2IH8A

A low-dose crystal structure of a recombinant melanocarpus albomyces laccase
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
559
structure length
559
Chain Sequence
b'EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
publication title A crystallographic and spectroscopic study on the effect of X-ray radiation on the crystal structure of Melanocarpus albomyces laccase.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
total genus 184
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2ih8A03
1QLEB 1NPNA 1KDJA 1XB8A 1AZUA 2AFNA 2CCWA 2H47C 4AKQA 1L9RA 1RZQA 1M57B 3NJIA 4Q8BA 4YSAA 1ASQA 2Y69B 1CYWA 1SJMA 4UF7C 1ILUA 1AZRA 1L9PA 4E9RA 2GSMB 4HCIA 4BDVA 5IY5B 1RZPA 2J57A 3ERXA 2VN3A 1QNIA 2YQBA 4DPCX 2E86A 3PAVA 3ASNB 1GR7A 2UXFA 2IDQA 2FQEA 3MBWB 1NWPA 3UACA 4AX3A 2AANA 4HAKA 1ASPA 1N68A 2VM4A 3H56A 2QDWA 3NJHA 3TA4D 2W88A 3UGEA 3RYMA 1BAWA 2AZAA 3X2QB 1BQRA 4M4RB 4E9QA 2XXGA 4AI7A 3EH5B 1OOWA 1L9TA 2IAAC 1E5ZA 4YSCA 3TU6A 4BDVB 3QQXA 5I6NA 1JXGA 1V55B 2GB2A 3TBCA 3S8GB 3FQ2A 3NJNA 1CYXA 2UX7A 2PLTA 1WAEA 1WA1X 1AG6A 1MG3C 1ILSA 3AZUA 3UAAA 1KBVA 1W6LA 2XXFA 4W9ZA 2WO2B 1GS8A 2IWKA 4DP0X 2Y1AA 1AZBA 3S8FB 3FQ1A 1VLXA 1ZIBA 2HX9A 3NJFA 4YSDA 1BYPA 2IDTA 2QPEB 1IBYA 2YXWA 4DP2X 1XMEB 3IN0A 2IDSA 3QJSB 2PP7A 4KO5A 3EF4A 4A2EA 4A2GA 2JKWA 2FTAA 2XV3A 1E67A 1PZBA 4GP4B 5D4JA 2YAOA 5I5IA 3FSAA 2CALA 1V54B 1J9QA 3NSFA 3T9WA 2QDVA 2PPDA 5I6MA 2CJ3A 2N0MA 5A7EA 2BW5A 1AACA 2Q9OA 4E9SA 4P5RA 2XVBA 2YXVA 5B1JA 3AG2B 1E65A 1OCCB 3NJLA 4G71B 4HCFA 5AKRA 5I5JA 3QJRB 2UXGA 2IWEA 1SF3A 3AW5A 4A67A 4HZ1A 2VSMB 4HCGA 5I6KA 4W1TA 1AS7A 3UAEA 2BW4A 3FSVA 3PXLA 3H4FA 2ZONA 2VSKB 3PLYA 4GY4A 3N2JA 1URIA 1OCZB 1ZV2A 1YLBB 3DIVA 2P80D 1PMYA 1SFDA 1AR1B 1BEXA 3WKPA 1HAWA 1R1CA 1WA0X 3IEAA 4BWTA 2OV0A 4NAJA 5TK4A 3X1EA 4A66A 2QT6A 3NSCA 1AS8A 2ZOOA 3T71A 1NIDA 2PP9A 2IH9A 1NICA 4GYBA 1UATA 4X4KA 2FJSA 3ZBMA 1JZJA 2JFCA 3CVBA 3FU7A 3NP3A 2FT8A 1SDDB 3C75A 2W8CA 1GS6X 2R7EA 5B1JC 1IC0A 5D4IA 2GC4C 2DV6A 3AG1B 4A68A 2EIJB 1AOZA 3T6VA 2NRDA 3BQVA 2XLLA 2VW6A 2HXAA 3S3CB 2YAEA 3WG7B 3DTUB 4KNUA 3NSDA 4WTQA 1NPJA 1NTDA 3FYEB 3OM3B 3ASOB 1TEFA 4KOCA 1BXVA 1A65A 4F2FA 1BQ5A 4RH4A 5E9NA 1HAUA 3IN2A 2DYSB 2WSDA 3CVDA 3OD3A 4Q89A 1QHQA 3SBPA 1E5YA 4PCYA 1ADWA 1PLCA 3FPYA 4N8UA 5B1BB 4E9WA 2FNWA 3FU7B 3AG4B 1J9TA 1KGYE 4GXFA 4BK5C 2HX8A 3TASA 1NWOA 3FT0A 8PAZA 3CVCA 3FPXA 1BQKA 5PAZA 1NIFA 1PCSA 1SNRA 4F2EA 2IDUA 3FYIB 1FA4A 2TSBA 5AFAA 2BP8A 4YSOA 3IBOA 2LLNA 2FQGA 5FC9A 2PPCA 3HB3B 3X1BA 1JERA 1ZIAA 1OE1A 1NZRA 1NIAA 1OCRB 1N70A 3EH3B 2HX7A 4YSUA 2A3TA 2PCYA 1AAJA 1OCOB 7PAZA 4L0PB 1KYAA 4YSSA 4PAZA 1OE3A 1JZEA 3WNIA 1JZHA 2GI0A 4DP6X 1J9SA 1A4BA 1L9QA 4AKOA 9PCYA 4HALA 4KO9A 1X9UA 3QJUB 2BP0A 2BP8B 3X1GA 3SBRA 1PNDA 4WKXA 4YVUA 1IKOP 3G5WA 2OCCB 2X87A 2BZCA 3H4HA 4AKPA 4ZK8A 2CUAA 4HIPA 2IWFA 3S3DB 1FWXA 2I85A 1RCYA 1J5CA 1AANA 4HHGA 4QKTA 4KO6A 1SF5A 2ZWNA 1V10A 2XV2A 3PAUA 2I7OA 1OV8A 4DP1X 2FT6A 4E9VA 2B3IA 2EIKB 3S3BB 1JOIA 1KDIA 4G7RB 4CSPA 1L9OA 3GXUB 2GC7C 1KCWA 4EF3A 1ZDQA 2WO3B 1ASOA 4KO7A 2BP0B 2GHZA 2XYBA 1WA2X 2PPAA 1IUZA 2DWSA 2BWDA 2JXMA 4CSZA 4FA7B 5ANHA 5AZUA 2YAMA 3QJQB 3AY2A 1AZNA 1SHWA 1CUOA 2BHFA 3FU8A 5EHFA 4A2HA 2J5WA 3D12B 3FQYA 1J5DA 1IBZA 4BXSV 2FWLB 2FQFA 2PCFA 2YAPA 4JHVA 2YAQA 4A2DA 5I6OA 4QLWA 1A4CA 1M56B 1KV7A 1X9RA 3GYRA 3AG3B 1JVLA 2VW4A 3EHBB 4M3HA 4NERA 3V9EA 3FU9A 4DP9X 3KW8A 2DY2A 1PLAA 3SQRA 1TEGA 1RKRA 2UXTA 5B7FA 1A4AA 3CZUB 2AVFA 4DP7X 1AS6A 2BWIA 2MRYA 4JKNA 1DYZA 4BXVA 4UANA 1SHXA 3CG8A 2PPEA 4UAHA 3NJGA 3QPKA 2BO0A 1PZCA 1M9WA 2PPFA 4DPBX 1NIEA 5B7MA 1MZYA 1W8EA 2HZHA 5I6LA 4G7QB 3T6WA 2YARA 3EH4B 3T6XA 2R7EB 2OJ1A 2Q5BA 7PCYA 2P80A 1MZZA 2UXVA 1PAZA 4YL4A 1KCBA 3OQRA 1JZGA 1GYCA 2IDFA 2MTAA 4P5SA 5TK2A 1PLBA 3UADA 4DP5X 3WI9A 3WIAA 4FAAB 4MFHA 2FT7A 5B1AB 5LDUA 1PZAA 5B7EA 1AIZA 3WNJA 1PNCA 4E9XA 2HRGA 3ABLB 3NYKA 4YVNA 3OMAB 2I7SA 1KBWA 1MG2C 1GS7A 5PCYA 3IE9A 3NT0A 1AQ8A 1TKWA 2XUWA 1GW0A 1I53A 1WS8A 2CAKA 4TXVB 3ZX1A 1FFTB 3OMNB 2VM3A 6PAZA 1L9SA 5D4HA 3HEIB 3NJJA 2CBPA 1ZPUA 2X88A 3CDZA 1WS7A 2AZUA 2TSAA 3T6ZA 5B3SB 3DKHA 3V9CA 3FS9A 1EHKB 3U25A 3SBQA 3NJKA 2EINB 2HLEB 1XB6A 2VW7A 1GY2A 4K9JA 3X1FA 4F7KA 1JVOA 4DP4X 1EZLA 1JXDA 2PP8A 1PY0A 1SFHA 1F56A 1A8ZA 3UABA 1GSKA 1W6WA 4BWWA 4GP8B 1JZFA 2DYRB 2XWZA 3MX0B 1JXFA 2VMJA 3TBBA 2XX1A 3L45A 2H5UA 3JTBA 1OF0A 3WKQA 3QJVB 2J55A 4HHWA 6PCYA 2ZXWB 4KOBA 2B08A 1NDTA 1T5KA 1XB3A 1J9RA 1DZ0A 5I26A 1CURA 3ABKB 1BXUA 3JT2A 1B3IA 2DWTA 3CDZB 3NP4A 2RACA 1CC3A 3N55A 4YSQA 4ENZA 1NIBA 2GBAA 4AZUA 1AZCA 4JHUA 2HRHA 2H3XC 2XX0A 5I5MA 4BWUA 3NJMA 2YAFA 1BXAA 2BZ7A 4G70B 4DPAX 1E30A 2QPDB 4GP5B 4YSTA 4YSEA 1ET7A 1BYOA 1GY1A 2IH8A 2GIMA 3QJTB 5I28A 1NINA 4G72B 5I6PA 2EIMB 4N4YB 1SDDA 2UX6A 4YSPA 4E9TA 1ID2A 2EILB 4KNTA 2J56A 3NSYA 3PPSA 3FSWA 3ZDWA 4E9YA 1MDAA 2YAHA 5F7BA 1A3ZA 3BVDB 4KNSA 1PF3A 3X1NA 3ABMB 4A2FA 4YSRA 1ETJA 1TU2A 3GDCA 2XU9A 4NB7A 2FQDA 1ET8A 1ZDSA 4G7SB 5B1KA 1AG0A 3FSZA 4DP8X 5F7AA 1HFUA 2XV0A 3KW7A 3PCYA 3OMIB 1ET5A 3PAZA 1OE2A 3ABGA 3ZIYA 1JZIA
