2IH8A

A low-dose crystal structure of a recombinant melanocarpus albomyces laccase
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
publication title A crystallographic and spectroscopic study on the effect of X-ray radiation on the crystal structure of Melanocarpus albomyces laccase.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
total genus 184
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A03
1PMYA 4BK5C 1J5DA 3X1BA 2MRYA 3T9WA 1AAJA 1JVOA 1NIFA 1ASPA 1OE1A 1WS7A 4KOCA 2JKWA 1IBYA 1AS6A 2VW7A 1J9SA 2E86A 1SFDA 4G71B 4F2EA 3CG8A 3CVDA 1VLXA 3H4HA 4YSCA 1AIZA 3N2JA 2XXFA 1PZBA 2XWZA 2YXVA 2TSAA 4G70B 3X1GA 5I6MA 3PCYA 3ZIYA 2ZOOA 2HLEB 2IDQA 1AG6A 3H56A 4HAKA 3UADA 1JXFA 4JKNA 1ASQA 1WA2X 2JXMA 1AS8A 3C75A 1NTDA 4G7SB 2A3TA 3UGEA 1SF3A 3ABLB 4ZK8A 3AG2B 1MZYA 4DP9X 1JZHA 3NJNA 2BP8B 2HX8A 2H47C 2CUAA 2HRHA 5D4JA 2BP0B 1W6LA 4KNSA 4HCIA 4E9RA 1QHQA 4RH4A 4JHVA 4WKXA 2PPEA 2ZXWB 1L9QA 1AZBA 4YSTA 2GSMB 4E9SA 1OCRB 1AG0A 1HAUA 1EZLA 1JZFA 2J56A 2DYSB 1XB3A 1M9WA 2GB2A 4GP8B 2I85A 5I6NA 4KO7A 3BQVA 1WAEA 1GR7A 1KV7A 1L9RA 2BZCA 4GP5B 4YSAA 1OCOB 1SNRA 1MG3C 2CALA 3DTUB 1E30A 1AZCA 3OMAB 1NINA 1GY2A 1A8ZA 4P5RA 5D4HA 3S8GB 4M4RB 4BXVA 1JZJA 1BQ5A 2BP8A 2N0MA 2PCFA 3KW8A 3OQRA 2BP0A 3ZX1A 2BHFA 3GXUB 2HXAA 3H4FA 5E9NA 3S3BB 5I26A 4W1TA 1SF5A 3NJMA 4M3HA 4AI7A 4YSRA 5B3SB 3FU7B 1JOIA 2VMJA 2Y1AA 3QQXA 3NSFA 2YAHA 1XMEB 1CURA 1ET7A 1IUZA 2BW4A 3UAAA 3ZBMA 3BVDB 1X9UA 2H5UA 7PAZA 1RKRA 4QLWA 3EH4B 4N8UA 3EH3B 1DZ0A 2GC7C 2BWIA 2YXWA 1PCSA 4DPAX 5B1AB 1E5YA 3ZDWA 2PP7A 1OCCB 1KDIA 3AZUA 1R1CA 4UANA 1RCYA 2FQGA 3NJGA 2H3XC 6PCYA 2YAQA 3S3CB 1I53A 1PNCA 2AVFA 2QDVA 2XX1A 3FU7A 4KO5A 1E65A 4E9WA 1YLBB 2IWFA 3S3DB 2VW4A 3CDZB 3WI9A 2X87A 2FT7A 1A4CA 5D4IA 5AZUA 4AKPA 4EF3A 3X1NA 1FWXA 4A2HA 5B1JA 4F7KA 3N55A 2GI0A 4WTQA 4FAAB 3CVBA 3TU6A 3ABMB 1IBZA 1OE3A 4DP6X 1SFHA 6PAZA 3G5WA 2XV0A 5I6LA 1ETJA 1HAWA 1KDJA 2WO2B 2IDUA 3OMIB 4NERA 3UAEA 3EH5B 5I6KA 2B3IA 1ET5A 1J9TA 3AY2A 3SQRA 1ASOA 4HHWA 2FWLB 4BXSV 3MX0B 2VN3A 2IDTA 3CDZA 1NWPA 3FSWA 4GY4A 1PZCA 2FNWA 2GHZA 3V9CA 2IH8A 1AACA 1HFUA 2Q9OA 2WO3B 3ASNB 1FA4A 4W9ZA 1PLBA 1T5KA 1OCZB 3WG7B 5I5MA 3QJVB 1AR1B 2DWTA 2YAOA 4MFHA 2HZHA 4A66A 3AG1B 1J9RA 3X2QB 1BXUA 3NJLA 3PXLA 4AX3A 5FC9A 2I7SA 5B7MA 3T6XA 3CZUB 3V9EA 1RZPA 2GC4C 4YL4A 3RYMA 4HHGA 1PLCA 3NT0A 1NIDA 1QNIA 1V10A 1GS7A 1GYCA 3FS9A 3NJIA 3WKQA 2DV6A 2FQDA 1ZDQA 1E5ZA 1AANA 1L9TA 8PAZA 4KO6A 1PNDA 2YAPA 4HALA 2XLLA 4PCYA 3TBCA 1EHKB 1MDAA 4DP8X 1WS8A 5IY5B 1URIA 2PPDA 4AZUA 2UX7A 4HIPA 4DPBX 1TU2A 1JXDA 3UABA 4CSPA 2UX6A 4AKOA 5I6PA 1ZIAA 1KCBA 3JTBA 9PCYA 3WNIA 1IKOP 1NICA 3IN2A 1CC3A 2UXTA 1CYWA 2IDSA 5F7BA 4DP0X 3TA4D 3PAUA 4KNTA 4PAZA 1NWOA 2FQEA 4BWUA 4AKQA 5I6OA 3ERXA 1BXAA 2BZ7A 1XB8A 1XB6A 1ADWA 4E9YA 5ANHA 3U25A 1N68A 2W88A 1PLAA 1ZDSA 2XU9A 1GSKA 1KYAA 3NJKA 4E9XA 1AZUA 1ZV2A 2PP9A 4A2GA 3IN0A 4BDVB 4DP7X 4NB7A 1J9QA 1M57B 3QJUB 3FPXA 3X1EA 2MTAA 1AZRA 1QLEB 4X4KA 2P80A 1ILUA 1JZIA 4DP4X 2UXFA 3WKPA 1NIAA 4YSUA 3NP4A 2XV2A 1NZRA 3FSZA 1KCWA 3UACA 4TXVB 2EIMB 3QJRB 3T71A 2CCWA 2J5WA 3EF4A 2B08A 3X1FA 2PPCA 3FYIB 2PPFA 2GIMA 2R7EB 2YAFA 3ASOB 2WSDA 2W8CA 4BDVA 2PPAA 2TSBA 4UF7C 1NIBA 2J55A 2OV0A 2VSMB 3EHBB 2DY2A 2UXVA 2YAMA 1SDDB 1IC0A 4YSPA 1SHXA 5B7EA 4E9TA 1B3IA 2FT6A 1ID2A 5EHFA 2EILB 4YVUA 4QKTA 1E67A 4K9JA 3NYKA 3IBOA 4Q89A 5I5JA 1ZPUA 1GS6X 5B1KA 4ENZA 2DYRB 2EINB 1NDTA 3GDCA 3OD3A 2EIJB 2JFCA 4YSQA 1ILSA 1F56A 3FU8A 2PLTA 5A7EA 5TK4A 1JZGA 5B1JC 2CAKA 5B1BB 3HEIB 3NSYA 2RACA 5I5IA 3HB3B 1L9PA 3AG4B 1NIEA 2R7EA 3IE9A 2XV3A 1NPNA 1OOWA 1OV8A 4A67A 1SDDA 2FJSA 3FQ1A 1GY1A 1DYZA 1PAZA 1MG2C 1A65A 4GYBA 3SBRA 2IWEA 2VW6A 4HZ1A 3FQYA 3OM3B 2IDFA 2AZAA 2I7OA 3WNJA 1ZIBA 5AFAA 5I28A 2QT6A 1SJMA 1PZAA 3TBBA 1CUOA 4A2FA 1RZQA 3S8FB 4GP4B 1GS8A 1CYXA 1SHWA 3QJTB 4G72B 3T6ZA 3AG3B 5PCYA 2LLNA 2VM3A 4G7RB 5TK2A 3FU9A 1MZZA 1OE2A 4L0PB 4N4YB 3NJFA 4Q8BA 1J5CA 2BO0A 3FSVA 2IH9A 3QJQB 3AW5A 4F2FA 4YSEA 1TEGA 3L45A 3KW7A 1NPJA 3FSAA 1V54B 2XUWA 2X88A 3SBQA 3FT0A 1GW0A 1KBVA 3NP3A 3ABKB 2XX0A 5B7FA 2IWKA 2FTAA 4UAHA 1BXVA 1PY0A 1PF3A 2FQFA 3FPYA 3NJHA 3TASA 3SBPA 1M56B 2Y69B 5AKRA 1JERA 1KBWA 1AQ8A 2HX9A 1V55B 1OF0A 2NRDA 1X9RA 2GBAA 3T6VA 2J57A 2YAEA 2ZWNA 1W8EA 2QDWA 1TKWA 2CJ3A 2UXGA 1AOZA 3PLYA 4DP2X 2OCCB 2AZUA 2ZONA 2PP8A 1A4BA 4HCFA 3WIAA 4KO9A 4HCGA 2AFNA 2QPEB 4DP5X 1BQKA 2VSKB 2OJ1A 3D12B 3NJJA 3JT2A 4P5SA 2XYBA 3NSDA 1A4AA 4DP1X 1JVLA 1W6WA 1BYOA 3DKHA 4G7QB 1FFTB 4GXFA 1BEXA 1TEFA 2XXGA 3T6WA 7PCYA 4FA7B 1JZEA 2CBPA 3GYRA 4BWWA 1JXGA 4E9QA 3MBWB 1UATA 3NSCA 4KNUA 1N70A 3FQ2A 3PAZA 3QPKA 4YSOA 1BYPA 1A3ZA 4NAJA 3ABGA 2VM4A 4A68A 2XVBA 2AANA 2YQBA 1WA0X 4YSDA 4CSZA 3QJSB 2HX7A 1L9OA 3OMNB 5F7AA 5PAZA 2BW5A 4E9VA 4YVNA 1BQRA 2QPDB 2DWSA 1KGYE 4DPCX 4A2EA 3DIVA 2FT8A 2PCYA 3PAVA 2P80D 2YARA 4A2DA 1L9SA 4YSSA 1AZNA 3FYEB 2EIKB 2IAAC 4KOBA 1BAWA 5LDUA 2BWDA 1ET8A 4BWTA 3IEAA 1AS7A 1WA1X 2Q5BA 2HRGA 4JHUA 3PPSA 3CVCA
chains in the Genus database with same CATH superfamily
