1WBXB

Crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title Crystal Structures of Murine Mhc Class I H-2 D(B) and K(B) Molecules in Complex with Ctl Epitopes from Influenza a Virus: Implications for Tcr Repertoire Selection and Immunodominance
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wbxB00
1S7XB 1H0DB 2HFGH 3V5HB 4Y4KC 1WT5A 4ODUB 4HQQH 4G3YH 5ITFB 4I1NB 1DEEB 3BWAA 5C0AA 2OTWB 5ITBL 1KJVA 3NABH 1GAFH 1CLYH 4HCRH 3HG1E 4JRYA 3K8LA 4GFTB 4KKAD 4O5LL 2HT4C 3V79C 2XNAA 2ZSWB 5E8PA 2A6KB 3IDUA 4KHXL 4Y2DB 3TZVA 1T1YA 1HDMA 4J12A 1INEL 4XPAH 4XPTL 5IQ7L 2V9QA 5GQBA 3DHJA 3RHWF 1WCQA 4K3JH 4U1JA 4ZQKA 1FJ1B 1N8ZA 3MV7D 3FONB 2NR6C 3UTSD 5HHOE 4LHUA 4BSWA 3RPKA 5GZOD 1K2DB 1G9NL 1B6UA 1P4BL 2AK4E 3OKDA 2ED9A 4KVCL 4U7MA 5JQ6L 5F9JB 5E2TH 3WFCH 4G8EB 1YN6B 1BIIA 5SV4A 4U6YB 1T6WA 4L4TB 3DURB 2VQUA 2XTJC 4RWYL 4P9HC 1SY6H 4IJ3C 3VGAB 4EIZC 1MCJA 1YJDH 5ENWA 3D39D 4AIZA 1LP9B 3GSXB 5FUCE 5GSRA 5MERB 5TGBB 2HJFA 4R2GC 5EZJB 4UQ2B 1GZQA 3WKNA 2GEEA 2VLLB 5HHXL 2BNQA 1GJIA 4PY7B 1FIGH 1WICA 3CFBA 3TJHC 1JWSA 4NZJA 5IMMB 4XMLL 4OZHB 3QFJA 5FKAA 4KJYB 2BZDA 1P4LB 5E8OA 5CWSA 5L7XH 2BVPB 3PWJA 5B8CA 4Z7UE 4YDKL 1UM6L 5C0IA 2WSKA 2DRUA 5JXED 2YZ1A 4ZPVA 1U3HA 4XCYA 3K0WA 3BGAA 4JFZH 3RNKB 2BVQA 1RUPH 4L3ED 4CN6A 3VRJA 4PJFE 3G6JA 3VRLF 1YNTA 3EO9H 3ULVH 1VGKA 3U6RB 1BJMA 4HC1A 5KVMC 3H3PH 5FYJH 4HH9A 4JFHE 1CTOA 2IH3B 5GGVY 5TE4H 3QUZB 4MNGB 1IZKA 1MJ7H 4Y2DD 2ZWLT 3IJSA 4LAQL 4XH2B 5DEGA 2OK0H 1ZLSL 2OR9H 3FB7A 5FYLL 4UV7H 1Q94B 2X5PA 4ZUUB 2EDYA 4AQ1B 4JFDE 4MQSB 4R96A 2NY5H 2X4RB 3FKUS 4UMGA 1X3DA 2OJEB 2ZP0T 4L4TD 3RNQB 4MXVE 3JTTA 1F6AA 2VISA 3FRPG 3U79A 3U4BH 3S5LG 1MCWM 2PO6B 1BBJB 4JZNB 1IFHL 1MIEL 3GJFH 1OY3B 1RUQH 2ICWB 1NAML 3LAFA 3EGSA 3WFEL 4Q9QH 3KYKH 4JO2L 2R2CA 4PBXA 3O3EB 5AEAA 1AR1D 5D1XC 1IJ9A 5C09B 1JPSH 3MROB 1A3LL 5T1DH 3LRGA 1PLGH 3LN5A 4IOIA 1EHLL 3IFPB 4WW2B 5C0CA 4AT6A 1YMMA 3BEVA 3HZYB 4WFED 3FO2A 5BW7C 3E0GA 1JPTL 3LQMA 1A47A 4YDIL 2GJ6B 2Y5TA 3MRJA 2PKDA 1Q1JH 1YEFH 1CN4A 1I3RB 2XI9A 3WMSA 2J2ZA 2NNAB 3L5IA 5CBEB 3THMH 3LCYA 3D2UA 3GKWL 1T7XA 4PJXF 4GXVL 3PQYB 4NN6C 5GGQL 3QUZD 4LF3B 2AV1B 3VWJA 3L3HB 5IEKA 3DECA 4OV5A 4P3CH 2P8LA 3VWKD 1NCDL 4MJ4A 4IDJH 1G9MC 5EULV 2DM4A 1EA9C 3BAEL 5DR5H 1U8LA 3TGXA 3ARGB 3OGCB 1B0RA 1JNJA 5ESVB 3QBTB 1A1OA 4AIOA 3C09B 3E2HB 1K6QL 5IM7B 1FG2B 2EDBA 4XNXH 1A7PH 3BKMH 1ZHKB 1BD2A 5JNYB 1CU4L 3SGDH 2HFTA 2IEPA 4OCSH 4MDIA 4RNRA 5C08B 1WWWX 5T5NG 3LPFA 4BFBD 1BWWA 4M00A 3UO1H 2XQYG 1Q9KB 3PJSB 3S34H 2NW3A 5KSBE 4Y5XA 1C5CH 2JELH 4FQCH 1UACH 5EU6A 3FT4A 3PWUB 1GGTA 4LK4A 2ZUUA 1UXSB 5FA4B 5JXEC 2CUHA 3U2SB 1Q9WA 4HV8B 25C8H 3TO2A 5C09D 2HA1A 4WV1B 1OVZA 4PJAE 3SCMB 1AGEB 1SEBA 1T0PB 3HCVA 3U7YH 4GW4A 4P2CG 4WEBH 1JGVL 1H3PL 4OT1L 2QQNL 3B9KC 4WWID 4PJFF 3BPNC 2EKSA 3TLRA 4CU7A 4JFFE 3RZWA 3VGDA 3WFBH 2R2HB 1FL3B 1NCAH 4O2EA 2YK1H 2GJ6D 5D7SL 4K3DL 4YFEA 1OGAA 3F5WA 3H9SB 1TCRA 4F9LA 4ORZC 3VFUA 1NQBA 3KYMB 5EUOB 3RWDA 4QRQB 6FABH 4JAMB 3KPRA 3M45A 4GRMB 4PG2A 3BZ4B 2A74B 3O8XD 3P4LA 3R1GL 2DWEA 2W60B 5DSCB 4NUJB 1BQHG 4KKNA 3NFPA 1NAKL 4XCNB 5JHDB 2IADA 4F7CB 2F5BL 1FNHA 3WLBA 2X4PA 2ATPA 3ARGD 1CBVH 4X6DA 3H0TA 2XN9E 2B4CC 2F19H 3VGAC 3DIFA 2CO6B 1RURH 4X7TA 2BY3A 4TNWK 4LCWE 3MFGB 3FQWA 1I3UA 4I3RH 2UZYB 3VDBA 4AMKL 1P7HL 4FG6D 4JY5L 4OFYD 1A0QL 3UTPD 1NUNB 1L4IA 1AR1C 2DQGL 2G75A 5LWYL 3FAXA 1YMHB 4OM1L 3U4EA 3VXQA 1INQB 1O5DT 1RAMA 3WNKA 4OLXH 1DL7L 2A77L 3RWGA 3UPRA 3V0AC 4JDZA 5J9PA 3PIQA 2ZUXA 5GRUL 5JW4Q 5E2VL 3QIWB 4BK5A 3ZTJH 5TFSH 1P7QD 3TNMB 5IMLB 4WEUD 4HKZB 5F71A 4DKFH 3T77B 1JF1A 1MELA 1OTUD 5L0QB 4OGYL 2DMBA 3EYSH 1U8OB 1L0QA 1JL8A 3A6CH 3FFDB 5E24E 3L7EB 1RZJH 4E41E 5EN2B 4RAVA 1KBGH 4KDTC 4HX1A 3VWKC 4PJ9A 3U46A 3MRBA 4RDQF 3H9SD 5I1LA 4V1DE 4HEME 2ADIA 1X4ZA 1SBSL 3Q6FB 1KJ2H 2DJ4A 4NKQB 4OCMC 1RJYA 1A5FH 5FK9A 2Q8AL 2ZZUT 3F7PC 5I1IL 4GKNA 1MCPL 2FNBA 1MCIA 1G0XA 2MKWA 1T83A 1MLBA 2JJSA 1MCWW 3EIFA 4LAJH 5MEOA 2D0FA 4JHAH 4RAUA 2YHGA 3UJIL 1J18A 2EYTB 3VXRA 5JHDD 1RK0A 3LDBC 3EJYD 3KNBB 3SKOB 4ZUSA 2FIKB 1VFBA 1NAMA 3AXLA 4NN5B 5GJTL 5SWQB 3VFGH 3CVIL 2AXGA 4XB7A 4DGYH 4ZFFB 5BRZE 3Q1SH 1XR8A 1ZHLA 2QSVA 2OP4L 1INDL 1LVEA 3FMGL 4G8GE 4R8WH 2FWOB 3WYRA 2ZCHH 7FABH 4OF3A 4G7YL 5F89B 3CSYA 1ZA6A 3KS0H 4W68A 5GS2D 1CIDA 1Q38A 3K74B 2A9NH 5J1SC 2QQKH 3MRLB 5DRNB 3UTTB 2AEIT 4JM2B 4YC2B 1WZKA 3VCLB 5AD0A 2VH5L 5HDQH 4NJ9L 2VDKH 3QIWD 5F1IB 3UJJL 1CLOL 3MUGA 5FA3A 5I1AB 5KTEL 5SX4I 3WJJA 43C9A 1UM5L 2YSSB 1XCTB 4LARL 4FNLL 4PJBA 2FCBA 2CUMA 3O8XC 4Q9CA 4NSKA 2ZOLB 4WDIA 1XF3B 3O6KH 2VZOA 4IRZH 3LHPL 1KIUA 2XQBH 2GFBA 3Q6GH 4LLVB 5EZLA 4UIKL 3MV9A 4HW6A 4XMKH 1ZLUK 1QQDB 1AI1L 3DX8B 4DVBA 4HK0A 2MPAH 3CCHA 5IFAL 4Z7WF 1FVEB 3N85H 1LE9B 1NLDH 4P9HH 5GRVK 3ULVF 1UQSB 3E2HC 3UYOD 4NZRH 4QHMA 3VXOB 2EDRA 4Q9RL 4IM8A 1U8PB 4GMTH 1E4JA 1ZSDA 2ILLA 4FG6C 4FS0A 1JYWA 5FF6B 3LKOA 1E0OB 1AXTL 1XGPA 1NGWB 1MNUL 3JUZA 1N2RA 3NAAL 4OZ4B 1OF2B 4NC1C 2BRRH 3QT2A 5GRYA 3MFFA 1J88A 4JZJA 4G80B 2BC4A 1ZHNB 2LFGA 2O5ZH 2JELL 2R1YB 3CK0L 2AS5M 