2IH8A

A low-dose crystal structure of a recombinant melanocarpus albomyces laccase
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A crystallographic and spectroscopic study on the effect of X-ray radiation on the crystal structure of Melanocarpus albomyces laccase.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
molecule keywords Laccase-1
total genus 184
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A03
1AANA 4DP1X 5B7FA 1B3IA 1WA1X 2J57A 3PLYA 3ERXA 1GYCA 2HX8A 1URIA 3GXUB 3UAAA 5I28A 3WNJA 1CURA 2YXVA 3TBCA 3X1EA 2I85A 2UX6A 1WS8A 3NSFA 3BQVA 3NT0A 2B08A 4UANA 4KNSA 4YSQA 3N2JA 1W6WA 1SHWA 1PLBA 1QHQA 1BYPA 4BWWA 4DP2X 3HEIB 4FA7B 2MRYA 5B1JC 1A4CA 3PAUA 1NIBA 2CAKA 1AR1B 2BP0B 1BQ5A 2NRDA 1BAWA 2UXTA 3ABMB 3FQ2A 2LLNA 1UATA 1SF5A 1ET7A 2YAQA 2CJ3A 2IH9A 3GYRA 4BDVB 1OOWA 1V54B 3JT2A 1GY1A 1PCSA 5I6LA 1R1CA 1PAZA 3QJSB 2OJ1A 1XB3A 2BW4A 3RYMA 1JXGA 3DTUB 1GR7A 2XXGA 4MFHA 3FPYA 2QT6A 4YSEA 1BYOA 2UX7A 3SBPA 4EF3A 1I53A 4E9WA 4F2EA 3FYEB 3EHBB 1OF0A 3NJKA 1AZNA 2MTAA 3T9WA 4JHUA 1KDJA 1W6LA 2Q9OA 2J5WA 1KDIA 3TA4D 4FAAB 3OMAB 1NIFA 3FU7B 3CVDA 1OE3A 1PMYA 2WSDA 2W88A 1JZEA 1ZDQA 4A68A 5E9NA 1NINA 4KNTA 3T71A 4BWTA 2I7OA 2QDVA 3HB3B 4AKQA 4A2GA 1BQKA 2PPCA 5PCYA 5I6OA 2FQEA 4BK5C 5I6MA 4F2FA 1J9QA 1WAEA 3UAEA 2YAFA 3MBWB 3S3BB 5I26A 4DPAX 1E30A 5TK2A 2J56A 1KYAA 3NSDA 2H47C 3FQ1A 2BP8A 4P5RA 1AAJA 1NDTA 2EINB 1BXUA 2ZXWB 3JTBA 3WG7B 3CZUB 1J5CA 3WI9A 4WTQA 3NJGA 1JZJA 1J9SA 4JKNA 1F56A 1E5ZA 4KO7A 2HZHA 1MDAA 2IDUA 3CG8A 3X1FA 2PPFA 2YQBA 4YSUA 2BZCA 2N0MA 2TSBA 1JVLA 1KCBA 1NIEA 3WKQA 4PCYA 2XVBA 3FPXA 1E5YA 6PCYA 2I7SA 4KO6A 9PCYA 4YVUA 2WO3B 2PCYA 4HAKA 3QJRB 2QDWA 2DY2A 2R7EA 1WA2X 1M9WA 1A8ZA 4TXVB 2YAPA 2VW6A 1XB8A 5F7BA 1GS7A 2AANA 7PAZA 1KBWA 4E9XA 2BHFA 3DIVA 3UABA 2XXFA 1A4BA 4DPBX 2Y69B 3CDZA 4ENZA 1BEXA 1JZIA 1OV8A 4DP6X 2BWIA 2GSMB 2R7EB 1JVOA 1PZBA 2P80D 4W1TA 1BQRA 2GIMA 1E67A 3NJLA 1AZRA 4E9SA 3OD3A 2HXAA 4GYBA 5D4IA 2PPAA 3X2QB 1ASOA 1ETJA 2HRHA 1M56B 3UADA 2XX1A 5F7AA 4KOBA 2AZAA 3EF4A 1HFUA 1AACA 4KO5A 1GS8A 3NJMA 2BO0A 3FSAA 4KNUA 3PAVA 2GHZA 4A2EA 2JKWA 2AFNA 3FT0A 4HCFA 2VSKB 2W8CA 2PP7A 1RZPA 3H4HA 3T6VA 3QJUB 3WIAA 1GW0A 4CSPA 1FA4A 1NIAA 2XLLA 4YSCA 5D4HA 1AG6A 4E9VA 2HX9A 1V10A 2IWFA 1A65A 1AOZA 2XU9A 3CDZB 4X4KA 3OMNB 1AS7A 1MZYA 3AG3B 1AS8A 1L9TA 3S8GB 2ZWNA 3NJNA 2XUWA 3T6XA 3C75A 3FU9A 1NPJA 2PP8A 2VMJA 4M3HA 4DP8X 2H3XC 2IAAC 4YSRA 2AZUA 1JOIA 4WKXA 4Q89A 5AKRA 3N55A 1L9RA 1W8EA 2BP8B 1T5KA 1AS6A 2EIJB 1IBYA 1X9UA 2VW7A 1SDDB 3V9EA 3ZDWA 3X1NA 1NIDA 1L9OA 3PAZA 4A2DA 5I5MA 5B7EA 4A2HA 4AKOA 2PLTA 3KW8A 4KO9A 2EIKB 4DP4X 2AVFA 3ZX1A 1PLCA 1ILSA 1KV7A 4NB7A 1L9PA 2XX0A 2RACA 1A3ZA 1NTDA 1OE2A 2Y1AA 2HX7A 1OCCB 1DZ0A 3H56A 2P80A 4AKPA 2XV3A 1SDDA 4YSDA 3NSYA 1IKOP 3FSWA 1TU2A 3AZUA 3PPSA 1ZV2A 4PAZA 1SF3A 3NJHA 4BXSV 3U25A 1AG0A 1OCOB 3S3DB 1FFTB 2DYRB 2YAMA 5A7EA 3NJFA 1L9QA 3AG1B 1YLBB 1NWOA 4N4YB 2FT6A 3FU7A 3KW7A 4JHVA 3MX0B 3CVCA 2BWDA 1ZIBA 2FNWA 1PNDA 2CBPA 4HIPA 5B1KA 1L9SA 1SJMA 2JXMA 2GC7C 1TKWA 3UGEA 5I5JA 2DWTA 1QLEB 4GXFA 1FWXA 4W9ZA 3X1BA 1M57B 2X87A 4HALA 1HAUA 3WNIA 2H5UA 4YL4A 4RH4A 5B3SB 4A66A 2UXVA 3NP3A 2XYBA 1GY2A 4E9YA 3AW5A 3FSZA 2CCWA 1NWPA 2E86A 2FTAA 1ET5A 1E65A 1XMEB 1GS6X 2IDSA 3IN0A 4G7QB 4QKTA 4AZUA 5B7MA 3DKHA 1PZAA 4HHGA 4A67A 3CVBA 2PP9A 2Q5BA 1N70A 3AY2A 2YAHA 5B1JA 3IBOA 1EHKB 4K9JA 3WKPA 3ZIYA 2IDFA 1WA0X 5D4JA 1ASPA 2FQFA 1AZUA 1RCYA 1TEFA 1J5DA 3S8FB 1A4AA 2YAEA 2UXFA 4G70B 1PLAA 3TBBA 2EIMB 1XB6A 3FSVA 4HZ1A 3NYKA 5I5IA 3FU8A 4GP4B 4CSZA 4BXVA 2VM3A 1CYWA 1OCZB 2VSMB 3EH3B 1SFDA 2YXWA 1AZCA 1TEGA 2GI0A 2IDQA 2YAOA 4YSAA 1MZZA 2FJSA 4YVNA 3NP4A 1JERA 4UAHA 2IH8A 2DV6A 4ZK8A 1J9TA 1IC0A 1SNRA 5AFAA 3SBRA 3PCYA 2ZONA 3NJIA 4E9QA 1CUOA 2XV0A 1CC3A 1KBVA 2BW5A 3IEAA 4P5SA 4QLWA 5FC9A 1PNCA 3PXLA 4DP5X 3QPKA 1J9RA 1PY0A 5TK4A 1V55B 2QPDB 4YSPA 2FT8A 2HLEB 2VM4A 1NICA 2GB2A 2BZ7A 4E9TA 4Q8BA 5B1BB 1GSKA 3QJTB 4AI7A 2BP0A 2VN3A 3NJJA 2UXGA 2PPDA 2IDTA 1N68A 1OCRB 1AIZA 2FQDA 2OV0A 1JZFA 4L0PB 1MG3C 4YSOA 2HRGA 2XV2A 1ID2A 3OQRA 4DP7X 4BDVA 3ZBMA 2WO2B 3L45A 3OMIB 5IY5B 1X9RA 4HCGA 5ANHA 3ABKB 1JXDA 4GP5B 4DP9X 1MG2C 1IBZA 5I6PA 4GY4A 1KGYE 2EILB 3ASNB 1AQ8A 2X88A 5AZUA 1SHXA 1SFHA 3FS9A 3G5WA 3SBQA 1NPNA 2J55A 1VLXA 3UACA 1DYZA 4KOCA 2A3TA 3EH4B 3EH5B 6PAZA 2FQGA 1EZLA 3BVDB 2ZOOA 5EHFA 2QPEB 3ASOB 3NSCA 1ZDSA 3T6WA 2IWEA 1AZBA 2FT7A 3IE9A 2TSAA 4AX3A 4F7KA 3ABGA 4HHWA 4HCIA 1ILUA 3V9CA 2PPEA 3FYIB 1BXVA 3X1GA 4YSSA 4BWUA 4NAJA 2IWKA 1ZPUA 3QJVB 3S3CB 1JZHA 4DPCX 1OE1A 3IN2A 1WS7A 1ZIAA 1IUZA 4YSTA 1JZGA 4N8UA 2OCCB 1ET8A 2GBAA 4A2FA 4M4RB 2DWSA 3SQRA 4DP0X 4G7RB 1RZQA 5LDUA 3D12B 3TU6A 3AG4B 3T6ZA 3AG2B 1HAWA 4NERA 1NZRA 7PCYA 1CYXA 3OM3B 5PAZA 3FQYA 4G71B 1PF3A 5I6KA 2YARA 2JFCA 1RKRA 3ABLB 3H4FA 4GP8B 2DYSB 3GDCA 2XWZA 3QQXA 5I6NA 4G72B 2VW4A 1PZCA 2B3IA 1ASQA 4UF7C 2FWLB 5B1AB 1QNIA 2CALA 1BXAA 4G7SB 4E9RA 1KCWA 8PAZA 2PCFA 3QJQB 2GC4C 1JXFA 2CUAA 3TASA 1ADWA
chains in the Genus database with same CATH superfamily
