2IH8A

A low-dose crystal structure of a recombinant melanocarpus albomyces laccase
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
publication title A crystallographic and spectroscopic study on the effect of X-ray radiation on the crystal structure of Melanocarpus albomyces laccase.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
total genus 184
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A03
1OF0A 2FT7A 4GP4B 2VMJA 3L45A 3FS9A 4TXVB 1OE1A 4KOBA 5I6OA 4GP5B 2XV0A 2IH9A 1XB3A 3DTUB 2CAKA 5I6KA 1OCCB 1ZDSA 4HAKA 2NRDA 1MG3C 1MZZA 3ABLB 3ASNB 3ZDWA 3ASOB 1GY2A 4YSQA 5AZUA 3T9WA 3T6ZA 2WSDA 1RZQA 3S3CB 1BXAA 4CSPA 2P80A 2GC7C 1N68A 4JHVA 1AS8A 2YAFA 4KOCA 1MZYA 2YXWA 2CBPA 1A4AA 1QHQA 4GY4A 4E9TA 4HZ1A 1QNIA 4AI7A 2I7SA 2VW4A 1IBYA 1DYZA 5A7EA 3T6VA 1I53A 4E9YA 3IBOA 1J9QA 5AFAA 4YSOA 4PAZA 4Q89A 2AVFA 2PCFA 1WS8A 2YARA 3SBRA 5I6NA 3GDCA 2UXFA 3CVCA 3NSDA 3T71A 4RH4A 4YSSA 3NJGA 1TU2A 2HLEB 3C75A 1BQ5A 4Q8BA 1V55B 1A3ZA 2GB2A 4HHGA 2MTAA 1WA2X 3UAEA 2YAHA 1NDTA 3QJUB 4HCFA 2JXMA 2WO3B 1NIAA 3EH5B 2B08A 4DPBX 1A4BA 1M56B 3FSVA 5B7MA 2N0MA 1KDIA 2HX7A 3MBWB 3JT2A 2FJSA 3X1FA 1AR1B 3AG3B 3TA4D 1JZJA 3AY2A 1JXFA 2GBAA 2YAOA 1KYAA 1AQ8A 2J56A 1EZLA 2PPFA 4YSEA 4KO5A 4KNTA 3CDZA 4KO9A 2BZCA 3GXUB 4BXSV 3IE9A 4AKQA 3OQRA 4A66A 2CJ3A 2CUAA 2GIMA 3S8GB 3PAVA 3U25A 4YL4A 3WI9A 1PMYA 3WKQA 1AS6A 1NICA 2ZWNA 2E86A 2RACA 4YSAA 3WG7B 1GW0A 2PLTA 4G71B 1AACA 2PPDA 4DPCX 4G72B 1QLEB 2H3XC 1OCZB 3IEAA 1KGYE 4A2EA 1AG0A 2FT6A 2VW7A 3KW8A 3TBBA 4ENZA 4W1TA 1RZPA 2DWSA 2GSMB 1NINA 1RKRA 1AANA 3QQXA 2R7EA 3NJIA 4K9JA 5B7FA 3RYMA 1W6WA 3FSZA 1EHKB 1JOIA 2FQDA 3FPYA 1FFTB 5B1JC 1IBZA 1TEFA 2GHZA 2FNWA 4BK5C 4M3HA 3H56A 3WKPA 3NSCA 1KBVA 4WTQA 7PCYA 2PPEA 4KO6A 1ILUA 2AZAA 3AG4B 1NTDA 3FU7A 7PAZA 2IDSA 2QPEB 3AG1B 2VM4A 4A2GA 4M4RB 5ANHA 2HRGA 2FWLB 4F2FA 1E5YA 4DP4X 2DYRB 1HAWA 1SDDB 4X4KA 3OD3A 3FPXA 1AZUA 2QDVA 1V10A 3OMIB 3OMNB 2IAAC 4G7QB 1X9UA 2Q9OA 2HX9A 2IDUA 1BYPA 1GS8A 1URIA 4G7SB 3X1BA 4E9WA 2HXAA 3IN2A 1AS7A 1PNDA 1UATA 3UADA 4PCYA 1GYCA 1KDJA 3QJTB 3AG2B 3ZBMA 4AKOA 1XB6A 1M9WA 2PP7A 3TU6A 5B7EA 3NJFA 2FQFA 4DPAX 3T6XA 3QJSB 1E67A 2BP8B 1AOZA 2CALA 1NIEA 4YSRA 1ET5A 3DKHA 4YVNA 1CYXA 3X1GA 5F7BA 4DP9X 4YSDA 1NPNA 2BHFA 1J5DA 2W88A 1SFHA 3QJVB 3NSYA 1OCOB 5AKRA 2J5WA 1R1CA 1J9TA 1M57B 3CVBA 1JZIA 6PCYA 1CC3A 3FT0A 4E9XA 4GXFA 2UXGA 4JKNA 4YSCA 4YSPA 3GYRA 2W8CA 5PAZA 2IH8A 2BWDA 1GY1A 1GS6X 1SF5A 2TSAA 4DP5X 1SJMA 4A67A 4DP2X 4E9VA 3QJQB 2FTAA 2BW5A 1PAZA 3SBQA 2IWEA 3NJKA 2XXGA 2ZXWB 3N2JA 1E30A 1WS7A 3V9CA 4A2DA 2OCCB 3FYIB 2X88A 3N55A 4BDVA 4DP8X 1JZFA 1RCYA 1OE3A 2VM3A 3UACA 5LDUA 4BWUA 1PLBA 2Y1AA 1JZHA 1J9SA 2VW6A 3HB3B 1CURA 2I85A 1WAEA 4P5SA 4AKPA 1CYWA 1W8EA 3ZX1A 2XUWA 2B3IA 2X87A 3PAUA 2PCYA 1L9PA 1JVLA 3PLYA 2DWTA 2HZHA 3PXLA 2VN3A 3H4FA 4A2HA 2AZUA 2BP0A 2BO0A 3NSFA 2UXVA 5D4JA 4AX3A 3CZUB 1PCSA 3PCYA 4NAJA 1FWXA 3FSAA 5D4IA 1TKWA 3QPKA 3FSWA 1BXUA 3UAAA 3BQVA 4EF3A 2JFCA 3CDZB 1ZIBA 1JZGA 2EIKB 1L9RA 3EH3B 3KW7A 4NB7A 5I5JA 2WO2B 4DP6X 2XXFA 2FT8A 1KCBA 3CG8A 4DP0X 1TEGA 2HRHA 1HFUA 2VSKB 3X2QB 1L9TA 1ASOA 1GR7A 1XMEB 1AZCA 1X9RA 3AW5A 1A65A 2EILB 3V9EA 4KNUA 4A68A 1A4CA 3NJLA 1PZAA 5E9NA 2YAMA 1IKOP 2XU9A 4NERA 1L9QA 5I6PA 4UANA 9PCYA 2PP8A 4YSTA 1AG6A 3S3BB 1GS7A 5F7AA 2UX7A 1ILSA 3OM3B 2QDWA 4F7KA 4FA7B 2R7EB 3TBCA 2A3TA 3ABMB 2IWFA 3FQ2A 5I28A 1AZBA 1BXVA 2UXTA 3JTBA 1BYOA 4N8UA 3X1EA 2JKWA 2YXVA 2XV2A 2VSMB 4BXVA 3FU7B 1J9RA 1ZPUA 2DV6A 3HEIB 3SQRA 1OE2A 1PNCA 1ADWA 2Y69B 2PPAA 4G7RB 2BP8A 3OMAB 5I6MA 3NJMA 2QPDB 4AZUA 2HX8A 4E9SA 3SBPA 3WIAA 3QJRB 3X1NA 1B3IA 1CUOA 2AANA 2PP9A 2XLLA 4WKXA 3NJJA 3PAZA 2XVBA 3NT0A 1NWPA 1PZBA 1AAJA 5B1JA 1NZRA 1DZ0A 3S8FB 1OCRB 1JXGA 1V54B 3MX0B 2MRYA 4GP8B 3FU8A 2J55A 4QKTA 4DP1X 1ETJA 4G70B 4HCIA 1KCWA 1KBWA 2GI0A 3DIVA 5FC9A 4JHUA 3ABGA 3UGEA 1ET8A 3BVDB 2ZONA 1AIZA 4A2FA 5EHFA 2H47C 5IY5B 2LLNA 2AFNA 1L9SA 3FYEB 3EH4B 1AZNA 1GSKA 1HAUA 2TSBA 4F2EA 4HALA 1T5KA 1PLCA 1JXDA 2CCWA 3EF4A 4W9ZA 3H4HA 1SF3A 3UABA 2J57A 3NYKA 3EHBB 2FQEA 2EIMB 1NIDA 2QT6A 4FAAB 4HCGA 5I26A 1E5ZA 2IDQA 1FA4A 4UAHA 4BDVB 5I6LA 1WA0X 4KO7A 1SFDA 2ZOOA 1PF3A 5TK4A 2XX0A 3T6WA 1OV8A 2IWKA 4MFHA 1W6LA 6PAZA 1MG2C 5B3SB 4ZK8A 4L0PB 2OJ1A 3TASA 1IUZA 4GYBA 1KV7A 1BQRA 1NIBA 2IDTA 3NP4A 8PAZA 4N4YB 4BWTA 2DY2A 3G5WA 1ZIAA 2P80D 1NPJA 5PCYA 1ASPA 5TK2A 2GC4C 1BQKA 1JZEA 1N70A 2FQGA 2YAEA 1NIFA 2BP0B 5D4HA 1PY0A 1F56A 3WNIA 3FQ1A 2YAPA 4YSUA 1ASQA 2BZ7A 4HHWA 1JVOA 3S3DB 2PPCA 5B1AB 4YVUA 2EINB 1SHWA 2IDFA 1A8ZA 1L9OA 1J5CA 1OOWA 2I7OA 1WA1X 1ZDQA 2XYBA 4P5RA 5I5IA 4DP7X 1PZCA 3WNJA 3ZIYA 2BW4A 2EIJB 3FU9A 2XWZA 3AZUA 4CSZA 3D12B 1IC0A 2YAQA 2DYSB 1SDDA 3PPSA 1BAWA 3ABKB 3NJNA 2BWIA 4KNSA 2UX6A 1SHXA 2Q5BA 3ERXA 1MDAA 4HIPA 4BWWA 1XB8A 5B1KA 3NJHA 2H5UA 5I5MA 1SNRA 1ID2A 3FQYA 1PLAA 3NP3A 1E65A 1YLBB 4E9RA 3IN0A 4QLWA 1ZV2A 1NWOA 1BEXA 2XX1A 1VLXA 1AZRA 2XV3A 4UF7C 1JERA 1ET7A 3CVDA 5B1BB 2YQBA 2OV0A 4E9QA
chains in the Genus database with same CATH superfamily