1RQ5A 2ALAA 3P0YH 3X1BA 3DC0A 4LKCA 2IQ9H 3HC3H 2FD6L 4N90E 5FUCC 2ESVB 1RVFL 1WS7A 3DUSA 3J7HA 3OAUL 1VCAA 1GYWA 3D85B 4JO4H 5BV7L 3D08A 1LP9E 3W3BA 3HRZA 1J9SA 4XN9A 3QQDB 4LLMB 5FHAL 5TDOA 4HXBH 3EHBC 1OGSA 1UH3A 1LYQA 4Z7AA 5HDQL 1EHXA 4FRWA 5ICZA 4I77H 3DHJA 3V8OA 3QORC 4LQFL 5AG8A 4HZLA 1UOVA 5KOMC 2X42A 3UP1A 2O5YL 2YJQA 5H37H 5IW3A 3FSOA 3K81A 1RUAH 3P3UA 1SOXA 1WO2A 2JXMA 2X89A 4KX7A 5DQJA 2VKXA 2UY7B 3W2DH 3OKDB 4LZKA 4WUUD 3VXMA 1H3VA 1WC7A 2WLZA 4RAHA 3EJZC 3N1GC 1CFSA 4M4PA 5GGUA 4CC1A 2F53A 1N67A 4L3EB 3ARDA 3I75A 5HGGS 1ODAA 3GMRB 3MLSH 3MNZB 4ANKA 5B3JF 2MNUA 2NUTB 3IVKB 2F8IA 3AWFA 1NBYB 1A6VL 1MFAL 3RY6C 1FYTD 3WEOA 3D3VB 1G9MC 2J56A 4AVKA 2YWYA 1WIOA 3EYOB 2I85A 3H3PL 1W16A 3QQ4B 4ZO8A 1RZ8B 3IMTA 4DO5A 3S37H 4EUPB 4OUOA 2X2UA 1JPGB 2Z92B 4QJ4B 5K39A 4AEIH 3KPMA 1KPVA 2DLFH 2PCPA 3KLDA 1ROCA 3Q1SH 1MQKL 2ICEB 1S7RB 1ZLWH 4M6NH 2P8PA 3S8GB 1QTYT 1TQBC 3WGVB 1DVYA 3WENA 2DQIL 4K3JH 5F70A 2CXKA 3U4BL 4UYQA 3MNWB 2HXAA 2ZUVA 1KIUA 1MJ8L 3MCKB 3QWNA 3TT1H 3NJMA 4FXLA 4AI7A 2D9CA 5CZVH 4NQED 4H5SA 3ZBMA 3HS0C 4HLEA 4PRNA 2DWEA 5C0NC 5CGTA 3GRWA 4KQ4L 2BOCA 3PREA 3V6ZA 2VNCA 3OLEA 3RGVA 4DERA 5EZPA 4Y4HC 2ZKMX 3QUYD 5B8CB 3FFCE 1VB9A 2GJZB 4OT1H 5E0QA 5JPNA 5F1NB 2YA2A 1GXEA 5C0EA 4WI8A 2ATKA 5F9WB 4N8CL 2FBRA 4G6KH 3ZE2E 5EU6E 1S7VB 1U8HB 2NY1D 3AT9A 1NFIB 1DQLH 5DUBB 5IOPA 4YLCA 2XKSA 4YLQT 2BINA 4RDQF 4LSSH 1IO4C 1Q94A 2LR4A 3T3MB 4ZDHB 3RKPA 5TE6H 1YUKB 3OAYH 4NO5A 2OL3A 2D7MA 4G6MH 1T7WA 5A2JH 4DQAA 1ZRUA 4XN2A 1EHAA 3MV9B 3OV6A 1GJUA 2DIAA 3HC4L 4QRUB 4OIFA 5FO7B 4HJEA 1SRDA 2F54B 3L5HA 2W91A 3K6SA 1FGNL 4A2LA 5DXWA 1S9VB 3AT8A 4MDIB 2A74A 4TUOA 1KB9J 3VD9A 1A1NA 4N2BA 5EZIL 1IGFL 3S36H 2BRQA 1GOFA 3QR1A 2J43A 3UPRA 1G6RL 3PWJB 1J9TA 1H3PH 3TM6A 4KY1L 4BK8A 5C6TL 1QSFE 3RTLA 3C6LC 5TJWK 3OJMB 2MWCA 1D6VH 3L9EA 3KR3H 4TULL 4Z7WA 1IEAB 1P0SE 5D2NB 5JXEC 1H3GA 1UEYA 1B9KA 2XFGB 1DSYA 1KG0A 3RNQB 3MJ9H 2MKWA 3ROOA 2V5TA 2PN5A 1CMOA 2LQRA 3O6LL 5ICXB 3DOIA 3ARFD 2F15A 2Y22A 3GZPA 1RPKA 4P07A 3L17A 5CNHA 1AR1B 3IU4H 1HKLH 2DWTA 3KHOA 4WO4A 5MENB 4DGYH 1F18A 2CDGA 2FEDD 1OSZB 5FCSH 4GRMA 4P4KB 3NEEA 3QUHA 3BVVA 4XNBA 2BC4B 1V7ML 1X4XA 2OSLB 4MNHA 4LLYA 3V9EA 1HYSD 3K2KA 4N6QA 4TN9A 2GC4C 3HMWH 4JFFE 4N3UA 2C9SA 5FHBL 4LEOB 1DBMH 3KPSB 4POYA 2JJUA 5KJ4A 4U0RC 3AM8A 3GXPA 1EO7A 4WDIB 1VGEH 2MPAH 3BYYA 1JDCA 2ZOKB 1TZGL 1X5YA 1HJBC 1Q9OB 3MFGB 4KO6A 4ODUA 2VXQA 4HALA 1EJOL 5LN4A 1V3JA 4PCYA 3BWAB 2WZ5A 4JFXB 1KEML 1RIUH 5F7KC 4B0MB 3DSNB 3V0JA 1KCRL 1NGPL 4LARH 4Z95H 5JQ6H 2H1PH 3KLLA 5GSRB 5FA4A 1KTRL 4TOYL 1ZLSL 1IKOP 3C6SB 1NICA 2E75C 3IGAB 4M8UA 5EN2B 4Y9EA 2AEQL 4JRYD 5GSVA 5JHLH 3ARBA 3NAAH 2CCVA 2VT0A 2Q8AL 4K9EL 1JV5B 4B96A 1S4IA 2WXLA 3F83A 2PYEE 1IQWH 3DBXB 4X80L 1P4BL 1FYHB 2W88A 2VH5H 3ARXA 2C34A 2JKTM 4NCDA 5AW3B 4MMXA 4HEME 1ECZA 3MRLA 1KT2A 2OMYB 4NZJA 1Z9MA 2UUDH 5TF1L 4IBZA 1PY4A 1MI5B 3RL1A 4BJLA 1PVHA 3FPXA 1NC4A 3B2UC 4AG4L 2Q3XA 2D31B 4U6HA 1YY8B 4LCWB 5BXFA 3S34L 1K2DA 2EEAA 1JD7A 2OTPA 5ESQA 4R3SA 3O3DB 1G5AA 3TEXA 3F2LA 3G04B 2FJGA 1IC1A 5FO8A 3OR7A 3AAZA 2FX9L 1HU8A 1NZRA 2ZAGA 5BOPA 2XWTA 1URLA 5I0ZA 4OLXH 1UQSB 4R7NA 2IMNA 3KPOB 4NN7C 3WIFB 3N42F 3FYIB 2PPFA 2E7HA 4EIUA 4BFIB 4AUJA 2G75A 3D4GA 4JZNB 1RIVH 4JRXA 5ISZA 3RX7A 3WN5B 1YO4A 1NC2D 3M17A 3LCYA 2XA8L 3AU0A 2XPYA 3NFNA 2ZXGA 3HE6D 3BDBA 3EYSH 3MSPA 4YHLL 2N7AA 3DJRA 4KHTH 1E27A 4K9JA 2CKBB 2X1PA 3FBKA 4O2FA 2KT6A 4JFED 3TNMB 4ENZA 1HI6B 2CGRL 1KJ2L 4M6MH 4WI6A 5D70H 1C5DB 1ODUA 4ACPA 2IPTL 5EUKB 1YUHB 5HHOE 1MRDH 3WD5L 5LBSL 4FJ6A 5E4AA 4P2OB 3DRQB 3NSYA 5I5IA 4MQ7B 3Q7JA 3TJPA 2BOBB 2A77H 2BVEA 3L7EA 4Z7QB 1BBDH 4H44C 1SDDA 1UWFA 1O7SA 1L6XA 2WZ6A 3O8XC 4TRPL 4LXFA 1U58B 4YMPA 3N0PB 4ZFGL 4XBEH 4GYBA 4OZIE 1A7NL 4ZG1A 3JTSB 4N22A 3ESMA 3DHPA 3FQYA 1URZA 4QHMB 3M86A 2IDFA 2Q86A 3AGWA 4GQRA 2R51A 3P69A 5I28A 3EO9L 1SJMA 2FEJA 1JWMA 1UM4L 3FUHA 5E99H 1VADA 4GUOA 4RGND 2W9DH 4X7SL 2C7FA 4M1CD 2F7QA 3AU1B 3MRDB 1OZTG 3MLTA 3CLWA 3QXAB 4EE2A 4OV6F 4ZUTA 2I9LA 4N2IA 4ODWA 4X6DB 2BY3A 1CT8B 1A5FL 3LTVA 3X12A 4LNRB 2CPCA 3IS1X 4OJEH 5D9SA 3LOWA 1TNNA 5D5MF 4L0PB 1R3IL 3U79A 3NJFA 4X98B 4F7CA 5J6HA 1F4XL 2KC0A 5KW9H 2XVKA 3L45A 1JWUA 3HB3C 2CG9X 4LAJH 2BDNL 4HG4K 4RFEB 2ZSVB 4M1DL 4GKZA 5FO9A 2DEYX 1SLUA 1QSZA 5DZAA 2R1WB 1FFOB 4HT1L 2DQFA 5DJZA 3MBXL 2DLGA 1JGLL 4N0UE 3C5ZC 5DDHA 3RUGB 1LEKA 4PV9B 5I1HH 2OS7A 3CMOL 4CC4A 2ICWA 1I9IH 3WIHL 4EO5A 3PYCA 3PXJA 3LPWA 1A7BA 5D1ZA 4EUPG 2MOQA 4EN3B 3SY6A 3EJRA 4NQVA 5DLLA 4EOWL 1KPRB 5DFAA 2DYPB 5L8JB 4GKSA 4UM9B 4DNLA 1LO2L 1T1ZB 2NT0A 3A6OA 3PQYB 4RZCA 5HDRA 1HCYA 3RURA 5E9DB 5L4FA 4HISA 4XMTA 5DRWA 5IZ7A 4FQXB 1YA5A 1JSYA 4KKPA 2NQ3A 1QP1A 3SODB 3HE6A 3HMXA 4PSRA 4MB1A 3RB7A 3T4YB 1MJ7H 3LNIA 3ZL2A 5C0RH 4Q9QL 2GG1A 2IFFL 3FB5B 1NFAA 4QRTB 1QBMH 4C4KT 2WWMC 3FQUB 4H8QA 4Z0BH 4UV4H 3VG0L 3ZGIA 2XN9E 4G6FD 2CO6A 4G7QB 4YR6A 4APQC 3LPOA 5JHMA 3GRBA 1WBZB 1Q38A 2QKIB 4PJDF 4R97C 2VLKB 5L6YL 3BKCH 3QEUA 4TUUA 4XHJC 5L0QC 4IIQC 1GIGL 4MJ4A 2QADD 3KXFD 2DQEH 4N8VG 4R0LB 2I26N 4F8LA 4M29A 4LSTL 3ULUL 3VXSA 4OF0A 