA 1O5PA 2YMTA 4FTDA 4JDZB 1T0MB 4AEEA 5EU4B 4FQ1L 2EE3A 1IBYA 2KQNA 4IBUA 1CXIA 5JA9A 2UYLB 2CMRH 1MEXH 1QNIA 3IFLH 1XH3A 4MAZA 3PGDA 5LNDA 2IPKB 2BNRB 1CE6B 1EDYA 2ICWA 4IOSA 1OEZW 5F9WB 1FGVH 4PUBH 3IE4A 4K8RH 3H54A 1AGEA 4P04A 4ZMTA 4UM9B 3VWKA 1U92B 4LVOC 4KVNH 2OMZA 4TF4A 2BFGA 3H3PH 5B3SB 1OCCB 1ZVNA 1XGUB 5A2JH 1KGYE 3HS0A 3UAEA 3UJIL 2FATL 4YE4H 2XFGB 3KWUA 4FNTA 3ZYIA 5I1KL 3C2AH 2OYKA 3FUHA 4BZ1A 3Q9QA 1TMQA 4IBTA 1UVQB 1DHKA 1TEYA 5INDA 4S1DD 1USZA 2LTQC 3IDNB 2HN7A 3O6ML 2XTLA 5KVDE 4QTHA 2VDRB 4PS3A 3I6GB 5C07D 1JGDA 3QXUA 2VM4A 2HH0L 5BV7H 4QJ5B 1QSFA 2QADB 3PP3H 4W9LC 5C0NC 2R1WB 3WDHA 1BVLB 4BM7A 1F1GA 5K5YA 3QEGL 5KSBB 3L5XL 1HVXA 3FO0L 3SY0A 2YHGA 5J6GB 3KJ4B 4DP8X 4RLDA 4ANVA 5F3BA 3DI2B 1PCSA 1S9WA 2DQDL 3KPRB 4M43H 4M7JL 3VXRD 3VFMA 1L9RA 3VG0L 5KBLA 3MKKA 3MRLB 4BQCA 5I15H 1RV6X 4FJ6A 1HCFX 4ODHL 5EIIB 4JNXA 1OT2A 1INQA 1T6WA 3I3DA 1A7NH 3UDWC 3K6DA 3EIFA 4AYID 1ZVYA 3MLSH 4Z7OF 5HYSB 5BOPA 4EDWL 2VDML 5IWLA 2L04A 1OF0A 3U9UA 3QZMA 1C12B 2GSGA 4PI2A 4F8LA 4GLRI 4U4IA 3OR7A 3ALXA 4EPSA 3Q13A 1A14H 3CTTA 4QLWA 1BWWA 3CFIC 2WWMC 1ORQB 3GZQA 5KG9A 3X3FL 1R3KB 4RMUA 3L3HA 2BW5A 1SM3H 3GSOB 4YGVA 3V4VH 1UZ6E 2C9RA 2YPKA 2ZYIA 3ZHDA 4Z77B 3T0BA 1AZCA 1NAMA 1KLUB 1AQDA 3D2UD 5EUOE 5AW4B 3ZUCA 5JYMA 2YPLB 5ILTL 4JRYE 3VFVA 1RUQL 3EBIA 4XP1L 1AY1L 5F89B 4PV9A 2VXUH 3QQDA 3ZQ9A 3KW7A 2XWBA 3N42B 5B8CA 3CSFA 1NUGA 3D8MA 3QDGD 4NO5B 5BZXA 3OF6A 2HKFH 3FBKA 3SQOH 4KY2A 3HG1E 1HWWA 4F7PA 3HIZA 3LZQA 5E56A 5JW3H 5JPNA 5D1XB 3DTXA 1I9JH 5EN2B 3RQ3A 2D8KA 3VM5A 4ZD3L 5KVDL 2OZ4L 2AEPL 1W72B 5CF3A 3EH2A 5J8OA 5EU6D 2I7SA 3K5SA 4MQXC 1CDBA 3QO1B 5MEPB 3T3PE 5D70L 2V2TB 4JR9H 4ACTA 3AITA 3PWNB 1EA9C 5J6HA 3V0WH 3V4VB 4B6ZA 3L5IA 1J11A 4HDIA 2YAEA 1U8PA 4CRPA 1GMEA 3N43B 4MZRA 2VZSA 4JZNA 5C0EA 4EQ2A 2CK2A 4JEGB 4IOFD 