3LQMA

Structure of the il-10r2 common chain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
201
structure length
201
Chain Sequence
MVPPPENVRMNSVNFKNILQWESPAFAKGQLTFTAQYLSYRIFQDKCMQTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVQITFSPVDDTIIGPPGMQVEVLADCLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKQGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Interleukin-10 receptor subunit beta
publication title Structure and mechanism of receptor sharing by the IL-10R2 common chain.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqmA01
1D5MB 3Q5OA 4L4VD 5J9PA 1M7IB 2HT2C 2PTVA 2B1AH 3WXVH 4EXPX 3QSKB 3I3BA 4IRSC 2A6IB 4HS3B 4Z77B 5JOEA 4OI8A 3O6LL 2XKNA 3EFDL 5LQBL 1JWUA 1D5XB 2VJXA 4L3CA 2OYPA 4XPHH 1KG0A 3OKLB 5IROC 3UTPD 3H42H 5IQ9A 4G9FA 2ZOLB 1F3DH 2K3TA 3ZL4H 3MJ6A 4XCCL 5CEXA 3TYFA 3L3GA 3FN0L 1H3GA 5L8LB 4L8SA 2OTPA 3WJLA 1INQB 4JM4L 2C4XA 5F9OL 5IEKA 3VXUE 4QTHA 1LO5A 1BQHA 5EFIB 3RWIA 4DQOH 4YDJA 2VLRB 4KQ4L 1S9KC 4HEME 3VH8G 2UWEA 4WJ5B 3PWNA 1A6VL 2IPTL 1EH9A 2D7OA 1CGSH 1P4IH 4R2GB 5IBTL 3RL2B 3KPSB 2CKBL 3VFGL 1VADB 2VDRL 4FABL 4WTZG 4GAJL 2ITDA 4Z7QE 4ZOBA 3MRFA 4FS0A 1IRAY 4QRPE 1C12A 3WNKA 2EDWA 3MRPA 4R4FH 2ITCA 3GMOA 5J6HA 8FABA 3P73A 4K7FB 4OIAA 5DURD 2ARJA 4LU5H 5EBWB 2A6DA 3S9DB 2A6KB 1N64H 2X4PA 1FNEB 3LHPH 2EDDA 2XKSA 3BEWB 1HEZB 1WK0A 1XF4A 1WT5A 4U0RC 4UB0H 1NCUA 4Y7MA 1AXIB 3KXFD 5TDPA 4TUJA 4L3AA 5I1GH 5JR1H 3LDBB 4MAYC 3GHBH 3WLWD 4YHNB 1RZ7L 1DDHB 5F7DB 3PL6D 3BSZH 3QNYA 3FONA 4JGJA 1WVZA 1U95B 1ED3A 3KLAB 1A0QH 3G5XB 1LO2L 4PLKC 3BP6A 4Y5XA 3NTCL 5E03A 4PJFB 3LV3B 4HC1L 5FUOL 3MNZB 1SBSH 1QFOA 5EC2A 4GAFB 1DN0A 3QFDA 4HWEH 2GHWB 4LVOC 4MQXC 1UWGH 1XR8A 3QIBB 1YQ2A 4QTIL 3SY0A 5T5FH 4LIQL 4D9RD 4XCNB 3GMPB 4JO2L 1QR4A 4ODTL 3ZYZA 2WANA 3F7PC 1HINL 1LNUB 2JK5B 4HPYH 1RJLB 1YPZF 3QPXL 2OJEB 5D7JA 1P53A 1IAKA 4F7PB 3KGRA 4U31A 2J6EH 1Q72H 3O8XD 3WFHB 4M8VA 3H3KA 3SKJH 3ZE2F 1T83A 2MCG1 1JF1A 1KJ3H 3C5JB 4YPGA 4OQTH 3S37H 3F6IA 3P4MB 4POUB 2FEEL 2X44D 3LMJL 2R0WL 4PP1C 1RFDL 3IJSB 2ZUSA 1LILA 3CH1A 4WU5B 1HSBA 3FCTB 5I18H 2D7NA 1T2QH 3JVGC 1LEGB 2JF1A 3HCVB 5IJKC 3ILQD 1HSAA 3KPMB 2X4RA 5E5MA 1KCKA 5FHAL 3HE7B 3B3IA 3BVNA 3EYUL 1AHWA 4M7ZB 4YE4L 4EVNB 2DIAA 5CEZD 2W0PA 4YWGH 5KVGL 3KLSA 5D2NE 3X13A 3QCVL 2OJZH 1ZLSH 2WIMA 4GRMA 3OQ3B 3KS0H 1FN4B 4H20L 3RIFF 2JTDA 3RVVC 1KULA 2HRPH 1GAFL 3WO4B 4L4JA 3ARED 1MJUH 4XPGL 1RQ5A 4U6HA 4XVSL 3MLXL 1S7VB 5C08E 1F02I 1H15B 5F1NB 1TCMA 1CZ8H 3CDYA 1FO0B 4NUJB 3MXVL 4FQCH 4HWZB 1MCIA 3TBTA 1KACB 3X12B 1RUKH 3QXTA 1EBAA 3BMVA 3F7VB 4IOIB 3VE0B 1XIWD 4NN7C 4OSUL 4JFPA 4MHHI 2JIXA 4C83B 5JLZA 2YRZA 3B5HA 1NEZA 4U7KA 4MJ6A 3IDXH 1IL1A 5EBGA 3CZJA 3FT4A 5IR1B 2AABL 3KPNB 4Z0BH 2EE9A 4MJIE 4Q9RL 3TNNB 4OJFL 4OM1L 4WHTB 3B9AA 1RZKL 4YHPA 1SYSB 5DK2B 4P9ML 1NBYB 2FJHA 4KUCF 1H5BA 1RVFH 5AG9A 3QULA 4OLXH 4ZPTA 2C5DC 5E6YA 3OR6A 2GIYA 4CADA 3JV6B 4P57A 4X4XB 5EN2B 4KK9C 3WFDL 1SEQL 1A3QA 1JN6A 5MHSD 4PB0L 3BIKB 5C7XH 1Q9OA 2OP4L 3WDIA 4LEOB 5A2FA 3EDDA 3OG6B 3ARGA 3QDJA 1TQCC 4ZNCD 3SN6N 4D94A 4PRHB 4Z95H 1ADQH 4WWKB 4MVBC 2XN9D 4PGDA 3ROOA 1NMAL 1AKJD 5T3XE 2E9BA 4FQXC 3BP7B 3BQUA 4IRJD 1KC5L 4JQIH 3H9SB 1R5IA 5CP7B 2HTKC 3M8OL 1A7PL 4M1GL 3UTZB 3H3BC 5EUOF 4ZUSB 1YMMB 2PR4L 2CRMA 3VI4E 4DKFL 5FKAA 2A74A 4G8GB 3NH7H 4ZSOE 2FNBA 5DJ0A 4N9OB 5BS0B 4ALAL 3B5GA 3NCEB 3VFRB 3NOIA 4HPOL 5DMGC 3GRWH 1YEDA 1B6DA 4FRWA 4WUUD 4NRXB 3ULVC 5FYJD 1DZBA 4GW1A 2IAND 2NXYC 4UZGA 1RUML 5LCVL 1WEJL 5JW4N 5FK9A 5LWYH 1EO5A 1YNLL 4ONGL 4QOKB 3AAZA 3QWOA 1FZJB 5FB8B 3OX8B 3V0VB 3GJEA 4KVCL 3TPKA 1WZ1H 3LAFA 5KS9A 4XC1L 3REWB 4LHUG 4JN2B 4U1MB 3FO9A 4U49A 4PJ5E 4MQTB 4HG4J 1HK6A 1S3KL 1CFSA 2QKIA 1MH5A 1AGCB 5BW7A 2VDOL 5JMOC 3OGOE 2BMKB 2X1XR 3HNSL 3MUZ1 5L2JB 5I66A 3OKEB 1NFDA 5AD0B 1ZANL 1IC7H 2BRRL 3TVMD 2VDML 4LCWD 2WK2A 1D9KB 2I9LA 3CXDH 3VD3A 1IM9D 1PLGH 4CMHB 1KPVB 1GHFL 5KOMC 4I48B 3RGVD 3U2SA 1FV1B 4OCSH 4O5LH 4XP1H 1TVBA 4WUKL 1GRWA 3GSQA 5JZ7D 3RWHB 4DN3L 1YYLL 4FQHB 5IWLC 2C9AA 1KCUH 2GJJA 5BMFH 4NJAL 2XZAH 2RGSA 4TSCL 2DL9A 3JTSA 4YXLL 1TPXB 4UIKH 2B1AL 3WXVL 5KSAA 2ZSVA 3ZHLA 5DDHB 2IFGA 3T8XA 2P4AB 4NHUB 2YPLE 2ED9A 3QUYB 4Y1AB 5KZCD 1VFMA 4JY5L 3K81A 1J1OH 4U1HA 3QG6B 3EJJX 4P4RA 3ZL4L 2BHZA 4QHMB 1ORSB 3BT2H 1NMBH 1I7ZB 1T20B 5CMAA 4Y4HA 3V5KB 4UDUA 2EKSA 4LHJB 2XWBB 4TUOA 4N8VG 4KHTH 3RWCB 3SDDB 3UPRB 1R5VA 4G6KL 1NBZA 5D5ME 3HAEG 5SWQB 4U1LA 5EU6B 5FYLH 4PLNC 2GK0A 5IV2A 4DQOL 4P23D 1U41A 3TBWA 1HHJB 3MA9H 3P9LB 1KCLA 2XFXA 2HP4A 4PRIE 2VWEC 5CFHA 1JK8A 2WQ8A 3O2WH 3MR9A 1C16A 2YHGA 1P4IL 5JA9A 2VRAA 3FAXA 2YWYA 3HC4L 3NAAH 3TO2A 3OGCB 1L9NA 2JE8A 1A9EA 2UUDK 2B0SH 4R4FL 5LGKA 5DHYA 3GMMA 3K0WA 5GSVA 1CDYA 3DROA 1XFPA 1U9KA 2GJ6A 1DE4B 3LRSB 1T4KA 3GZKA 2P42B 4NNXA 2NY4D 1Y6NR 2OL3A 4ZFZA 1CK0L 5F1IB 1N64L 2FHCA 3V7AG 1VHPA 3KPOB 3LHPL 4RISH 4NKDA 3RY6C 3UBXG 2JB6A 2HJFB 4MNHA 4MCZA 4G8EB 1UCBH 4Q58C 2R2HA 3O4LE 1AFVH 1DQQA 2X89D 5FGSA 5E8PB 1UM6H 4UB0L 2CH8A 3JTTB 4GAGH 3S5LB 1DBBH 3LEXA 5B39B 5I15H 5JR1L 1LP9F 1O7SA 5HVHC 2EE3A 3GHBL 5EC1A 5KJRH 