3QEQE 2EE0A 4IKKA 2A6KB 4J3OD 2WOBA 5JIQA 1G84A 5B4MC 3BLKA 4Z7OB 4MJID 3BHBB 3OMNB 2RB8A 5F1KC 3DTXA 3CVIH 5HI4C 4PJ7B 3VM7A 4LLWA 1MREL 2O5NA 2Q1EA 2BIPA 5I6XB 2ARJQ 1YEDB 3L3KA 4HUWB 1JPST 4KTDL 3REVB 4KOBA 5HYJA 5C07E 2JK5A 4XO8A 4NOBA 1TJGL 3FMGH 4UOW1 2E4TA 4IK7A 3HG2A 3HE7A 1UFUA 1S78D 3FTGB 3VFVB 2DQDH 1KN2L 2LAGB 3C09C 4IK6A 5EV7A 5AWNH 4NO3B 5CBEA 4WW2A 3B3IA 1AS6A 3BEVA 4K7PL 4TVPH 5J3HD 3I6KA 2AQRA 3N1QC 4HUNB 2NX5D 2L7JA 2XWCA 1JN6A 3N04A 3M1CA 2XWZA 3PWPD 3U9WA 5BNXD 2AK4B 1YMME 2E5EA 4ALAH 3H9HA 2Y5TB 3GI8L 5IBLC 4LFHG 2X4UA 3F7VB 1SOQA 1IBBA 3QA3A 4FQIH 5AOMA 3EJSA 2B1AL 3C75A 3HS0B 3VFWA 3HHSB 3P40A 5EU5B 1SXCA 1MFUA 1FNSL 5BW7C 1OO2A 2P28B 2CO3A 2OXGB 4PU2A 5TDNB 1MZYA 4Y4HB 2YGPA 5INDA 3VMNA 3RWHA 4JFZH 4ZMPA 2EABA 3MO1B 3AY4C 3VXRB 4ZMZA 5IOKA 2WZ0A 2YGOA 4OLEA 1PEWA 3FFDA 4P2AA 4R90H 5F3HA 2GSMB 4PI2A 1NGZB 1ZANH 1N5YL 6FABL 1NH6A 4YHMH 2FATL 3QQ3A 4G8IB 3D8MA 3BQVA 4QHLA 1NDGA 2DKMA 2CALA 4MQXC 4KTEH 2M1KA 2BIOA 2XVLA 1AZCA 1GC1C 1IARB 2IAND 2E8ZA 4JE4B 4PJ9C 4OLVH 2BSCA 3P2TA 1KNOA 3HZ3A 3L2MA 3QZPA 4I18C 5CJQH 4NNPL 1JMZA 4DF9A 5E08H 2UZXA 2VSCA 1MHHB 32C2B 3ETTA 4N6RA 5KAQG 2EKJA 2OCJA 4W81A 5ID0A 4W1TA 3JSSA 2OQJA 4L4JA 4Y19B 4EZMA 3LQAC 3NSFA 2WW8A 1NCCH 3BRFA 1ET7A 2BW4A 5EF3A 5EUOE 2J6EH 1RIHL 1H15A 2IH1A 3Q5TA 4MJIA 3REWA 4X9FA 3EH3B 3UC0L 2X9YA 4QTHB 2EEXA 5IV2A 1E3ZA 4QLRA 2EXYD 1P7KA 1I75A 5JO5B 4R4FL 5ADPL 5E8DH 1ZVNA 4I4WB 5JPMC 1KXVA 1LP9B 3L16A 5D6DC 2ZOLB 4KRPB 4IKIA 4LVHC 2YR3A 4QRPE 3PP4L 2OP4H 4POZC 4KO5A 2WUBH 3AB0C 4HK0A 3M1OA 4FFYL 1RV6X 3QCUH 4YHPA 4E9WA 3V6BR 1OARH 4P3DB 2OJZL 1MFEL 4OAWA 2LOEA 1CLOH 2FL5B 4AL8L 4JLRA 1U33A 4QRRB 2W65A 1RL1A 3ABMB 2B9AA 4TNFA 5DRZB 1LK2B 4WWKA 5DMKB 4NZTL 4U0RB 6PAZA 3SPVA 5I23A 4PEEA 1F97A 3Q8AA 2X4QA 4Z7UA 1KJVA 1T7ZA 1HK6A 3EH5B 4WTXA 4MAUL 3KLHD 2VQ1B 3LRGA 3VVVA 1Q0YH 3K4DA 1TJHL 3GBEA 4KK8D 3KEHA 5F3BB 3CQQA 2BRRH 3CZEA 3FQWA 1TITA 3HTLX 1I8IB 2AJ3B 3MUGA 4YE4H 1R46A 3NIDE 3SQBA 5ACMA 1W9XA 1MAJA 3EGSB 4X5WA 4N0CD 5SWSD 5GJTL 1M05B 4OKVB 2XZCH 3T65A 1SBSH 5F9JA 4H25A 3VFRB 4O00A 5C0DA 3O9WC 3PNWB 4A66A 2HT2C 3PAYA 3A21A 4Z3EA 1UM5L 2VIRA 2NUPA 5IFHH 2ZTBA 4HBCH 1AH1A 5DMIH 5FC9A 3VTMA 1A0QH 2BOLA 3Q3GB 4KKLC 3GSOA 3SN6N 4ESKA 1RZPA 1J1PL 5GRJH 4G9FD 1CGTA 1HHGB 4WHCA 1RURL 3ULVC 2Z65C 3MN8A 2BCMA 3FS9A 4JQVA 3RVXC 4TLUA 1XAKA 4IRJC 3KPTA 2B16A 2HUEA 3MRFA 2YAPA 4R96B 2C9UA 3LZNA 1KACB 3IJEA 3ZE2B 1XF2B 5EU6B 1UA7A 4OLZH 3VGDA 4AVJA 4OQTA 2YPVL 3GHEL 3MGOA 5KSBE 3F7KA 1DVSA 1BLNA 3IJYA 1QO3A 3P11H 1SVZA 1FVEA 1F90H 3UYRH 5C0BB 4P2RB 3N6YA 4TV3A 1MSPA 4JVPA 4LU5L 3G9VA 1F00I 5FF6A 3FKUS 4I0PD 1MCIA 3BPOC 3GDBA 4KVCL 3PHQB 4HD5A 3L1GA 5F7BA 3VU1A 5EORL 4DP0X 4XVTH 3HKZA 4JFDE 2BSRB 4XI5D 1JRHL 1A6ZA 2BP3A 2WY3B 4OJFL 1Y7VA 4U6XA 1NGQL 3RDJA 5ANHA 5C2BH 1FRGH 3MXVL 3O3UN 1ND0B 2PW2A 2V4LA 4WEUD 5D1QE 4LE8A 2R2HA 3G6JA 3R19A 5CLTA 5CAYB 1XCTB 5F44A 3GC3A 4HPYH 3QJUB 1T20B 5ILTL 1T04A 3ARYA 3IJ9A 2MTAA 3KYNA 5LJYH 1NFKA 4DKEH 2P80A 4W9KC 1S7QB 1PQZB 3ZRSA 4PB0L 2GTWB 1ILUA 2DL9A 2Y6SC 3WJLA 4X7FC 1JGVL 4X6BA 4LRIC 1A6AA 5KVEH 4LK4A 1CICC 4PP2B 1JUFB 3KH4A 2DJSA 5MEPB 5TTRA 2OTUA 5KJ7E 3QW9A 2EIMB 2DQUH 1XTMA 1UCBL 4NKOA 3OJDB 3DMMC 2KBGA 4HGMA 4NJAL 2PNDA 5TFSH 1OM9A 1NCUA 5F1IA 4K23H 3LN5A 1OP3K 1C8QA 5ABZA 1UUSA 1S8DA 3LS5H 3VE0A 3WLWC 3ZDZE 1DLFH 4ZUUB 2UXVA 2X9XA 3FOMA 1MDTA 4MXVF 1T5WA 1XBRA 1U8QB 2EILB 4I48B 4F15C 1B4TA 5I5JA 1JXKA 1WIPA 4NLAA 1GAFL 3CHQA 4HIXH 2V9RA 4JFFB 5DWUL 2A9ML 4G8EA 3BUBA 3RVTC 1SVBA 1NUNB 3DTDA 4PTTA 1MLCA 4C56D 5T3XH 3GSNA 5CZKA 5DK2A 5DT1H 2F7IA 3FL7A 4CJ0A 3FB6A 1HINL 3I6GA 4U33A 4KKRA 1P6FA 2ORBH 3HB3B 3N43B 5LGHH 1O7DE 2RD0A 4HLZG 4G9FA 4RMRA 1BD2E 4JFQA 3U7WL 1YNTB 3N40P 1NGYA 3RWDA 2NY2D 3L3OC 4A67A 5JW5A 3GBDA 1PKQB 5KS9F 3C5ZB 4Y0GA 1AE6H 2X9WA 1GGIH 3ZPDA 1EVTC 1H3UA 1D7FA 2LFEA 2ZCHL 1U92A 2W07B 1HQRB 1AGDA 4TNWF 1U8PB 2VDLL 2XI9A 1MVUA 5ICUA 5EO0B 2AZAA 5I1JL 1DZBA 1SYSB 4KI5E 5IBUB 4ICWA 3O6MH 2GFBB 1B2YA 2PYEB 4JG1H 4XBPB 3VQ1C 3O41B 3U1SL 4L23A 3K6OA 2FWSA 2WCSA 4JCWA 5G5DA 3SDCC 3H9SE 3TTSA 1NMAL 4XN7A 1YEKL 4OZHA 5IB4A 5EOCJ 2FECI 1XF3B 4FKEA 3U36B 2PXYD 1KBGL 4GAAA 3DVNB 5I18H 3GSUB 3HG1A 5KTEL 1K9TA 1F11A 2R8SL 2YUZA 1D9KD 4KJPD 12E8L 1K5NB 4DCQB 1OAUH 1N64L 1QBAA 1JF5A 2W92A 3L9RA 4HAFA 4PWFA 1KXTA 4APXA 1B4JH 4QPEA 3BO8A 4M03A 2MOVA 1TTAA 1LLAA 1MFCH 2X9ZA 3CU1A 4UUJA 1BX2A 5IB1A 4GW1B 3US9A 3V4PL 5L0QB 4IIQB 2Y72A 4W9LC 5ESAA 5JDSB 3ZKMC 3CWGA 2TAAA 3SBQA 5DGQA 4B41A 4LGPB 4RESB 3UJJH 4HA1A 5DD1H 1G7MA 3D18B 4XP6L 1I31A 2ICCA 3NJHA 1UYWL 2CBOA 3QHZH 4UQIM 3I9PA 1PZDA 2DWDA 1XT5A 5AW6B 3OLDA 3QDGD 3TN0A 1MJUL 3STLA 2WGXA 5EBWB 3I50H 3PABB 4XXDA 3NCJL 3MNDA 5CSGA 1KCUH 4PGBB 4TNWK 3AGVA 3WTYA 1Y0LB 2A9AA 4IGBC 2BSSA 5D1QC 2UXGA 5IKCA 5BZWB 2XKNB 1HIML 2PP8A 3A6BH 5HHOB 3ZDYE 4YIQB 4TTGA 5INCB 2J72A 1A1MA 4JPIB 5DZLA 2BIQA 1T3FB 4D9QD 4Z7NE 3BYTA 4PJBA 5DU7A 5IUSA 4ODSL 2NYZA 2VSKB 1HHJB 2AEPH 1XGTA 3C6EA 3D12B 3GJFB 3C09B 2WLNA 4M93C 1GPOL 5FXCH 3BMWA 3KJ6H 4LCVA 1TENA 4AXWA 3CMGA 