chains in the Genus database with same CATH superfamily
5DUPL 3BQUD 1MOEA 2IFFH 4X98B 4XBPA 1WBXB 3BLBA 3F7RA 4MJ5A 3QCVL 2V9TA 1LEIA 3RWEB 1IT9H 3NZHH 4QTHA 4PIBA 4XMPH 3RWFA 2O6DA 3P4MA 2R2BA 2Y69B 4JREB 2W9EL 4JPKL 5F1SA 2X4SA 3C5SB 4HCIA 2F1BA 3CX5J 5FF6B 5GPRA 4Z7QB 5EU4A 3RKDD 3VWKD 3HNSH 1Z5LB 3SIKA 3W37A 1KTDA 5FHBL 1QNZL 4I3GA 3OKDA 2ZWKA 3IXAB 3UJJH 2R4SH 3I02A 4J3OC 4OGXL 5ACZB 4AYDC 2UXFA 4DNLA 4LHJB 2BSTB 4MJIA 4DGVL 1ZGLB 1CJYA 2AANA 3ARPA 5HSFA 3IDMA 2VM4A 3LX9A 4AVHA 4YXKH 4PGEA 3TA3C 2B4CC 3RUGE 1XR9B 4IIZA 3P54A 5DEJA 1BQRA 1P84J 2XVGA 4UIMA 35C8H 1VFAA 5B3NA 3EH5B 4N8VB 4U0QB 4BSJA 4BDVB 1I8LC 5CGTA 1EBPA 3HUJB 3C8KB 1MFEH 2UY7B 2YJLA 3VFRA 2AAVA 4JCMA 3D4GA 3S9DB 2WTPA 3V55A 1FE8H 4FG2A 4LLQA 5I1IL 2F74B 2C9UA 2WD0A 3VQLA 1W6LA 2B15A 2RCSL 1SHMA 1PZSA 2HUEA 3K8LA 4OU3A 1XCXA 5DJ0A 2Q87A 3FCTB 5I1JL 1Q0YH 4PP2B 4XN7A 4YR6B 3UPCA 4HKZB 1BMWA 4GI9A 3H9SE 4L0ZA 3ROLB 1HOCB 2EDRA 3AAZA 3OX8B 1A6AB 3RVUC 1LDPL 4P23B 3V7MA 1PG7W 3IS1X 3VXPB 3LRKA 2O26U 5EA0L 1FJ1B 4Y2DD 1QYGH 1VHPA 2J88L 3KWWB 4I77H 4LBAA 2VRAA 2O5NA 3JWNH 4Z7UA 5DZJA 2LHAA 5L2KE 2YAOA 3V6OE 4NIYE 5AW7B 5LAPA 1AZVA 1JPTL 1EHNA 2ZYHA 4BZYA 2WY3B 5D7KE 3VH8B 5I1HL 1HHGA 4KXCA 3V0IA 2NQDA 2XZAL 5LLIC 2YD9A 4WUUB 2J43A 4Y4HC 3IDIB 5I0WA 1S7UB 2VLJB 3GWJA 3IETA 4PWHA 3QIBC 5CCHE 4JUSA 5EZPA 1J0JA 3NJLA 3CVHB 1AC0A 1NA8A 3F83A 3J7HA 4UILH 4OLUL 5TD4A 3WKML 1R5WB 1OPGL 4Y9GA 4IW4C 4RGMB 1OB1B 4U0RC 3V0VB 4UTAH 1UASA 5AWNL 5HGDA 2E7LA 4LB8A 5HYJB 4KXAA 3LXBA 1U3HC 1IBFA 2NX5D 4ZQTA 3W0WE 1EMTH 1MCQA 2Z7WA 3S98A 1RUQL 3LVEA 3IPFA 4WWID 3VU1A 4F24A 2H7WA 5JDSB 3QWRA 3LQMA 4HUCA 2DN7A 4C56E 2EDDA 1PY9A 3K2UL 4KX9A 1NJ9A 1DFBH 2NY6C 1SXCA 1U4FA 3I85A 4PCTA 5GZND 2RQ8A 1QPKA 1MH5B 1RK1A 3MV7B 4H0GA 2FX8H 4L1LA 4DH2A 3ZDYB 3T77A 2WTRA 1UVQB 4XMKH 3O2VL 5EWIL 4J12A 4Y1TA 2ZOLA 3QQDA 1OKEA 2OP4L 4LCCC 1HHKB 1A47A 4KKLD 3T4YA 3AXLB 4R9HA 4Z77A 3C75A 1C16B 2DIEA 1OCWH 4AXWB 2WW8A 1T21A 4PRBB 2I32A 5BS0B 3MRDA 3ZHFA 1SEBA 1TTAA 1O6SA 1YQVH 2QQQA 2NXYB 1CDYA 3H3PH 5LG1A 2WOYA 3PP4L 4WFHD 2JWYA 3BSZH 5EH1A 5FO7B 3TBVB 2KMWA 1UQSA 4CBPA 4ZO7A 3TZVD 1OQXA 3S35H 1A65A 3DYPA 2BSEA 2K8MA 4PJ8A 4RH4A 4QHUA 2CGRL 4EIBA 5MI0B 5DRZB 3KCPB 3FPYA 1D5RA 1FI8C 2YKKA 2VIRA 3B9EA 3BKJH 4GMTL 5CZXC 2SEBA 1I4FA 4GUPB 3DMMD 3B1TA 2HX8A 2Y6SC 2F54D 2IADA 3LNEA 3SGDI 3ZTDC 4A6YB 2EXTA 1UM5L 2KLTA 1BQKA 4TLTA 4WEUD 5DJDA 4DEWA 5E2JA 4ADGA 1J5IA 1QFUL 4UOJA 4FXKC 4DKEL 4LCIL 1AD0A 4RDQF 2TSBA 4YPJA 3KL0A 1XDTT 4PJGF 1MW1A 3IJ7A 1QEXA 4ELME 2QVMA 1UOVA 4L29A 4LRNH 2Q86B 3FQUB 2ZOTA 2J20A 3ZOAA 4YGVB 4GKSA 3LZNA 4D8OA 1CBVL 3IB4A 1E9PB 3PYCA 4DOHB 2IJ0C 2A77L 4YDIH 4YSUA 3LNGA 2G5RA 5KVGL 2YSTA 3VD3A 5TE4L 1AC6A 4GT7A 3PWVA 2NX5E 3NIDF 4G6KL 5ICYA 2R15A 1EO8H 2ZE0A 3VCLA 1QW9A 4PJ5A 3DO7A 4X5XA 1E0OB 1IBDA 3E3QE 4AKOA 9PCYA 2EVHA 3BVWA 3EYUH 1U8JB 4FG0A 1FNGA 2HFFB 4IK7A 4GAFB 2CO2A 4LRIA 4TF4A 5HD8C 1I3RA 2R23B 4WU7B 3ARBD 3NN8B 1SVCP 2VCOA 4LSSL 4PHXA 3WY4A 1IFRA 4YVUA 3HI1B 5A16A 4L3ED 1OSEA 3W11D 3EJUA 1X5XA 2WUBH 4NWTH 3QEGH 4AKPA 3NIFF 4JFFD 2K0RA 2FNBA 1O6TA 2DWYA 2YOAA 4NZUH 4PJGA 4WIQA 4BCYA 5JPNB 2XA3A 5MEOB 5E08H 5LDSA 4M7JL 2VAAB 4J39A 2I5YH 4X0KB 1NCHA 5KG9A 3EJRA 1KTKE 2XI9A 3M86A 5IV2A 4NFBA 5J9PB 3WY1A 3EOTL 1OAUL 2FO4B 3KLAB 3LQAL 2NQCA 4WFHE 2BCMA 4LHUG 1BMGA 4TVUA 1IGIH 1I1AD 1QKZH 5CCGE 1S9WB 1KDIA 4MCYA 3C87A 1L9OA 1F11B 3OR7B 1UCBH 4AM0B 1RQ5A 4WV1A 1CG9B 1E4WH 2GBTA 3LKSA 4J27A 4NQVB 1W16A 3HB3D 4WW2C 2D7OA 3MUGA 5IJDC 1TLKA 4PLJD 4PV9A 4DUWA 2C9QA 3NG5A 3HNTH 2HG5A 4GW4B 1G1YA 3SGKA 4LDOB 3BAXA 3RIKA 5EHFA 3AREB 4JFED 3TT3L 3V8CA 3RDTB 3OHMB 4MNGB 1KLGB 4ZXBD 2FWLB 2ZUVA 3D52A 5JIQA 4M62H 1A4CA 3Q0HA 1U3JA 3MACL 2FX9L 3F5WA 4B9PA 1UM6H 2ZF8A 1KXHA 3EHBB 3FUDA 4MBRA 4BE5A 3F7LA 1JUFB 2AEIT 1U33A 3K2MC 3NCWA 5EG6C 1U2HA 4KK5D 3B5TA 3LKOB 4R7NA 5E6IC 2OYKA 3WENA 4NX0A 3UCQA 3SJVA 4IMKA 4OZFB 4X7TB 4IGBA 1NL0H 2F58L 5B7FA 3V4PL 1NFDE 4ZO9A 4Z1PA 4HJJH 3UGUA 5DHVA 1CFBA 1EERB 1P4BH 3I6SA 1U3ZA 3BN9C 4PJAB 5JW4R 4LPXA 3ZRSA 3RKPA 1CGTA 5EIIB 4LLUA 1BM7A 1IBBA 3UC0L 3WD5L 2GK2A 2CMRH 1TVHB 3GUFA 2IBZY 4FABL 4XMLH 5HDOA 1UURA 4J3OH 3ZSTA 4GKNA 1S3RA 4L3EE 1F90H 3SKNB 3FDWA 1K8DB 2R27A 1NEZB 1BBDH 1ZK9A 4JFFE 2EYTB 3OVUB 2O5ZH 4ZAKA 2IBZX 3BKYL 4BBWA 1RJYA 2BX5A 1IM3A 3HC0A 5FO9B 1OAKL 2QADB 4HJGA 4OSUH 5E2VH 5FW8A 5ADOH 1FO0A 2VDOB 1LK2A 4ZMWA 4HOWA 4PJBE 1M6UA 4X99B 1XIWD 1ZVYA 1QD0A 5D9SB 1F4YL 1R17A 1SOKA 1HXMA 4TXVB 5FOJA 4MD0A 4KI1A 1E4KA 4IIQC 1TZGH 4OF7A 3TBSB 4MMYA 3NJJA 1TZAA 2OW7A 5MHSD 4G9DB 3K6SA 2B77A 1GC1C 1RUKH 3PNWA 3O45A 1KTJA 1I3GH 4OCWH 2CDEB 2CKBH 3U25A 2KZBA 1DBMH 2DM4A 2X1WL 3OKMA 3QQ3B 1LO5B 2EUVA 3T1WA 2JIXD 3VMNA 1A8ZA 4X9BA 4ZX3A 5CUSL 2J6EL 4HXAL 1AQDA 4JFEE 3ALPA 5EZLA 3BAEH 4GP8B 2Y7OA 5JLZB 2AI0L 3II3A 3LMJH 2DJMA 5MEPB 2NNXA 1XSJA 3VRLF 3DVGB 4KJPC 4HS6B 3WKQA 5KVFH 1SYSB 4AGNA 3E8UL 5J3HC 4F15B 2MMXA 3QIUD 1UGKA 2PYEA 3WFCL 5F9AC 5D2LA 4X8JA 4PJCF 3E9UA 1MFCL 1Q38A 3BT2H 1JNNH 1HOEA 1IO4C 5I76A 2DQUL 4IRSB 2X0WA 5TDPB 4BZ1A 5IUSA 4HLZG 