2NY6B 2VLLB 5IBLC 2CK0H 4DJMA 3BSZL 5FECA 1HHKB 2AJVH 3TGXA 5ADOH 1A0QL 5F9AC 5IOPB 1JPTL 5I0ZA 5IB3A 2E7LC 1OAYH 1UYWH 3VFUA 4JFEA 2AV1B 4HIXH 4HWEL 3MUJA 3JUZA 1UWGL 4PRNB 2EE2A 4HCRA 5T5FL 2PYEE 2ZSWB 4WFED 3FRPA 2APTA 3DBXB 3C60C 4QYOA 3MLZH 4P2OA 1TJIH 5L0QC 4JFFD 3HB3D 1QBBA 4HPYL 1PAMA 1DLFH 2D7TH 2WP3T 2NR6D 1S9VA 3CFEA 3QWQB 1QSEE 3RDTB 3ZZ1A 5CGMA 4U2YA 5F9WB 3F58H 5E9DB 3RGHA 5EZJB 2J6EL 1Q72L 4ETYA 3EKCA 2ZUVA 1P1ZB 2A2QT 3G6JB 3SKJL 1VFBB 1GIGH 2NX5B 4JKLA 3E8UH 4NN5C 2VDNH 5L2KD 1KJ3L 2HLAA 4OQTL 4AIXA 5MERB 3S37L 1UWEH 3LD8B 1BREA 3QDAA 3BZ4B 5EZOL 4NRZA 3O6MH 4XAKE 4BELD 5D96C 1RJYA 2BVYA 1NPUA 5D4QA 3VGGA 2OBGA 1CG9A 2BK8A 3HG1A 1AD9A 4FFZH 4XNQB 3O6FB 1NAMH 3FO1A 4YWGL 2KL6A 3SDXF 1AO7D 3MLTA 2AXJA 2OJZL 1ZLSL 4X7SH 2B1HL 5FAAA 4JR9H 5SV4A 1T21B 4HH8A 1RPQA 4KDWA 1KPUB 1EV2E 2J88H 5E6IA 3SBWC 5SWSD 2HRPL 2NLJB 1NJ9B 3VMOA 2EDYA 1T7VA 4X7FC 1NUFA 3EOAA 5FYKH 3DRTB 1CZ8L 2H9GB 4M02A 4J2XA 4GS7B 3RNQA 1F42A 2FR4B 2MPAL 4FQCL 1UXWA 2CKBB 5MENB 4QRUB 4MD0A 1FLTX 4YHKH 4RFOH 4JM2D 1RUKL 3D85B 1BOGB 4LRIA 3VXUA 4M03A 1FNAA 1AQDA 2WWKO 3PWUA 3IDXL 3UTSA 4RMSA 3LEVH 3O9WC 4NDMA 4Z0BL 4HF5H 2FJGA 4X5XB 1X3DA 4B7IA 2Y7QA 5MEOB 5EU4A 1OW0A 2HFEA 4ELMA 3O3DB 3QXDA 4GBXC 5AUMA 1HHGA 3FFCA 5B38B 4KI5C 3SE4C 1RZJH 3W9EB 5C07E 2BVQA 1RVFL 4OLXL 1EX0A 4V2CB 3ZTJH 4MB5A 3QPQC 2Z92A 5KG9A 1I1AA 1E27A 2DLFH 1NUNB 5I71B 4I9WE 5AZEH 4PG9B 2EIDA 3M45A 3SJVD 3GBMH 3MRRB 3OPZH 2A83A 3UXFA 3V5HA 4NGHH 1OGAD 1NDGA 3RL1B 3MC0A 5EPMA 4NN6B 3LQMA 4XXDB 2R2BB 3BZFA 4Z95L 3ISWA 3WUWA 1ADQL 3QP3A 3PIQA 5CWSA 4EUPG 1AP2A 2E8YA 3UROR 3MJ8B 3ES6A 4Z76B 1ZS8A 3NIDE 2FSEB 4GQPH 3QIUB 4RGOL 4JQIL 4BKLB 3QFJD 5J12C 4PJHA 5C6PB 1ZK9A 1Y0LA 3QIWC 3GDBA 1YDPA 4D3CH 1KIPA 3GBNH 3BH8B 2XY2A 1U8IB 3K74B 3L3HB 2P5EE 5TGBB 5EU5B 4XPTH 3LKSB 4EI6A 4MD5A 1FL6A 1J8HD 4AK1A 4D9QE 3MLYH 4J3VA 4OZFG 2GSIB 5FHBH 1U36A 4I0KA 1BD2A 4MNQE 2Z0BA 4KHXH 3U46A 1S9YA 3DSNA 3C6LA 5LWYL 3MRDB 5HDLA 5DTFA 3JV4B 2ZOKA 1W2KT 2WBJB 2G9HA 1WZ1L 2MOVA 5F89A 5I1JH 3CXHK 1U8HB 3LQAC 1CD1B 4PFEA 4PJ9A 4TNWK 3T1FA 2N1KA 4NKOB 1BQUA 1EHAA 3SCMC 2CK2A 4LLYA 1P5UA 2X1OA 1QFHA 1G9NC 1PVHA 4NKMB 2RIKA 4X9FA 4MXWH 1IC7L 1U8LB 3AM8A 1NGXB 5GZOC 4X99A 3MRLA 5I74C 3WHE1 5JHLH 3QUXD 3BI9X 3CXDL 3NZ8B 2COQA 5JHDB 1C5BL 4L8CA 3MTRA 1PLGL 3SDAC 4IDJH 3Q5YA 3PGCB 4CDHA 2LVCA 5D7IF 2HVJB 2CJUH 4Q7DA 1OT2A 5EIIB 4LLDA 4XP1L 2EYSA 1YN6A 1FFPB 2BFVH 4C56E 1FNLA 2JJTC 5BV7C 2Y5TA 5EB9A 1JWMB 1KCUL 1F00I 5IMOA 5BMFL 1DUZB 2XZAL 3RUGA 3TWCH 4KFZC 2CO7B 3MRJA 5AYQA 4CGTA 4J4PC 3RZCD 3TT1H 5E94A 3BGMB 2ZUUA 5I8OH 1T22B 4CJ0A 4LK4A 4Z77A 2A6IA 4HS3A 3S3PA 5F6IB 5IFAH 3PG2A 1JV5A 4KMQA 5ID1A 1J1OL 1H3XA 5GS2H 4P49A 1U3HC 3OKLA 3RRQA 4Z7VF 2GI7A 4K9EC 3BT2L 3H9HA 2MFNA 3OKYA 1NMBL 4YBHA 5DRXB 4G6AD 2VZOA 4ELKB 3TC9A 4H26A 1XR9B 4TULH 3RWFB 1CFTB 2VZVA 1RIUH 1I9RH 4HK3J 4HKZB 4LRNL 1YPZE 3UYPA 3KG5A 1TIUA 1J10A 2RB8A 4RMQA 3R0MA 2R2EB 5DD5H 4XB7A 2YMXH 3FB5A 1XZ0A 3MA9L 3OB0K 3FQNA 5D7LD 1WBYB 5GRVK 2XPGB 5I1AA 3U30C 3B8SA 2Z31B 3D18A 4JFDB 4WJ5A 3NAAL 3QDME 3ZKMD 4G9FD 4K3HA 4RRPA 2H8PA 3GMRA 4LLMB 3RL2A 5FV1L 3ARDB 3KPSA 1VADA 1FJ1B 4JJ5B 2R0KL 5HGBA 1EXUB 5EU3A 2DI8A 15C8H 3DX7B 4UILH 4LSQH 3HFMH 2NXYD 2BSTB 5KSVB 4K7FA 2CDGB 3TO4B 2VOTA 4RISL 1FZOA 2AP2A 1T5XA 3QAZB 4IOSD 1UCBL 2A6KA 4X5WB 4PJEB 1JZ8A 3O41A 1UM6L 3ARXA 1FBIH 4GAGL 1K5NB 5EU7E 4PJBF 1MWAH 1WTGT 1DBBL 4WEMB 5I15L 4AEEA 3MFFA 3OB0H 5KJRL 4ZSOA 1T04B 5IW1B 2CK0L 2RAMA 3IVKA 2YSSB 3HS0A 3CFCH 1DBKH 4KU1A 4GJTB 2AJVL 4DOHE 3VRLF 5ADOL 5CGTA 3BP4B 1UKSA 1OAYL 3HMWH 4YHNA 1UYWL 1HH9B 5F7DA 3FZUD 3RQ3A 1Q9LB 4HIXL 3QXWA 4FTVB 1U95A 3WHE0 3KLAA 3G5XA 1MNUH 3KJ4C 3VG9C 2OMBA 2GT9B 3E3QC 4PJFA 4IJ3C 4AIZA 3BD5A 2QSTA 3MLZL 3ORJA 4AMKL 3QJFB 4PJ5A 5DHXB 4LLQB 4EN3C 1DLFL 3QIBA 3RKPA 2D7TL 2JKXA 4XCNA 4OZHE 3SGEH 3MV9E 3E6FB 2DQIH 5FIEA 4F3FA 2ICES 4Y16C 1LNUA 4ETQB 3F58L 1RJLA 1JPFB 4W6YB 2ZUQB 3LB6C 5FA4A 1HDMB 1GIGL 5HVFB 4F7PA 4LLWB 3E8UL 4S1RH 3SE9H 3RNKA 3CLEH 2PN5A 1CR9H 1N5AA 5EUKB 4PJAE 1B0GA 3C5JA 3O6ML 5EA0H 1MHCB 2BSRA 3P4MA 5ANMB 4P3CH 2J4WH 5EO0B 2YPKA 4AM0B 3U79A 4D9LH 5BVJA 3QUZC 3HMXA 2WZPD 3MV8B 4PP2B 4FFZL 1P2CA 4WU5A 3PHSA 4JRXB 3BXNB 5HD8D 1NAML 4JDVB 1G84A 2R1WB 4X80H 3GSOB 4BZ2H 3H2WA 3U7WH 3F8UB 3ECBB 3OKMB 1RZFL 2MHAB 4NQCB 4X7SL 4ZAKC 3D3VE 5IB2B 3SOBH 4N1CA 2AVGA 3BW9B 4EVNA 2J88L 4JG0H 4HUKB 3V95A 1FSKB 3B8YA 4KK5D 5FYKL 1N8ZB 3KPLB 3CX5J 5HHMB 1BIHA 3D39E 2EH7H 4NZTH 3WS6A 3HUJF 3GSNH 4XGZB 5D72H 5CBEA 4EI5B 4YHKL 4RFOL 2ZG1A 5F1NA 5DQ9A 1DLHA 3ULUC 2I27N 4WO4A 4KXZI 1J05B 1R5WA 1X5ZA 5CIPA 1FO0A 4NUJA 2ADGA 4RFNB 4TSAH 1YC7A 4ZUTA 4LGPB 3EYSH 3PGDB 2EXWC 4IOIA 3LEVL 4YBLC 3VE0A 4EBQH 4QRTB 4HF5L 5T5NF 3MRKA 4PRIA 5I1EH 1MIEH 1NANH 3BUYB 3EGSA 4F37F 4PJGB 4Y2DB 1X9QA 4NNPH 1ZAGA 1EZVX 1SYSA 5DK2A 2ICEB 4YFEA 2DLFL 4C4KO 1A2YA 1MUJA 2DLHA 2I07B 3PQYB 3SDXB 4TVSa 1SJEA 3GBML 3JV6A 4APQB 4JKPH 4ZXBD 3LIZH 5FOBB 3CK0H 4N0CD 4PRDB 2N56A 3VGAB 5IJVB 2AEPH 2AXFB 2V17H 2I24N 3CMOH 3P30H 4LEOA 2JIXD 5DD1H 1QNZH 5ENWA 2DMCA 5C8JB 