1DDHA 4IOFD 1OQOA 1DUYA 1MAML 1U3HD 4UQ2B 3NDZE 4WU7B 5A2KH 1RI8A 3CFCH 1AGFB 4JO1L 4X4XB 3VRJB 4BWWA 1HNFA 3MV7D 4E9QA 4GAYA 1P1ZB 3LKQA 4LOEA 4Z7WF 2WN2A 5CLWA 1UA6L 2VLRB 3FQ2A 4HF5H 5HTSA 1GOGA 3QWOB 3S5ZA 2GYSA 4RBPH 3T2NH 4ABUA 1CD9B 2QQKH 2XVBA 3CXDL 3LVTA 4MZIA 1RK1B 5LQBH 3WTVA 5L8KB 4ANVA 4M6OL 2CLRA 2JKIS 2NZ1A 3PFUA 4JDTL 3R06A 4RDBA 4KJWC 5FUZL 2VUKA 2FIRT 1C5CH 1VGKB 1FZOA 3BEWA 4KMLB 4Z7VA 3CDGB 1H8NA 1JPEA 2Q8BH 1YEIH 5A2AA 1J1XL 4PS4L 4NXKA 4UIKH 1CTOA 3HZKA 3V6OA 1AVAA 2P5WB 3GMQB 3P9WB 4NGHL 5DCCA 1I9RH 5D7KE 1BXXA 2FGZA 1WFMA 4HSQA 3KGRA 1M3IA 5HJ3B 3GNMH 1NFDB 2E74C 3L9YA 2MNWA 3MLWL 4S1RH 3RWEA 1CK0H 1O7DC 5C0CD 1MY7A 3NCYP 4NDMA 4UOQA 4PPTA 3WY2A 4RMTA 3V52H 5AB9A 4PJ9B 1X4ZA 1OAJA 2AMUA 4DAGL 1TVBB 4HKBA 3H42H 4AV4A 5LNDA 2FHBA 4YDKL 4I18B 4FULA 3KLKA 1FJ1A 3CLFH 4WWOA 3T1WA 1OIOA 3AREA 4KI5C 4BEIA 3QWQB 4ZAKA 3FFOA 4XNXH 1GZPB 3BWSA 4I2XA 3BZ4A 5I9QC 2O6FA 4L4VB 1KB5H 3ETBJ 4G8GE 2J2ZB 4O02B 1Z5HA 5T5FH 4NO2B 3TJEL 5ERWB 4JDZB 5I0VA 4NRXA 3FB7B 4XGZB 3IAGC 4PV8B 1UJ3A 2O30A 4G7SB 4DT2A 2YD6A 4GMSL 2H2PC 3AG2B 4TPRL 4AM0B 4FYQA 4H13C 4WRLA 4AV0A 3CH8A 3UTTD 4NM4H 3QUKB 3MYZA 5TE7H 5CEZE 5ANMB 1E2ZA 3O4LE 3TV8A 5BOZG 3A4FA 2VL5B 2G2RA 1XGZA 2EDLA 3QHFH 1HHIA 3VD0A 3MBEA 5JPMB 4HULB 3UBXG 3FULA 1FZJB 2JELH 1Z2KA 4Z78B 4YHIB 3BX7C 1H3TA 3ZJAA 4K0OA 2J1YA 3WFZA 4FG2A 4LVHB 3QDJB 5BS0B 4L9DA 3QPQD 4HWZB 1F4YL 4BFFA 4PVBA 3AB0B 3L9BA 2IXQB 4AQAA 5EFIA 2CO2A 1WT5A 3HNSL 3IU3B 4TVPE 1NMCB 1UOLA 4GG6A 1E5CA 2G5UA 2GKIA 2F7OA 3FH8A 1LQSR 3QEQB 1LD9A 3D0VA 3MR9B 2CUMA 4QT5B 3DV4B 2LE9A 4I85A 1TCMA 4KPHL 3OQRA 4PD4K 3GJFH 4FFWD 1S9WB 4JY6A 5E9NA 4NHUB 2O1AA 2HKHL 1JNLL 1ZVSA 2CK2A 1MUJB 3CFJA 4G6JH 1KWKA 3MJ6A 2VMJA 4GJTB 3TJHD 4AVIA 5HYFA 3P3SA 3QJHA 1D5IH 4IBVA 1JI1A 1T22A 3F3HA 2W60B 2WJ7A 4HXAH 3FTVA 3FQRB 1M42A 1JYWA 4P4RB 2B77A 3KDMB 5HHQB 3KYKL 4PBWD 4P8QA 3JWNE 4A6YB 4NQSB 2HJKB 3CFKB 1NL0L 2J4WH 3O0RL 3CN4A 5HXMA 3LZPA 2R56L 1IGIH 1ADQH 2FLRT 2NYYC 4J4PA 2WQAA 4BYHA 1CI5A 2PP7A 3D2UB 2JCCA 4P5MA 2EXSA 2H6UA 3I02A 2Q7YB 4KZDH 2AV7A 4L4TD 3SDDB 5JXAH 1UWEH 2DJUA 3S3CB 1A1OA 3OKYA 4AIZB 1LWJA 3V6FA 4B0MM 1MCCA 4L1HA 4QKXB 5BRZE 1S5HB 3VXUE 4GBXA 3NN8B 2AK1L 1IKFH 1RZKH 3C08L 3BPCA 3GK8H 2ZXDA 4FTVB 4M5ZL 5AZUA 4G59C 3X1NA 1BZ7A 1BPVA 2L8AA 4YFLI 3QZLA 3PDOB 2VR4A 5K59E 1X9LA 1CGVA 4BFEA 4CBPA 1NAMB 4ONGL 5D1XD 4IRJB 5BVJA 4YDJB 3Q2CA 1I9JH 1BDYA 4XOBA 5F8RC 2V2XA 2WMPA 3PJNA 1OTSD 4MD4B 2B3IA 2BNQB 2DMHA 2ZCZA 4YDVA 2EVHA 4LHUB 3AY2A 1CYGA 1SJVA 1SJEA 3DXAD 4X5LA 2BVTA 5ALCL 4KHXL 2FNWA 4O02H 4PRID 2NW2B 3TVMB 3ASNB 3OB0H 4W9ZA 3B9AA 4EJ1C 1QYGH 4EZLA 5I8EB 4LSRH 1JIBA 4RAUB 5I5MA 3U46B 1A3RH 5EOTA 1MFBL 2IALB 2MFNA 2OXHA 2WXNA 1E2VA 3IJ7A 4K55A 5AVXB 2HN7B 2PYFB 1B0RB 4FI8A 4XPBL 2FAUA 5LDSA 1J05A 4FQLL 3QYNA 3RGHA 4D9RD 1PIFA 2XICA 4NUMA 5IROC 4Y88A 1T0OA 4F2MA 3RLSA 5HY9B 2A9NL 3WMQA 4DGVL 4YQXL 4LLUA 3F5WA 3ZQWA 3OLGA 4YL4A 1R3KB 5C0JB 4YPJA 3L3IA 1UXSB 1KJ3H 2QLVB 5CEXB 2UZIL 1MCQA 3GMLA 1XFPA 2AJYH 4KRLB 5FM4A 5C7XH 3RFRA 3P77B 4P46C 4GT7A 2X2IA 2MJWA 4XB8A 3H0TB 5JHDA 3WDJA 3GRGA 4N1EA 4QGTA 4NN6B 3OKNA 4NNXA 2IDCA 3F04A 3ZTEA 3D0LA 5T33H 1EA9C 3UABA 2WYHA 4EDXB 2XOTA 4PW4A 4IRZH 5LGKA 3SCMD 4MD5A 4F57L 1ES0A 5HPMB 1SVCP 1CYWA 1R3JB 2E9GA 4I3RH 3PAUA 3MCYA 3DDFA 5CZRA 4D0CA 1HSAB 4AKQA 2V7NA 3VFMB 1XIWA 3U82B 4F15B 2ZUWA 2OPCA 1T80A 1U30A 5FCUH 2VDML 1HH6A 2X6UA 1BQHB 4PRAB 3SKMB 3GXTA 4L4TA 3WL9A 1OAZH 4A6YH 3HI5H 4HWBH 4UT6A 2YMXH 5I1LA 1BVLB 1R5VA 1MFDH 2ESVD 4PFEA 4ZRGA 3N85H 1KXQE 3D85D 2JKRM 3WFDH 2YRBA 4PWHA 4NB7A 4DQOH 4LCCC 4PJXA 4KFZC 1I3RB 4ZFQA 2XG4B 2DKUA 4DEPB 1SEBB 3B9KB 2QTVA 3L3OB 1W80A 3JWNC 4C83A 1J48A 2XWEA 3EBAA 5LAXA 4NFDA 1WAPA 3NOIA 4FQQA 4UINL 3OAWA 2AJUL 4GS7C 2WVUA 4WW2F 3T1FB 3OKLB 2R39A 4HYTB 4JKPH 2FZ3B 5EPMA 3GKWH 4QRSA 4PIBA 3ULVH 2R7EB 1I7UA 1ZA6B 5J12B 4L3ED 1NAMH 2TSBA 1NIBA 1KYUA 1YECL 2CGYA 2CK0L 1HHHA 1KELL 1BM3L 3RA7L 4DVRH 3U2JA 5B3NA 5CBAB 2K4AA 4YXLL 4HOZA 3VJ6A 2V9QA 3QZBA 3WFEL 5IHWA 2CRZA 1PG7X 1JHTA 1AHWA 5EHFA 1YRKA 3MUZ1 3O2DH 5CCHE 1BA9A 3OXRA 2E0PA 2BS9A 3D3VD 4Q56A 3VMPA 4K5MA 1PG7W 5K9KB 4IRSC 1TFPA 1ZHBB 4XWOD 4K8RH 2VXUL 2ITCA 1F56A 2PTTA 2VJ8A 1XSIA 3PIQB 4XO9A 3MJWA 5MERB 3QSKB 5C0AB 3R8QA 2JI2A 1QUNA 4QXGL 3BIBX 1FFPB 5TF0A 3BQUC 5JIKA 5AG9A 5IJDC 1F58H 1AI1L 1TZHA 3NK3A 4NZFA 3B8SA 2RA1A 4M6AA 3PP3K 4C57C 2CR3A 3CH1A 1DYZA 5FECA 1YMHB 4BKTC 5CZXC 1YY9D 1WISA 4PY7A 2IPUK 4M48H 1A7OL 1ITBB 4X42A 5C9JB 3DOHA 3OM3B 5I74C 2EUVA 3IDXH 3DURB 1A4JA 2Z7WA 5LCVL 4UQ9A 2EH7L 1IM3B 3TBBA 2R0WH 3FN3A 3JQOB 1QR4A 4IGBB 2FD6H 4TLTA 5D1QB 1RVFH 3W0WB 1BECA 3U9UA 1YNLH 1FUNA 2WTRB 3NG5A 4G1EA 1PDKA 3QXDB 2B15A 3GTTA 2H8PA 4NS0A 5PCYA 1W72B 3HUJE 4MJ5B 4N0FA 4H8PA 5HDQH 4ZQKB 3F62A 3G3LA 5E8OB 4LQFH 3IKCB 4M93B 5SWQB 3GS4A 3MLRH 1G1YA 1S9YB 1J5CA 4UNTA 3JUYA 1TQTA 2ESVA 1T6WA 3TNNA 1ZGLA 3X13B 1U8JA 3MV9D 3KE0A 2F08A 1FNAA 3NZ8B 2D4FA 4P99A 5CU5A 3QQDA 5EU4A 2F54D 1PGRB 3KBPA 4LLMA 5IHUL 4Q0XL 1QSEB 3T3PE 4LPTA 4RLDA 3ZOAA 15C8H 3GSXB 3BZDA 4NBYB 