2QQLH 4LSDA 5EO9B 1IAOA 4BSVB 2Y07L 3MRPA 1JZ8A 3BD5A 1OM3L 4NCC2 3GMRA 3UDWA 2ZUTA 4M62H 3SQOH 3O2WH 2GK0A 2PXYA 3BYTA 3MUJA 1CFVL 2NY6B 3IDJB 1J9CT 3D85A 5E7FA 1N6VA 1NJ9B 3GHBL 4Z76B 4GOSA 4MA1C 5CSBA 4LLWB 4G8IB 4JM2D 2VQ1A 3KYNA 3LRHA 3TPUB 2W0FB 3OZ9H 1I7RB 3CFDB 1TJHH 4H8WC 3O6FB 2BFVH 2V7HB 5GRJH 1XGTA 2R56H 1UENA 1CFQA 5F96H 4P99A 2MCG1 4QHNB 1HOCA 3LVEA 1JVKA 1D5BA 3MV8B 3HZMA 5FECB 4DUVA 3N1MC 4TVPE 3FTGB 1FC1A 1GPOH 4PRAB 1T22A 3RU8L 3GMQA 3S3JA 4D2NA 3C5JA 4MJIE 4MJ2A 1F2XK 3FFCD 3Q3GB 1YDPB 5AZ2H 2H2PD 4MD5A 4N8VG 4QRSB 4OI9A 2XZAL 4D8PB 3O2VH 4O4YH 1UWGL 1V3LA 5I73C 4K23L 1YN7A 1LO0L 4U1MA 4UDUA 3VFPB 5EC1B 4TSCH 4HBCL 4DKDC 3U7WH 2B7DT 1I75A 3V4PH 2FJGA 5ESAB 3DLQR 2BK8A 4NWUH 1WC7B 2P43B 3O0RL 3T2QA 4XP6L 1F11A 1SYVB 2DD8L 4NQCA 4LLDB 3IAGC 1HE7A 1RPQA 4KAQH 4LSUL 4M6OL 3REVB 1XGRA 3DRTB 1WTGT 2CGRL 4ZUWB 5IV2B 2E9WA 4JDTH 12E8L 1R5WB 1IGYA 1I9JL 3BO8B 5LXGL 2R23B 4PB9L 2BMKB 1NFDA 3BKCL 5IBLC 2DQFA 4UT7L 4RFOH 4OLUH 2WP3O 3U82B 3LKSA 4WO4B 2F58L 5D7IB 2NY6D 1VERA 3QO1A 5I19H 4H25A 2WLYA 1UB6B 3LRSA 4AENB 1X7QA 1KG0B 3HHRB 4KK8D 5IOPB 3BDXA 3BT2L 1U3ZA 5HGBA 4XNYH 5IBTH 2F74A 3O6FD 1FFNA 1AJ7H 4TSAH 4RGMB 3HMXH 1L9NA 4UINL 1G9MH 5T3ZD 3GIZL 2XY1A 3MRKB 2GTWB 1T89C 3G6DH 4J8RB 2VL5B 1CFSB 4I2XE 2B2XH 3BDBA 3HPJA 3MV8D 1CTNA 4HJGA 5DT1H 3V5KA 4CKVX 3FB5A 4I13B 2R29L 1JYXA 4PTUA 1TNMA 4JFEB 5DD1L 5HHMB 5C0GB 5IG7A 4LLUA 2V5SA 1F5WA 4ZFGL 4GG6E 2R1XB 1S5IH 2A83B 1CDHA 5GRZA 5HGDB 3DXAE 4X80H 3T0XA 4DW2L 4N0UA 4DGIH 5CINH 3VI3F 2VXSL 1KTDA 3DX7A 3QDME 4NN5C 2PNDA 3LKRA 4P5TA 5JDJA 3KPLA 4LKXB 2Y5EA 1OB1A 5EU5B 2FGZA 1SM3L 4HT1H 1OCWH 1MCKA 1E6JL 1G7QA 2VDPL 4YHZH 4TNVF 3KYOA 2I27N 4GRWB 1BQUA 4ELKA 5DUBA 2DYPA 2X6MA 4JQVA 2NZIA 4GKZB 5FYKD 3WS6C 1S7QA 5ISZD 1JHTA 4L8CA 3MRIA 4JM2C 4JFYB 4G8FB 5TF1L 4XMPH 5C0DB 1T0MA 2R0LH 4DCQB 1AKJB 1A4JB 4WO4D 1YPZE 1F3RB 2YEZA 4OM0H 1D5MB 5E2WL 3SGEI 2B1AL 2P5WB 3IS1X 4JKPH 1WIPA 2VERN 4X9BA 5DJ2A 1UGNA 2EDJA 4OFKA 2WINA 2DM7A 3W5MA 1HNFA 2CIIA 2EDOA 2FBJH 1EX0A 1CL7I 4JHBA 3ARFC 1FH5L 4X6EA 2YWYA 3BKJL 3KPSA 2X4NA 2H2PC 3VMNA 1KIQA 3QEQB 1IQDA 4PD4J 3CMOL 4LLMA 4YGVB 3WXVH 1W8NA 1NDGA 5BVPH 1JGDB 3IS0X 4Q2ZA 3KLDA 3OR6A 5HI3D 4UI2A 1ZVSA 4HZAA 2B4CH 4PJ5A 4G43B 3OKLA 4GAYB 4HPOH 5I1HL 4M1DL 1K8IB 3SO3C 5EOQL 5HHMD 3DVIA 3F7YA 5CLWA 3GSNH 1F58H 3IETB 2VLKB 5CJQH 1RZ8A 5DO2C 4JB9L 3MNZB 5I6XB 1IEBB 4XBEL 4LVOB 1HNGA 1VADB 1XF4B 1RUAH 2DQJH 4Z0BH 1ND0A 1UA6H 3WL9A 1NGYB 3RDTD 4BQBA 4HS3B 4PY8J 3WUZA 2JIXA 3CDFA 4NPYA 2YKLL 1LO4H 1I8KA 5DEFB 3U1SL 1ZANL 5EOTB 5DD3H 1ZWIA 5DDHA 2X89A 4QRPB 1AD0B 1LO2H 1F8TL 1HHGB 3OKYA 5J89A 3R06B 1VGEL 3D0LA 4KK8C 4UT9L 4N9GB 4XHJD 3E3QC 4IDLA 3QHZH 4DZ8B 1BVKA 3O6FC 4JFOA 3RUGF 3AREA 3IKCB 1RZFH 4LCCA 1A7OL 1BJ8A 1IAIM 4I77L 3RGVB 1UC6A 1WBXA 1LO5B 3U36B 4B5EA 4WUKH 3MR9A 4XC1L 4QTIH 1BVLB 1MWAH 5K9OB 1R3HA 2W0KA 2MWCA 5J6GB 4Y1AD 3TH3T 1KEGL 4YHNA 5K9QI 3C5SB 2DQCL 3IJYB 5FYKU 3QEQD 1OAXL 1RJCA 3QG7H 3WSQL 1J0JA 3WNLA 3JV4A 2LVEA 5BS0E 3TT3H 3MUHL 2BNQE 4HKBB 1RZKH 4KTEL 2AXHA 4HULB 3ZDYF 4PJGF 4O2CA 5MENE 5IVXE 4LSVL 1VPOL 3BPLB 5IVOA 4LMQE 4JEGB 3QFJE 1DUYA 4YDLB 4MAYB 1BZ9A 4Z78A 2N56A 5TE7L 2VLKD 2UVEA 5FDWB 4X98A 3JWOL 1IC5L 1L7TL 1NC2A 1WGOA 3D3VE 1NBVL 4C54A 3F8UB 4AJ0A 1MH5A 2PYEB 1JUFA 2CKBH 1OT2A 4ZSOA 3PDOA 5GRXG 2EECA 3G6JE 1XEDA 5MEPA 2J6EA 1NCTA 4K8RD 2PW2A 4WO4C 4O02L 4KY1L 1QA9A 4NQXA 4BQCA 4K94C 3HAEH 5SWZB 4P5MA 1KACB 2H8PA 3IFNH 4PGDB 4ETQA 4QRPD 3KPOB 2DQEL 4WI5A 5DWUL 4JFDB 4LSTL 4RMTA 4YFDB 3VW3H 4GO6B 1GIGH 5GRVL 5JOPD 4JHZA 1EIBA 5TDOA 1A21A 1KPRA 1SMAA 2DLFL 3MOAL 1MHCB 1MFDL 1H9VA 5E1HB 4TUOA 4RGMC 2LQRA 2AK1H 1D5XB 2WM0A 2ICEA 3QCUL 5HI3C 5I8EB 2UYLB 3D0VA 1P6AB 1JJUA 4KZDH 3TPKA 5F9OH 3RVVD 4I0PB 4MSWB 1NCCL 2PYFB 1A14H 3UYRH 2UV3A 2AW2A 1K8DB 3GMPB 4OF5A 4YPGB 1QUNA 2XA3A 3RDTC 4KRPB 1KN2L 5KS9A 4F7EB 4GRLA 1IE5A 5IVNA 1P9MC 2MQ0A 3QWRD 4JM4L 1GGIL 1ZV5A 3MUZ1 5C0CE 1DEDA 3DVNB 1JZ4A 4MAYD 4K7PL 3QUKA 5KOMC 4M43L 2W9EH 2DI7A 3CZFB 4IIQC 1DQDH 3G5YA 4RDQG 1NC4A 3NTCH 5F72S 2DJSA 2V2XA 1YEGL 3DYOA 4M7JL 4U6XA 3BXNB 4W6XB 4H20H 1OAYL 3OAZK 4OF0A 2WIMA 1HIML 4QCIB 2AKRA 3FQXB 1Z5LA 1F4YL 3ZTNH 4H8WH 4G6KH 1MUJA 4UAOC 4D94A 5ABDE 2ID5A 5SWZD 3UTOA 1T21B 4X9IA 4XPBL 4FFVC 4I8DA 2EYRA 2ATKA 2D31A 3GMNB 4R4FL 2HLAB 4P46D 5DTFB 3KVQA 3W2DL 3VI4E 1CD0A 4GS7C 2EZ0D 3QXDB 4ZDHA 4JPKL 4NGHL 3B9DA 5GGTL 4PJ7E 1MHEA 3ZKXC 3MBXH 2Y1VA 3WHXA 2YA0A 4H5SB 1I1AB 3P9MA 1RZGB 5BO1L 5T3XD 3MOQA 3OJ2C 1VEPA 2IG2L 1RZIA 5CZVL 1B4JH 5GS0C 3MLYH 4PJAB 3KXFE 4YWGL 2L7JA 5GGRY 4RRPA 4LBEB 1XR9B 3KDMB 4I9WD 5KSAB 1ZT7A 3T2PA 5F9DC 2H9GA 2C3WA 4Y4FC 2R69H 4WU7A 3VFVB 4LVOC 3HRPA 2AJYH 3T0DA 3QAZC 4OSUL 2JCCE 5GS2H 2IALA 5MEQA 1LWRA 3CXDL 1UYWL 3MRQA 1I7UA 3NIDF 4E5XB 4X0KB 1WITA 2WIIB 2A6IB 5KANG 3RKPA 4L3AA 4DN4L 2IFFH 5I30H 4K8RC 3G6JF 1FL5A 4S1DD 1WISA 2YPKA 1ROWA 4ZNEE 3D9AL 1XIWD 3T3PE 5B38A 5CJXA 4UTBL 1UZ8A 2WZPD 3RIAF 4XBPB 5D5MB 4LOUD 3ME0A 6CGTA 3OKNA 4OCYH 3RKDC 4KUCD 4F7PB 4DVRH 3CFKB 3C6SA 3KPRE 3S9DB 