4JFFA 1KYAA 5DI8A 1ZLVK 2APVA 1N7MH 2YKLH 2ESVE 3STZB 3ULUE 1QQDB 4GAFB 1U3YA 1BJ1J 2F8VA 4IKLA 1VGKA 1DCEA 3NK3A 5BRZA 1CG9B 1BEYL 1QZ1A 5HGDB 3RVVC 3BUQA 2C3VA 1M53A 4KI5F 2W07A 1KJ2L 1LILA 3LY6A 1OE3A 5DK3A 4F15C 1GCFA 1IGFH 4HISA 3JTSB 2J88L 4Z3FA 3ESOA 3NIDE 3RFZB 3G5XB 3MYZA 5KYXB 5KN5A 3GXTA 3HZMB 3Q8AA 2H1PL 4WAFA 4MMXB 4QRPE 1M7XA 5DUPH 1IGIH 1FNSH 4ONGL 4PR5B 3VFNA 3U7YH 1VLXA 1P5UA 5KBDA 3BGMA 2X09A 1MCPL 5ESVB 1LD9A 3BDXA 2OYPA 1EX0A 4J2XA 1DTUA 3IDJB 5HPMB 1R3HA 3GMMB 2AV1A 5E4EB 3DSFL 3C60D 5DSCA 5EIVA 3A5VA 1Y1UA 1GS6X 2NX5B 4OZFB 4FG4A 4BHUI 4JRXD 3UTQA 1JWUA 3QR1A 4M48H 1RK1B 4YFDB 4ZFQA 3NJNA 3CVIH 4RMTA 4QRRA 5AB9A 1OP5H 4L48A 2BVPB 4NJ9H 1J86A 5JYLA 4QRBA 2R23B 5D2NA 1IM3B 2WQSA 5F97E 3RILA 4NCC1 6FABH 1I85A 5IB3A 2VXQA 1U0QA 2DWEB 3TA4D 4AZ8A 4LLWB 5FV1L 4NPYA 1N64H 5AAWA 2OK0H 4F8TA 5FUCC 4IRZH 1F3JA 1ONQB 3U9PH 5CGBA 5FA4B 3SBPA 4XXDB 4K3JH 4M4PA 1QFWL 4PRAA 4HGMA 4LBAA 3MLTB 4ECNA 4NBZB 5EO1A 5FGBC 1QUPA 2FYYB 4JHWL 2C1PB 1RVFH 1Y6KR 4Q2ZB 1TTRA 1UHVA 1QSEB 6PCYA 1I3RB 3GF8A 4Q6IC 3QP3A 4GJTB 1G0YR 2OX5B 3G3LA 3F7YA 3L4WA 4FL4C 1NZRA 4KKCC 3QI9D 4FZEH 3VB9A 1GL4B 3ARGD 3KW8A 1ZK5A 1WYJA 1QWNA 1A9EA 1EJFA 3CK0H 1ZTXH 4OZGA 4XVUC 2J12B 5EUKB 1MF2L 4Y5XC 4XPGL 2DLFL 2PP9A 2HX9A 4OAWA 4PS4H 2WPGA 2FZ3B 4UTBA 1N12A 1XGTB 4X4XB 5JO5B 4QTFA 2R8SH 4NN6C 2OXGB 3UGEA 3MXWH 5FR3A 2X12A 1R5WB 1AGDA 1EEZB 4JPKL 2WAHA 2A99A 3LHPH 5C0CA 3BZEA 1AACA 4XVTL 2FR4B 3PLYA 4N0RA 3IMTA 3QCUH 1G1CA 1SDDB 2P5PA 3DBXB 3SE4A 1DQKA 1QSZA 3DPBA 4BH7B 2CPCA 4UQ3A 3C5ZD 3B2UD 2W88A 4WTZA 4LPVA 3QIWA 1Q9KA 2UWEE 4MJJA 4E9SA 4F8NA 1NKGA 3AXHA 1U8LB 1QFWI 3NABH 1M2VB 1OARL 3QUML 2E7LC 1CDJA 2RR3A 2MCMA 3GI8H 2G2RB 3L2LA 3FU3A 2LU3A 5KS9E 4G6FB 4EKXA 3SYQA 1B4RA 3QAQA 4HJJL 2CLRB 3N40P 1O7DE 2GSMB 3VA2C 4NWTL 3FONB 4AUUA 1N10A 