3BXNB 5CLXA 3U2SB 4ZMTA 1ZGLP 3L8QA 12E8H 3KPQB 4ZTEA 1A4JA 1CXIA 3MRCA 1N6QL 3LTVA 4QO1B 3EO9L 1TTBA 2W59A 5I28A 3KM2A 1A3RL 5JMOC 1KXVA 4XHJD 3GXFA 5DVMA 1MCSA 1NC4A 4DHLA 4MMZA 2OZNA 3GWJA 4ACPA 4K8RL 2J21A 2J8UE 2R0KL 3GMOB 1VGKB 3G5ZB 3OQ3B 2AJYL 5FHAL 3IB4A 2VDNB 2ARJB 3NUKA 1HDMB 4P59L 2NCEA 5I1DB 3IFOB 1YJDL 4U05A 4FA7B 1ZOXA 1I8MA 1G9ML 1NIBA 3X12A 5J8OA 1E27B 5I0ZA 2VN7A 4JANB 3W2DH 3ULVH 2GJZA 1BQ5A 4XNMA 4LGPB 4C83A 1TITA 5AW0B 5A2JH 3RQ3A 1UT2A 4K9EC 3MV8E 4POUB 1CLVA 4OCXL 3IE4A 2PYEA 4TUOB 4TQHA 5JQ6L 1JTPA 4OSUH 1MHCB 1YA5A 5FGSA 1BLIA 1R1CA 5MEOA 3DGGA 4OGQC 5FK9B 5C0JB 4OUUB 1AC0A 3HN3A 3UEZA 4OQ1A 4P9HC 3GMLA 5GS0H 1E3XA 1RJYB 1RK1A 3BAYA 4FZEL 4ZSOB 4UNUA 1OL0A 3FT9A 3IDYB 1QHPA 2IALA 2WBWB 2X4PB 4HJGB 4OCMC 1ZHBA 1J05A 5AB9A 4LP4A 3CN0A 3D33A 4Y16C 1LP9A 4GSUA 4Y1AB 2BSSA 3QR0A 1NM9A 3ZE1E 1R24B 3CDGA 5BXFA 4IOSD 2WYHA 4CL7A 1C12B 3L17A 2FJGA 1C08A 3ZKND 3EGSB 3VTMA 1JTTA 1RUPH 5JW4M 2G0LA 4YZWA 3QC5X 1ZT7A 2QDVA 3SCMB 4WTZG 4NO2A 4PGBB 1BQKA 3DJ9A 1P1VA 3MOBH 1OAKH 4MRBA 3EJYC 4BK5C 3R18A 1U92B 1QNZL 3RZCD 4G59C 4LQ1A 1RJLA 4PRIB 4FLQA 2YGQA 5DZLA 3G6AB 4S1SL 1X7SA 5EIVA 1D2PA 4CN4A 1A14L 1MCKA 3GRWH 4PVLA 4OVVA 1IKNA 4JL2A 5H4YA 4IOFC 2A6IB 2H47C 1ORSB 3CVHH 4X7TA 2BNQE 4OCYH 2VLME 4D7BA 1HEJC 1JGLH 1OAZH 2IGFH 2VIRA 4I9XA 4CC1A 4Y16B 1BXUA 1A9EB 1TLKA 5EMYA 2NXZD 5I30H 2IQAB 2H32B 43CAA 4AGQA 5GS1B 1QRNE 4NRZB 1EAPA 1J9SA 1AP2A 1TSRA 3QZWA 3IMBA 3F12A 1UJ3B 4GKSA 4HK3J 1JPGA 5IOKA 1ORSA 4L1LA 1OK8A 4JPKL 2XFXB 1TJIL 4MJ5B 3JZYA 4WUUD 2XTJC 1E8WA 4GBXA 3TN0C 1D5ZA 2Z35B 2KI6A 4PN6A 1B0GB 1ZHLA 3PNWB 3ZLQC 3AT0A 1BOGA 2PXYD 3RWCA 4B27A 4M9PA 1ULVA 5HJBA 2CLVA 3I3DA 4X8XA 3FO9A 1FFQA 5F7MC 4I2XA 1D6EA 3RU8L 8FABB 4L5FE 4X5QA 1MI5D 1D5XA 3T0DA 1PU0A 4U1JA 1SLWA 2WWKO 5C92A 3PUCA 2CWRA 3RWFB 4KXBA 2AANA 4XWOD 2VSDA 3WEAA 3EDEA 3L4TA 1WWBX 1OEZW 2GEEA 3I3EA 3ENEA 5CIPA 5DI8B 1HINL 2E7HA 2XRAL 1T5WB 3F6JA 1ZHNB 1QYGL 3KXFA 5IVNA 3UZQB 3CZLA 1G7QB 1IC7H 2P43B 1JZIA 2Y1ZA 1ZKAA 3LEYH 4EQ2A 1R3IL 1CO1A 4P48A 1EX0A 2ZCKL 3ZTDC 1CBJA 2E7CA 1FO0L 1QLFA 3PF2A 4JDEB 3BWUC 2XTJE 4I1PA 2OJZL 4QTHA 4MXWH 2FECI 3MNWA 2O5NA 1BVLB 4X8CA 3RY5A 4L9DA 5AUMA 5K59E 1DQML 2R9HD 1FVDA 4F1ZA 1WCQA 1MNUL 1CFSA 3DDFA 2F8VA 4UT6H 2JJSA 4KO5A 2BO0A 3DDGA 1ZA3B 4L4TD 3PFUA 2DQUL 3APMA 4HJIA 4NUJA 2BNRA 4KX9A 4XXDB 5L7XL 1V5JA 2AJVH 3ZOAA 4H8WH 3LN4B 4U1NB 2MMXA 4M4PA 2IPKA 3GJFK 5A6LA 2Q8BH 2Q3ZA 3LX9A 1BVLA 1RL1A 2PP7A 1J1OH 2X6BA 4HWUA 4LLAA 4O02H 2E9GA 1Y1DA 4MHHG 1QSVA 2E7BA 2YZ1A 2BNQB 3WFZA 3MA9H 4A37A 2N1KA 3WXVH 3MLYL 1YEGH 2VB5A 3UZQA 2DZEA 3WAJA 2L04A 3ARDA 1HNGA 3TEXA 3D25B 3C2SA 3PGFH 3IFLH 1FGNH 3SYCA 2J3SA 4S1QH 5JOFB 2DD8H 1XSIA 3KVQA 4MJIA 2HTLD 1T21A 2RALA 4EPSA 1IVTA 3BKCL 4XBPB 3WSQH 5ILTH 3CMOH 3WS3B 4M3HA 2PP8A 2R2EA 4GRWB 2O61B 2Z31A 2ZUYA 3U0TA 5CEZH 1OAQL 2AJSH 1GGUA 1W8EA 2JJTA 1U8QA 3MUZ1 5F8QC 4BD4A 5ETUA 5I17B 2FO1A 2XIDA 2VDOH 4LB8A 5DSCA 3MJ8A 3QXAB 1GPOH 3K46A 1FCGA 5DGQA 5CS7A 2A6KB 1WBZA 5IREA 4P2OD 1N8ZA 3IPBA 2G2NA 4N8PA 1VACB 3LMJH 2FBRA 2OLDA 4S1RL 4F7MA 5IOPA 1BBJA 5AAMC 4E2OA 4ANKA 2NTFA 4GRMA 3H56A 4AIXA 2CBMA 3VGEA 3ZR6A 2OMZB 4I0KA 4KWUA 4PJ9B 4TUJB 3AZUA 1OALA 1PIGA 3HNVH 4Z7QB 4M1GL 5J06A 4Z0XB 1AKJD 5GRZA 4M8VA 3NZSA 1KMGA 1A5FL 3SDXB 4PG2A 1B2WH 3SPGA 3WLBA 3TCLB 3OAUL 3REVB 3JWNC 4QRPB 1FUNA 4LDOB 4LVNB 1ZVSA 4AMWA 1ZJBA 4K3DH 1J0ZA 1ZT1B 3PWUB 2F7IA 2VMCA 3MUGA 2XKNA 2FBJL 4XZUA 2EDTA 4XXWA 2NYZA 4FI6A 1KELH 4JRXE 3QZOA 4I3SL 5L2JA 3C08H 4HFUL 1A0QH 1F3RB 1K5NB 3KYAA 3DYPA 4MKMA 2IANE 3LNGA 4C54A 4IOSA 2XZAL 5JHBA 2X9WA 1UTDA 3JTTA 4EMZA 2HN7A 4BKLB 3EHBC 4KXZH 3HAEH 2OMNA 2GW5A 2LTQC 4JG1L 5IBTH 4KNQA 1TVBA 3T77A 2AK1H 3AW5A 2FSDA 2HJFB 1E65A 4AZUA 2YC1A 3TIEA 4KK9C 4O2CB 5JYLA 3LS4L 1JF5A 4HHGA 5I8KL 1ZRUA 4BFOA 5FYJD 4D2NA 3SGDH 3SQBA 1WP6A 1QI3A 4LHUD 3CVBA 1RI8A 2ADIB 3MLRL 2VXUH 2FHCA 3FUDA 2VDOL 4L8CA 1IQWL 1EHKB 3DO7B 1HK6A 4P07A 3VXME 4M8RA 3U7AA 1EHNA 4LVOB 3AADB 3VRIA 4EBQL 2AJZB 1INDH 4NKMA 3MUHL 1T20B 3FH7A 3K1DA 4ZFGH 4IM8A 4YIQA 1MCEA 1CE6B 1TEFA 1JIBA 4ZMYA 2I26N 2GUYA 4IMKC 4WU5A 2C9QA 3DNKA 4YC2B 4AG4H 3IFLL 3TBBA 3TIDB 1YECH 4AGLA 4ZO9A 2D7TH 3ZTJH 1MPAL 4GBXD 4BXVA 4HKJB 3Q2LA 4G82A 2Y3NA 3LZPA 5D8JL 5GS3A 2PO6D 5A2FA 2IQ9H 3LB6C 1IGCL 4DN3L 1G94A 5CU9A 1FAIH 1Z3GL 4H1LG 4RBPH 2F54E 3DV4B 4KDWA 2FJGB 5GGSY 3ABZA 3ML8A 3GS0A 2XKSA 2XY2A 1E9OB 4KV5E 3TEYA 2AEWA 1WPCA 2C9VA 2VQ1B 3DX6A 3J8F7 4FG6C 3KPOB 4P2OB 1MI5A 3HS0C 4WVRA 1IILE 5E99L 4F24A 4TVUA 5JXAH 2XWBB 4MJ6A 4F8LA 2EEAA 3ETSA 2VDMB 3CFUA 4LCUB 5SWQB 3TV3H 5IR1B 2MQCA 3QPKA 1DBML 3TPKA 2FT8A 2UYLA 2HLEB 3UTTA 2OJZH 2EUWA 1N4XH 4I48A 1SVCP 2IANB 2GB2A 1U3HB 4GW4B 2UZIH 3SB3A 3F85A 4LK4A 5B1BB 1FLTX 5TDNA 1G0XA 4L29A 3W9EB 2BP0A 1RZIA 3HC4H 2OQJB 2GT9A 1HT6A 1R5IB 5KVFL 4Y4FB 5M94B 5KBNC 3GM8A 3KEHA 5IVXE 3NN8A 3QAZC 1ZK5A 1MRFL 4JFEB 4L4TE 3MRBA 5F6HJ 4AM0B 2ZSWA 2JJTC 4NPYA 3ARBD 4P23D 2MCAA 3MNDA 3O11A 1PVHA 4LSRL 5C0CE 3SZKC 3SDAB 3PNRB 3KHQA 5ICXA 5D1QA 4OZ4B 3UPRB 1KGYE 2BY1A 4FEIA 3Q6FA 5B21A 3EW3B 2O6CA 3GI9H 