4NCC1 3DUSB 2OJZL 1KNOA 5CSGA 1YNLH 3LS5H 2LVCA 3SDYH 1TENA 2QKIA 4TVSa 1O7VA 2ZG2A 1N4XL 3TJEH 3TCXA 3TEUA 5FCSH 1E28B 2XKNA 4F9PA 3GMMB 4KJQD 3GSRB 4Z8FL 4ZFZB 4Z5RB 2UUDH 3TIEB 1LEKB 2RGSA 4XNZC 4DEPC 4OZIA 2B5IB 4JKMA 3BZFA 1TZIA 3VH8A 1T5WA 1IBGL 3D5OF 5SWSA 4X6DE 1V3KA 1EAJA 3X3GL 4P2OD 4EDWL 5I8OH 2XIDA 4ODTH 4U1IA 4YX2L 5F88B 3HNVL 3P77B 2QJDA 1PG7L 1I1AD 2F53D 3QCVL 1HYSC 3LV3A 1I8LA 4L4JA 2I24N 4EUPA 3WD5H 5EC2A 2Q6WB 4IMLA 5FV2A 4YDLC 4JKKA 2VWEE 3OX8A 1WK0A 4Y19E 4P49A 1B2WH 1IKFL 1RMFH 5KSAD 3NCBB 1OP3H 5K9KB 3L3GB 3O6LH 2KDGA 5GHWL 5D70H 4G7VL 4WI2A 4U1SB 3QIBA 1J1PL 1M7DA 5I8CB 5J3HD 4FQXA 4HFWB 4ELMB 1K5NA 1X9QA 1G84A 3K2UH 4V1DB 1FYTB 5TH2A 4C58B 2P5ED 1XAUA 2CPCA 5JO5A 2PR4L 3FB8A 4M7LL 2VZ3A 2QSCH 5E94B 3DX6B 4MNQD 3PHQB 5D7LE 3X12A 2GY7B 3MJ6A 2NX5B 4FTVE 4O51B 3FQUB 4ZPTA 5FYLE 5DRWB 5IKCB 4AG4L 3QXVA 4RAHA 4JPWL 2MJWA 5B39A 4Q6YA 4YQXH 1N6QH 4P46C 1OAKH 4WI6A 5BZDA 4H1LH 2DQDH 2DLGA 5I71B 2VXUH 3ROOB 1YUHB 4WY7L 4JJHA 3E8UL 1FZKB 3BPCB 3D39A 2RIKA 3HB3D 1U8HB 3VI4F 1BGXL 4X7EC 2IPKB 4FQIH 4XCCH 2XV6B 5H35B 5GGSB 4XRCB 4GJTB 1U92B 2HH0L 3C8HA 3VXRE 3QEHA 3MLSL 2KZWA 5DA4A 3HRZB 1QP1A 4HWEL 3TA3A 1UVQA 4RQQA 5IT2H 5HYJB 4XVSH 3MCLL 5IUSA 1YQVH 2E6JA 4M9PA 3MNWA 1PY9A 2J8UA 3QJFA 4NO5A 2O61B 4AEEA 1A6AA 3VFOA 3P4MB 4ZO8A 4QXWA 4FZEH 3MA7B 4N0YL 2ZNXA 1S7XA 1RULH 3GSQB 1FRGH 4J3OC 5GSVB 3V5HA 5HHNB 4ODUA 4XP5H 5IB3A 3REWB 4R90H 5FKPB 2B0SH 2W65B 4D0DB 1DEEA 4K9EC 1DQLL 2O26U 5EA0H 3SKJL 4OFIA 4CAGA 2DDQL 1RIHL 1ACYL 1XIWC 5B22A 4X4ZA 4Y2DA 5ACLA 2W59A 2HTLD 4UNVA 4LOUC 2APBA 5GJSL 2L7UA 2AGJH 1TVBA 2DBJA 3RY4A 4KRLB 1FYTD 2BNRB 3U0WL 2VDRH 1FJ1A 5GS1C 3VG9C 2YPLA 4KJWC 3I3DA 3FONA 1M7IA 2JB5H 1K2DA 2NXZB 4QHKI 5T3ZH 3MBED 1CXIA 2NX5D 4M93C 4KJQC 4NRYB 4JO3H 5F9JA 3GGWA 2MCPH 5B21A 3HR5B 3SDAA 1CF8H 3INUL 3MV9E 3NH7H 1T7YA 4U6YA 5LGKA 3RY6A 4L4TA 2HVKB 2IGFL 3IDNB 2JF1A 3PWPB 5A43C 1WEJH 4YPJA 3MLWL 1IL1B 3HUJB 4P2OC 1QSEB 4Y16B 4X6DF 1RFDH 2O5YL 2R0KH 1LP9A 5TGBA 1WBYB 2AVGA 4Z7VB 3D18B 4BKLB 4K3EL 4EVNB 1CT8B 2X4QA 3ARDC 1R24A 8CGTA 2GHWB 1EHAA 1MRDH 4YE4L 5HYJD 5IMMA 3GHEL 4OZHA 1AD9B 4JVPA 3TV3H 4M7LT 2CLVB 4KJYA 2VIRB 1P4LA 4QGYA 1QFHA 2C5DC 2BVPA 3L5JA 2VLJB 5I0ZA 2OMNA 5J3HC 4Q0XH 1GC1H 3CLFH 3RNKA 3MOBH 5EPMB 1CQYA 5E08H 4UV4H 5I16B 5DJXB 4MB5A 3PWVA 3QI9C 2CRIA 5F6HJ 3UC0L 4N5EC 4JFPA 3DV4A 4NNXA 2IH3A 5F6IC 4K94H 3QUZA 1I4FA 3ZTJG 1TIUA 4MNGA 4FFZH 3EDKA 4NHCH 4NFCA 3ARWA 1TETL 5C6PB 5KOVC 4M8QB 1A6ZB 1OLZA 4XH2A 3TWCL 4Z7NE 1P69B 2BNRD 3N1GC 1AY1L 4YBLC 5TPWL 4OD3L 5LCVH 4HFUL 2NY1B 3GKZA 5J12B 1GGCL 4NM4H 1I8MB 1FDLH 4OGXL 3HB3C 3VGEA 5HY9B 1MCFA 1Q94A 2NXZD 5BVJB 3TN0B 1FGNL 4W81A 1NCUA 2B5IC 5EB9A 3HA0A 5IB1A 2OJEA 5CZXD 3VXSB 2KBGA 4F15C 3PWPD 4XTRD 1WV7T 2FX8L 1FHGA 2JTDA 4C57C 4X6CB 2X1WL 1KIRA 2R9HD 5I1CL 1QSED 4BA8A 2PO6A 1S9WA 1BBJA 4JZNA 4KMTH 1Q0XL 2GITB 5HXMA 4NC0B 2BDNL 2ICWA 2E5EA 1IGCL 3A6BH 3IDIB 2FD6H 2G60L 3H7BB 4NC2B 4NQCE 1IEAB 1B3JA 3MROA 3QUMH 5H2BB 4MB3A 4NO0D 3S96B 3IFPA 3IAPA 4WW2A 3SDAC 1ZEAL 3DARA 4YXKH 2NTFB 2VLRE 1BQHB 1KTRL 3HZYA 1NFDE 4N0FA 1MFCH 4U7SA 3S88L 3IJHB 3GBNH 5CUSH 1LDPL 3V4VH 1F6LL 2GJ6A 2HTLC 4WHYG 4OLZL 3ORJA 3OAUL 3M17B 1I3RA 4FHBD 1S7VB 5DMGC 3N1FC 5D93C 5D72H 4KXZI 3DMMB 3QCTL 5CBEA 4ENED 5EBWA 3RI5K 3LEVH 4KH2A 3O6MH 4Z7QE 3PQYA 3KPPB 3MBEC 2CD0A 4PJBF 4LF3A 3ULUL 3EYUH 3L3HA 1MAKA 2FHCA 5IFHH 4GG6B 2DTML 1B6DA 1BWMA 1EVTC 5ETUB 2ZKHH 3ARGA 2NY1D 5ESVA 5T1LB 3K2MC 5KANI 2FJHA 4YXHL 2KPNA 1OSPL 1FG2A 1QLRB 2ZPKH 3HC4L 3QWOA 2P8PA 5D8JL 4XNUH 1ZHKA 3CFEB 5JNYA 3TN0D 3GBLA 5F1SA 2EYSB 5HVFB 3QEGL 2J6EH 5C08A 1QFUL 4LVHC 1IGIL 4Z9KB 3DRQA 2QV2A 1YEEL 5GS0H 1Z6JT 1Q9KA 1AGDA 1FPTH 1ZE3C 5INCA 4YDJB 1TVHA 3QULA 1BPVA 1EMTL 3P4OA 3PWUA 2XXCB 4NQDB 3CC5A 1JHKL 4IBLT 4R26L 5EBLA 2VXQH 1UXSA 3VRIA 5D2NA 1BFVL 5GXBB 3CFCL 4HV8A 4OTXL 1G6VK 1YPZB 1L7IL 4WV1A 3SCMA 1AGEA 4C59B 4D3CH 4EDXB 3BE1L 4Y5VA 4J2XA 1NMAL 2VYRE 4FQHA 2Q86B 2J4WL 2W9DL 3SDXA 4F8QA 3RA7L 2R2HA 1KFAL 1IM3B 3BYYA 1S7WA 1KCSH 1UKTA 3H9SA 3KYMA 1IKNC 2VABB 3I6LE 5ID1B 4QRQA 2Q7NA 3HC0B 4JAMA 4K7PX 3DMMD 4MA3B 3BZ4A 2YA2A 4WFFD 4CADB 4KKLD 3B8YA 4XP1L 1MEXH 2A74A 4PBVC 5CEZH 1A6WL 4ODVL 3KPSE 4LCIH 3SO5A 3KR3L 4RIRA 2IAND 2W60A 3HI6L 5DSCA 2AJXH 2EDTA 4F7CA 2YBRB 5ADOL 1DQQB 2ZUWA 2BSED 4A6YB 3BH9B 2YC1B 5JHLL 2R0ZH 3QRGH 2R9HC 1ZTXH 4XVUC 4JQIL 1U9KA 1FVDB 2A73B 3MRMB 3SE9L 4FQLH 2VXVL 4LNVA 3IDGB 3TP4A 1R3LA 3MLVH 4PV8A 3T3ME 3L6FB 1YMHA 5IESL 1R5VA 3O9WC 3OB0H 1XGYH 3S37L 1INQA 4GMSH 2ESVE 4TPRL 5KVEH 5HGHB 4YXLL 3BI9X 4XZUB 5FYKL 1CLZL 1T3FA 4OCXL 1MQ8A 1S7UB 2Z91B 5DRXA 4NQDD 4LHUG 1OT1A 4UNTA 1A6UL 4UTAL 4Q0XL 1NFDF 3QIWA 2QADB 1J0YA 2GCYB 4BFIB 1IGML 5IMLA 3QG6A 1JN6B 4HKZA 1Z9LA 3T77A 4S1QH 1T7WA 1U6AH 3SGDI 2RB8A 3HKFA 3FFDA 4X7SH 3GMLB 4FQQB 5HYSB 5EN2A 2X2YA 1P84K 4HLJA 5DMIH 5HHVH 4Z7QF 3HS0B 2ICWJ 1KF9B 1FZMB 1AQDB 4LGRB 1LQSR 5D1ZA 4P2RB 3Q6FA 3LZFH 4LASH 4OJFL 5J12C 5BJTB 5EZOH 1I3GH 4JPIB 4ODSL 4PG9B 3H6JA 5IVXB 2IAMB 5K9JH 1QOKA 1I1FB 3RWJB 4MA7H 1MY5A 