3H9YA 4EDXA 3B83A 5DJZB 2V2XB 1CICD 3O4LA 1XMWA 1MAKA 1U93B 4R4BA 4WWKA 3GNMH 1IZJA 4P2QE 4M4RA 2EDTA 3E0GA 4M9OA 3WUZA 3UTTE 1MCWW 3H9SA 3UC0H 3WNNA 2FBJH 4EZMA 3W11C 1T7ZA 4XPTL 4RNRA 4LCCC 3DI3B 2WBWB 4G8GA 1NC2A 2XXMB 2VR5A 3MLYL 5FHBL 2OCFD 2ORBH 2G75A 3DIFB 4KHXL 1T1XA 3LKQA 5BS0A 1QSFE 3ARGD 3VFRA 4DGYH 3ZKNC 5FO8A 2PYEA 1ZA3B 2EDNA 2Y23A 4NRXA 3BE1H 1QR1B 5DJ2B 3SPVB 5I1JL 1TMCB 4K7PX 3MMEB 1QRNE 3EIFA 2KUTA 1XH3A 3WV0A 4B5EA 1FDLH 3OX8A 2D31B 3REWA 2WNGA 4U1MA 2HN7B 3QRGH 4MXWL 1YEKH 1AGCA 1RI8A 2MTPA 2QSCH 1MOEA 4R2GC 5JHLL 3O3EA 4W6WB 5D2NB 1JBJA 1SBBA 2YRLA 5E95B 3L3OA 2G5BB 1NC4B 1RUQL 3VFSB 1D6EB 4I48A 4JDTH 3BO8B 1FZMB 1UG9A 5BXFB 3EO9H 4OZGE 3CH8A 1LP9E 4H88H 4MDJB 3IJYB 4A6YA 1ZHKB 3AROA 3J8F7 3QZWG 4X7EC 4FQHA 2A6JA 4GG6E 2JELH 1J8KA 3EDFA 3TT1L 3LKOA 3V52H 5J11B 2PXYD 4NM4L 5F72S 5FDWA 3ARRA 3UZEA 2UZIL 5I8OL 1R0AH 2P48B 1S7SA 1H3PH 3O2DH 5IFAL 5DDHA 3WN5B 5IIEA 3KNBB 3E6HB 3NACL 4NHUA 3WFEH 2R1XB 2ERJB 2CKNA 3TBSB 1IARB 5TF0A 3RWGB 1UZ6E 4WV1C 4GW5B 4R26H 2C4FU 4J23A 2P24B 4PRPB 1FG9C 4TULL 5AG8A 1SYVA 1EA9C 1I9RL 2X4OB 4JHAH 1NAKL 4QHMA 5F7LB 1I7ZA 2YRPA 1QHPA 3T1WA 2V5RA 4HWUA 3EJZD 1FL3B 1LE9B 3H7LA 2YMXL 3ULVH 4F7CA 2PF6A 3P3YA 4DKAA 1MCWM 1V7ML 4GKSB 4L9LB 2AQ2A 2ZG2A 2D9QB 3TA3C 3UMTA 4GXVH 5SWQA 2PTTA 5EU6A 5HYFA 2VN7A 1KJMA 4PRBB 4RDQF 1U8JA 4I2XB 4HWBA 2GYSA 4U1JB 3HI5H 1BQSA 4XXCA 3F5WA 2X7LA 3CCHB 3T3ME 1FVEA 4XCFH 5L8KB 1MCRA 3MRNA 15C8L 4UILL 4LSQL 3HFML 4Y4HD 3I6KB 4JFYB 4RMRA 1YNTB 4X4ZA 1LE5B 3BPNB 3O3UN 2QSVA 5F7EH 5HHOE 1CLZH 2NY3B 4JFOB 3PWPB 3KJ6H 4NC0B 3RKDC 1DE4A 2AKRA 3LRSA 5D1XD 5C0GB 4PRAB 2NTSP 2NY0D 1KGCE 3REVB 3EFFA 1TZIB 5F1IA 1I3GH 1ES0B 2WV3A 3BEVB 3KPOA 1FBIL 3HE7C 4ODHL 4XMPH 4YC2C 3ZYJA 1L0XA 1MWAL 3PABB 3ARBA 3BUTA 4G8EA 5GSRA 3SQBA 4DZ8B 2P5EA 3T2PA 3GSRA 4OB5L 3TH2T 1R6VA 5M7QA 1JPGA 3CSYB 1I85A 3JTTA 5GRVL 3T0ED 1DBKL 3S5LA 4M8QB 5B39A 1B4JH 5D7SH 3PWJA 3HMWL 2R23A 5ALCH 2O26U 4GRWH 4NC1C 3V7MA 2ATPB 4AENB 1JGUL 1IFHH 4TOYH 5JW4R 4HKBB 4DTGH 3NBNA 2DWDA 1CLYL 1X5JA 5BJTA 4RAVB 1B9ZA 3CFKB 4E5XB 4PBXA 1M7DA 1GOFA 3ZYOA 1CU4H 5KVMC 3DBXA 2DQIL 1YNKH 4J8RB 1MFDH 1R3KB 2W60B 3MLVL 4NQEB 2ADIA 3ROLB 1FC1A 4YFLF 4HK0B 1KB9J 4S1DD 1EJOL 3LRHA 5E9DA 3B9KB 4U2ZA 3CFIC 1R3LB 3FB8B 3IAQA 1KT2B 4JFED 4NBXB 5KN5B 3HZMB 1NGYA 1JZ3A 4ONHA 5HGHB 4C56A 5MERA 4HDIB 4P3CL 2J4WL 4G8FA 5IF0A 4ZFFA 2YD7A 1T5WB 4P2OD 4D9LL 3TF7C 1IGJB 2Q76B 5F7KC 5F88B 2Z35A 4NKIL 4BZ2L 4X0KB 3U7WL 4JREB 1SEBA 5E8NB 2VLMD 1YY9C 3O6FA 1WFNA 4NFDA 3SOBL 1NCDH 2DI7A 1WISA 4LSUH 1S7TB 4H1LH 4KTEH 1JWSB 4FMKA 5A3ID 1G9MH 1ORQB 1WWCA 5ACZB 4R7NA 3WL9B 4L5FH 4IOFD 1KPUA 3LZFH 4NZTL 4CVZA 5ESAB 3GSNL 2EDBA 1ZV5A 2NW3A 1O0VA 1YPZA 1P7QA 2H9GA 1VCAA 3OV6A 2FR4A 3S35H 3QI9D 4YXHH 5MENA 4S0TD 5LGJB 4TSAL 1S9WB 1IAIH 3EYSL 3D85A 4EBQL 3MQIA 1LK2A 3DPBA 4X6EB 5I1EL 5DYOB 1MIEL 5D7IE 4Z8FH 4NO5B 1DR9A 2DQEL 3QDMA 4NNPL 5E6ID 1X5AA 2ESVB 3DRQB 4Y89A 5I6XB 1NMCC 4X5LA 5IVOA 5D2LF 1E6JH 5B38A 5GGUB 3W9EA 2R9HD 3HI1B 4EEEA 1IGYB 3VXOA 3IETA 4GW4A 4HBCH 2WIIA 2HJKA 4JKPL 3FQRA 3LIZL 4HV8B 3CK0L 4OZIE 4NT6B 1CIUA 1PQZA 2AEPL 3MRRA 2V17L 3MRQB 3CMOL 3P30L 1LO3H 3MPCA 5B3NA 1FNGB 4P2RE 5J6GA 5DD1L 1QNZL 4JM2F 2R2BA 4NQSB 4FXLA 3UTSD 3B2UD 3MBEB 4FOMA 2H26A 1WF5A 1P84J 3MJ8A 4Z7VE 4OD2A 2C3GA 4IMKA 3FFCD 1NLDH 1RU9H 4BKLA 3UC0L 2FBJL 2A38A 3MA7B 1MCSA 5I9QB 1BVLA 3QUYC 3IRZA 1G1YA 2CDFB 1ULVA 3BH8A 3MREA 2F74A 2YD4A 4AQOA 5M94B 2CIIA 2HTLC 5EU5A 5C70A 3FTGA 4JCMA 2C1PB 5JDJA 2IF7A 3MGOA 4CUCA 1UM4H 1MHHB 1DQJA 1NUDA 5C0CE 4DGYL 2M2DA 3T2OA 2FX9H 3QT2A 4NO0B 3TIDB 4X7DC 2EC8A 3PP4H 4L4VE 4LEXH 2GSIA 4JQVA 4OF0A 1EAPB 3WIHH 3FJTA 4M3KB 3ARUA 4KK6D 3SDDC 2VR9A 1IGMH 1UB5A 4X4ME 5HJ3A 3VWJB 12E8H 2V6HA 3BZDA 3D48R 4QRQB 3MRDA 1G7IB 2YD1A 4IHOB 1FDLL 2WBJA 4MQ7B 3MV9A 5D70L 3LH2L 3UTPE 5SX5K 1U8HA 2OS7A 4QWWC 3TT3H 4FG6D 3QRGL 2N4IA 4EUPH 4HFUH 3WHXB 1YEKL 1UQSB 4XP5L 4QHKI 2QSCL 4G8IB 5FGRA 3I2CH 1BQHG 1QFUH 1FZKB 2J8HA 1MCJA 1NAMB 1AJ7H 5C0IA 2YUZA 4PJ8B 2NNAB 3GIZH 2G2RB 1WCBB 1NGXA 4CNIA 3RIAK 5EOQH 4KGJA 5C86A 1QRKA 5KAQG 1BD2D 5JHDA 4JVUA 3MRBB 3DXAB 4JDTL 1QHOA 3EO9L 5TF1H 5EUOA 2V5YA 4PJBE 4LKXB 5A2IH 2F8VA 2X4UB 3IDMA 1DQLH 1NCWH 4OFPA 1I7RA 4OZFH 5HYSB 1FFPA 4PJ9D 5EO9A 4DN4L 5E2JA 4N5ED 4N0UE 2JELL 4HXAH 1ZGLM 3VRLE 1DUZA 3RVUD 3V52L 1AGEB 3HNTH 3C8KB 5C0BD 4D2NA 3D3VA 5DI8A 3I02B 1H3PL 1I8LA 1JNHB 5SX5H 1T22A 4PJIF 3WFEL 4OF6A 2NY6C 4WHCA 3D39A 5IMMB 2DWEA 4R26L 2VLKB 2EDLA 3IDGB 2DM4A 5FUCC 3C5ZD 4JHAL 2AQ1A 3DMMB 4NBYB 1QLFB 4RGNB 1QD0A 5DRXA 4M93C 1MCEA 3LY6A 3ULVL 1T1YB 4O02H 2DKUA 5F1KC 3KXFE 1HHIB 2VXQH 4GXVL 2R2EA 3BN9D 2ZUXA 1MQ8A 4KRPD 5D1ZB 3LQAH 1X5YA 1CLOH 3CVHH 1DUYA 2FO4A 3HI5L 1A1OB 1CGYA 1WBYA 4E42B 3C6SB 5DMKB 4UOW1 4XCFL 2LU4A 1G9NH 2JCCE 4HX1A 1ZXQA 1HCFX 3FHAA 4JFDA 4TN9A 3DARA 5CHNA 4YAQB 4LLMA 1U3ZA 4D9RE 4D8PB 5F7EL 1FJ1A 1EXUA 3KJ6L 3E2HB 5GGQL 5DGQA 4QHNB 2NY1B 1INDH 4F8QA 2BSTA 3T4AB 5KSVA 1I3GL 3OAUL 3CIQA 1N6QH 2UYLB 2KKQA 1I9IH 3KAAA 4LMQI 5BV7H 3UAJD 1CBVH 4XMPL 1P5VA 3WFBH 2HFFB 3UTTA 4KROC 