4GI6A 2X41A 4B3VA 4L18A 1YNLH 4KKLC 4TSCL 1HH6A 1NCNA 3LEYL 4N2AA 1HILA 2IBBA 4EIUA 3WAKA 2R69A 1YEHL 4WHCA 3ALPA 2AK4E 5TQ0H 4OH2A 1DBKH 3D4CA 2NX5A 3MLPA 3BGMA 4QXTB 1BAGA 1ETB1 4FMFA 3VXUB 2GG1A 4WK2B 2DWDA 2O26U 2VDRH 2ZWKA 4U6XB 3MGTA 5ALBH 3BN9D 4D9RD 5I1AA 5D7KD 3S3SA 1A3LL 1NL0L 4OKDA 3LSOA 2QTVA 3ECBA 1URLA 4RFNC 3S3CB 1Z9PA 3CFQA 1BXAA 4HBQA 1PKOA 3TPKA 5EO0A 3WKYA 4MAZA 5D71L 1OCWH 2WVVA 3OGOE 4NQSB 3Q5YA 3WY3A 4C59B 1V27A 2X6CA 4WSJA 4E2OA 2R0KL 4JY6B 4RA0C 2DLHA 1FQ9C 3MNZB 4DGIH 7TAAA 3T6VA 2QVTA 2O72A 4NIYE 1HQ4A 5BW7C 4ZOCA 5TE7L 4K73A 3KPNB 2NLJA 3HG1B 4YXLH 1W15A 3LDBB 4ZMTA 1UH4A 3L3DB 4NRXB 1KGJA 2CBTA 5FA3B 1KPVA 2ZOLB 2ESVD 5EEZA 1LE9B 5DUBB 3SDDB 3I50L 1JWUB 2EEFA 2R1YB 1BQ5A 4WSKA 1KELL 5DVNA 5GS1C 2E9BA 4EUPB 4N0UA 1DQJA 2GB2A 4XNXH 5KVFH 5EOTA 3TX4A 2XKNA 1NBVL 2X0WA 3FTWA 3ETSA 1LEKA 5I73C 4JN2B 4UT6H 4DPBX 4PMEA 3MPCA 1ZV5A 1N8ZA 2ZWYA 3AC0A 3U7YH 4IKLA 4LCCC 3NCWA 2JQAA 2RFXA 2QSTA 3VXRB 4MZIA 2WZPD 1JZJA 1XCXA 4N1HB 4B6ZA 1FNSL 5AKSA 4CMMB 4CVXB 3JWNE 5L8JB 5CMAA 2ILLA 4D7PA 4NDMB 3DOSB 1MCNA 4FTDA 4N2DA 4PLKC 3MOAL 3I9GH 3WHXB 1KPUA 5HDQH 2VN6A 4MRBA 3LZNA 2NY4D 2ZWNA 3DUUB 3RWCB 3T2NL 2R0ZH 1LL1A 4YFLF 2HTKD 2CRMA 4H8WH 5DD6A 1UCBH 4Z3IA 4KU1A 2KZKA 3QIWA 3QPXL 3B6SB 5IK3A 4PJ9B 1G1CA 4R84A 1E8WA 4H4NA 4EVNA 1BBJB 1CE1L 1IBFA 4QRTA 5DMKA 2F58H 1IRAY 1RKRA 3ZRFC 2FR4A 2QKIA 2EICA 4A7VA 4K9JA 5HVFB 1UM5H 3CX5K 3DXAE 2BSSA 1RUQL 5SV3A 2V7HA 4KKLD 4NNXB 3EYSL 3FB8A 4RFOL 4GIOA 2ARWA 5CUSH 5JYMA 2EDTA 1J1XH 4R96B 2AZAA 3GJFH 4UV7H 1NAMH 5EB9A 3F01A 3P9MB 4JG0L 5EUOE 3U7WL 5J6HB 2WYIA 2H26B 3ARDC 4RX4D 2FWLB 1WUNT 2D2OA 4P05A 5CEYB 1P4BL 4XPFH 3U1SL 4X4KA 4HIQA 4G3YL 3D85B 4XHJC 4R4FH 4Y4KB 1LE5A 1MCEA 4G7QB 3D4YA 1GS8A 2FL5B 4X6FB 1OB1B 4N0FA 5CCJA 2V2XA 1AS7A 4KI1A 4HUUA 4LSSL 3PWPA 5DQJB 3U83A 3S3JA 4MDIB 1OP5H 1DJSA 2X6BA 5E08H 4POZC 2EVFA 2YGVA 3OR6B 1IGML 1T1WA 3NIGF 3HZVA 3MBXH 4HIXH 1CDBA 5EO9B 3QFGA 4TF4A 4WO4A 4XP5H 4TNFA 1E50A 3WXWL 1NCUA 2ZWZA 2J1YA 1AGCB 1NBYB 3CHQA 1Q8MA 1U91B 4N2OA 4LIQE 4J8RA 3V5HB 3TBTB 2BHFA 2CPUA 2W88A 2HFEA 1J9TA 3VD5A 1YYMH 1NCWH 2VC2H 5T33L 5GGUB 3UC2A 4C56B 2P48B 2AJ3A 1QR4A 3F64A 3RUGB 4TNWK 2OZ4H 5SWSE 5INCA 2O5XH 5FF6A 4G42B 5FFOA 2R2EB 3WUZA 1RL1A 3P0GB 1YEDB 1M6OB 3MN8A 1VGKA 2N1KA 3X3FL 2XV6B 4FABH 2FCBA 3QZNA 2XG4B 1GA2A 4V1DA 4XVJH 1QTPA 3PUCA 5DR5H 1OTSC 1UXSB 4JQIA 1FNLA 4Y19D 1K6QL 4P3DB 3PGDB 5J06A 3DURA 3NIFE 1NCHA 4GKZB 2EO9A 4PLKD 3QYCA 1A3RH 2OMWB 1KCVL 5CIPH 4RETB 2LW3A 1TR7A 4AVHA 2WLMA 2UZYA 2WLLA 4P2QB 4N9GA 4R83A 5E0QA 3WIFB 4PYGA 3DX7A 5J3HC 4F20A 1XH3A 2WNGA 2YC1B 3ZQWA 3H6AA 5ACZB 4OZIF 1SN2A 3HNSH 1M9SA 4HFUH 1U3ZA 3EYQC 1MJ7H 3D52A 1M05A 4L4TA 4G7YL 2VN3A 3H4FA 2I60H 4PJBF 3AAZA 2PXYC 1MI5D 3E2HB 5F7UA 3CZUB 4QHKJ 1WAAE 3BZ4A 4GLRH 2JCCA 1EZVY 4M02A 3EOBB 2HVBA 3L9BA 2GJ6D 1UUNA 2BSEA 1NCCL 5HYJB 2GEQA 2EIKB 1Q0XH 5AG8A 2UWEE 1OAUL 3ZE2F 2X2YA 1LO5B 3KW7A 4YFDB 5TDOA 1P7QB 3H55A 2FWOA 4XP4H 3ARDD 4ZDHB 4QOKB 5ITFA 2EABA 1OLLA 3LKPB 1UKTA 1N6QL 1IM9B 3LJ3A 4W9FC 2FZ3B 4XHJD 3QXAA 3C60A 4E41D 1GH7A 1J1PL 3RWFB 4OZFH 3ZYOA 1X9RA 3VFWB 2ZD0A 4UILH 1A65A 4A38A 5D6DC 3T4YA 2WIMA 2VZ1A 4ADIA 3QORC 3VFNA 4WDIB 2G0LA 4HD9A 1YEWA 4HZLA 4LL9A 5IEHA 3K0WA 1CDYA 4HA1A 4POZD 3VFGL 3ZL1A 5GRJL 4U1LB 5T1MB 1QSVA 5F7LB 4B9JA 1YMHA 1BXVA 3K8LA 5BRZB 5E2WH 3LOWA 3PU7A 3MRIA 1S7UA 1YC8A 3HEIB 1ZPUA 3IRPX 5EZLA 4TM9A 5BMFH 4X9BA 1T4KA 3VFVB 1BA9A 1JWSB 2HFGH 1G1OA 3QHZL 2R4SH 4HLJA 1J86A 5C07A 5FB8B 5BS0E 1L6PA 3PV7A 1ACCA 5EA0H 4TSCH 5HY9A 4TTGA 4MA7L 4Y1AB 1B3IA 1CGXA 3VXME 5LVEA 4ZG1A 5MEQB 4HHAB 5C0AB 3D07A 4MJ4A 1P0SE 4WW1A 1A14H 5F89A 4B97A 3STZA 1NL0H 4NN6B 3TNNA 1OTSD 1AGDA 1B4TA 5T1LD 2ZSVB 2OMNA 4YHZH 3V8CA 5BVJB 2FX7L 1MFAH 3MCG1 4LKXA 3TO4B 3FO0H 1DZ0A 3VD1A 1QFPA 3BKJL 2X3AA 4G1EA 3W0WE 3TYFB 3BIBX 2HG5A 1OWWA 2DQHH 4FQPA 1SOQA 1QZNA 1T7YA 5JPNC 4EIZC 2WVVB 5AW1B 3RX9A 2R0KH 4FFZL 5AEAA 2J88H 5J3HD 2WSPA 2ZJSL 3QGVA 3VJ6A 1I7RB 3D30A 2H47C 3EYQD 3QHFH 3HJ0A 1CFVL 4UMGA 1E90A 2D0GA 3D0LB 1TTUA 2OI9B 2VERA 1HQ4B 3CN2A 2HH0H 3CUPA 3LRKA 1GSKA 3RHWK 3DYPA 1MCQA 5EIVA 2NLJB 1GZQB 2PXYD 2A73B 3B9VA 2OL3H 3NIGB 4LGPB 2HT2C 4PB9H 4YPGA 3EG9A 4L4JA 1S78C 5B3NA 4AYFA 2R2CA 3UABA 3G04A 1KELH 1XGYH 2DI9A 2LLGA 3MSPA 1VGEL 3VGBA 4Z7VA 5KVEL 5EEXA 2FK9A 2Y1YA 1MLBB 1HHJA 3MXVH 4YH6A 3CFJB 3F7KA 1NGQL 3IM1A 1E4XH 1ZHNB 4N2MA 3ZZQA 2X4QA 1FFPB 2XX0A 4X4ME 4G5ZL 3RZCA 1CD0A 3BKYL 3TJPA 1PG7W 3MMEB 3O0RL 3O4LD 1ZGLA 1F2XK 5CEZD 2IPTH 5GZOA 4NKIL 1SOKA 2D2CC 4GYBA 3N40P 2CKBH 2X6AA 3ARGA 4M7JL 4L3AA 1L6ZA 3HFFA 4J5VA 5CMAB 5EU5A 2K9UA 2OCJA 5DUPH 3V4LA 2LTQC 4MB1A 2W95A 2D4FA 4PRBA 2DS4A 3VQ1C 4P4KB 3QORD 2BIPA 4JFYA 1FNEA 2DYPA 4OCLC 1DVFA 4F57H 4RZKA 4AEEA 1MKFA 1IBGL 1CFNA 1N5YL 3CVHH 1PAMA 2EC8A 5DI8A 2BY0A 3VFTB 3ESPA 2YPLD 2J1XA 3OC8A 3FTVA 4YGVB 1G7LB 5IKCA 1SHWA 4BIKA 1EQWA 1S7TB 4K7PX 4PJ7A 1HDMB 4D0BA 4HJ0C 4K7PY 1PZCA 1KZYA 5IK3B 5TF1L 3VXSA 3DHUA 4YDVB 2OP4H 3D0AA 4U3SA 3BWAB 4HJGA 2XBZA 4I1PA 4O2EA 3OKEA 5A2LH 2YFNA 1EHLL 4LLYA 2F53A 4XT1C 3DX9A 4JANB 4PJBB 