3BP5B 4JCMA 1BXVA 5EO1B 3TIDB 4GAJH 1GHFL 4BZ2L 1EK3A 3TASA 3L4CA 1IC4L 1JERA 3WUWB 5KS9E 3LXCA 1OEZW 4XTRC 5F0MB 2UY7A 3H3PH 3RJDA 1VFUA 1LWHA 4D7PA 2GBAA 5KVDL 1YJDL 2KUTA 5D2LF 4F7EA 4K07A 3BUTA 4NWUL 1VF5C 1KN4L 4X8GA 2F2HA 4MQTB 3RPIA 2R23A 3B9VA 1A14L 3MNZA 3MGTB 1A4BA 1AMYA 3CFMA 1UT2A 4OFIA 3NFSH 4LFHD 3IETB 3W11D 1AMXA 1U91B 3FHAA 3QUZB 1A9VA 1I1AC 3V79C 2DQIH 5HI5D 1ORSB 5DSCA 4LMQI 3TT3L 1M1XB 3T0EE 2Z0BA 2EADA 3KS0H 3POHA 4N85A 1AR1D 4YUEL 1OAXL 5GRVL 3UAJD 4URKA 4PVNA 5FA3B 3U6RB 4CDGC 3QIUA 4Z7UF 1MJ8H 1SXBA 2XDHA 3EJJX 4DP1X 2HFEA 1NCDH 4JJOA 3AS1A 4QCIB 3SGJA 4P4KD 4UTBA 2IADA 3U6XS 1BMZA 2ICEA 3ISRA 3MODH 3FCSA 3I9GH 4XVJH 4XPGL 3DX8A 3ZYIA 4KQ4H 1P4IH 1VEMA 2CR6A 2HTLC 4I89A 3GIVA 4N2EA 3KPSD 2NPLX 3C5SA 1RZGB 1H6EA 4BBWA 1IL1B 3VGAC 1MCBA 2VM4A 4N8CH 3FAXA 4UDTA 4N8PA 5DZ9A 3TBVA 3N42B 1O6SA 4QHKJ 3X17A 5IFJB 3QO0A 2O93L 2KH2B 1AD0B 4JO2H 1YDPB 2LU3A 2ID5A 3IXTB 4BFRA 2JLLA 4DPCX 2PR9A 2VDOB 1KTKE 3DIVA 5LGJB 4YXKL 4N8VA 5F1NA 4RNRA 2V5SA 1LK3L 2PETA 1N3NB 2ZUSA 2P43B 4JFHE 4X9HA 4KKAC 5KANG 3HC4H 3B6SB 4FNTA 4IOIA 2XQYG 2ZP0T 3GLZA 4QF1A 4JM2C 1IEBB 1G7LA 3T9WA 4ZDHA 5LNGA 1NCHA 2CGZA 1OE1A 1S2EA 2WBXA 4KITB 3WO4B 1RK0A 3ELQA 2XBZA 5EZIH 1IGFH 4IOSA 1W15A 3H4HA 3MV9A 4K5OA 1MI5D 2HFGL 4LHUG 4BQBA 1G6RH 3HZYB 4DPRA 1O6TA 7CGTA 1RP9A 2XXFA 4LCWD 2YMOA 2F54A 1BYNA 1E4WH 2QQLH 2VZ3A 2V2TA 2W0FB 3VXQB 4TULH 1WJ3A 3EYUH 3IDJB 4BZ1A 1AG6A 1JXFA 4OJAA 1OCWL 1MW2A 1D7CA 5DJ2A 3QZNA 2XC8A 3O6LH 4U1MB 5GRVK 5AZEH 1F6AB 4KUCD 2NNFA 3FO0L 1AFVL 5EU3B 1WBXB 3G6JF 3LJ3A 4L8DA 4R4ND 4ZK8A 1KIRB 5GGTA 5AW8B 2Y7QA 4FYSA 4JR9L 4LDEB 1KLUB 2H47C 2YSSB 3DYMA 3SY0A 1QHQA 4RH4A 5CD5C 2NYKA 1NQBA 4JHVA 3H6AA 2PPEA 3OSKA 1U3ZA 1KIQB 3RNQA 3UPAA 4ATWA 5D5MB 4E9SA 2HLFD 2V6HA 3U48A 4MXQD 3MOAH 2YS4A 4BQ8A 4XMKL 1IAKA 3UTSE 1WAEA 2BZCA 5DZJA 4N0RA 4Q9RH 2D3NA 1L7IH 1V7NL 2EIZA 4ZS7L 4YHYC 1TZGH 3ARDC 3V0GA 2YKKA 1OSZA 5EB9A 1HWHB 1EJOH 4P5RA 2WTOA 2WXIA 3B3BA 4AK2A 2GSIB 4ELDA 4P4KA 4P2OD 2CDEB 4PTUB 4QHNA 2BC4A 3MROA 4KXZH 2OSLA 1KEMH 2BP8A 4FQHB 5JW4Q 4WAFA 3ZX1A 3LHAA 3LNDA 3PWNB 5DA0B 1MWOA 2ZXBA 3G7TA 3GXUB 4ZPTB 1XF5A 5IWLA 2FUQA 1R24B 2IH3A 2IGLA 2NNAB 4OGAD 4WDIA 5B3SB 5I1GH 3IMUA 1CLZL 2AEQH 4H26A 4KVPA 4OZGA 1AQKL 4KXZI 4K5NA 5K93A 3EXLA 3UAAA 1IT9L 1SJXA 2K8MA 2FBJL 4WHYH 3BWAA 1FE8L 1DCLA 2BSED 2VXTL 2YPLE 2DKSA 3TZVB 4QLWA 2OAAA 1P4BH 2FNBA 2UY6B 3FCBA 4PJEA 4Z3HA 1VACA 1EHNA 4CGUB 1FAIL 1ZE3H 3T0EC 4K7FB 1PL3A 4WHTA 4ABQA 3FNKA 1J11A 2P5PA 3IDUA 4JY4B 4XXWA 2XFXB 3JV0A 4HUXB 3K71A 1INQB 5H4ZA 2FR4B 5HI3D 4MZRA 1OCCB 5FM5O 1OAQL 2QV4A 2X6MA 3BSHA 4Q6IC 4TTDD 5IT2L 3BKYL 4M8RA 2NZ9C 4MSWB 1MW1A 5EC2B 1JHKL 1LHZA 1GZQB 2J8OA 2VDOH 1BZ9A 3QDMB 5SV3A 4PJDB 3DVGB 3GMOA 5JPNC 1VERA 4Q74A 4EDWL 1UOWA 5ENWB 2DQTL 2B2XL 3BXNB 5AAMA 1A4CA 2IF7A 2ZCKL 4WU5A 4V1DE 3L3JB 5B1JA 1WFIA 2KKQA 2WINB 4LP4A 1JGUL 5CMAB 4WTQA 3ET9F 4JJ5B 1FLTX 3CVBA 2Z4QA 5B39B 4OZHF 3R18A 3UIYA 5J56B 4JBSA 3CIAA 5DD0L 4HJUA 1L9NA 4GSXA 2NW3A 2C1PB 4IMKA 4P46B 5EC1A 1VENA 4PJAA 2WO2B 3G5VB 3Q43A 4L29B 3RX8A 2IDUA 4G83A 1NBVL 2RCSL 4YHLH 5MP6L 1D6EB 2J1XA 3LHPL 3DIFB 4HMDA 3CVHA 4O9HL 1NANI 4DKAA 4EN3D 1UQSA 2CGRH 4WEEA 1ASOA 3KPOA 2DYPD 2BS71 4UOW0 3QUMA 4UM9D 2NTFA 4DTGH 2MCG1 4WJ5A 3MRCB 4G9DA 4BFIA 2IPTH 2ZCLH 1FNEB 3PQYD 3KVPA 2VABA 5DI8B 5HGDB 3UYOD 1N7MH 3V9CA 1E8ZA 3CZJA 4FQXD 5KVGL 3T08A 1FA4A 5F9AC 3NA9L 3ZT7A 3P73B 3VWJC 4AGPA 2DQCH 1XF4B 4JM4L 4XP1L 4P23A 3PWVB 5DUPH 4Z7IA 4KQ0A 4UT7L 4FFZA 5J1SC 5C08E 1A21A 4TVSa 4HJIA 4TRPH 1FP5A 2Y7SA 3T0BA 5CWSB 3UZEA 3IJSA 4AGOA 5F7DA 3DGDA 1VESA 1OM3L 3VWKB 1IBGL 5B7MA 2XWDA 4XMZA 4P2OA 2VLKD 4U1GC 4CL7A 1KCVH 4YAQB 4MQ7A 5AYUL 2VDNL 3LZFH 3E8UH 3NIFE 2EECA 4X7SH 2FQDA 2BSTB 1MJJA 4WO4C 2E27H 1GCFA 5C3TA 4U7MA 4NPYA 4MNGA 3QI9A 4PJBF 1WFNA 3L4TA 4K3EH 3HOGA 4OM0L 3V4LA 2AXJA 1RZIA 4GS7B 1OGPA 3S3SA 3EJZD 3UMNA 3SGDH 2KZ1B 1R3IH 4TMPA 3MA7A 3D0AA 4OD2B 3AM8C 1F4XH 3MRDA 4HMEA 3BDYL 4ATTA 2HAZA 1D7DA 3MRPA 4FLRA 4PMFA 5EH1A 3ERXA 2BZ7A 5E70A 1TIUA 4P9HL 1CT8A 2A9DA 5HYEA 1IAOA 4L8SA 4E9LA 1Q9LA 3KBHE 5HHNB 2X6AA 3MBXH 4CNIB 4PBDA 2IMMA 2Y7MA 4XVUC 4ZS6C 2PP9A 3BGMA 3HPLB 4J3BA 3EO1A 3OGCA 2I24N 3D39A 4LSUH 4Z7VF 3WUWG 2OK0L 3WE6B 4ELMA 2NOYA 4N2GA 4MMZB 5AUMA 3ZU8A 4HCRL 5A6LA 3NJVA 5C0FB 4F7PB 2LLLA 4QHPA 3TBWB 2FX8H 2E7CA 3FCTB 5DJ6A 1NBQA 1RJLB 2AK4D 2E7MA 3SYCA 4WCYH 4RX4D 1CIDA 1HDMA 3NP4A 5CGMA 1REIA 3CCHB 2GUOB 2WPGA 2H3NA 5I74B 1XGQB 5C0ND 1DVTA 1S7WB 3RWGA 1FBIH 1WZ1L 2Z7ZA 2MHAB 3T71A 4G80B 5J8OA 3CPLA 2HPTA 4PW3A 4EN3A 4Y4HD 1KPRA 3WY1A 2GJRA 2X4OB 3RI5F 4XPHL 3VG0H 1LTXA 4ELKB 3BN3B 3VXRD 5MI0C 1IC0A 4FZEL 2H32B 2IO5A 2RQEA 2VAAA 1EZUA 2JMRA 4KDWA 3U1PA 3V0AC 4Q89A 5CIPH 2QBWA 2VE6B 5E6ZA 1GIGH 3MLXL 2R29L 3MJ7B 3O3EB 3S37X 2XV6B 2OCFD 5ABAA 4LSTH 3FU8A 5JR1L 2HT4C 3BAIA 5MEOA 1HSBB 2MNJB 2O4EA 1SY6L 4R4BA 4BFNA 1KV3A 4LLQA 1WBZA 1YZZA 2AQPA 3IGUA 3AG4B 4OUUB 1DVFC 4XWGH 4ZI8A 3GSWB 3HNTH 3SIKA 2QGBA 1NPNA 3C8KA 1U6AH 1C16B 4LBEB 2KQNA 2C3WA 2L7UA 1R3HA 4JW3A 1NCTA 1JPFA 4NZUL 2YD8A 3QORA 