2O5XL 3T1FB 2UWEB 1QR4A 4ZTPL 3IDYC 5L2KD 1OAQL 3F7VA 4Y5VC 1CVRA 2QSTA 1HHKB 2EIZB 4XVJH 3QDGA 4OLWL 3EO0B 5M7QA 4P4KB 3KNBA 3FCTB 3SKOA 5D1QA 3LPWA 5IJKC 2FIKA 2A6JB 3JV0A 4N8CL 3BEWB 5I1GH 5SWQA 3KPTA 1N7ML 1CWVA 1H3TA 3MRNB 3MJ9L 4ZFFA 4EOWH 3WEXB 5LBSH 1H3XA 4M1GH 3W39B 5E6YA 4IRJB 1LK2B 2WQ8A 1CD1B 4BYHA 2FWOA 5C0JB 1V7ML 2WBJC 2C26A 4C4KO 1GHFL 5J8OA 2BNUA 2EDWA 4XPGH 5F89A 2X7LB 4H0HB 1JWUB 3QUYB 1TVDA 2GK2A 2H32H 4ZSOE 4HWBH 3MRLA 1AE6L 5BXFA 3MLUH 1J87A 1WAAA 5DRNA 1TZGH 3V7AE 3UTTA 1JTOA 4TOYL 1PG7X 1ODAA 1X5HA 2V7NA 3HC3H 2VDLL 5F93C 2DQUH 2QADD 5F1IA 3WO3B 2C4FT 3BP5B 3JV5A 2Q3AA 3I9GL 1MCOH 5I1AA 2ARJQ 3FQNB 4LL9A 5DJ0A 4KKLC 4Y5YC 1XCTA 3P9LA 2ZOLA 2NPLX 1P4IL 1XGQA 5T1KB 4HGKC 4LLVA 3C6LA 4PPTA 1OD9A 1QQDA 1LD9A 4S2SB 3DX8A 1FVEA 3DBXB 3LIZL 1LE9A 1RUKL 2EDNA 1UQSA 2M26A 5E8EA 4CRPA 2F54D 3VXOA 4GLRI 3QQ9D 5TE6H 3K8MA 2GT9B 1DBKL 1YNKH 4GG8A 5K59E 4XNMA 4M4RA 3VXMB 4Z7OF 4G42A 1ACZA 1NGWA 2X1QA 5JXAH 2Z4QB 4OZ4A 1QG3A 4P4KD 5CAYB 5JQHC 3T3MF 4G80A 4PLKC 2Z9TA 1L0XA 2W91A 3ARTA 2AEWA 4M03A 3JWNC 2BXYA 4C4KT 1Q0YL 2R1YA 1QYGH 3ABZA 4OAWB 4TULH 4O9HL 1NUDA 5H94B 4BSVA 3C08H 5B3JE 1QFOA 2VC2H 1YEDB 3HI1B 3FQTB 2BSTA 2VSDA 3L5WA 4OKDA 1YEJH 3QUYD 4K8RL 4ZO7A 1RHHB 5FAAA 4Z76A 4NQUA 1VACB 4KQ3H 4LLWA 5E1AB 1BBDL 4G8IA 4KTDL 4PJIA 2W0FA 3B2VL 3MNVB 1I7RA 5D1QC 4ZS6D 3RX8A 2W0LA 3EOYG 1CE1H 5D7JC 4KQ4H 5ID0B 4AEIL 5ICYA 3RY5A 4RISH 5ERWB 5EZIL 2GYSA 1HN1A 4XWOC 3TVMA 2AEQH 3FTGA 4PRAA 1XGUA 4HWZB 2RR3A 2HKHL 2NY3D 1MAML 1YDPA 3KXFB 2DN7A 1A8JH 4QRSA 1RIUH 3ARPA 2BHUA 2XXMB 1PBYA 1WFTA 1IAKB 3VD7A 4HUWB 5E8NB 3P73B 1KCVL 2J8OA 4XP4H 3VFPA 1B4RA 1X4YA 2NW2B 1B90A 2JCCB 4PS4H 2X70B 5E0QA 4OF8A 2XWJB 5CGMA 4ZFOB 3K1KC 5ESAA 4JG1L 4ODHL 4HGWA 4LDLB 4Q6IB 3VXMD 5C07E 1SYVA 4O2FA 1KCUH 1MRCL 4WI3A 4DQOH 4LLDA 1NCBL 3MLXH 5FGRA 1HH9B 4ZUWA 5IV2A 4UU9B 4N90D 1U8MA 1ZVHA 5EU3A 3NGBB 3BO8A 1HYRC 2IQ9L 4PRDB 4U1HA 4KMQA 4RZCB 3IYLW 4ZUVB 1QTYT 2D03L 1FO0B 2BMKA 3BMVA 5FGCE 2Z8VC 4XXCC 2FX7L 2QADC 5D7IA 4UB0L 3SN6N 5DC4B 1S78C 1F4WH 4XPFL 1NL0L 1JGLH 1R3KB 4OCRL 2PF6A 1UB6A 2C3VB 3MPCA 1TZHA 4RCAA 5DGRA 4J3VA 5J1TC 4OLYL 5F97E 4ALAH 2AJUH 2MQ3A 5DD5H 2X9XA 1W72L 4YHKH 1WCBA 4NWTH 4MAUH 2YD6A 1W0WA 4EXKA 1BZ7B 1DBAH 2AQ1A 4NZTL 4W4OC 4X9HA 3MRKA 2GTWA 1AFVH 1LO3H 4J8RA 4KV5F 1CFSA 4PJHB 1QSFB 3EYOB 2EE3A 4XT1C 4X4MA 3OHXB 3PGDB 5SWSE 1BQLL 4L1HA 4DTGL 4GKSA 1KC5H 4JFEA 5C0GA 4U1NB 3GO1H 2VKWA 4HAGA 2YN5A 5T3XL 3RVUD 2XQYK 2A83A 2NY4C 5C0BE 3FZUD 1JMZA 3T8XB 4P9ML 4Y19B 5IROC 4EBQH 5HGDA 4P4KC 1CCZA 4ONGL 3MJ9A 4GSDH 5FGBA 3JWDL 5AYUL 3NCJH 1DQML 1N5AB 4YBQD 2GSIB 3UJTL 5KS9F 1YY9D 3ILPB 3NIFE 4RSVA 4EKXA 3FQRB 4OZGA 1HQ4A 5B3JF 1N0XH 5F9AC 4PB0H 1R3JA 5F7NC 3SDCB 1MY7A 2YZ8A 4K9EL 3RZCC 1RVFL 3NPSB 3QUYC 1NCWL 4QNPF 2BX5A 3TYGL 1CXFA 4YHOL 3PP4L 3QQNA 1DUZA 4JFYA 3MTRA 4ZS6C 4G8FA 1KTLB 3MV7E 3O4LB 3PNWB 3UTSE 2CJUL 5C0DA 4DCQA 3GI9H 4XAWH 1AKJA 4LSRL 1F45A 2HJKB 3T0AA 3VG0L 1D5MA 1DJSA 2P5WA 5CIPB 1NH6A 3AB0B 4QXGH 4TNWF 1UKSA 2NY7L 3T0WA 4R4ND 5EORH 3T04D 1J8HA 3K4AA 2NY3C 5F3HB 3QNZB 2H1PH 1UWXH 4MXWH 3D39E 1HXYB 3QEQA 1AGBB 4UBDD 4WU5B 4YGVA 4PTTB 1JRHH 1QRNB 1JGDA 2DLTA 1CLCA 5ANMB 1QSFD 1VDGA 3OB8A 4H88H 2CXGA 4YEFA 1MRFH 4Y2OA 5FHAH 1H15B 2YOCA 4GAYA 4WCYL 4JO4H 4U49A 1FCGA 4OB5L 1K8IA 1YYMH 2XPGB 4DAGL 5J56B 5TDNB 4QT5B 2J8UE 3IETA 2VLKA 2AK4D 5D9SA 1S7TB 3WCYA 4NBXB 1BEYH 2DI8A 2X09A 2XT1B 3MNZA 1UCBH 3NCMA 5TQ0L 1W0VB 3HG1A 1IEBA 3IXAB 3GI8L 2ZG1A 1VADA 4ONFL 1NGYA 5DHVB 4HS3A 3NOIA 1OP5H 2XWTB 1BVZA 4YK4C 4WEMB 4HXBL 4XBGB 2MMXA 4EN3B 1KYOK 5EOTA 5IB4B 3SDCD 1KB5B 1SJVA 2FSEB 4DGVH 1AD0A 3EW3B 4LRIC 4JLRA 4D0CA 1KGCD 4BZYA 2RHEA 1CS6A 2QHLA 2VZTA 1RIVH 5I1DB 5CP3A 3VE0B 4JN1L 4D9QD 8FABA 4JG0L 4M6NH 3UAJD 5CD3B 1DSFH 3RJDA 3V6OC 4XNQB 4F3FB 4UUJB 3IKCA 4XP9L 1Y0LB 1VFUA 1MFAH 3RGVA 4LPXA 4U3CA 1LO5A 3U36A 3LSOB 1T03H 1FNGA 1BVLA 3C60B 4L4TE 3T0EB 4OZIF 1ZT1B 1QEWA 5K9OA 3RWCB 5ACZB 5J6GA 2UY7A 1DLFH 4OD1L 3CU7A 3H9HB 1JYVA 3RVUC 4LIQL 3FZUC 1V05A 1M6OB 4Y4HC 3BRGC 2Z35B 1QRND 3RL2B 2V5YA 1IGJB 4WUUB 4Z7UA 5HYFA 4GAFB 3CUPB 1JZ3A 3W11D 1KENH 1FNSH 4LKCB 4OZHE 4P3DB 1XF5B 4LLYA 3PE9A 3QWRA 4YBQC 2YMXH 4YHYB 1PGRB 1YY9C 4KGJA 4JQXA 3OPZL 4MAYA 1A64A 1G6RH 4L8SB 1IC7H 3EFDL 5DZOA 3NIFF 5AWNL 2EH8L 3WNOA 2Y36L 4WFEE 5I1KL 4WGWB 4Y0GA 3HNTL 5CBAA 3DUUB 4PYGA 1FVCB 1DE4B 2PYEA 1T5XB 2HG5B 2AJVH 5IGXH 4XI5D 3B43A 4LPYA 4HZLB 2VUOA 3QFDB 4GAGL 5I1EH 3GSWB 4X4YB 1A7BA 5SWZA 3S37X 4MNGE 5E8DL 1QSZA 3U9UA 4JFDA 1L9MA 4HIEB 3I50H 1W72A 5E00B 1FAIL 3VU2A 4YNYB 2OLDA 5I2IB 4WHTA 4QOKB 3WN5B 2BVOB 1EEYB 1T66C 1MHCA 4HPYH 3TC9A 2IQAB 3BZEB 5LAXB 5C86A 3QDAA 4HH8A 4RGOH 4NJAL 1MPAL 2FO4B 1S9VB 2OX5A 4MJ6B 2UYLA 4NBYB 3EOTH 5E99H 1T2JA 2P8MB 3C60D 3T0ED 5E95B 3W0WB 3DJ9A 1MFBH 3MACL 4I0PA 4MSWA 1F02I 3L1OH 1ZHBA 1CGSH 4ZNCD 3QNYB 1H5BA 1SYSB 4KVNH 4NIKB 3S4SA 2PYFA 5DJAA 2J8UF 2LV4A 4GQ9H 3GUTB 1EEQA 1K8DA 4Z7WB 3PL6D 4WUUD 3AAZA 2FLRT 4YPGA 4ZS7L 2E7LC 1OP9A 3F58H 4HF5L 5C09E 4PRNA 4NQTA 4P0DA 4F7EA 1FNLA 