2AGJH 2Q5BA 3P73B 5E4OA 4P2OA 4M5TA 1R5IA 1G0XA 2FLRT 3TN0B 1NPUA 2DDQL 3NCYP 4NC0B 1CLOH 1RUPL 2A77H 2CSPA 1HINH 2VDNB 1THAA 2WKLA 3BAKA 5B39B 4NZUH 3PHQA 3SE8L 5MENA 5EZPA 1RPQA 1P4BH 3OAYK 3U1SH 4KFZC 1LNUB 4G3YH 4GT0A 1Z5LA 2G5BA 1A2YA 1A7NL 1BSIA 4AYID 4DWHA 2OMYA 4KWUA 3UJTL 3L45A 5I17B 2JELL 1SN0A 1OE1A 4TUKH 4XPBL 3OSVA 4LSSH 1FAIH 1IV8A 1B0RB 5CU9A 2ZXEB 4NLHA 5HI5C 4UIMA 3HG0A 1DVSA 1PVHA 1KN2H 3HC3H 4MMXA 5IVXA 3KZ8A 1RJZB 3ARBA 4DN3H 1S9VB 3DVIA 4P2AA 1HXMB 3AJ7A 2VLLB 4KKCC 4GUQA 3SY6A 5CLTA 1PFOA 2GABA 3F7QA 4FCHA 2P1YA 3VE0A 1RK7A 2HT2D 4Z7VF 4Z7OE 2CGYA 4TSBL 4IRSB 1UZ8B 1MZYA 1LEIB 4L8BA 1S78D 1R9FA 4G6JL 4KI5E 4GMTL 4MNGB 3GNML 5J11C 4KRNA 4WKZA 2IANB 5HHXL 4ZAKA 5J12C 5CR8A 3QEQB 5FA4B 3FFCA 2Y4SA 4YMPA 2EEXA 2NY2B 1JG9A 5IWLC 2BOCA 4I48A 5I6NA 2APVA 2RAMA 4IBYA 3FO1A 5F3FA 4GAYB 2Z91A 2GY7B 3GJEA 4MA8L 3GHEL 4K5MA 4WWPA 1IL1B 3F5WA 4PTTA 1F18A 4ZUTA 3SE3C 1K6QH 1M1XB 2IGFL 4JFDA 1F6AA 4UDTA 4BQ8A 2X4SA 5LHDA 5HHMB 2DB8A 4R7DB 1WA2X 4PJGA 3DURB 4B9ZA 4D8OA 4HCFA 3B4NA 3DVGB 3IETB 2B08A 3OKKA 2ADIA 1RIHL 1IEBA 3N40F 3PQYD 2N0MA 2P8PB 3APDA 4NRYB 4PJ5A 1P5VA 2F19H 5FHBL 5HXMA 2YA2A 3IJSB 4F7MA 1WFJA 2J56A 2LU7A 2PPFA 2Z92A 4LOUC 4RAHA 4N68A 5D7KE 5IVOA 3GBMH 5MI0B 4K8RL 4AWJC 3GUTA 3B8YA 4CN1A 1J7VR 4G7YH 4HJ0D 4KC3B 1CWVA 2VZOA 3JWOL 3OB0H 4NENB 5H8DA 4JFSA 2J8UA 4AKQA 4FFYH 2NCEA 4K5NA 4BSWA 5L2KB 4EI5A 4MJIA 3AREC 2DLTA 1TQVA 4A7SA 4YL4A 2F5AH 2FBOJ 2JJTC 1UA6H 2BNRA 5AALA 3FHAA 3KYNA 3S2CA 1G6RA 3MRRB 3WDIA 4BK4A 5JR1L 1XGPA 3U1QA 1N0XH 4HG4K 4DPCX 4NWTH 5CSGA 1KXQE 1JPGA 1NCCH 1HHGA 4G83A 3R19A 1JTOA 5HI4C 1QRND 3T5WA 4WFFD 3TVMA 4XPGH 2Y36L 2L0DA 1A47A 4KAQL 3AADB 5AVXB 3ZXAC 2ESVE 2FWOB 3K0YA 1ND0B 1KMGA 1AO7E 4PS4H 3WFDL 2EXYC 1B9KA 1H3UA 4ZO9A 1OAQL 2MCG1 4UDUB 5EUOF 5FDWB 2Q7AA 4BK5C 4CU8A 4PRIA 3VFUA 3LKOB 4KO6A 1SZNA 4M1DL 5DO2C 5HI5D 1GOGA 1XGQA 2AMGA 2VJXA 2VM4A 1TQCB 3B7SA 3LN5B 4O02A 1ZLUK 1P69B 1QEWB 3PWVB 1HZLA 5IEHB 3MR9B 4GS7C 1E4WH 2CHNA 4F2FA 2L7UA 3MRQB 2CU9A 4XCFL 4KKCD 4FQXC 5E56A 4QXUH 4FEMA 3FPXA 5ALCH 4QRUB 2YD5A 1XTMA 1X9UA 3QG6B 4PJ6A 3IE4A 3VQMA 3CZKA 2XOTA 1K4DB 2XYCA 3HS9A 3V6FA 3E9UA 3Q5TA 2BSDA 4YHML 3RY5A 1QA9B 3BPCB 3BVNA 1HXKA 3JWOC 2NSXA 4FTVE 1P4UA 3MUHL 1DQMH 4F37K 4MA7H 1HH9A 1MW2A 4HS3B 5LQBH 4I9WD 4FHJA 1MQKH 4KPHH 4KUCF 5DEGA 3X1GA 1M7UA 2FE0A 3RIAF 4F58H 1Y6KR 5JHLL 4LEEA 3GSWA 3MLUH 2J72A 4X9YA 3WEXA 3WDJA 5F89B 2CDEA 1TEYA 4ODHL 3UBFA 5ERWA 1YY8A 3V7AE 4EI0A 5GS3A 3MRGA 1K9TA 3KEDA 5EBWA 3FSOA 2HG5B 3OKDB 1EEZB 1ZSDB 5FO8A 2DBLL 3HI5L 2AK4B 4S11A 4EN2A 5BV7B 3SKNA 3WIHA 2ZJSH 2R83A 1S2EA 1CMOA 1GGYA 3NIFF 4GW1B 3ZR5A 4LOUD 1BMGA 1EXUB 2CDGB 4P59L 1HI6A 4XBMA 1A7RH 4FXGA 5F7WC 4EE2A 1A6PA 1DSFL 3ARED 4OV6F 5IW1B 2Y1AA 3FTSA 3DGGA 2XPGA 1F6FB 4XB8A 4RZCB 2G75B 1IGFL 1F4WL 2P5ED 4AYFB 5J7CC 1JHLH 2X87A 2HYMA 2YZ8A 3OHXB 1P9MA 1OLZA 4B9GA 4Z7VB 1JZ7A 2B0SL 2OTWB 4EN3B 1RZ8B 1KT2B 1L9PA 1JVLA 4XE5B 3WD5L 1K5NA 2ZOTA 4PP1C 5HI4D 3VI3E 1NCOA 1HCVA 2CJUL 2Z1KA 4DGVL 4F8PA 4A2HA 1WAAF 4G5ZH 1X4YA 2BP0A 4URTB 1HL9A 4FLRA 4RMBA 3RDTA 4LSTL 3VXOA 5DGRA 4MD4B 3NQIA 4LK4A 5JW4M 4TVPL 1BQHG 4M7JH 4NWUL 1KIPB 2EXYD 4JB9L 4NAJA 4OCWH 2VZVA 1Z5YD 3BAYA 1UUSA 3II1A 4HWNA 1QW8A 2UWEF 3C2AL 4G8IB 5I23A 2JIXA 4QAMB 3MUGB 3P3UA 2F7OA 1BQHA 4C55A 1JZGA 3FCSB 5ESAB 5DO2D 1QFWM 1QG3A 3FRUB 4S2SA 5DK0A 5JW3L 1NDMA 4J3OG 3V6OA 3PYCA 1IBGH 1RJCA 1BF2A 1JF5A 4ODBD 4OKVB 3EYUH 4GBXA 3SPIA 4BZ2L 2AK1L 3LPOA 1CFNB 4DQOL 5BQ7A 1T0NA 2DQJL 4PUBH 3JZYA 5ESQA 4FQXD 1UKQA 4IOFC 4NQQA 1KEML 2JKJA 4BH7B 2A6JA 4JK0D 4JPIA 3EO9H 2VB5A 4D0BB 3ZZ1A 2IADB 5G5DB 1J1OL 3IT8D 3TLRA 5C08E 1TETH 3J07A 4DK6A 5D7LD 5FKPB 3EW3B 3TPUA 1MUJB 1T04B 3OQ3B 4RAUB 2EYRB 1PGRB 4UOQA 4OBSA 3TA3A 5CSBA 1IIIA 3RTQC 4KXZH 3Q2VA 4JDVB 2J4WH 3BJLA 2J20A 4LLYB 3NCFB 4BH8A 2OSYA 5EO1A 4CGUB 3LN9A 4Y5VB 2XVLA 1A9VA 1NAKL 2F1BA 3TH3T 4ZX3A 5I28A 4I0CC 2Q7NA 2C9XA 4JG9A 1BGXL 3JTBA 1KWGA 2NXZC 1RK0B 4QRAA 1GZHA 3U6XS 3CGTA 1RUPH 3B2VL 1FSKC 4JN1H 4EMZA 3SE8H 5F1NA 1MI5E 4B7IA 2QMJA 5KTEL 5HYSG 2WMPA 1Q9WA 1UB5A 1YNTA 5A40E 1A7NH 1B4LA 4UM8A 4UQAA 4MNHB 1I8IA 4GEJA 2VR7A 4MCYA 5EZIH 4ZW7A 3VD0A 3BMVA 1Z7JA 4XPBH 1BF5A 1FGVL 1ZV9A 4FFWC 3KJ6H 1WTGT 2XTJC 1VZIA 2AANA 4PJ8C 5J1SC 2MPAL 4Z0XA 3BVVA 5HGBA 4PW3A 1C12A 4WKXA 4C58B 5H37H 3LIZA 3L6FA 3T2QA 4XNUL 2ICEA 1NLDL 4ORGA 3T6QC 2OA9A 1YN6B 5LWYH 4FYQA 4BK8A 2FB4L 3LNHA 4E41E 4FKEA 4KMQA 4G6KL 1KYUA 3BSZL 4GW5B 1Q9OA 4UU9A 4Y8AA 1YCSA 5F9JA 3S37X 1OSYA 1KCSL 2EDHA 3K8MA 4GP8B 3VDBA 4G6JH 5JW5A 2J55A 1F0LA 2V5MA 4QPEA 3U6RB 3NTCH 3GNMH 2Q20A 4JHUA 1IEAA 5DVLA 3P3TA 4IU3A 1TVBB 2D7TL 4PTUA 4RFEB 4FADA 2BHZA 4ZAKB 2WUCL 3ULSB 4PP1D 3FFCB 5EBLA 2LLNA 1JPSL 2G3MA 3GRBA 3QYMA 3EXJA 4X9FA 3LD8B 4BQ6A 2CCWA 2OSXA 2I07B 2QQLL 1Q9LA 3LMJL 4PIBA 3BFOA 1JVKA 3LH8A 1EHAA 4GI9A 3D69B 4PJXE 2DEWX 2QV2A 3BO8A 2X4SB 4FAAB 2P8MB 1BVKA 4J12A 4XRCA 4AZ8A 4PJGB 1UD3A 1KB3A 4RDQG 1LQBC 3D8MA 3K91A 1D9KC 5FHBH 5ISZD 4IGBA 2KI6A 5K1NA 1YYLL 2UVFA 5EZOL 2UUDH 3F65A 1FO0A 1P5VB 4X7TA 5F96H 5IVNA 