1M7UA 1M7DB 4NQXB 5GZNA 1KLUA 4E0RA 5F7EL 2D7OA 5AWNH 1O6SA 3HKFA 4X4YB 2R2BA 3RILA 5DYFA 1I8IA 4WKZA 1KYDA 3BVDB 1AD9B 1YPZA 4JPKH 2J72A 4ENEC 1EXUA 2R4SL 5CGBA 5SWQA 1C12A 3DJZA 3IE9A 1KZQA 1INQB 3T0XA 5C3LD 4DQOL 5TFSL 3FQRA 1KLUB 2CGZA 1BP3B 3G08A 1TTUA 1XBDA 1TZGL 3BP6B 4MRCA 5KYUA 5ACZA 3G7TA 5HD8D 1VPOL 4APQB 1ZLUH 2XZZA 3LQAH 3H55A 4N6RA 2HKHL 2AJ3A 2GKIA 3C87A 1DEEA 4AM0A 3D87B 2EC9T 1VA9A 1NZRA 3B9AA 1K4CB 5EEXA 4BQ8A 4O9HL 3M8OL 1PF3A 5HTSA 1AQDA 1OK0A 5LGJA 1RKRA 4P46D 5JDSA 3V0IA 1J8HD 3QUYC 4K07A 5L6YL 2YBRB 2YD0A 3NH7L 3RHWK 1IGTB 3O4LA 2COVD 2CR6A 4A7QA 4UF7C 4HDIA 4EUPG 2V3DA 3CCHB 3PWJB 3QQ9C 2LFGA 4PRBA 3UZVB 3VXRD 3FQUB 5BQDA 4AZ8A 3VVVA 3FKUS 3TO2B 1AQDB 1L5GB 1QBBA 2HKHH 1JNNH 5T1KB 1G7LA 5CZXD 3PLYA 1AI1L 1JHKH 5K93A 3S35X 2NY6B 3N3EA 4ELMA 4WY7H 4NENA 3VFSA 1VPOH 4JUTA 1ACXA 4QJ5B 1TG8A 1YNKH 1V3LA 1NKRA 5HYSA 3KPTA 4GKNB 4NXSA 4JFEE 3RVTD 3BQVA 5DHXB 1N19A 1F02I 4U7MA 4UANA 3RZCC 3EZJB 3N2JA 1DL7L 1HH9A 2TAAA 4NZUH 4QRSB 4XOEA 3LKOA 3WJMA 5GGQL 1WBXB 5BCAA 3RDJA 1SYSA 2QQNH 2E27L 1ZHNA 1MXDA 4P05A 5F1NB 1BECA 2IANA 4B53A 4N8CL 4GG8A 1KBBA 3WO4B 5I15L 2EDKA 4QLRA 5FYLH 1YMME 4O58L 4ZFQA 4ZODA 1FFNA 2O6EA 4UQEA 5ICZB 4XO5A 2ZJSL 1IAKB 3H8NA 1HC1A 3GYRA 3V6BR 4Z7IA 2H8PB 1DFBL 2X4UB 3RY4A 5F6IB 5AB0A 5D1QB 2QT6A 1NCUA 3VQLA 5I18L 4NO5B 3A4AA 5IMKA 1OF0A 4KBPA 1MDTA 3OB0K 4GW5A 3KWVA 1EAJA 1IBGL 4IRSB 5DU7A 1SOKA 2NT1A 3OG6B 3OBAA 1RZGB 5D5ME 4HJ0C 1KDIA 3ETBJ 1CFQA 1ZD6A 4OLEA 4LGRB 5TDPB 3C5JB 2QR0A 2R0LL 5E6IA 5C09D 4MJHA 2XIIA 4JO1H 5ADPL 4UQAA 4YQXL 4BFIA 2OMYA 3RX9A 3JUYA 1E4XH 1ZANH 2WBJB 3MCKA 1CGSL 2DJ4A 1H15A 2YN3A 1MRCH 1BREA 4CW1B 2PPCA 2FQEA 4C8XA 4NT6B 4Y9EA 1KTLA 5JIDA 2NSQA 4RX4D 3K71A 4M48L 5TQ0L 4K7PL 1EUUA 3EG9A 4MNQD 3ALPA 1OWRM 1KF9B 2YSSB 3DSNB 15C8H 4HIXL 1BBDH 3BI9X 4LRIC 1AAJA 1UWEL 4U1LB 1TO4A 4NNPH 4I9WE 3FZUD 3D85B 2ZX5A 5IBLC 4BH7A 4FQXB 3OPUA 3CFCH 3WG7B 4Z78A 43CAB 2GT9B 3C8HA 3OMZA 3HI1A 4OUOA 5KZCD 1CFTB 4PJXB 1J5HA 1J05B 2QKIB 3DYMA 4OLZH 3L1GA 1D5IL 5E51A 4DOHE 1XHHA 3PABB 2E9JA 2Y5EA 4WEMB 1XGYH 3HW7A 4WO4A 3F62A 1S5IH 1MCFA 5C0AE 4ZQTA 4X80L 1WFIA 4IHBA 5HVFB 3NK3A 3ULAB 3SGEI 5TE6H 4Z7UB 1RSFA 2WO3B 3QE5A 1B4RA 2PCYA 3NAAL 2GQHA 1GW6A 2EO1A 4WI3A 1G6RA 4Q9BA 5DVKA 4QRPA 3VH8A 1YRKA 5K1VA 1HOEA 4MMYA 1W0WB 1GHFL 3FF8A 3QZMA 4ES9A 2CHZA 4WEBL 4V11A 4KJWC 4N0CD 3BLBA 43C9A 4ONHA 1JK8B 4Y5XB 2P3YA 3TA3D 4ES8A 4B9ZA 5IVXB 1UWYA 1YAIA 1G7MA 1A64A 1XGQB 3SOTA 4WTXA 2Y69B 4NAMA 4QWWC 1UHVA 1E5BA 2E46A 5HHXL 3W0WE 3BYYA 2GSMB 2W0KA 3OR7B 1V7MH 1FDLH 3G9AB 3QUXD 5AOMA 2OX5B 3RL2A 3IJHB 2IH1A 4MD0A 3L7FB 2GIMA 2YRBA 1WBYA 3SE3C 1AZRA 3C5ZD 5FO2A 3UTSD 4QOKA 2FHFA 3U1PA 2PPAA 3S98A 1V05A 4J8RB 3GB7B 5FO7B 2ATAA 3LIZA 1NPUA 1BV8A 1XSJA 1I7ZA 2WB7A 4JGNA 3B3BA 4M6NL 1DFXA 1AACA 4HPYL 5IWLC 1NCCL 3IRPX 4D7PA 8CGTA 2WQXA 5EDSA 3AWEA 5FOJA 4DK3A 5FUOH 4A2EA 2JKWA 4WWOA 1H3XA 5KVMC 3OAUH 1D5IH 3FT0A 4GRLC 4HCFA 2I69A 3AY4A 2B9BA 3ARBC 4P23C 4N2FA 1ONQB 2NPLX 3VRIB 1RZGA 2XLLA 2AGJL 4JVUA 1Q4NX 3QWRA 3CU7A 1RVFL 4JJ5A 2B4CC 4JPSA 1ZCRA 5GGVH 5IB3B 2A74A 2CA3A 2IBZY 4LKCA 3HR6A 4NP9A 3FUJA 4NNPL 1KB5B 5H4ZA 2XN1A 1I85A 3VFNB 5EBMB 1G7LB 1HXKA 4HWBA 3QXTA 1RZJL 1ZV9A 4XCNA 4WWKC 2QVMA 4B95C 1HHGB 2DMKA 5E94B 2K6WA 1H8OA 3VXRE 1K8IB 2C26A 4UTAL 1U3YA 4GEIA 4KZEL 3FU9A 4LLVB 4RAVA 3C5XA 3L9RB 1J1PL 2CNYA 3QNZA 1FJ1A 2Q76B 3AT8A 4LL9A 1AGBA 2P7TA 5SWSB 3LXBA 3X1NA 1I3GH 3O9WD 3UPAA 4YMPA 2VR7A 4PS7A 1HL8A 3UBXA 1X44A 3W5MA 2DD8L 3OPZH 3KW8A 4DP4X 4ZXBC 2R2EB 2B1HL 3FHAA 3MGOA 5HYIA 5KVGL 3RI5K 4MWFA 5HYJD 3FB6A 3TJPA 5FYKD 4FG4A 5DUML 3S36X 3FMGH 3ATAA 3SKMA 1P7HL 2BRQA 3MBXH 1AZZC 1I3RB 1QP1A 2JB5H 4GW4A 3LRSA 3PPSA 3L3IB 1SJEA 5GGRY 3T4AA 5BOPA 1BPVA 1C5DB 4PJFF 2HVKA 2NX5E 1EPFA 1WBZB 1DFBH 1T1XA 1USZA 2Z93A 3BIKB 4HJGA 5ECJE 5ACMA 1IM3D 3LD8B 1T4KA 1NGWB 3EJTA 3PV7A 2PYFB 1WGOA 3L3DB 1F3JB 1WEJH 3GSNH 2NTFB 1B6DA 2D7QA 2JELH 2VAAA 2BC4A 1K85A 2P5EB 4DFHA 1U8LA 4R7NB 5L7XH 2BRRL 5D1ZA 2OM5A 3F84A 1CGVA 2WAHA 3ULVE 3I50H 3ARVA 3GZPA 2EH8L 1QFUH 5IG7A 2CCVA 2FZ3B 2DLTA 2W60A 1N3NA 1XEUA 5MEND 2JXMA 2GC7C 4HOZA 3CFJB 5DS8B 1T7VA 1FWXA 2YPLE 4OCRL 3LRLA 3VO0A 3ZK0A 1WFTA 2BX5A 2X87A 2XNAB 4IK6A 2JE8A 2X09A 4N1HB 2WTOA 5D1QE 2NY0B 3FAWA 4C56D 1CGXA 3TH4T 1OQOA 1N3NB 1VGKA 3AWGA 4PVNA 4RGOL 4ODWA 5JR1H 4JFFB 5IQNA 1ZGLM 3EYUH 5IESH 4Z5RA 4XNQB 2ZCZA 2X5PA 5DYOA 4XBGB 2VO8A 4GW1B 5ICYB 1IQDB 2D7NA 3FTUA 1R4XA 3LN4A 3AY2A 3OB8A 3AROA 2GI7A 5EOTB 4RGMB 1FFNB 1HQRA 3LPPA 4HLZH 2ZYRA 3A4EA 1T5XA 4NKOB 2HT4D 3V95A 2WZAA 4XN1A 5L6YH 4UQ2A 5T5FA 4YWGL 2L7EA 1OGTB 4XP4H 4U4BA 1PL3A 2XKNB 3QULB 4J12A 1ECYA 4F93B 5JA8B 2ADIA 1IGFH 2HRPH 3HNTH 1KXTB 1KCSH 1M4KA 2C4XA 2R4RL 2ZOTA 3EJCA 5HI4D 1UH3A 5EOTA 3CX2A 2HLFC 1N67A 3M1BB 1XVSA 5I8CB 3GSVB 3ZQ9A 5D55A 4CSZA 1OCZB 3LSOA 4XO4A 3LIUA 3TZVD 4JHAL 5AAWA 3EOAA 2MHAA 3PHOA 1FGVL 4ODTL 5KAQF 3RIFK 1TEGA 5EZOH 2YAOA 2ICWJ 3G3LA 4QCIA 3U6RA 2X3BA 4OV5A 2VXQH 1FBIH 3ZDYE 3AU1B 5EUKB 2UWEA 3CIAA 4WW1A 1IRAY 4TNFA 5IB5A 3VFMA 4QHMA 3U48A 3QRGH 2ZUUA 