3LQMA

Structure of the il-10r2 common chain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
201
structure length
201
Chain Sequence
MVPPPENVRMNSVNFKNILQWESPAFAKGQLTFTAQYLSYRIFQDKCMQTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVQITFSPVDDTIIGPPGMQVEVLADCLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKQGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-10 receptor subunit beta
publication title Structure and mechanism of receptor sharing by the IL-10R2 common chain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqmA01
5CP3H 3MJ9L 2ORBH 3F12A 2ID5A 5I71C 1C7TA 1YPZA 2WK2A 1SM3L 2ZCLL 1UB6A 2BNRE 2IQAA 4CW1A 3NABL 4Y8DC 4Y2DB 4L9DA 1SJHB 1S9WB 3L7EA 4FQXB 4F2MA 1YNTB 5T5FL 1U92A 5KVEL 3HE7C 3CMGA 1MFAL 4Y5YA 4YX2H 5E1AB 5F9AC 3BAEH 5J13C 1WWAX 2B20A 3S6CA 1JGUH 3MLWL 1FG9C 1U3ZA 1YEHL 5HHMB 1WIUA 5MEOA 4LIQE 2NQCA 1QVOB 2VLRD 4JHAH 4OKDA 4RX4A 4XX1E 2PW2A 2Z8VC 3UXFA 4NZTH 4PRPA 4KPHL 2UVEA 2EC9T 3FT3B 1VESA 4FQJL 4EN3C 2CDEB 4GG6B 1A9BA 1IT9L 5EBLB 5I1EH 1UWXH 2WSKA 3IXAA 4LHJB 3BSZH 3UTZB 4G9FA 5MP6H 1B6DA 3OBAA 2MPAH 4PJ7F 3U46B 4M61B 2HP4A 1F4XH 4LPYA 1SYVB 1FLRH 1RJYA 2ITCA 2EDOA 3CUPB 5F21B 3WS3B 2CKNA 3MROB 1IARB 4IEFB 4IOSD 3UZEA 3GSXA 4FTVD 4JY5H 3SO5A 1XGTB 4TVPE 5BCAA 5CINH 3PGDA 4JLRA 1MELA 1PG7X 1AFVH 2VZOA 1BBJB 1NDMA 4JPVL 2D7OA 1DR9A 3FB7B 2NNAA 4OLVL 4N90D 3U79A 1J87A 1DCLA 1K8IB 1LK2A 1TTGA 5CUSL 2CRYA 2VXTH 2I24N 4L3EB 1S5IH 1ZEAH 3VFPA 3BD4A 1JMZA 1NMCC 3IKKA 3JWDL 1MCPL 4TVSa 1MCSA 4TTGA 5TH2A 4Z7OF 1WBYA 1DN0A 3ESVF 3NCYP 4XXCA 4D0CA 3VW3H 2ZUYA 2VISA 2ADJB 5A3ID 2H45A 3C60D 2OL3L 2F5BH 4TQEH 3NZ8B 2W9LA 4PBVC 2D31B 3QXTA 3TNMB 3ZSTA 5C0FB 4JN2A 5FM5M 4H8WH 2CKBA 3WIHH 4RAHA 4ZO9A 3DMMD 5EULV 5IMKB 1MQKH 1AD0A 2DIJA 4MA1C 4KXZI 1Z9MA 3LZFH 4LLWB 3U9PL 2PXYA 5DR5H 2BY1A 1Y6NR 1QFWI 2GAZA 3ARBC 3MLXH 2KDGA 5C0EB 3U36A 1KJ2A 4P23B 3VFWA 1VFBA 2R1XB 5E70A 1A6WL 3C5ZB 4JDVA 4MJIB 3WL9B 1NAMH 4ZO7A 4KHXL 4HWUA 2YD3A 2VDMH 5ESAA 4MNQD 3P9LA 5DVKA 4ODWA 3MC0A 3LKOA 1NL0L 1YJDC 3CCHA 3FOMB 4AENA 5KS9E 2H3NB 4ZAKA 5JA9A 1JWUA 5KSUA 3UTTE 2PYEE 1YNLL 1FO0H 3NIFF 4PJFB 2X4PB 3S5LA 3GMPA 3OKKB 2VABB 3OJVC 4PB9H 3S97C 4H88H 1W8NA 3RL1A 2IBBA 5EU6A 4KI1A 3B9VA 2P44B 4JFOB 2VQUA 5BQ7B 4OUUB 5GISH 2YA2A 4JFXA 4DN3L 3WDHA 3ETBF 4MSWA 4S1RH 3SDAD 3RWHA 3D25B 1YEKH 1OSZB 3UBXA 1MREH 4PRDA 3IDJB 1RUAL 3SGKC 3DROB 3IRPX 1LEIA 2ESVD 2AJZA 4FFYL 3OR7A 3CPLA 3C6LB 5BV7B 5GZOC 4AQ1B 4OT1H 4S1SH 3B83A 4JRYD 4F3FB 1DL7H 3ZDXE 4KK9D 2CXKA 2YEZA 5IOPB 1G7HB 1N6UA 1J0YA 3H9SE 4NRYA 5BW7C 4X4YB 1MUJB 5DJXB 2R2HB 1CICD 3GKZA 2W59A 3MODH 4GAGL 5CBEA 2QQLL 3FONA 4NM8L 1S7SB 1IFHH 1FSKB 1XH3B 3E3QC 4DZ8A 4G3YH 2EDJA 5DRZA 1CU4L 3I6GB 5E8DL 5AZ2L 3QCTH 1BJ1H 1FJ1A 3CX5K 4WY7L 3QUXB 2BVEA 4G43A 4CMHC 1CR9L 3O9WA 4JFQA 4M5ZL 2Q76B 3MLZH 3KYKH 3OX8A 2ZPKH 1KCLA 1JCKA 5IB1B 4RAUA 2IADB 3MV9D 4L9LA 3GUTA 3P73B 4O51B 5DEGA 1ZHLA 1P1ZA 4P4KB 3FB5B 3O2WH 1J9CT 1T1ZB 1U3HD 1T2XA 3MQIA 3WFHB 4FXGA 1IQDB 3LV3A 4B7LA 4NBXB 5E2UL 2Y5TA 1BFVL 5SWZD 4F7CB 2IPUK 4Y5VA 3KYOB 2EIEA 2W9DH 5KVDL 1MI5A 4L29A 4OIIL 4D2NA 4MB3A 3QDMB 5ADOL 2BVUA 3UO1H 3MRKB 1MJ7H 3CLEL 2GCYB 1BQLH 3AAZA 2IJ0C 5ACZA 4HUXB 1MJJB 3NFSH 2D0GA 1YYMH 4EOWH 2NY4D 3VCLB 4ZXBD 3VFOB 4GRLB 5F93C 4LKCA 1EAPB 2I9TA 3VFGH 3FO9B 4BYHA 3HG1A 3S3JA 4NQDA 1J18A 2BOBA 1GRWA 2YA1A 3MZGB 4FQHA 3LN5B 2IAMC 4QXGH 4PJBF 4RGOL 5HY9A 1CD1B 3VD3A 3ARPA 3QQ4A 1A3RH 1S7VA 4JDZB 3RBSA 1R5IB 3RGVD 3R06A 1UJ3A 4PGCB 4WFFD 2BY2A 3NIFE 4EXKA 3X3GH 4F37K 3SKMB 1JPFA 4JREB 2Y6SD 3DHJA 1LEGA 4G6FB 4TTDD 4WWKC 3S35L 2ZUQC 4P46C 1U91B 2JIXB 3GMMB 1GHFL 2DQIH 4I4WB 4C56E 1D9KC 5I1IL 4LFHD 3B5GA 1E6JH 3BP6B 3NIDE 2EDBA 3V5HA 1SJVA 2Y36H 3G08A 4Y5XA 4FQIL 2Q3ZA 1VKXB 1A7PL 4X6DF 3FB6A 3ZE0F 4W4NA 4UILH 5JOEA 4U6YA 4OJFH 4G6ML 3WFEL 4ZUSB 4OLZH 5C09A 1PD6A 1S7WB 2F53B 1RZKL 1HQRB 2B4CH 3QUMH 5HJ3B 1KSRA 5SWQB 3LDBC 3LKSA 3RHWF 4OD1H 1ZE3C 1GXEA 3TVMD 1CQKA 3TV3H 1HWHB 2J7LA 2DQFB 4XNQA 1UVQA 3EOTL 5DVMA 5IHZA 5L7XL 3N1GC 2CRIA 2EKSB 3DO7A 2Z0BA 2XWTA 3OG4B 4MQ7A 4AJ0A 3KPRB 4HUUB 3SCMC 4OZIA 3TWCH 1UG9A 4HUKB 4PLJD 3V7MA 1E28A 2C7UA 5DUPH 3QNYB 1NFDA 1CI5A 4U1GB 4KH2A 4HWEL 1YYLH 3CFEA 4P3CH 4K94L 4F80A 1M05B 3HMXA 3V5KA 1JRHH 2CMRH 5I8CB 4H8WC 4XNXL 2J88L 5MEQA 3MYJA 1NMAH 1ZLUK 1F3RB 3QEHA 1MRCL 3CX5J 4HKBA 2MQ3A 1PZ5B 2QR0B 3MCG1 1WK0A 2BFVL 4HQQH 2WIMA 4H26A 3MXVH 3I9GH 1IAKA 1A6AB 5A2LH 5L0QB 2ATKB 4L5FH 2K1MA 5IF0B 5I8EA 5DHYA 5MI0B 5FM4A 5CZXC 1INEL 4GT7A 3VGBA 2ADFH 2P42B 1NGPL 5TQ0L 2J1KA 1UB5A 1ZT7A 5HHNB 1JP5A 4JM2C 1S3KL 3DRTB 3GBMH 1NBZA 3ZT6A 4KUZH 5JHDA 4U49A 1MEXH 3GJEB 4U3XA 1H3PH 3NFNA 3QPQC 3DVIA 5MERB 4PJBE 1I9RL 1OGAB 4H5SB 5D2LA 1V3LA 4U0RC 5D7SL 1FFPB 4R7DA 3W9DA 3MSPA 4JRXD 4RFEB 4XPGH 1XIWA 4FS0A 1HILA 4KK8C 4UT9L 3VH8A 3VRJB 2NW3B 3RI5K 1SQ2N 3MLVH 1JPTH 2FJFA 1KIPB 3SE9L 1QKZL 3ZDYE 1B90A 5JXEA 5EZOL 4ZDHB 4NZDA 4CDHA 4X6DE 4G42A 1LE5B 4O9HL 1MIEL 4J2XA 3T3PF 1RJLB 4H20H 3RVUC 4WNQA 5DS8A 3CVHL 5DO2D 3WLBA 2HFFA 5KTEL 1BVZA 2EIDA 5F7YC 3THMH 3B9KB 1OVZA 3QEUB 3ZT5A 