1GAFH 2J5LB 2AJSL 2CLRA 2VKXA 2ICWB 4U6YB 3LNEA 4K8RH 4IOFD 3IGAA 3T0DA 5ETUB 3BKML 4W9IC 5T5FA 5DWPA 1MJ8H 2PWFA 4OFVA 4B41A 1ZIAA 5FLVA 1PLGH 1CK0L 3NIFB 4FQCL 1HZHH 5SWQA 4MJIB 5KBMA 2V2TB 3S6CA 4FXKB 3IF1A 5I8EA 5F97E 4HC1L 3SBWC 3RTQD 5D4HA 3AU1A 4RBPK 5DS2A 3PHOA 4TLSA 4J4PC 4AM0Q 1R3JA 1WAPA 2W60B 3IPFA 2BZ7A 2GK0A 1W2KT 5HPOA 2DMCA 2BOBB 1XGPB 4HSAC 3G6DH 1L9OA 1GZPB 5FAAA 3RNQA 2AXWA 1EPFA 2X89A 3CFKB 3KPOB 2NXZD 3L3OA 4LVEA 5HHOA 3EBGA 5IVZA 3EDJA 2Y36H 5DO8A 3MRNA 2W9EL 1BZ9B 2FGWL 4IRJC 2NR6A 4PV8A 1C5DB 1TYRA 4C54A 3CFNA 5BO1H 3CBRA 2APBA 1FG2A 1N64L 2DYSB 1OAQH 3P4OB 3U30B 2BWIA 4TUUA 1OHZA 3M1BB 5AENA 2CLVA 4L9DA 4FFWD 3K4ZA 2XTJD 2C7UA 2WLHA 1BVLA 4PRIB 3UZEA 5I5MA 1JZ3A 2A6DA 2PCPA 4PJ8D 1KGIA 4AENB 4S1RL 4TVPD 4YDIL 4K3JH 3GXPA 2QQQA 1H15B 2AQRA 3KDMA 4B5EA 4LRNH 4O02B 5CD5C 2A9NH 1A7OL 3O4LE 4GG8B 4TLUA 5CEZE 5D9SB 2GCYA 4XCFH 2R29L 4HKBA 4OGXL 1JV2B 3PGCB 3ZHFA 4RMVA 1AYOA 3V4VL 4WUKH 3N50A 5E5LA 2EVHA 2CGRL 5CGBA 1E3ZA 4ZODA 3NEEA 4HU8A 3F85A 4ZTPL 3VFRB 3ZDXE 3EGDA 3IKKA 2EECA 1MAMH 1ZDSA 4N5UA 2ADYA 3CTTA 2Z8SA 1OAYL 3WYRA 4L8SA 3BVNB 3QNXB 4K23H 2YPLE 4K3DL 4PB0L 3RI5K 4FQJL 2ORBH 4Z7OF 5LAXA 3T6ZA 1X5ZA 4YAQB 2W59A 4YHOL 1WZ1L 2YD1A 3I9AA 4KI5F 3W5MA 1N5AB 2X10A 3U4EB 2ITDB 5KJRL 5T1KD 2NY3B 5DEGB 1AS8A 3UJIL 3UTPD 5E1QA 5AB9A 4Q97A 3L1OH 2JJUA 3ARZA 1FVCA 4HZ1A 4K94H 3MLVH 4YEFA 3ECQA 5TFSH 1T03H 4ZFZB 1KJ3L 2Q86A 4ODHH 1FIGL 1UFGA 5J13C 5I5RA 5BS0B 3DX8B 4FI7A 4ODSL 4QDGA 4JM2F 1QLFB 5KBLA 2MKWA 1DTUA 4RDQF 4GQPH 4HK0B 1D9KD 2NY5L 3LXUX 4CVZA 3LVEA 3LN4A 4XBPB 1DJYA 5E5MA 4YHYB 5CCKH 1X7QA 3DO3A 1MRDH 3D5OF 2Y06L 4XMTA 5FECB 5FO8B 3TURA 4FZEH 2CGZA 5F3BA 3MROB 3WELA 5LGJA 3QWOA 2ZOKB 3MNVB 3MAWA 2Y7LA 4FNLH 4ZW8A 1MFVA 3V5DA 5JHBA 1MWAA 4WCYH 3LXAA 4PD4J 2CCVA 3FUHA 2BINA 5FWQA 3ILQC 4KFMA 4JFEA 3HS0B 3QRGH 4UCFA 3ML8A 3GEFA 3UYOD 1ZHKA 5J0BA 1IGFH 2FJSA 2IALA 4J4PD 4OD1L 4DCQB 2VXVL 4LPVA 1RU9L 2VDOL 2KERA 3EYOB 1TDQA 3KM1A 5AVVB 5JORB 1SQ2N 1JXFA 1MREL 2RTTA 4TUOB 3VVWA 3WD5H 3ZTDC 4KNTA 1FZKB 3FDWA 3US9A 1TITA 4L1HA 2E6PA 3GXUB 3V0AC 4B53A 1K5NB 2B16A 4PRNB 3N41F 3VCLB 4EZMA 4IRJD 4PP2B 4NO2A 5C6PB 4Y16C 2PYEA 3P4LA 3GDBA 3PAVA 2AJXL 4MSWA 4ALAH 4PCTA 4HCRL 5FYLL 3GSXA 3WKQA 4PRHD 5AW8B 2COVD 1FG9C 3WFEH 1GCFA 1G7IA 2PLTA 2EDFA 4IIQB 3BW9B 1NC4B 1WFMA 2R23B 2OMTA 1DVUA 1G9MC 4F7EB 2LU3A 2H3XC 2NQ3A 2JK5B 4ZI8A 2LFEA 1FI8C 3HVNA 3ZMNA 3ARXA 4WWKB 4S2SB 4ZO7A 1NDMB 3GTTA 4BYHA 1I3UA 4C83B 4Y9EA 1CDUA 5CD5D 2Y24A 4DQOH 1NMBL 2DQJH 1NCDH 4UM9D 5EOCL 1BFOA 1P1ZA 2ICWJ 5D7IE 5A2JH 2EYTA 1SY6H 1MHPL 1WBYA 3W37A 2WINB 2ADJB 5F6IC 3N04A 1O6VA 3FU7A 3P11L 3S88H 2F61A 3AM8A 1INEL 4NJ9L 3VXNA 5GZNA 3PQYE 3BVWA 2YN5A 2MNUA 2KQMA 4N2IA 2V7NB 4Y88A 5ANHA 4KZDL 4LDCA 15C8L 4NJAL 2DQUL 4A04A 3VWJB 1M7DA 1LEGB 5LKNA 2XY2A 2WCSA 4FZ8H 3HNVL 5E6IA 1JHKL 3OMIB 1ETZB 4MJ6A 4XCNA 5IJVA 3SOBH 1J18A 1DQTA 1PNDA 5T5NG 1G7MA 4JFQA 1T7VA 2H3KA 3BKCL 2Z34A 5B7EA 2H3NB 4AH2B 3ARYA 4FYTA 5CJBA 3ZGIA 2EUXA 2XQYK 1NOLA 4MCYB 3TBYB 1J11A 3N1QC 5HYSB 1HTYA 4Z7QE 1TSRA 4EO5A 2MPAH 4O9HH 1DJXA 1QRNE 2LR4A 1MEXL 1LM8V 1U8LA 1XAUA 2EIDA 2IXQA 3FBKA 4WFFE 4L1TA 4YSDA 1DJWA 2QPFA 4WU7B 2UY7A 2VDKL 3F3HA 4ETQA 4L05A 4FNRA 4LDEB 4X0NA 4XNUH 5I30L 3WJLC 1CR9L 4DT2A 3CVBA 4AM0A 5JOPD 2MMXA 2JLPA 3PL6C 3RX7A 3SCMA 2VH5H 2GSGB 4FQIL 3OKLA 1FDLH 1UB6B 1WYJA 3BHBA 3GYRA 3OZKA 3GT6A 4J3WA 3ILQD 3ZTNL 1F45A 1EMTL 1XT5A 4GW4A 5JHMA 3CH1A 1SJMA 5DMIH 4ZYKA 3X13A 2HT3C 1NCBL 4ZS6C 3S97C 2D7TH 3KYKH 1JDAA 4XP1H 1ZHLB 4AQOA 1INDL 4PTUB 2OCCB 4B60A 2EZ0C 1OAXH 1P7HL 2Z31B 3FQNA 5DUJA 3QJHB 4JRYE 3T8VA 4Y16D 1D6VH 1RZJL 4I2XA 1UT2A 2P5WD 3IKCB 4YBLC 2ROXA 3DRTA 3RX8A 3ARSA 3MNWB 4ADGA 4P5SA 4AKPA 1TJIH 4HH9B 2OXHA 1W8EA 1AIFB 1R34A 3VI3F 4UT7H 5FV2A 2NY1B 3N3EA 3BISA 3N42F 1FJ1B 5ICYB 4CUCA 2DQIL 3BAJA 2PCYA 2Y22A 4NNYB 5L9DL 5DZPA 4ODWA 3BO8B 3QCVL 2Z35A 1VFBA 2F8VA 3NSFA 1KBGH 1OD7A 5D2NC 3KL0A 3H53A 2ATAA 4JG1H 1F1GA 4PCSA 4JM2B 1KTDB 2XWXA 4HYTB 3QDJA 5TE4H 1HU8A 3G9AB 3VNYA 2QHLA 4AQZA 4D7BA 5ID0A 2GJJA 1TVHA 2VUYA 5GGTL 1E7VA 3O6KH 4JO8A 4M3KB 1XGRA 1NSNL 3FN0H 2Y7QB 3CQQA 1R24A 3WTVA 1Z3RA 4HWBA 4ONFH 4NCC2 3UBXI 4ZOBA 5IIEB 3C6SB 5SWQB 1R19A 3IF1B 3VMNA 4Z7WE 3N1GC 3TBSB 1JWMB 5CGYC 3KPMB 2VJ8A 2IH1A 2R4RL 1OGPA 3FZUC 3BZEB 3GIVB 3X2QB 1E5BA 1X5IA 4AGLA 2AVGA 3H0TA 4BHUA 3HG4A 1BZ7A 1Z0NA 2GJPA 5DJAB 3L3OB 1XMEB 3CXDL 5IVZB 1F4YL 3P2DA 2K8QA 3B5GA 1I7UB 3BZFA 2QQNL 3DTXA 1HCFX 2K70A 1N64H 4KXAA 2GSIB 4IEFA 1GS7A 4M8QA 2P5EE 3N41B 2VAJA 3OL2A 4NN7C 1IGYB 3SO3B 2F54A 4QRRA 4LRIA 4FHBD 1I1CA 2E7CA 4I13B 5M94B 4MJ5A 3FRPA 4O2CB 4UT9A 3O45B 3CK0H 2B4CL 3LKNA 5J9PA 2HN7A 5EN3A 3KDMB 1F13A 5DJ6A 3APNA 4EI6A 1GKOA 3Q6FA 2ESVB 2GCYB 5ECGA 3SPJA 1AO7B 3PL6D 2P8LB 3FTUA 3NJMA 4XO3A 4LEXH 2ZCZA 5B38G 3OC5A 4E42B 4KV5E 5I71C 1XQ4A 3FT9A 3BIAX 4I3RH 1XCQA 5G55A 3HOGA 4ZPTA 5A16A 1QPPA 1HL4A 2PP9A 5SWZE 1NC2D 2HT3D 4ZUWB 1FFQA 1OAYH 3GSUA 4ZS6D 2OXGA 4IMKA 4JRWA 3AU0A 4LSUL 2NUTB 4PJCA 1BD2E 2FEJA 4HOMA 2EZ0D 4AK1A 2O6DA 3NCMA 1PIFA 4PWJA 5B1JA 