4AYBA 4B3EA 1QW8A 4Y19D 3RBGA 3P4OB 3M7FB 2FX7L 5F7WC 3WV0A 4JFYB 2IPKA 4F3FB 1J18A 3BUYA 1C1EL 2ARJA 3FHQA 4U4IA 5HGHA 2A6KA 5DHEA 2DICA 3TEZA 1WVZA 3WNJA 5AFAA 3ALXA 1E43A 3OC5A 1PZAA 4XCFL 4CW1B 4GG6F 1DO5A 1IGCL 5GS0H 2JIXB 2QPSA 4JB9H 5JXED 1OZUA 1U0QA 4LSPL 2EVIA 4DGIL 1SHWA 1AQDA 1JZ3A 1G9HA 4NYLA 2Z1KA 5DJDB 1I1AB 3RY6A 2YD2A 4KRPD 4AW7A 1AJ7L 2X5PA 4XXCA 5DJ8A 3FTGA 1TEYA 4N4YB 1OAKL 5FV1L 5SWZA 1KB9K 4KJQC 3GI8H 4NKDB 4KTYA 4IDJH 3F84A 4L8CB 2B1AH 4FKKA 4H8VA 4ORGA 4XP4H 5L8LB 1FNSH 2D7QA 3U9PH 3ZQXA 4P57A 1SDYA 4OFDA 4EVNA 2YKLL 4FQ1L 2EACA 4QRRD 2BNRB 3K91A 2Z35A 3ASWA 4HWUA 1EAPB 3P9MA 5GZOD 5HHXL 1OGAB 1YG9A 5B7FA 2WGNB 4NRYA 4AYSA 3VNYA 2K3TA 2AKRB 4OFQA 2AJZA 4FYRA 1BBJA 3Q2VA 4RX4A 1Q9KB 3S36X 1I1FA 4DK3A 4UYPA 3FZUC 1N5YH 2AXGA 1HXKA 2VM9A 3U0WH 4JFOB 4FNQA 1SUJA 4BH7B 3T6VA 5IW6B 2WCGA 5DO8A 1QR1B 2E76C 1TOXA 3QULB 5T3XD 2CH8A 2NCMA 1CB4A 4G7VL 1THCA 3ECBA 1HESA 4DP2X 4HCFA 1FNLA 4XO5A 2CQVA 2OA9A 3JYCA 2GY7B 3JT0A 3BE1L 1FL3A 1CFNB 4FI7A 1VDGA 2QPEB 5IF0B 3TEYA 2YD7A 3ZHLA 4XNMA 4WVRA 3W57A 2D0HA 5IB2B 1JCVA 3KPNB 3Q2WA 4H8WC 3ULSB 1AYOA 2HVKA 3JT2A 2D3VA 1A4AA 1UCTA 3CNKA 3CHXA 4ZUWB 4XAKE 5D71H 3HR5A 3WFHA 4OB5H 1NBZB 2WWNA 3ARVA 3TYFA 3KYAA 4O5LL 2H32H 1KPUB 1ZTXH 1O0VA 4L3AA 2CXGA 1ZK5A 3AQXA 5KBKA 2C8NA 5E7FA 2AABL 1OAYH 1BQUA 3VYOA 32C2A 3NIGE 5CILL 3ES6B 1L5GB 3RX9A 4R5TA 3UC0H 3QPKA 4FHBD 4YSOA 4XPTH 4YS4A 4FDWA 1RU9H 4MWFA 1JK8B 3B43A 3DK2A 4LKCB 3Q8BA 2EICA 3U7YL 4OF3A 2Z8SA 3DUSB 4JREC 4Y19A 5EF2A 5L88L 5D55A 5EU6D 2F19L 2H0FA 3QJSB 3HRZB 4XX1G 3PDDA 2JB6A 3FH7A 3EFOA 3OG6B 1PYWA 4LMQE 5TDOB 2QPDB 3EH1A 3PP4H 3C6LA 5C0BD 1CPUA 4GSDH 4P2RD 3HA0A 5J1AA 2WXJA 2B3RA 2NQDA 4YBHA 4BFGA 5ICZB 3G5XA 3P0YL 4HZLB 4PY8I 4U1NA 4UZSA 1DFXA 5D2LE 5LDUA 2IQ9L 3F6JA 3N41F 4BWTA 2D7OA 3IEAA 4U49A 4UTAH 4JO4L 2JXMB 5DQJB 2AEOA 1LP9A 4BD4A 4AL8H 2EYRB 4ANXA 1QI5A 3RAJL 3C60C 5K33A 1UD5A 2CHZA 3VXMB 5KN5B 4XPFH 4G5ZH 4F27A 1CFSB 2F53B 5I16B 3IGLA 5D7LE 2G60H 3ARDB 4UT6L 5EEWA 4GRWH 4P2CG 1XD0A 4QRQB 1Z32X 4P3DA 2D3LA 3BUQA 4HWNA 1SOSA 1RUAL 1MFMA 4TUKH 5KS9B 2FL5A 2YXFA 3TV3L 2K3HA 2FJFB 3HE7C 3LH9A 3IDIB 5A16B 1N10A 3Q5YA 2VMEA 5IP4A 1AC0A 4N1HB 1L0PA 2H4EA 5HHPA 5K39B 4WW2C 3KPMB 4JKNA 4LESA 2D7PA 4QWWC 2PCPB 3EADA 4RWHA 1ZY9A 3U2IA 2EVFA 2P8PB 1G9NH 2CIKA 4DESA 2IV9A 1TSRA 3T0EB 2YHGA 5DO2C 5A6IA 4GAFB 4KNSA 3THML 4PJXF 2A0LC 5DD5L 3S37L 2LU5A 1OP3H 1UKQA 2PF6A 3VGBA 4AEIL 3OG4B 2DLFL 2YQ3A 4H5SB 1FZKB 3CFBA 1BZEA 2J20A 1Z3RA 4PRNB 2DWEB 2X4TA 4JFFD 4TKWA 4CU6A 3V6ZB 2CO1A 4JQIA 3EGDA 3JWNG 1U36A 4KV5F 4N26A 3VFRA 1S7UB 2BPBA 5L2KE 5BO1H 5JPNB 3HS8A 5HD8C 2OW6A 4MCMA 5C0EB 1LE5B 4I3SH 4HOXA 4OIAA 4QNPE 2YPVH 3HB3D 5CZVL 2ZNXA 5IOPB 2YQGA 3UBXA 3T0AA 1IFRA 1Q94B 3AC0A 5IMOA 1HILA 4M3HA 4LU5H 3C5ZD 3FFCA 1QOKA 2OL3B 3L1OL 3UXFA 5EORH 1RZFL 1N26A 1JRHH 1AKJA 4OJFH 4G6KL 1TTUA 1NGQH 5EU6A 7PAZA 2YMTA 3ECQA 1QEWA 2PYED 3MXVH 4FEIA 1J8HE 2P8MA 3N50A 4RRPG 3FU3A 2EDDA 4LSSL 1RSFA 5DR5H 4NQQA 4YDZA 1BF2A 1JRHI 4QHUA 4DPAX 5TE6L 1K6QL 3ZDWA 4BQ9A 5FIEA 2NR6C 3QC6X 4FFVC 2WSPA 4H1LA 4G6ML 2YD5A 4LCIH 3NJGA 2H3XC 1R9FA 2VUOA 4Y5XC 5C0GB 3UPRB 4PB0H 5EBGA 2WWMD 3CHPA 1ND0A 1NEZB 4LB8A 3UTPE 1U8CA 3GBMH 4RFOH 2VUYA 3DHMA 3TEUA 1K4CA 2R2BB 2VB5A 4Z7WB 2KI6A 4ZNEE 2I5YL 1N4XL 1KG0B 3LEYH 4IU2A 4P04A 3ROOB 4A2HA 3I3BA 4DSYA 3SGKC 1T20A 4XHJD 3IDMA 4NJAH 1SZNA 3VO0A 1CVRA 3G5WA 4UNUA 1H3PL 4WO4B 1WZLA 2ZKYA 1QSFA 2CDGB 3O8XA 3RBSA 3FHEA 5FWRA 1D6VL 4GLRH 4GRMB 3ZDXF 3KR3L 4PYHA 3KPRE 2EO9A 3SOTA 4C59B 4PP2A 1ET5A 3CN0A 3MJ9L 4MNHB 1UKSA 2GPZA 2P5EE 5DWUH 5HI4D 1DSFL 2FWLB 1MPAH 5JNYA 1KZQA 4NCC2 4WWKC 1GYAA 3IGFA 4LPYA 5EF0A 1M2OA 1CL7H 1JGEB 1ZCRA 1HINH 5AW2B 5I1AB 3S7GA 3HAEG 4ZD3L 4HH9A 2R4SL 4ODUB 5HHOD 4YHOL 2WXOA 5EOQL 1XGPA 2EXWC 2Z6FA 3KWWA 2EXTA 2DI8A 3CHOA 2YAOA 4EEEA 1MH5A 5J1TC 4JFFA 3HMWL 4WI9A 2M8XA 3TIEA 3PXLA 1A6UL 1X5LA 1NGWA 3LKPB 1VGEL 3CZUB 4PREA 1BEYH 5FKAB 5GSVB 1B4LA 2VDLH 3ARBB 5T1LA 3AT0A 3DVFA 5KYYB 1UB5A 2UVFA 5EEXA 1F6LL 4ZX6A 1GYCA 1E9QA 3U1SH 1ONQA 2GW5A 2VLRD 2P7TA 5HJGA 2WBJC 3GD1C 5TGBA 1BJ8A 4LARL 4Z95L 5JQ6L 2H1PL 2V5YA 3C5ZA 2HMID 2FIKA 3MJGX 3MRLB 4H40A 1KT2B 5EEYA 1SXAA 3O3BA 1HCVA 4NOFA 1U8PA 3EFFA 4CSPA 5JHLL 4UCFA 2R8SH 2UX6A 4NI3A 1NC4B 3CHSA 1ED3A 2PYEA 4U6HB 2FYYB 1IQWL 3O41A 5BXFB 2Y5EA 4MCZA 1T4KA 1U8IB 2CPUA 5AKSA 2VH5L 4R3SB 2G9HA 2OL3H 5ESQB 1I85A 5MI0B 4UT9L 2P5WD 2M83A 2FJGB 2YK1L 4N24A 3BUPA 5FO8B 2OI9B 1BXAA 3OR7B 4HEMA 1XF3A 2QSQA 2XA3A 1OWRM 2XWTB 5E2WH 2MQ0A 4R7NB 1T1XB 1E5BA 4KMQA 2FO4A 3K2IA 5AB2A 4MQXD 1QZ1A 4K5LA 3VQ2C 1IFHH 1K5NA 1ML0A 2G75B 1E8YA 2BH0A 4G6AC 4HSAC 4JRXB 5ISZB 2PCXA 1LO3L 4PJ9D 4L3FA 5FGRA 1B0GA 4APQA 2IGTA 3K3QA 2WLIB 3IMBA 3M17B 3NFNB 3CFTA 1EHLH 5FDWA 4EI0A 1DVFB 4X4KA 4ZMTA 1E27B 2N0KA 2MCPL 2DQGH 1XSOA 2HH0H 2LFGA 4O2FB 4KC3B 4OLXL 1KIPA 1S9XA 2N3JA 4L4VD 3WKPA 4R5XA 3IRPX 1RIVL 3ILDA 1O6VA 4TXVB 5EZJB 2VLJE 2RR3A 1E3FA 4WEBL 4ODSH 4AQ1C 3K8MA 5DHMC 4H4NA 4KHTL 4JPQA 2IEPA 1IC7H 4PGBA 5GGTL 3L7EB 5FGCE 1GPOH 4WFGD 5C08B 3PJSA 2YAMA 