4AQOA 3WKMH 1FNGA 1FPTL 4OZ4B 2X1OA 1CT8A 3PWPE 3DRQA 4HK3N 3VGAC 4N9GA 1HHKB 1JV5A 2GTZA 3LKNA 2WWMC 5C70A 4UB0L 5KBNC 5C1MB 4HPOH 3KXFB 5I16A 4KY1L 2AK4D 4M3KB 4Z8FL 5J1AB 3GSVA 5HYEA 2A38A 2XZZA 1K6QH 5CGYC 3ILPA 1CBVL 5JHLL 4R90L 1TVBB 5E9DE 4U1SB 4Y8AA 1BQHB 4UQ3B 3F58L 1DVFA 2P8LA 4GS7B 4Y19A 5D2NB 1SEQL 3ET9F 5FA4A 5IVXF 3QIUA 4JQVA 4P2QE 1KTKE 1DBKH 1GGIL 2BVPA 4QRSB 3BW9A 4R96B 1IILE 4LKXA 5C0DB 3RZWA 3WFDL 4NT6A 5EU7C 4E0RB 1T7VA 1WBZB 4FP8H 3ZE2E 2UWEB 2DAVA 2NY5H 3PWUA 1QFOA 5K9KB 4PV9B 1E4XI 4L1DA 4WI6A 2XN9E 5I73C 4XBEL 5ISZA 3N9GH 1PKOA 3QNXA 1DN2A 15C8L 2PW1B 3N85H 4MQSB 1OM3H 3VXQB 1UADC 1C5CH 4X6CB 4ZUTB 2P7TA 4XPFL 4NUGH 3KPSE 5C0GB 3LRSB 5C08A 2J6EL 3GMNA 2XKSA 3WNNA 1U8QA 2YKLH 3BRDA 2C26A 4PTUB 5DD0H 3IJYB 3RY5A 5D1ZD 4P9MH 1YQVH 4ORZC 4YXKL 1P9MC 4U0QB 5HGAB 4QYOA 1JK8A 3EO9L 1OWRM 3FCTA 3NN8B 4ZFOB 3EOBA 1BBDL 1F02I 1UWEL 1AQDB 1RZIA 3T0EB 5LBSH 1FL3A 3PJSA 3HR6A 4TSCL 1T0MB 3S96B 3TO2A 5EUOE 1MJ8H 2VR4A 3A6BL 1F11B 1F3DJ 1T83A 1QRNA 4PR5A 4Y4HA 4IIQA 4NQVA 5CZVL 5HI5C 5L88L 4WU7A 3SJVB 5EO9B 4NKMA 1ITCA 3O4LA 5L2KB 1CDCA 2B4CC 3BPLB 4XVJL 1TDQA 2YMXH 5BRZE 2HJLB 4PUBL 5EOCH 4J3SA 5IK3B 3RX5A 4BSVA 3NACL 4MX7A 4RIRA 1T1WB 2B1AL 4N0UE 3ARXA 3JUYA 4PJIB 4ZFFB 3QG6A 1MRDL 1CZ8H 4OFPA 3L3KA 3TNNA 4QRTA 5B8CC 1I3GH 1A9EB 5IESL 3LPGA 1JGLL 1Z5LA 3ARDC 3O45B 5DUBA 4ZUWA 2Z4QB 4JPIA 3S4SG 5LWYH 5C0IA 1X7QB 4LK4A 3QCUH 1YEGL 5HYQA 3CC5A 2JELH 1JNNL 2W60B 5EC1A 1E27A 5EN2B 1JTOA 2V2TA 1HE7A 5T33H 5DEFA 1FL5B 1ZHNA 1CTOA 1R0AL 4IOIB 1CFQB 4EI5A 4PPTA 4Y88A 2DOCA 3LH2L 4RGNB 5C0RH 3IFLH 2YPLE 3QIWD 1QD0A 4HKZA 4OCYL 5IW3A 3TBWA 2OI9B 3BHBB 4NHCH 4UINL 5D1QC 1BIIB 4Z7VF 1I3RB 3OZ9H 4CU8A 3DBXB 5F6IC 4MA8H 4GXUN 3PL6B 5A3IC 4G6KL 1JZ7A 1JF1A 3C60C 1WUNT 4JFPB 4NO2B 5IVXE 5DHVA 1DANT 3FFCE 3BX7C 1ZT1A 1T80A 4XWOD 5CEZL 2GIYA 4ELMA 4CU6A 4PB0H 3WN5C 1RU9L 1K85A 1VERA 4KAQL 1TPXC 1FE8L 3MUHL 4YPJA 1N7MH 1KELL 3BVNB 1A6VL 1KACB 4Y4KA 1NCBL 4D8PB 1GGYA 1OAUH 3C6SA 3ULUH 2H32A 1BZ9A 2Q7NA 4RDQF 1G7IB 4KQ3L 1FZKB 5HGDA 1MCFA 1TQCB 5C8JB 4Y4FD 4NJ9L 3QO1B 1G0XA 1NKRA 1T1YA 4D9QD 3VG9C 4JKPH 1ED3A 2D4FA 1K2DB 3D2UD 2NX5B 3U0TA 4WFED 5E7FA 1QHOA 4NDMA 4L4VA 1VFAA 1MI5D 4KMQA 5GGQL 1FCGA 3IF1A 3IKCB 3DECA 3L3HB 4WUUD 5HVFB 5ESQA 2O5XH 3X14A 2VXSH 3I3BA 2F58L 1NBVH 4YUEL 4KWUA 4MXWH 3QFDA 1SMAA 4HFUL 2X4UA 3L6FB 2RB8A 2MHAA 4HKXB 3T77B 4L8CA 3MO1A 4LRIA 4KK9C 5I66A 2DLHA 5EORH 2OXHA 2AJSL 1AGFA 4NQDD 5GGVY 4QRUB 3B8SA 3MLUL 1B0GB 2AVGA 3CLFH 1FAIH 3QEGL 3K2MC 3VFRB 2DQCL 3BT2H 4P2RA 2DMKA 1LNUB 3ZYJA 1JGUL 1YECH 1FFRA 1OB1A 2V9RA 4NRZA 3CZFB 5HHQB 2DQJL 1QSEB 1DSFL 2LAGB 4XHJD 3V95A 2X4TB 2RFXB 2P1YA 1R3HA 1L7TL 2ARJA 2P24A 3P77B 1KIQB 3V79C 3D85A 3RDTD 5C3LD 5GGUB 3T1FB 1SBSL 2FDBP 2IQ9H 2OQJB 1GGBL 1SY6A 1S9VA 1F6AB 1T20A 3CDGA 4BQBA 1U8JB 3KJ6H 3QDHA 1HN1A 2R0KL 5DHXB 4MAYD 1EIBA 2PTTB 1ZHKB 5FYLD 1BD2A 1U3HC 2UVFA 3VWJC 4XCFH 2DM3A 5I8KL 4IOFD 1AH1A 3G5YB 4AM0A 3S98A 3JTSA 4HS8L 3IFOA 5C09D 2BNRB 1ONQB 3JTTB 5MHSE 5D1XA 4JAMB 4G9DA 1HEZB 4P57A 4HZLB 5HGHA 3SE8L 4GRWB 5FA3B 3VFSA 4LHUG 3TC9A 4XP5L 4D0DB 3V8CA 3RY4A 1VGKB 1I3UA 3NPSC 3GSUB 1VEOA 4J3VA 2QJDA 2ZCHL 4X4ME 2V5SA 2WBJC 1Q94B 4GMSH 2NY4C 4LSRH 3RKDD 1DBAH 2DBLH 3CSYB 1U3YA 5H2BA 3NCJL 1CGTA 1PSKH 3R8QA 1EFQA 2SEBA 4HJGB 1S7XA 1J5OH 1HOCB 5E8NB 3BPCA 5SV3A 4Z9KB 1ZS8A 1EJOH 5FUZH 1FZOB 4X98B 3ALWA 2DMBA 1EFXA 2DDQH 3LIZL 4PJCE 4Q7DA 4Y2DA 4ORGA 2O26U 1SJHA 1KXQE 1U93B 4U6TA 3TO4D 4MNHB 2X89A 3RGVC 4Z78B 4D9RD 1U8MB 4KROB 1IC4H 4HIXH 2ZWLT 1UH3A 1ES0A 2UUDK 4LVOB 3TZVA 3EJYD 4YGAB 1NUDA 5BS0E 1MFCH 2Y6SC 1Q9OB 3LQMA 4TTDC 1QQDB 4QOKB 5HGGS 1N5AA 2CLVB 3ILQD 4ODUB 4MS8D 4MVBC 3BE1H 2DI9A 4J3XA 5E5UB 4LHQB 2CR6A 3ULVH 1B0RA 2NTFB 4OZFH 1ND0B 35C8H 4OD3L 4ERSL 4GSDH 3IDUA 3VXME 3QUYA 3MNZB 3CK0L 1T04B 1U8KB 4I0PA 4LSPH 2EYSA 2VXVH 1U8LB 3PWLA 4KJWC 5JHDD 1CDHA 4U1LA 3HI6L 2VDPL 3VWKB 3T0BA 4H88L 3HLAA 2GJ6E 1ZVYA 5GGSB 3WDIA 2XZCL 2AQ2A 1MNUL 2Z91B 5ALCH 1F90L 4KJYB 5HYIA 5DURB 1UZ6E 3O41A 3KR3L 1KPVB 4RWYH 4PV8A 1FNEB 5DI8B 3BQUB 3FB8B 1MFEL 4E41D 2C1PA 5B21A 4X7EC 3CSPA 2BNQE 3ZLQC 1YEFL 5TDOB 3T0XA 1HZHL 3QUZC 4HIIB 2APWA 2R1WB 5C7XL 1ZANL 5EA0H 1RZGA 3SDXA 5JR1H 3VFVB 5T1MB 4BUHA 5I0DA 3GDBA 3U2SB 1HHIA 3VXRE 3HHRB 1IKFL 1RUML 4OCRH 5BVPH 4X6BA 3WSQH 2AV1A 4YAQA 1ADQH 5IQ7L 4Q2ZA 4FZEH 1MFNA 4LPXA 1A7RL 4OCSH 4WI3A 2X1QA 4P99A 2PYEB 3BPNC 1Y0LA 1N8ZB 3QCTL 2D31A 3ULUC 1RVFL 4MWFB 4QXWA 1NEZG 1I1AA 1J12A 2X4QB 4JVUA 3DV6B 5CJBA 5IMKA 3K2UL 5FKPA 3KYKL 4XRCB 3V6ZA 4LLWA 3ZTNH 3I2CL 4PJAA 1U9KA 2OTPA 3VI4F 5HPOA 1EA9C 1MFBH 1G6VK 5E8OB 3GHBL 1WZLA 4YH6A 5DTFB 4LAQL 2QQNL 5IHLB 2AS5M 2X4SA 1UA6H 4KDTC 2EDQA 2R0LL 4M9PA 4F33B 4NNPL 3VXUD 1QEWB 1DVFD 4PGEB 2NXZB 5KSAB 1MHPH 1I8MB 1OLZA 4Y19D 3BKJL 3QIUD 3ARSA 2Q8AH 4PRBB 3WS6C 2X4PA 4U1NA 1V3JA 2EDFA 3DX7B 2W9DL 4UV4H 3EYOB 2FECL 12E8H 5LG1A 2HKFH 3H9SB 4KI5E 3L5JA 4ZUUA 3M07A 4M3JA 4JE4B 4OUUA 5IBUB 1YPZF 5E8EB 3A6OA 1HI6B 4EOWL 2B1HH 3TCLA 1PQZA 3HMWL 3D25A 2OR9H 2QHLA 2AABH 2WQ8A 5ISZD 1B0WA 4HG4K 3HPJA 3DROA 1ETZB 