4LESA 4ODXA 2AV1B 2XX0A 1D7BA 2AJVL 1TTUA 4G8EA 4LLWA 4HUUB 2WMPB 1RZGA 2A7BA 3OJDB 3DROA 4UM9A 1YEFL 5DR5H 1INEL 3MGTB 3SE9H 3FUNA 4NUQA 4X7FC 1PD6A 3R19A 1ZLSH 1QI4A 5K9QG 2E75C 2VXQA 3HRZB 4HBCL 2PMZA 2PTTA 3MJ8A 1OP4A 4LLVB 1VERA 4RMWA 2WQ8A 4PV1C 3ARDB 3D85D 3HAEA 2VJ8A 3QDMB 2A6JB 5D6CB 1A4KB 4R90L 4LSUL 1SJEB 5GJSH 5C3IA 5DQDL 4Q0XL 1OAYL 5CHNB 3MLYL 3ULVF 4J3BA 3QEHA 4WJKB 4PJCA 4G7SB 3FQTB 1GYUA 1UA3A 2Z91A 4EZLA 5F21B 1AR1C 4DP8X 5F7AA 3K4ZA 4GIAA 4OY9A 4HOXA 2WKGA 2R1WA 3A6CL 4NAMA 1DLHA 4IRZL 1SUJA 3D08A 2XKUA 3STLB 3GGWA 3K4DA 5B38B 2EUZA 2Y36H 3F6JA 1FVEA 2PR9A 5MHSE 1P1ZA 2WQWA 1Q9WA 3IJHB 1WZMA 3G3LA 2X44D 5KSUA 2WLZA 1IKNC 3GI8L 2RB8A 3U1PA 4FZ8H 3NJIA 4A7GF 1AXSB 1I9JL 1ILUA 4MZRA 2GSMB 4NWUH 3OF6D 3SDCB 5CP3A 1WCQA 4HHAA 4XX1E 2ZX9A 4WWKB 4Z7VA 5E56A 4JFDB 4DPCX 1AXTL 2ODIA 2O61B 3GMRA 1MWOA 2Q6WB 2CJUH 4EKXA 1ADQH 1FPTL 2KH2B 2XRAL 3QNXA 4HAKA 3H2PA 3ZTJG 3OGOE 3R0NA 2EE9A 4XBPB 2PO6D 3FU0A 2C1PA 3QZOA 4MJ5B 3UAJA 3X2QB 1LEIB 4U05A 1LK3L 2DJ4A 1BQSA 5E99L 4QTHB 3IAGC 1BD2D 3RWFB 3P4MB 2R2BB 1OOWA 1CXLA 5JHDA 3O6MH 2VR4A 5F89B 1E9QA 2X4SB 2NY0D 3WU1A 3OZ9L 3WNMA 5D7JD 2NCEA 3ATEA 4ODVH 3EO9L 3GM0A 1K72A 3RWHA 2F8IA 3LD8C 5FIEA 4KTDL 4A7GA 2EC9U 3U7YH 3I02B 1UACH 4X6BA 2OL3L 1E5AA 1G0XA 1QFWM 1J10A 3MBEA 4MJIB 3K0WA 4PGZA 2WCPA 2YFNA 4WHYH 5DO2D 1WAPA 2IWKA 3LN4A 5JOFB 3IDMB 3Q8FA 4PJHE 4APQC 5HJGA 4AY0A 3WIHA 3OMZA 4PGEB 4S1SL 4N6RB 3B7SA 1WZ1L 1ODUA 3J8F7 1QSEA 2QELA 3I9PA 4UIMB 4JGUA 5D1ZB 1VFAB 3VFMA 4GG8A 4P59L 1HNYA 3NABL 5IJCC 3AACA 4LVHC 3T0EB 3VFRB 1PZBA 1JCKA 2O6CA 5HVHB 2WVTA 4LLQB 2EIEA 4YH6A 3GMLA 3DGCR 3FRUA 4BFOA 4DETA 2Z1KA 4LEBA 5E6SB 1AACA 4WTXA 2RAMA 4KJQC 4CRPA 3LXUX 3BCFA 5DJ0B 3WN5A 1YZZA 5B1JA 1OCCB 3D4CA 3PGFL 4HWEH 1MCEA 4P99A 1FLRH 4DW2H 3N85L 3LYRA 4HV8A 4CMHC 3TIEA 3AAZB 3KL3A 1M42A 1NGYA 1Q9KA 2YN3A 1IC7H 3N42B 5I1AA 3KD4A 4XR8C 2YKLH 4P57A 4FNLL 1TCMA 4Y8DC 5I73C 1GTFA 3L48A 1YN6A 1AKJB 3SPHA 2HCZX 3DIVA 1DQTA 3MLXH 3PV6A 4Z7UB 3VQ1C 2UVFA 3LB6C 4TNVK 2QQLL 1CBJA 2Q8AL 4CBZA 2ALAA 2JKNA 4AQ1A 5L6YH 2B2XL 3ZZLA 3G6DH 3NEOA 3O2WH 2QT6A 4DK5A 5ENWA 3NSCA 5LNDA 1J1XL 2ZG1A 3QI9A 3IETB 1NIDA 1ZLEA 3MBXH 1DSFL 1G9ML 4N0FA 4JBSA 1BD2E 1JZJA 4D3CL 3GTNA 2R9HC 2VR6A 1ICTA 4K5PA 5IJKA 1SDDB 2ZKMX 5AVVB 3GNMH 3SYAA 3FC8A 3TPKA 5HGDB 3Q5YA 4PIRF 2DEYX 4P23D 4X4ZA 4K73A 3FW6A 4P9HC 4XOEA 1W2KT 2APXA 4EOWL 4PWEA 4JPSA 5DVOA 4QHLA 4OLYL 3W1ZA 1UB5A 2E0PA 2XLLA 5C0JB 2QHRH 2VWEE 1NTDA 2NYZA 1NJ9B 2VDNH 5GGVY 1NCIA 3B2VL 1RK1B 4FFYL 4N5UA 5CWSB 4NNYA 3QSKB 5A43C 4B9CA 2BZDA 3WDHA 3WE1A 4WUUD 1RZJL 3IN2A 1HHIA 2OMUB 4PYGA 2WTRB 5CGYC 4OGYH 3T77B 2VLJD 3MOBL 5BVJB 5TPWL 4PCYA 3QQDB 3RAJH 3H6AA 4N22A 1RP9A 4JN2B 5B1BB 3BIBX 2WANA 1QBLH 2XWTA 1HEZA 3T4YB 4ONGH 1BHGA 3WEAA 1J9TA 4Z77B 4BK5C 4H2AA 1X5AA 3KL5A 3FCBA 3TASA 2K6WA 5A3IC 1MCWM 1KXQE 3MRDB 4B3EA 1SEBB 1O6SB 2V5TA 2KYIA 4FNSA 2CPCA 2ZKXA 3AT9A 3VGHA 3QR2A 4ELKA 5F93C 4F57L 5AYUH 3GMMA 1UQSB 1A7PL 3IBEA 1IVTA 1NZRA 4PJ7E 4W9GC 2QSQA 3MV7D 4PJ8B 4AZ8B 4MXQC 3HC3H 4M5ZL 1I9RH 1QHOA 5EPMA 1AD9A 2MNWA 1YEHL 4KHXL 4LLDA 2VIRB 2Z4QA 2L04A 2SEBB 3PAYA 1I4FB 2VXVL 5HTSA 3WOVA 3B7UX 3QZPA 5I1KL 4GH7B 2IADB 2I69A 4HGKC 3GFUA 1UJ3A 2GI0A 4RGNC 1RIVL 2VMFA 2ZUQC 2QEJA 5DJDB 4RAUA 5BS0D 5CFAA 4IJ3C 1CPUA 2VAJA 5CR1A 4YC2C 4GRLC 2NXYD 5HY9A 1CN4A 2DQFA 1AD0B 3BW9A 4H1LA 2BP5M 2YN5A 4EVNA 3LOWA 3X1GA 3LKQA 5IB1A 2F7QA 4ZTPL 3L9RA 4GKSB 1SEQH 3ZXAC 5T3ZD 1FVDA 1TTGA 5DRWA 2DMCA 3JYCA 3HG3A 4BHUA 4TLSA 5HHPA 1MJ8H 5FFLA 1ULVA 3PWVB 1NC4A 4UQAA 1OIOA 5ICYB 3VCLB 5AAMC 3DO7B 4M8VA 4X4MA 3RI5F 1EAPA 1DDHA 1WO2A 4X5XB 3S88H 4PJIA 1S9YA 1OV8A 5BO1H 2OK0L 1OW0C 2X9YA 4K3GA 2OBGA 2GTWA 2D0FA 1HE7A 1NAMA 3HHRB 4KDWA 3GXUB 1ZTMA 1I3RB 1Z6JT 4TSBL 3JSSA 4XC1L 4ICXA 4WUUE 4P2QA 4F7TA 2VLJE 4JDTH 5A16B 4WI0A 4URKA 4NLAA 1IEBA 4G7YH 1C12A 3BFWA 1TJHH 1R3KA 4Y5VA 4WK2B 1BQHA 5HYQA 3GBML 1D9KA 4PJGB 4GRMA 1KB5L 5BV7H 1H8LA 1QPXA 5HYJE 5KG9B 1NLBH 4G6MH 4HCRH 4JE0A 5I2IA 2ZWZA 5IV2B 4HF5L 3TVMC 2NY5C 1GZHC 4Q9QH 4JG1L 3SPJA 1KV7A 4OLEA 4XAWL 2CLVA 3CLFH 1XR8A 4BFEA 3NIGB 4GSQA 4UBDC 4EIGB 5C0CE 1JPGA 4MCYB 4UAOC 3SZKC 5F0PB 1BMZA 3CIAA 3P9MA 2XTJB 1YAIA 4ODTH 3RQ3A 3M17A 3LKSB 1IJ9A 2WXJA 4YHIA 1BLIA 4G3YH 5FUZL 3TYGH 5JXAH 3O81A 4KRMB 3C8HA 5E7FA 2EDOA 4I7ZC 3VGGA 3LH2H 4DFHA 12E8H 2WJ7A 3APNA 4JKNA 2HG5B 2DOCA 3HE6C 4Y9FA 2Z93B 2ZTBA 5EOCH 1J8HA 5K39A 2X1QA 1AJ7L 5FECA 2ZD0A 2W0FA 1A3LL 4HWBL 1ZAGA 1MZYA 4MZ3A 1WIOA 3CLEH 4KXZH 3ILPA 1JGDA 1NAKH 3GLDA 3MLZL 3RGVA 4HH8A 3F5WB 3WFEL 4JQVA 3C2AL 3OPZL 5T3ZE 4AQZA 1IGTA 3DX9A 4KHTL 2CO7A 4R7NB 2ALWA 2P5ED 2BFVL 3SJVB 1JHKH 4IGBB 3QS2A 4MKTA 4CSTA 4B60A 2E4TA 3BX7C 2H9GA 2I7SA 3ISYA 1MG2C 5DHVB 3NSJA 1IFHL 4PJDE 3X3FH 4UT6H 1E3ZA 1TKWA 4OM0L 2EZ0D 4ONHA 1DL7H 4LLUB 3ARED 4PM1A 2A83A 2HTKC 2OXGA 3RDTD 4FCAA 1J1OL 3QRGL 2VM3A 6PAZA 5GGUA 1SBBA 4MD4B 4ZW8A 4UTAA 3ZPDA 2WNGA 5FV1L 4GKNB 4KQ0A 3EHBD 1IGYA 4YZWA 2EXYD 5E1IA 4K9JA 4XVSL 4DOHE 2A9MH 2PP8A 1R3HA 3WEBA 3UTTA 4ZAKB 3OXRA 4F8TA 1LO2H 4BQCA 1VJSA 3RVXD 2MPAH 1Q8MA 1BOYA 