2OSLB 1YC7A 3QRFM 5FUCC 3HMWH 5M94B 1HKFA 3HE6B 1JFQL 5JDSB 1IC4L 3CZFA 3GMOB 3SDDC 3SDCC 1E6OH 2CXKA 1J12A 1R3IH 3EYQD 1SJHB 1DBBH 3P0YH 4J3WA 2GJ6E 3DGGB 3UCRA 4JY4B 3MJ8A 2YRPA 1YECH 2I25N 2XZCL 5CGTA 2FATL 1HQRA 4F58L 4QCIA 1HHIA 3CD4A 3UAJC 4K55A 3T65B 3C2AL 2PW1A 1I7TB 1UXWB 3AU1B 3PQYE 1FBIL 1KEMH 1S8DB 1J05B 1T21A 4M6ML 1T0NB 5DQ9B 4NQEB 1CICB 4UT6H 3GSOB 4LDEB 2EH7L 3GMNA 4JFXB 3WIHL 5HYQB 1KPVB 4ZD3L 4FQJH 5J13C 4QOKD 1KELL 3V6FB 2HLAA 1G0YR 3GJFB 4WFHD 3FHQA 4ZOAA 4DKAA 4ZMAT 5DTFA 2D7OA 2EE2A 4F37K 4QYOB 4FQ2H 3QXDA 1QNZL 1SVCP 4K71B 1A9BB 5KSBA 1FZJB 1LP9F 3UTPE 1BM3H 4I18B 1KCRL 4H5SA 1I1AA 4YO0B 5A2LH 1CD8A 1RZGA 4NZUH 4HK3N 1U95B 1KCLA 4JKWA 3S98A 3WJLC 4PJAA 4OZHF 2C1OB 4L29B 4QTHB 1XR9A 3CH1A 4E0RA 1MQKL 5KSAA 1J1OH 1D6VL 4KU1A 3VFVA 1OAZH 2XWBA 4A2MA 4JFFA 2G5RA 3TT1H 4BUGA 3ULVD 3BQUB 5EU4B 3AY4A 5D7KD 3DOSA 2QHRH 4ZTOH 2XN9D 3AMLA 1CDGA 1T4KA 2F5AL 4KUZL 3MA9H 2E8YA 4XI5C 4NN7B 4E5XA 4X0KA 3EHBD 4ISVB 5CEXB 3S35H 1WSST 5A16A 3TFKD 4GBXB 1FNEB 2CIKB 1I7ZB 1E4KA 4Q7DA 1H8SA 1UJ3A 2I9TB 2CKNA 4L9DA 1PG7W 3MYZA 3H9SE 3O3UN 4TVPL 1H5BC 5GGUB 5J4MA 4F7PA 5EUOE 3ZL4H 4L5FH 4Z95H 2JJTA 3QXUA 1JNLL 5BQ7B 4RMUA 1CR9L 1ZLWK 1A6VL 5GGRB 5IWLC 2XRAH 2LU3A 1JWMB 1Z2KA 4LCWA 3VFWA 3MMEB 1UB5B 1J1XH 3GSRA 4Z5RA 5E5UB 1VEOA 4IHOA 1LEKA 5BV7C 5JHDE 3GK8L 3MODH 3GJEB 4LSSH 2AABH 5LGHH 1A7NL 2OMBA 4OI8A 5EFIB 1A9EA 1W0YT 2ESVB 5BCAA 2H26A 4N1HB 1QHOA 4P23A 3SJVB 2L0DA 3PL6C 1HINL 4P59H 1UADC 4J4PA 3C9NB 3WFHB 3U7AA 3U9PH 2VOTA 1HEZB 1JTTA 5GGVL 5I8KL 3AGVA 1RJLB 3MYJB 3NACH 1T2QL 3DYMA 2XKSA 1MCDA 4RFEB 5K9KA 2WUCH 3L3GA 1AHWC 5LGJB 1A4KA 1MF2L 3EYQC 4QRUB 4U1SA 1BAFH 3BQUD 4MWFA 5I8CA 2DAVA 4X83A 2NCMA 1M05A 4HFWA 4ELMA 4QO1A 3LD8B 4V1DA 1UWEH 1U8IB 2IPTL 2XFXA 1BMGA 4HXAH 5E94A 5J1AB 3DX6A 4G8GD 3PHQA 3BN3B 3BDYL 4WI8A 1KOAA 2E27H 4U6VL 2NX5A 4CVZB 5JA8B 4O51A 3FQUA 3PP3K 1CDBA 4NKIL 1OOAA 2FGWL 5IKCA 5DRWA 1D9KD 1UM4H 2APVA 3VA6A 5JW3H 3GZKA 4NO2B 1KLUB 4B7LA 3J7HA 3GRWH 3ROOA 1YUHA 4C56B 4G5ZH 3WIIH 1UJTA 4JJ5A 4BJLA 1FZKA 3KHOA 2G2RB 1D5IH 4CMHB 5C0RH 1T20B 5BRZA 5FYJU 5H35A 5GGSA 1LILA 4XRCA 5CMAB 1CL7L 3MXWH 1IQWL 4ZAKB 4MA8L 5HYJA 5HGAB 2LTQB 1EAPB 1DVFA 1V8HA 1VB9A 1C1EL 2DQHL 1QSVA 3L3JB 4WHCA 3V7AG 4OLVL 5KVFH 1YEKH 2ERJB 3BFOA 3SJVD 4XPHH 5I1JH 1RK1A 4QHLB 1NDMB 4FZ8L 3GSQA 5GSVA 1Y6MR 3T2NL 4J6RL 2Z92B 5A2JH 4F2MB 3F65A 3T09A 3V0WL 3REWA 5JORB 5FKPA 5DRZB 2W65A 4D0DA 1KLGB 4NRXB 5GISL 5HDOA 5I66B 2B1HL 3SGKA 1P5VA 3FOLB 4FP8L 3LKPB 3TFKC 1WAAE 1OWWA 4FN0A 1ZLWH 3SDXF 1KJ2B 2HLFC 2V5RA 3P11H 4ZUTB 3LQAC 35C8L 3WFDH 3C87A 4YFLI 1JE6A 2WUBL 4X7FC 3UP1A 5DMKB 2BNRA 3ULUE 4QXUH 4HGMA 4EI5A 3I6KB 4U3XA 4M5ZH 4HG4K 4U1KB 3D6GA 3FFCE 2ADFH 4NRYA 1WBZA 4AEHL 3RTQC 2VDML 3HR5A 4R4BB 1X5IA 3O81A 5F7EH 3OJDB 1E4WH 1AH1A 3AC0A 1HH6B 1S9YA 2IBGA 3SPVB 5JLZA 2HVKA 1P84J 3IDNA 2FEDD 4C56D 1CZ8H 1IL1A 3HUJA 2VZVA 3IDXH 5ECJE 3RUGB 1OGTB 1QSEA 1AQKL 4Y16A 4Y4KB 2ZCKH 4AL8L 3OXSB 4A6YL 1WBYA 2JK5B 3CLEH 3AS0A 4OFPA 4IOSD 3VXTB 4X5LA 5L8LB 2SEBB 3G5ZA 4ZODA 5C6TL 3D18A 4EVNA 1JHLL 4ZAKD 1H3GA 3CJJA 1CT8A 2FX9H 3NZHH 3EO1A 5JW4M 1GGYA 5D71H 1T2XA 4B41A 2FR4B 4U31A 2FH6A 3AVEA 4AQOA 1RUMH 2BJML 2I9LB 3GNMH 4LEOB 2VLJA 2FRGP 4PV9A 3CDYA 2IPUG 3LOWA 4IRSD 3T4AA 4PJGB 1UKQA 2RCSL 4S1SH 3BQUC 4F7TB 4PJEB 2H45A 1N64H 2V2TA 2G5BB 5I18L 3PP3H 2M2DA 5ESQB 1I85A 2JB6A 5SV3A 5EPMA 1MIMH 2JJUA 1OW0A 4NN7C 3WLWD 5I16A 3IKKA 1L6ZA 3O3AB 4P2YA 1SQ2N 1BECA 2Z0BA 3E3QE 4KROD 5DUMH 2X42A 2XTJB 4LCYB 3MLRH 3MLZH 3LH2L 2BERA 4RX4D 4M8QA 1A6ZA 3B2UC 3B8SA 1D9KC 5IF0B 5T3ZE 2XY2A 3QPXL 4R2GB 2VZ1A 2XICA 3CMGA 3KHQA 1YYLL 3DVGA 3MV8E 1ED3B 5E6IB 3ULSB 4TSBH 1UEYA 4BFGA 3ZZ1A 1OTSD 5C2BH 4HJJL 2NYYC 1KJ3L 5HY9A 2Y4SA 5BVJA 4RRPG 3TN0A 2Z31A 3WS3B 1WWAX 2Q76A 2DL2A 1M7XA 3VXSA 4WWKB 4Y89A 3PGFH 1K4DB 3BW9A 4X6CA 4Y4KD 1Q9LB 4JY6A 5E56A 2EC8A 3HE7A 1BX2B 3LQZB 4G6ML 5I9QC 1A3RH 4LCUA 5FGCB 3IDIA 4PRPB 3EOAB 1CG9B 3L95B 2EO1A 5FYKE 2DBLL 3H7BA 5B38G 1ITBB 2HT4D 5ISZE 1X6NA 1IEAA 2HFEB 2VUYA 3ESVF 3QDHA 1Q8MA 5E9DD 4IMKA 4NUGH 3HN3A 1U8KB 3TBVB 2R0WH 3VFMB 1WAAF 1QBLL 2JJVA 3DYPA 5FM4A 1WJ3A 5LQBH 5D7IE 3LN4A 4YDVB 1PZ5B 3QDMD 3SY0A 3M17A 4HMDA 4AZ8A 3CGTA 2VO5A 3VH8G 5DVNA 1NLBL 3DMMA 5C0AB 4I2XA 1KJVB 3ULUF 1BP3B 1IGFL 5E5MB 3ARYA 5HVWA 2OQJA 3ALXA 3DETD 4JRYB 4TQEH 1DBJH 5KAQF 5E8PB 2XTJD 3K1DA 2B8OT 1PAMA 2WAHA 3TZVB 4GG6A 5CD5D 1FLRL 9CGTA 3KPQB 4R2GD 2MHAA 5ETUA 1T1WB 3OKKA 4YHLH 1LHZA 1A7QH 2FEEI 2X41A 5E6ID 4KI5E 4EUPG 5T1LA 2E7CA 1MJ8H 5IMKA 2C1PB 4JN2B 3TJHD 5D1XB 3DSFH 3BN9D 4LHUB 3OKMB 4JFEE 5HHME 3O45B 5CJOL 3CFEA 1KXVC 1I85C 1X4XA 1QFWH 4G9FB 4LSQL 4PRHB 1DN0B 1FN4A 2LTQC 5L88L 4WWKD 5HDBE 5HPMA 1JYNA 4I3SL 3SOBL 3TYFA 4CNIB 2XZQH 5ENWB 4YDJA 3UXFA 4AIZB 2ERJC 4OCWL 4IRSC 2XA8L 1GZQB 3P9WB 1XZ0A 4GRWE 3JTSB 3H9YA 3A67L 4PRPD 4ORGA 3CFBB 3VD3A 1IC1A 2I60L 1YPZA 5IBUG 2KQNA 5KVGL 3WLWC 3IU3A 2Z31C 1NGQH 5B39G 2Q86A 5CWSB 2VKXA 3BSZH 1UZ6E 4KROC 3BGMB 1Z9SA 4WI4A 5B8CB 4PJIF 2R4SH 5C0IB 4DZBB 1IM3A 4G9DB 2ITDB 3OG4B 4PGJA 