5JIHA 1BM7A 4DVBB 2H1PH 3EBAA 3S36H 4UQEA 5CLYA 3UJIH 5KYWB 5AB1A 1H6FA 4IYKA 5F7DA 3D3VD 3IYLW 3V0EA 4N8CL 3M17B 4DP1X 1T1YA 2FVNA 1GSMA 4JGJA 1CDIA 3MZGB 4H40A 1H3XA 4QMEA 2NY4B 4B9FA 1J8SA 1C1EL 1NOFA 4AEHL 4J2XA 3HZMA 1BOGA 4FTVB 2BNUA 3FYEB 1J8RA 2MHAB 1IKNA 1RLWA 3U9PL 1BQSA 3KXFD 4QY8B 2XN9A 4JPQA 4XX1E 5A2CA 1HKLL 4GAGL 4TOYL 4XNMB 2YSTA 1CIUA 5DZJA 1S5HA 1X7QB 1S7VB 4OJDH 4I9XA 3WN5C 2V3EA 4WLCA 4CA4A 2Y5QA 4P9MH 3FQRB 3MV9A 1SJHA 1YYCA 2G0KA 2YO3A 4IU2B 4Y4FA 4DH2A 2IDQA 4BDVB 1A6VL 5I6LA 1WA0X 3T0AA 1HCZA 5KYYA 2ZOOA 3MV7D 2IFFL 1X3DA 1PF3A 5FXCH 2JJSC 3GBEA 4JFEB 5E8OB 5CGYD 1RU9H 2VDOH 3RIFF 1I9EA 5DJDA 2JMRA 3FCUB 1U8QA 1J0KA 3L5WB 1KFAL 1IE5A 1LGVA 3FZUD 3OAYH 1H8LA 1GGCL 4LSVL 2Q3ZA 4H20H 1IJ9A 1O9ZA 1R3LA 5EC1A 5JHDA 3JXAA 2VDQL 3OAUL 1FFOB 2AEQL 4MB4A 5PCYA 3BPOC 2J44A 2VLKD 4LCIH 4ONHA 4HH8A 3LS5L 2XY1A 4Y1TA 1N70A 2OK0L 1NIFA 1INQB 2OJEB 2B20A 3GSXB 4B95C 2ZQKA 5DK2B 4JCMA 4DGWC 1J10A 1E6JH 2WOBA 1R3KA 2CIKB 2WXNA 1I9IH 1XBDA 4XO4A 4ELMA 4P2RA 4EPSA 1G7IB 5C3IA 4OCSL 3WNLA 4W9DC 2H32A 4WFED 5TQ2L 1RVFL 1C5CH 1MXGA 2GPZA 3CDGB 4LL4A 4WUUE 3VI3B 2BW4A 1JFQH 4OAWA 4OUUA 4ANVA 5JOFA 3N42B 1N0LA 5I8CA 1NMBH 4HUVB 2CE6A 3APFA 1BJ1J 1AE6L 4R90L 5BVPL 3PPSA 4JFFD 4RMUA 5KN5B 2ZUXA 5DUMH 1I8LC 3MJ7B 3PRZA 3PIQA 2DH3A 1RUAH 3GZOA 2J8HA 2IMNA 2AAVA 3FW6A 1WBYB 1KJMB 4I0PC 2HLAB 3P11H 4X42A 3TEYA 5I73B 5GGQH 1E65A 2N59A 5ISZE 2OAAA 1SEQH 1VJSA 1ZV2A 2J25A 1P4LB 3I6LD 4ABWA 3BVTA 3HI1A 4LCCB 3SJVA 1IFHL 1RSYA 2R2HB 3QUML 1ORSA 1ZY9A 3WE1A 3LRGA 3OKOA 3LZFL 3M8OH 1EK3A 3ZDXF 1H5BC 4HUMB 3IWVA 4P5MB 5E6IB 5JQ6L 2A7BA 2IAMB 4G8GE 4TXVB 4MS6A 1Z2KA 4NPKA 4NP9A 3VDAA 4DZ8B 4G6MH 3IU3B 1O7VA 4ICWA 3B7RL 5C08B 1G7MB 4TVUA 3WNPA 1QOKA 1W72B 2GJRA 1U3JA 1WWAX 4DESA 5KVDH 1OPOA 2R8SH 1CTNA 2JQZA 1MZZA 4DZBA 4HEMA 3FT3B 3GHPA 2KYIA 5AOJA 4H1LB 1WV7T 2Y07L 1EAPB 3CLEL 3QJZA 1RV6X 1KYOJ 3NZUA 4I7ZC 5ANMA 5DHVB 4HIIA 1U3YA 1T5WB 1MEXH 2J73A 4CC4A 1E9OB 2P7TA 5TE6L 3VA2C 1DFBL 4OLEA 4KK9C 1EA9C 2VDKH 5I8KH 1U8LB 1W80A 1KB5B 1VFAA 1G4MA 1WSST 3FK3A 2G5RA 2GEEA 2QLVB 4TNGA 2WQSA 2BFVH 1MI5B 1SYVA 5LBVA 1QWUA 2DKUA 4GEIA 4LVNB 2BVYA 3LKQA 1IAIH 4FQIH 3HE6C 4PJHA 1B88A 3ETBF 3SCMB 4F2ME 1Z5HA 4DFHA 3ZTNH 3WTWA 2YRBA 2DWYA 1O6SA 4KTDH 5DMGC 4YE0A 5E7BA 4Y9CA 3U9WA 4AT6A 3FO2B 1XH0A 5E24E 1R5WB 3N06B 3JTSA 3NAAH 3UTTE 4CN6A 4AE0A 3K2MC 4L5FL 4MAYA 1NCBH 1ORQA 3NCCB 4Q7DA 4RH4A 4M8VA 4L48A 1E28B 3X13B 3E0GA 1TU2A 3ARDB 2Q6WB 3EFFB 2JJVA 4WI9A 4IIZA 2UV3A 2NNXA 3SDAA 1A3ZA 4DO4A 4EKXA 5JHAA 4YHKL 3ZE1E 1M7IB 2OMBA 1TFHA 2ZKWA 1C9SA 2JKTM 1G0YR 1NDTA 4E41B 1RZJH 5AYTA 4ELMF 3GFUA 4RAVA 3CSTA 2BDNL 4JHWL 2DWXA 4I2XB 4URKA 1KCRH 2ZSWB 5DTFA 4LQFL 1YEJL 2A74C 2QVFB 4S1QL 4ELKA 5KVGL 1UVQB 3H7BB 4P3CH 3RWJB 5L9DH 3QZWA 3V0DA 5CZVH 3BH8B 1MCBA 1TZGL 1ZE3H 3GMPB 3K1DA 4GRLC 4UQDA 3OJ2C 3GXTA 1F00I 3QR2A 1DBJH 2ZNWA 3DARA 2FO8A 4QXGL 3QFDA 1I1AA 1YN7A 3L4CA 4QHKI 5AKTA 3MOQA 1U8NB 3Q43A 3Q6GL 2BSRB 4G9FA 4JM4L 3C5ZA 3OKMB 4PR5B 4EDXB 1VFBB 3UTPE 2VSDA 3B8SA 3MUZ1 3TIEB 4S10A 3ZRSA 2WQWA 4OF8A 3JBG7 4TPRH 5ID0B 3TNMB 1UJ3C 4A55A 1HX0A 1Z9NA 1XGRB 4I0PD 1OCZB 2ZPKL 3OMZA 2FT6A 1R24B 4NT6A 3KLHC 2X09A 1NJ9B 1YDPA 1AP2A 3D05A 4R4BA 1UURA 4ETYA 4O2FA 2HRPL 5EG6C 2R4RH 2GSMB 3QQXA 3NJIA 5I0YA 5I1EL 3IXTA 3FQUA 2VDPL 1HN1A 5T1LB 1DL7H 3WKPA 3MFGB 2G2PA 3QDMD 4WTQA 1UWEH 5FKAB 1G1KA 4WTZA 1X44A 1KBPA 3DTXB 2BXZA 1JNLL 3EO1B 5I76B 3IDNA 4LSPH 4YJZL 3VI4A 2G4EA 1SDDB 2VAAA 4S0TD 4W9CC 5D2LE 4K3EL 3PP4L 2O5YL 4OM0H 4NCDA 1B0GA 4UIKH 4KK9D 4XBGB 4F15C 2A4CA 3WLBB 3IN2A 1IGTB 4X4YA 4F91B 4AYSA 2PXYB 3HC4L 5ABDE 4PRHE 1T83C 2G9HA 2FQFA 3NJFA 4DPAX 2C3VB 3AWGA 1E6OL 4RMRA 1O0VA 2B3RA 3HE6D 5SX5K 1P4IH 4X98A 4N5EC 2BVPB 1JD9A 2GAZB 2VDML 4JUTA 3T77B 1QI5A 4QHNB 4PJDE 5DMGD 5J6SA 1SBSL 4QCIA 1JXJA 1ZT1B 4YVNA 1DANU 1T6WA 2AXFA 1RH8A 2F8IA 3FQTB 3O9WA 4MYWB 5B38B 2PTUA 5JUEL 5IV2A 4POYA 3QCUL 1IAKA 1RERA 3F04A 4LSUH 5H2BA 3O4LB 4X83A 4XO9A 3ARQA 4HWEH 1JZIA 3FB5B 3KPQB 1ZWIB 2V8MA 2AJYL 2XZCH 5FCUH 3MDJA 2IH8A 2H9GA 1W8OA 2BWDA 4IRZL 3MLZL 4NXKA 3N43F 2D31A 5AAPA 2JE8A 3ZDXB 3K72A 4KH2A 5DF0A 1HE7A 4MBRA 2F5BH 3TF4A 4LLMA 3WS6A 5GGSY 1AVAA 1U8CB 2BRRL 3IMVA 5FM8A 4DVRH 1JF1A 4AEHH 3C5SA 4GRLD 2W9LA 2CMRL 2X1WL 4L1DA 1QAWA 2EDEA 4J3TA 2Q8BH 3UACA 4GAGH 4UTBA 1XF3A 4G43A 1ZXQA 1LHZA 5IJBC 1OW0A 1WWBX 3A4AA 1RD6A 2F1EA 5I15H 2B3IA 2HKFL 5T3ZH 3PAUA 2B14A 4HIJB 3UCQA 1LD9A 2CK0L 4N6RB 4IKKA 4X7EC 4Z95L 5TGBB 3T2PA 2DWTA 2HZHA 1WF5A 2CUMA 3BDXA 3BC9A 2IFFH 2WXQA 1MIEL 1XWVA 3U4KA 1AJ7H 5ADOH 1X5LA 3KLHD 4AJVA 4W6XB 5IHWA 2HA1A 3PXHA 4QIRA 4PRAB 4WI0A 3MRHB 4AVJA 3ARRA 2BVQB 3QCTL 1MAKA 4R7NB 4HAGA 2FDBP 5I1LB 5A3IC 5ICZA 4LSVH 2WUBH 5CCHE 2CIIB 5JPMB 1TMQA 1HEZA 5JOPE 2NQCA 5KYUA 2AEQH 4Z7WF 3MXWL 5JHDB 1KPRA 1U3HB 3AS3A 3H1ZA 3LS5H 4HF5L 4PLJC 4G59C 4GQ9L 5DZVA 1DSWA 4YE4L 3O2VH 2YD3A 2YD4A 4HKZA 2OS7A 4OLYL 2AI0L 4BM7A 4ELMB 4MRCA 2VSKB 3QI9B 4JO3L 4KQ3H 4P2RB 1EJOL 4OCSH 3NFPA 4G8FA 4F24A 1P5UC 5DS8B 2X6UA 1U8KB 1XL6A 1H3VA 2H32B 2ZUQB 3QIBA 4J39A 1DCLA 2ARJQ 