1IM3B 3HC0B 15C8L 5DUMH 7FABH 4HJGB 1CTMA 2HJKB 2X89D 3WFBL 1YYCA 1FO0B 4YHLL 1LK2B 4HH9B 4JFWA 2P43B 1NUFA 1OP5K 1RJZA 4HZLA 3H3BC 1HXMB 1MPAL 4QHPA 3DWTA 3IRCA 5LKNA 1MNUL 1NCUA 3EUUA 4MMYB 3ECBB 5A2KH 5D7IB 3CVHL 1IC4H 1I82A 2YMTA 4HS8H 3TN0A 2YK1L 3NP4A 3K6SB 4P5TA 4Y4KC 3PNWB 3O45B 1FAIL 2WLKA 4JHUA 3U0WL 2HT4C 1BOGA 3OKMB 5AQ0A 4KK8C 3BSZA 4G1MA 2E46A 5HVGB 4QLRA 1AQDB 5EDSA 3BSGA 2C3HA 2F9BT 4XO5A 1FHGA 3RVWC 2EDXA 2QADD 3ENEA 5AUMA 3TO2A 3WJMA 1HKFA 1WWAX 3FBKA 3BWUF 3L1GA 4ECNA 4J5VA 1S7VA 4YSPA 1T03L 4P49A 1UD3A 2VKWA 2NR6C 4JDEA 3IGLA 1U36A 1THAA 3FSWA 3IDXH 1LEKA 1P53A 4PWGA 4MNHA 2ICWA 1T4WA 2OI9C 2XN9B 5D2LB 4X8JB 1TFHA 4Q9BA 1W80A 1CF1A 5I76B 4JM4H 4LIQH 4ZT1A 2X4OB 3VM5A 1TMQA 2H3KA 3CH1A 5HHOE 4A2FA 2AK4A 4YSRA 3RFRA 4NNPL 4L8SA 1PZUB 3HI6L 3MUY1 3V5HA 4E5XA 2EQDA 2WBWB 4G8EB 4YHKL 5EOQL 4Z7OF 1RZGB 4M93B 3DROB 2EXSA 2ZPKH 3TJHD 4KY1L 2B0SH 2ID5A 2DWXA 4MNGE 3TXAA 3ABGA 1KWGA 3P9LA 1I3UA 1UT9A 3EJSA 3KDMA 4TSCH 1JZIA 4YHOL 4YXLL 2AGJH 1OARL 5T3ZL 2OMZB 4ZS7L 2PTTB 5K9JL 2Q3AA 4UMGA 4PVBA 1YC8A 4V1DD 4JFZH 4Y9BA 3PV7A 5DC9B 2YZ1A 3HAEB 1SY6L 3LIZH 2ISDA 3ZW3A 3CQQA 1SJMA 4Z0XA 3COOA 4L37A 4WLCA 2IG2H 3FTZA 1WH0A 3MCLH 3JWDH 1LJMA 4A6YL 4IRSD 1MQKL 3NCXA 4WF7A 1U8LA 2E9WA 5ITBH 4F33A 1RPUA 4CMMA 5J11B 4H8UA 2BNQA 4PJCB 1GR7A 1WGOA 2Z91B 4IOFD 1HYSC 2XQBH 5DJYB 1DLHB 2DMHA 3GGWB 4FKEA 3SDDA 2FRGP 1FVEB 1P1ZB 5KSUB 2LR4A 4YHZH 5DVLA 1MIML 4EQ3A 4I85A 1CT8A 3ARDD 1AOHA 3B2MA 2X38A 3N0PB 3QDMD 3L7FA 4ZQKA 5HGAB 3SE3A 3IU3A 2V5SA 4M1DH 3QQXA 1OP9A 5JXEC 4HHAB 3IDUA 4Z7VB 3CVIL 3FQ2A 1BM3H 1RFDL 2BXZA 3KH3A 2VDMH 4X80L 5LCVA 3GMRB 4NC1C 1D7CA 2VUKA 3UEQA 2JCWA 3HE7A 4GW1A 3QNXB 4L9LB 4O5LH 2ENYA 4Z76A 5CLZA 3SOBL 3EJCA 3CNKA 3CQFA 4F7PA 5IEHB 2VXUL 4XPBL 3CBRA 1HCVA 4X8XA 3SQBA 2G0LA 4RDBA 1Z7JA 1KTCA 4POZC 1E43A 3MTRA 4JFQB 4ZX5A 4CC1A 4XP5H 3QZMA 1LO0H 1BZ8A 5KANG 4AJ0A 3QJSB 1QO3A 1E9QB 5F72S 3S4SG 1V7ML 4A2GA 1NCCL 5CD3B 3BKCH 4FFVD 3VXUA 4WWKD 3W82A 1YNKH 2ICCA 4F9LA 3VB9A 4JFDD 4UNVA 2G5BA 3CSYA 2ZT9C 1L6PA 4AEIH 5I75C 4X6BB 4OF6A 3GI9L 1KCVL 3MBEB 1GYVA 3ATDA 1AY1H 3A21A 2O5YH 4YHMH 1ACXA 4F8QA 5HYSG 3GTVA 1KJMB 1EA9C 3GRWL 4JY5H 3W9EB 1T83C 2Q0ZX 3UTQA 2D7NA 2J5LC 1AS7A 5CCKH 1F18A 2IGLA 2NSMA 4DVRL 2P7TA 3KWTA 4GY4A 3VFMB 4GG8B 5FGCB 1XV8A 3MODL 2ADGB 4XMTA 1RIUH 4R7LA 1KG0A 4ZO6A 2CR6A 1HCYA 2EDLA 2P80D 5EU3A 1JTPA 1NMBL 3MLWH 3TBWA 5T3XD 4JO4H 1CDBA 2NTFA 1WITA 4KVPA 3DV6A 1W8OA 3GMLB 1A7QL 1ZOXA 4OAWA 3S8WA 3FRUB 5CP7B 3U30B 4TL4A 4MJID 4OKVA 4KRPB 3CFCH 1EJOH 1WYJA 3TA3A 3WN5B 5EF2A 1V5JA 2FE0A 3QDME 4EIZC 3SGJC 5DD0L 3WMSA 3VXTA 3TNNA 1PEWA 5JPMA 1A6WL 1GS6X 2XFGB 4MYWB 1Q9KB 1NGYB 3L3DA 3RWJA 5I1AB 1ES0A 1AMXA 2A1WL 5D1ZD 4P57B 1D5ZA 3FH5A 1J5OL 2HFGH 4M6ML 4MA1B 3DHJA 1GPOH 2VW6A 3UDWC 1YN6B 2ZCLL 3PV6B 4K7PL 4P3DA 5FFOA 3T0ED 2CKBA 5AKSA 1C1EL 3GD1C 4RFEA 1S9VA 2VQ1B 3W39A 1KT2A 4AQ1B 5SWZA 3VYPA 5C0NC 3DC0A 5ENWB 1T2QH 2DYSB 5D5ME 3QI9B 4EXPX 5I0XA 2WXNA 3LZFH 5IHLB 3P9WB 3PWJA 2VDOL 1G7LA 1FORL 5J0BA 4ZZFA 4OD3L 5I71C 3VXRA 2NZIA 3ZK0A 4JGMA 4QHLB 2APSA 3H42L 1S78C 1UB5B 5IVXF 1KY7A 1AKJD 1ID5I 5DUPH 1RZFL 4Y5YC 1ZIAA 3QCVH 1OTTD 2F0CA 3TM6A 1NIAA 4Y4HA 4FFTA 5HI5D 1QRKA 3Q6FA 1UENA 1UXMA 1CLOL 1BZQK 1INDL 2HX7A 2XTLA 4NNYB 5CBAA 3AC0A 1ZV5A 3DBXA 4Y1AA 5CGBA 3OC5A 4NCDA 5EZOL 1AFVL 3JV4B 1QNZH 2XWTB 1ZMYA 2CU9A 1HEZB 2JLPA 5FHBH 4OGXH 3O4OB 2CCVA 3TEXA 1SXZA 5KBDA 4NQDA 4DGVH 4R4FL 1L9QA 2C9XA 2XXCB 4P46C 4PWJA 3ZE1F 5T3XE 2JLLA 4IBQA 3W3BA 3NEEA 4A38A 3QJUB 5A6IA 1NBZB 4QJ5B 3QWRD 4MJIE 3PIQA 2H0FA 4ELKB 2BVUA 1UWFA 4WKXA 3GMMB 2MEJB 1IKOP 1WFJA 5JW3L 4WCYL 3MA9L 5FM8A 1GZPA 3H7LA 2LW3A 1R3IL 5EPMB 2I85A 4LLDB 5ERWA 5AW4B 2G4GA 4XX5A 2Z4QB 5HHQB 2ESVA 5B3JE 4LF3B 2I7OA 5I1IH 3ZHKA 2IV8A 2EXWD 1UJ3B 4AIOA 2EIKB 4ANVA 3GMQA 3U4EA 4RAUB 1T7YA 2KKQA 5EZIL 5I1JH 2APVA 4N2KA 3LPFA 4PJ9A 1VFUA 1DBBL 2F5BL 5HY9B 1QLFA 5INCA 2DQFB 4R4BA 4H1LB 4O2EB 1ASOA 3CXDL 2ZX8A 4Q6IC 3LKQB 4EVNB 4ATWA 5IB1B 2WZAA 2BWDA 5GSVA 3L9RB 3HG2A 5EA0H 3IFLL 2YD5A 3PDOA 4U1GB 1FVDB 5DRWB 1PZ3A 2J88H 25C8L 4Z78B 2BSED 4PJ8D 1MLCA 5G5DA 3KCWA 5HHPB 1VENA 5J7CC 4EAEA 4LVOB 2D7QA 3ILDA 1NC4B 3QUXC 3FQXB 3ZL1A 4AE1A 1WJ3A 1JPTH 1EAPB 1DDHB 2FQFA 4PJIB 4CGTA 1S9YB 1YSOA 1ZCRA 3CFEA 4Z7UE 1JPFA 3QWOA 4CDHA 2EEXA 4B5ZA 2GTWB 4GI8A 2X12A 1ZLUH 4FNQA 4ERSL 2OMXA 3D2TA 1NAMB 5C6PB 4CKQA 3P3YA 1IAKA 3WKMH 3RNQA 1LE9A 3QZWG 4ONFL 1OPGH 1TEGA 4NUMA 4F7TB 5AWNH 1X7TA 4WI0B 3OV6A 5DJXA 4XMVA 1IEBB 3CZUB 3VH8G 1C12B 3QFGA 5I1GL 1BSIA 1R3KB 1X5IA 4Y5VB 3CLWA 4PW4A 1RUQH 5HYQB 2AKRA 3ARRA 1D9KB 4GRMB 2MKWA 2X4TA 4JRLA 4YJZL 5L2JB 4OGZA 4XWOD 3WEXA 2R51A 4EIUA 3L3HA 3CDYA 4K8RD 5B7MA 5IK3A 4XODA 5I2IB 3L3KA 2ZNXA 4X4XA 4I3RL 2FZ3B 4NKOA 2JB5L 2CLVB 4G8FA 1XR8B 4ZPVA 4N28A 3ZRFC 3BLPX 4O4YH 5EWIH 4F8NA 4UNTA 1JPGB 2WXFA 4HETA 2OP4H 1HL5A 1XGPA 1FZKA 3V0DA 5JR1H 4XTRD 3L17A 2CO3A 3P9MB 5JIKA 3M17B 3AS2A 1N6VA 4YHIB 2CGZA 1JPST 2JCCA 1I1FA 2IVFC 3VMPA 3P02A 3U1SH 5T3XL 1NCGA 4YE4L 3NPZB 3UX9B 3PP4H 3LPGA 4NM8L 2VR5A 1J8HB 1I53A 5K39B 5FECB 1LTXA 