4JO3L 3M1BB 4KK6C 4PJ5A 4M6ML 5D7LA 3SQOH 2JF1A 4S2SA 1FDLL 4JY6B 5FV1L 3EFFA 1KJ3L 1F00I 1YMME 2D9CA 3JV4A 5IOPA 4J3UA 2ZJSL 3H3KA 5BOPA 2PTUA 2QHRH 3K81A 4RBPH 5HGBB 4WWID 3BP5B 4X9FA 3TA3C 5IV2B 4PY7A 3L5WA 1A6PA 1RJZA 2R15A 4DCQB 1H3XA 5ANMA 1JGDB 4GKOA 4TOYL 2O5ZH 4HIEA 4BH7B 4I5BA 4IMLB 1I7RB 3I6GA 3ABZA 3LQZB 5F9WC 1FLTX 2ENYA 4K7PL 1E4JA 1MHCB 1E4WL 2WIIA 4CJ0A 5E5MA 4PGJA 3MCLL 4Y4HD 1ACZA 3KPNA 3RWCB 2XZQH 4UILL 2VXUH 2W0FB 8FABB 4HDIA 4HV8B 2NMSA 1FVEB 4MCYB 4NZUL 5JO5A 1A7QH 4MD5A 1RUPH 3MNWA 3WHE0 3P4NA 4HULB 4AEFA 1OOAA 1T1ZA 1KCUL 3WJJC 3MRDA 3WFHA 2VWEE 2EIZB 2VC2H 3K4DA 2DQHH 5I1LA 4PJ8D 1LO2L 4JO4H 3CDYA 3OR6B 2K7PA 4OGAD 1OGTA 2HLFD 3FAWA 3QIBB 3NFPB 2GCYA 2VQ1B 3H0TA 4XVTH 3ZTJG 3EDJA 3WE6A 1IVLA 1A21A 1K8DA 5I0ZA 4QRRB 5JZ7D 5BVJA 5IFAL 3WMSA 1QP1A 1MCIA 4UNUA 2NY1D 1VFUA 3VFOA 1S8DA 3NTCH 3OXRB 3QXDA 4IRSB 3FO0H 4M62H 4EI5D 5DUPL 2Z31A 4Y0GA 1IAOA 4HCRH 1U8HA 4DW2L 5HXMA 3PIQB 5D1ZC 3LS4H 4QCIA 3VI4E 4MQXC 3LN5A 3G5VA 4D9LH 3L1OH 2ZOKA 4U6HB 5J6HB 1TZHB 3DUHA 2D7TH 5T3ZD 3RZCD 2LTQB 1N6QL 5JDJA 4LLVB 1AGCB 5H37H 1M7XA 1R5IA 3D0LB 1FRGH 5GS3A 2VUYA 1FNLA 2FL5B 1NGYA 4KJQD 1V8HA 3P0GB 1N0XH 4X9HA 4JRXE 1N64H 5AAMA 4C58B 3SKMA 3ULVC 3WEXA 4HS3B 1IGML 1PEWA 5FB8A 2G60H 4L5FL 4MD4A 1U91A 1X44A 2JIXA 2F19L 5T3XD 4NNXB 2R9HD 2EO1A 1YPZE 3LS5H 3ARFC 2WP3T 1UM4L 3VXOB 5M7QA 4K3DH 3KLHC 2CK2A 4GBXA 4HWZA 4LCWB 5CJOL 2OK0L 4DUWA 1A3LL 2E9BA 3RL2A 1IAIL 4K3EH 1C12B 4KUZL 4JGJA 1RZFH 1YC7A 4P2OB 2P8PB 3HNSL 3NA9L 3DVGA 4R26L 4XX1G 1EGJH 3IFPA 4NM4L 5DLMH 4PRAB 2OZ4H 1XGQA 4WO4B 4KTEL 1V7NH 3RA7H 3AM8C 2APFA 4DVBA 5F6HI 4MJ4A 3UAJD 3SDCB 1CGUA 4PRPE 3P4MA 4DWHA 5EBMB 3GMQA 5KW9H 4HG4J 4FQ1H 4JZJC 3QIWC 2AJYL 3KLAB 2O5YH 3OGCA 2ZUSA 4G9FE 4AT6A 1XR8B 1ZT4A 3ARGD 4FMKA 4HBCL 3BKCH 1JZ4A 3O2DH 1I8LA 4O4YH 4K23L 1K4DA 1G1CA 5EFIB 3T65B 3LVEA 2JB6A 3SDDA 1M05A 2R1YB 3MLSH 4X9IA 5I8CA 3QQNA 4XWOC 2YD9A 2LABA 4S1DC 4P2RD 1Q72L 4OM0L 3WKML 1L6XA 4OSUH 3TT1H 2OXGA 4UUJA 1P53A 4R4BB 3TM6A 4YHPB 1YY8A 1F58H 4IHOA 4PJBB 4GLRH 4F9LC 1PZ5A 2IGFH 2D7PA 3KS0J 4DVRH 1KBGH 4ZPTA 3D85D 3FZUC 4FFZH 1JTPA 5DK2A 3N06B 1S7RA 2CLRA 2O61A 2Q6WB 1HINL 2GFBB 2LVEA 3QJFB 4BQ6A 1OPGL 5HHNA 4YXHH 1I8IB 3VD5A 5GGVL 3OB8A 5EC2A 5LVEA 4XPBH 5JW3L 1TVHB 3QXAA 5C0BA 5ADPL 3UEZA 3RJQB 4G6JL 5CP7B 5L9DH 3O2VL 5D1XD 3RBGA 4X6DB 4FG6D 5KAQG 3S9DB 1CXEA 2VLKA 4P5MB 1N3NB 5CBAB 4M1GH 2XG4A 1WZ1L 3FQTA 3T2PA 3QDJA 3C8KB 3PHOB 1SYSA 2ZOLA 3N85L 2LQRA 2BVQB 2ADGA 3KAAA 5C71A 1TCRA 2FJHA 4MB4A 3O0RH 5F88A 1XEDA 3T0AA 2C3HA 1LO0L 1FH5L 4YO0B 1PZUB 3MRPB 1B3JA 1OAXH 1EMTL 3ES6A 5KOVC 4ZDHA 2QADB 1Q0XL 1NLDH 4POZD 5D72L 3K1KC 5E9DB 3CFDB 1I7TB 3OHXA 1FFOB 1EO5A 1EERB 2AKRB 2R4SH 2MQ0A 2X4NB 4WUKH 3KNBA 5KVFH 4XHJC 4P2QB 4V1DA 5EU6E 1W0YT 3P11L 2QQQA 4PLKD 5D96B 3TZVD 4HXBL 2NY2D 3RDTC 2RIKA 2XQYG 3C9NA 4GAYA 3P0VL 3OL2A 4MAYC 2XN9B 4HPYH 5DJCB 1MPAL 4K9EH 2YD2A 4O58L 4NN7C 4Q97A 4M8QA 1NAMB 1Y6KR 1T21A 1I75A 4HGWA 1BQHA 1QLEH 1XR9B 4JFDD 4U1JA 5IBUG 3W81A 5C0AD 1CZ8L 3C5JA 1QPPA 2FSEA 3Q6GH 2CGRH 4I0PD 3E6FB 3KPSB 3K7UA 3E8UH 1W72A 4Z0BH 3FO2B 1IJ9A 1JYXA 1FO0B 1DBJH 1OSPL 3P9WB 2J3SA 1X5IA 5JQHC 1YY9C 3AREC 2X1XR 3QBTB 4NFDA 1ZHBB 5DGQA 3SOBH 2JELL 3RKDC 4JKKA 2FECI 3MRNA 4OZIF 4U0RB 5F89B 5T1KB 5C07A 1NFDF 2PW1A 5JLZB 4XMKH 5E2TL 4UZGA 2VZTA 3IFLL 4Q0XH 4LSDA 4YZFE 3VXQA 4N8VB 1VHPA 1ORSA 3IDNA 4HK0A 4KHTL 4KVCH 2H6PB 2HT2D 3TEUA 1U41A 3TO4C 3PP3H 3E6HB 4D9QE 2C1OB 5BJTB 5ITFA 2J2ZA 1CL7H 25C8L 4KZDH 2XTJE 3EJYC 5BRZB 1B4JL 4WFEE 4XWGL 3WHE1 4N0UB 5F72S 3WFCL 4ZFOA 3I84A 1UWGH 5T3ZH 1QTYT 3BGMA 4PJ9C 4LCCB 3BN9D 2HTKD 2A73B 3ILQC 4NWTL 1AQDA 3T0EA 1WQVT 2V2WA 5D6DC 3WKNA 1NDGB 5JPMB 1SMOA 5FDWB 1I1AD 3BDYH 3MJ6A 2J5LC 2BC4A 4V2CB 3SN6N 1CGYA 3GBNH 5IEKB 3HG1E 1MCKA 3VI3E 5HDLA 5FHAL 1CYGA 2VLJD 3PQYD 2NY3C 4N8PA 3U7YH 2P5EA 1DQJA 1TFHA 3P2TA 4AH2B 1XZ0B 5GS1A 1AKJB 2IEPA 2YPLB 4X0KB 3CU7A 5D2LF 1LE9A 5ERWA 1P5UA 5D7JB 3T8XB 3RVVD 5F6HJ 1G6RH 4OD2B 2YRPA 1XGRA 4WTXA 1NQBA 2OLDA 1QSZA 4LIQL 4U7SA 2ADIA 3NIGF 4RMVA 3QT2A 3AVEA 5IVXB 4JANB 2HVKB 2O5XL 4LSQL 3FFCB 2NY0D 2JJUA 2VXSL 3AXLA 1YZZA 5EN2A 5SWSD 2PYFB 4R97C 4LLDB 5JORA 2FATH 2J4WH 5ID1A 4IOIA 3Q6FB 2R2BA 1KNOB 3O8XA 5GRYA 3QHFH 3RRQA 4XP4H 5FYLE 2DQDL 3PWNA 4GOSA 4M02A 5JUEH 2PF6A 5D7LD 1NJ9B 1D5XB 1BQSA 5TF1H 3NGBC 1BIIA 3ISWA 4WIQA 1CLYL 1EO7A 5DRXA 4TYUA 4NZRL 3DBXA 5C09E 3I02B 5F7DB 3TJHC 4I3RL 1KTLB 4QY8A 3C09C 2OSLA 3EO0B 5BZDB 3NH7H 2YR3A 1KPUB 4NO2A 5LGHH 1FNFA 3QULA 4G7VL 1IGYB 1RJCA 4TVPL 1XCTA 2QQKH 1F8TL 1NC4D 3DIFB 1AE6H 3QQ9C 1W2KT 1IKNA 1OTTC 5I30L 4PREB 1N59A 2VLRB 3GEWB 1Y18A 5TDNB 3FN9A 1AIFA 2IWGA 2AERT 2QKIB 2V7NA 1S9XA 1E0OB 3CX2A 4OZIE 2BRRL 3IDXH 2ZUVA 1NFDE 1G7IA 3O6FC 3EO1B 3AS3A 4KVNL 4U1HA 2VZ3A 1IAII 1UEYA 4M43H 4JRWA 3QFJD 3QO1A 4J4PC 3L5XL 3EJJX 1AJ7H 3V6FA 1L7IL 2VL5B 1CLCA 2WUCH 1BM3H 1VADB 1KFAH 1L9NA 1K9TA 2LU4A 4J6RH 3BN3B 4UIKH 4QRQA 1K2DA 5F3HB 5IM7B 1RHHA 1HIMH 4XBPB 2BXZA 1T22A 2FIRT 5DFVC 1MWAB 4MD0B 1PSKL 3S8WA 1WTGT 2XRAH 3LEYH 5D4QA 1TIUA 1RMFH 5IBTH 4PRNA 