5IHUL 4ZPVB 1EGJH 2P5WE 2VABA 5ID1A 2BVQB 4DJMA 5IW6B 3HC0A 5C0AD 4MA3A 1QBML 4MQXC 4R7DB 4CADA 1OTSC 1YNTB 2I5YL 2ZJSL 4JRYD 2H2SD 1DQTA 5EO0A 1IT9H 3V52L 1P2CA 1IRAY 3QEQE 5FHBL 3LMJL 3TZVD 5BV7H 2YBRA 3QHFL 4KZEH 4A6YA 3BH9A 3O2DA 1Q9OB 2YC1A 2VDNH 4KHTH 3G9AB 4OD2B 5DEGB 3UTZA 3FB7B 5D1XD 4LHUD 4P57B 1FVDA 5EOCH 4HHAB 3MRMA 4L3EB 1TLKA 2VLKE 3GJFK 1U93B 3IDGA 5L2JB 3B9KB 4G9FD 1TQBC 2D7TL 4PRHD 1EHXA 3L6FA 4MCYA 5C0FA 3BPNB 1JNNL 1OARL 2X05A 5KVDL 3S36H 4ZFOL 1F6AB 2VISB 4JDVA 3SQBA 5HGHA 5FXCH 1IM9B 4NQVB 1S7UA 5AUMA 1I9IL 5HHQA 1DDHA 3KJ6L 1S3KH 4NM8L 1PKQE 3DV6B 4BFIA 2APTA 5EIVA 3PGCB 1JN6A 4QRPE 1FO0L 5D7IF 4APQA 2OXHA 4UIMB 3DX9B 4IOIB 4HKXB 3EDJA 3B9EA 1YMMB 3U0TB 5JOPE 3DETC 4HUUA 3X3FL 4NNPH 2KQMA 4LRNH 4ZXBA 3GMLA 5HYSA 3JVGC 1CGWA 1R0AH 1Y6KR 3FO2B 3HS0A 4R97C 3OF6A 3G08B 5CD5C 1GSMA 1TTGA 2AI0H 4KXZH 5E4EC 3GSNB 4P2RA 5BS0A 5E6IC 5CSZB 4ODXA 2EDQA 5BJTA 2HP4A 4JPIA 5FUOL 4PG9A 3D2UB 5MENA 4R7NB 2IAMA 4XVTH 4KI5F 1KN4L 3VMOA 5IVXA 1I1FA 3BN9C 3RWJA 3TESA 4MD4B 2D0GA 3T1FA 4NRZB 1CK0L 5DF0A 5IW1A 1DBML 4NT6A 5DHXB 5DYOB 3EO0A 2YS4A 3EOBB 4JVWA 4WWKC 5EDXA 4BFEA 3FN0L 3V5DB 2A6JA 3EYVA 2C9AA 3D3VA 2GAZB 3P0VH 4HUXA 3BEWA 5HDBF 1A1OB 3NFSL 5IHZB 3MRNA 5GZNC 2D9QB 5DK2A 3W39A 4IRJA 2YUWA 5DS8A 3M1BA 1LK2A 4OZGF 1CD1A 3B9KD 4L9LC 3MO1A 5C0JA 4ERSH 4MDIB 3ARSA 5A2IH 4YUEL 2VSCA 2Y9RT 3AM8A 2PYEE 3I2CL 3C5ZC 3LS4L 3P30H 1JWUA 2BP3A 3VWKB 5DLMH 1G7PB 1ORQA 4I48B 2AJSH 1IM9D 3UBXI 1MJUL 4Y5XB 1LK3L 5EU6B 2HT2C 1QO3A 3FT4B 3LQAH 4KGLA 4GW1B 1WT5C 1MWAB 3D48R 5SWZE 2YPVH 3BP5A 4F57H 2AEPL 5ALCH 5A2KH 3HI5L 3HCVB 1NMCC 4GW4B 2HN7B 1KYOJ 1OD7A 5C0CD 1YMMD 2VDOH 3LDBB 3QDJB 2H2SC 2C7UA 4TUKL 1YEHH 2EKSB 3HFMH 1FL6B 2ORBH 3N9GL 4EZMA 5T1KA 3TZVC 5CHNA 1PQZB 1YEIL 3GBML 1OGAB 1TCRB 4S2SA 3VFUB 4XWGL 3RPIB 4TRPH 4FABH 4FQ1L 5T3XE 1N5YH 3D2UD 1WUNT 4IS6B 4O58L 2R4RL 2DWEB 3VWJD 1EJOH 4I9WE 4Q74A 2CKBB 3ELAT 1JZ7A 3FO1B 1FAKT 4GAJH 4HIJB 2IADB 1LE5A 2FB4L 1SEQL 3WLBB 2JKXA 5J57B 3LEXB 1IGTB 3DIFB 4X7TB 4XC3L 3HAEB 4PUBH 5H94A 5DUPL 4YHMH 3FQWB 1BD2D 1OPGL 1FZOB 4B53A 1YEDA 3CH8A 3HI1A 1TITA 3WKMH 2VLME 3FQTA 2DKUA 3M8OH 3PHOB 3OKOB 2G75B 3O8XB 2PTTB 5DJ6B 1CFNA 4OUUA 1RI8A 1VESA 3VXQB 3L3KA 5CILH 5TQ2H 1MREL 1RHHA 4MZ3A 4J3UA 3JV6B 5EWIH 3Q2CA 3UPRB 1VACA 1C5BH 1KB5L 1PSKL 1FFPB 4L4VB 4JDZB 3BP4B 5B8CC 4HDIB 3MNVA 5EU6D 2OYPA 2R8SH 5MP6H 2W07A 3ISWA 2CUIA 5IR1B 1O7SA 4AY0A 1U3HC 5ID0A 2UZIL 4LQFH 5ERWA 4PJ7A 4BK4A 2YD9A 5I0DA 2A38A 1Q72L 3QDJD 1A7RH 1QKZL 2HRPH 4LEXH 4HWZA 4RBPK 1BFSA 1FCCA 4UDTB 4HIXL 3KXFA 1NGPH 4HX1B 4BUHA 4PJ9B 2A1WL 3U46B 1OGAD 3BGFC 1MCRA 1JI2A 4N0CC 5I1LB 1IAKA 3VJ6B 4HEPG 2HFGL 5E8NA 3P73A 2VZSA 3VXPB 3T0VA 3TBTA 4M5YH 4HQQL 4Z7UF 4G3YL 3HNSH 4P4RB 4LU5H 2R39A 5ILTH 2JCCA 2J1KA 4WJ5B 1TJIH 1MFEH 1P7QB 3NABL 2OTPA 4ZFOA 1GAFL 4WTXA 1CLYL 1AXIB 4HCRL 4Q6IA 1J5OH 4LP5A 4JHWH 2XG4A 1XMWA 4MA1B 3FT3B 2XKUA 4WHDA 1MVFA 2N7AA 3H42H 4ZNEA 1I9RH 3TCLA 3RI5F 1VFBB 4XPAL 1HH9A 4UU9A 1DFBH 4K3JL 2AXGB 4PRDA 4ZUVA 3EAKA 4W6YB 3NZ8A 1ZHLB 3CFJB 4CGTA 4JR9H 1EEZA 4RFNB 2ZUQC 3TO4A 4QY8B 2EIDA 3FL7A 5E2TL 3WFCL 5HHPB 1F90H 1R3KA 1EZVY 3CSYB 1ZA6B 2V17H 5D5ME 2C3VA 1S5HA 3ROLA 4YIQB 1GZPA 1EFXB 3MXVH 5I73B 4L4VD 5I17B 1ZKAA 5L6YH 1SY6L 5AD0B 1YJDL 4MXVF 1FGVH 1UH4A 1BZ7A 4JZOB 1FIGL 1K3IA 4PJHA 3EYOA 3BJLA 3QYCA 4LIQE 5ADPH 1GH7A 3OHXA 3PGDA 3ZLQC 5DJDB 2QSQA 4PJBB 4N9OB 3OMZA 4U1NA 3QXWA 1QLEH 3VWJC 3UPCA 4QKXB 1RZ7H 4XX1G 1QR1A 2GTZB 2OL3H 5L7XL 4PJ9D 1S9XA 4Y19A 3T8XA 4PRBB 5FYLD 5I15H 1MHPH 5DXWA 3K4ZA 2CDEB 1WWBX 4HK0B 3CCHB 4GLRH 5ICZB 3LKNB 4JFZL 5DHYB 5MHSD 2DS4A 1RUPL 4QHMB 2GSIA 2DM2A 3ILPA 3Q48A 3EO9L 1ZSDB 3ULVL 3FQRA 2LU4A 2CMRH 3H3PL 5FYJL 4ETYA 1A6TA 4MMXC 5TE4L 1EO8H 1V3MA 1WIUA 1MJ7L 5D7LA 5JUEH 2VITB 3MFFB 4FTVA 2AERT 2CK0H 2BC4B 3RWIB 4KTYA 4ELME 4M8VA 4S1RH 1FYTE 4Y5XC 2OK0L 2BVYA 2NY0C 2OR9L 4P2QB 3TNNB 5IVZA 4UV7L 3O4LA 3PNWA 5DQDH 1G7LB 4J23A 3MGTB 4RBPH 2VJXA 1ADQH 4PGBB 5D2LB 2NX5E 2OM5A 5CIPA 1W8OA 2NY5L 1FE8H 1X5YA 5T33H 2BY2A 2D7NA 2D7PA 1EFXD 4JO1H 1RZKC 5F3HA 3QNZA 4OIIH 1GGBH 3U4BL 4Z77B 1HXYA 1AGBA 1U58B 1WZ1H 7CGTA 1T1ZA 1XGTB 4WU5A 1RUQL 1X5ZA 3QSKB 4PTTA 1J86A 4F9LC 1CFQB 1QRNA 1KJMB 5KSBF 3KYKL 1HOCB 3BH8A 4Q9QL 1G9NC 5F8QC 5ANMA 1MJJB 4JPVH 1D5BB 1EH9A 3NCYP 2OZ4H 3HZMB 4PG2C 4YZFE 1JPSL 5HYJE 1F13A 1H15A 4OFVA 3QIUA 5T1DL 1PLGL 3CVHH 3KGRA 1Z9OA 2XPGA 5TDNA 3K80A 4WHYH 4DFHA 4BM7A 3NCFB 1H3WM 1S7TA 1U3YA 3D25A 4PJAF 5DFVC 5DJZB 1W0VA 3MV9D 3IXAA 2Y06H 1HHHA 4BQ8A 5IBLD 1YN7B 5JMOC 5T5FH 1Q1JL 5BMFH 1YEFL 4UDUB 5JZ7C 5DHVA 1Z3GH 4NKOA 2BY1A 3MV01 2XWTA 2CLZA 3THML 2FJGB 4JGUA 3MGAA 5KAQG 1S7SB 4X4XB 4LSPH 4QXTB 2AJZB 2CLRB 5M95B 4EN3A 4K2UH 2FZ3B 5E2UH 5FUZH 3NFNA 4H1LB 5C0EB 3ARFB 5JIIA 4P3CL 1KB5A 3CDGA 2FSEA 3FFCB 1HZHH 2XZZA 4I0KA 1F3JA 4M48H 4IDJL 5HYEA 4D9LH 4NOBA 5DR5L 4ZYKA 4R0LA 2PN5A 2BNRE 5I1DA 1JNHA 3VE0A 3MRDA 4G6JH 4P2QD 5CD3A 4HMEA 2H6PA 1MCQA 4XNXL 1A7PL 3BKML 4XNQA 4F3FA 1Y0LA 2Q87A 1HHJB 2PXYD 3SO3B 2N7BA 4OCSL 2EO9A 1L0YA 2CDFA 3LSOA 