2AK4B 4BH7A 1HNGA 2VLRD 3HUJE 1N59B 1HKFA 1HQRB 1VB9A 1K5NA 2EDJA 3PWVA 3KPSD 1B4JL 5D7SL 2XTJB 5ALCL 2WM0A 4HG4K 2XZCH 1CE6A 3GBLA 4M7KH 1IFHL 4TOYL 2CRIA 4DTGL 3DSFH 3SGJA 2CUHA 1R24A 3VDCA 2J5LB 4K9EH 5CEZH 5FEBA 1Q9LA 4O4YH 5CEZE 2Y6SC 1DJSA 3R06A 2W91A 4QO1A 3BAEH 3ZT6A 3RHWF 2GT9A 7CGTA 1CU4L 3KPQA 2VZUA 4OV6F 3QJFA 4Z78B 1YNKL 5J3HD 1BEYL 1MFDL 2R0ZH 3LPGA 1DVFA 4YGVA 1ZSDB 4NQDB 5CAYB 5T3ZH 4HUMB 2RCSL 3ZKXB 1ZHNA 4JHZA 1CWVA 1NEZG 2FECL 3ULSB 1ZVHA 5F7YC 4YUEH 4ZYKB 1U58B 1EHLL 3P0YH 5I71C 1QBLH 2OZ4A 4NM8H 4U3HA 1MIMH 4HXBL 2VXSH 3MRCB 1RHHB 2ATKA 1YQVH 1ROWA 1WJ3A 4GKNB 3T4YB 4KJYB 5AYUH 1S7WA 3X11B 1LP9A 2FH6A 2J8UE 1X5KA 1HWGB 1PZ5B 3BDYH 4R0LB 1BF8A 1MHCA 2R15A 3TN0A 2DJ4A 5IFJA 5GIRB 3QIBD 5ANMA 5KOVC 1BAFH 5FKPB 5EO0A 2SEBA 2CDEA 2W38A 4QHLB 4XBEL 5JW4Q 3QIUC 1OTUC 1EGJA 5DC0A 4R7DB 4PP2A 1E28A 4XPBH 5ID0A 2CMRH 1EHXA 1NCDL 3DYOA 2XOTA 4XWOC 3NCYP 3NPSC 1MI5B 4KTEL 2VMFA 3OKMA 2FBOJ 4ISVB 4TQEH 1G9ML 3F7YB 4NQCA 2FHBA 5IB2A 4L5FL 3BW9A 4LF3B 3S88H 5L7XH 2BHYA 4GRWF 3V6BR 2AJYH 4KKNA 2PO6B 5C2BL 2XN9E 3WJJA 4HZAA 3KPLA 4NZUH 1KTLB 3CVIL 1DEDA 3CC5A 4V1DA 4P99A 2NY5H 5ICXA 2JJSC 3L6FA 4EI5A 1IAIL 1JHTA 2VERN 2BVEA 1DBMH 5HHPA 1ACYH 4W81A 4GUPA 3I9GH 5KTEH 4Z8FL 2BSSA 3PGDA 5DO2D 2VIRB 4QRTA 3ZDYF 4NOFA 2FJFB 2R4SH 3TCLB 3QWRA 5JQHC 1JIBA 3BUYA 4WUUE 1INEL 1E6JL 4F2MB 5FYJE 4NO3A 2IANE 1A6UH 2C3WA 5KSAC 1Q94B 1UACH 4WWID 1MWAB 4OCLC 5ESVB 3BGFB 4HKJB 2W0KA 4HBCL 4HJGA 1MEXH 4HMEA 2ICEA 1IILE 3Q6GH 2GAZB 4IRSB 2I07A 4WEUD 5HHOA 2H6PB 3SDXA 3U9UB 1T89A 3PXJA 3MLSH 4KRNA 3VG0H 3OJMB 1KV3A 5J06A 4OZ4B 1ZMYA 2GSGA 5HHVH 4TVPH 4J12A 4B0MM 5CUSL 1OL0A 3EOBA 2D0HA 4LKCA 2XG4A 4MA3B 4JEGB 4N0RA 2GKIA 3MODH 2DD8H 3ARTA 3GI9H 1T1ZB 4LCWE 2VH5L 1FVCB 4IIQA 1NLDL 1RU9L 4N8CH 2EZ0D 5KANI 4Q0XL 4UBDC 4DVBA 2E9IA 3MJ9H 2XWTB 4AEIH 4P5TA 3TNMB 3WO3B 4OZHB 1D6VH 5FYJU 1I8KA 1RZIA 1MLCB 3LKRB 3TYGL 3VXRB 4GOSA 1I9EA 3LKPA 4NPYB 5D1QB 3ZTNH 1KB5H 4ZDHB 1I1YA 2FX9L 4E41B 4BH8A 2OSLA 4YR6A 3PP4L 4LEXL 5D2LB 3ARFC 1T66C 4P0DA 3IXTB 3STZB 2J6EA 1F97A 2Q86A 43C9A 1IGML 5DRNB 12E8L 1JL8A 4AY0A 4PRHD 1K8IB 4BZ1H 1ZA3A 4WWKD 1GGIH 3ULUH 1RY7B 1QR1A 3SPVA 5F9JA 5J57B 2B39A 5HXMA 5CJOH 1VGKA 3T0AA 3MMEA 4OFIA 4HFUL 5EIVA 1ZGLB 1JTPA 3U9PH 3H9SD 3EDJA 3QUMA 4XP9L 3KPRB 3VXSB 3FMGH 1QFUL 1LO4H 4XBGB 2DYPA 4I18A 4LSRH 1R3JB 2LU3A 4G8GD 4ACPA 3UJJH 1BFOA 1NH6A 5EOQL 5FFLA 3CFJA 4CRPA 3ARDC 3CUPB 4U0RB 5BS0D 2EO1A 5TF1L 4OKDA 4WW2C 4LCUB 3EHBC 1W72H 2ARWA 2G5BA 4UQ3B 1DQLL 1NC4A 1NCWL 4MX7A 3B9EA 1N7MH 1G7MB 4MAYB 3ZE0F 1FZMA 1DBJH 5BXFA 5CJXC 4J1UB 4QT5B 4TRPH 3GSNB 4HXAL 1IEHA 4P3DB 3HNTL 1KEMH 3HPJA 3IJYA 4XRCB 2ARJQ 4CU6A 4LQ1A 5CZVH 4PUBH 1BBJA 3WIIL 3TFKD 2R29H 2DOCA 4P48A 1PDKA 5JQ6H 5I1KH 1TETH 3AS2A 4LVOB 1D5ZA 3T2NL 4M7JH 5J89A 3KHOA 4GAYB 1KIQB 3CFBA 1MCKA 4RIRB 1KNOA 1D9KD 3C5SA 3EO0A 5E08H 5C09B 3TBSA 1M6OA 3QNZA 4JZJA 4LP5A 3RTQB 4BSWA 1KSRA 1UM5H 1KLUB 3RWGA 2EXYD 1TTFA 2X1WL 3NIFE 4GW5A 4RA0C 4UDTB 4YNYB 4XB8A 3W0WB 2VSDA 2QHLA 4PRPA 5EDXA 2A9MH 3IU3B 1GGBH 3SKUD 1GZPB 2X4OA 4OGAD 4O02L 2ZZUT 5C0FB 3BH9B 2VXQL 5FCUH 1OTSD 2X9WA 4JN1H 1FL3A 5E2WH 5F7FA 1IAIM 5D7IA 4GKSA 2ZCHL 4L9LA 3LQAL 4X9HA 4X6CE 3CVHL 1QOKA 1RMFH 3FRPG 3P9MB 5HI3C 3DX9B 4GRLA 4U1SB 5T1MB 4OTXH 3D0VB 5IM7A 3EYVA 2ZUQC 4U1GC 1C5CH 1P6FA 4KI5F 1EERB 2EICA 1AGFB 4HBQA 3S96B 3C08H 1TENA 1Z0MA 2HTLD 4WFEE 2IADB 3EJYC 1DANT 2NY7H 2VL5B 4JFFE 3U0PB 2V9RA 2IMMA 4H5SA 2RQ8A 1INDL 3DO3A 5IMLB 3VGDA 1LE5A 2HA1A 4PR5B 3SDDD 4JFOA 1QSFB 1JVKA 4RMVA 3IFOB 4JLRB 1I9IL 5ICZB 4PGEA 3QXVA 5BV7L 4PRAA 1CBVL 3GRWA 4Z7VA 4Y0GA 5EU6D 2GY5A 3WFBL 5JW3L 3REVA 1A14L 1TZIA 4ODWB 3QO1A 5L2KE 3DHJA 4HFWA 4ZD3H 2XY1A 5HGDB 1GSMA 1CDGA 1JNNL 4RCAA 1A64A 2EH8H 3CSPA 4NN7B 5J4MA 1RJZB 3NN8A 2R56H 2XZCL 3U4AA 4M7KL 4YO0A 4HIJB 2C7UB 3O0RH 5C0CA 4F33A 4OT1H 3DSFL 3KYMB 1A1NA 4PS4H 3V6OE 1N4XH 3LCYA 3QQ9D 4K3GA 3MSPA 4K9EL 2CIKA 4C55A 5CEZL 3BIBX 4AENA 4RGMC 5BOZG 5DK3A 4O4YL 4JKKA 1I1AC 4MB3A 4X4MA 4HKBA 1JYVA 3FQTB 1WUNT 2APVA 4QF1B 3BAEL 3GMNB 1AO7E 1AY1H 2PW1B 3DHMA 1Q1JH 3OJ2C 3RVXC 4GH7B 1CDIA 2W1NA 4BSJA 1CYGA 1TNMA 4E5XA 1ERNA 1MLBB 5JO5B 2R0ZL 4YK4C 5SWSE 4F58H 4CW1A 5T3ZL 4ZG1A 1RIHH 4CVXA 3QJHA 5CZXD 1TQCB 3K2UH 3AS0A 4YUEL 4NQEA 3DNKA 1BX2B 3V9FA 3OAZK 1H8NA 3P0YL 1QBLL 4LHUB 4ZFGH 4NM8L 1BFTA 2IALB 1MIML 4FQXB 2VXSL 2E6QA 4HZLB 1YQVL 1A6WH 3IKCB 1KLFA 5AYUL 4PJBA 5CJQH 4G7VH 5KN5A 5JOFB 3QEUB 3HZMA 5IBUG 3VGAC 2X1PA 3BDYL 4LCYB 5HGHA 4YXKL 4JKWA 4XX1E 4HDIA 4NFBA 1MCOH 1FFOB 3BP5B 1T5WA 4E0RB 5DHVH 1IMHC 1IGJA 1OSZA 3WUWG 3C6LC 5DJAB 3BHBB 2CMRL 2DICA 1EMTL 1YECL 2F8OA 3OKKB 4X0KA 3RDTD 3OJVC 4TQEL 3SKOA 3VXTB 1OGAE 1MCHA 5E9DD 1H3VA 5L7XL 4TTDC 1S7TA 1JWSA 2NX5D 2AJYL 5ECJE 1HYRC 4MWFB 5ICYB 1CVRA 4NZUL 4PJ7B 2X42A 2FZ3B 1A6AB 1JI2A 1HI6B 1F6AB 3OAZH 1ZHLA 3FQXB 2ILLA 1TZGH 2NY5L 3QFJE 2A73A 4QHUB 4HD9A 5GZND 4WNQA 2Q7NA 1TJGH 2VDPH 1P7KA 1DBML 3KXFA 5EOTB 3LN4A 1ACYL 2AJZA 2VC2H 3I75A 3I9GL 5D6DC 3EYFB 5KTEL 5LGJA 4NYLB 1S9WA 5GS3A 4Z7UF 3S4SA 3O6FD 5I1CH 1G7JA 5IVZB 4X4YA 4X6EA 