4N0FA 4M4RA 1J86A 1MOEA 1HXMA 3WFZA 1AGEA 4YR6A 2BMKB 3FN0L 4OQ1A 2Z31D 1F45A 3BZ4A 3S36H 2I5YH 5JHDE 5E4EB 3MBED 2NW2B 4NFBA 3UC0H 3UROR 3OPZH 4NC0B 1BFOA 1IC4L 1TZGL 5D2LE 1FBIL 4CVUA 1C7SA 4JM4H 4Z7VB 5IB5B 3TGXA 1MCWW 5A16B 1QSEA 2YPVL 3ULSB 1BJ1J 2HN7B 4AG4H 2EH7H 3NIGE 1R24A 4K9EC 4X7SH 4OV5B 1PX3A 3M17B 4JVWA 3QP3A 5IHBA 3DMMB 1U8PB 5JPNA 3C5SB 4YBLB 4L8DA 1EHAA 1SBBA 4DFHA 2JTDA 1UACH 4TULH 1JYWA 3WXVL 3F7QA 4GBXD 1HXYA 2PTTA 4P3DB 1KJVA 5IWLA 4RFNB 4QHNA 5FUOH 4YHLL 4CVWA 1FGNL 4MHHG 3DUUB 4J3WA 4KMTL 4LU5L 4MNQB 4K7PX 5I19H 5GS0D 1IM3B 4M6NH 4OGAC 2NYYD 3HI5L 4PJCB 2HLFC 1EVTC 2X70B 4U1KB 2A6KA 4Y16A 1RUQH 5IROA 3GI8H 4HW6A 3MBXL 3RWDA 5JZ7C 3MRFA 4NO3B 1U36A 3P30L 2D0HA 3Q1SL 4EEEA 4ONFH 5BS0B 4JPKL 1OAKH 3BEWA 5EIVA 4XMPL 2W9EH 4K7FA 3SDAB 2EH8H 5J6GB 2UZIH 5E99L 3SE4C 4ACPA 3BESR 5EA0L 5JR1L 3GMRB 3ARWA 1WBXB 1FZOA 4Y19E 2B39A 4JRYB 1N2RB 1TLKA 5C9KA 3RZCC 4L8SA 4HH9B 5DK0B 3OKLB 1ADQL 4FZEL 4Y2OA 5JIKA 1U8MA 4ELMF 3HZMB 5AG9A 4KJQC 1KB5H 3DUSB 1CICB 3V0WL 4MDIB 3H6JA 2DQEH 3GNMH 4O02L 4QOKA 3PWVB 1U8IA 2DYPB 3IETB 4MA7H 3DV4B 3PXHA 2CLVA 1D5MB 2XPGB 4FQ2L 1KN4H 4H1LH 5HI4D 4CUCA 5FIEA 5KZCD 5ISZE 3LSOB 5DA0B 3STZB 5EU4B 3ZTNL 4Z7UA 1T5XA 1BVLB 4NKQB 3HC3H 4P5KA 1MFBL 5BMFH 5K9QG 2AK1H 2FBJL 3T2NH 2CSPA 4YHMH 3VXSD 1YEEH 2WUBL 3IT8D 5C08E 3QZWB 3DJ9A 5E6YA 2BNQB 1M6OB 3D18B 3MNZA 4Z76A 2BCKB 4XT1C 4PGBB 2W0PA 1KG0B 3B3IA 4OGYH 5M94B 4JHBA 1AXTL 4UTBL 3QH3B 5CJXA 2GQHA 4PYGA 4D0BB 2EDYA 1CXHA 3D6GA 3QDGA 3VXRB 2WAHA 2NR6D 5T1LA 4K3HA 3PABA 1IE5A 5DD3L 3DURA 1LEKA 5FGRA 1X5HA 1KPVA 4UTAL 2VLKD 3MJ8B 2GUOA 4OQTH 1BWWA 1FZMA 3QA3A 1QRNE 2HRLA 3BQUA 4RA3A 4HEME 5D9SB 4X5XB 1R3LB 3ARRA 4A2LA 1BEYH 2X9YA 3F7VB 1E4KA 2VLMD 5DDHA 1EHLH 5A2IH 1IGJB 3ARGC 3UJIL 3SE3C 2NY4B 4ZXBB 5TDOA 5IQ9A 3MMEB 3O4LE 1BLNB 3U30B 4HIIA 4HUWA 1V3MA 4NCDA 1FC1A 4O2CB 1I4FA 1MRFL 4GKNB 4WI2A 3U2SA 2EXWC 4G8GA 4LCYB 4HC1H 4NO5A 1TJIH 1BVKB 4PJGA 5DJ6B 1J0IA 2EEDA 1S5HB 4GXVL 4G8IA 3K46A 2F54A 5AUMA 32C2A 1OLLA 3HE7A 4I0CC 1FVDB 4TSBL 2A6JA 2C4FU 1MIML 4YK4C 3TH3T 5CKAA 4M7ZB 2N1KA 3TN0D 5DQJB 3VGDA 1JFQL 4XRCA 3DVNB 4RAVB 4ZTPL 2VXUL 4KXZH 4QF1A 2R23B 3RVTC 2G75A 1QFWH 3CXDH 4CNIB 4EN3A 2JJVA 4YHKH 1A5FL 4LL9A 4F33A 1AO7A 4FZ8H 3U48A 4YHOL 3ZT7A 4Z77B 5D8JH 1RFDL 1IGFH 3C87A 3RWEB 1A6ZA 3ZHDA 4PJ7A 1MCWM 1UXSA 1FG2A 2EYTA 4ELME 3GK8H 1PLGH 2PETA 2HT4D 1XGUB 4DKDC 4DKFH 1FL6B 2IH3B 4WHYG 3X12B 3KPMB 5T3XE 1JBJA 3TVMB 4TRPL 2Y06L 3RWIA 1RHFA 1CF8H 4XPAH 3LHPH 4UIMB 4PRHD 3GJFB 4HGMA 1Z0NA 2EXYD 2DWDA 43CAA 2XWJA 2HJFA 3BJLA 4GUPA 4JPWL 5INCA 3EZ8A 1IC7H 2PCPB 1LVEA 3FFDA 5TFSH 4IRJC 5I15H 4LOUC 3OKEB 5FKAB 1P4LB 4GAFB 2FLRT 5IV2A 5FK9A 4KKCC 1V5JA 6CGTA 2VDOH 4MAUL 3SY0A 1JGDA 4YE4H 4L4VE 5DQDH 5EBGA 4I18C 4LQ1A 3EJZC 4IRZL 4B7IA 3HUJF 1JHKL 4BH7A 1BOYA 3OJDA 5FYJE 5ID0A 1QSFA 1UEMA 1BAFL 1OY3B 4FABH 2CLZB 5IG7A 2ZG2A 1CIDA 4ODVH 4KZEL 2GKIA 3UTSA 3T4YA 2V5TA 1WEJH 2HT3D 2R29H 4EIGB 1ZLSH 4Z0XA 2Q86B 3ZYZA 4F7TA 4PBXA 1MJUL 4HSQA 5C92A 4EUPH 1G9MH 2Z8SA 3ARBA 5J9PB 4EVNA 4L8BB 3QI9B 3QAZB 4P2RE 3IU4H 1FORL 1MCRA 1YN6B 4GQPH 5GS0H 3QCVL 1NMBL 3FQNB 2J12B 4N0YH 1PW3A 1FN4B 5I1CL 4BFIA 4F58H 5JMRA 1Q9WB 3GSNB 2R2EB 4KRMB 1EEZB 3LEXA 1NH6A 2BERA 3I50H 5JNYB 3U7WH 5HHXH 3HZKB 4JRXB 3ZYIA 1X5YA 1ZWIA 3MLYH 3G6JA 1MH5B 1LHZA 1RK0A 2M26A 3MV8A 5F1NA 3O8XD 2HT2C 3EHBD 1XGPB 1BD2E 5GRJL 3O2DL 3KPQA 1BGXL 3P4OA 3HC4H 5F96H 1YPZB 2A77H 3W0WD 3SGKA 4NQTA 4N0RA 1ERNA 3F7PC 4R4FL 3V6BR 5J6HA 2IQAB 4KI5C 5HVGB 4GO6B 5F9JB 5IKCB 3L7EB 4LLVA 1AGBA 4NGHH 5GGTH 1U92B 5E95B 4FQCH 5BW7A 4Y5YB 1J0JA 2MMXA 3GIVA 3RUGF 4HS3A 1KBGL 4PJAF 1ZLUH 4P5TD 5GSRA 2V9TA 4H25A 5MEOB 4FFZL 4LDLB 2D03L 4RDQG 3SDYL 5FOBB 4CADA 2JE8A 2PW2B 5F1OB 3P4LA 1XF3A 2VL4A 3NOIA 5F9WB 3NCEB 4LCWA 4MCZA 4PS4H 1C08A 1F3DH 1E6OL 1A9BB 3IXAB 3PV6A 4XP6L 2P8PA 3EDEA 2KQNA 1YEJH 1JMXA 2X9XA 1QNZL 3WCYA 2VZSA 1LK3H 2G2RA 2NLJA 1CDBA 3KPLA 1RJYB 3A6CL 2ITCB 1O7SA 4HLZG 4PRAA 4W6YB 4NOFA 3LN4A 2NY0C 1KJMA 1ZKAA 5I9QC 3SDCA 3D39A 1X4YA 1B2WH 4QXUL 1TJHH 1AHWC 3GSXB 3RFZC 2C3VA 3A0OA 5CP3A 4BM7A 4NRXA 1JGEA 2OCFD 3KLAA 1TETL 4M7KL 1NDMB 2XKNA 1WAAF 4YHZL 3KPTA 2NNAB 1LK2B 3VA6A 4CJ1A 3MJ9H 2FZ3A 5BZWA 2D0FA 1CLOL 3VFPB 5EFIA 1SM3H 5F7LB 2FD6L 4YDLB 4WUKL 5D1ZB 4JHWL 3D3VA 5TH2B 2IANA 2WMPA 1WBYB 4AL8L 2IAMA 1DN0B 1JPSL 1UCTA 4D0CB 2OS7A 4M7JL 2EDDA 1WGOA 2WW8A 4XMLL 5T5FH 5KVEH 1DLFL 1MFAH 5LKNA 3O6KL 3DHMA 2H41A 4LQFL 4BSWA 4JN2B 2N4IA 2CKBB 1YEHH 2JKXA 4HPYL 1IM9D 4YC2C 5GHWL 4WWKA 1AD0B 1LDPH 4L3EE 4KPHH 4S1QL 3RIAK 4S10A 5CIPH 2H8PA 5SX5K 3SDXE 2XQYK 2PXYB 5FHBL 4FQJH 4HWNA 4ZOCA 3Q6GL 2CGRL 3U36B 1KJ2B 1IT9H 3VFWB 1VFBB 3E8UL 1CLZL 4JDVB 1UC6A 3VD9A 4RMQA 4EQ3A 3OAUL 4F57L 3P9LB 4M93B 5F9OL 3PGCA 4ODWB 5E7BA 3LKOB 1JI2A 3CCHB 4AENB 4ZAKB 1JWUB 5KSUB 3PDOA 4P5MA 3GSQA 4Y16D 3JBG7 3S5LB 3GMPB 5IJKC 4R9HA 4XNYL 2XA8L 5EU6B 1H5BC 3K80A 5CLWA 3SGDI 2EDHA 4WCYL 4QO1A 3H7LA 4PJAE 4ZOAA 2ARWA 1MCDA 4JFXB 3K74B 1S7UB 2VNCA 4MSWB 4KVCL 1IEAA 3L3OA 4YO0A 5ICYB 4JPVH 3MXWL 3VD7A 2IMMA 1QR1B 4OLVH 2AJZB 3IDYC 