4MKMA 4KQ4L 4K5NA 4C47A 1EBAA 3AB0C 4JK0D 3I84A 4WI6A 3ILPB 4HUXA 3TCLA 4NS0A 2CGRH 1OQOA 1MEXH 2LU5A 3SYQA 1EHKB 5MENA 2E8ZA 3O4LE 5F3HA 3QULA 4GMTH 4PEEA 3TWCL 1IGTB 3DX9B 3HG0A 4K71C 1F02I 2CO7B 4NKDA 2XTJD 1ZJBA 1HH9A 1X6LA 1E4XI 5I9QB 1UM5H 3KYAA 5LBVA 2H9GB 1KPRA 3LN9A 1NBQA 3FL7A 4MTMA 4RZKA 3V4VA 4PRAA 2NDGA 3OJVC 1M2OA 1Q1PA 4LCIH 3T5WA 2NY1D 5E2UL 4HIEA 3B3BA 4NUGL 4LHQB 4GNKB 4ONHB 1OSZA 2A83B 1NFKA 2OXGB 2H45A 4KH9A 1CBVH 1P5UB 5GGUB 4R97C 4UTCA 2A77H 5IB4A 5KVGH 2RACA 1FP5A 3VXSA 5E6IA 5TE4H 4K23L 2PNDA 1DSYA 1AZCA 1IGYB 2EDJA 4NQUA 4G6KH 1LILA 1EGJL 5M94B 1R3HB 2GAZA 3UTTB 3OXRB 3SJVD 1ORQA 3KPMA 3AFLA 2NPLX 4IGBD 2GJPA 2Y0SA 3QJTB 2HTLD 5CM1A 5C92A 1XEDA 3KH4A 4PJ5E 5EFIA 4FP8L 1HIML 1JE6A 1XGZA 2EIMB 3OHXC 3O2DL 5E51A 1RJZB 3VRJA 4HZLB 4LSSH 3LRMA 3FT3A 5LXGL 2BC4B 3U6RA 3ZDWA 1MDAA 1RHHA 3ARFA 3TN0B 4U1IA 3VFSA 3EO1A 4P5TB 2V5MA 3CFNA 2XT1B 4M7JH 2GT9A 5CEZD 3CH8A 1BV8A 3TC9A 4WHDA 3DK0A 4UZUA 4UIKH 2XU9A 1XD0A 4PJGE 3EOTH 1AG0A 4FX5A 4G1MB 4JKPL 4ZAKD 1OAUH 1WG3A 3LQAH 4GXVL 5E6ZA 1ZEAL 2IAMA 1WIUA 3OMIB 2RMNA 2HVBA 5ESVA 3Q1SL 5DU7A 2EVFA 1IM3D 1GCYA 3TO2B 1XFPA 3F64A 3WJMB 1E50A 2F08A 3PWUA 3L1OL 3DDGA 4IIQA 1A4JB 3FRPA 4EDWL 5KSAC 1TF4A 2F8OA 2YXMA 4JDEB 4MSWA 1LEKB 4PSRA 3C12A 1F41A 4M6AA 4MJ2A 4MNHB 2WZPA 3MLRL 1CYWA 3EH2A 2XTJE 3AXIA 3CH1B 3TT3H 1E5BA 2AK4B 5CCJA 3FUEA 1PLGL 2GBVA 1GGIL 2BSDA 3N1FC 4L8SB 2YEZB 4E5XB 3MBWB 4QHNB 3VYNA 1U41A 1A7RL 3GZKA 5IOPA 3MACH 2FX9H 5B4MC 5ALBL 2CRZA 1SVBA 3KDMB 3NIFE 2PYFB 4HJ0D 5KBPA 2D9CA 1JDCA 3WXWL 1C7TA 1KGWA 3CFDA 4NPJA 4M4RB 2DKMA 2CJTA 5AW8B 1YA5A 3F3HA 3KEHA 3V4PH 3GJFK 2XN9D 4R0LB 1MHEB 4FLQA 5DS1A 4HBQA 4L37B 5KSVB 4YSCA 2Z0UA 3WHXA 3SJVE 1NMCC 2TAAA 4OCXL 2RHEA 3NJNA 1HWWA 1WAEA 4U7MA 1E5UI 3UC0H 2XKNB 2ATAA 4CMMB 1DJXA 3WD5H 2BNQB 4IS6A 4AGPA 3KMDA 1VSCA 2MOGA 1G9NL 1UXWA 3MJ7B 5MP6L 2E56A 5JNYA 1GS8A 4DZBA 2WXGA 5AG9A 5MERB 3UROR 1FHNA 4M48H 1RURL 4AE0A 3RTQB 1A1OA 5FGBC 3O41A 4N85A 4Z7OB 5EU7C 2NNAA 3BKYH 2HX9A 4KU1A 2ETWA 3L4XA 5IVZA 4HCRA 5CS7A 2ZG3A 5BJTA 1CT8B 4XP1L 1E2WA 1OAKH 4D7PA 1IBYA 4DP2X 2VLMD 3L7FB 1HQ4A 3IU3B 1IIIA 2LQRA 2XV3A 3FOLA 4TMPA 1F4YH 3BJLA 4PYHA 4W4OC 3SO5A 3V7AE 1H3VA 2J44A 1NEZG 5KYNA 4Q58C 1J9QA 5C6TL 4P5MA 3T2OA 3UYRL 3T8MA 3PF2A 3PU7A 5A7EA 2BW5A 3HE7B 1DVXA 3EYOA 2YD2A 1IGFL 4GW1B 4MDJA 4XPTL 3UG4A 3SE8L 2A99A 1IKNA 4MB5A 3B2UD 1OT4A 5DMGD 4Z76B 1X5HA 1OWWA 1PGRB 2VSMB 5IROC 1S8DA 3O6LH 2J6EH 4HXAH 3SQBB 4DKDC 1EEUA 5GRWA 2A4CA 2AI0H 4OW6A 2LAAA 3QWNA 4FQCL 5E94A 1OCZB 3VXUB 5J1SC 5I74C 3E8UH 1SJXA 4FE9A 2EADA 2G5BB 1CCZA 2AEPL 1ITBB 2Y7QA 3WFCH 3F65A 3RJQB 4TULL 2Z7ZA 5KVEE 2EDFA 3ZDXB 2NUPA 2DQUH 5JHMA 4JO1L 1VEPA 1HWGB 2WB1A 3GK8H 3ZBMA 4XHJC 1KIUA 2FEEL 2PYEE 4B95C 3S3PA 2AJVH 2BSSA 2C9RA 1QTYT 3SO3B 3PXHA 4A2LA 4QF1A 3KJ4B 3UTQB 3UAJD 4UV4L 2DD8L 2DV6A 2X1XR 3K8KA 1INEH 3H9YA 4AC4A 1FL5A 1QLRA 4WENB 3GXIA 5I82A 4HBCH 3S3CB 2YAEA 2HVJA 1NOFA 1KG0B 2MH4A 2E27L 5EU3B 2QPFA 3QQ9C 1WBYB 3H55A 3TBWB 3KE0A 4JRXE 4PI0A 2NTFB 3MYJA 2H2SD 2ZUWA 3DV6B 3LZQA 5E6YA 4APQA 4R90H 5DMYA 4LSUH 1T7VA 1C5DB 5IBLC 3KPTA 3BJ91 3MBED 3QBTB 5DQDH 3KEDA 3TA3B 1J9CT 4Q0XH 1OAYH 4XP9L 1MFAL 5CLXA 2N1KA 3MLYH 2XHNA 1JP5A 1MFUA 1JF6A 2VLME 1ORSA 2NY4B 2WB7A 3TNNB 4JM2C 3VXTB 4UQ2A 5JPMB 2NNRA 4HIQA 1DEDA 3TJPA 2VITA 5F9WB 5KOMC 1DJYA 1LD9A 2FK9A 3A6CH 3L3DB 4IRZH 3U1QA 1D6VL 1ES0B 1I1YA 1D5ZB 4PJCE 4XWGL 4P3DB 4Q2ZA 5JZ7D 4RISL 2C3VA 4OM1L 4RFEB 1S9VB 5CEZL 3I3EA 4IEFB 3H0TB 2E9JA 4OIBA 2F7IA 1I9JH 1KT2B 4JDZA 4PFEA 4M5YH 5SWZB 3C6SA 1DJHA 4KRPD 3EOAA 4MAYC 1BIIA 2FR4A 5CJ5A 2VRQA 4JQXA 7PAZA 1XO8A 2AP2A 4JVWA 4TRPL 4M00A 1KCUL 2ZX6A 3PWJB 3C5ZC 1G7LB 1FPTH 3QG7L 2Z8WC 1ND0A 2R0WL 4HX1A 5D71L 4N5EC 3NOIA 1A4BA 1Z1WA 1BZ9A 3VXRB 3S7GA 2HT3C 3KYOA 3LZOA 4M4PA 4PG9A 3MCG1 1GGCL 4MDIA 5KYUB 2KDYA 5IMKA 4OUOA 3F7QA 4Y4HB 1LK3H 5E99H 3Q6FB 3ZY7A 5T1LA 5CBAB 5TF1L 2VB5A 4FMKA 3DBXB 3OZ9H 4Y1AB 1W15A 2K9FB 2KBGA 2HJLA 3QI9D 1ETB1 4FQQA 1CE6A 3EO9H 4UINL 1FIEA 3DECA 5JHLH 4U0RB 5IGXL 5SX4I 4ZS6D 2YD6A 2ZWNA 1U3HB 5JHDE 1TQTA 3OLDA 2OL3H 3EDKA 5F7NC 1A7OL 2J8OA 4MQXC 5KVEL 3RPBA 3LIZA 4AG4H 1K4DB 2BS71 4LDCA 4G7RB 4YIQB 3VSQA 2NY6B 4WHTA 3HC4H 5I66A 2WO4A 4S1SH 1XVSA 2XYBA 3BT0A 3PIQB 4PBWD 1G0YR 4FA7B 5T1KA 2W92A 1JXJA 5T33L 1TFPA 2AXFA 4GSXA 1ZV9A 4Y2OA 3MNVA 2V9RA 5AVWB 4BZ1L 3ROOA 2O72A 1GZPB 1T22A 4LCCB 4P59H 2WAHA 3BUYB 3A4AA 3NA4A 1G1CA 1JGUH 3GXTA 4G11A 5GJTL 3HIZA 4BK5A 1DN2A 3PJSA 1QSEE 3QZNA 4XVUC 5ERWB 5EEXA 4ZTOL 2ESVB 2IPUG 3L81A 5SWSA 2DQGL 2VM9A 3OSKA 3GYRA 1NCWL 4X5LA 3GMQB 3ARGC 3U4EB 2HLAA 2DTSA 1YECL 2E4FA 1MFVA 3P77A 4PJ9B 4W6XB 3PGFH 1QLFB 5INCB 5LNEA 3KW8A 4R4BB 1DCEA 2CZNA 3N85H 4BFGA 4C4KT 3W56A 2HSIA 3PWPA 4ORGA 2VDRH 3OR6A 2XACC 4NQCA 4U1NA 8FABA 3PDOB 4FNLH 1MLCB 4LOEA 1FYHB 1OAXH 4QRBA 5G5DB 4GUOA 2PPEA 4GSUA 4LHUA 5IHZA 2VLLA 2QQLH 3Q2WA 2Q8AH 2G2RA 2HZHA 4ALAL 3HG1A 1NFAA 5B39B 4GRLA 4LSVL 1MJUH 2R7EB 2Q5BA 3CFEB 4BFFA 1JPFB 1J1XH 3QWOB 2Y7MA 4NENA 5DVPA 4ABUA 4NO0A 1PAZA 5D7LA 1DSFH 1G9MH 4XPAL 4FQJL 4D3CH 4ZFFA 5AVXB 