2W9DH 2R4SL 5DYOA 1J8HE 4LOUD 4OD3L 1EUTA 1JUFA 3ARVA 4S1QH 5DJDA 1G6RH 4OCXH 1A6UL 3ARSA 2DQJH 1RSFA 1UACL 5C0EB 1MFBH 4XVJH 3HTLX 3L95B 4L3EB 3U7AA 5D2NC 1MEXL 4X6DB 2DDQH 1JZ7A 3QNXB 3Q6GL 1WBZA 1NCAH 1DFBL 1P7QD 2P8MB 3MLSL 1JRHI 3VG0L 5I1IH 5JIPA 5BQ7A 5MEND 5HHVL 4TVPL 3D85D 4GRWB 2K7PA 3OXSB 4PJIE 1HQ4B 4L1HA 4MLIA 1L6XA 4ODXB 2DLEA 4RBPH 3O8XA 2CLZB 3S7GA 4BQ9A 3MODL 2DD8L 4KKLD 4Y5VA 3GI9L 2D7PA 3B9DA 1S8DB 3HUJA 3NA9H 3CPLB 3MJ9L 1K3ZA 3CDCA 3F62A 1AXSB 1CXIA 4AEIL 1AR1D 1D6VL 4O2FB 2YBRB 5I16A 1S78D 4RAUB 3K8MA 1NFIA 3WN5C 3JV0A 4EKXA 4CN6A 4Y4FC 3VXME 2VE6A 2F5BH 4BQ8A 4OUUB 3UBXB 3WNMA 4G5ZH 4OFKA 3RPIB 1KB5L 1OGTB 3BJLA 5IG7B 2OK0H 5HBBA 3WLBA 5E2VH 3RA7H 1FFNA 4I13B 3RWEA 1RK0B 2C1PA 1KENH 1AGDB 4NO0A 3MUGB 1PG7H 2GITA 4BZ1L 2P43B 3BZEB 4FXKB 1U2CA 4U1IB 3H7BA 3ULUL 4BA8A 2AEQH 2K1MA 1NSNH 2Q20A 2XYCA 1U8NB 5CJOL 5INDB 1IC1A 1E4WH 3AREA 3VWJA 1MHPH 1KELH 2V7HB 4OFDA 5C0AB 2XRAH 4Q6IA 3U9PL 4XZUB 1UC6A 5IVXF 3L3DB 4MQ7A 1LO4L 4F57H 3NFPA 3QDGE 4KJQC 4LSRL 3BISA 3WHXA 1OB1B 3IRPX 1VFAA 1XGTA 2W9EH 5HYQA 5F8QC 4A2MA 3VFNB 5FOJA 4XNUH 2G2RA 4H1LB 1WCBA 3NFSH 1TVDA 2X4TB 3SGDH 2VISA 3M17B 4RRPG 2GK2A 3GMLA 1W72L 1BZQK 4NRYB 1QYGH 1UENA 3UDWA 3DXAA 5HVHB 4FQPA 1DBJL 2H32A 2XIDA 3NCYS 5D7LE 4ZUUA 3L5IA 2L0DA 1Z9LA 3DX8A 2WBJD 1MRCL 1XGUA 3LS4H 1T3FA 4P4KB 5HYSA 5ILTH 3UYOD 2EECA 2IH1A 5DJXB 3D9AH 4G9FE 2F53B 5CZVL 4PUBL 2R29L 3DO7B 4JRYB 5JQ6L 4K55A 5I1KL 2IPKB 1F13A 4M7JL 3QYCA 3I02A 2JLLA 4N90D 1PKQE 3C60B 1QFWH 1JNHA 5MEQB 1ZA6A 5JHDD 5E08L 1UJ3B 4LPWA 1IEBA 5E2TH 3IDJA 1QLRB 1UM5L 3DTXB 1K3IA 4UT6H 2W0FA 3WE6B 5JW5B 5KW9H 5MI0B 1XGPB 5HPOA 1HH6A 1KLGB 4P9HL 2A9ML 3QR2A 5FM5O 5HY9B 1GGBL 2P49B 3TZVB 4Z5RB 4G9DB 4OZIB 2YZ8A 4S11A 5FCUL 5C71A 4JN1L 5E2WL 4I4WA 2VKWA 4NN5B 4ZUVB 2Z91B 4G6FB 1LK3L 1RMFL 4LARL 1HHIA 4XH2B 3QUKB 5H2BB 1HCVA 2V7NB 1RUAH 3LKNA 4OTXL 2HVKB 1CDUA 5KSUB 2APXA 2IANA 4WY7H 1S7RB 1KPRB 2X9XA 2QV2A 4H8WC 2Z93A 5E00B 1O7VA 3UZVB 1A7QH 3C08L 4LSTH 2KPNA 5DMKA 4FA8A 2FATH 1JNJA 2NY7L 3VXPB 4DFIA 4YAQA 5JDSB 1H3UA 1ZKAA 2I5YH 1F90H 1UCTA 3OZ9H 5JORB 4D0DA 1I8IA 5TQ0H 1EEQA 1Q9WA 3TVMA 2Y5EA 3NABH 2N7AA 1G7LB 4OCYH 1IM9A 3V4PH 5F7UA 4WO4C 1MFNA 3JUYA 3STBA 4LDOB 2AK4A 5I75B 2EH8L 3UJTH 2Z31D 2IQAB 3GSVB 4JFDD 1PKOA 4NOBA 4ESKA 1B2WH 3Q0HA 4EUPB 2C1OA 2RFXB 3G5YB 3O0RL 2FL5B 3O9WB 4ZPVA 3ARDD 4OT1L 2IWGA 3MV11 4PS4L 4BK5A 1N4XL 2YPVH 1RZ8B 3PDGA 3X3FH 1G7HA 4YFLI 4GBXB 1YEFH 5GQBA 5TE6L 2EDKA 4URTB 3KYOB 1JFQH 1XCQB 5JPNA 1AY1L 4X83A 1YUHA 3TO4D 2NTFB 1Q1JL 3HR5B 4QEGA 4Y4KC 4F58L 3NVQA 3FQUB 3MGTA 5E70A 1RIHL 1MFAH 4OZFB 4N5UA 3RVWC 2IC2A 4Z78A 2GJZA 1QG3A 1VFUA 3I3EA 3FO2A 3K2UL 5GGRA 4NQDA 1J0KA 4ZFOL 5B8CA 4PJXB 3QEHB 4FP8H 1TZHB 2OTUB 5GGTA 4ZFGL 4KUZL 3I84A 1KIRB 1A6WL 1QPXA 1U58A 3L7FB 5GS0D 4GT7A 1RV6X 5DURB 4PREB 3QIWB 4YHIB 1Q8MA 2R39A 3TIEB 2GFBB 2VZSA 4FQ2L 1R3IH 2KDGA 2Q3ZA 4KJYA 1MVUB 4KMLB 3UCRA 1MCOL 1U8OB 3H3PL 1QZ1A 3MV7B 2W59A 5GS1A 4XC3H 2XQBH 1A4JA 4HIIB 1DVFD 2DAVA 1RZGA 4YEEA 4Z9KB 5FKPA 2VB5A 3VXQA 1T0MB 1UA6H 3FT3B 3FN0H 4R7DA 1VA9A 5ACMA 5I8CB 4P5MB 1VEPA 5HHNA 2BVOB 1OARH 1RK1B 1HNFA 4JM4H 5I9QC 3SGEI 4HIEB 3CZFA 1GGTA 5F9OH 3EBAA 5CKGA 3CVHB 4ISVA 3F7YA 4MXVF 1D5IL 4YBQC 1PZUB 5CJ8A 3F7RA 3SCMB 1ZEAH 1N2RB 4JY4B 3NFNA 4AIOA 1TZGL 1AR2A 1A6VH 1U8MB 4YH6A 1GCFA 4LFHG 4JFXB 1JMZA 5I1DB 2VDPL 5I74B 1KTLA 3IFPA 5GRUH 4ZNEE 2DM7A 3HZVA 3B2VH 2VC2L 1N6UA 3ZKQD 5J56B 2V5TA 3SDAB 1VKXB 5H37G 4FABH 3ZDXF 5TE7H 3CDGB 3MV8D 4KAQH 3K1DA 5I1CL 4JRXD 4UINH 3IXAA 3VRJB 4HWNA 5IFHH 3S37X 4IRZH 1KJ2A 2W9DL 1JYNA 2RJMA 4LPYA 1XCTB 2F54B 4WFGD 4S1QL 3TBYB 4NQCD 1G6RL 4M7LH 4OCXL 5BV7B 1YC8A 2DQJL 5DUMH 1MFBL 2FJFA 3TCLA 4MS8D 3GSXB 6CGTA 2DDQL 1NCAL 5HHMD 4NQVA 2XKUA 4OLEA 1Q94A 1C1EH 4Z7WB 5I1IL 3LPWA 2VXTH 1MFEH 4RFEA 4V1DD 2GAZA 1DQMH 4EI5D 5BRZB 4UOJA 2H6PA 3VRIA 2GW5A 3IDNB 1LD9B 4WI2A 4JQXC 2N7BA 3MRMA 5E5RB 5IROA 4XTRD 3NA9L 2OR7A 2W07A 1X4ZA 3JBG7 3AU1B 3QWRD 4OUOA 4NWTH 3NTCH 1FVCA 3TPUB 4Y2DD 4S2SA 3K7UA 4Z7UB 1NANI 2XWTA 1RURH 2DMKA 2F5BL 2YUXA 5FGBC 4QTIH 4G5ZL 5KS9E 2OK0L 3PQYD 5CSBA 4DGVH 1MLCA 4ODTH 5J0BA 5E2VL 4KTYA 3RA7L 3GSUA 4M1DL 4RQQB 3CSBA 3MCG1 4XXCC 1F3DJ 4APQD 1XIWB 3U30B 4ZDHA 1WBXA 1HILA 5IVNA 3V5DA 5D2LA 3HPLA 1NFDE 1Z9OA 1H9VA 2AEQL 4XPAL 1NSNL 1HHHB 5DRNA 1E4WL 1BBDH 1VDGA 1MHPL 1KELL 3DETC 4OF5A 4X6FA 1A8JH 3U4EA 4M00A 1ZLVK 2VYRE 4MCYA 4LLUB 4HUUB 4F57L 5EOCL 4ODUB 2WBKA 3NMEA 4BFIA 4JM2A 2EEBA 4MXQD 3VXSA 4N0FB 1SMAA 2W9EL 1HXYA 3VCLA 3B5TA 5IW3A 3P4OA 3FB7B 1JNLH 3EO1A 3ARBC 4G80B 4XNUL 4EXKA 4X7TB 1OTTD 3NFSL 4U6YB 5FHAH 2H45A 3EYUH 2VZ1A 3PNWB 1QYGL 2EDEA 1YEHH 4R96A 4FHBD 3F6LA 3E2HC 2GCYA 1S7XA 4JO4H 1P69B 4KV5E 2CRZA 2NY1C 4H20H 4UQ3A 1MQKH 1I7TA 2UZYB 5I30H 5ILTL 2AJSH 1G7MA 2ZCKL 4MAYA 3D9AL 4J1UA 3MJ7B 4PB9H 3VD7A 2NY2C 5IHUL 5B22A 3QB7C 3M1BB 3DUUB 1HIMH 4ZS7H 1OGAA 3KJ4B 3VG9B 5J13C 3IS0X 4NZRH 3SEPA 3ZYIA 4IJ3B 4I8DA 3VFTB 4OBRA 1ZLVH 4PY7B 3L7EB 5DD6B 5IB4A 5A2KH 2I25N 5E2TL 4GAYA 4AL8H 1KIQA 4UT6L 2OR9H 4RIRA 3RWJB 5KW9L 5JXED 2HLFC 1FC2D 3S5LG 