3OR7B 1CL7L 3SCMA 4AEIH 4YEFA 4ZFGL 5CUSH 2Y1VA 2DLIA 4GJTB 3LRGA 4NC2B 4GMTL 1JPST 1X5AA 4F37F 4NQED 4J3TA 1Q9KA 1JF6A 5F70A 4I9WE 1BWMA 3WO4B 2MKWA 4F15C 4NRYB 5GS2D 2WWKO 3ZDZF 4YBQC 1KF9B 2DWEB 2BNUA 4JO2L 3WIHA 3RIFF 2OL3H 3CH8A 5FECA 2A6IA 3VA2C 3ZE1E 4DZ8B 5DRZB 4XNUL 3QSKB 4MA3B 1G9MC 1C1EL 5L8JB 4PJ5E 4NO0A 4G43B 1HKLL 2N56A 3O9WB 4JFQB 2NY6B 1NAMA 3OX8B 4WW1A 4RAUB 4WVRA 4MJ5A 4L9LB 3U9PH 5E1HB 4I77L 5GS0C 1MHEA 2AV7A 3E6FA 5DEGB 5DJAA 4Y4FB 1A6WH 1ZHLB 4JM2A 1FO0A 1P1ZB 4KHXH 2H2SC 4OKVA 1NUFA 4FXGB 2QSQA 1NL0H 3QDGD 2VDLL 1J88A 4PGDA 1I9EA 3LV3B 3D2UB 4JZNA 1YNLH 2Y5TB 4Y5VB 2H2PD 3MYZA 3UDWC 4UQ2B 1MI5B 4L29B 2PR4L 2MOVA 1E4XH 3NA4A 4WUUB 4RFOL 3S4SA 3AAZB 4NBYB 5ACZB 4L4TD 4OF6A 4XCEA 2JCCA 4DN3H 2D9QB 2A1WH 2I9TB 1LILA 2OJEA 1RUAH 5FYJU 4HXAL 5F7MC 2FIKA 1F2XK 2HFEA 5BJTA 4FFYH 2OP4L 4NQDB 3BFOA 5CJ5A 3JVGC 1AC6A 1P6AB 1UQSA 4FQHB 2F8VA 5HY9B 2V9QA 5D93C 5I74B 1AE6L 4OLWL 3QQ4B 5FF6A 2YC1A 2EDNA 2A73A 5J7CC 1S7VB 4WFGD 2GHWB 2GEEA 3R06B 4QRPA 2YXMA 4WI7A 2F54D 5D70H 1QR4A 1ZGLM 3HE7D 1I9JL 4WRLA 1U2CA 2F74A 4GAGH 4ZUVA 4NM8H 1JPFB 3MOQA 3BH9A 1I7ZA 1LEGB 4Z7WA 1CU4H 5E8DH 5AZ2H 4WY7H 5IB2B 2GJZB 5F7WC 3V5HB 1CR9H 3G08B 4M5ZH 4AH2A 1XZ0A 2OMNA 3FB6B 2AEQH 3ROLA 4W6XB 4U6YB 1BM3L 3MJ7A 5C0CA 1HK6A 4LPVA 1AO7D 3NVQA 1CE1L 2IALB 3NCCB 4OGZA 5D7KE 5C09B 4PRIA 5KSBA 3RI5F 4HJJL 3LKSB 2GSGA 3CDCA 3D1MC 2P5WA 5HDOA 1PAMA 1VEPA 5IBTL 5E2UH 3ZDZE 5KVDH 2NZ9C 5ADOH 4QKXB 3KGRA 4XNQB 1UVQB 3FL7A 4BELD 3U0WL 3CLEH 2KZ1B 3BJ91 3FN3A 5GRXG 4C4KO 4FQQA 2I5YL 3DO7B 3BZFA 3C2AH 3F7RA 2XWTB 1NJ9A 4MQ7B 3FT4A 5J11B 1DFBL 4OZIB 2AJVL 2C7UB 5F7DA 1EPFA 4X5LA 1NFDB 4EKXA 1KTLA 4BA8A 3EO0A 5TE6L 3TO4B 1DQML 3UJJL 3BH8B 3CFEB 3HRZA 4FN0A 4JM4L 1KT2A 3QO0A 4ZPVA 4HAFA 4OCNC 4RGOH 3V5KB 3GSOA 1P9MA 1B88A 2OTWB 2FRGP 1F4YL 5CHNA 5ECJE 3MYJB 5MEQB 1GCFA 1KEML 2YRZA 3QR2A 3TN0C 1WLHA 4PREA 3QEHB 3WNPA 2VLRA 1QSFD 2A83B 2FHBA 4YDIL 4HKBB 1KTDA 1G7LA 2QKIA 5ILTL 1FC2D 4H26B 4NIKB 1IAKB 1VEMA 4FRWA 4RMTA 1GVIA 4N5EC 3S35H 3SO3C 5I8EB 2XTJC 5DHYB 5E2WH 4DAGL 5I1IH 2K3TA 1VPOL 3T4AA 5DWUL 5J0BA 1UB5B 1ZT7B 4FQIH 3R8BB 1A7PH 5K9QI 1ACYL 1NBZB 3QUMA 3KLDA 5IW6A 4PJXF 3MV7A 5JHDB 1RIVL 5C2BL 2HT4C 2L7JA 3WFEH 3QHZL 2AP2A 1C16A 3GB7A 5B8CA 3RHWK 4ZTOL 5D2LB 4FTVA 3ARDA 5E6IC 4R7DB 4DKAA 1A22B 2I07B 1P4IL 4DEPB 4E41B 3U4BL 2EXYC 2VOTA 3FRUA 1XIWB 4F9PC 4QHUA 4GKSA 1YA5A 5IFHH 2FX7L 3MV8D 3SPVA 2CD0A 3EOTH 3AY4C 1DUZA 3L7FA 5L7XH 1UJ3C 4A6YL 2X4RB 2ZUWA 2BVOA 2FJFB 5E2VH 4WJ5A 5C0BE 3IXTA 4NZJA 3INUL 4EXPX 1NLBL 1OQXA 1KB5L 5GZOD 5D1QA 5H35A 1OGAE 4G42B 5HHMD 2ED7A 5TF0A 4HWEH 2VLKE 4Z7VA 3GNML 1C5BL 4K94H 3C60A 3WLBB 2HFFB 2HN7A 4U7MA 3TBTA 5DZNA 2QEJA 3QDJE 5CEZD 5GS2H 4K71C 4XNXH 5DVLA 2J88H 1UH2A 1FNGB 4UAOB 4MYWB 1CT8B 1CFVH 3DRQB 5JOFB 3HC3L 2HT3C 1JGVH 1MRCH 3WN5A 4LF3A 2I9LA 2GTZB 3LKNB 2QSVA 2BFVH 4FA8A 3BGFB 3MUJA 3HE6C 3S5LG 5I16B 2CDFB 4O2FA 4PJDF 3GSVB 3QISA 4RZCA 1HYSC 3GZKA 4OGYL 1INEH 5CJQL 1Q9LA 4YQXL 1WCQA 3K3QA 2UY6A 4DUVA 3OF6D 1NGPH 5HHPA 1U2HA 4M8VA 4MNQA 5TQ0H 3S37L 1DVFB 4LVHC 1ORQA 5DFTA 1HH6A 4NKIH 1GGTA 4Y19B 3DX6A 1S3KH 5FA4B 4OFYA 3T0WA 3QIUB 4V1DE 3UBXG 1OHQA 2BVPB 3BW9B 3IFNL 2X70A 2DIBA 2DL2A 4LKXB 4MMZC 1W0WA 4NT6B 1I1FA 4Q6IC 2GITA 5J12B 1I9RH 5ACLA 5D7SH 3GSRA 3PWUB 4MGXA 4JQIL 1OD9A 3EHBC 5IW1A 2XYCA 1T7WA 5ISZB 2E7CA 1RIUH 3QNXB 4AIZA 2E7HA 1A1MA 1N5YH 4UT9H 2ESVA 3VMPA 1ZGLA 4FQPA 2VSDA 3DYOA 3BPOC 4GAJH 4JRYA 2B5IB 1TJIL 4NQCA 4APQD 3VFTA 1A0QL 5C08B 3PNWA 5DK0A 3SE9H 1QKZH 1CL7I 1U8QB 3HZMA 5EZOH 3H8NA 1YEIL 3KHOA 3D3VD 1XCQA 3MRJA 2IAND 3O4OC 3W9EB 5IGXL 2IAMD 1KUMA 1CICA 4O9HH 4QYOB 1MAKA 5C0NC 4MDIA 2MNUA 3FCTB 3CVHH 3EOBB 5KTEH 3BIKA 3QRGL 4Y1AA 5C07E 3KJ4C 1FL3B 3LSOA 3TP4A 3PJSB 4ONHB 5EU4A 4HBQA 1AR1D 1FPTH 2C3WA 2CQVA 3C5ZD 1XGYH 4MJID 4WEBL 4P9HL 3TO2B 4JKWA 3VMNA 2YK1L 3LB6D 1QRNB 4PR5B 4Y4HB 5FGCE 4NQVB 3CXHK 3DOSA 4P46D 1WV7T 3MV9A 4C83A 2E5EA 1D9KD 4KY1H 2KBGA 2IC2A 4NKMB 4KV5E 4AEEA 1CBVH 3O4LB 4K8RL 5JHLH 3F65A 3GSNL 1I8KA 3L95B 3EYSL 4ODSL 4BSVB 1U3HA 4RIRB 3F58H 4MX7B 4R7NA 3VWJA 4Z95L 3AU1B 5L8LB 2F5AL 3L3KB 3TNNB 1SEQH 4PJ8B 5I17A 2XWBA 3T0EE 1GGIH 4MMXC 5SWZA 4NP4L 4JEGB 1Z5LB 4E5XA 5DUBB 4U2YA 4UT6L 3WFDH 4ZUWB 1CF8L 4JPIB 3MUY1 1QBML 3SGJC 2UV3A 4M1DL 2IFGA 2IH1A 5HYQB 4Z6AT 3CC5B 5EC1B 2PKDA 1E27B 5CMAA 3UZQA 3OJMB 2WBJA 2NY1B 2V2TB 4YDKL 5DEFB 3V9FA 4XBEH 1ZHNB 2V7HA 3ARTA 1BLNA 4HX1A 4XCYA 2P5EE 4EI5B 2XFXA 15C8H 4IDJH 5GRWA 2HFTA 2CDGA 3F62A 3PP3K 4HKZB 5KJRL 3TBWB 3O3AB 4XPFH 4JFHD 3SCMD 5HYSA 3GM8A 3IDMA 3KYNB 5M95B 2LE9A 3O81A 3M8OL 1OCWL 2HG5A 2J6EH 3G9AB 3UPRA 1ZVSA 5DJ0A 5DQDL 3I75B 1N26A 1IGIL 5H8DA 3RZCB 1JF1B 4N1CA 4OCXL 4YWGL 3U4EB 4DGVL 3QUXD 3U4AA 3RGVA 3AMKA 1DBBL 4MLIA 5DHVB 5F7FA 4YXKH 4L3CA 2DQGL 4AK1A 1ZT1B 3EO9H 4BUGA 4WW2C 3ZKXC 4ELMB 4FXLA 2EZ0C 1BBDH 1M71A 2Z92A 5I76A 1UWEH 3GSWB 3CIQA 5EH1A 4RAVA 4TSCH 2AXHA 3H9HB 1JWMA 4JFZL 3A6BH 1KXVC 3G5XA 4WV1C 3KS0H 4Y4KB 1H15A 2OBGA 3C6SB 5CZVH 1BZ9B 2EE2A 1SEBA 4ODTL 5L88H 3VG0L 5HGDB 4W68A 2VAJA 4XVSH 2H9GB 2W07A 1EZVX 