3PWNB 4JY4A 4MMYA 4FA6A 3QUZA 1LO2H 4NLAA 1U36A 2P5WE 1JPEA 4CN4A 4F8TA 5F88A 1AKJD 2OLDA 3HRPA 4YXKH 1FHGA 2K45A 2GHWB 3DXAA 2OBGA 3NRFA 4N5ED 4OFYD 1G6RH 2IWFA 4MHHG 2K78A 2KPNA 3DO7A 5A2KH 2JI1A 2A83B 5D7JD 4PREB 5KANG 2AV1A 4QUOA 1JPTH 2NXYB 2VSMB 2DJUA 1S7SB 2MNJB 5C09A 3VRJA 4D0CA 1XAKA 2O5ZL 1L7IL 4XH2A 4HPHA 1PNCA 4XNYL 3ROLA 4C57C 5CFHA 5KVFE 2K4WA 5C2UB 3VGGA 3QXVA 4YHIA 3WIAA 3C5JA 5LGHL 1XGZA 5AQ0A 1VAHA 2LTQB 4ZUVA 3HMXA 1VACA 5FEBA 4APQC 1G7HA 3K2KA 5EU3B 3QEUB 3IMWA 3NA9L 1IQWH 3DI2B 4YGAB 4WTWA 3INUL 4NZ8A 3IGLA 3DX6B 3VGEA 3OG4B 1OF2A 2WBJA 4JFOA 4OGYH 4UTAL 2YUVA 3QJFA 5ILTH 4YFLI 4XZUB 3IDXL 2Y3NA 1A6TA 4HIIB 5MERB 2YUXA 5HBBA 1UH3A 4Z3FA 1UYWH 4HDIB 4EXPX 3V0VB 3II3A 3IPBA 1U21A 5J6GB 2A0LC 2CR3A 4QKTA 3V4PA 3RFZC 1PZSA 5CXPA 3HVDA 3CDCA 3M46A 4HCIA 5FUZL 4AIZB 2HMIC 3OKYA 5B8CC 3IK2A 5I16B 3C9NA 3L4ZA 3X3GH 4AQ8C 4WNQA 3WU1A 4D9LL 3TM6A 5A1AA 3QO0B 3HZKA 4PJFF 2P24B 4PJHB 4DKEH 3D39D 1NEZG 3NDZE 2AQNA 5F7EL 1O6SB 2YK1H 1J8HE 4OI9A 3WFHA 4AT6B 4L5FH 1QP1A 1QRNB 4PJAE 1NEZA 2CZNA 5ACMA 3T04D 1GJIA 1IC5H 4MAYB 3BVXA 5A3ID 3L3KB 2X9WA 2VRQA 5T1DH 4W9HC 4AGOA 3N1FC 4BKTC 2J71A 3ZMRA 4PLJD 4DKFL 4ORZC 4XOAA 1WCQA 1RZGB 1U8MB 5FM4A 5LJYH 1S7WA 2RH0A 5AYQA 5DTFB 2APSA 3QDAA 4NKOB 3MJ6A 4NUGL 4MLSA 4ELKB 4ZTOL 1QSED 1R3HA 3Q2LA 3LYRA 3WIHH 1TZGH 1HYRC 4EIBA 2I9LB 4HBCH 3N43B 1E9PA 3F58L 3LKRB 4JZNA 4BWTA 4UNIA 3O81A 3FU6A 3UMNA 1XZ0B 1KTLB 4JM4H 3CHRA 4P48A 1JNNL 4Z7IA 4JRYB 3V0FA 3D3VE 4JDZA 5DD5L 3CFCH 1OGAE 4ZPVA 4ZBJA 1JHTB 1XXFC 5IFJB 1A8JH 3P2TA 1ZS2A 4NBZB 1XR8B 3KGRA 5IHUL 2K9FB 3Q9PA 2Y6SC 3LHAA 3FUKA 5HGDB 2W80C 3AUWB 1IVLA 5J12B 5CINL 2Z3FA 3KWWA 3I6GB 1BXXA 2Q87A 3ARFC 3MBEA 1WHPA 4KZEH 3KXFE 4YIQA 5BOJA 3QIUA 2I9TA 4CSZA 1AP2B 3JV6A 3BYYA 4R4BB 3ETBJ 4IHBA 2CO6B 1FBIH 3CSPA 5D8JH 5GRWA 4ISVB 4L8DA 5DWUH 5I1EH 4YXHL 5JQHC 3KAAA 3TT3L 4JAMB 1EHXA 1MDAA 2X4NA 3BWSA 3FQUB 1W0WA 3FOMA 1ZVSB 1F58L 1IFRA 5F71A 3ZPDA 4ZZKA 4UNTA 3MV7E 4APQD 3R06A 3ILDA 3FONA 2BSTB 4JW3A 3QYNA 3SDDC 1NWOA 1MJJA 4H25B 3S98A 4GQZA 4Z7WB 2VLJA 4M5SA 3A24A 2FWUA 1ET7A 2XZAH 3F6JA 3P30H 4K3EH 3LH9A 2VAAB 1BP3B 3N44F 4IJTA 4J3OH 3QAQA 3UDWA 4QF1A 4OFIA 4W6YB 3UPRA 2E7LC 2VLKE 2A0LD 4ZMYA 3HC4H 1XB3A 3STLA 4X4YB 3BUYA 4M9OA 1A4KB 3UOAB 3G6AA 1VADB 4AV5A 1U2HA 3Q1SL 2NSMA 1ZLVH 4OTXL 1G84A 3U0WH 2P5EB 3AACA 4YDMA 4WV1C 1ZTXL 4GQQA 3GSNB 2WSDA 3NG5A 4WFEE 1S7QB 4KHTL 3VXMA 4GG6E 4PIRF 3B9KA 1O5DT 2CDFA 5EFIB 2YAFA 3KPPB 6TAAA 3ULVL 3S35H 1SMAA 1AHMA 1E2ZA 1D5IH 4WGWB 3N1MC 4NQCD 1KG0B 3C12A 7CGTA 3B2MA 1BDYA 3LNFA 3MJGX 5H2BB 1PG7X 4JFFE 4JQXA 4FHKA 3GF8A 3KNBB 5F7MC 3UG3A 5K93A 4PJ9C 5I1KL 4KUZL 3W0WA 3MLZH 1EFXD 1KXHA 1MNUL 1QATA 4HV8B 4N20A 4M48H 1WS8A 1OXYA 5IROC 1DLHB 1HHHA 2ARJA 2RCSL 3CVCA 4JDEA 4JKMA 1QPKA 1JZ5A 4Z9KB 2BRRH 5SWZB 1UWXH 1PKQB 2YEZB 3RWGB 3LIZH 5C9JA 3HN3A 3NRQA 1MCPL 4H5SA 4YX2L 4FCAA 1BD2B 1EDYA 5IBTL 3R8BB 2VWEC 2A6KB 1U95B 2IQAB 3WNNA 3NPSC 4HJUA 5FOJA 4FJ6A 3BOVA 2PYFB 3I75A 2VE6B 4JQVA 4QHPA 2WB7A 5T3XH 3CN0A 4JVPA 1FC1A 1MCRA 2DQFB 3LEVH 3SD2A 4MMZC 4UQIM 4XMPH 2B5IB 2Y6SD 4GH7B 4Y4KC 3SQOL 4AEFA 3PDOA 4Z95H 4ENEC 4G80A 4NO3A 1SRDA 1LD9B 2E0PA 1I7TB 2WLZA 3NOIA 4YDKH 1BWMA 1X5JA 3C8KB 3ARFD 3PPEA 5CSZB 3TYGL 4Z76A 3KYOA 4I18A 4DUXA 3O6LH 3S5ZA 1UT9A 4PJFB 1NICA 2M1KA 3S96B 4XN2A 2EVJA 4HPOH 1U33A 2I27N 5KS9E 2JKRM 1YEGL 2H1XA 4GAJH 4K5PA 4CAGA 1E40A 4PD4K 1HEZB 2VLME 1CN4A 1UADC 4XR8C 4F33A 2BX5A 3D06A 3HG1D 1DQLH 3MLTA 4D8PB 2DIAA 3D50A 3NN8A 4HF5H 4W93A 2X4PB 3DK0A 5BXFA 4KROB 1LQSR 3Q8EA 3LNDA 4IMLB 4KX8A 1K4CA 2XETA 4YE4H 2Z8WC 3SDDD 3V6ZB 4ELDA 4NHCL 3VX1A 4UWQB 1F4XH 4UQ2A 2OJZH 4Y4HC 5AVRB 2AI0H 1Y18A 5GSRB 1T89A 3DIFA 1FO0H 5DLML 2R7EA 4JO3H 3TTSA 1CB4A 1AQDA 2LGNA 1UZ6E 2AQPA 1CE6A 4NFCA 2XVGA 1WG3A 4X6EA 1WICA 3QR0A 5T5FH 2PPEA 3WE6B 4NQDD 5LDSA 4LMQE 2Y2YA 3IBEA 2GIXA 4FX5A 4MXWH 5F44A 3OV6A 3VXRD 5D2LF 4LLQA 3TCTA 1LO3L 4WHTA 1FORH 1FLRL 1LILA 2PTVA 4OLWL 2YA1A 3VQ2C 1NANI 4CW1B 3T0EC 2QVKA 3RIAK 2HWZL 2GTWB 3EH2A 1V10A 4MA1B 2WAHA 1OQOA 4WI7A 5CN2A 4ALAC 1BYPA 2EIEA 5EMYA 2O5ZH 3UIYA 1ROCA 4NUJA 3GSVA 4WUUB 1F8TL 5C09B 2WXRA 5FLUA 5DZ9A 5IHZA 1VEPA 3X12A 4YBQC 4OZHA 5CBAA 4F5CE 1WZLA 1SVBA 4AL8L 1F4AA 1IGJB 1RFDL 3RA7H 1PZDA 4MCZB 5IW6B 4PJ9D 4YUEH 1S5IL 1E4KC 1JGLL 2RQEA 5GGRY 2ZUUA 3FTGA 4N3TA 2WP3T 5D5ME 4LSRL 1UTDA 4X8GA 4XZ4A 4Y9GA 4ZUVB 4OCRH 5IROD 3AQDA 4DP9X 3U46B 3E2HC 1B4JH 5ISZB 1B2WH 1QBMH 4ANWA 4ACPA 4D0DA 3KCPB 3VWKB 3H3BC 3WO4B 1PZ5A 3MA9H 4PY7A 4UTAH 4MB3A 3D4ZA 2X1OA 2CR0A 4HXBL 1OF2B 5M95B 3UC0H 4JKLA 1AGFA 2W8CA 2R1XA 4UT6A 5PAZA 1WPCA 1K3IA 3VX0A 3QDME 1AH1A 4G8GB 3VTAA 3SQBA 1MQ8A 1SF5A 4Y7OC 1A1NA 4RGMB 5LCVL 4KGLA 5FUZH 4HKJB 3N44B 1ZVYA 4AUJA 4OB5L 3MRBB 1YA5A 3D85D 4IOSA 4IQHA 3RTQB 4Y4KD 2AP2A 2ZXWB 4ENED 1S9WA 3FYIB 4AC4A 3OPZH 4JY5H 4TV3A 3TF7C 3K6OA 4AGPA 1T0MA 3U79A 5LDUA 5TDPB 4BWUA 1IC7L 2LVEA 2NXZB 3S5LA 3AMKA 2VW6A 3WFHB 1HKFA 2NUPB 1HEJC 4MA3A 5CM1A 2CPCA 4RMTA 3FT4B 5I0DA 3HN8A 4WI4A 2V9QA 5LNGA 4PSPA 3SE9L 3KL3A 3FU0A 5B22A 4OGZA 3FU5A 2DBJA 