1NC4D 4Y16B 5GRWA 4F7TB 5C09A 4WHYG 5B39G 5B3JF 2NYYC 2F8XC 1F11B 1X6NA 1KLUA 2AV7B 4P9MH 5I8KH 5CP3H 3IU3A 5GRYA 1GOGA 2D0FA 4ODBD 3T0EE 4JG1H 5C0FA 3LQZB 4NCC1 5E4EC 1XEDA 3IDIA 1J8HA 1RUAL 2PW2A 3I85A 4QXTB 4XVUD 2OP4H 3UYRH 2OL3H 2BX5A 1ZWIB 5JW4M 3T65A 5A16B 4LLVB 3QQNA 3T77A 3QUZB 1A7QL 4LSTL 2MQCA 4UU9B 1GGUA 2X5PA 1FYTB 2FATL 1NMAH 2XA3A 3JVGA 4HH9B 4NO2B 4KKBD 4QRSB 4L9DA 4OCWH 4PRPD 4ZAKB 3EYQD 2I5YL 2IADA 1F90L 5DFVC 3OZ9L 1U6AH 5BO1H 2VL5A 1XGQB 2XWJB 4P46C 3QQ4A 4PJIA 2PR4H 32C2B 1KB5B 5TQ0L 1G0YR 4GQ9H 3BKCH 3H9ZA 4NP4H 5T1KB 5D6CA 5IMLA 3NABL 2Q3AA 1HN1A 3QUXA 4PR5A 3X17A 2BVPB 1Q9KA 4OCYL 3EUUA 4JPVH 3V4PL 3QHFL 4JLRA 5IHZB 3N1GC 5ETUB 1JHKH 1OP9A 4H25A 1B6UA 3G5VA 4JFEE 3UJTL 2EDFA 1XGRB 3VXMA 4OV5B 1B2WL 4ZUWB 2AJXH 2R0LL 4ONGH 3P4LA 2YKLH 5ESQB 3OR7B 2DS4A 1II4E 2X10A 3KS0J 1QVOB 3QEQB 1E4KA 2YPVL 4Y8DC 2IAMC 1EEZB 4FQIH 1RJZA 1FG2B 2UWEF 3X3FL 5JOPD 1BLNB 1YEFL 2WINB 4BFBD 1QA9A 3RZCA 4JFQA 5KAQF 2NY3D 1JFQL 2LE9A 2R4RH 2VLME 3K8KA 5HI5D 1QBAA 3AS1A 4P23B 3OMZA 1X7QA 2P8LB 3FQTA 4XI5C 4QF1A 5DMIH 1S5HB 1W72B 4XNMA 4ZQKB 1UZ8A 5TH2B 3QH3B 2PW1A 2JJVA 1MFAL 4JB9H 4ORGB 4EQ3A 1I75A 2B2XH 3VFPA 3QDGA 1J1XH 3C09B 1OP5H 5HI4C 4NNYA 4D0BB 4O2CA 4WUKH 5DEFB 4QRRB 3QRFM 3IT8D 1YJDL 4FP8L 3W9DB 1T03H 1DL7H 5EU7C 3RY4A 2P8PA 1DQTA 4I5BA 2BOBA 2EIEA 1BX2A 4YXLH 2CLVB 2OQJB 4YZFF 3DURB 5B38G 3O2DA 5DVKA 1BJMA 1TQBC 1R3IL 5D7LA 3VWKC 3HZKA 2XA8H 4YDKH 4WW1B 4LCCB 4JFHD 1Z5LB 4XC3L 2XQBL 2APWA 3MCKB 1OQXA 4XCEB 4JY5H 3DUSB 4MJ4A 3RBSA 1LO0H 1E0OB 3PWLB 1UA6L 4E0RA 3MUHL 3D69B 5FO9B 3BPOC 1OARL 3ILPB 4NQED 4WU7B 3RI5F 4X6BA 1PKQA 2QR0A 1T0NB 4LSPH 4G6KH 1IAOB 5HYJB 1K4DA 3WXWH 3QZWB 3UBXI 3B9KD 1ZEAL 1QFWM 4GSDH 5D1QC 5INCA 5CGYC 4KJPD 3UTSE 2CR3A 2X70B 2FECI 4UIMB 1MRDH 5IVXE 1CD0A 5ICYA 3GIVA 1JGEA 1LDSA 2FZ3A 4ELME 1LEIA 4U6XB 4HLZG 4ZOEA 5GRUL 1F6AA 3FFCE 4HULB 3B2VL 3HC4H 2QQQA 1CGVA 4QHUA 4LGSB 1Y18A 5TE7L 1WC7B 2X40A 4KAQL 4MZ3A 4X8JA 4UINL 3HRZA 1UH3A 5IFHL 4OGXH 4IRZL 5IB1B 4LLAA 3SDCC 3EYFA 2APBA 4L8BA 4EIGB 4M7LL 1OAXH 5IVZA 5FYLD 5DUML 1CK0H 2V2TB 3QXAB 3MZTA 1NCBH 5F3BA 1ONQA 1MSPA 2VLJB 5IWLA 4L29A 3G6JF 1C1EL 4L3EA 2DBLH 1MFEL 2VXTL 3RX8A 2DLIA 1IQDB 4PJHE 1DQML 1N3NB 2WUBL 3KYNB 4KJWC 1J0ZA 5CD5D 4Q9CA 1MCFA 3OXRA 2E5EA 3EZJB 4M61B 1TITA 3TJHC 5SWZB 5I8EB 4WV1B 3G04B 3OXSA 4C57C 2VXUH 4K07A 1JPTH 1BOYA 4JO1H 5IP4A 4NWTL 3V79C 3HLAA 1BD2E 2QSQA 1FL5B 2F19L 2ESVD 3QO0B 1RURL 4KKAC 1PYWA 2YBRA 4RAUA 3TA3B 5HGGS 1T1WB 1Z9SA 4DGVL 4X98B 1PGRB 1WWWX 3C9NB 5F3HB 2BCKA 4KWUA 1HXMA 1NGWB 3P77A 4POZD 1NGPL 3RTQC 1G1CA 2HJLB 1H0DA 3AS3A 3RPIA 4ZFOB 1OGTA 5IG7A 2V2WA 3WIFB 5BZDA 4NQUA 1CI5A 3O11B 1DEEB 3VFMA 5C0BE 4YJZL 4HKXB 1GJIA 2PCPB 4TNVK 2P7TB 1F2XK 3T0DA 2DMBA 5I1HH 1BBDL 3FRUA 3CLFH 3MUGA 3MBED 3BZEA 4Y19B 4U1IA 2P5WB 4ZS6C 1MCLA 1IGIL 3FQWB 1FE8H 1WIPA 3NPZB 1OWWA 2D7MA 5AAMA 4WI5A 4YDIH 3THMH 5DHVB 5EZOH 3ZE1E 1DCLA 2F9BT 2X6MA 2YOCA 1JNLL 2HMIC 3L3KB 4IBLT 4F15C 3SJVB 4NSKB 4M1CC 1OB1A 3RUGE 2ZWLT 1X4YA 1OVZA 3GUTB 4YC2B 4CMMB 3RY6A 2E6JA 5DJYB 1YEHL 1I3RA 4H1LA 3MCLH 1HYSC 4NO0D 4JO4L 1CFNA 3B9VA 3M17A 2B1HH 3S34H 1OP3K 1IGFL 1IVLA 3X14A 4NRYA 1MQKL 5I30L 5FM8A 2AJSL 4P2CG 3BWAA 3VWJD 2DB8A 3SGJC 5K9KB 5JIKA 4PB9L 4DEPB 1QSZA 1NDMA 2NMSA 2W65B 2GTWB 3STLB 1TCRA 1HIML 2BHUA 4ZS7L 5IW6B 2MPAH 2E7LA 4PLJC 5L8JB 4ZXBA 4NZRL 5TDNA 4K7PL 4JRYA 5SX4H 2HT4D 2E27L 2XZQH 2W9LA 1KTRL 4PJ8D 3A6OA 4HGWA 4Q2ZB 5DQDH 4AL8L 2OR9L 3C60A 1G6RB 1CICA 3ALPA 1QP1A 1KN4H 2HT3C 1SJHA 2Z9TA 1L0YA 3DXAD 3DTXA 2DKSA 2K9UA 4ZNEA 3WE6A 3HC0B 4L4TB 2VLRE 5FYKD 2PYFB 5I8KL 3MNWB 5F8RC 1KLGA 2WWMC 3HKFA 1U8KA 4Z7OF 2Q8BL 4XP4H 2BNQB 5HVGB 1IM3A 4Z5RA 3OHXB 1YY8B 4FXGB 3MLWL 4JG1L 2J7LA 3GMQA 3KPSE 3VMPA 4ZUVA 5LVEA 2Z91A 1JI1A 3UYRL 2OL3L 2YN5A 3S3SA 1AI1H 2V7NA 5KVFH 3NGBC 4ZOAA 5CBAB 5HDBE 5T3XH 2V9TA 2OMNA 2WSKA 5JXAH 1ZHBA 1YYMH 3PE9A 4EDWH 2VLKD 2AXGB 2Q7YA 4RGOH 4OCWL 3D87B 4IMLB 5DEZA 2FEDD 3KYAA 1U6AL 3PDOB 5BO1L 4O2EB 3X3GH 3DMMD 1MREH 4GQ9L 1EFXB 4RGND 3BKCL 4NP4L 2OM5A 4Z7NE 1AE6H 3O45A 5JORA 1J7VR 3EYOA 4HUWB 4P5KB 4JPVL 4F80A 3H6JA 4ODSH 3VJ6B 1JHKL 1ZE3C 5D1ZD 4PPTA 3WIHA 2J12B 1LEKA 5GRJH 1TLKA 5JNYB 2AJXL 4P2YA 4HCRL 5EIQA 2C3VA 2YKLL 1J0JA 1QLEH 3O3AB 4PJFE 1X44A 9CGTA 4LAQH 4DW2H 4UV4H 3GO1H 3GSVA 2QLVB 1QEWA 4FQIL 5DUBB 3MNVA 2X4QB 5ERWB 4HK3N 4HGMA 4PBVC 1A5FH 3GM0A 3K4AA 3O9WA 3GJFA 2PXYA 1X5FA 1N5YH 2R4RL 4G42B 1WAAF 1RZ8A 3VGHA 4UNUA 2WLZA 1NMCB 4GBXA 5J9PB 2ID5A 2WAHA 3SE4A 5CSZA 3WNPA 3O81A 4PLOB 5DMIL 2VNCA 3KYOA 1T89C 1C5BH 1CGWA 1XCQA 5FA3B 2X2YA 2XKNB 4HS8H 4JB9L 2NTFA 4RSVA 2B2XL 2Q87A 4L3CB 3WKNA 5TQ2H 1FVDA 1J1XL 4XHJC 1UVQB 5DD0H 2AK4D 4HJJH 5IQ9B 4ONFH 4K8RC 5L88H 1YEGH 4M6AA 5IHBA 1CDJA 1T03L 4U6VH 1CTOA 1DL7L 4Y8AA 1VENA 4OD1H 5CEXB 1JYWA 3HMXH 3TYFB 2E6PA 3L3GB 3KR3H 5DJCA 3WNOA 2XTJD 1S7QB 3QEHA 1TZHA 3KLHD 4H8WH 5IEKB 4N0YL 4GXUM 3L7FA 4GG8A 4QTHB 4PREA 1LO5B 5FF6B 2XA8L 1EBPA 4YDKL 1IBGH 3IB4A 4HJ0D 3TIEA 4WW2F 4YDJB 2AERT 2J8OA 2QADC 2UWEB 3L3IA 4FFVC 5F97E 4GO6B 1FNSH 1MVUA 1LO0L 3MX0A 3ARWA 