4OJDH 4YSPA 5DJCB 3GIZH 1J18A 3FQWA 3KYKH 2OCCB 1GSKA 4RMRA 2NW3A 3R7RA 3CFTA 5J13B 5LGKA 3LHAA 2FO4A 5F7EH 3MRIA 3WJLA 2ZX9A 5B39B 2OMYA 2CJSA 3QWRD 4PSPA 4IIQB 4UV4L 5GGSB 2Q7YB 4U1KA 1Q4NX 2DM2A 4DEPB 3BUIA 4YDIL 1AKPA 5T1KA 3SQBA 4G83A 1KULA 1U8NB 2I9LA 3QDAA 4NQXB 1ASQA 1CI3M 3CLFL 3NJIA 5ICXA 4GY4A 4GKZB 2H26A 3CBKB 4AQ1A 1CCZA 5AZEH 4AENA 1PJWA 1CXFA 5ALBL 2HSIA 3RU8H 3HE6B 1HEZA 2PP7A 5J3HD 3RLSA 3IGUA 4ODSH 3MRNB 4LBEA 3L3IA 4QY8A 3IFOB 2EUVA 4ORGB 4D9RD 3ZDYE 1YA5A 2ZPKH 3AUWB 1P4BH 3ZTJH 3LQAC 1ORSA 4M8RA 3BAEH 5HYQA 2DJSA 3HNVH 1KYOK 4RSVA 4U6VH 1JWSA 1QLRB 2HRPH 4G2AA 2WXGA 1T2XA 4JO1L 4TV3A 1FZOB 3C8KB 3UTPD 1X5LA 5E8NA 3CDFA 2WLLA 3K6SB 4MA7L 1JDDA 1I8IA 3ARWA 3S4SG 2XG5B 1Z5HA 3BEWA 1KY6A 3U0TB 1T7XA 3CHOA 1VFBA 3D4CA 1T2QL 1XCXA 2XZQH 3NPZB 1Q8MA 3ABZA 2UZXA 3MACL 4FFZA 4HIHB 4MNGE 1SYVA 3U4KA 2GCYA 2WUCH 3DV6A 4G9FD 4NQDD 2YD5A 5DJAB 2EKSA 2IIJA 3SE3C 4BQBA 3MRGA 2YGPA 4ZXBC 3Q1SH 1MFVA 4FZ8L 1UD5A 2RMNA 3W9DA 4D3CL 2A5UA 3LKSB 2NW2A 1WWWX 1ZSDA 1URZA 1CFNA 4X5LA 3HKZA 1T66C 4OF5A 4LK4A 3RVTC 3N3EA 2BNQB 2GBVA 2XIBA 1XF1A 1NDMB 2DLHA 2VSDA 3GBDA 4H8PA 4LSVH 4WO0A 5E94A 4B9FA 2IPTH 3GQFA 3Q0HA 1WZLA 3QQ9C 4GAGH 4IQHA 4ISVB 1MWOA 4XTRD 3F3HA 5IK3A 2X4UA 4YWGH 3WFDH 3P3UA 2APBA 1FI8C 1TYJA 2H3NB 4DNLA 3QJFA 5HY9B 3ZJAA 2I5YL 3JWNE 1QBAA 4UDUB 3ZDXE 1JPEA 2H9GB 2Z31B 1AGBB 2XVBA 3OLDA 4FX5A 3HE7B 2WBJD 4POZC 5CP3A 1KCSL 3IJSB 4PJCB 5C71A 4YK4B 3MRPA 2KH2B 4MYPA 4U1SB 2Q10A 1PEZA 4LPUA 3LEVL 5HHMD 1IB5A 1UD3A 2XPYA 2HUHA 2LE9A 1P4IH 4HIXL 1MI5E 4NZFA 4XP6H 4BCZA 4B9CA 3CN3A 4R7NB 5JW4R 3TYFA 4ONHA 3RG1C 5A1AA 3PABA 2DQIH 4XBEL 3B2XA 3GRWA 4FLSA 4NQQA 3MGOA 4P5TC 3GMRB 1VPOL 2Z1KA 1WWBX 3FHEA 4YSSA 3Q05A 3P0YH 2YOCA 2F74B 4NCC2 3UDWA 2W59A 3L9YA 3NN8A 2HX7A 4FA8A 43C9B 3QDJD 1BQKA 4L8SC 1FAKT 3WFHA 5ESAB 