1IAKB 2KLSA 3RNQB 1LE9B 5FHAL 2ZWYA 1AIZA 3QXUA 3VSVA 2Q2EB 2F7RA 4F1SA 4EOWH 5IFAL 3EJPA 4R2GC 5E2TL 4OLYH 5DURD 2AKRB 1O7VA 1T6VN 5AAMA 3GPSA 4XAKD 2X4TB 3STZA 3UJIH 1H3GA 2A6KA 3WEXB 2QQKH 3Q1EA 3B8SA 3O3DA 5ID1A 1NC4D 2X40A 3B2VH 4R5TA 2BXYA 3L3HB 4O51A 5TGBA 1KXVC 4PRPE 5IK3B 4AYMC 5BOJA 3L3KB 4FFYH 4NQQA 3SYCA 3ORJA 1N8OE 1ZPUA 4X4XB 4XRCA 4NKOB 2FL5B 1RZJH 4F8LA 4G8FB 1UZ8B 4XNYL 4ZPVB 3V9CA 3MOBH 4OZIF 2VE6A 3FO2A 2H2PD 1XGPB 1FZKB 3DGDA 1P4IL 2VC2B 4YX2L 3X1FA 3ZR5A 4JZOA 1FCGA 4D7BA 5T5FH 5FUOL 1R5VA 4G1EA 4EI6A 2QV4A 4NO5B 2JCCB 2UY6B 4JPWL 1I1FB 1NGQL 2Y07L 2CR3A 4YDLC 4PRHE 1JZFA 4U6TA 2JK5A 5HHXL 1D9KD 1HKLL 3CN2A 1CVRA 2YQ3A 1GZHA 4Z3IA 2XG5A 3U46A 1O75A 4Z95L 4F57H 1A7PH 1CLCA 1J7VR 1NDTA 3ECQA 4JB9L 3LIUA 2WGXA 4K15A 4HUXB 3TCLB 4DFIA 3SKMB 2FGZA 4IK6A 4M5ZH 5A1AA 1YEHH 2A0LC 4KHXH 5F3HB 3QULB 1I9EA 1JN6A 2VXVH 3F6LA 2MQ3A 3NJMA 3PHSA 4NKDB 1JIBA 4KKAD 3RI5K 3N1MC 2LGNA 2ORBL 4Y4FC 5I1KH 1CDUA 5CJXA 3ULUC 1RIVH 4YEFA 1MDTA 4ABQA 5BRZA 1P6FA 2WUCL 2OSXA 2JQAA 1KPRB 1EAQA 3V4VB 3QC5X 1KB9K 4MQTB 4PRAB 3CUPA 4ETQB 3SDYH 2C9VA 4E9TA 4PB9L 3RZCC 1SLVA 4HIEB 1UCTA 4ZI8A 1J8HD 1MCPL 2ARWA 1OSZB 4PG2A 3UBGA 4AMWA 2OULB 4ZTPH 3P2BA 2N1TE 1GIGL 1ZLWH 3DO3A 3A4EA 3OKNB 5D6DC 1DUYA 4S1DC 5E6IB 4AM0Q 4XE5B 4ZDHA 3DX1A 1T04A 3X13A 5I18L 1M05A 4I89A 1YEGH 4QCIA 4Y16A 4PB0L 4P2OC 1ZE3H 3QPQD 5AOKA 5DYFA 4RMQA 2C4XA 3ETBJ 5KVMC 2OK0H 4H25A 3NCBB 4XPFL 1ORQB 2VDNB 3KPMB 4BV1A 3I74A 2RTTA 1CFVL 1EUUA 1UHVA 5M95B 3QHZL 3CE1A 3HS0A 5K33A 3L5IA 4X4ME 5EFIB 3DBSA 1MLBA 1L7IL 4PJIE 4TSBH 4ZMTA 4K9EH 3VRJB 1KDJA 2H47C 2CCWA 3KM1A 3FT3B 4GSDH 3U6RB 3GSNH 3MO1A 1RHHB 3ARFB 4U3XA 2B1AL 3HKZA 1GRWA 4UF7C 4U1IB 3GBMH 4ODUA 5FW6A 3VFSB 3EO1B 3ELQA 5EMYA 1KB5H 3FZUC 1SDYA 4P2QE 3EZ8A 1DJSA 2GT9B 5C6WH 3WCYA 3K72A 3R7RA 4NZRL 4W70A 2E86A 2IOIA 5AW0B 2OTPA 2B9BA 4JG1H 2BOBA 3PHQB 3UTTD 5FPIA 3JQOB 4XAWH 4JY6A 2XDHA 1L4IA 2HAZA 5ESVB 3OKEA 4HK3N 4KWUA 2Z8RA 1WFIA 2P5WA 1AGFA 3WS3A 4F5CA 3BHBA 4DERA 5A2BA 4IIQB 1HWHB 3FRPB 2KERA 4U7KA 1UT1A 5LHDA 2PTUA 1A6UH 5FUZH 4KTYA 2F2HA 4MSWB 1XF5A 2XQYK 1WCBA 4HK3J 2IAAC 43CAA 4IKIA 4LGSB 2GQHA 4ZUUA 1D2OA 1F3DJ 2YPVA 3TLRA 3TN0D 3TU6A 2Z8SA 4P5TD 2HFEA 2NYYC 2XV6B 4KX7A 3AXHA 1FAKT 1CYXA 1ZJAA 5I1EL 1AJ7H 4JCLA 2E7BA 1A3LH 4HWBH 3OKYA 3LNIA 4YDKL 1DVFC 1W0VB 2R0KL 1JGEA 1BJ8A 5IOPB 4NGHL 5DD3L 3WFEH 1Q9OA 3V4LA 4ISVA 2NR6A 2V5RA 3C2AH 3OPZH 4LLYA 4H0IA 4OBRA 3O8XC 4KHTH 4L4VA 4K94L 3V0GA 3QR1A 5J06A 2PW1A 2BFVH 4XN2A 3WNNA 3WYRA 1FF5A 3PQYA 1BYPA 3AABA 3CFDB 3O9WC 4KY2A 4NZDA 5EUOF 4NPKA 5EC2A 1X5YA 3VFGH 2V3FA 3VFTA 3JWNE 3WHXB 2C1OA 3BPNC 4OM0H 5DD6A 3MXWL 5HDLA 1FSKC 1J1OH 1E8XA 2AK4D 1FL3A 3QRGH 3GDBA 4RVBA 2Z64C 4IS6B 1NCJA 4L9DA 2RIKA 2N0MA 5CXPA 2B16A 5D93B 1UXWB 3RUGF 4YPGA 2EO9A 3EYSL 2M1KA 4XCEA 4P4KA 5JNYB 4DZBB 4M7ZC 4KZEL 2XVBA 5TE7L 4JFSA 3SBWC 3UTSB 4EXKA 1Z9OA 3LNHA 4PMEA 3H54A 5I8EA 3TURA 4XVSH 5JIMA 1A1OB 5BV7B 2R2CA 3O41B 2DMBA 2C4FT 4HFUL 4E42A 2NNAB 2FD6L 5IVZB 1SOXA 5BJTB 2BIHA 2GW5A 2BW4A 3PXLA 4BGLA 15C8H 2BY1A 4E36A 3DV4B 4WTZG 1QR1A 3WFBH 4QRPA 4YHLH 1HQ4B 2GJZA 3IJ8A 2C7FA 4GG6B 5L88L 3FOLB 2BOCB 1MPAH 1SFDA 1AR1B 5EUOA 1IM9A 4BWTA 1MNUH 4NP4H 1NAML 3CVHH 3GLAA 2YK1H 1OZUA 3HMWL 3EYOB 5ICXB 2YEQA 4MDJB 1BQLL 5L7XL 1FAIH 2R1XA 3AT0A 3T2LA 4DQAA 4ZW5A 3U0WH 2CUHA 1G87A 2R4SL 1MCOL 4PVLA 3RTQD 5I8OH 4NN6B 4PS4L 2ITFA 1S8DB 3WDJA 3BVNA 5BZWA 1Z9MA 1G4RA 3BWAA 1UKTA 3FULA 5JXEA 3GM8A 4LAJH 1TXKA 4BFRA 5DTFA 5I8KL 3IMSA 3EDFA 3WAKA 1Z2KA 2KLRA 4WFGD 1T03H 1CI3M 1WICA 5E94B 2BNRA 3STBA 5I0YA 4TTDD 4DJMA 4LBEA 1TEFA 1SLUA 1BF8A 4JG5A 4FQHB 2J1WA 2Y7QB 4Z5RB 1BXVA 4NUPA 1ED3A 3LKRA 4YEEA 3UPRA 1XGTA 1DQJA 3HE7D 2IPKA 2NUPB 1L0YA 2Z6FA 2FEDD 4G6AD 1F4WH 1U21A 1A7BA 4OGQC 5J89A 1KIUB 2D7MA 3G5XA 4NNPH 4PW3A 3HI6H 2BSSB 2QGEA 3VD4A 4YHKH 4QF1B 5EOQH 5DVKA 4KY1H 2AK4E 3LD8B 4WKZA 2D9QB 1FL5B 1QLRB 4YHOH 5D2NC 4YXLH 1OARH 4HUNB 5T3ZH 2OAAA 1L0XA 4ZS7H 2HVJB 4YSOA 5LXVA 5K9JH 4GBXC 3O3BB 4FJ6A 3UAFA 4GQRA 4OZHA 1XGYL 1O0VA 3C60C 4J1UA 5F44A 3EH3B 4N9GA 1SY6H 3MYJB 4OCRL 4APQB 3SPVB 2DI9A 1ZHLA 5T1JA 3OLGA 3WGVB 3MREA 1ZLVK 4A6YH 1MQKH 1F3JA 3H6JA 5J57B 2F7PA 4HSCX 1YNTA 4PPTA 3ZQ9A 1ORSB 1MHHA 3QJOA 1IU1A 1JPEA 3BMVA 5IOKA 4JANA 4UQ2B 3VNZA 1CDJA 2PW2A 5GRVL 1G1OA 2VITB 3B9KC 3OXSA 1PY4A 3VWKA 1HU8A 3DX6A 4R7DA 4LVHB 4Y5XC 1I1YB 5K5YA 5GGSY 4NO3B 2NT1A 2BNQE 4OF0A 4UILL 3IJEA 4J3OD 4Q2ZB 1JWSA 1MIMH 3OKKA 3AUVA 4OKDA 2FLMA 3NCJH 4JDZB 3IS0X 2HVKB 3ZHNA 4GOSA 4Z7OE 3C6SB 4LFHD 3TA3D 2XJLA 3CVIH 4UT9A 3TNMA 3TBTA 1RFDH 2V8MA 4X80H 2A6IA 2NY4D 4WFGE 3CIQA 3N41F 5I73B 1ND0B 4HX1B 4MLIA 1B4LA 3UDWA 1P84K 1UA7A 1T89C 4MB3A 1TMCB 1U2YA 4PG9B 5IHHA 4EF3A 3BH8B 5CZKA 4KO7A 3SOBH 2JE8A 3DIDA 4MDIB 5JIDA 4XPBH 3RY4A 3OTTA 1TZ8A 3ECVA 1NDGA 2MFNA 4JR9L 3WHE1 2HMIC 1SHSA 4L5FE 5T1LB 4UOZA 2MHAA 4BCZA 1V7MH 5DWPA 5SWZD 3ML9A 3HMXA 1NCCH 3BSZL 3CJJA 3IYLW 2HJLB 4G6FD 4FQQB 1CE6B 2K7QA 2J5WA 1UTDA 4KAQH 3K74B 3RVUD 3B5GA 4Y2DA 5F1OB 1L6XA 5IF0B 4JHVA 2YAQA 4JO5A 3TESA 4N1EA 3GI9H 1KCVH 4QTIL 4RMBA 3VXUE 