4BA0A 1SDDB 1F2XK 4I9WD 4JO1H 1S7SA 5E4EB 4E0RA 2AHIA 5HHOA 4B9PA 5INCA 4NIKB 5E2TL 1GGCL 2XTJE 1UA6H 1FPTH 4H0IA 4I9XA 4NAQA 5AW0B 3KYMA 3QDJD 1WP6A 1FQ9C 5BS0D 1D5MB 1VA9A 1VADB 5C92A 4KI1A 4YEFA 3QS3A 1W0WB 3VRLF 4TLSA 3CXDH 1BBDL 2DEWX 3MLTB 3B2VH 2VXQH 3QEQD 4ZUTB 4JDTH 4HUUA 4ODWB 4CC0A 4K9EC 4MJJA 4XBEL 4OZIA 1AGFA 1DP0A 1HXYB 3CDCA 4LSVH 3X12B 1P1ZA 4NT6A 2FDBP 4F58H 3MOBH 4UOJA 1LO0H 1J1XH 3A3YB 3UEQA 3WAKA 4Y1SA 5K9JL 3B5GA 5ES4B 1A65A 1DLHA 1A7RH 2QGCA 4F7CB 2C3VA 4NGHH 1RJZA 1WFJA 5J6HB 2WB1A 3AACA 1T0PB 1OLZA 1CXHA 1R47A 4XMWA 1FL5A 3CZGA 5BW7A 1JWUB 3MLWH 1VGKA 5IM7A 1NCWH 3BOVA 3CDGA 4GKZB 2WZAA 5FO9B 5KG9B 4XZUA 5H94A 2ZWYA 2DQFB 5DJZB 1MELA 3AY4A 4X9IA 1HVXA 5DDHB 3ECVA 3BD5A 2CIIA 3D2UD 5I76A 4JNXA 2ICWB 3W82A 4XODA 5I0WA 2A6JB 5HJ3A 3WFCH 3SDDD 2D7TL 4UDUA 5D1ZB 1P5VA 4OZGF 4NQVB 3CX5J 3F85A 43CAA 4M7KH 3ULUE 4GKSB 5D96B 2HT2D 3DO7A 3WTTA 2K9UA 4WSGA 4PBVC 1WTGT 3O2WH 1JI2A 4RZCB 3TJEH 4FTVD 1SLXA 4G2AA 4PJEF 3S3PA 2Z64C 4MKTA 4N0UA 4PJ9A 5GJSL 4KKLD 3IKKA 5DRWB 1TVBA 5K5YA 5I1HL 1P2CA 4I18A 5KAQF 1NPJA 1I9IL 3E6FB 4TPRH 3ULVD 1KTDA 3IFLL 1BHGA 1U8MA 1YAZA 4IRJD 3ENEA 2CE6A 3R1GL 1KMGA 3A4DA 4WFHE 4W68A 2IJ0C 2XQBL 2CO6B 4YR6B 4NO2A 5T1MA 1ICTA 1P4UA 2BNQD 4XGZA 3BPLC 2Z7UA 4RMQA 4AITA 4LHUD 3QEUB 4BH8A 2ADIA 1MJ7L 4K8RD 5JHAA 1W8EA 2B59A 1QBML 2WP3T 4QRBA 2DMCA 3K6DA 4NQDE 3CN3A 3H3BC 3VXSB 3MGAA 4Q97A 1N6VA 4KKCD 3TVMD 4UV4L 2XN9A 3ETSA 1DVZA 5D6DA 3S35L 3TN0C 1QMUA 4PJAF 3C60B 5LNEA 2COQA 2NY5C 3BKCL 4C47A 2CKBL 2HKHH 1JNLH 4TSCH 4PJ8A 1JVLA 4FFZL 3SOBH 3DK0A 2DQEL 4LLWB 3RTQC 3HI6H 2V0AA 2F18A 3IFOA 4ENEC 5I15H 1HHKA 3L3KB 4L1TA 3QEQA 5HYJB 2JK5B 4B5ZA 2GT9B 2YLKA 2Y5QA 3MR9A 4NQCE 4E42A 4F91B 2ZXAA 5ETUB 2BMKA 3HE7B 3NCXA 2Y6SD 4KZEH 2BJML 2E9JA 1NL0H 3CVIL 4HS3A 3TF4A 2O72A 5CBEB 4WW2B 3BSZA 4DO4A 2C26A 3B3IB 1P7QA 5F7NC 2GBTA 5F7AA 3NEOA 4BRVA 3I6KB 5C07A 1NEZG 2XTJC 3QYCA 2DWSA 1KGYE 1JNHA 3FCGA 4NBZB 3FMGL 1XBDA 4P4RA 4U3HA 5A3IC 5HHQA 4UAOC 4A2DA 3WLWD 2AK1H 3VTAA 4EIZC 5L9DH 2A4ZA 3H9HB 1BAWA 4M5ZH 1IC5L 1ET8A 2X4UB 1PPIA 5IB5A 5AD0A 2NY3C 3C12A 4OIBA 3VFWB 3QAQA 4B9ZA 1A4KA 1NLBH 1BLIA 2K4WA 5K1VA 2IBZY 5INDB 1FNHA 3QRGH 3O9WA 4OFKA 2OR7A 4PRHE 3RWHB 4AMKH 2IBGA 1XGUA 5CR1A 2VW7A 1YMMA 1KLFA 4AZ8A 2GJ6E 4TLKA 1SFDA 4ALAL 4B50A 3EG9A 3FFDB 5F3HB 2ZXQA 4GQ9L 3UROR 1V8HA 1N59A 1PZBA 4P5KB 3WJJC 4G70B 4R7DB 3QQ3B 3DUHA 3MLUL 4ANUA 3ILEA 3A5VA 4QHLB 1NDGB 1CFBA 1EUTA 3CXHJ 1R4XA 5ALCH 4IRJA 4JFZL 3B9EA 4PRDA 2EDFA 1UZ6E 4ODVH 4P06A 1E2WA 3S3JA 1EBAA 2B8OT 1KNOB 5CINH 1MFBH 3JWOL 2UZXB 1NCNA 2ERJC 1MXGA 2HRHA 4B6ZA 4YHML 4N6RB 5BRPA 2XACC 4ELMF 5I1IH 1QFWH 4XCNA 3ULUC 2OQJB 4RMWA 4J1UA 3MRBA 2NW2A 1EZSA 2ADGA 3IWVA 4OLVL 1JMXA 5B38A 4I1NB 2IH1B 4MJIB 1MG3C 2DAVA 3REWB 5CJQL 5E08L 4OI7A 5HPMA 3A24A 1D2OA 2VWEE 3K4AA 3RWJA 4IMLB 1WIUA 1UT9A 3QCVL 5IV2B 1CR9H 1FZMA 5C0AD 2OMVB 1CF8L 1DCEA 3HC2A 5IEHA 2YPKB 1P7KB 4ABVA 4NZRH 1NCCL 3ZRFC 4LNVA 3VQLA 1IAIL 1ANUA 5EUOA 2J6EL 1B4RA 2J25A 3MRNA 3HN8A 5CEXA 3NZSA 4F57H 2EUXA 2EEDA 4QO1A 2WXQA 3V95A 4PJGE 3PP3H 1WPCA 2XHNA 3PV6B 4HK0B 1OTTC 1EMTL 4LRIA 1QI4A 4YHPB 5D2LB 4FOMA 1WT5C 2BHUA 4PJ5E 1CICA 4JFDD 4ZOEA 3MMEA 4F5CE 1IM3D 1RH8A 3MA9L 2DQHH 4OAWB 5E8DL 3DMMA 1EJFA 4YXHL 4HKXA 3W9EA 2W65B 3QWRA 2GC7C 1KULA 4OZIB 4WWKB 4IGBD 5D1QD 3L1EA 1Z5LA 3B9DA 3W0WD 3SPVB 1O75A 4QRPA 5DVMA 4WI2A 2WQ8A 2OP4L 3LB6C 3WE1A 4HZAA 2WUBL 1OTUC 1E6OL 1KDIA 1A7PH 3AZUA 5F7EH 1I3UA 4NSKA 1HSAA 3QCUL 2CA3A 2X4QB 1F02I 3FF8A 4FJYA 1LQBC 3M45A 4Z7UB 3V5HA 4ZUSA 4D8PA 4HDIA 4U1LB 2NSQA 1LEGA 3GSVA 3SKMA 4OM1L 3Q6GH 3FQWB 4ZW3A 2PO6A 2YRPA 2Q2EB 3NK4A 2IWFA 5D8JL 5F9DC 1BVLA 4RA0C 3SQBB 3PXHA 1FWXA 4J4PC 2AJUH 3E9TA 4FAAB 4KX9A 5EZLB 2EC9U 1I3RA 1VAHA 2KYIA 2VLMD 3OBAA 4PGCA 4DZ8A 3T65B 4FQJH 4FA6A 3B2DC 1QSED 4FGMA 5F9JB 5KYXA 1SEBA 2R2EA 1Q0YL 4UQEA 1YECH 5C0DB 1KDJA 2BRRL 1G43A 4YE4L 3UAEA 1EJ8A 1QPKA 4EXKA 2VIRB 4Z76A 1X5IA 2NUPB 5I6KA 2YFOA 1IGYA 2ZG2A 4KJWD 2WLMA 2IV8A 2EAEA 3BT2H 3FO1B 4HHWA 1FDLL 1NUFA 2VXUH 1SBSL 4OFPA 3CDZA 2X6CA 2VZUA 1OT1A 2F5AH 4UQCA 3SDCA 4L05A 4HUKB 5L2KB 4JFSA 3MRFB 2CUIA 3SE8L 1XL6A 4QXGH 4QXWA 4LVNC 3QUZD 4HBCL 5JW4R 2CO7A 1A0QL 5CJ8A 1SDAB 3ILPB 1F41A 4NAMA 5GRJL 1BLNB 2OJEA 2YA0A 3IJYB 1QO3B 1L0QA 2XZQH 5JORA 2JVUA 1FVEB 2Y4SA 2ENQA 3VH8A 4AX3A 4E41E 2LT9A 1A7OH 4I0KA 2E7BA 5KJRH 4MNQE 2EH7H 2EO7A 3P2DA 4U6XB 5CP3A 4X6FA 1QLRA 2X28A 1YPZE 3BKMH 3QARA 2VGLM 5KSBA 1EO8L 4WGKA 1H8SA 3B7YA 4MD0A 3KPLA 1XH2A 4CVWA 2R2HB 3RNKA 3P11L 1F90L 2E3VA 3UYRL 3G6JB 3DJTA 2BHZA 1URIA 1HTYA 1S46A 3SE3A 2EUZA 5C9JA 3MV8E 1QD0A 1I8AA 4JFDA 4WFFE 3CQPA 4EI5C 2H2PD 2WQVA 3GLEA 3MQIA 3FC8A 3KPQA 2QQNH 3LKRA 4WEMB 2VWEC 5D1QA 3OX8A 1XCXA 3MC0A 2Q7NA 1AXIB 4BWUA 4X6BB 4NUJA 2W9EH 3VW3H 1A6AB 3SJVE 1A9EA 1CDYA 2OTUB 4GW4A 1W72A 4HPYL 1DHKA 1Q9WA 4P49A 1WWWX 2VN6A 2ZUQC 4NKOB 5E1AA 4EZKA 1FNFA 5E8OA 4OFYD 1RZ7L 5F1IB 4DKEL 3LN5B 3WCYA 4DP7X 1S8DB 1GGBL 3VE0B 4WIQA 2R69A 3FOMB 3TO2B 3B34A 3RFZA 1T5WB 5FYKU 1QLEB 3TH4T 2MQ3A 1MNUH 5KVEL 2PTUA 4P9MH 4PRPE 1YJDH 