2P7TB 1X7QB 2VN4A 3EZ8A 3T0EA 3T08A 2BSRB 1ZT1A 2HKFH 4UILH 5I75C 3RWCA 3S6CA 3PWPE 4KJPD 2GSGA 4XGZB 3UO1L 3HUJE 1QSEE 3H9HA 5HGBB 3S34L 1GCFA 2F74B 5FCUH 4B7IA 1FFNB 1C5CL 4FMKA 4PJ9C 4FQCL 1S7RB 3Q5OA 1UACL 1M6OA 4I4WB 4OQTH 5EIIB 4Z7VE 4F7MB 2A9MH 1IGJA 4WUUA 3R8BB 3CUPA 1U2HA 4HCRA 25C8L 4LKCA 2AAVA 3IRPX 4P3DA 3U7YL 4PTUB 1T83C 4WEBL 2JJSC 4QF1B 5C7XH 4L8SA 2HRLA 4XB8A 3NIGE 1TQCC 2DIBA 3P2TA 2VLJE 5ICXB 3ZYOA 3WFBL 4MDJA 1NCAL 2YK1L 1FVCA 1DE4A 1T5XA 3DX7B 4ODBD 1NMBH 2HG5A 6FABL 1OB1B 4ELMF 3QUXA 2DQTH 3PABA 2VDQH 3O2DH 3OR7B 1JRHI 4HZLA 5IEHB 1EO7A 3QFDA 4RFNC 5K33A 1G7QB 3GSWA 4K7FA 2DYPB 4FMFA 1JGEA 1X5LA 1OAUH 3ARFD 4MD0A 3U0PB 1JPST 1SY6A 1JHTB 4N8PA 1FNAA 1YZZA 4HIEA 1CXLA 5E00A 2EE6A 1J8KA 1RD6A 4XCFH 4YNYA 5I2IA 4NP4H 4QOKA 3WN5A 1CBVL 2BVOA 1EEYA 3ZSSA 4WNQA 15C8H 3BKYH 2F19L 4HIIA 1RURL 2R2BB 1ZLVH 1CXHA 2V5MA 3WXWH 2IQAA 4I3RL 3BZEA 5LAXA 2EDHA 1JPFA 2MTPA 5GIRA 1BLNA 1E4XH 1S9VA 4MJ6A 4HG4J 3TF7C 5DJ2B 3WJJC 5F7FA 5DO2D 3VXSE 3W0WA 4M3JA 5CCKH 5ISZB 3LEYH 4YZFF 4K3HA 4OLXL 4X6CE 1TDQA 2IFGA 1AIFB 1SYSA 1TJGH 4JKLA 1PKOA 4NYLB 5IB2B 3GUTA 1DANT 1NDGB 2VLRA 1F4XH 1I8IA 2HMID 3JXAA 2WWMC 5DC9B 5TFSL 4PJ5B 2OSLA 5IQ9B 1N6UA 4DKFL 3OKLB 5EUKB 2HFFB 3DTXB 4KK5D 5AZEH 2W1NA 3HE6A 4KPHH 3EYSL 3A6CL 4ODWB 1RZ8B 1RZJL 4QHKJ 3GMOA 3OGOE 5ALBH 1KBGL 3IF1B 5CJBA 4JZJC 3DGGA 4JY4A 3WL9B 1U8JB 2IF7A 2D7MA 3V4UH 2DQIH 1FORH 2JIXB 1KJ2L 2P47B 1A5FL 3VA2C 5L9DH 4WFFE 3HZKA 4OGAC 3C8KB 4RMSA 3UDWC 1I7TA 1U8NB 43CAB 1UXWA 3EZJB 3AU1A 4CW1B 4TUJA 4DN3H 2DYPD 2PXYC 2ED8A 5DQ9A 4NQEA 1ZWIB 4BZ2H 5DDHB 4JHAL 2Q8BH 1NEZA 4WFGD 1CICA 3JZ7A 3GSOA 4JFXA 5HYQA 3SE8H 5C6WH 1KPVA 4HC1H 2D4FA 3V6FA 4CN4A 3D0LB 3GJFA 3C2SA 2NZ9D 4KJPC 3MRRA 2LE9A 4QYOA 5MI0C 3LN9A 3VFGL 5KW9H 1OQOA 3RDTB 4DGYL 1HKLH 3HUJF 4X99A 3Q1SL 4GW5A 1NBYA 1A9BA 2WV3A 1FZJA 4LCCB 3RAJH 1G1CA 3QUMB 2Y6SC 1URLA 1CE6B 1EDQA 3IFLH 3L5XH 4I18A 4R8WL 1WBXB 2ZCHL 5IMOA 7FABL 3SBWA 1JGUH 4IIQB 4QWWC 3GSUB 3DO7B 5C70A 3QZWA 2M1KA 4PP1C 4YHNB 2A9NL 2QQKL 5CEYB 4L29A 4QTHA 2VL4A 3FO0H 3FB6B 4B0MM 5KJRH 2PUQT 2VB5A 5DVKA 3B9VA 1KUMA 3QH3B 2ZCLH 4NQDE 5HDQL 1PFCA 5FOJA 5FO7B 1ZS8B 3NA9H 3NIGF 2VDKL 4LNRB 5EU4A 5K93A 5D6DA 1HILA 4UAOB 3RWEB 4PJ5D 2CRMA 1IAIH 4M7KH 2VXTH 3KPMB 4ISVA 1DUYB 1BZ9B 3BUYB 1R5IB 2J3SA 1SBBA 4GBXA 1DCLA 4POUB 3O6KL 2CIKA 4Y1AB 1I7ZA 4IRZL 1RU9H 5JR1H 3EDEA 1NEUA 3DROB 5EOCJ 2XQBL 3Q6GL 4GS7B 2I9TA 1C08B 4FXKB 4XMKL 1JUFB 4FFWD 2JIXD 4DK3A 2MPAL 3ZT6A 3ZKXB 5JOFA 3UTQB 3PDOB 3N85L 5F1NB 3EFFB 1NLDL 4P9HL 3WIFB 4NZRL 5GGRA 3OXRB 4LQ1A 4GMTL 3PWNA 1JWMA 1XF1A 1QA9B 4NQXB 5L2KE 4L8BB 3ECBB 4IOFC 2X89D 4ETQB 1NSNH 1V7NH 3LY6A 3JSSA 1NGXA 2BRRL 3IU4H 4Y4FB 2J88H 1I1YB 1VSCA 5FB8B 5DFTA 5TDOB 5EFIA 2O5ZL 3QAZB 5DJ8B 1BQSA 2ESVA 1VEMA 2F15A 2QQLL 4X6CF 4FFYH 5JPMB 1CGTA 1VKXA 3SJVA 2F8VA 4HS8H 5I76B 2WMPA 2HMIC 3MRGA 4M62L 3SQOL 3WFHA 3NN8B 5DD0H 3O2WL 3RBGA 4CN1A 5H8DA 1HEZA 1PKQB 3RL1B 2HWZH 4KK5C 3MYJA 2FDBP 4WI9A 3RIFF 3QO0A 4RFEA 2C4FU 3SE4A 3OZ9L 2FHFA 1TJHL 3ARBA 5LGJA 2BFVL 5GRJL 4BZ1H 3S97C 4B50A 2R56L 4FXGB 5F96L 1GXEA 4P5TC 4HSQA 1CIUA 2NY2C 5KS9B 3B6SB 4FFVD 1HSAB 4XNZB 4DEPB 3UBXB 1U8IA 1GPOL 3QUKB 5ITBH 5C71A 4JQVC 1MLCB 4GT7A 1MCNA 3G5YB 1V5JA 1NC2D 2C3GA 5AZ2L 5HTSA 4O5LH 4AM0B 2VAAB 4PJCB 4KHXH 4ONHA 3GSVB 3O2VL 4O4YL 4Z0XA 5C3LD 4GG6F 4P2RE 1INEH 5TF0A 2NZ9C 1KLUA 4XPTH 5IQ7H 2P4AB 4C56A 5HJ3B 1VFAB 4E42B 4TSCL 2X4SB 3U7WL 3V4PL 2G2RA 1JPGA 4OBSA 1T20A 3JUYA 2IH1B 2UWEE 3FN9A 5GS0D 4NWUL 4LVNB 1G9NH 5CMAA 4AK1A 2EYRB 4MCZA 1P4BH 4KVCH 4ZAKA 5JQ6H 2D31B 1BHGA 4Y4FD 5HGAA 3ZYIA 4N0RA 4KAQL 1CFTA 3V0VA 1JI1A 4JDTL 3L3JA 4RWYH 1AGCA 1GC1C 4DWHA 3WHE1 3TBSA 3MCKB 1MHEB 4QHLA 4RFOL 4OLUL 3CSGA 5HHXH 3P9MB 2RFXB 3SGJA 5I19L 1N3NB 1KLGA 1YPZF 2Q3ZA 3DHMA 4XMLH 3FOLA 3L3IA 1X5JA 3LKPA 3RKDD 1OSZB 4P46B 4XNYL 5IBTL 1KJ2A 1F3DH 1KTKE 4LFHG 4ZUTA 4F33A 1AJ7L 4TSAL 4YDKH 1UM6H 3G6AB 3HMXL 3VMPA 3QR2A 1G9ML 4PP2B 5CEZD 4FFWC 5T1MB 4PLOB 1ZXQA 3MRCB 3G6DL 4GRLD 5C8JB 5DMKA 2B2XL 1KB9J 5DT1L 3I6KA 1FSKB 4U1GC 1KT2B 4KK6D 4U1KA 1FL5B 1KIPB 3I6GB 3S4SG 1NC4D 5EH1A 1S5IL 3SE3A 1RJZA 3H3KA 4XXDB 5B38B 1XH3B 4R4BA 4POYA 1UZ8B 4X80L 2UUDK 1YA5A 3RX5A 4DGIL 1HH6A 2GIYA 3SPVA 5CKAA 5CINL 4LAQH 2E9BA 5GRWA 4HWNA 1K85A 4Y4KA 3OAYH 1HYSD 2KZ1B 1ZLSH 2ZNWA 3OXSA 4XAKE 1G7MA 2JK5A 3AREC 5FYLH 3IVKB 4LCCC 4HT1L 1OCWL 3VXTA 2SEBA 1H8OA 2VN7A 3V7MA 3VXME 3WDJA 4EQ3A 4YHZL 5CJ5A 2H32B 3VD4A 4U1LB 1T1XB 1BOGA 5HSFA 3BZFB 3S8WA 1U91A 3L7FB 1XIWB 4Y7MA 2F9BT 2FR4A 1XCQA 3L3OA 4PJ8A 4N90E 3N0PB 3VXNA 1RQ5A 1X6LA 2I9LA 4U1IB 3O3BA 4XMPL 5GS1B 1OP3K 4PJGA 3VG9B 2R0LL 1IFHH 2UVFA 1MIEH 3X11A 4PJEA 5KG9B 1NAMH 3L3DB 3WFEH 4OM0L 2G5BA 4JO2H 3RVXC 4JKPL 4PRIB 4EUPB 4M93B 1A3LH 2FBJL 3O3AA 2Y7QB 1EHLH 4PJDB 4U0RC 4YAQA 4LCYA 3CZJA 4P2OB 1JF5A 2VAJA 3WXVL 3I02B 5IF0A 1JPTH 2M8XA 3FJTA 3T4YB 1FFOA 5BVPL 4OZFA 4YDIH 1K5NB 5J6HA 3ULSA 2B4CL 2F53B 4HPOL 5FO9A 5JO5B 3ARDB 1N59B 3VFRB 1GRWA 3GKWH 2X1PA 2GJZA 5IVXF 3GSNL 1F58L 3X12B 2YUXA 1O0VA 5CJQL 4GXVH 5GGQH 2R1WB 