2E0PA 4MS6A 3IMUA 1YUKB 1KELH 1RZGA 4UM8B 5FO2A 4O2EB 4YHYC 5AKTA 2NUTB 1MFCL 1X6NA 4EI5C 3EDDA 5IQMA 1N9PA 5SWZE 3AUVA 4LLUA 1N18A 4XR8C 1ETZA 1F90L 2DEYX 3WS3A 5F93C 2A73B 5I1LA 5GRJH 3RWCA 1QSVA 4ZX3A 2BSEA 1CIUA 1X7QA 2KBGA 2X10A 1ESOA 5HVHC 2DQEL 2ICWJ 3DXAB 5BRQA 2HTKC 3ZKNC 4JFEB 3U30C 5ANMB 2J8UF 15C8H 3ULUF 5FM4A 2CDFB 5TPWL 5T3ZD 3GPEA 2XSKA 4A7TA 5C0DB 2G4GA 3N0PB 3GXDA 2B1HH 5DMYA 1EEQA 1UGNA 1J5CA 1J0KA 1Q9OA 4WJG3 1RZJL 2BRRH 3GPSA 5ETUA 3ZDZB 3UTOA 3NA4A 3CFNA 3B8YA 4PJ5A 2K6WA 1WJ3A 3M86A 2WSDA 2ZWSA 1JZJA 2UXTA 1FDLL 5HD8D 1JK8B 3GS0A 3NIDF 2CD0A 3OZ9L 4F20A 1CGUA 2O5XH 4JM4L 4AT6B 4EVNA 3FTXA 1IKOP 1FO0L 1CU4L 1NC4D 3L7FB 4PJGB 4X5WB 3QJQB 4CU7A 4RAUA 2Z7WA 2ZD0A 4WK2B 3CX5K 2D3JA 4FXTA 1UJ3C 4APQB 3UPRB 4GUPB 2UY6A 2IGFL 4MCZB 3EF7A 4L8BB 2F58H 2ODIA 2HVJA 3J07A 5C6PB 1Y1DA 4Y5YC 5K59E 5AW7B 1BJ1H 4QT5A 5ISZA 1G6RB 4H8WL 4HGKC 3KEHA 3QA3B 5EEUA 4PJ6A 3TZVC 4ZNCD 1IZJA 2QR0A 2VDPH 1VRSA 3V4PH 1RMFH 1BZDA 3LRSB 5DZ9A 1GTNA 3S34L 2ICEC 4LNRA 2CU9A 3LD8C 3MRRB 2DQTH 2OI9B 4LNVA 3U2SA 1AQKL 5HDBF 3SCMC 2NZ9D 3F58H 3IYLW 5I6LA 4NM8L 5DFWH 3FQXB 5LN4A 5IJVB 2AQRA 1A7PL 1UA7A 4UBDC 3V5DA 1F58L 4P5RA 4OLYL 4QXWA 3QUKA 2E56A 4Y1TA 4ZMXA 5IBUB 4JANB 3BVTA 1SQMA 4NZUL 5IVXE 1N8OE 2W94A 2XKUA 5EPMB 2XN9D 5KVGH 1B4JH 1WAPA 4J12A 2BC4B 1KB3A 1G7MB 3GHEH 4XPHH 2PXYD 5B7EA 1GZPB 2YK1L 2EDTA 3I50H 3QYCA 4UQAA 5DRXA 3UBXI 5DT1L 4J5VA 1ZT4B 1XH1A 1QRNB 2A9AA 4LE8A 1P7HL 3QVAA 1D9KC 2XPGB 1EAJA 2AJUL 3O6KL 1W8OA 2EH7L 3V4PB 1I1FB 5TK4A 2XG4A 3IVKB 1Z9PA 3TFKC 4FE9A 4JFDD 2PR4L 4N2CA 4H40A 1V7MH 1WFJA 3GZPA 4U6HB 1TO5A 4HJ1A 4OKVB 1AP2A 4NGHL 4K23L 3UZVB 3HNTL 4YDLC 3X11A 2NY7H 2XWXA 1KOAA 4YE0A 2W5PA 1HOCB 4X7TA 1R9FA 1AYOA 4EBQH 5FHAH 5E9DA 5FKPB 2E6JA 2PWDA 4MASA 3D85B 2APXA 4YLCA 1T1WA 1HHIA 3Q43A 3VXMB 4DW2L 4PJEF 