2ZCKL 3QDMD 4XVJH 5AWNL 5TQ2L 3RWEA 3ZHLA 1T1YB 4YDJA 1MRDH 3MRCB 3X13B 3VJ6A 3X12A 2ATPA 5IESH 2E7BA 3TVMA 4L4VB 1VFAB 3MLYL 4R0LC 1UKTA 3IF1B 3TYGL 5ESQB 1YEGH 3X14B 4XAKE 1TTUA 1P69B 1CDJA 4I2XA 1S9YA 3QFDB 4KRNA 4KK8D 1R0AH 4WHTB 3FQXA 2X4UB 2MHAB 3MO1B 4HIJA 3LH2H 2EDLA 43C9A 3QUZA 1ZA3A 4KTDL 5GJTL 5I1DA 4DKEL 4UINH 1T83C 4IIQC 1YUHB 5B39A 4R8WL 4P2RB 3GHEL 4G6KH 1PKQB 4KKAD 4Z7UF 1OB1B 4NRZB 2FO4B 1NCTA 4QRPD 5C6TL 5J3HD 3MRRB 4OLXL 3FQUA 2WLZA 5CEZH 1KJ2L 1D5IL 3UTOA 3WXWH 1R3HB 2P24B 1RU9H 2ARJB 3CXHJ 5I6XC 3MPCA 3D85B 4PS4L 1BF2A 2P46B 5GRUL 1S9VB 1FE8H 2WWMD 2AXGA 1OP3K 5CKGA 1T20B 3CDGB 1KELH 1QPXA 1NCBH 4YNYA 5CGYD 1BD2B 4KQ3H 2Z35A 4NHUA 4Y7MA 3UYPA 1IC1A 4PP2A 5DMGC 4KDTA 4W4OC 3VH8G 4R3SA 1DEEA 4AM0B 3JTSB 3IFOB 3FRPA 1QSEE 5D1XB 5JTWA 4NJ9H 4P57B 5HGHB 3IS1X 3FOLA 2R4RL 2H2PC 4ZSOB 3WS6A 4JG0H 3VFSB 3IJSA 3KPRD 1EEZA 1T3FA 3W2DL 4BH8A 2DKMA 5ICXA 2ICES 3LD8B 4N9OB 4W81A 5GGQH 4GW4A 5H2BB 3HZVA 4HHAA 3ZL4L 3AB0B 2F58H 3IVKB 1S7XB 4U4BA 4YUEH 4PJGF 3BPCB 4HFUH 1ZS8B 1KENL 2HRPL 2BSTA 1EFXB 5F9JA 4ORGB 4GRWE 2AJSH 3BISA 2ZUXA 5T1DH 5IKCA 3O11A 1R5WB 4WFHE 3MLUH 3HFML 1ES0B 3QEGH 5CGMA 2DQCH 3TZVB 3RWJA 1BZ7A 4ALAH 2NY2B 1D6EA 2VR9A 3FT2B 4J12A 2YRLA 1OARL 2E7LA 1AY1L 1G0DA 2DQJH 1DSFH 1N5AB 5ALBL 5FOBA 1LDPL 3VFUA 5E6ZA 4DK6A 2AK4A 1F4WL 1L7TH 3NCMA 1ITBB 3UTQB 1B0RB 1SBSH 4RISL 1GGBH 5B3JF 4X83A 5HI5D 2X9WA 1A7BA 4V2BA 1DQQA 1GZPA 1OAQH 2R0KH 1UZ8B 3FQRA 3QUYB 4I0PB 3C08H 2EYSB 3P9MA 4WI4A 3EOYG 3PWLB 3A67L 5I8KH 3MV7D 4U1LB 3WJJA 3QHTC 1U95A 1PFCA 4HS8H 2XZAL 4LBEA 4QOKE 3HLAB 4ELKB 3MTRA 3SE8H 3OKMA 1P2CA 3IU3A 3E2HB 4TPRL 1PGRB 3O41B 3ARDD 4XP5H 5JW4R 4Z7UE 4LHUD 4QWWD 4PV8B 1ZA6A 2YOCA 5IFJA 2ZCHH 2VDNL 3QYCA 2C1PB 3H3PL 4E42A 5FO8A 3NCJH 3OGOE 1NCAH 3N1MC 3PV7A 1A1NA 1MFDL 4AEIL 5BOZG 3TH2T 1V05A 4JJ5B 5KS9A 3UTTA 1RZGB 3SDXB 4QHMB 5D1ZA 3G6AA 4POYA 3QDGE 1HHIB 5D1QD 3LIZH 1EUTA 2ZG1A 5FO7A 5I1KL 4X6BB 1ZLWK 3S36X 3SHSA 3I6KA 2AV1B 4M6OH 4G80A 3KXFD 4YAQB 4Q2ZB 3I6LD 3WIFA 5JOPD 3QJHA 3H2WA 7FABH 2IBZX 4YHYC 1Y0LB 3FTGA 1WFOA 1HHJA 1I1AB 4OZFA 5FKPB 1CE6A 3V6ZB 3MUGB 2AEPH 3RUGB 4PJAB 4XNZB 2VLJB 5FGBC 4N5UA 3ARFA 4G8GE 3S88H 1RULL 4OD3H 4PJGE 4ERSH 5GGRA 2X4SB 3CK0H 4OZHA 4OFYD 1LO4H 3BP4A 2F54E 3MRMA 4U1NB 3HI6H 2VDPH 5HHOA 5H94B 3GJFK 3G6JF 5FAAA 2A0LC 1E4XL 3AM8A 5CSZA 2Z8RA 1R3KB 2XZCH 2NY0B 4ZUUB 1MNUH 2FR4B 1F90H 1T5WA 4XC1L 3IGAA 3KR3H 4Y2DC 4OBRA 4FQXC 2C4FT 3TCLB 1S7UA 1PQZB 4YFLI 4WEUD 3QEQA 3TT3H 2A1WL 1MFEH 1HSBA 4JZJA 3LEVL 4FXKB 5ICYA 3OWEA 3HPJB 3QWOA 3QIWA 1QR1A 5JW4M 1ZAGA 4PJ5B 5D7LB 1X5XA 2VJXA 1YEFH 3PP4L 4GKZA 4S2SB 1HZHH 4NQCD 1ZVHA 3EFFB 5HYFA 1ZTXL 2I26N 5C7XH 3JV4B 1ZANH 1ADQA 3PWJB 5IVOA 4PJ7E 4QHKI 2ZSWA 2WANA 1LMKA 3RJDA 1IKFH 1AI1L 1RUMH 4PY7B 3L5WB 5D70L 4B50A 1RJZB 4XB7A 1U58A 1KN2L 1NC4B 2DWEA 5ANMB 5E0QA 5IQ7H 4ZYKB 1A7RH 3W11D 4HIEB 4Y1AD 5I1AA 4I5BB 3BWAA 1R5VA 5C9JB 5L2KD 1U8NB 1IGTA 1DQTA 1NGQL 1VCAA 4MA3A 3ME0A 4XXDA 1RVFH 2WIIB 3W5MA 3K2UH 3OKOA 5E5MB 4IJ3B 3KPNB 3J8F7 2W91A 2AEQL 3I2CH 1P84K 1X3DA 2VE6A 4HDIB 4JQXC 5FYKE 3GHBH 5JO5B 4LAQH 2QQNH 4Y4FA 2WZPD 4MD5B 2HH0L 5ESVA 2P49B 3MNWB 3P4NB 5I18L 2R0LH 3VWJD 3MRDB 2ICWI 4NNPH 4RRPA 7CGTA 4XAWL 3MZTA 5I1LB 3BKJH 3CZJA 4Z7OE 2DTML 3D2UA 5HVHB 1QSFE 3HAEG 1FVCA 2HTLD 4UQ2A 1OGTB 4RGND 2D7MA 4LMQE 4HIHA 4RGMB 4WUUA 4DGYL 3UTSE 1CD9B 3H0TB 2X41A 3WE6B 1K8DB 3N1FC 4POUB 5BVJB 5T5NF 2KL6A 3C2AL 1AP2A 1EK3A 3U0PA 2WBJD 1B6UA 5EWIH 3PL6D 3HMWH 1S8DB 3QXDB 3F6LA 4APQC 1WFNA 5EO1A 2BHZA 2Z31B 1IAOB 4L3AA 3MA7A 4JO3H 4KRPB 3T08A 1U8HB 4M7LL 3VE0A 4M6MH 2EDKA 4RQQA 4KQ4L 3MBEB 4QCIB 1GIGL 1K3IA 1FDLH 3G5VB 4HT1L 2G5BA 2ZOKB 1KJ3H 5F7UA 3RWFB 3LAFA 1NFKA 2ZJSH 1K5NA 1NGZA 4Q9RL 3AS2A 1D5BA 4M5YL 4P23C 3B43A 4QRRE 1NGYB 1AR1C 3C5ZC 1KLUB 5A2FA 5CWSA 4TOYH 3WEXB 1ULVA 3G6JE 3LB6C 4OI9A 5FB8B 4MD4B 3MV8E 2BK8A 3RDTA 3QPXL 2ICEA 5E2WL 4K7PH 4MVBD 1T7ZA 1PG7W 1E4WH 5IB2A 2GJZA 1M7DA 1T6WA 1H8SA 4GBXB 4HWZB 3MCLH 4MAYA 1L4IA 5GZNC 2P45B 1P4BL 5E08L 3HI1A 4Q6YA 3RL2B 4LRNH 1BJMA 2NX5D 5CEXA 4WEMB 2IALA 2CIIA 4NZUH 1OP5K 4M48L 2FGZA 1U8OA 2VXQL 3DVGB 1V7ML 3L3GA 2ZKHL 4NN6B 1KCUH 3QXUA 3BZEA 3IFPB 4KJWD 1XGQB 3LN9A 4XBGA 1LO2H 3TBYA 3C6LC 4DVBB 3AREA 3E3QE 4BQ9A 1F3JA 3MFGB 4ENEC 3UBXI 2HWZL 4IS6A 2YXFA 3P4MB 5TPWL 3GMQB 3RKPA 3DYMA 4LCWE 4QXTA 3GO1L 5IFHL 3RAJL 4HCRA 1R3JA 2I60L 5IFAH 4M7LT 3OGCB 2KH2B 5E2VL 4OB5L 5F44A 4AT6B 1ZT4B 1FSKC 4X4XA 1KOAA 1M1SA 3EUUA 1A47A 3QUZD 4DW2H 1RZ8B 2HMID 4X8JA 4XPTL 3VFNA 3TO4A 3BH8A 3QUXC 5EU3A 4NCC1 1K4DB 3EIFA 5HTSA 5HYJA 3IB4A 1Q8MA 2JB6B 1REIA 3SDDB 4BQ8A 3D39E 2OTWA 1N6QH 4LLMA 5E8PA 2H26A 2N7BA 1K3ZA 4UUJB 1CFVL 1YY8B 4PJ9A 1HDMB 1JGVL 4K3JL 2A83A 3HR5A 3PXJA 4IHOB 4P4KC 4Y89A 3W39A 1EHNA 2AI0L 1IGMH 3OKDA 4ZPTB 5D6DA 3ULUD 2WINA 2F19H 3IAGC 5DK2B 4NQUA 1P84J 1S7RB 2CLRB 2O61B 4JM2F 3HKFA 5DJYA 1TJGL 1UM4H 2X7LA 2G5RA 5CJOH 5AYUL 2BDNL 4NKIL 2OK0H 2JJWA 1EGJA 4J1UA 3D3VE 1A3LH 2IANE 1IAIH 5EC2B 2OZ4A 4YHIA 3QXAB 5C0BB 2YWZA 2IPTH 3HNSH 3NA9H 5LGJA 2FEDD 4GRLC 4R26H 5IHUL 4NM4H 3S3SA 