3UP1A 3O8XA 1R3IL 4QT5B 3C2SA 1QFWH 4OLXL 1HQRB 4F2MB 3NFSH 2SEBA 3QC6X 3CZFB 3LZPA 5DFWH 3OXSB 4X4XB 3NFNA 4PJ8B 4E0RB 4Y4HD 4MX7B 3UTTB 3RGVA 2XXCB 4C56D 1JK8A 3QPKA 3F58H 1EXHA 1SM3L 5EIIG 4Q9CA 2DI8A 1QSFD 1OTTC 1MWAH 3G08A 3O4OB 1L7TH 2G60H 1PSKH 2GBVA 2LU4A 5DD5H 3LS4H 3QXTA 4L9LB 3MO1B 3VG0H 6FABL 5EIIA 2XVKA 4GO9A 3AITA 2V9TA 4XAWL 4NN6C 5ID1B 4BUHA 4O4YL 1R5VB 5IHUH 3T0ED 2CLZA 2OR9H 1ACYL 2BVEA 5DFTA 2E6JA 1MCCA 5C3LD 3L1FA 3VSTA 3CFEA 1ASOA 4ADJA 5EC2B 3KWWB 2IJ0C 4X6DA 1UENA 3CN4A 3BCDA 3V9EA 4KNUA 3I3BA 1BG1A 4P2QD 4YBQD 1DEEA 2PP8A 3EYFB 2I9TB 3JV6B 1MCFA 1TCRA 2X9XA 2UX7A 3GI9L 3OXRB 5I1JH 2QDWA 1OOAA 4LHQB 3HUJE 5DD3L 3WS3B 4OCYL 2CM6A 2OI9C 3O11A 3OSKA 1IT9L 3PV6B 1H3PL 2F7QA 5CEXB 5E8EB 5IHLB 1T21A 2X4NB 2WVUA 1F58H 3ESOA 4KX7A 2VISA 5C1MB 2C34A 2YQ2A 3M88A 3KVDD 2XV2A 3B3IA 2YBGA 3QNYA 4YWGL 4D3CH 2FGZA 5DJXA 5DC4B 1FYTB 4AQAB 2DV6A 4N2FA 2B1HL 2G2RA 2VDNL 2YR3A 2QR0A 2BP8A 1I8MB 2NTSP 2VM9A 4XNZC 5ABAA 5C0GA 4P99A 4BE5A 2AS5M 1HVXA 1D5ZA 5HYJD 1PEZA 4G82A 5HJ3B 4KTGA 3LQZA 1JGUH 4XN4A 5E8NA 43CAB 4Z0BL 3OBAA 3WCYA 4QOKD 4JFZH 1AXSA 1IM9D 3FCTA 1VKXA 4PJEA 2EUVA 5AVTB 1AHWA 4WO0A 4HUCA 1ZTXH 1QZ1A 1Q72L 1PZBA 4JRLA 2FJFA 5D2LB 1T1ZB 1WCBB 4Y0GA 4N1CA 5EU6A 4KHTH 4P4KC 3KS0J 1OCRB 4Y5YA 4XC1H 3ULVH 1CFBA 4NRZB 1V7MH 1KXTB 3EGXB 1TO5A 5EU4B 5J5EA 4OM1H 4NHUB 1S7XB 1HHKB 2X2HA 2DD8L 5FUCC 2BS9A 1XEUA 4MXVE 1JGIA 1KJVB 3ABGA 1AIZA 2XWBA 4I0KA 1GMIA 3IMTA 2ZP9A 5BRZD 3QIWC 4N90E 1HSBA 3BT0A 2WKOF 3P3RA 4HEPG 4LLVB 4PSRA 3UTZB 2CUHA 1XIWA 4IOIB 3ZKMC 1V7NH 1PCXA 2ARJB 4HEPA 2QKIC 4RX4A 3SYCA 4R6UA 4TSAL 3L3JB 3SGDI 1MCPH 2APXA 2YD8A 1IO4C 2Q7YA 4DHLA 4UM9B 5C9JB 5IBTH 2EEDA 3KJ4B 3TN0C 1TG8A 1TZHB 1OTTD 3TBWB 2FAUA 4PWFA 1G7JB 3K2UH 1U30A 3CMOL 5C0AD 5L6YL 1G6VK 4XNDA 2QLYA 5JMOC 1AOHA 4KQ4L 3HAEG 1DUYA 3ZMEA 4N2CA 3A4DA 2CK2A 3G5YA 1J5HA 3KR3H 1KV7A 1BIIB 5I1GH 4DOHE 3HAEA 3LB6C 2IV9A 2VITB 1XF2A 1RSFA 2YLKA 2OSLB 4POUB 3MRKB 4LCWA 2O61A 1CD9B 3RWIA 2ITCA 3WL9A 4GUOA 3REVA 5CD3A 3BFWA 3L4XA 3O2WH 5FK9B 4Z76B 4I18B 5L88L 5JO5A 5AVSB 2FD6H 3FQ1A 2ADGA 5JW4N 1YEGH 2NW3A 2GJZB 1WBZB 5GS1A 3WJMB 5E6ZA 1TKWB 4WO4C 3F6IA 3PDGA 1JRHI 1EEYA 2NY0C 3D39E 3RJQB 3WLWC 4M7LT 3NN8B 4GFTB 3AGVA 3RRQA 1ESOA 3ZIYA 5GJSL 4B0MM 5JIPA 4JPWH 3BEWA 1J05A 4G7VL 2ICWI 3MCYA 4BFIA 3DRQA 4Z78A 2YAQA 4JO5A 1BWWA 3ABKB 4FDWA 3SKMA 3VW3L 5BCAA 1T1XA 3IJEB 4ZFFB 4Y19A 1PQZB 1CE6B 1KCUL 3L9RB 4HIPA 1XB8A 4WY7L 3WUWG 4BWWA 4OFKA 3HKFA 1YJDL 3A6BL 8FABA 3UIZA 2Y1VA 2HJLA 4MS8C 3V95A 4J3VA 1YMMA 4OFPA 4FQQA 4HUXA 1LO3H 2W92A 1UM4H 4NQEE 4RA3A 4KVNL 2WXJA 3HR5A 5DVKA 4K9EL 3IFLH 4QYOA 5E9DB 1MRFL 5GSVB 1MCOL 4F9PC 3ULUH 1VLXA 1AZRA 2VDRB 2NDGA 2RJMA 2XPZA 1OVZA 2X4RB 3UBGA 1I1YA 2QFRA 4P4KD 5IQ9A 2CM5A 4GMSL 5EBGA 4DN4H 1T66C 3RAJH 4DUWA 1N8OE 2L7QA 1BJMA 4R4NC 1NKGA 4LU5L 3DVNB 1F4HA 5BJTA 4XCEA 3ROOB 2WVTA 3D51A 4Y16B 1SVCP 3M45A 3W9EA 5AWNH 1MLCA 4E5XA 4OZHB 1IC1A 5CBAB 4PGEB 3ASOB 2Z8VC 1MH5A 2YD0A 3QIWD 1S5IH 5AZUA 1JGLH 2CJSA 5B3JE 3CFDB 2GJ6A 2IPUG 4LSRH 5AYUH 4L4VE 1MFEH 1RMFH 2ED6A 1KLGA 3K46A 4P8QA 1M1SA 2F74B 3ZKMD 5CR1A 3DMMB 1A4AA 4GY4A 3CCHB 4B5ZA 4AI7A 2YUWA 4R0LA 4ZOEA 4BSVA 4FG2A 3RWDB 1KIUB 2XWEA 1R47A 4X7DC 4GKNB 4JLRB 3TN0D 2WWKT 4LHJB 3WAJA 3I6SA 1CGSH 5KBDA 1RJYB 4L0ZA 1UM6H 3CC1A 4FJZA 1H3WM 2AVFA 4DW2H 4G11A 2WTPA 4OD3L 1FL5B 5DRNB 1ULVA 2VGLM 3IMSA 3FULA 2FJHA 4FKHA 5BV7L 1ZS8A 1SXBA 1KYOK 3LB6D 1OSZB 1U8JA 2XNAA 1S9WB 1A7PH 2XDHA 3UO1L 3MZTA 3S5YA 4OBRA 5EF2A 3EH5B 5KSUB 4B7LA 5B7MA 1TQCC 3PWPD 1KDIA 1KFGA 1VEOA 4JHAH 5DYOB 3JYBA 4PS3A 1YEIH 4PJXA 2GBAA 2YMXH 4UZUA 1VCAA 2IFGA 4WO4D 2VL5A 5EWIH 3CDZA 5C0FB 3O8XB 1RZIA 2NY0D 3L2MA 3WLWD 2WN2A 5E1AB 2HSIA 3NH7H 1T7ZA 5DJ8B 1JYXA 1U3NA 3FC8A 3OB8A 2CUAA 2EE6A 2GTZB 4MNQA 5IQOA 1J8HB 3SDXA 5KS9F 3SGJA 3MGOB 3B5HA 3P3YA 3UXFA 4EOWL 3BQUA 1ZRUA 2IAND 3X17A 5GJTH 4BRJA 4R26H 1DLFH 1M2VB 4PV9A 2DM7A 5C0DA 4K7PL 2XBTA 4DTGH 4TQ8A 4MS8D 3GJFB 1GJUA 1NAMB 3IVKA 2D3VA 2JB5H 5D6CA 1U8PA 3TBBA 3TZVB 4P06A 3HLAA 1LDSA 1UZ6F 4V1DD 4YL9A 5EIIB 4HX1B 3VXQA 1REIA 3GMOB 1CFMA 3PWLA 4FFTA 1NC2B 4QHUA 3VFOB 3TEXA 1S7RA 3AXLA 4X7CC 1CVSC 3V4UL 5D1QB 5IT2L 2YPKA 4U1JA 5E1HB 1WGVA 4NO0A 1P84J 1L3WA 1T66D 3ZE0E 7PCYA 3NZHH 4JZJB 4R4ND 1O7SA 1PBYA 2D3NA 2O6FA 2E56A 1QVOA 2PW1A 2QPEB 5BV7C 1DDHA 5IB4B 3D3VB 3GI9H 2YRZA 4TUJB 1DEEB 3GMQA 4YBLB 1OGAB 3BPNB 1N2RA 2IGLA 4ZMZA 4WW2F 1ZE3C 5AOMA 3GPEA 1RZKH 3GSQA 2DM2A 4MYPA 1TXKA 4UAOC 1QUNA 5DMJB 4L4TD 3GI8L 1GIGL 1ONQB 1D5XB 2VDLL 2WZ0A 3PJNA 1PS3A 2B1HH 3QNYB 2P28B 1GYCA 4W9JC 3W11C 1L6XA 4AKOA 3U0TA 2DKMA 3OHXC 1WP6A 1LO4H 1NKRA 2VC2B 1FNFA 3D34A 3RG1C 4NC1E 2OMUA 5D5MF 5K9JH 1E67A 4EN3C 2BP8B 2BP5M 1AOZA 3EFDL 2CALA 1ZA6B 3KYAA 3PWUB 4GUPA 3HG1E 2FH8A 2XA8H 5D6DA 4Z0BH 1WFUA 2J1KA 3RZCC 1NLBH 4WWNA 1J5DA 3MV7B 4NYLA 1CT8B 3K5RA 4WSGA 4WRLA 1EDHA 1EUTA 1EO8L 1IAOA 4GXVH 1UHVA 5EH1A 2QMKA 3HFML 4OJFL 4E9XA 1A7QL 1KC5L 4JKNA 4KK6C 1X7TA 5AZ2H 3QUXA 5FYKH 1UOLA 1AR2A 5EU6B 3TBVB 4LLUA 5CIPB 4WHYH 2YZ1A 1VZGA 4WJ5A 4NQDE 2HJFA 4Q9QH 2FX9H 