4HSCX 3EJUA 2MSPA 3D50A 1ZT7A 3VI3E 3Q8CA 1KN4H 4EBQH 4G8EB 1Z66A 4Y2DC 1BMGA 4PTTB 4WW1A 1IV8A 1MLCB 3GSXA 3GSNB 1XCWA 4PWKA 4K23L 3LRSB 1QG3A 3V2AR 4L8BA 5JDJA 4M5YH 3LS5L 3FB6B 4J12A 3I6GB 1DTUA 1EH9A 3WUWA 1U93B 3EF4A 3N44F 1OAXH 2YUWA 1HN1A 3NQIA 2WSDA 4G9FB 3HC0B 2R27A 4UV7L 1D5ZA 4HIXL 1CF1A 1NGYB 1UZ8A 4FXKA 4XHQA 4XOEA 3RWDB 2B9BA 4H0GA 2L0DA 5T3XL 2EYTA 2DLHA 5DT1L 1L6PA 1U92B 1AGDB 1XWVA 2DYRB 2H0EA 1INEL 3AWGA 4WZ9A 1MVUB 1UJTA 1MXDA 1GKEA 5LGHL 1RMFH 3ZQ9A 1BD2A 2IGFH 4LVEA 5IQMA 5G5DB 3AVEA 4OZHB 5IB4B 3KH3A 3EKCA 4ODXA 2R1YA 3HG1B 3IS0X 1F11B 4WUUE 3KYOA 1CDIA 1P53A 3NPSC 3O6ML 4JG1L 1IRAY 3L9RB 4XNQB 4M5TA 4X5XA 2ED9A 3LZRA 4FNRA 3LXBA 5BZXA 1EDYA 3H9SA 1KXTB 4APXB 3G9AB 3BO8B 5D7KD 3AMLA 3PPEA 1UM6L 2Q20A 3TZVD 1R0AH 1FYTE 1CUOA 1BX2B 5IB1B 4X4YA 3IXTA 1QTSA 5ESAB 3IMWA 3P3RA 2JKNA 4WI4A 2RAMA 3P0VH 1CYXA 1OAUL 3QJTB 3CFUA 4X9YA 1N3NA 1G7MB 3KWVA 2CCLA 2VERN 2NY0B 4F20A 2DWDB 1B4JL 2ZSWA 3TN0B 3STLB 1DBJL 3LIZA 3BP6B 4XXDB 1SBBA 3QDMD 3IK2A 4MXWH 3MLVL 3CFIC 3RJOA 3VFOA 1M7IA 1AXTH 3RTQB 3BAEH 4YK4B 1OCWH 5IROD 4LPVA 1ZEAH 3NBNA 4F8QA 2CSPA 4G8GD 4FADA 4PLNC 1OGTA 5DD1L 4NQEE 3FO0H 5DJXA 1AFVH 3NUKA 3TXAA 3QHZL 4NENB 1A1MB 4WI7A 4F92B 3GPEA 3HZYA 1V54B 2X88A 1DL7H 4PJBB 3PS6A 1ZHKA 3I50L 1KBVA 5E5LA 1XGTB 1LO4L 5GGSA 1GH7A 2FTAA 4UAHA 4JG9A 2W0FA 1KCUL 4P46D 2OMBA 5FGCB 2OZ4A 2WZPD 4AXWB 1DDHB 2Y23A 1DUYB 4FNLH 4W9CC 1G94A 4XMKH 4BE6A 3K4ZA 4GAYB 3FTXA 2XTJB 3LKQB 3JWDC 1KIRA 2HP4A 1YEFH 3MRQA 2VISA 3ABZA 1W0VA 2J7LA 4UAOB 2FSEB 3X11A 5TE4L 5FYJU 1LXMA 1AGCA 3GSNH 3CD4A 2MQCA 2CU9A 4MVBC 3KJ6L 5IJCC 2Z31C 2BLFA 2CLRB 3CQFA 2NSXA 4C54A 3S9DB 1I1YA 5FS5A 3EXJA 3GINA 3NJJA 3R06B 1AP2A 1XCQB 5F96L 3BEWB 2EE6A 4Z7VB 4DWHA 3RPBA 1KY7A 1SHSA 4Y9BA 3EOBB 4NC1E 4HF5L 4GXFA 2X40A 4IYKA 3VWKD 1AQKH 2HKFL 3HZKB 2QQKL 4OJDH 4TUJB 5KUKA 5DC9B 2VXTH 7FABH 5LQBL 3S2CA 2XN0A 1FL6B 4A63A 1FAIH 3RWEB 1BWWA 1C5CL 4ZPTA 4MRCA 5GS0D 3PY9A 4NDMB 3QIUC 4GOSA 2P3YA 2YQBA 3OF6D 2Q8BL 1YEIL 3NCWA 5LGYA 4XCYA 4UIKL 2H0PA 3BKYH 4HKBB 5D7EA 1I9RL 2HLAA 4W9JC 4X9BA 1JHKH 5CD3A 1FJ1B 1MCDA 3NPZB 2ERJB 4A2EA 1CXKA 1YAIA 3AREB 3EYVA 4ZAKB 2AJVL 1U8KA 4S1RL 3ROLB 2AQTA 3FUIA 1CK0L 4I2XB 3BZ4B 2B2XH 3IE4A 2CLVA 4CMMA 2FEEL 3OGOE 4JQXC 4LP5A 2ZCKH 4HUXA 2Q5BA 1INQA 3FU5A 1B9ZA 3HRPA 3V52L 1J5OL 3S5LB 4NRXB 1JGUH 4WENB 5IESH 3UZVA 1UJ3B 3H42L 1NOAA 4IRSD 3IJHA 3QIBC 3V10A 4MSWA 5TD4A 2IVFC 4OD3H 4R7VA 4XNXL 1NBVH 2RCSH 3P02A 1J87A 2V9UA 2E86A 2G2RB 3ALPA 3B5TA 3N06B 5IROA 2XIIA 1HHIB 4G8GA 3TH2T 3MBEB 4HHAA 4O9HH 4NHCL 4CMHC 3U6XA 2VN5A 5T5FL 2WD0A 2BXYA 2NTSP 4L0ZA 5CMAA 1A9BA 4ZODA 3RVUD 1FO0A 3WIIH 3II1A 4L5FE 4JHAL 4NPJA 4X4ME 1KJMB 5CZXD 4KQ3L 1BAFH 4AQAB 1J0KA 2WZPA 4AQZA 2ZP8A 5KVGH 1DE4A 3O4LA 4IS6A 4GG6B 4JRYE 2DTSA 2FO1A 3BC9A 4JM4H 3QHFL 3UGEA 2E7LC 3D0VB 4MA8L 4YWGL 5FYLE 4JRWA 1JZHA 2CUAA 2JELL 3II2A 1TYJA 4OGXL 3RL2A 2G5BA 4JY6B 5F8QC 5JYMA 3MRCA 1ZVSB 4KAQL 1M9SA 4FG6D 4RMBA 1IBGH 3CFJB 1CI3M 3KG5A 1AG0A 2PW1A 1SPDA 2VQ4A 4GNKB 3QJHB 5AW7B 5J11C 4JHZA 1T22B 4PCTA 2E56A 4NQCB 1CXFA 3PWVA 1DR9A 2ZF9A 1E7VA 1GW6A 5CJXC 4Q52A 4UOZA 4OZFG 4HS6A 3LNGA 4KROC 4UB0H 1M4KA 3QUYC 1HJCA 4G6JL 4OM0H 1D5RA 5E7BA 4AY0A 1KF9B 4LCCA 3S4SB 4P5MB 3W5MA 3Q9QA 3LS4L 1D5IL 2IOMA 3NVQA 3I02B 3STBA 2AV7B 1G87A 4N2AA 4ODBD 1SF5A 4HXAL 1A1OB 3VD2A 5CGYD 3QRBA 3V6FB 2BSTA 1JOIA 2ZWKA 3ILQD 4JUSA 4GBXB 5FFGA 2KZWA 3BPCB 1IGIL 4XTRD 5C0IA 3E9UA 1PZ2A 1UA3A 4OI8A 3ZMRA 4O58H 4JAMA 3FRPG 3MRGA 5AZ2H 4HWEH 4JFEE 2GABA 3HN5A 3GXMA 1X5MA 4KZDL 2CRYA 2F8OA 2JIXD 1CGUA 5JXAL 4CILA 1UWEL 3F12A 4OZIF 5BVJB 3KS0J 1FG9C 5DUMH 4YFEA 1QZNA 4NC1C 5BRZA 4LP8A 2V2XB 3VXUA 3WSQH 4CAGA 4D0DA 2AS5M 2WMPB 1IKFL 1I1AD 2I69A 5SX5K 4BGLA 1X5HA 1J8RA 2ALWA 3B7TA 3UZQA 1MCRA 4YDVB 4XN8A 3C2SA 3O81A 3EDEA 2H45A 4IRSA 5HHNA 2WKGA 1WZAA 4BHUA 1MCKA 5GPRA 3WS3A 3FUDA 4CNIA 1SJEB 1J1OL 4KTGA 1EANA 5KBPA 3CPUA 1RUMH 2C4FU 5G55A 3IFNL 3K2UL 4AJ0A 1GC1L 1CXEA 3N3EA 2SEBA 1I9JL 1MIMH 3D07A 3SQOH 4EZJA 4OV5B 2G2PA 1H6FA 1VFBB 4AQ8A 2HTLD 3BQUA 3WS6C 1AKPA 2YD9A 2BNRD 1FVDA 1GKOA 4MZ2A 5EOTB 2OXHB 3TBWA 1OGAD 3ARFC 4XPHH 1MCLA 2VQTA 3GIZL 2GTQA 3SKNA 1J05B 2VXSL 4U2YA 4J23A 2RTTA 4RZKA 2FEDC 4F2MB 3LQAL 4OZ4A 4GQPH 1PZ3A 4G8FA 1IX2A 3F5WB 2MOGA 3MLXH 4LLUB 1QYGL 3BZFA 4LSRL 3L3IB 2IDTA 3N41B 5FKPA 1S3KH 2VZSA 3GMLB 4GY4A 5JR1H 5IW1A 4DN3H 2K0RA 1SY6H 2O6CA 3EO0A 4IMKC 1HEHC 5M95B 2ZOTA 4QMEA 4BUGA 1PLBA 5JHDB 4NNXB 3OKNB 3BKJL 4L0YA 4ZQTA 3FH5A 3D0LB 4WKZA 2ZUQB 1RJYA 1WTLA 3U0PA 5GRZA 5KYWA 1KJ3L 3CC5A 2Y24A 4HKZA 1K5WA 4J3UA 2OSWA 1ES0B 1RLBA 2AJYL 4PLKC 1HSBA 5C7XL 5DZPA 1DBBH 1HE8A 5F21B 1PLCA 3L4XA 3HAEA 1XIWB 3MXWH 4GKLA 4R5VA 4OUUA 3ZMEA 2D7NA 3WKQA 1M2VA 3CN2A 1HH6B 5T33L 1IGCH 1JP5A 3RWFA 3WL9B 1A6WH 8PAZA 5I1LB 2PUQT 4LSPH 3VFNA 1R5VB 5IK3A 3SHSA 3T6QC 4JFYA 4AZUA 3PFQA 3V0DA 4I3RL 4PJXB 2EVGA 2B4CC 4LSDA 2X6VA 3US0A 1ZIAA 2I27N 2ZD0A 3GI9H 9PCYA 1KGXA 4ZFZA 2ZX7A 4N0YL 2NY6C 3D4CA 5CD5D 4D0BA 1OAZL 2HFFA 4A6YL 4C83B 3HI5L 4HWBL 4UNVA 2YMXL 5LAXB 5BQ7A 5JW3L 2DI7A 4F37F