3WUWB 1Z0MA 5IBUB 5C07A 5BOPA 4MHHG 4HS6A 1NCDH 1RUAL 2DQJL 4Z0BL 1UA6L 1K4DA 3BAEH 4ONOA 3TH4T 3BESR 5IB5A 1Q9LA 1LO4L 1NFIB 1K6QH 4CJ1A 2P5EB 1MCHA 3K46A 3QI9B 1CU4H 3QEHB 4PRPA 4NHUB 1CG9A 3L95A 5DD3L 4MNQB 1SVZA 3TA3B 1UVQB 4RQQB 5F6IB 5SWSD 1LO2L 3CX5J 3W9EB 2HFEA 3VDCA 3QEUA 2FH8A 2PTVA 2D3VA 3IGAA 3MSPA 3VFOB 3QHZL 3TBVA 3VFNA 3VFMA 3FRUB 4YBLB 4KJWD 1RZFL 2QL1A 4YDVA 1PZ5A 2NXYB 4GRLC 5IB3B 4PRID 4F37F 5DQJB 4WUKL 2DF3A 4QTIL 2CRYA 5FM8A 1MWAL 5E5MA 4J1UB 4KK6C 1QFWM 5C3TA 2P48B 1K4CB 1JGVH 1H3PH 4OT1H 5DI8B 2QQNH 5CGYD 4F15B 1ZA3B 1JV5B 2X4TB 1JBJA 1ONQB 4PJ8C 1VFOA 3QG7L 4H26B 3AUVA 3QIBD 1P53A 3TT3L 5C0BA 2N1KA 3KPQA 4FQXD 5D7SH 1RZKL 1TVBB 1T1WA 4K3DH 4PJHE 1QSFE 2YPLB 2C1PA 4JN2A 2BOBA 4PJXE 3KWWA 4YHPB 1M7IB 3ARDD 5D1XA 3VFSB 1WZMA 4NFDA 3OKMA 3O45A 5JIKA 1F4AA 1AC6A 1EPFA 4LVNC 4WTWA 5FFLA 3GGWB 3UZEA 3R1GH 1MCCA 4G9FA 3SDAB 4PRHA 1DN0A 4AH2A 5IFJA 1U36A 1NAKH 5AAWA 3BJ91 2F5BH 4D0BB 1HI6B 1MSPA 4KKBD 5BW7A 1A3QA 2CKBL 3O41B 4CNIA 5FO8B 5EU7C 5FM5M 3T2OA 5D93B 2BSSB 3O11B 3QPQD 3U30C 3MV7A 4AMKH 4DFIA 2YD5A 3QI9D 4DUWA 3JTSA 3UTSA 4JY5H 1A0QH 4N5ED 5CLTA 1NANI 2X4QB 3EJZD 4GXUM 1R24B 3IFNL 3TA3D 4CDGC 3MBEB 1EFQA 2DQGH 5LWYH 1DQJA 1KGCE 4OM1H 3VW3L 3G5VB 3HMXA 1GIGL 1DL7H 2A77H 4D9QE 2HTKC 3BGMA 3MRHB 3O4LE 4MS8D 4DZBA 3KS0J 1TXKA 4G9DA 5CS7A 2ITDA 4JCLA 2AK1L 3BD4A 4HLZH 5GRUH 2NXYD 5E2VH 4DKEH 5IW6A 2UZXB 2APFA 3GIVA 1FSKC 5IW3A 4JREC 4PJ7F 4N5UA 4R7DA 3PWVB 4KZDL 4LVHB 5F9OL 2P45B 4OGYH 4JFPB 3DV4B 3ZE0E 4NNXB 4TTDC 2DI9A 3BVNA 4KRNA 1I4FB 1TMCB 5CJXC 1A14L 2RAMA 3UYRL 4KWUA 1QRNE 1P7KB 1Q9OA 5ANME 4OD2A 2DOCA 1H0DA 2YPLD 4A2LA 1SBSH 5JXEA 2Q8AH 5I1IH 5ITFA 1MCPH 4P57A 2JCCF 4HHAA 4L3EA 2OTWA 4F9PC 1XFPA 4U0QB 1U93A 2W9EL 5L2JA 3B9KA 3SDAD 1DQDL 3NTCL 5C9JB 5IB1B 3UJIH 2ZSWA 2A6KA 1WWCA 2KH2B 4OUOA 4H20L 3PWLB 1MAJA 1KIRB 3T3PF 4P5KB 5HVHB 1IM9A 4NQVA 1S9WB 5GJTH 3ZTNL 5DMGD 3CVIH 3S5LB 4H8WL 4G6KL 1F42A 3VXUB 3F7RA 2H41A 2OP4H 1I8LC 1INDH 3DV6A 3FMGH 3JWOC 3PGCA 3EUUA 2AJ3B 4UIMA 2JLLA 3J8F7 2LAAA 3DX9A 4G7YH 4HKXA 4G8EA 1YN6A 3RP1A 1QFWI 3U0TA 5GGTA 5CGYC 4KKAC 3HZVB 3DURA 4POZD 4M9OA 4N0FB 2ENYA 2VH5H 3QIBC 3G08A 3GSXA 5MERA 3MBXL 4FQXC 4NJ9H 5EZJA 4UQ2A 4WTZA 5IIEB 2VLLA 3GSNA 5CSZA 3UJJH 5KZCB 4PY7A 1CLOH 3T0EE 5KTEH 4PJHF 4R7NA 5EBWB 4QLRA 1UM5H 4MD4A 1B4JL 5FIEA 3MLYL 5GZOC 2EIEA 4LARH 4NRZA 3O9WB 4FNLH 4NO0B 1FC2D 2R2EB 1QHPA 2FYYB 2R69L 3LHPH 5DYOA 3FT2B 3FAWA 3EOBA 4UIKH 4WUUE 5CP7B 2AJYL 2DLHA 4LPVA 4KKBC 3V5DA 1AI1H 2GAZA 3SKUD 4CU6A 5IFAH 5AG9A 2FJHB 5IHZA 2MOVA 3QWOB 3NBNA 2P8PB 2J5LC 4Q9RH 3QPQC 2IFFL 5EBGA 5I30L 3ZDXE 3U6RA 1RHFA 3OJMB 4I3GA 5DC0A 2H3NB 1AXTH 3EJZC 3TA3C 3PV6B 1MNUH 3NAAH 1KSRA 3DRQB 2CR3A 4KDTA 3VWKA 3WBDA 4OCYL 1G7PA 2A0LD 4I48A 4DVRL 1AGDB 3HLAB 2V9RA 5INCB 2PO6D 3RBSA 1TVHB 3QULB 3CK0H 3P4OB 4NBZB 4HMCA 1YNLL 3LS5L 3CC5B 3SDYL 3VXUD 4MS8C 1WIOA 1WF5A 2Y07H 5EBLB 4GW1A 3VRIB 3TJEL 5D2NB 1MWAA 1OM3H 2NXYC 4ZUUA 5INDB 3B5TA 1GYAA 1CFVH 3IDYB 4OQ1A 3R0MA 2HN7A 4Y5VB 5FOBB 2X4RA 3WE6B 4FQHB 4QOKE 4WFHE 3QDJA 1ZGLP 3RNQA 3SDXB 3GHBH 3OL2A 1FL6A 5I8OL 4HIHB 4Y2DC 3IDMB 3ZE0F 4XVUD 4ODTL 4CUCA 1PQZA 1S7WB 3SKMB 3RQ3A 3RPIA 2XTLA 1G6RB 1UFUA 5KZCD 3O3EA 3W0WE 3WD5L 2K7QA 4BH8B 2WBJB 4IS6A 5C09A 1FIEA 3ZKMD 3MLTB 3O9WD 3PQYD 3IXTB 3RU8H 1B2WL 4RIRB 1RMFL 4NCDA 2CKBA 4QRRB 1YY8B 3FO1A 4HIJA 3O6LL 2QQQA 4NKDB 3B3IB 5D70L 3RY6C 4Z7WE 2XZAH 3ULVE 2IPUK 2DTSA 5D7KE 3LEXA 1UWGH 1IGTA 5FYJE 3OB0K 4K23H 1LO0H 5JA9A 3K2UL 3HAEA 4YHIB 4HBCH 2NNAA 4GQPH 3TBWB 4FOMA 1FZOA 2QSCL 2WWKO 4Y5YB 1C7TA 4C55A 3PHOA 1R3LB 4PV8B 1MCEA 3OKOA 3O8XA 2EE9A 2PTTA 5DJ6A 5C08D 3O0RH 4MHHI 4XP6H 2D0HA 4X6BB 2AV1A 1R5VB 2DD8H 2IANB 4KMLB 5HPOA 1Y18B 3QWQB 4YQXL 1N6QL 4M6OH 1OAKL 3JV6A 4LSUH 1I1RA 1KCKA 2DQDL 4Y8AA 2CGRH 1T3FB 2VXUL 1FFPA 12E8H 4L4VA 4OF7A 3BP4A 3OGCA 4HDIA 4POZC 1I9JH 5DRXB 4PREB 5LXGH 4FA8A 2OI9B 4PB9H 4FQIL 4XCCL 4NKMB 5IM7A 5IR1A 3BKCH 4DKEL 4UT7H 4D9RD 3BUTA 4NQEE 4RGNB 3BZDA 1UG9A 2ICES 2F58H 3QG6B 3SCMD 4OFYA 4HUVB 1WFUA 5IT2L 2ZUSA 4MZ2A 4XVSL 4QEGA 1OLLA 1YQVL 5L8JB 4U7KA 4UDTA 3QUZC 3VGBA 1D6EB 3BT2H 3PJSA 1BFTA 4FZEL 3VJ6A 1RULL 5D1ZB 1FRGL 3P4NB 4UINH 3VXPA 3VDAA 3GIZH 4OF6A 5FA4A 4P4RA 4XP5L 4R90L 1GOGA 3U2SA 2F8XC 2B0SL 2WBJD 4WJ5A 2FECL 1P7QA 4J3TA 2R29H 1B0WA 5DD1H 5EA0L 3F7VB 3LPGA 3BHBB 4QRRD 3ZDZE 3QDGB 4ZFGH 4PLNC 3FT3A 3ZDXF 3KLSA 1HWHB 2BOCB 3TBYB 3MJ7B 5D1QB 2WWKT 4DW2H 1FL3A 5C0ND 1UH2A 2A0LC 2AGJL 5D7JB 1AGFB 5HVHC 2VXSH 2VDRL 2PO6C 4JRXB 5KN5B 2MFNA 5EUOA 1SJEB 4GRMA 2KUTA 3CFJA 4Z7NF 2JB5L 1SM3H 4PGEB 5CZKA 4QY8A 3F62A 5T3ZL 1E6JH 4XHQA 2VDPH 4LLQB 4JO3L 2MCPL 5HHPA 2BNUB 5KSVB 5L2KB 1CF8L 3NH7L 3OG6B 4NUJA 4WW2C 3B5HA 4XCNA 4YIQA 5JHDA 3IFOB 2EKJA 5BXFB 1EFXA 1WEJL 1QLFB 1NGZB 5I17A 5K9QG 1RFDL 2R0KL 2QR0B 2V7NB 2LU7A 5TF1H 4JZOA 4RGND 4XCEB 4S0SD 3RVTD 4AEFA 5E2WH 1U8QB 2B1AH 4I5BB 1MRDL 3STZB 5DJ0B 3OSKA 2NMSA 2BXZA 5DJDA 3TV3L 3OKEB 3EDFA 3ZKMC 1EBPA 4H0GA 5F44A 3P9LB 1P5UA 1PW3A 4PLKD 4YEEA 1FH5H 2GTZA 2FEEL 1SHMA 3BKJH 1XGQB 3C6LB</