2HVBA 3CCHB 5EC2B 2PPFA 4KKZA 2OFQA 2EVHA 1WA1X 2RH0A 4QR7A 3STBA 5FGBA 3GIVB 4RMVA 1TO4A 2UWEF 5EBWA 1OIOA 5AUMA 4IBVA 4XOEA 4RQQB 4Q6IA 4YDKH 2EP6A 3GBNL 1BXAA 1LO0L 5FOJA 3RTQD 5IW1A 5KS9F 2D7TL 3IF1A 3HG4A 2VLKB 3SJVA 3HPLB 2OZ4A 1FVDA 3VGAC 3QUYC 1KPVB 3QFGA 5E0QA 3KXFD 4HXBL 1LWJA 1KIUA 1TOXA 4Y5XA 4UT9H 3BOVA 3ESNA 1MCKA 5C0RL 2OTPA 5GSVB 5T1LD 3ARPA 3PWPE 4MD0B 2WZAA 1EDHA 1Q1PA 4WWOA 4LCVA 2OTWA 3T1FB 2NNFA 1YQVH 2BOBA 1NLDH 4RVBA 5DR5L 5C08E 2G30A 1BEXA 2CCVA 1BLNB 2J20A 4D9QE 2Y2YA 4F91B 2EDLA 4J6IA 2BHYA 3UJJH 1NMAL 4WDIA 3PJNA 4H8WC 3QH3B 2WK2A 4FQLH 3RWFB 4P5MA 2E7LA 5J5EA 5D9SA 3TBWB 4U1JB 1GMIA 1EWHA 3DI3B 3U2JA 4WUUD 2BS71 1KJ2A 3HI5H 2OR8A 5AOZA 4UM9D 3V2AR 4X99A 1IBBA 4LT7A 3NQKA 2OMNA 4EKJA 3RAJL 2YUWA 3ZKMD 4Y4FB 4ZUUB 3RNQB 3IT8D 2EDRA 1UJTA 1A2YB 1N6VA 5E1HB 3QISA 5F1IA 3A6CL 1P7KA 1P6AB 1XEUA 2XN0A 3VDAA 4LEXH 1BFOB 3PQYA 2D3NA 3GBML 2YD1A 2BS9A 4HYTB 1CBVL 5F6HI 1QI4A 3Q9PA 4XAWH 2VXVL 2V4LA 1I82A 3D3VE 3INOA 4JPWH 5LCVH 1U8QB 1VFAB 3G5YA 3QHZL 4HKXA 4L9LC 4N24A 5AL8A 3AB0C 3MLUH 1RP9A 3TC9A 2Q7AA 4GW4A 4WI2A 3B43A 2AF2A 2QKIC 5JPMC 1ES0B 3GXNA 3L3OB 2XWJB 5DZNA 4P0DA 2DJMA 4N9OB 2CDEA 2C7FA 5HJBA 5DVOA 4YS4A 2ROXA 2Q76B 2C4FU 1I9IH 2Z7ZA 5AVSB 1T1YA 3F04A 5TE7L 1GGBH 2FT6A 2JIXA 2X4TA 4M1DL 4RBPH 1K2DA 1FL5A 1DBJH 3CZJA 2ZQKA 3B9DA 3LEYL 1WTGT 1T7ZA 2YKKA 5I2IB 3OB0H 4KGJA 1JGVH 1QI5A 3L9EA 2ZCZA 1A6PA 3S35L 3TIDA 3ZDXF 1RZ8A 4UIKL 5D5MA 3SGDI 1A1OA 2B1AL 1NJ9A 1P0SE 2LR4A 4L5FE 4XN2A 2X4QA 4JPQA 4KK9D 5B4MD 5AVQB 2PCFA 4JCWA 5EU5A 5FHBH 2J8UA 4H2AA 1HH9B 3X14A 4YHZH 4ZXBA 1A9BA 1V7NL 1JSYA 2YXMA 4K7PY 5TH2B 1UM5H 2GI0A 3D7PA 2GITA 5K9KA 1L9OA 3BSHA 4EIBA 5C0AB 4TOYL 1BMWA 3VCLB 2EVIA 5IFJA 1K8DA 1WFOA 2IANA 1BVNP 3NFSH 2WVUA 1TYRA 4HQQH 4K5OA 4N0UB 3CQQA 4L3ED 4B5ZA 5JHLL 5DD1H 2BIHA 5ADPH 