3MV7A 3DX6A 4XBPA 3L3JA 1KN2H 2FIKA 3MUY1 3DVNA 4MSWA 2BNUA 4NQDD 4U1NA 4ENED 1OHQA 4PJEF 4DK6A 1J18A 3MRFB 4NC1E 4LRNH 1C12B 5CIPH 3FT3A 4LSPL 3GMOB 5J6HB 3D6GA 3TBVB 8FABB 5D1XA 4Z6AT 1IGCL 5SV3A 3WXWL 3T3PF 1U8PA 3U48A 2FD6H 5FUZH 2ARJB 4GSDL 1CXFA 4IS6B 5ISZB 3PF2A 2W0LA 2EYTB 1MRDL 1A4KA 4I18C 3PJSB 2X4PB 3MLRH 3WBDA 5B4MC 3JWNC 2VL4A 4JY4A 5GS2D 5J1AA 4PJCF 4PJDF 2DM2A 3BFOA 5TDOA 1QUNA 3G9AB 3T0EA 3DVGA 4OGXL 5GJTH 1W8OA 1QO3A 2R0KH 5TDPB 4TUJB 3RVTD 1IEAA 3PHOB 3U6RA 1OAXL 4I0PC 3OKOA 1P4BH 1X5XA 3P0GB 5KSBF 1CLCA 3ARZA 3FONB 4OLUH 1MI5D 2EE6A 1F4HA 1NCBL 1PEZA 5F96H 2JJTA 3BP6B 2VDLH 4F7EA 2DBLL 4R4NC 3GSXA 3F12A 4PRHE 2VAAA 2PO6D 3L5WA 1G9MC 1MELA 4J4PA 1RIVH 3K4DA 43CAB 3H9SE 2O5ZH 4DKEH 1A7OH 4JZJC 2H2SC 2NXZC 4XI5D 1YMME 4P4KC 3IDNA 5D7JB 5E24E 1BPVA 4L8DA 2VXUL 2BY0A 4G8GE 4JO1L 1U3HA 1FLRH 4G3YH 2B8OT 1MJ8H 2UUDH 3PUCA 5BS0E 4M93B 4HHAA 1JF1B 3CMGA 3EOTH 3HE6C 4KRMB 4N1EA 3B6SB 4HIHB 4AMKH 1MAJA 5TJWK 2NZ9D 1P4LA 4Z7UA 1UJ3C 4GRLC 4QOKE 3CH1B 1K4CB 2H2PC 2HT2D 1ETZA 3H8NA 1HSBB 4IRSD 1JGDA 2AW2A 5MI0C 4HQQH 5E7BA 5D8JH 3P40A 4Z7QF 4K94C 2BNRA 3TZVC 3B3IB 4DCQA 5I1HL 4C54A 3BVNB 3CLFL 3X13B 1FE8L 2PETA 4GRMB 2IBBA 1E4JA 3OJDB 1CT8B 3VGBA 4YDIL 4CU8A 3THML 1XF5A 4U6HB 4ODUA 3QI9A 4PJGF 4A6YH 4FFWC 4XCYB 2MKLC 5ITFA 3TBTB 3VXRD 1BJ1H 3WS3A 3FB7A 4KROB 3LRGA 2ZNWA 5JA8B 3MCLL 4X7TA 4E41D 1RZFH 4JFPB 2CO6B 2JIXB 3S34L 3PNWA 1NEZB 4MJ6B 4O51A 1IL1B 2NQCA 3FT4B 1C5DA 3UO1H 1AQKH 3OWEA 2D9CA 1YA5A 1ZT7B 3IF1A 4F7MA 5E8DH 4Y1AE 4X9GA 2FJHB 4AQ1B 3KVQA 4G43A 3QULB 4ZPTB 3U83A 4HUVA 3OR6B 4LPXA 4CADB 3KPRD 2E8ZA 1HWHB 4FNLH 4P57B 3VXSD 5I75C 3K3QA 1JN6B 3M1BA 2XZQL 4O00A 4MNGA 5DQDL 5I73B 5H94A 2R1YA 2HH0L 1PSKL 4HLJA 3L7EA 1KN4L 3QDJB 5IVXA 4EN3A 3BOVA 5DC9B 5EU6E 4CBPA 3DGGB 5H35B 3ROOB 4HWBH 4F7TA 3BQUB 5GRXG 3BPLC 4XP4L 4ZO6A 4MAYD 2AV7A 4U7MA 1B0WA 3JZ7A 5ALBL 2L4OA 1I8MA 4PGBA 1OCWH 5FKAB 1J0IA 2A74B 4BQ6A 4PLKD 3AY4C 2C4FT 5DJ0B 3RJDA 5I76A 1AI1L 1K9TA 5DZNA 5KVFL 4LNRB 4MQXD 3BD3A 4QXTA 4KKAD 5T3XL 1YEDB 1A1MA 4XP6H 5JXAL 5K9JH 5C6TH 1YYML 4EDWL 2B20A 3QUZA 5C09D 3KPPB 3AAZB 3QWOB 3SE3C 3GJEB 3X3GL 1ZT4B 2D7QA 3NPSB 4NO2A 2EDRA 1FPTH 1MREL 3FO9B 3KWWA 1AE6L 1CFSB 2QKIB 5EG6C 1XGQA 4WHYH 5I1LA 3DECA 5I66B 4DZBA 4ODSL 2CUMA 3TCXA 5T1KA 1NFDB 5IMKA 4OF8A 3IGAA 35C8H 4KC3B 4R9HA 3TEUA 4PP1D 1BWMA 5GRJL 2I9LB 5IHZA 3WSQH 1BF2A 4D0CA 4CVWA 3O4OC 4MMXC 1XF3B 3MO1A 2I9TA 3WLWC 2A0LC 1QLEL 3U2SB 3PL6C 4LAQL 4DW2L 1NGZB 4JZOB 3GO1L 4UV4L 4JDZA 1XGRA 1S9XA 2HG5A 5IK3A 4OV5A 3FFDA 4ZUWA 5FO7B 3GSQB 5KVEH 5ESQA 2YD6A 1FGVH 1A5FL 3OR7A 1XT5A 1BZ9B 3QEQA 1N5YL 3VA6A 5C0BA 3EZ8A 4TYUA 5IEHA 2WINA 2RHEA 4WHDA 4WI9A 1J9CT 3BKMH 3GGWB 5E8OA 3RVVD 5KSAB 2ZSVB 4YHZL 4HS8L 3T08A 5E9DE 5TQ2L 5DD0L 1M71A 1S5HA 4ZQKA 2NX5E 1RUQH 1GVIA 4HJJL 3QH3A 1F4XH 4ONFL 4ORGA 3VXMD 4LSDA 3C5ZA 4U1HB 1YEGL 3O8XC 5L88L 3Q3GB 3S4SG 4U6VL 4Y5VC 1GL4B 4P4RB 1S5IH 3L1OH 4MJ5A 4OD1L 3HMXL 3KR3L 5DEFA 3BRGC 3HRPA 3ZHDA 4OAWA 5CMAB 4Y4HB 5DZOA 1I1FB 2EKSB 3MZGB 4ERSH 3W9DA 5EO1A 4H8WL 5LG1A 1JZ5A 1CVSC 1TVHB 4JHWH 1R5VB 4J3OC 4LVNB 4NM4H 1BIIB 1NBZB 4RZCA 1D5MA 2EEAA 2UZIH 1M7IA 3VFVB 2CLVA 2OQJA 4U1LB 1IBGL 3DURA 4MD4B 5IV2B 3TBWB 3ILQC 4UV7H 3NACH 2WWMD 1IQWH 1D5XA 1FNSL 1JK8B 1PY4A 1SY6A 1JTOA 4GMSH 4LCCA 3KHQA 4KK9D 2B4CC 3QDGD 3F7QA 4QXUH 4XCEA 3RIFK 3DUSA 3TO2B 1PX4A 1KN2L 2ZOLA 5GPRA 3ARFB 1A9EB 1E4XH 4PV9B 4HSQA 1NAKH 1FO0L 5DHYB 3ZO0A 3GMMB 3AREC 3DROB 4Q6IC 5FGCE 5MENE 2GJ6B 1INQA 2FD6L 3HZYB 1T4KB 4MVBD 5FUZL 4NNXB 1V7MH 3ZE2E 4ZFZB 4LHUD 1DBAH 2YN3A 1IAOA 2VKXA 5HYJA 4FQXD 5K9QG 5F7HA 5EFIA 2HTKD 3MLRL 4JVPA 2VLRA 2X70A 1XIWC 5T5NG 1WSST 4BK4A 4MNHB 4MCZB 4NZJA 2R2HB 1A22B 4XMKH 4HGKC 5EWIH 2EDHA 4U6XA 4F9LA 5GJTL 4NCC2 4UNTA 4U3XA 5DMGD 4HAGA 3BMWA 1EO8H 5EC1B 1P4BL 4WW2B 3ULVD 3IDYC 5IB1A 5FECB 4OLUL 5E7FA 1FGNL 3VXNB 5F96L 5IB3B 3MRIB 3S8WA 2VDLL 3VFUB 2V2TA 5HTSA 5EBWA 2YC1B 2X4SB 1FNEA 5HVWA 2MQ0A 4GKZB 3RX5A 4ODHH 3VMNA 2KZ1B 1RHFA 3BEWA 1HEZA 1OM3H 2DQTH 4QYOB 1RIVL 4LCIH 1I1CA 2EDOA 2O5ZL 4OB5H 4DKEL 1A7OL 4KDVA 4LPCA 1S9VB 1T7YA 3KYNA 4LIQE 4IRJC 1M7XA 1BVKB 4HLZH 2DBJA 2E7MA 1Z2KA 2NY5C 1DDHA 4M61A 1FLRL 4PJDB 4PJCB 4G3YL 4QGTA 4WV1A 1JGUH 5I8EA 4M4PA 4XHJD 1MJ8L 3NCBB 2CXKA 4JVWA 3U36B 1CLYH 3EOTL 3S35X 2HLAB 5D5MF 3LV3A 2CPCA 3MNZA 4K3JH 5F70A 1FL5A 4Z7OE 3QO0A 2P46B 4L3ED 2FLBT 5E4IA 4UQ2B 5KSBB 2QQKL 3GMPA 1RJYB 2CR6A 4J6RH 1KF9B 2YA2A 1CG9B 2JK5A 4HQQL 4JAMB 5D8JL 1NCTA 3HG1B 3MLVH 2Y72A 1AD9B 5J1SC 4U1GB 2OJEA 2ICWB 5IESH 3FO1B 1EIBA 3O11A 2BOCB 2O5XH 1EJOH 1JHLH 3MLTB 2WUCH 3WFHA 4N90E 2B5IC 3JWDC 5E6IB 5JHDE 2MSPA 1IC5L 4QXWA 2P5WA 4J7RA 3FQWA 5T1DH 4X9IA 1D7FA 3TVMC 3EOAB 5EUOE 5GISH 4P59H 3IJSA 4A6YL 1I9JH 3RNQB 1UXWB 3RGVC 3R4DA 4MD0B 4NKIH 3FCTA 4OFYA 3L3KA 4MLSA 1LEGA 4NSKA 3HCVA 3VXUB 3KPMA 5JZ7C 3HE7A 1AQDB 2VZTA 4CMMA 3PWUB 2ADJB 2EEDA 4RWYH 4NDMB 3UO1L 1AQKL 2FJGB 5EU4B 3NCCB 2HFEB 1FN4A 3QXDB 1HHGB 5E8DL 2W92A 3OAYK 4Y5YC 1CL7H 5C0AD 1S7VA 3G5ZB 2Z92B 4QRPB 4RGMB 5KG9B 1I1AB 1H15A 4FNLL 5IHLB 5IBUB 5IW6A 4HWZA 1U42A 