3AFLA 4KTEH 2VLKB 5B38A 5IB3A 4M00A 2JCCF 5HDQL 5ICZA 2I07A 3U82B 3FQTB 4E41A 3QDJB 1RIUL 4JY4B 1SYSB 1DZBA 1UM5L 2ZOLB 4LEOA 2YD7A 1N5YL 3ORJA 2ADGB 3T0DA 4HMEA 1TCRB 2FJHB 3BKML 4GAJL 2ARJQ 3O2DA 5F88B 2ENSA 5DJ8A 2AJYH 3VGHA 2X4RA 4CL7A 4KROD 2E8YA 4QHKJ 3V7AE 1J1XL 1JNHA 4JREC 4KK6D 3BI9X 3ES6B 4HBCH 3ZE0E 2DB8A 4KKAC 4K23H 3OHXB 5EIIA 5T3XL 2X09A 4LGPB 5J3HC 3KNBB 5DVOA 1DQLL 4TVPD 4Z7WF 4LVNB 4V1DB 3TA3D 3MOAL 1Q72H 4OM0H 1JI1A 4I3SL 1XGYL 5E00A 5JOFA 3WUWA 3O3DB 2CXGA 3WLWC 1C5DA 1MCEA 3C9NB 3TBVB 4GAYB 1OAZL 2CDFA 1RV6X 1RIHL 2HKHL 3VWKD 6FABL 1RZ7L 5K93A 4RA0C 3MJGX 1QFUL 1HINH 3H42L 4M8QB 3SO3B 5KSBF 2ICWJ 1T21B 4HGWB 4OBSA 4U1JB 3O6FA 1OPGH 3OKNA 3VXUA 1QYGL 3C5JB 2FSEB 4OFKA 1DBML 5GGVH 1EDQA 2BX5A 4XP1L 1W72B 1WSST 1X5KA 2VH5L 5JW3H 4J4PA 5ADPH 5FYJL 4G6JH 5EUOA 2XQBL 3O2VH 3TJEL 1HNFA 3T04D 1OP9A 4DZBB 4PJXB 1DTUA 2EEBA 1I8LC 3L5HA 4U1GC 3E0GA 2Q1EA 2CK0L 3BO8A 1NCCH 3UZVB 3GMOA 3MRNB 4PJEA 1WZ1H 5C07B 4KMLB 4IDJL 4EBQL 1ORSB 3IDNB 4JG1L 2APTA 3RTQD 4HK0B 2VERN 5FGCB 1A7OL 1LO0H 1FH5H 3PG2A 2X6MA 5LAXB 1I1RA 1LWRA 2W65A 3KPOA 3UTTD 2PYED 2AJ3A 1EMTH 2AW2A 3OAZH 5ITFB 4DTGH 5L0QC 2R8SL 4MQXD 1Q0XH 3W9EA 3AS1A 5D72H 3MX0A 1IEHA 3NAAL 1T2QL 1MLBA 2A74A 3I85A 4F7EA 2OL3B 3BGMB 3D5OF 1SY6L 1OQOA 5FYKU 3P11H 5I8OL 4ONHA 1KC5L 4I48A 3EDDA 2V2WB 4HXBH 5E94A 4G8EB 3ULVD 1QACA 4U1MA 5GIRA 2JCCE 4NQXA 2BC4B 2FH8A 5IP4A 3AC0A 4NN5B 1PG7L 4GG8A 3P0VH 5E24E 3DTXA 2XNAA 5J1SC 2QV2A 3RVXC 4JDTL 4URTB 4XVSL 4ZO8A 4OF0A 1VACA 3ARFD 1MPAH 3KLHD 2VLLA 2GK0A 1G0YR 2P5EB 3LKRB 4O58H 1DQJB 1URLA 3L95A 5CCKL 5GS1B 3B9DA 2HJKA 3AU1A 3ZO0A 2BJML 1LE9B 1O7VA 5ERWB 5DJZB 4PJ8A 1HSAA 1K4CA 4QRPE 1XGRB 1OSPH 1YNKL 5EZJA 3WV0A 4ESKA 3T3PE 1F6LL 5HHOD 2ADIB 1WC7B 4QWWC 5L2JA 4OGXL 4N68A 4Z7WE 3AXLB 2YD8A 5JORB 1A3QA 3V2AR 3V6OC 1JTTA 1LP9A 5ID1B 5HBBA 1JZ2A 2APXA 2R2BB 3QEQD 3O8XB 1T0PB 3B9KC 3V52L 3V4UL 3PWNB 5E2TH 3ZTJH 3SE4A 3W0WB 3O3AA 5DUML 2FWOA 3KYNA 5F1SA 5C0CE 4KHTH 5DRWA 2HVJB 5DRXB 4UMGA 4PRIE 2YWYA 4QY8B 1II4E 5DK3A 3MFFA 2OSLB 3I75A 4PP1C 3RZCA 4JHZA 3U4EA 3BMVA 1EO8H 25C8H 5F7EL 3RPIA 3QULB 2P5WE 3B6SA 5EU7E 1B4JH 4XWGH 4HF5L 5TE4L 1XCTB 5E56A 3WFCH 4S1DD 3BOVA 2AJUL 1I85C 3GSWA 3WXWL 4GS7C 4NWTH 4P5TB 5D2NC 5HDBF 1N59B 3JV6A 2QSCL 1JYVA 1Y18B 3H9HA 2DQUL 1AIFB 5CILL 4OI7A 1WIPA 2V7NB 1S9XB 5IMLA 4G7YL 4LP5A 1CGVA 3FZUD 3GRWH 1I1CA 5C86A 1INDL 2YS4A 1WIOA 4X5WA 2RCSL 4ZS7L 5EZIL 1WWBX 5FHAH 4C59B 2ERJB 4AY0A 4PBWD 1G6RA 2H9GA 5IT2L 4U1HB 2FNBA 5AG8A 5IUSA 4KFZC 1DP0A 3V6FB 2DKUA 3MRCA 3X13A 4JG0L 2YD4A 1FNSL 4QRQB 2VLRE 4KK5C 4YGVA 1RHHB 4LIQH 3VXTA 1T22B 4C56D 4XGZA 5GJSL 3B8YA 2QBWA 1G7JA 4LSQH 3BRFA 4PRNB 4N0FB 4MNGB 3IAPA 4RWHA 1NBYB 4PY8I 4WHDA 4QNPF 1HXMB 4WHTA 3ARGA 3QWQB 3SE3A 1AGEB 4YR6B 2DQDH 1JZ3A 3BZ4B 5DT1L 3VRIA 1A2YA 3MV7E 5T1DL 2D4DA 4HH8A 4HWBL 1I7UB 1CLYH 4ODHL 1KPRA 4NZRH 5K9JL 1BFOB 1YUHA 4I3RH 1NANH 1PKQA 4FTVE 3F5WA 4ALAL 3K8KA 4XNMB 3W11C 3L3IA 5IEHA 2Y9RT 1PY4A 2FO4A 4G7VH 4X80L 3MRRA 4BZ1H 3BPLC 4TVPH 5INDB 1F8TH 3HA0A 3HPLB 3G6DL 1R24B 4N90E 5I30H 1IM9B 5JPNB 4L8DB 4J8RA 1A6TA 1LO3H 2BRRH 1KLGA 1OAQL 2XXMB 4OZGA 1HXYB 1S78D 4CAGA 1KJVB 2YUZA 3C08L 4QHNB 5DQ9A 5LQBL 4ODBD 4KVNH 5KVMC 3IYLW 4Z7VE 5GSVA 1KEGL 1HWGB 3I6LE 4LSUH 2HTLC 3L5XH 4ZSOA 1L7IH 1QFWM 3MRGA 4RGNC 2Q87A 1T4KA 2C3GA 3P0YL 5D71L 2A6KB 4Y16B 2OI9C 1A4JB 3RWDB 3V0AC 1KIRA 1YY9D 3MRFB 3ARED 3LCYA 1A6UL 5BV7L 3PL6C 1NCAL 4R0LB 2BSSA 5HDBE 3BEWB 4U6XA 4K7FB 1MVUA 5HHVL 3IVKA 5HI3D 1TTFA 3DSNA 4XZUA 1KCRL 4MNQE 3DX9A 5TE7L 3FN0H 1V3KA 1X5LA 4QHLA 2EECA 2GJ6A 2ZSVA 4L8SB 3ECBA 4NQEB 1R5WA 1NAKL 3LKPA 4M6OL 4IRJA 1TMCB 3KDMA 3VGEA 5HYJD 4XHQA 3X17A 1QZ1A 1TZGH 4ZMAT 2CO7B 1JYNA 7FABL 1FBIH 2UYLA 1BQHG 3CFJA 3FT2A 2FBOJ 4I18A 4PJ9D 1TQCC 1U8IB 1D6VL 2YPVH 5GRVL 4UU9A 5L6YL 2X1WL 2NY7L 3GI9L 2AEPL 3HUJA 5JMOC 2ESVE 4Z7UB 1T5XB 4O5LL 3UTQA 3S88L 4P5KB 4LSSL 4JRYE 1WVZA 4BFBD 1VGEL 4P49A 2XG5A 4JFDA 5FOJA 5SX5H 5C0AA 3WXVH 4Z76B 1UZ8A 2Y4SA 1G9EA 2NY3D 1A7NL 4PG9A 2R0WL 4YHLH 1FGNH 1LO4L 2V5MA 3B3IB 3S35X 3O6ML 4IDLA 4HJ0D 4Z7QF 3CFKA 4KMTH 5HPMA 4LDEB 4LU5H 3G9VA 2YA0A 5LCVL 4ELKA 1WITA 3PWPD 4Q58C 3HI5H 3QDGB 5EOQL 5T1LB 4JZOA 1U6AL 3PABB 3T3MF 4KDVA 1BIHA 3DURB 1LEKB 1MAML 2GY5A 2GUOB 3MBXH 2F15A 1FZMB 3QA3B 5E03A 3TT3L 3JV5A 3P30H 4QGYA 3FKUS 3Q1SH 5FUCC 3MV9E 3MRQA 4UT7L 1Q1JL 5DDHB 4XP9L 4JPKH 4KUCD 5GRZA 1A4KA 4XMPH 1IZJA 4A6YA 5IQ9B 4JFEA 3VXPA 2HMIC 1AR2A 2IG2L 4JJ5A 5E99H 4HUWB 3SBWC 4QHMA 5I71B 1FIEA 1I4FB 4KTYA 1KB5A 4G8GB 4WU5A 2M8XA 5I1GL 2CRMA 4NO5B 4Q9QL 3K4ZA 4FNLL 3TJHD 3D69B 4PJGB 5SWZE 3N1PC 3HB3D 1BMGA 1CG9A 4H1LA 3ULUF 4G8IB 2XN9D 3MLTA 2F54B 5AUMB 32C2B 3V0WH 1TZIA 3HE7B 5ELIA 2JJTC 2HFGH 2VB5A 2CRZA 3EYVA 4B53A 2A6JB 5J13B 1J0ZA 1T66D 3QQ9D 4JFFA 4O02H 1OTTD 4MQTB 1Q0YL 1MCOL 4FQ2H 2VKWA 3MUGA 2P48B 4S0SD 3RUGA 2VLJA 4QF1B 3PQYA 4HKJA 2FBJH 2G75B 4EN3B 5HD8D 3RX7A 2WUBH 2OTUA 3O6FD 4N1HB 2FEDC 4WGVB 1H3GA 1X9QA 3NBNA 1AO7B 4NC1E 4DGIH 3CFBA 4WFFE 1AXTH 1EUUA 4UTBH 4J4PD 4HUMB 4LCIL 4OQTA 1A6ZB 5H94A 1DUYB 4PJ7B 1UXSB 1FG2B 