1ODAA 4N90D 4OFIA 3K0WA 4OLUL 4U6TA 5FGSA 4UDTB 4G5ZH 3S3JA 1DQTA 3MNDA 3QRFM 1JP5A 2BMKA 2A7BA 5I74C 2GAZB 3E6FB 3Q5TA 5B38G 5BOJA 2V9QA 2WOYA 2CJUL 4FNQA 2EXYC 1A5FH 4AYFA 5JHAA 4YHOH 5KUKA 1IIKA 1SEBB 2W81C 5DEGB 4OJYA 5DEJA 4AL8H 5D1XD 5FS5A 1EFXB 3BP5A 3Q3GA 1B2YA 1RUPL 3MUHL 3ULVL 4ZFGL 5CEZE 3BT2L 1SJHB 4LSQL 1TXKA 2P4AB 3WNNA 3GZOA 4NYLA 2JV6A 4M1GL 2JJVA 4OD1L 2EEDA 5DUJA 4WCYH 4NZRL 3SDYH 2EE9A 2OSLA 4KQ3H 1F11B 1NBYB 1B6DA 3D18A 1A7RH 2C7UB 1XD0A 1CLCA 4YGAB 3KPMA 2X05A 4OZ4B 3AROA 1GAFH 4P5TA 3D34A 4E0RA 3MV9A 3RX8A 3TIEA 2X4PA 4UU9A 1ZT1A 2E27H 3ZRCC 1TF4A 3FO9B 1JPFA 2K45A 3HN8A 4L8SA 5GGRB 4RGOH 4MA3A 2BDNL 2G3NA 2Y72A 3VD3A 2IWKA 5K1VA 5A6LA 4PV8B 3VMPA 4AG4H 3SPVB 4LP8A 4CC4C 5M7QA 4EI5A 1N2RA 1RULL 4H0LC 5JNYB 4JK0D 4NUMA 3QAZB 2OMVB 3TJEH 4B3EA 3C6EA 2IBZY 4Y19D 3VQ2C 4QKTA 3RWGA 1NCOA 3VXUE 2QTVA 1JYXA 3FT0A 3H42L 3LZRA 2A9NL 3CZSA 2RHEA 2HYMA 3ZYOA 3UZEC 3T8XA 4YMPA 5CZRA 3I6KA 4CVZA 4XPTH 5FECB 4DVBA 5TF0A 2YC1B 1K4DA 2CUIA 2Y07L 3G6DL 5I26A 2XKNA 3BMWA 1RPQA 3ATFA 4JO4H 2XACC 1W16A 2JJTC 4NQTA 5E99H 4ELME 5FDYA 2G9HB 3LRHA 4KFZC 4KPHL 2QSQA 5I1AA 3G5WA 5I0YA 4PJEA 5E6UB 5DFTA 4BZ1H 4M62H 4TL5A 4WWNA 5H4ZA 2DKSA 4AH2A 4JBSA 2QZQA 5L4IA 3RY5A 3ATDA 4KVCL 3SYAA 2P5ED 4LEBA 1U8OA 4PJBB 4YPGB 3VGEA 2JK5A 4MKMA 2X70B 4WFHD 3VO0A 1FZJA 2XLLA 4MA1C 4M8VA 1UJ3A 2IAMC 3PGDB 3ZR6A 3QRBA 4JRWA 5DD6B 2ICWB 4J4PC 4P2RA 4QI3A 3RA7H 5I0VA 3EJCA 5BUPA 1CDIA 3UCRA 1A65A 5CINH 1LQBC 3VWKB 2F54A 4AQZA 4Y5YA 2VLMD 5HDLA 1WUZA 1CVRA 4WKZA 5IMLA 4WI6A 1NL0L 4GRMA 1DZ0A 1MCSA 1YEJL 4NWUL 2A2QT 3MHZA 3WLBA 4A67A 3TZVA 1OSEA 1H15A 2VDNL 2B3RA 4HBCL 2O61B 1PAMA 5DS2A 3FYEB 1HL4A 2ICEA 4G8GA 2MJWA 1VEOA 4Z7QF 3SCMA 1X7SA 4MNQE 2A9CA 1T1ZB 3ULVC 3O8XB 5MP6H 2HN7B 3CGTA 4PYGA 4FNLL 5E8PA 4YSQA 5HHNB 4NN7B 2VNCA 2FIRT 4L4VD 4KJPD 