1EMTH 1KCSL 2BIQA 4AIEA 3MLWL 4U6VH 1YAZA 1IGFL 2JCCE 5I0WA 5HI5D 1UXSA 5KUKA 4WHYG 2ADFL 3VACA 2V5RA 4GRLD 2DH3A 5HDBE 1KGUA 2A6JA 4RCAA 4UQ9A 1YEWA 5TQ2H 5EG6C 5CJBA 5L9DH 4PD4K 2AMUA 4XH2A 4KK8D 3PXLA 1B90A 1Z5HA 4JM0A 5J6HA 3MYJB 1JPFB 1NICA 1NCNA 4NO0A 4NO3B 3VCLB 2VRKA 4PJHF 3BZFA 2WINA 3EYUL 2I9LB 1U3HC 3GSWA 4P4KD 1OCRB 25C8H 2P49B 5IGXL 2XHNA 3MREA 5DJ6B 2HRGA 3TEWA 1DDHB 4EQ3A 4WFGE 2AXHA 4FGMA 3B9DA 2WXRA 3OQRA 4MA3A 3V4LA 4BDVA 4DP7X 4FTVD 4JFFE 4LLQA 2CUHA 4GP5B 3T0AA 3C9NA 3QIBC 2YMTA 4OF0A 1MG2C 2EP6A 3T3PB 3VQ1C 4NQCE 5C0EA 4UYPA 1ETB1 3K91A 3SBQA 2N56A 2BINA 2X9YA 4JQVC 1A3QA 4X6DE 1VLXA 3QZLA 3KPOA 5AZ2L 1U8PB 2A3TA 4UV7L 1J0JA 3EH5B 4RFOH 4AM0Q 1U95B 4YPGB 5HJGA 3IF1B 4FNPA 3UXFA 5LQBH 2QPEB 1INEH 3ASOB 2HH0H 5AVWB 2QLVB 4M5SA 5EU6B 1O9WA 1TTCA 3EFDL 3FFDA 3UTPE 2AJYH 4HCIA 4L05A 2AI0L 2H0JA 1MFMA 3IK2A 4KKLC 3FT4B 2MOVA 2YRZA 1FAIL 1Z3GH 2VLKE 4HS3A 5I9QB 1DZBA 1L3WA 4QNPE 4EN3B 2O93L 1R5WA 2B0SH 4W9DC 2VXTL 3U4EB 3R7QA 3JWNG 4Q7DA 5A2CA 5DJ2B 1BBJB 1XIWB 4BZ2L 4PGCA 4M4RB 4FZ8L 2P47B 4XN2A 4NSKA 3VXRB 3FZUC 4ZMVA 4AG4L 3U1QA 1NUGA 2D3NA 3LXUX 4YIQB 5C0BB 2H6OA 4FADA 3LZNA 5ITFA 4B7IA 4G71B 2K9UA 4P5MB 3RI5F 4AMKH 4Y9CA 1LK2B 2YARA 4C83B 4PJBA 4W9LC 1IQWH 4N6RB 2KZ1B 3ETBF 1PZCA 4HWZB 1MWAB 2EIZA 2GFBB 4Z9KB 4AEIH 1QNIA 5IQ7L 2QSQA 2WSKA 4JREB 4WSGA 2ZCHH 5C6WH 3Q06A 1QA9A 2XBZA 1NOLA 2GC4C 4KNSA 4EUPH 1I7TB 5I66A 4JFQA 4L37A 1X5HA 3LS4H 3T8XB 5HBBA 5GGRA 5BV7H 2B7DT 2CGYA 3M17B 4QF1B 1GYCA 4AQ8C 3IKCB 2B8OT 2DQFA 3H6JA 4IGBA 2R1XB 3WNMA 3JTTB 4F9PC 3SYOA 3B83A 4LOUC 1SEBA 1QZNA 4Q9QH 1U58B 1E4KA 2UX6A 4AYEC 3DX8B 3EJZC 5IW1B 2NX5B 3NSFA 4YK4B 4CNIA 1T83C 1SXZA 1KACB 1JJUA 2KZKA 2XN9E 3B2UD 3B2XA 4KKPA 5HVHC 3S35H 3FO2B 2WN2A 5E6RB 3LS5H 4N87A 5CP3A 4QO1A 4YHOL 1EHXA 3QFDA 4X6DB 4JM4H 3BAJA 1DQKA 1U92A 3STBA 3GMQA 3R1GH 2DM3A 4HFWA 1C16A 1JK9B 2CJSA 4PJ9C 4YHOH 4M6NH 3U30B 5CINL 1I8LA 2F61A 3BE1L 3WTVA 5IB1B 1KXVC 2NQDA 1V54B 1CLYH 1AMYA 2B15A 2RHEA 3R8QA 5CF3A 4L8DA 2BW4A 2VZTA 1I9RH 1OF2A 2GAZA 3BVNB 4Q6IA 5D9SB 4JM2D 5FB8A 4I7ZC 3T4AB 2F9BT 3KLAA 2Y06L 4OY9A 4W6WB 2WN3A 4MNHA 2H3NA 3AT9A 4FC3E 1MCQA 2VN5A 3QNXB 3PHAA 3BH8A 4YPGA 1T1ZB 2ESVA 3CPLA 3THML 1GHFH 5J89A 2X6UA 3OMAB 4KKBD 4OUUA 2WVUA 5JIPA 3CVDA 2LAAA 3WV0A 4M03A 4AEIL 1J48A 3OR6A 1G7HA 3OHMB 2LVCA 2V2XB 4JHWH 2VMFA 4I5BA 5TE6L 3UCRA 1CDIA 3UYPA 4BYHA 4UTBA 1LVEA 1PFOA 3RZCA 1NBYA 2IO5A 3CXFA 4K7FB 2H6PB 3GEFA 3MNMA 1I7UA 4RDBA 4KTEL 5L4MA 3NIFF 2QR0B 5EU7C 1CDUA 1KULA 1MW2A 4QHUB 2J88H 4GQ9L 5IJDC 1M05A 4NHUA 4R5XA 3QUHA 2IEPA 2BP8A 2VDNH 4NO3A 4HSCX 4PRPA 2EC8A 2D9CA 1VF5C 3KMDA 3RWHB 1NOFA 1XGTB 1RZ8A 5GS1A 2R2HA 1IC1A 1HH6B 4EI5C 2ZUQB 4LOVA 1EUTA 5C3TA 3Q3GA 4M93C 3QZPA 3FK3A 3GBDA 3L2MA 4ZMWA 1YEFH 4R5VA 2ARWA 3CN3A 1MDAA 2AK4D 2BSTA 1NJ9B 1UA6L 1JD9A 3ARGB 1XR8A 4JFXA 4M48H 5TQ0H 4X2UA 2FD6H 1IAIM 3T65A 2JB6A 1CQYA 2DQUH 3DJSA 4MBRA 3GSXA 1KCBA 5DRNA 4PCYA 4TUUA 4M5YH 3L4WA 5GRUH 2EE0A 3ZT6A 5E4AA 4PI2A 3ZVVA 1QUNB 1ZANL 2G9HB 2OXGB 1F6LL 4QRRB 2HSIA 3H42H 3VJ6B 1T4KB 5D7IE 4L1DA 1N59B 3MOAL 4H8PA 4LVNC 2H26A 4A63A 3PWNB 1S7SA 3P2BA 4MMZB 1W2KT 2W92A 3LSOB 2IAND 4G8GD 4GRWH 5IUSA 2UZYB 4M29A 4QRSA 3QO0A 2VKWA 3ZZSA 5CLWA 1IC7L 1ZLEA 1UXWB 4LLWA 4WFFE 2PMZA 5B38B 2XXFA 5HI5C 3GSOB 1NAMB 3FT4A 1K5NA 4FKHA 3MRNA 1RZJC 2JQAA 3QUMB 4APQC 4R3SB 3O0LA 4KZ0A 1AGEA 1EFXA 4ZAKC 5AVUB 3QT2A 2HJKA 4PGZA 4JFHD 1PYWA 4Y5VA 4LPWA 4I18B 4TNVK 1TF4A 3HE7A 3X2QB 2XPGA 2GTQA 1KFGA 4RDQF 4ICWA 4EXPX 1PG7L 3HAEG 4I0PC 5BQ7A 3AABA 2PO6B 5EA0L 4XNQA 3BLPX 4LARL 3LZFH 5FO8B 5I73C 4U6VL 1OTUC 2C8NA 1QLFB 5ALBL 2DTML 3MNVA 4NJAH 5K39B 2UY6A 1HHGA 2N7SA 4JFOA 5B4MC 3NVQA 3MACH 4PB0L 3QJUB 3ZHKA 3UAJD 4S10A 5G55A 2C4FU 5D1XE 1I7TA 4RAHA 1QASA 5CJQL 2P8PB 1OP5H 3B2VH 3O3EB 3T1WA 1PZUB 4X0NA 1BWWA 1A6PA 2DQHL 3JQOB 4X6FB 4Y2DA 5ETUB 1SXNA 1YY9C 1CGWA 1FORL 5DO8A 1FL3A 2XPZA 3NPSC 2ED8A 4JDTL 4KKAC 3R4RA 1EZUA 5BRZA 3HNTL 1R3JA 3H9SB 3K71B 5I1LB 4LO9A 5CN3A 2J6WA 4P2YA 2R27A 1DHKA 1GGBH 4J4PC 5DZOA 1QRKA 3O3EA 2VRAA 4P2QE 3RA7H 4UTBL 3ZTJG 3RVTC 5DUJA 1RUPL 3N55A 1T5KA 4KITB 1E27A 2YHGA 4DEPB 4Z3EA 4O9HH 1CDJA 5I24A 4H1LH 1H9DA 1GAFH 1O5PA 3DIDA 3O2VH 4HC1H 4NJ9L 4NRZA 1SBBA 2NW2B 2M8XA 4EIZC 1BGXL 4ZFOA 3MFFB 2BVOA 2OSLA 4PJGA 3MUY1 2E7LC 3X14B 5BNXD 3PQYD 5KSBB 3TNMA 2FRGP 1AQMA 1DZ0A 3B2VL 2CRZA 5DFVC 5GGTL 4XRCB 5LKNA 3LRHA 4CMMA 4J3OH 1HOCA 1IGJA 3ULVF 4GSDH 5ITFB 4DGYH 4P3DA 3VXUA 2Y6SD 3QRLA 2OQJA 4OCRH 4PB0H 4H0LC 1WZLA 3O6LL 5CSBA 3ESUF 2DL9A 4HWBH 3TNMB 3W9DB 3LD8C 4UQ2B 3KLHC 4OB5L 5FKAB 1NWOA 3PGDB 3AITA 4FQCL 4PLKC 5F70A 5I9QC 3DI2B 4QXVA 4DQAA 5FO9B 3BH9A 3OGCA 4Z3GA 4R90L 5B38A 3V5KA 3OC5A 5EBGA 1JI1A 4HIPA 5ANME 2H0PA 4W9FC 5I5JA 4A7TA 2DWTA 1O0VA 1A6TA 2AXGA 2WXGA 5HGAB 1UGKA 3U6XA 3IU3B 1W0YT 4POZD 3WNIA 3BRFA 2ESVD 2H1PL 4K8RH 3MV9B 4NM4L 3GMNA 2JB5L 5FIEA 1B88A 3CX5J 4N3TA 1T7YA 4I1RA 2RQEA 2H1LM 5D1XB 2BSDA 1A3RH 3ILPA 5T1JA 1ET5A 2KYIA 2XICA 3C09B 3PL6B 3AY4C 2F15A 4K73A 4Q58C 4XP9H 5KVFH 1INQA 1MJJA 5AYUH 1DN2A 4A67A 1P5UC 4PRDA 2Y36H 