3MLRH 4Y9FA 1K8IB 1OP3H 2VLKB 5KBKA 4KMLB 1MF2H 5FYJH 2R2BB 4WFHD 4G8EA 2FATL 2KLTA 2NSQA 3QZOA 2X40A 5IQ7L 2E9GA 4MXQC 4PJIE 2WXLA 1SDAB 2B15A 2VXQL 1M71A 1AY1H 1MPAL 4KDWA 3DO4A 1KLFB 5FUOL 3PFUA 5JW4R 3FQ4A 5B21A 4WQOA 1WEJH 1G9NL 1E2WA 3L3GA 4LIQL 4X99B 2BCKA 3OWEA 4UV4H 4P5TA 3DV6A 1EUUA 3QXWA 1A1MB 2ZXQA 5ICXA 2OTUB 3C8DA 4DEPB 3BP7A 3OR7A 1VERA 5EORH 4KQ4H 5JPNA 1FV1A 1JRHL 3AY4A 1E8YA 2BM3A 4Q4EA 3QULA 5EEVA 5F6HJ 5DJ0B 3QPQC 3PE9A 2DTML 3FUMA 3DJRA 5F72S 4AW4A 1QHPA 1VSCA 4C4UA 5KSAA 3S9DB 3WEBA 3H54A 1JCKA 3UROR 5I1DB 2PUQT 1NFIA 4OZFB 3WKNA 5LXGH 2WHVA 1XX9C 2VWEE 2O61B 2A9AA 3QNZA 2XTLA 3RWIB 5I8OL 1CD1B 5BUAA 4PGDB 5IFHH 1BMZA 4NM4L 5L88H 5CD3B 3GXIA 5INDB 5D1ZB 1RHHA 3U7AA 4PMFA 1TQTA 3REWB 2YD6A 2YBRB 2NCMA 4K7FA 3L8QA 4MMXC 4DP0X 4MZ3A 3WTXA 1Z9SA 2V17L 3ARBC 1DJZA 3NACL 2DQCH 2P42B 2W9DH 5IB3A 3VD9A 2HUHA 2A6IA 1CVRA 1U2YA 5DVPA 1DBAL 2AEPL 2PW2A 2EDNA 3W11D 3HUJF 3I2CH 3HZYA 4M61B 5IJKA 1AG6A 3CPUA 1SOXA 3DRQB 4LCYA 4M8RA 3QISA 3U9UA 2TAAA 3IMRA 5D7IA 1RJLA 4ZAKC 4EN3D 1A6UL 2ALWA 4M7KL 1KCUH 4WY7H 4HFWA 1T1XB 3S4SA 5KS9B 4XCYB 1YJDH 2MCPL 3PABB 1NBZA 2X9ZA 2WNXA 5KVMC 2Y2WA 3LD8C 2YXVA 2HJLB 1DN0A 3RZCD 1YMMB 3H9SA 4FQQB 3EZ8A 3PQYA 1MCOH 4HWZA 3UGUA 3WUWB 3HR5B 3KVQA 4NQVB 4QYOB 4YN3A 3DPBB 5EPMB 3ARGD 3TIDA 2HTLC 1PW3A 4Q6IA 1XF4B 2PR4H 1WLHA 4KK6D 2HX8A 3L9YA 1SOSA 4I4WA 1QRKA 2XACC 5GRUL 5C2BH 1QSFE 2PWEA 3T3ME 3X1NA 2AEWA 4FFZA 1OM9A 4LPUA 1LK2A 5GRYA 3BPOB 3BD5A 2VXUL 5GIRB 3KEHA 2J5LC 4Z3EA 1A9EA 1F86A 2ATPB 2JKSA 1GTFA 3BEVA 3ZTEA 1USZA 1QR1A 3IDJA 2IVFC 4G5AA 1GC1H 3T0EE 4MXQD 4B9PA 5A43C 2X2UA 3NCYS 5LGYA 1IARB 5KAQF 2DEXX 5TPWL 2FRGP 4OZGF 1NZRA 4KH9A 3OKNA 1AGBB 2QQKH 1H0DB 1V54B 2OL3B 4MXVF 4WW2B 5C8JA 4H2CA 2XI9A 3GMNA 3FU8A 3NEXA 2D4DA 4QRSB 4H88H 4P2QE 1ZEAH 2E9WA 5J1AB 1KBWA 4PS7A 5F9WB 4L3EB 2OSWA 1UQSB 1BJ8A 3BJ91 4KHXL 4M1GL 3RIFK 5IY5B 2PKDA 4UOZA 2EDJA 1HAUA 1BEYL 1CXLA 2LLLA 3TVMC 4DNLA 3GS4A 4ZUSB 2A38A 2ALAA 4I0PB 5FPIA 5D5MB 3MBWA 2PWHA 2W07A 3DGCR 2XG5B 3OWRA 4W9ZA 5E6RB 5MEND 1T5XA 3VYOA 4FA7B 2NY7H 3QPQD 1FZOA 2CKBB 5IJCC 3LRSA 4C4KO 1FVEB 4PGCA 4RRPG 1MHHB 5ENWA 4U6VL 3UO1H 1TUPA 3FH7A 3L4TA 3HE7B 3EADA 5I26A 2NNAA 1GYUA 3W3BA 1E4HA 4QD2E 1D7DA 4RRPA 5FHAL 1ZJAA 4QI3A 3A23A 2ED9A 1F1DA 1TQUA 1MG2C 2ZP8A 2HKHL 4L3CA 1LK3L 1T20B 1DJIA 1WQVT 3CVHB 3ARBD 4Z7UA 3RWHB 4NXSA 3C5XA 3DX2A 1UWGL 1IEHA 4JCWA 5FYKU 4N0CC 5IMOA 4CADB 3D2UB 5IUCA 3KLAA 1UGKA 5K5YA 1N5YH 1OK0A 5FFGA 4P4RB 4MNQB 4JJ5B 2B2XH 5HYFA 2FBJH 5FYJU 1TT6A 3I02A 1CF8H 4UTBH 3BD4A 3BQUB 1GHFH 3EYVB 3BSGA 5EF3A 3SE3A 5IMLA 4ZAKD 3GBNH 4QRFA 3JWDL 3FFCD 3KLSA 4QHMA 1QLRA 1J5OL 1NGZB 4K7PH 3HE6B 1ZDQA 1HHIA 3BLKA 2W94A 4PN6A 2EIJB 3ENEA 1I3GH 3MLSH 3VD2A 1DQDH 2VO8A 1U8PB 4XBEL 1MFCL 5FX3A 1CDJA 1IC0A 4KUCD 4OCNC 2JKXA 1JD7A 2Z0UA 4JFDD 2HTLD 1N59A 5HGHB 2AQQA 1CL7L 4GKOA 4KNSA 1HSAA 4A7QA 4PQXA 3P4MB 5E00A 2E59A 1O6TA 3P77A 5H37G 3IDIA 4LPYA 3GUFA 3VRLF 4RSVA 1T22A 2P3YA 4BFEA 1EEUA 3DYOA 3AREA 4E9RA 4AITA 4OQ1A 2DMHA 3SY0A 2NX5E 3SYPA 5H37A 3TWCH 3VXPB 4F3FA 2PW1B 1JK9A 1PJ9A 2JJTA 4RWYL 1JZDC 1BEXA 4U1KB 1ZK9A 1O7DC 1GJWA 5HJGA 1Q94B 4K71C 1FFNB 2O6CA 4WF7A 1LYQA 5CNHA 2VDLH 4AY0A 2VMJA 2QKSA 3N9GH 1B6DA 1CJYA 4FXGC 4LHUG 4UUJB 1RZFH 1J0ZA 4MJID 4ZQKA 3HS0C 4LLAA 2DQMA 5GGSA 3WKML 1ADQL 4LFHG 5ADPL 1TYEB 3CJJA 2KKQA 3RL2B 2P45B 3H9YA 4LHUA 4NKMA 1HIML 4QHLB 1K72A 4DIXA 5B3JF 3G5VA 1FF5A 1YUHA 2Y7SA 1ZA3A 1W9XA 5CGTA 3EDDA 3W39A 1CCZA 3HUJB 5CP7A 1UJ3B 1DQQA 3TVMD 5DSCB 3PHAA 5BZDA 4A7UA 3S37L 1U8IA 5DEFB 3GIZH 4NYLB 4IIQC 4FMVA 2C1PA 3IJHA 1XHHA 4I77H 5L4IA 2YGNA 3HFMH 3LPGA 4ZW6A 4AK2A 5LNDA 1IAOB 1KC5H 2EVIA 2UYLA 4FQXA 2Z8RA 2D7NA 4GPVA 3QEHA 3RGBA 4PRID 3E3QE 3IBOA 3VFMA 3VGFA 4PU2A 5JDSB 4L0YA 4WWKC 4EBQH 3T3PF 2IIJA 2PCFA 3QQ3A 5D7LA 1YZZA 4LLWA 1EJ6A 4ODUA 4GBXC 3HMXH 1JUFB 1NGWB 3MRLA 3MTXA 2FATH 2BSBA 4J3OC 4MD5B 3ZO0A 4RNRA 2C9VA 5AUMB 2YEQA 4B0MB 4N0CD 2H0PA 4L37B 3MVSA 1AD9A 3CU1A 1ZTMA 3M7OA 4HGWA 5DJYB 4LSQL 3AXHA 4NAMA 3Q44A 2BP3A 3EUDA 1G9NH 1GVIA 3JT2A 1GGUA 4OZGB 3VWJC 1KENH 1HXYB 4L1BA 2OMVA 4HJJH 3V4PH 5MEPB 1AQ8A 2GBUA 5DRZB 4NP4L 2CCLA 3DUSB 4BE6A 5E9AA 1GZHC 3IDGA 1GYVA 2FYYA 4ONGH 35C8L 3FB6A 4IKIA 2FUTA 5D7JB 2XFGB 1M53A 5DQDH 1YPZA 2KLSA 3WI9A 2MNWA 1I82A 1ID5I 2IG2H 3K6FA 4JPKH 5E2VL 5F9OL 5EULV 4G71B 3P0YL 5JIIA 5A6LA 1Q0EA 1ZLDA 5JDJA 2IBZY 4UBDC 4NO5A 3WY4A 5I8OH 2FSEA 2YD7A 3ATDA 1X9LA 4KITB 3QNZB 4QTHB 5F1SA 5BZWB 1D5BA 5FO9B 1QBBA 2XFXA 3FFDB 4WI2A 1R46A 3U6XA 3BGFB 4Y5XB 4F7PB 3FF8A 4AG4L 2V17H 1A1OA 3D0VA 2R59A 1KGXA 2WOYA 2DLIA 3ZE0F 3QWQB 3FSZA 5C7XL 4XVTL 3UFIA 5L7XL 4LZKA 4WNSA 3LXBA 5CZXC 4DOHB 1IBZA 2GHZA 2FNWA 4U2ZA 5IB3B 1NM4A 4NBXB 3VFSA 2AEPH 3WIIH 2H6PB 4XMWA 4O51A 3U36A 3UEQA 4MDJB 3MRMA 4BFOA 3PWPE 5C0IA 4M6OL 2OW7A 1Q0YL 3HZYB 5HHQA 4YNYB 1SDYA 3GB7B 4M7KH 2O6PA 1DR9A 3U9UB 2C9PA 5I66B 1U8HA 5DRXB 2Z31C 2AQTA 1Q4NX 2CO7A 2R56L 4X0KB 1NGYA 2HX9A 1NBZB 5JHLA 1K8DA 2HXAA 2F15A 3GMLA 4QWWC 3D9AL 1YQVL 4HWZB 1R4XA 4N28A 1NC4D 2EDXA 3T6XA 4BHUI 3HC0A 5GGVL 3D87B