3WBDA 1FFRA 3IN2A 4U1IA 4FABL 5ID0B 4TM9A 1G7QA 2F8OA 4GQ9H 4JN1H 4QXGL 2ZSWA 4R97C 2CHZA 3SKMB 4X6DB 3DUSA 3SY0B 4RWYL 2WVSA 1M7DB 4NNYB 3QO0A 4PJAE 4MNHA 4CNIA 5F3BB 3W5MA 2ENYA 4JY5H 3QRGL 4AV4A 5JORB 2N1TE 2VUYA 4EDXB 3KHQA 4J23A 3IDGB 2P3YA 1FFTB 4RGMC 1DVQA 2ZYSA 5D7LE 3NBNA 2WTRA 1N4XL 3FU8A 2VDLH 1NCWH 1D9KA 3UPAA 5AVZB 5AW9B 1LE5B 3MLRL 3FOLA 5IG7A 5EBLB 3WDIA 3Q44A 4R7LA 3MXVH 2ZUQC 3BFQG 1I1AD 4G6FD 4CBPA 2GK0B 4TRPH 3DETD 4TNWF 1N0LA 3RDJA 3PCYA 3GUFA 4EJ1C 1RSFA 3U9UB 3QWNA 3LNFA 1J8HA 4JHAH 1QAWA 2ADFH 4LRIC 3OR7B 1KB9K 2O30A 3W81A 1RLBA 4Z0BL 1A8ZA 3JZYA 2AHIA 4XNUL 3ROOA 4AW7A 1HHKA 5BJTB 3HN3A 4XPBL 3QJZA 3BWAA 5TDNB 2O6DA 4AEHL 5KG9B 5KYUB 3OLEA 1DJZA 3L3HB 2O26U 4XOAA 1I31A 2YPKB 4UINL 5AEAA 1QYGL 3V0GA 1NAMB 3MCLH 1CFMA 5GRUL 1BW8A 1JK9A 1FC2D 5JXAL 1KPRB 5J11C 4EMZA 2ED8A 3UADA 4PV9B 3QQDB 4A66A 3CC1A 5B8CB 1FA4A 5AYUH 2DMBA 4ODWB 2NY1D 4GXVL 4GXUM 5D71L 2WYZA 5E6RB 4A2FA 4F7PB 3QUYA 3B8SA 5CO1A 1DJIA 4HWEL 1A4JA 3NCFB 1CWVA 1J88A 1WICA 3DTXB 4R26L 3VXSB 4LCWE 3S37X 3PJSA 1FO0A 1EVTC 1KCVH 3NZHH 2P7TA 3RUGF 4IK6A 1JRHL 3RIFK 4P5KA 4WKXA 1AJ7L 1EO7A 4KK5D 5D55A 2EDNA 2ERJB 3HN5A 5CGTA 3DOSA 3N91A 4GW5B 5J7CC 3PRZA 3NCCB 4LVEA 3ULVF 5C09A 5J6HB 4HDIB 4TVPD 3FQ1A 3ULSA 4PCSA 4GG6A 5HTSA 4C56A 5C0EB 3ARQA 2AKRB 5GGTA 4FQJL 3VFWB 2FD6L 4JFFB 3MRKB 4MZ3A 4E5XG 2WSPA 5DI8B 1BBDL 1N59A 5AOJA 1HKFA 3M1BA 2WQAA 2HJKB 4U1GC 4V1DB 5AOMA 2R15A 2KERA 1YEFL 5KTEL 1JF1A 1VGKB 3ARDA 4WK0B 1T4KA 3CFBA 5BRZB 3FQTA 3GJFA 5KSUB 4FCHA 2FQGA 4HFWA 4NKQB 3ZMNA 2H3XC 4A7QA 4KUZL 4QTIL 2C3VB 5D1ZC 3CMOL 2BIPA 2YAFA 2GY7B 5F9OL 4TULL 2W07B 4JE4B 3OSVA 1NCCH 4Y0GA 3GT6A 2VXQH 3VI4E 1QW8A 2VXSH 5I76B 1JGIA 3C08H 5I1DB 3VACA 1CDHA 4WEMB 5TF1H 5CLTA 4ZNEE 2VLJE 2NQCA 4NI6A 4PP2B 2NY4C 3EO0B 2IDSA 4JG0H 5I71C 2ADGA 4DN3H 1QATA