1LTXA 2EYTB 2UZIL 2I9TA 2NY5C 4S2SB 3MUUA 3Q3GB 1KYOK 3HG1B 3K74B 3RFZA 5D7JD 3U9UB 4IMLA 2OMWA 5DLMH 4OT1L 4GI8A 2CLZB 1BFOB 4WF7A 3ZIYA 4YHNB 1UM5L 1WHPA 5ICUA 2D3JA 2ZSVA 4KRLB 5TH2A 1B9ZA 4XVOA 1RCYA 4BINA 1ZSDA 1CIUA 5LB1A 3V0JA 2EIDA 5TJWK 1XH2A 3HUJF 2KERA 3NIGF 5GRVK 4JZNA 3N42F 3F7LA 4FXKB 2D8KA 5I5IA 1XO8A 1DJIA 2AV7B 5ENWA 1LDPL 2HJLA 1U3JA 4KI5C 5KANI 6FABH 3TFKD 4E9LA 2FDBP 4O51B 1FRGL 3JWDC 5KS9F 3MU3A 1H3PH 4PJBE 1AZCA 1I9JL 1WD8A 2O5ZL 5TF1H 3WMSA 3FXIC 4XMKL 2J43A 2VABB 4AYSA 5JHMA 5D2LF 1HQ4B 1G4MA 5KYYB 5DJZB 2BS71 5DFAA 2NY6C 5SWSA 1N0XH 4DN4H 4DZBA 5FUOL 1E5AA 2HFGL 3ELQA 1I1YA 4UMSA 4Z23A 5EU7E 4URKA 4Z7AA 4PGDB 1GC1C 4FG2A 1NGPH 4CKVX 3VD7A 1IEBB 1YMMD 3V5HB 1IL1A 1U3NA 4O4YL 1JWMA 4FDWA 3F00A 4N2KA 5GZOC 3GS7A 5B1CA 4U1SA 4L1TA 2D7PA 1OT4A 4EI5D 5D71L 1SVBA 1MLCA 2BZ7A 4U1LA 2QL1A 3THMH 3CZKA 4AI7A 3L3GA 1Q8MA 3I9GL 4I0CC 3L54A 3FU5A 5I8KH 1SN0A 3VQ2C 3EUUA 2A73A 3O6FC 1MKFA 3N40F 2H45A 1GC1H 1NCAL 4NCDA 1T2XA 3OMIB 1UM6L 5IBTL 4WEBH 1A7PL 2NNAA 2J8UB 4WSJA 1P5VB 1NLDH 2M83A 4ODVL 2CRYA 3PQYA 5IEHB 2NY1C 3OJMB 2VMEA 5E6SB 4N0FA 2EYRA 3QUKB 5A7BA 4BFBD 4I3SH 5CINH 4PY8I 3UACA 1M71A 1OCWH 3ZSSA 4EVNA 4R96B 3AAZB 5F71A 4IRZL 4V33A 2VXSH 4QTFA 4YZFF 4GG6E 3RVUC 3VXOA 2WLHA 3I75B 3GBNL 4XPGH 4B9GA 1HZLA 3SBWA 4KX8A 4N2CA 2X70A 3AVEA 3JWOL 1E0OB 5I82A 1J5OH 4J3WA 3VCLA 2NOYA 4FFYH 1PZDA 4ORZC 2J73A 2IWKA 4KKNA 2P1YA 1M53A 2A4EA 3S3CB 4UYQA 2J12B 4PJBB 3N0PB 4HGMA 4HIXH 2OCCB 4UQ3A 1NDGA 5C0NC 5IK3B 1TMQA 1SEQL 2M2DA 2DWSA 2AEQH 2XQYA 4HOWA 1RLWA 3LMJL 3FT1A 1RUKH 2BP3A 3M07A 4LLQB 3C09C 3GMPA 4JY6B 3GTVA 1WFUA 5HHOA 1GPOL 2VJ0A 3RY6A 5C07A 2IAMA 2F1EA 1TETL 4MS8D 3QYCA 2R0ZH 3ABLB 4HUWA 5T3ZD 2DYSB 2DAVA 1S2EA 4KMTH 4F3FB 2UY6B 4Z7NB 3IS0X 4E41B 3L7EA 5EIIB 1I1RA 3WN5C 1NC2D 3TJHC 2EC9U 1BQSA 1YYCA 4PRIE 1OSZA 1PKQA 2UXTA 3ABMB 4OJYA 2OJEA 4EI6A 4ZMLA 4GUOA 3QJXA 3UPCA 3ALXA 4ATWA 2AEOA 3QNYB 1F41A 1HHIA 4QXGL 1URIA 4NN5C 2BJMH 4KVCH 5DMKA 2WYTA 4UOW0 3WNJA 2YXVA 4PV9B 1CCZA 4A2MA 2P28B 1ED3B 1TVBB 3OKKB 3F7QA 5CNHA 2AI0H 1U8OB 3G5XA 4GSRA 5JUEH 5IR1A 3ECBA 1C08B 4BWWA 1GOHA 2ZX7A 3EFDH 1NFAA 1S7RA 3HEIB 1AQKH 5B1JC 1KJ2H 1U8QB 4ZAKD 5I17A 1DE4A 1Z9LA 2I07A 4XCCH 1S5HB 3O41B 1CT8B 3RGVC 4RISH 1F90H 3IJHA 3V4PB 1NBQA 4P2RB 4QHKJ 1MNUH 3SODB 1WE5A 2HT3D 1U8NB 1DBKL 3FFCA 4GG6B 2LE9A 1PBYA 2EABA 2IH9A 3KZ8A 3RVXC 5BV7B 5I16A 1GL4B 5IZ7A 3A6CH 4RSVA 2EIEA 3QULA 5DK2B 4ETYA 1FO0H 1BQHB 1FE8L 2OJ1A 2ZCKH 4AIZB 3NEEA 1GR7A 2DLGA 3CVIH 1BYOA 1HX0A 5CMAB 2O1AA 1KN4L 3MNVB 3NCJH 1KBKA 1UKQA 2OS7A 4FG6D 1F42A 4JQIA 4RWYL 2E7MA 3FONA 1H15B 1SXAA 5CEYB 1HYSD 2R2BB 4JRYD 5HVGB 1XAUA 2DWEB 2ZYIA 2P5EA 2AABL 3B34A 3TA4D 1WCBA 1MJ8H 2K7QA 3MBWA 2FEDD 2YD1A 1KC5L 4MA7L 4ELME 3LPWA 3RDTA 3CK0H 2I7OA 3HE7C 2YPKB 3QG6A 5L9DL 2BMKB 1FPTH 4MS6A 3W5NA 2XNAA 4N86A 1PAMA 3T0EC 1W0WA 1OP4A 3CHXA 1CICD 4MCMA 3OKOA 4APQA 5J9PB 1Q0EA 4GT0A 2IPTL 1OP3K 3S34H 2X2HA 2CO4A 3MGTA 4GMTH 4WHTB 2GTWA 3MKKA 3GIVB 3FQ1A 3PAYA 4PY8J 4XMLH 3E80A 1QI5A 3LIZL 2N7AA 1TZGH 3CZUB 2WIIB 1DN0B 1KTLB 3LIZH 4HS8H 2OXGA 1SUHA 1RJZA 3IJSB 2F54B 2OCJA 3O8XA 1I9IL 4QD2E 1ADQA 3X3FL 5SX4H 1MF2H 3X1FA 4KKCC 3TCTA 1X7QA 3FO1A 2DIBA 2ZYSA 2R4RH 3J7HA 3BW9B 3TH3T 4GO6B 4HIJA 2TSBA 5CCGE 5TDPA 2F2HA 4NM8H 1QW9A 4FQXA 6PCYA 4NUJB 3K5RA 2HLAB 3MCLL 4J6IA 3L4CA 4PRAB 1YEIL 2DPKA 3VA2C 1AE6L 2WXHA 2FR4B 2PTTB 3QFJE 3EOBA 1X5XA 3NABL 2ATKB 1IC5H 2A9ML 2J71A 2BHZA 3MRFB 2CU9A 1CXHA 3QHZL 4N85A 1ACCA 4OGZA 2H6UA 3UTQA 4Z7WB 5C0CA 5JPNB 5KJ7E 3N40P 3RTQB 7PAZA 1YYML 1HILB 1DO6A 1XZ0B 5GHWL 1RMFL 2OYMA 4N2IA 4OD1H 4Z7UA 3CDZA 3IAPA 5EOCL 1TZIB 1I1FA 3MBED 4JGUA 3ZKXC 4R8WL 2ATPA 2BWIA 3HC4L 1IIIA 2DJMA 3BN3B 3DV6A 3VI3E 2EH7H 2VAJA 2P80D 5CIPH 1ID5I 5KOMC 4X8GA 1R5VA 3F01A 3SGJC 3WEOA 3NJLA 1EBAA 4Z7WA 5C0CB 3UTQB 3MRHA 1CLZL 4A7UA 1NDGB 1UD5A 5M95B 5IBUB 5C0FA 2QKIA 1TCRB 3SO3C 1M7IA 3OWEA 1N64L 4JJ5B 5LXVA 4U3HA 1ZSHA 3SQBB 3OR7A 1D5ZB 1R3KA 5E70A 5DMYA 1EO5A 2BIIA 4OM1L 2XG5B 1XBRA 1MI5E 2CM6A 2JELL 5DMGC 1AQKL 2CRMA 2EXSA 4PJEF 3TJEL 4OGYH 1YEDB 2HFEA 4WENB 4Y0GA 4OJDH 5C07D 1E8ZA 3TYGH 1GW0A 3E6FA 3WLWC 4N8VG 4RRPM 1P9MA 3VXQB 3NN8B 4PG9A 3LH2L 2IWGA 1IM9D 4MMYB 5TE4H 2XWRA 3P2TA 3RGBA 4F27A 3WXWH 2JKSA 2CDEA 2VM9A 1BXXA 1E2WA 3ARZA 5MEPB 4QHNA 5IFAH 3MZTA 3VD9A 4AH2B 2YKLL 4CU8A 3R06A 4Z77B 4S11A 4PRID 3BUBA 1OPOA 4YDZA 4NFDA 2OMUB 1XSOA 5GS0D 3C6SA 3FUKA 4Q4IA 4E5XG 1P6WA 5KVDL 5IVOA 3LXCA 1J8RA 4JMXA 5AVSB 1NPJA 2G60H 2PWFA 5ESVB 4Y2LA 4ZFGL 5LAXB 1J0YA 1HVXA 1WC7A 4Q89A 5EULV 2ZP0T 3KPSB 5EU6A 4CN1A 1PZ5B 3ULUD 5ADOL 1H0DB 4K3EL 1ZGLB 4L4JA 4XNXH 4U1GC 4Z76A 3A22A 2Z65C 2VXUL 2ZICA 4L3FA 3D1MC 4PVBA 5LWYH 1MW0A 4Y5YC 2WXPA 3BHBA 2AEQL 5IJVA 1YNTA 3TEZA 3B9VA 5A6IA 1AHKA 3O3UN 4K94L 2VAAB 1A9BB 1A1MA 2GY5A 3MJ8B 1IKOP 2O5YL 3FSWA 4BSWB 1RJYA 3IETB 4FJYA 5D7LA 1Q9OA 1OGAE 3QQ3A 4Q74A 4YFLI 3F5WB 5E8NA 2FLBT 4D0CA 1B0RB 4AT6A 5KSAD 4DEWA 5JXED 1JUFA 4M1DH 3RVVC 2ZG1A 2PWGA 3KPPA 3QXWA 3W38A 4ZX5A 2ZOUA 1HU8A 3J2PA 5E1AB 3WIHL 2I5YH 5F7HA 5DO2D 3CZSA 3NACL 