2EYTB 3JV0A 1ZV5A 4KJPD 1R3KA 1BECA 2FR4A 5SWSA 5DD3H 4UTAH 3SGDH 3RWIB 4PY8J 1AHWA 2XI9A 4KGJA 5DFVD 5EWIL 1IQWL 1BFSA 5DJDA 4FXKA 1HHGA 4KROC 4HFWA 4HS6B 4LVOC 4K3GA 1M7IB 1P7QA 4LLQA 5BRZD 1H8OA 5TJWK 4OLYL 2DWDB 3UJIH 4HC1A 3VXNA 43CAB 2XWJB 4IBLT 3OJ2C 2HJFB 4GUPB 1JUFA 2DD8H 1GGCH 5INCB 3PWJA 1WAAA 2K9UA 3DGCR 1MRFH 3FFDB 5EOTA 3C2SA 2D7QA 1X4XA 1NMCB 2VR5A 4LAJH 3BIBX 5FK9B 2PO6D 1QLFA 1NC4A 3BP7A 3SY0B 4ZYKA 4GXVH 3QXWA 4HGKC 4DJMA 3VGGA 4G6AC 3OJDB 4OAWA 3LPWA 5C9JA 1U8NA 5ID0B 1QSFB 3L5IA 2V5RA 4TSBH 4PG2C 1MIMH 4OTXL 5BXFB 1RZJC 1JZ5A 2YPLD 5IG7B 3VWKC 1NPUA 4JGMA 3T4YB 3UTSB 3GMLA 1JFQH 1IRAY 3U1SH 1YDPA 4ZTPH 3X11A 4LRNL 4Z0XB 2JB5L 1WT5C 4MA1B 2F8OA 4I8DA 4XCNA 1DEDA 4F7TB 4TNWK 4NUJA 4D94A 3ARBB 5EDXA 4MZ2A 3QFJA 1A5FH 4EVNB 5KAQF 1Z0MA 3T0VA 4YHOH 5CD3A 4OFIA 3UJTL 4J7RA 1RFDH 2LU7A 2PN5A 3ALXA 4BFIB 4XTRC 1WCBA 4JGUA 4NJAL 3EBAA 3DYPA 5IJKA 3ULUE 2AQ3A 3ARZA 3LEXB 3AS0A 3T2QA 4TRPH 2Y06H 1H5BA 5KS9F 1ZWIB 3G6JB 3RTQC 1HKFA 1RK0B 3MV8B 5F1NB 1HNGA 5GPRA 2EKJA 3KPQB 3P4OB 4LEXL 2CR3A 3MBEA 2L0DA 4M1CC 1QBLL 3JWOL 3HNTH 3KWWA 2VN4A 4JPWH 3RWFA 3V0VB 1O0VA 5FGSA 2X5PA 2PNDA 2WP3O 2J8UA 3RWGB 5D5MA 3B9EA 2BOCA 1AGBB 1YN7A 3ULVF 4RCAA 1NFIA 5DD5L 2MFNA 3UMTA 5MEPA 1KLUA 3RIAF 4MAUH 1IC5L 1WICA 3GIVB 4NBZB 3ZDXF 4YXLL 4IRZH 1J8HA 1JHKH 5KSAC 3HCVB 2NXZC 5GSRB 4H25B 4CMMA 1FQ9C 3MNVA 1BAFH 3Q5TA 4CADB 1XF3B 4EUPA 5JXAH 4KZEH 1W72L 3MRHA 3UYRL 4CMHB 4G8FA 2ZP0T 4MCZB 1CK0H 4OZHF 1C08B 4MXQC 3VMOA 3PV6B 1MJUH 1D7FA 2ICWA 4ZD3H 8CGTA 2IPTL 1INQA 4LDOB 3WFBL 1TENA 2NPLX 2G2RB 1MCLA 2NLJB 3MRIA 3KPLB 5LXGL 1IL1A 1FORH 1RURL 2MKLC 1JE6A 3LN4B 1KJMB 3QCVH 1NMBH 3D39B 1KYOK 5I1CH 1XF4A 2AK4E 2C3VB 3UDWA 3ZKNC 4NRXB 1JGEB 4HEPG 5CJ8A 2XKNB 1CD8A 4ZFOL 5GRJH 4OF5A 4APQB 1BGXH 5MHSD 1RZ8A 2FZ3B 3HC0A 1U42A 5BZWB 4EI6A 1A14L 5EU5B 5GGTA 4R4FH 2EXWD 4I0KA 3JVGA 3D3VB 4GH7B 2IANB 5MENA 2IAMB 3VDAA 5DJ2A 1HDMA 4YDVB 1NGXA 1LD9A 3BEVA 1G7PA 4LSTH 4BSWB 1J7VR 4GXUM 4M9OA 4X7TA 4DQOL 1QLRA 2GSIA 3K0WA 2D03H 2NZIA 3NCBB 3VXSA 3SDYH 4WWKB 1NCNA 3WNLA 5B4MD 2ZUQB 4P46B 1EEYA 1WZMA 1D9KB 2H8PB 4ZOBA 3CNKA 5I75C 3TPUA 3QIBC 1E6OH 1IBGL 3RVTD 1QRKA 4YIQB 4XP6H 1J8KA 1HCFX 1QNZH 5BS0D 2F9BT 3ROOA 4IRSC 4OM1L 3PGCB 2OYPA 3NIDF 3KYAA 5LJYH 3A6CH 3B2UD 3PDOB 1JWSA 3GSQB 3R0MA 4CVZA 3ZMRA 3ULVE 1NCCL 4Z18A 1VFOA 3LDBB 4ETQB 1P7KB 4JY4A 4QXUH 5IVZA 2GT9A 3RY6C 3OSKA 3SEPA 1FV1A 1AXSA 2LTQC 2VUOA 1LO5A 3RX8A 3VXMD 3MJ9A 1IEAB 2XY1A 3L3OB 1TETH 3TIDA 4M7KH 5K59F 2R0ZL 2KZWA 4YHZH 5FCUH 3C8HA 4DTGL 3SCMB 4OZHE 3V5DB 2DYPD 2GJ6D 3FQWA 5IJVA 5EZLB 1CLOH 1Q9KB 3CSBA 5HHOE 2FD6H 3I3DA 4IRJD 4YHNA 4LOUD 2UZYB 4JHWH 3B2VL 3N50A 4AL8H 3FMGL 3CVIL 3HNVL 4KKCD 1JPSH 4AZ8A 2UZXB 4M7JH 2GY7B 4P2OC 4XMLH 2BNUB 3EJZD 2BNQD 4KGLA 1DLFH 4W70A 3O3DA 5FECB 3REVA 3QEQE 5GRVK 3TN0A 2A6IB 3O6KH 3TBVA 3CH1B 1JZ6A 5CIPA 4LQFH 4P2CG 2DN7A 3TESA 4WO4C 2FYYA 1S78C 4NO0B 4PJHA 4O2EA 5KSVA 5GHWH 4P2YA 3VXRD 4WW1B 4S1QH 3SDCC 4MJ5B 2Q8BL 4YFDB 5FHBH 4IM8A 3TFKC 1MHEB 4OLUH 3OXSA 2AV7B 2R2CA 1JNLL 5DJAB 3WHXA 1CLZH 4JM2B 1RD6A 2P8MA 3MGTA 4GRMA 3OAUH 4F57H 5KG9B 1GPOL 2RQ8A 5F9OH 5C3TA 4OKVB 1UCBL 4BZYA 5DMIH 4NQSB 3PF2A 4WI5A 1KYOJ 4DZBA 4EDXB 1HHHA 4PGDB 4PJXA 5C2UB 5JDSA 4JZNB 2V2XA 1F6FB 2DICA 3KHQA 4XNYH 5E6IA 2XA8H 4PRHA 4XCCL 5HI3C 3S4SB 5DF0A 1MLCA 4WCYH 3DSFL 4TUOA 4WHYH 2E6JA 3KYMA 4RMRA 4XCEB 4JO1L 2EYRA 4LASL 5F1IA 2JCCB 4AMKL 4F9PA 3R1GH 4NSKA 4JFED 4IMKC 4WTZA 1QUNA 2OJEB 3AY4A 5LAXA 5KN5A 3CMOL 3MXWH 2Q7YA 1G84A 4D3CL 2FIKB 2HFEB 3REWA 3U9UB 2P4AB 4QTHA 5JW5A 4ZFGH 1EO8L 1UQSB 2DIAA 1VFMA 4GMTH 4KI5D 3D87B 5K9OB 3GBLA 1MI5E 2OL3A 5FF6B 2YC1B 2YPKA 2ZZUT 4WUUE 3EOAB 4QRPB 3RIFK 3ZDYF 3MRLA 2F74B 4G8EA 1FFNA 4ZUVB 3KPPA 5TDPB 4JO2H 4JFFD 5I2IA 2A9NL 3BH9B 2JK5A 4EDWL 1I7ZB 4P4RB 2RHEA 3P3YA 1XT5A 5EO0A 4Z7WB 4GW5A 3VGAB 3GRWL 2ZUUA 4XNUH 4OLEA 2DLFL 1C1EH 1OF2A 1YMMD 4NQDE 1HKLH 1NCDL 1NC2A 4JJHA 3HE6A 1OTSD 3LKRA 3GM0A 5DC4B 4HJ0C 5K59E 5DC9B 1GZQA 1PBYA 2NXYD 3HN3A 3ROLB 3G5ZA 4I77H 5DJZA 3MJ7B 4PJDA 1NGWA 1QA9A 5C0CB 3GIZL 5I1JH 3CJJA 5JQ6H 1MWAH 4PRIB 5DMJB 5KSBB 2IF7A 1DQDL 4M6AA 1JJUA 1WC7A 1X5JA 4KUCF 5KVGH 1TXKA 2GSGB 2VDLH 5ENWA 2QADC 2P5WB 4Q6IA 4U31A 4UV7H 2PR4H 2A2QT 1OL0A 5I1HL 4RFOH 4Z5RA 4ODXA 3TLRA 5I73B 4HMCA 5D96C 1PX4A 1CDGA 4FQQB 3V4VL 1EH9A 1JHLL 1P7QD 3BZFB 1QOKA 3W0WA 3FT4B 3ZE2F 2HVJA 1J1OL 3H7BA 1ODAA 1ZLVK 2AXJA 3EFDL 4HXAH 3HB3C 2OP4H 1PJ9A 2BSRA 1FZJB 1GAFL 3RNQA 2DTSA 3HRZB 2WV3A 1KT2B 3QO0B 5DRNA 4ZPVB 4BZ1L 3MCKA 3GSOB 1T66C 4OLWH 1X4ZA 5CHNB 4RMWA 4P5TA 1CTNA 5IR1A 2D2OA 3CFCL 3WD5L 1BQUA 1I9JH 1KULA 1KTDB 3DX8A 4QTIH 1G7LB 3QI9D 3IDGA 1LO3L 4UDTA 3DETD 5HD8C 1I3VA 1RZJL 2EDEA 4LCUA 1OP3H 4LSVH 3T4AB 2IMNA 4K8RD 5F7KC 4D9RE 2A9ML 5EUOF 5HYJE 1F5WA 4K2UL 2GW5A 1P6FA 4LSUL 3QUMB 3RGHA 1VSCA 4JR9L 2Z9TA 5IW6B 3MV7B 1SHMA 1MAJA 4KJPC 1CE1H 4XB8A 4PJEF 1C16B 1KCVL 2E3VA 4PD4K 2V17L 4R4NC 3GB7B 5B8CB 5T5NG 5FFLA 4X6EA 4FTVB 1GC1L 3ARDB 3SKOA 4HJJH 1H0DA 4HLZH 4LHUB 5DSCA 3RQ3A 3FHQA 5AZEL 1YC8A 3SGJA 3Q48A 3BUYA 4MNGA 3FRUB 1NBYA 2G9HA