2QGBA 3VXRD 4KGJA 3BKJL 1FL6A 2LVCA 4Y5YA 1DO5A 1HDMA 1WP6A 5I66B 2F15A 4XVJL 4AQEB 3GRWH 3H53A 3ZDXE 1ZT4B 4FFZL 4G5ZL 2QKIA 5K1JA 5IFJA 3EFDL 4M1CC 3K6IA 5T1KB 5EN2A 3I3BA 4JLRA 4WO4C 2AXFB 4Y4HD 4B50A 4Y2OB 1NLDH 3MNVB 3L5JA 1OK0A 3QIBD 3ROOB 4NQXA 1T22B 3B7YA 3MODH 3U4AA 5KWYC 4Y1AD 2FO1A 1AZZC 4LRNL 3PJSB 4DPBX 5I6LA 1NANH 4P46A 1U3HD 4OFKA 1A7QH 3CPUA 2AJUL 4KPHL 5GGRB 4CJ1A 5AKTA 1J05A 5JO5A 3OWEA 1HHJA 2HLAB 1KCBA 4OZFH 1JZGA 3P77B 1EO8L 1MXDA 4QPEA 5E0FA 3ARYA 4NRXA 2NY6D 5DD0H 3REVA 4FAAB 3ZE2B 1A6WH 1T1WA 2P46B 3A67H 3PP3H 4ORGB 2VDMB 2VJXA 3OR6B 1MCSA 3ETTA 3EYUL 5E9DA 3K1KC 1DLFL 4E9XA 4AVKA 4NQCB 4U1NB 2MSPA 4M6MH 2H41A 5FWRA 3NT0A 3B9VA 3HZYA 4MB4A 4XX1G 2X1PA 1GW0A 2ZCLH 2CAKA 3MR9B 5EBWA 4LHUB 5D72L 3LJ3A 5IHZB 1C1EH 2VLLB 2G2RB 4NWTL 2ZUQB 5K9OA 2ESVD 3EAKA 3HG1B 3NPSC 4YC2B 4GRLB 5CZRA 2J6EA 3F84A 4O02A 3T6ZA 1UWXH 3CFBA 4NENB 2I5YL 4FYRA 4PVMA 4PJ9D 4ZFFB 2DTML 1F0LA 4F7KA 1LP9B 3HBQA 4L1SA 3FONA 1FORH 3KWXA 4N86A 4OD3H 4N87A 2ZKYA 3WTWA 1CGVA 2DYRB 1F4XL 1II4E 4JN1L 4M3KB 5LCVL 3SKUD 3H42H 2DQIL 3QUXA 4O9HH 3MNDA 4XN1A 3UZQB 4X6FA 5CZXD 5KVFE 2F54A 3STZB 3E1ZA 4IRJA 3V6OC 2A6KB 2Y6SD 6PCYA 1RZFH 2DQHL 3O3DB 5ID1B 1NCBL 4O51B 2GVYA 1GVIA 5TGBB 4AQ8C 4B27A 1CLOH 1INDH 4L5FL 4DTGH 3CHQA 3KPNA 1CZ8L 4XRCB 3MGOA 4DKTA 1RLBA 3RWIA 5KAQG 1NIBA 1IAIM 2VE6B 3FO2B 5EZOH 2HRHA 2W0PA 1AFVH 1FFNA 1P4UA 2H3XC 3N1PC 4ODWA 2CBOA 4JZOB 3MRQA 5KYYA 5HJBA 4Y1AE 1R5VB 1MKFA 3L54A 4G1EB 5C0GA 3P0VL 4H44C 1WEJH 3V0JA 5BVPL 5F6HI 4OTXL 4Q56A 4R26H 5CKAA 2JK5B 5DUBA 4DVBA 3ZKMC 4BKLB 3UBXI 1ID2A 5AAWC 3EFOA 3TVMB 1PX3A 3EADA 4NQDE 5IQ9A 1N6QL 2XG5B 2YRPA 3A4DA 3U46B 4ZOCA 5I23A 4A04A 1AR2A 5JW3H 3WL9A 4WCYH 3MA9H 3LRSA 3ESNA 3LEVL 1N2RA 5SV4A 1DVTA 2DWEB 1E6OL 1RZIA 2EP6A 1G6RA 3DRQA 3E9TA 3MRPA 4HIJA 3U2JA 3UFIA 4IRZA 1PF3A 5A6LA 1R3IH 3CDGA 4RLDA 5BPPA 2N3JA 3APFA 2BSRA 3DX7A 1JN6B 1T2XA 2CMRL 4TQIA 4PVNA 5B1KA 1V3LA 3NCMA 4FMFA 1WRFA 3HE6B 5AVZB 1R34A 1E8YA 4I2XA 5BRZB 1TQBC 1MF2H 1LWJA 2C5DC 3EJZC 2ESVE 4X0NA 2F5BH 3L3OC 1I75A 3CUPB 4I0PC 4AUUA 1OSPL 1DSWA 3CXDH 4PRNA 2H8PA 4PCKA 4AYFA 2BHYA 1EEYA 1XBRA 4WUKL 4TUUA 1MWAL 2B4CL 5E2VL 2ERJC 3IFLH 5DK0A 4J6IA 1RZKC 1AZRA 1U91A 1YAZA 25C8H 4UUJA 1M9SA 3KDPB 3N44B 1DUYB 1K5NA 2P49B 5CINL 4ZDHB 5BUAA 3X13B 1T04B 3ZE1E 4WAFA 4Y16B 4QCIB 5DF0A 2I27N 3I6GA 4JFXA 5KJ4A 4L18A 4EUPG 5EIQA 3SB3A 4ANWA 4H25B 3ZYJA 2MCG1 1I3GL 3SPGA 2QGDA 3VD7A 3AU0A 2Q10A 4CKVX 4H2CA 4XOAA 3HS0B 2GK0A 3H56A 4ERSH 4ZXBA 1GKEA 5DI8A 1QZ1A 1MLBB 4Q97A 4ONFH 5JHLA 3RYMA 4FF9A 3BAEL 2NNCA 5HGBA 3LMJL 1CF8H 5I1GH 4Z3TA 1S7XA 2OL3A 1JS4A 4ODUB 1TDQA 1JXGA 5E95B 5I6NA 1RV6X 2GB2A 1YCSA 5E6ID 5C7ZA 2WOBA 2UX7A 3K72B 1XXFC 1MW0A 4XC3H 3E3QC 1FYTB 2BOBB 2JKTM 4I3RH 1E28A 3EGSA 2JB5H 3BEWA 4KJWD 2QPSA 3BN9D 3OKEB 3JT0A 2Y9RT 4TSAL 1H9DA 2P5WB 5T5FL 1AGFB 3MA7A 2D03L 2JF1A 3WS3B 1UD5A 1V05A 3FFCE 1AZBA 3BHBB 5EEZA 4WJG3 1GXEA 2YGVA 3ZSSA 5ICZA 3S8FB 3IK2A 3UMNA 4YSDA 3VAEA 4YDVA 5IVNA 1HESA 3OAYH 4Q6KA 1XF5B 2VQ4A 5AL0A 5C07D 1WCBB 3ARFD 4UZSA 5I0ZA 2GYSA 43CAB 4ZUUB 4YE4H 2UWEF 4KO5A 4MX7A 5JHBA 2HFEB 5C08A 3VXQA 4NM8H 2FBOJ 4I9XA 2JCCE 4PWIA 3QORA 4KQ4H 2CALA 1HL4A 1V54B 4H20L 2QFPA 1T7ZA 1DQVA 2FIKA 3DXAB 4MJJA 4Y2LA 2MCMA 1XIWA 2VO8A 3SKJH 3EDDA 1JGEB 1PJWA 3GMOA 5DK2A 4IOSA 1Q9OB 4ISVB 5KSAA 1K9TA 4FI7A 4MRBA 3AWGA 5I5JA 4JAMA 3HJ0A 3TWCH 3OAUL 4L4VB 2UXGA 1KN4L 2PW1B 2OI9B 4GO6B 4X7CC 4ANXA 2FEJA 2K8QA 2VR7A 1JWMA 3P73A 3PQYB 2MQ0A 1IILE 5EC1A 3FSVA 5MENE 5EC2B 1I9IL 3DMMC 2WZPD 2WNXA 3RWCA 4M56A 2R2HA 1GYWA 5JYLA 2DRUA 2C1OB 5E2UH 4ZUWA 4NUGH 1WVZA 5DD6B 1A6PA 1E6JL 3H1ZA 4FZ8L 1U93A 5AZEH 3UH8A 2H26A 4DUXA 3IRPX 1ZVNA 5E4AA 1FZJA 5IFHL 1KGIA 1S46A 2OV0A 2C3XA 2UWEA 2PUQT 4A66A 3VA2C 4P2RA 2W0LA 4YPGB 3CPLA 4XCEB 4P4KB 3T71A 4K23H 1QW8A 5DFVC 4KJPD 3ZMRA 4JRFA 3QIUA 1MCWW 1GGYA 5I8EB 2QMJA 2OA9A 1CLYL 2FT8A 1EGJH 2HKHL 5F70A 4E42B 4S0TD 3S4SA 3VXSE 2OMTA 3T3MF 3V6ZB 1CFNA 1YC7A 4FFYA 1QR1B 3WHE0 4NQSA 4QRPB 2GJZB 2H0JA 1HIMH 4FP8H 2UZIL 2ZWSA 4MS6A 3O2DH 1EVUA 3WG7B 3LS4L 5LGYA 4KNUA 4BINA 4J2XA 3VQ2C 3LXCA 5LXGH 1A6VL 3IRZA 1IM9B 3VI3F 3GSXA 2MQCA 5HYSA 2A74C 4F92B 5T5FA 4F2FA 2AQ2A 3POCA 1EDYA 2Y23A 1U8OA 5F8RC 4Q89A 3CVDA 4KNQA 4GRWB 5FGBA 1S5IH 4OD1L 1ZXQA 4HOZA 2R1XB 5KSBA 3UTSD 1I7TA 1QSFA 4NN5C 3AG4B 2I07A 4N0CD 4JKPH 5BZWB 1ZEAH 3CZSA 5EO9A 4U6YA 4XBEL 3BWAB 3Q1SH 1RVFL 3L3JA 3QDJA 4X9FA 3QDGA 3VD9A 2O93L 2BLFA 1TJIL 3K7UA 5DTFB 2X4UA 3L1OH 1Z5YD 3NRFA 1OB0A 5CN3A 2GTZA 3QQNA 2BNRB 4EDWH 1VCAA 2WCSA 3OLIA 1AR1D 1QWHA 4LBEB 4B9IA 3UO8B 3Q9PA 4B96A 1ED3B 3UPRB 4AGOA 1XGTB 2VC2L 4QYOB 3HR6A 3SEPA 2WYHA 1DBKL 3T65A 1DQJB 2IPKB 2FX7L 1AMYA 3NCYP 2TRHA 4XXDA 3VI3A 1AGDA 4R84A 3QYNA 1FNAA 1PLGH 3ILQC 1GGIH 3G5XB 4G8IB 1EZUA 2DQ6A 3DO4A 3KLKA 4G80A 4QGYA 4Q9RH 5GS1C 1HJBC 2ENQA 1A7RH 3HHMA 5IQ7L 5AVSB 2XICA 4WGKA 1W0WA 5ALBH 1KWKA 4WKZB 4RMSA 2DJUA 2I9TA 3MRCA 3PWNA 4N2IA 1TZIB 3NESA 3DTXA 5DEGA 4FZEL 4OZHB 4PRIA 2YD1A 2ZXQA 3QR0A 4PY7A 4WRLA 4G6JL 4N9GB 5BO0D 1RLWA 1OANA 4L48A 1EJ6A 1OSYA 1ZTXL 4N20A 1OXYA 5FAAA 