5E1AB 4G6JH 2A83B 3ZT5A 3V5HB 3X12A 1NDGB 2FGZA 5EPMB 2ZG3A 3F7VA 2OI9C 5D93B 4YK4B 3MRGB 3O3BB 4H0HB 4WI7A 3BZFB 1MFCH 3I6LD 4N9GB 3PIQB 5CWSB 4C83A 2ZCLH 3ES6B 5DMJB 2DQEH 5IR1A 3KPNA 1ZS8B 4HWBL 4KVNL 3TNNA 4WHTA 1Y0LB 4DFHA 1NBYA 4RDQG 4P23C 5IBLD 1YDPB 6FABH 3MNWA 5C9JB 4WTWA 4JFDE 1KIPB 1EVTC 2HKHH 1OCWL 4Q9BA 2F5AH 5CLTA 2F53D 3TP4A 4X4XA 5EN2A 1ZTXH 3C09C 4JRYD 1G7QB 3BIKA 1E6OH 4MD5B 1FL6B 4R97B 4XP6L 5ITBH 5K9JL 3C60D 5C6TL 4PRHA 1S9YB 3P9WB 5CBAA 3C6LB 2ZOKB 1QFWI 5F89B 1FPTL 3BP7A 2LABA 2AXGA 5IQ7H 5CP7A 1CS6A 3T1FB 2IBGA 4JPIB 3CSGA 5F6HI 3UTZA 4ZUSA 1YMMA 4LLYB 4LVHC 3W5NA 4G6FD 4P9HC 35C8L 1EAJA 3MRLB 3RJQB 5GS0H 1A02N 3WSQL 3N1FC 4L8CB 1KCRH 1L7IH 2C26A 1GGCH 3DVFA 4FTVE 2DTSA 2IBZY 4QOKA 4Q9QL 1YN6B 5KVEL 1FZJA 1FGVL 5FB8A 4ZO9A 3V0VA 5D70H 5D71H 1T6WA 3LH2H 4JN2A 5HHXH 5IMOB 5DUBA 4XP5H 5ABDE 3TH4T 2BMKA 4XWGH 4AEFA 5L2JA 3BKML 1X5HA 3OKEA 3HB3C 2LV4A 5E94B 5AD0A 4LASH 3W5MA 2Y25A 2NR6C 2VSCA 1D9KA 2OZ4H 5FA3A 1A9BB 1F4XL 1KPVA 1JV5B 2VXVL 5ID1B 5T1LB 1FV1A 4JRWA 5C08B 2VN4A 1UVQA 1S5IL 3L1OL 3H9HB 3NIDF 3K1KC 4XAWH 3RWHA 3DWTA 4H26B 4ERSL 4DN4H 5ANME 1OT1A 1I4FB 4O58H 2O5YH 4JHWL 1H8SA 1CXEA 1EGJH 3O9WD 1UB6B 3MV8E 1S7QA 4JRXE 4LMQE 3FB5B 1XZ0B 4GBXD 1QFPA 4KI5D 5FM5M 1LQSR 2B7DT 4MJIB 2PKDA 4UV7L 3V6OC 4Y4FB 5DJ6B 3FQNB 1IQWL 3BKJH 3BGAA 4WFGE 5FF6A 3LEYH 3QPQD 4NQCE 3QUYA 4GMSL 4Y1AA 5I1AB 2VDKH 4QXUL 5EBLB 3D18B 4M48H 3QG6A 4LPVA 2OXHA 1E4XL 5HHME 2D3VA 2H8PB 3TH3T 3GMRB 1ORSA 1T20A 2LTQB 5LBSL 5HGBB 4V1DE 3V5KA 4XNZB 3IFNH 5EU3B 2XWBA 3RWCA 3SDDA 3FKUS 3UPRA 1DBAL 3TBVA 3KPTA 4M6NH 3HN3A 1K8DB 3QIWD 5EULV 4JM2C 1EHNA 1HHJA 4IS6A 1FZOB 3P9LA 1T5XB 5ISZA 2EYTA 3PJSA 1ZGLP 1MCBA 4XMKL 3O41B 5EWIL 4UT9L 1JGLL 1IKNC 3MV7D 4PJGE 3A67H 3OGCA 4XNYH 4F9PA 1J11A 3MFFB 1Z3GH 1EO8L 4LDEB 4ZSOB 4I77H 1H3TA 1A7BA 2YXMA 5LGHH 3IVKB 3PQYE 3HS0B 5H8DA 3SDXE 3PHOA 1MPAH 5GGQH 4MAUH 4WFHD 2BERA 4LHQB 2A0LD 4QLRA 5JIHA 4K8RH 3OAUH 3VDAA 1UT9A 5F1OB 2WWKT 1ZLUK 3SCMD 4AIZB 2HJFA 1OM3L 2DQTL 4LCIL 3HAEH 4PJ5B 4TNWF 1YMHB 1WIUA 5E8PA 2ED8A 3MOQA 1BVZA 3TJEH 3OTTA 4JO3H 5GZOD 3LSOB 3JWOC 4F3FB 5F9DC 43CAA 3ZMRA 3SDAD 3GK8H 3ETBF 2VLLA 3OL2A 4DEPC 4MA8H 4XX1G 5FA4B 1HHKA 4CKVX 5IOPA 2CLRB 2F54D 5E2UH 1L0QA 3RNKB 3FO0L 4GLRI 3TM6A 4K3JL 2AV1A 1FIGL 2QTEA 4Q6YA 2YEZB 5F7WC 5GGSY 3ZLQC 1OWRM 1F4AA 5C3TA 1N5AB 4PRNA 1B0GB 2ZSWA 2BSRB 3B6SA 4HIHA 4J6RL 1BEYH 4J4PD 2YPKB 1GH7A 2VABB 1BQLL 4PY8J 5BVJB 3QUMH 1K4CA 2EKJA 1P2CB 2RCSH 4YHOH 5BRZD 3RDTA 1ZLUH 1XAUA 5IESL 1UXSB 2O5XL 1R3HB 1JHLL 4N1HB 5EZJA 2WUCL 1EHLH 1P1ZA 2YPLB 3G6JA 1GOHA 1U3HD 4GMTH 1VFBA 2NX5A 5TE4H 4HXBH 2V5SA 1IT9H 5E1HB 3HI6H 3RU8H 2E3VA 4IDLA 5DT1H 5T1DL 5ELIA 4FZ8H 5GISL 3EDEA 3OJDA 1CT8A 4P59L 3QUXC 4J3UA 3V4VH 3BZ4A 1I9JL 2VR4A 3AB0B 3LPFA 2NPLX 5CBEB 1Z0NA 5T3ZD 5DQ9B 1DLHB 3AXLB 3LS5H 3L9RB 3WDJA 4WO4B 4XBEH 1OPGH 1R5WB 5CIPB 1KOAA 4XCYA 5D5MB 4KDTC 4XNQA 4V2BA 2ADGB 1V8HA 3IU4H 4ZUTB 2BNRD 4RWYL 4YX2H 5HPMB 1E4KC 3MRKB 4PRIB 1KYOJ 1BM3L 3K8LA 4MA1C 3MV01 1T21A 3QQ3B 5DS8B 3EGSB 3RZCC 2NLJA 1NJ9A 1CL7L 1EFQA 5C2BH 3GKZA 3DRTA 4OM0H 3V8OA 3T04D 1ZT7A 5E8EB 1A2YB 1FRGH 1MUJB 3CVIH 2CKBA 1SJEB 4QRUA 4G6JL 4PRPE 4ZTPH 3O2VH 2FEEI 1BOGA 4Y4KB 4OZHF 1PX3A 4LSVL 2D2OA 3F65A 4POYA 4G6AC 1MFCL 2OTWB 2NW2B 2CUIA 2ZCLL 1V05A 2QQLH 1OD9A 2QQNH 5ENWB 4EDXB 4X5XA 3O4LB 5MEOA 4R4BB 5E5UB 3O3DA 4CN4A 1INEH 3DGGA 5H35A 6FABL 4OLVH 4I2XE 2HKHL 1F45A 1CCZA 5BCAA 2F5AL 1GGYA 4K94H 4PJAF 1CFQB 4YGAB 3ZKSD 1SJVA 1H8OA 1ZTXL 4PG9A 4RNRB 5AZ2L 1BFSA 4QGYA 3G08B 2FB4H 4NQXB 1E6OL 2CQVA 3ZKMC 1NC2B 1H3WM 3RL1A 5JOPE 5ITBL 3AFLA 4XXDA 5D7KD 3OSKA 2G75B 2DTML 4M6OL 5CUSH 4LNRA 1T1XB 3LKQB 3PWPE 3BDXA 5CZKA 2XI9A 4PGZA 4EN3D 4L8SC 5FO8B 2PYEB 3WJLC 4Z76A 2KH2B 1A6PA 2FSEA 2VH5H 4QKXB 4HC1A 3QIUA 5IQ7L 2HFTA 4Q0XH 4Y16D 1XH3B 3KPPA 3LB6D 5HYIA 1QSEB 1ZT4A 4N8PA 1U8IA 3L3HA 1UFUA 3D25B 1B90A 3BIAX 5TGBA 3RAJH 1BHGA 3TYGH 4TVPD 5GS0L 3LKSA 3O3EB 5FCSH 3T0VA 1KCRL 4J3SA 1FH5H 1L7IL 3MGAA 3DV6B 1GGCL 4K2UH 3L3OB 1XF3A 2JJSA 3QUZD 3JV4A 3FZUC 1FYTD 5D71L 1NGZA 4JFHE 4JZOA 4B50A 5HHXL 1CD1A 3GM8A 5FO7A 1GZQB 1PY9A 4NKOA 4A6YB 2YD8A 4ZAKD 5F7NC 4XWGL 4XP9H 1BZ9A 2A6JB 3INUH 4WGWB 4NKMA 3LKOB 4LASL 1WT5C 5FDWB 1U8LA 4NQEE 5T1KD 1S7SB 3WEXB 2OZ4L 3GGWA 1BP3B 3CU7A 3NZ8A 4K71C 3V4UH 5IIEB 5BVPH 3PGCA 4XPHL 2HVJA 3WKMH 5EIIA 3ULUD 3H42L 1BJ8A 4W4NA 3T0WA 3U0TB 5GGRY 1W0YT 4XAWL 5GRZA 5TPWH 4MYWB 1FCCA 3Q3GA 3L5HA 2GTZB 1SYVB 4AH2B 1JWMA 4Y5XC 2EXWD 4O58L 2O5YL 1EGJL 2ZPKH 3QEQD 4OCMC 3VI3F 1I1FA 2KBGA 4F7CB 3WIIH 2JJUA 1TVHA 3EDKA 3QHZH 2QEJA 3BGMA 3BKJL 1BIIA 3LEYL 3VFVA 3T2NH 2PTTB 5HD8C 4MD4A 1KJMB 2VDKL 5FYLE 3VD5A 2Y07H 5GXBB 1P6AB 3TV3H 1UKQA 2VQTA 5C07B 2BRQA 4ZO7A 1FFRA 4M48L 1U8JB 5D7JC 1RAMA 2FDBP 1U92B 3F5WB 2X7LB 1J86A 4U0QB 1CGSL 3BPCB 2DQFB 1FVEB 1WAAA 4ELKA 1T83C 1XR9A 3IFNL 5CP3A 3ARFA 3MRNB 4M62H 4QRRD 3RWFA 1CFTA 4KK5C 3V6FB 4HKZA 4PV9A 4M6NL 3HZYA 2AKRB 1GC1C 2ZCHH 1HOCB 3AGVA 4MZ2A 3EFFB 1YJDC 4LU5L 4W4OA 3MBXH 4PD4J 3FHQA 3CX2A 3W11D 2XPGA 3HA0A 2ICWI 1AHWC 5IGXH 2Z31A 3A67L