5CILH 3FO0L 3NCEB 1U4EA 4D9QE 4JZNB 1URZA 2VQUA 2WCGA 1TKWA 2YPKA 4ZS7H 4DKFH 4ESKA 4MD5B 2PR4L 1VZGA 3A3YB 5EPMB 3W56A 1R47A 3NABH 3DUHA 1KUMA 1NLDL 2BERA 2BWQA 4LCCC 4UI2A 1L3NA 2Z91A 4D8PA 1S9YA 2LABA 2QMJA 4W4OA 4AMXA 1FNLA 2UXVA 5JXEA 3NRPA 2CIIB 4LNRB 3B1TA 1XMEB 3IJ9A 3G6JF 1VFBB 4ZMNA 4R7XA 3WIIL 1EHLL 2X89A 1BYNA 4L8SB 4QIRA 1QHOA 3KDMA 3H9HA 4PRHA 1CXFA 3US9A 1C5DA 1YEJL 1QSEA 4IGBD 2CHWA 3IYLW 5EORL 1F3DH 4YC2C 1OAUL 2IH3A 3JXAA 3P2DA 5H2BB 4UNVA 4QUOA 2EZ0D 3ILPB 5B39A 1WTGT 2QQLH 4LSVH 2ADGB 1FN4B 2HB0A 4IJ3B 4KX7A 1JDAA 4XMLL 3SGJA 1CVSC 2X0UA 3HN8A 5DTFA 4UDTA 4W9KC 1P6AB 2XZCL 3AXHA 2EJ1A 4R4ND 4UOZA 4UTCA 5C07B 2AQ2A 2GJRA 2X28A 4G70B 5E6ID 5C09A 3S96B 4HUCA 1DJXA 2GIXA 2NW3B 3NYKA 4NKOA 3VFWA 2EVIA 4XVSL 3KCPA 4PJDA 1KN2H 2LV4A 4I8DA 1MLBA 5T8IA 3MLYH 4GKOA 3IMWA 3BGFB 4NDMA 4PCSA 2ZSVB 2DQDL 4ZW5A 3CFCL 2XWBA 4MJ6B 3TT3H 2DWEA 1A2YA 2IDQA 5DMIH 4ZXBB 3T3ME 4ABQA 3FSOA 3MLTB 1UWEH 4B50A 4Y2OA 4M3KB 5GRWA 3POCA 1TYEB 3C5JA 4NBXB 2AABH 3INOA 5C0CD 2KLSA 1IC0A 1W72H 1BZOA 2HJLB 3L08A 1L4IA 1KJVB 3BAWA 2CXGA 2UUDH 5AVTB 2RA1A 4UT6L 1CXEA 3WKYA 4XWOC 4G6FD 1FFOB 2IDCA 4MXWL 3O8XC 1PX3A 4JO1L 2N1TE 4R4BA 2R0LH 4Y2NA 1HI6B 5IROA 1NFIA 2DQTH 4AOFA 5DVPA 5DHYB 2VIRB 4CVWA 1Z9MA 3D52A 5KSUA 3QJTB 3QWOB 3U2JA 1F5WA 2PWDA 3US1A 2Z6FA 1AIZA 3DX7A 2XFGB 1JZFA 3UGUA 5KJRH 1HKLL 1XXDC 3V0DA 4YSOA 1HINH 4MBOA 5I18H 1QKZL 1VGEH 4X0KB 1FP5A 1AMXA 1SJXA 5CSGA 5EOQL 2WOYA 2XQ0A 4D9RD 2JTDA 3VVWA 4IRSD 3WKNA 3KLKA 4MMXC 1B0GA 2HVJB 3EGXA 1KOAA 1VFAB 5LGKA 2W0FA 3G6DL 4HWEH 5JOEA 3IGLA 2W5PA 1FIEA 1NPNA 2WOBA 4UUJB 5EZLA 3U9WA 5J1SC 2FK9A 2VDOB 2YGNA 2WJ5A 1J8HE 2VKXA 2FQGA 2ZWYA 3CLEL 4LQFL 4ZAKA 1YPZE 4I13B 4F7TA 5A2KH 1NDMA 4XVUC 2X4SA 2IWEA 1AZBA 4U1SB 4HZLA 3N04A 3VFOB 2KLTA 3MCKB 3IXAB 1PY4A 1UYWL 1HWGB 4YBQD 4PSPA 5E8PA 4I85A 3SIKA 3GPEA 3PREA 3CH8A 4K7FA 4RVBA 5K9QG 5F96H 5J13C 2YQ2A 5CP3H 3WJLC 3CQFA 1ETZB 1SM3L 2OK0H 2DKUA 4NQEE 2X4OA 1R34A 1BD2A 5LDUA 3W39A 4NPYB 4HC1L 1U4FA 1DANT 3K8MA 3QH3B 5EU3A 3D39E 1WICA 5BW7A 2P5WA 3WGVB 5D1ZC 4KJQC 3S37H 1NGWA 4R4FL 2J1WA 5FDWA 3U6XS 3CHRA 3ECUA 1BQLL 4UCFA 5CKGA 2OXHB 3I6GA 4WV1C 5B1AB 3RHWF 2P24B 5SWSE 1CGYA 4L9LC 4L8DB 2PCFA 3V0EA 2C5DC 3KBEA 4YL4A 4V2BA 1FSKC 3LZRA 1ADWA 5IT2L 1DQTA 4JDTH 2QQQA 2E74C 1UZ8B 4Y8DC 3TTSA 3IJYA 3ATFA 5DUBB 2HX8A 3LQAL 2Y3AA 4WK2B 1BG9A 1P4LB 4U0RB 4D8OA 4NYLA 2MPAL 3PJSB 2K7PA 2X40A 2CUIA 1CZ8L 2VT0A 3SDYL 4ADIA 5D1XA 5FECB 1N10A 2XA3A 1JCKA 2WWKT 3P0YH 2ICEA 2X6CA 1BYPA 4XNAA 1RZKL 2RQ8A 1E4JA 3QZNA 3KPSA 1JWSA 2DTMH 3IDIB 2XZQL 4NENB 2FO4B 1Z7JA 3PAUA 3VFSB 5GXBB 1YEKH 1CF1A 3MRNB 1GZHA 4L8SC 1AR1B 2X2IA 1D6VL 3EHBD 4ODXA 1BAWA 1AQHA 4WZ9A 4G80A 4R0LA 4OGXH 4QY8A 2WBJC 5EEWA 1T03L 1ETA1 4J8QA 2BY2A 1KIPA 2HTKC 4F8NA 2CUMA 3BSZL 5GGSB 1DVFA 3BVWA 1AO7A 2YGVA 1QA9B 4BK8A 4C4KO 1HZKA 1MFAH 3CDCA 4K55A 1JPSH 2WIIA 3FCSA 1I53A 4ZYKB 3UX9B 4F2EA 2O4EA 3P11L 4NNXB 4PJXA 3GBMH 3QDGA 1KLGA 2EAEA 2HFGH 1TQBB 4NO2B 3F3HA 1TR7A 3QZWG 4PGBA 3H1ZA 2WLIB 3MA7B 4TTDD 3KGRA 1JGDA 1OE3A 2WSDA 3OKOB 2IOMA 3NZUA 5LAPA 4PEEA 3V7AG 4HLJA 1DBMH 5IHZB 1C5BH 3H42L 2NY5H 3HI5H 4AEHL 3WO4C 2DRUA 5BMFL 1TLMA 1VERA 2NNFA 4X5WA 1DE4B 5DC9B 3B9KA 4M5YL 1TVDA 5EN2B 1TYJA 3NESA 2FYYB 1A3LH 3SY6A 5E99H 4HJUA 2H4EA 2FD6L 1QR4A 4PVMA 1JK8A 1A3LL 5DHDA 1ZLWH 3ET9F 1JRHL 2DQEL 3NSDA 4WWID 1QSZA 3WUWG 4LU5L 5J1AA 1JTOA 5J7CC 2ZXWB 3QO1B 4OT1H 1MIEL 1RUAL 1WIUA 5AW4B 3NJGA 2D7TL 4NZFA 5KWYC 2HZHA 3DJRA 1QPXA 1E9PB 3I2CL 4M7ZC 3UH8A 5I6XC 1VADB 2VMDA 3C6LA 3G6JB 4GS7C 4RETB 5FFOA 4KZDH 2D0GA 2BIOA 3SPVB 3S8WA 1JVLA 4HKXB 1MREH 3KJ6H 3QO0B 2IFFH 2DEWX 9PCYA 2IPUK 3R19A 2QV2A 3KXFB 3LQMA 4YHKH 1EO8L 5KZCB 3EYOA 3LHPH 1M1XB 4ZUUB 5K69A 4HAKA 4YHLL 3B8SA 4D9RE 4W9HC 2Z92B 3QCUH 1BAFH 5DWUH 1JF1B 2WZ5A 4UAOB 1NCBH 3VI3F 5H35A 5HDQH 2A2QT 1G1OA 3HZVA 3MRIA 2YSSA 1KBWA 4JW3A 4OJCA 1XD0A 4FERA 2VABA 2F74A 4AJ0A 3OXRA 5EBWB 2E6JA 4KI1A 3UTOA 3BQUA 1XH1A 4X6DA 3V6FB 3ZT7A 3ZTNH 3LDBB 1E8XA 1IARB 4FMKA 3LKPA 5FX3A 1I9RL 1WWWX 2YPVH 4ZOBA 1Z5LA 5I76B 2JKIS 3B9KC 2XZAH 1KIUA 3ARDD 4X4ME 5E56A 3K6NA 1THCA 1BAGA 3GRBA 1FQ9C 5LAXA 5C0AD 1FG2B 3T3PE 5HGBA 4FNRA 3GSOA 3LVEA 2YPVA 4A2LA 1SXBA 4KZCA 2J8HA 1GS8A 3FT2A 4KNUA 3FSAA 5G5DA 3GMLB 2WQRA 4FXTA 4M1CC 3FJTA 2ROXA 1VDGA 1Z9PA 1BGXH 1OP9A 4LLYB 3HIZA 4DO6A 1QRND 3O4LB 3S5LG 3ZXAC 1BM3L 3CLWA 3LV3B 4LDEB 1KPVB 3QDJD 3MCG1 5E1IA 2GJ6A 4JPIA 3IU4L 1DP0A 3DTDA 4R4NC 3RWGB 1GOFA 4XRCA 4ZDHA 5MHSD 4M7KL 4G9DB 2OFQA 5E8NB 1A65A 2J4WL 4J6RH 4XOCA 1MJUH 1J10A 5IFJA 4X83A 2PYFA 3AS0A 3TZVC 2ZWKA 1U8CA 3GUFA 3HS8A 4X98B 4JZJA 4WUKH 4LF3A 2MCPH 4JFDE 4FKKA 2ZCHL 5JOPE 3QQNA 4FYTA 2YOAA 1K5WA 1DLHB 1G6VK 1JOIA 3QIBA 1A1OA 2CBTA 2Z8VC 1YZZA 2V7HB 3BMVA 4JFUA 1RZKC 3TPUB 3SDDD 3D39A 4YXLL 1F6AB 1X5YA 2SEBB 4FQXD 5F89A 2VW7A 3QXDB 2X4NB 3KBHE 3TWCL 2VOTA 1DQDL 5DK3A 1CPUA 3B6SB 4L3ED 3RWEB 4PWKA 1T04B 5EO0B 1O6VA 2BSTB 3LYRA 2KLRA 5D1QD 3PP3H 4X5RA 5EA0H 4KJQD 2A6DA 2DOCA 4F33B 4Y7MA 1IJNA 5F9WB 3VAEA 2BNRE 2AJUL 1IE4A 4YHPB 3WOVA 3ZGIA 4HWEL 4PWJA 