1ZHLB 1UOLA 2WINA 3A4FA 2J1KA 2PO6A 5E03A 4AV5A 4Z7QF 1XF2B 4OCXH 1F3JB 1RCYA 3TEUA 4DCQA 1YNTB 5E7BA 2J5LB 1MHHB 4GAAA 6CGTA 6FABL 3V4VL 5FYLD 3G6DL 1DQDL 2PW2B 4HMCA 5D7JA 1G9NH 3OXSB 3VWKB 5MP6H 3GSNA 3AQDA 3TCXA 3DX6B 3S3BB 3VI4F 3ATFA 4ZOBA 2JB6A 3QYMA 3BPLC 1RURH 3IJEB 4EZMA 1KB5A 4AK2A 2P4AB 5FGSA 3NQIA 4K5MA 1JWSB 3GLEA 4R96A 2OMYA 4XP1H 4WI8A 3CFMA 3F7YA 4APQD 3TV3L 1HTYA 3D33A 3DVNA 3ZKXC 4LSQL 4TUJA 3HUJF 5ANMA 5E00A 1KCSL 4LVEA 5DWUL 3MU3A 2VDNL 3TNMB 3RWEA 1R24A 4YGAB 5IJVA 1OAQL 3KHQA 3UYRH 3G5YB 3IAPA 1X9RA 1JVLA 3BPOC 4XPTH 2O6FA 1Z5LA 4P2AA 3SE8H 1R9FA 2HRPL 3L5HA 1FNLA 1G7JA 3IXAA 4LP4A 3A24A 2J25A 1OALA 5CU5A 5GZOA 1T66C 1U95A 3VI4A 1NDGB 3C9NB 2ZXAA 4KJQD 3BZEA 4MAYA 4W9FC 3WNLA 5DO8A 2MHAB 3S36X 1H3PL 2YO3A 2MRYA 4FQCH 4U1LA 5T5NF 5FCUL 3C5ZA 4XXWA 2PWGA 2E7CA 3RX9A 2FBRA 1RZKH 4JKWA 3VFPB 5I71B 2AEPH 1U8MA 4G9FA 3HJEA 4Y2DB 2R83A 5F0LB 1GMEA 4TULH 3RHWF 3HUJA 4DSYA 1AHKA 4AT6A 2UY7A 3DSNB 2VNCA 5TK2A 1OAZH 4K0OA 1FL6B 2X10A 2F68X 4Y5YB 1HDMB 2Q76A 3HLAA 3LB6D 3UIYA 2P24A 1CU4L 1C5CL 5LDUA 3N41B 1CGWA 2QKIB 3WFHA 2X0UA 4UV4H 5EN2B 4FTVA 2DD8H 2Y7NA 1EZSA 4JLRB 4YVNA 3RRQA 1CD8A 3VTTA 1KBWA 5T1LD 1BEYL 1JAEA 3EFFA 3QT2A 4F7CA 5FYLE 1OLZA 2FVNA 1OLLA 2E27H 2ZP8A 4S2SA 4ZMPA 3OMNB 1OZTG 2J8HA 1Q9LA 1HSBA 1L9SA 1NCOA 4JL1A 4P46B 2WSKA 4QXUL 2HYMA 5CMAA 4S0SD 1J05B 4OV6F 3QZWA 3ZDYF 3FS9A 3LEXA 1HHJB 5JO5B 3RY6C 5IZ7A 3CMOL 1F6FB 1MFAH 4XP9H 2ZNWA 3LDBC 3FTGA 3VH8A 3S88L 4LKCA 4J4PC 1ZSDA 2G60L 1T1WB 2CBMA 4KKPA 5DEFA 2Q7NA 1S7UA 4BWWA 5C70A 5E9DB 5T1KD 4WNSA 2D4DA 5CGYD 1D6VH 1VPOL 1VIWA 3O6KL 5HDBB 1I7ZA 4M6NL 4M7LT 3HZYB 3GKWL 4HSAC 4JHWH 1R5WA 1DANU 4XWGH 2KT6A 4LFHG 2H5UA 1OB1A 1JTOA 5EBWB 2X3AA 4RISH 2ZXWB 4OM1H 4UQBA 5AVYB 5A3ID 3RZWA 5CEZH 4Q52A 5K9OB 1XSIA 2D0GA 3EJYC 1VB9A 4ILDA 3VG9C 2NW2A 3L8QA 4O02B 4X5RA 5GS0C 4XCNA 3N55A 3BAJA 2ZUXA 3R1GL 4X7EC 3MV7A 4TRPH 4RFOL 4U1SA 4E41B 3L13A 3P11L 5IJBC 1KGCD 3CLFL 2R0WH 5D71H 4MXQD 3HZMB 1BYOA 1GY1A 3IDJA 4K7FA 4FL4B 4NQCD 1HHKA 2VSCA 1Q90A 2CHNA 2VISA 1XL6A 3QUXB 1J8KA 1TEYA 2F54B 5H37G 1GGCH 4IRJB 4JJHA 2ZYIA 2EILB 4LKXA 1XT5A 4LHUD 3PPSA 2VLRA 1ETA1 5FB8A 5LB1A 3LH2L 2FWUA 4UI2A 4ZMNA 2HRLA 12E8L 3O6FA 5TF1H 3TWYA 3KPNB 1FGNH 2EICA 4GRLD 4LIQE 3EXJA 3MGOB 1EFQA 1BVOA 4PBDA 3L7EA 3M88A 4UINH 3V0WL 3WEOA 2HUHA 4RGOL 3MZGB 1FFNB 4ODWB 5IGXH 2NY0C 1ETJA 3K5SA 2A5UA 2YUWA 3MRQB 1NAKL 3ATBA 5KYYB 4H8WC 1P7QD 1A7OH 1QHPA 5C0GB 5KVEH 3HZ3A 1JZ2A 1SY6A 2CM5A 2EO1A 1Q0XL 3MRIA 5BRPA 5AD0A 5DUBB 4Z78A 2VWEC 5DS8A 5IQ9B 4J7RA 4X6EA 3U4KA 5IKCA 3CAFA 2Y6TE 1Y6KR 5HJ3A 1ANUA 3VWJC 3LRSB 2IQAA 1N2RB 4BZ1H 3AJ7A 1RZIB 4HIJB 1G6RB 3DRQB 5FYLL 1RZPA 2J57A 3CDGB 2XPYA 5GJTH 2IOMA 4TNWK 3FXIC 4Z3JA 3B34A 4C55A 4RNRB 1BFVL 2BSRB 2CD0A 2X9XA 4JREC 4ZTOH 4QXTA 1OD7A 2DQGH 1YEDA 1B88A 4KRNA 3D3VA 3VFVA 3F58H 4M5TA 1NCWH 5A40E 4HOMA 4I2XB 4ZNEA 5DFAA 4YMPA 1YECH 2N01B 3S36L 5E4EC 5SWSE 5DMJB 1JFQL 2VN6A 4IBSA 2GTQA 1BJ1H 3TVMD 4PRNB 1TR7A 1MQ8A 2GJ6A 3MTXA 5AB1A 1D7FA 1XCTB 3OBAA 2BIQA 3PJNA 3FUJA 1ECYA 4ZTEA 5DK0B 1L9TA 1U91B 2B3RA 1E5ZA 2R23A 4IM8A 4UUJB 2OYMA 3ZE2E 4K71B 3DNKA 3PWPE 1KLFA 4Y4FA 3LXAA 3I6GB 4JFXB 2P26A 1WWWX 1AQKL 4HS8L 4ALAH 4DUVA 3TH3T 3SKOA 4R4NC 1ACCA 1NGXB 5C3LD 3HE6D 1S9KC 5L4MA 1HYRC 4JJOA 5CJ8A 2O1AA 4QI3A 5CSBA 4XPAH 2GK0B 5BRZD 3ZTEA 4FQJH 4ACTA 4X6CA 5DI8B 2HWZH 3HG1E 5J9PA 2WYZA 4LSRL 5BW7C 3FTWA 5FHAH 4OGAC 3DX4A 1VLXA 3O3AA 2EE3A 5CP3H 4AVIA 1KJVB 5D6DA 5D7LE 2CA4A 1S9WA 5HGBB 5IFAH 2DB8A 1QTSA 3BXNA 1XMEB 1S7XB 2OL3B 4FG6C 4MZ2A 5E2TH 3UTPE 2PP7A 2P5EA 3KYMA 4PJAF 2CRIA 4P2OA 2JKWA 3Q05A 4ZFGH 1IEHA 1IL1A 4G2AA 4Y16D 1F86A 3ALWA 1MW3A 1OPOA 4XO3A 3GRWA 3R4DA 5I17A 4ZBJA 3VG0L 1E28B 2CE6A 4JM4L 3BZFB 3OHXB 2ZCHL 4PN6A 4E9SA 3MA7B 3X14A 2HTKD 4FLRA 3BAKA 3I75B 4YX2H 1UC6A 1LXMA 3T8XA 1GGBH 3BDBA 2VL4A 1XAUA 4DF9A 5ICZB 1PCXA 1XZ0A 3KPRA 5FUOH 1M53A 4YDVB 4JPWH 1DN0A 3PXJA 1NGQH 2Y07H 5E8EA 4KZDL 2X4QA 2FLBT 3AM8C 4RAVA 5HHXH 4H0HB 4P9HL 3TYFA 4MX7B 2FSEA 5C08B 4WEBH 3FT1A 1BA9A 3FUHA 1PMYA 2EEFA 4Z95H 3PL6C 3QORB 4QRUA 4JB9H 5KVDH 5GRUH 3IJSA 3SZ6A 4NBYB 2FIKB 3WUWG 1XIWB 4NAJA 3EG9A 1FYTD 3X1EA 5AYTA 2VDRB 3JWDL 3GMOB 5EIIA 3AVEA 3BDXA 4WW1A 2XNAA 5TF0A 5KSAB 1E8ZA 2P5WD 2R69L 1WUNT 4R5XA 4JAMB 2OS7A 2VZOA 4AEHL 2X7LA 5AEAA 3VE0A 2ORBH 1RPQA 3DVFA 4EQ2A 1BQUA 5EC1B 4Y4KD 1IQDA 2NSQA 3RA7L 4ANUA 2R2HB 1CTOA 1NEZA 3MCKA 2HT4D 2EYTA 4IYKA 4B9YA 3SDAA 4PB9H 4LK4A 4ZUWB 3DTUB 4KK8D 1DVFA 1MCPH 3NSDA 4M1GL 4OZIE 5CEYB 1U93B 2NXYC 4X6DA 1JFHA 5BRZE 1FZJB 1WQVT 1GIGH 4QRAA 1X5JA 3RVWD 4IBUA 3DXAD 2HKFL 1XF4A 3MRRA 4P2RB 1JG9A 1PIGA 3O8XA 1IV8A 5D9SA 2DDQL 1NM4A 3CPLB 4IBZA 3WDIA 5I18H 2NR6D 5DZAA 5L8JB 3O9WA 4PB0H 4LDLB 1C9SA 1MAJA 4Y1SA 3ISRA 3S4SB 2OMTB 4XPFH 3PQYD 1CFNB 1CFVH 1NMCB 1R33A 5DVMA 2CDEA 4F2EA 4K07A 3QHZH 1QAWA 4WI9A 4NQSB 3G08A 3QQ3A 5I1LA 1L7IH 2AXWA 4G59C 1KCKA 1UEMA 3K71A 3MOAL 1QWNA 3B7RL 4XP5L 2CGYA 5TDNA 3GSXB 5HYSB 2B1AH 3VQMA 5FR3A 1U8OB 2WQXA 3L4CA 3BD3A 1J11A 1SYSA 1AAJA 4P4KD 1F4HA 4V1DA 1QP1A 5KSBB 1I7TB 1KYAA 1QSFB 4ANKA