1TU2A 3M7FB 4DK5A 3D9AL 1UZ6F 4QHNB 1DQVA 4O02L 1QD0A 2X41A 2BVOB 4POZC 5JDSB 3AB0B 1X5FA 5KUMA 1T3FB 3ZE1B 3DPBA 4UILL 2HH0L 3FCGA 3P77A 4LSSL 3RWDA 3HG2A 2CDGA 3FU7A 2DEXX 3I6GB 3MBEA 3MX0B 4HIIA 1WZ1H 5BW7C 2W9LA 4UV7H 3VXMA 3PIQB 3MRDA 4YLBA 5AZ2H 4YE0A 3SKJL 4LFHD 5C08E 4JGMA 4I4WA 1IM3B 5DVNA 3EGXB 2D4DA 3KPQA 3OHXC 3BQUB 4Z18A 1LEKB 1OAXH 5DSCB 5DK0B 3DHUA 3MOAH 2YPLA 1ZVYA 3DECA 5EDXA 5MERB 2P5ED 3S2CA 1XGPB 1F3DJ 1J88A 3LY6A 4L1HA 3WAKA 1TTFA 4A39A 4HMCA 4GJTB 1GY2A 2WZPD 4JREC 3CHSA 4GQPH 4UU9A 5FUZL 4PJCF 1XR9A 3STLB 4A1RA 1QYGH 2CHNA 4I4WB 4KKLD 1HL4A 3CLFH 4FN0A 4PM1A 4K2UH 2YOCA 3PWPE 4QRUB 2AQQA 1SZNA 3IU3A 4YFEA 1UA6H 2VERA 4P57B 1MFDH 1XGTA 2R56L 1F4YH 2PP9A 3IXAA 5KTEL 2LTQB 3BISA 3AGVA 1L0YA 2R1WA 2ZQKA 3U4EA 4PCKA 5IMOB 2VQ4A 3DBSA 2OZ4L 3E7JA 4BFJA 3BP5A 5F72S 3SGDI 1RH8A 2DIEA 2QHRH 2VN4A 4PH8A 5KN5A 4JPWL 5C9KA 2FX9L 4J1UB 3HI6L 3GSXB 3AWFA 2VDQB 4RMUA 4AYGA 3MHZA 1XCXA 4OZIA 2YPLD 3BKJH 1RHHB 4XXCA 1A4AA 3CHQA 4P5MA 4RMQA 2LU5A 3QRGL 1XF3A 1BW8A 1A4KA 1XB6A 4Y4FA 1A7OH 5T1DL 5CFHA 4LEOA 3WY2A 5KSVB 2XVLA 2NDGA 2WZ0A 5AB1A 2A1WH 2YSTA 1KLGB 1CYWA 4L8BB 4DVRH 3WN5B 3OZLA 3MJ9L 3ZDZB 1T4WA 3H7BB 3TF4A 4OI7A 1HXMA 2IGFL 3B2MA 3IMRA 3C9NB 4M6OH 5AVXB 3KCWA 4HA1A 5F8RC 3R8BB 1HSAB 2DV6A 4NN5B 2NY4D 4HSQA 3LPFA 4RA0C 3EJZD 4XBGA 5KVEL 4P57A 4MD0B 2E47A 3TZVB 4NQCD 4HIQA 4E9QA 1MJUL 3BUIA 3HC0A 4PS8A 4J6RL 4WFEE 3SKNB 4Y4FD 4HT1L 3IEAA 2EDFA 4G6MH 4JO5A 4MWFB 4YFDB 4OFPA 2C1PA 2X10A 3JBG7 3QPXH 4LRNL 5HGGS 3T3PF 4M61A 2ITDA 3NZ8B 5HPMB 3CBKB 3VFPA 4S1DD 1SMOA 3IU4H 4PR5A 4V1DD 2ORBH 4QJ3B 4UQDA 3BEVA 3RTQC 5EC2B 3BE1H 4HGKC 2YRLA 4DKFL 3QDJB 5KW9L 1FYHB 3SKOB 2EADA 3U4BL 1P84K 3A6BH 5CD5C 1TQWA 3FQNA 1KGWA 3VGAB 3ZKMC 4HJEA 4JM2B 4M9OA 4K3JL 1G87A 3EH2A 1G84A 3ZKQD 4ODHL 1YMHA 4LEXH 3F12B 4HUNB 4PWIA 2FUTA 2NY3D 1LHZA 1NFIB 3L6FA 1X5MA 3AUWB 3PWPB 2BSEA 4M1DL 5ANHA 1KTBA 5AW2B 3SPVA 1T1WA 3PP4L 2GIYA 3BZFB 5I6PA 4J3VA 2EILB 5DJ0A 2Q20A 5D7JB 5AZUA 4JUSA 3U4AA 3WJJC 4RRPA 1U8KB 3L13A 5IMKB 1KNOA 3BGAA 4Z8FL 3LKRA 4OD2B 1KJVA 4M7JH 4X4ZA 1QFUL 2C3XA 3MLPA 3UTTD 1OARL 1B4JH 1JWUB 3C60D 4B6ZA 2A6JB 1RP9A 3X17A 4AGMA 3A4FA 1ECZA 2F54D 4UQ3B 4Z3JA 1DQLL 4P59H 2OTUA 3NFSL 3PE9A 5A3IC 4P5TC 1BA9A 4PR5B 4TQ8A 1NBVL 3C5ZA 4YDJB 4IEFA 4LLDA 3SBWC 5JOPD 4ZOEA 4F91B 1U58A 2GUOA 4X50A 1EDQA 3D0VB 4JPQA 1JWUA 4BCYA 3IN2A 4NKDB 4CVXA 1KJ2A 5B4MD 3VXOB 1N6QH 2OL3H 2Q86A 2W65B 3OV6A 1NEZB 5IWLA 4PLKD 3ILQD 1TFPA 3ZL1A 2HP4A 3T6ZA 4LHUA 1QLRB 5D2NE 1FNEA 2IBZX 5FYKH 4F5CA 1SOSA 2AK4B 1NANI 2A77L 3OB0H 2WVTA 4TTGA 2IQAA 4FS0A 5C2BL 1PLGL 1U21A 4L3EA 2F8XC 2XWZA 1M2OA 2V3FA 1J1PH 2FVNA 1PQZB 1OZUA 5IBLD 3WY4A 1FC2D 1RK7A 1UD8A 1XR8B 3ARGA 4NQDB 2JJVA 5BOZG 2HFTA 3SDCA 4X5XB 3JWDL 3QFJD 2CUAA 1QTPA 3TASA 1LK3H 4DP1X 1OM3H 3FUFA 1JGUL 3QB7C 3U7WH 2VUOA 3I9PA 4R9HA 3FT3A 5LQBL 3ERXA 3B3IB 1I8MB 1TQCC 4GKZA 1ANUA 4WGKA 3QUXA 2J8OA 2RH0A 3HFML 3HMXH 1IZJA 5C08D 1MAMH 2DQGH 1CLZH 3ISWA 3RFRA 4YPJA 5DQJB 3T8XA 1ZLDA 4N0YH 5IHZA 1YUKB 2FAUA 3GJFB 5CBAB 4KVNL 2VZOA 3KVDD 3ZHDA 1H0DA 1ZGLA 4OD1L 3V8OA 4GKNA 5J11C 1QW8A 3QSKB 3L2NA 2GABA 4HXAL 1RXLA 3FUMA 1F58L 4QRRE 3CDFA 3TS8A 2G4GA 2EXYD 1L7TL 2ZT9C 5KW9H 2H1XA 1XDTT 3BAXA 4K5PA 4X0KA 2W81C 1OOWA 5ANMB 7FABH 3OC8A 5TE7L 1XL6A 2ORBL 2BFVL 4K23L 1GYUA 2APFA 4FFWD 5J1AB 4J3SA 2WTPA 1YEIH 2XWEA 1HXYA 3FPYA 4LRNH 1FDLL 2IGTA 4RFNB 4BELD 2GJZB 4XNMB 2QSCH 2YUZA 5EO1B 2FLRT 3ME0A 4X9GA 4OCSH 4E9WA 3FYEB 2O6FA 1R3HB 1RP8A 2AXJA 2WUBL 1G9NH 4FLOA 1OT2A 2DLIA 4IKNA 3GKZA 3L3DA 4JFOB 3BGMB 1MQKH 4JHUA 1OLZA 3IWUA 5IP4A 1BZ9A 1BFVL 4B3EA 2JIXD 4LSQL 2Q9OA 4PG9B 5DVLA 3NCMA 1NDMB 3MN8A 2NY4B 1ZE3H 1PMYA 4OQTL 3BVXA 2JJSC 2X9XA 2AK4E 2OBGA 1TTGA 4AC2A 5FM8A 3Q8CA 1Z9OA 3QDMA 1CFBA 2L7JA 1Q9KB 4OZFH 4HEPA 4A2GA 3QFDB 4M6ML 4U0RC 1DVFD 1N9PA 2VDRL 2BIMA 3HZMA 1XGPA 1IVLA 1QFWM 4N24A 4HHAA 3UBHA 5KSAB 4X6CF 1UD6A 3MRRA 4PRNB 1N8OE 5I26A 3BKJL 5TK2A 3HUJE 3U46A 3KVPA 2L7QA 3QUYD 1KB9K 1F6AA 2SEBA 4XP4L 5DA4A 2HKAA 1WT5A 3DXAA 3QG7L 3EFOB 5AKSA 2QHRL 2NY1B 3L9YA 1IKFH 4N5UA 4B9PA 1RSYA 3F7YA 2OZ4H 4WTQA 1QWNA 4QHLB 1BX2B 5BO1L 1WIPA 1MJ8L 4ALAH 2AAAA 1F4XH 1TFHA 3CE1A 4NC1C 5HJDA 1U2CA 4MZIA 3C60C 2PPFA 2Y4SA 3Q9PA 2BZCA 3SDAA 4IIQA 3ZW3A 1VIWA 1IV8A 2JI2A 4U1IA 43C9B 4B7LA 4P2QB 2O6DA 4UT6A 5D5MF 5F96L 4AVIA 2IGLA 2JKLA 1MXGA 4HUKB 4YVUA 1CLOL 2XWTB 1A4KB 1FV1B 2HPTA 4ZPVA 4D9QD 4CW1A 2KKQA 3BP4B 3KPPB 1U91A 2DY2A 3ARGD 3BUDA 4TTDC 5GISH 4N8VA 3QPQC 1ZVNA 3MJGX 1ND0A 3Q13A 5D1ZB 2OR9H 4XNZC 2XG4B 4U6YA 3CZFA 4OZFB 2B2XH 2V17H 2Z7UA 4CAGA 2EH8H 1FNSL 4WUUB 3DIVA 3L3HB 3UABA 1DJGA 1A4BA 5JW3H 3HNSL 4XCCL 2RR3A 3QC6X 5I74C 3SDDC 3ASWA 1EBPA 1OV8A 3MRJB 4PW9A 1WEJL 3GSNL 3P9MB 2P52A 1JV2A 4QNPF 1JYXA 3KHOA 3V4UL 1T2QH 2YD6A 3PJLA 4GO9A 5HVWA 3D69A 4GYBA 1XTMA 3D9AH 1T2QL 2ZOWA 4XMZA 1ASOA 1UXLA 3NSXA 3RTQD 1C8QA 4PMFA 2XX1A 3TIEB 3LRKA 2BFGA 2F7RA 2CK0H 5CD5D 1MWAH 3NJMA 3PWLA 2KS0A 4F20A 2LHAA 3WFHB 4DIXA 3WJLA 5KJRL 3F7VA 2W80C 2V17L 2F7PA 4ZYKA 2B1HH 2NR6D 3CNKA 5L4IA 4G8GE 4W9CC 5J6GA 4NWTH 4JLRA 4AYFB 1HQRB 3KYMB 3VNYA 5AL0A 3WFBL 5L2KE 2V5SA 5EF1A 3PWJA 2RAMA 1ZHKB 4YH6A 5KBKA 1UCTA 4TPRH 4L3CA 4WI0B 3SKMB 4PBVC 2VC2H 3RVUD 3TNNB 2DICA 4XXCC 2WBXA 4XOAA 2XU9A 3V2AR 1DQIA 2WZPA 1OD9A 3RLSA 1QLEL 4JM2F 4UTAH 5T5FL 2DDQH 1RUKL 2AV7A 2VR4A 4MAZA 1PG7W 1PCXA 5A2BA 5E8DH 4CADA 1F4XL 2JJUA 2I27N 5I76A 2FH8A 2GJJA 5LBGA 4NOFA 1EEZB 4OJFL 3QXVA 2GJPA 3FFCD 5F3BA 3CTTA 3KH3A 2EVHA 5HHME 5I19L 1LO4H 3K81A 1U36A 2GITA 1A66A 1LNUA 4Y1AD 3APDA 3QJOA 2F6AA 1Q9OB 1FZJB 2Q2EB 2UVEA 3QQ3B 2ERJC 2MQ0A 3ZKNC 4AYMC 1FZKA 4JLRB 1X5GA 3OAWA 3B37A 4H26B 4UU9B 4CGUB 35C8H 2RACA 1A1OB 3DBXB 4PSRA 2OMXA 5DEFA 1CJYA 1Z1WA 4OR1A 4D0DA 2A74B 3MUGB 3DVGA 3FTXA 1YEEH 4KDTC 3V6ZA 1C1EL 3N43F 3PNWA 4QRRD 1M6UA 5ECGA 4RIRA 3TH2T 1OAUH 4PS3A 2M26A 1J8SA 3H3PL 2Y5QA 3TN0D 4R97C 1NL0L 5JPNC 4R5TA 4G43B 2EDMA 4LSQH 5E1HB 1JZ4A 1I1AA 1V7ML 3VW3H 5CWSA 4P2QD 5HHXH 4FOMA 2EE9A 5C0IA 4LP8A 5F0MB 5J12C 2NXZB 1U8HB 1ZSDB 3MRPA 3P30L 1IGIL 3TEUA 5FEBA 4GAYA 1S7XA 5HYJA 2FNWA 4Y4HB 1T0MA 3N85L 1VFBA 3W11C 1K8DA 4KHTL 4RZKA 3UJIL 1I1FB 1QLEB 4JN1L 5DYOB 4LCWD 3R0MA 1T0PB 4YHLH 3I6LD 3RL2B 3SE4A 3LHPL 1KB5L 5EOCJ 1BVNP 1G7PB 1T1YB 4HAFA 3DO7A 2PXYB 2E4TA 4LIQL 4F15B 4MDJB 4E41A 1OXYA 3WNLA 1Q0XL 4AUUA 2NNXA 4FQPA 3WIHH 1SYSB 3Q48A 1BVNT 2DMGA 1UWFA 5CUSL 4PGEA 4E42A 4S1DC 5I1KH 2HVBA 2XXMB 2GJ6D 4FFZL 3EJYD 5KS9B 3WFCH 4W4NA 1JN6A 3QEUB 1N4XL 3HC0B 5ID1B 4P2RA 3RG1C 3HC2A 3HMXL 2WXIA 1XGUA 2APSA 2KUTA 4K9JA 4KI5F 1YG9A 1RPQA 1W15A 2JTYA 4DO4A 2ZF9A 5GSRA 2UYLB 3UTTB 1JNLL 3EBIA 4WJG3 4X9BA 4ELDA 3ARQA 2YXFA 3MJ7B 4PTTA 3MRPB 5JHDA 2X44D 1QUNA 4K7PH 3N50A 3VFGH 3L3OA 4I2XB 2L0DA 5I71C 3FU8A 5D93C 1IGTA 4I3RH 5HHOD 4U1GB 2FWOB 3FONB 3HPJA 1B3JA 4WAFA 4ZMAT 1SFDA 1CU4H 4IW4C 3HI5L 3NRFA 1EEZA 1GZQB 3WIFB 2Q7AA 4L4VA 3PS6A 2MQ3A 4EI6B 3IDNA 3X3GL 1GH7A 3DUSB 2GHWB 1CDHA 5JPMC 2VE6A 4JHBA 3KDMB 4OFQA 4HKJA 4PRPD 4QRPD 4UOQA 4OLXH 1NCWL 2Y2YA 3SBRA 2FLMA 5E2VL 2GTZB 1ZPLA 3OKLB 5DJXB 5IFAL 3KDPB 4WKZB 3VXPA 1I7UB 1BVZA 1JPSL 2ZXAA 5FC9A 4QLWA 2L3BA 3BLKA 5DZJA 3QEHB 3DROA 1ZTXE 1L0QA 1S7RB 1NBVH 2EYSA 5FYLE 3DJTA 1LWHA 3MJ7A 5E7BA 2WLLB 3TJEH 4OBRA 1JMXA 3L4UA 2ZJSH 3UCQA 3TBWA 1IIKA 4FTDA 4UB0L 4NQXA 2ICWB 4FJ6A 1EEUA 5J5EA 3CQQA 3KPRE 4Z95L 3RGHA 5E95B 2QQNL 2ZKHL 4LHUG 2LU7A 3FCBA 2N0KA 3MRDB 1YPZF 3H3PH 4OZGA 5KS9E 3EDKA 4JVPA 1NCTA 3RPIB 1KJMB 4FLRA 2MKWA 4CVZA 1CZ8H 3G5WA 4RQQB 2LOEA 3L4YA 4TQEL 2DKMA 5I1IH 1YNKL 4JRLA 1I1YB 1B6UA 4LESA 6PAZA 2OYPA 1NBCA 1G9MC 3A6BL 6TAAA 3ARFD 2XTJD 4F7KA 4NLAA 1XZ0A 4H8WC 1HI6A 2K4WA 5DMKB 3QXAA 1XQ4A 2EEBA 2N59A 4XC1L 5HYSG 5L4JA 1SDYA 2P8MB 4LLMB 4UTBH 4FG0A 5T1LB 3S4SG 4G7YH 4KY2A 1ET8A 5DGRA 4MXVF 4EZMA 2PCXA 2OSWA 4G8FB 2ZKYA 3AG2B 4LDCA 5EIQA 1MF2L 3V6ZB 2HWZL 4N2MA 4N28A 2BXYA 2EDDA 1E9QA 3U7YH 1SJHA 1CT8A 3LQZB 1B0RA 4AT6B 1HCFX 4IOFD 2QADC 3BFQG 3WO3B 1F3JA 2F54A 4XE0A 3SE9H 4G72B 3S3JA 3KYMA 5HHMB 4ANWA 2UY7A 1GA2A 4YFLF 1E4WL 3VMOA 4WFGD 2H9GA 1UOVA 5SX5K 2F5AL 3VXQA 1I8IB 2VWEC 4G7SB 3LKSA 4GMTL 1A7OL 5DFTA 5ILTL 3H0TB 4H1LA 1HWHB 5FK9A 5T1DH 5C0JA 1KCWA 4H40A 3ZPDA 4NJAL 4JNXA 4ZDHB 1YNTF 4YGVA 5B7FA 3DHMA 2CCLA 2Q6WB 1LEKA 1XX9C 4Q56A 1FPTL 3WE6A 1OAYH 3QS2A 2NXYB 3QNXA 2PN5A 4XP5H 3AXLA 4PJ9D 1SQMA 5HHQA 5I2IB 2I85A 4UWQB 1WS8A 1LDSA 3KPRB 3ZMRA 4B0MM 3BUQA 1FNGA 1IAOB 4PBWD 1QHQA 2CRIA 4DP2X 1IC4H 1GZHC 4L8SA 4UQCA 4MB5A 1FJ1B 2Q76A 1XD1A 1OGAA 1L7IL 2LLGA 3P9LB 1WFNA 2E76C 2ZP8A 5DZ9A 5TDNB 3VXTB 1USQA 2GITB 3NCJL 4YHIB 4NP4L 2WTRA 1Z0NA 2G5BB 1KYOJ 2E56A 3FQ2A 4LOUD 2ODHA 2AQRA 1SF5A 5DD5L 3HE7B 5E08H 3GM0A 2DQTL 1COBA 3IJEA 3OKMA 1X5AA 1YO4A 4GINA 4KRPD 3V55A 4OZIB 4Z7WE 1FF5A 1XB3A 5CR8A 5GRVL 2C1OA 5EU4A 4ZW8A 3MXVH 3EGSA 4MSWB 5F9DC 3EHBB 3FTYA 5E8EB 2AW2A 1D3CA 2ZUXA 3BAEL 4IKIA 1KJ2L 4QT5A 4X9YA 3KS0J 3K6DA 2HA1A 2JQMA 3ZZQA 4M5TA 1NCGA 5JUEL 2GAZB 2ZXCA 3BVNA 4Q6IB 1HXYB 4IKLA 4N2AA 4FEMA 4PJFB 2YEZB 2EEXA 5E9NA 3IKKA 3MDJA 4MSWA 1Z9SA 4DZ8A 4G1MB 3M88A 5D8JH 1I3UA 4PJIE 4QYOB 4Y16A 4BEIA 3HVDA 4KVCL 2ZTBA 5I6MA 4FJZA 5F7LB 4Y2DC 3LJ3A 1TJIH 3EJPA 2YAFA 3ARPA 4MA1C 2D4FA 3KLDA 1CI5A 1JFQL 4BH8A 4HPHA 1UWXH 4XN9A 1FFOA 3V5DB 4JKKA 4PBDA 4U7SA 3HE6A 3VXMD 1PZ5A 2WC7A 3TC9A 3F7RA 1KT2B 1CLCA 4R3SA 1V3JA 1OHQA 2AKRB 1A7QL 1QVOB 4ONGL 2R0ZL 1B0IA 4ZFFA 4PV8B 1H19A 4JKNA 4F3FA 3BWAA 4JS7A 1NEPA 2JCCF 3GRWL 4CC4A 4PTUB 1BFOA 1EFXD 1CG9B 4YHNA 1L9NA 2XJLA 3CHPA 4MQXD 3QEQD 1I9EA 4S1SH 1XAKA 1MVFA 2B14A 4K5MA 3ZZLA 1GZPA 4OQTA 2XVBA 4BSWA 5KBPA 5DEZA 1VFAA 1A4JB 1EZVX 2NXYD 4HF5H 2V2XA 4XPTL 3BIKA 4JG1H 1PD6A 3SYAA 5H37G 4LSPL 3QJRB 3KPRD 1AR1C 1QR1A 4OV6F 4UDUA 1BM3H 3GRGA 2GBVA 4ZS7L 4ZX6A 2Q7NA 3C08L 3HZKB 4HFUH 1GGCL 3EOYG 4CDHA 4GBXB 5FLVA 4HGWB 3FTGA 4HXAH 3MRQA 3DV4A 1N0LA 2FJFA 3E9UA 3NCYP 3EZ8A 4ENZA 4NZ8A 1Y7VA 3VD2A 3HA0A 4LPYA 4PQXA 1S5HA 2EUXA 5BPPA 3A67H 3Q8AA 3FNKA 4KY1L 2CR3A 2HN7B 3BAIA 4N0YL 4OFYA 5E5RB 5LBSA 4E9SA 5FA4B 1EH9A 4DOHB 3RY6C 4FFTA 3L9RA 4M43H 4X8JA 3ECVA 4HS6B 3L5HA 3UADA 1I7RB 4F37K 5LO7A 5K9OB 2NY2B 2VZSA 2NUTA 1NGZB 3T65B 4NQQA 5C7ZA 3ULVL 4IBZA 1UKTA 4N25A 3U7WL