3LQMA

Structure of the il-10r2 common chain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
201
structure length
201
Chain Sequence
MVPPPENVRMNSVNFKNILQWESPAFAKGQLTFTAQYLSYRIFQDKCMQTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVQITFSPVDDTIIGPPGMQVEVLADCLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKQGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of receptor sharing by the IL-10R2 common chain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Interleukin-10 receptor subunit beta
total genus 35
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lqmA01
1EERB 3DETD 2CO7B 3L7EA 3JVGA 3F7RA 4I0PB 1YMMB 5EB9A 1EO7A 3TO2B 3WUWG 2Z4QB 5INCA 2GT9B 3F6LA 3TA3C 3GSUA 5FV1L 3SKUD 5I0DA 4G6KL 5IB3B 5I19H 3ZT7A 4MB4A 1S7RB 1MJUH 4CW1A 3MZGB 1WICA 2UWEA 3VFTB 3ALWA 1I3GH 2Q76A 4MAUL 3TO4B 2BOCA 1SEBA 3E2HC 4RZCA 1B3JA 1D5MA 1F00I 1NGZA 1NCBH 4XC1H 4C57C 1BD2A 3O8XB 4RAUA 2B0SL 1U6AH 3ILQD 3QJFA 3MBEC 3RJQB 3UBXA 2YRZA 3DRTA 4PRDA 1CYGA 4NP4L 1JHKH 1MQKL 3OB0K 5FHAH 4U1IB 3ZDZF 2DLFL 5CKGA 5B3JE 4ODHH 1WC7A 3GSWA 3TYGL 2VLJD 1RIUH 5FYJL 4G6JL 5FM5M 1YQVL 2NXZB 2WV3A 4G7YL 4J23A 1F4HA 2Q8AL 4Z5RA 5FO9B 1HHHB 3VFOA 4EOWL 4FXGB 3RA7H 1E4WH 2DI8A 3HI1B 1ZHNB 1GGIL 3VA6A 2AXHA 4CVXB 1V3LA 4QRTB 4GJTB 5B38G 1WIOA 3W82A 4F9LC 1WEJL 3GSOB 4P2OA 5FOJA 1BFVL 5IVNA 4U3HA 1ZTXL 5FYLE 2GJ6E 2YD1A 3IDIB 2AABH 1IQDA 4Y2OA 2BNQD 5I1KH 1QRKA 4JREB 2MOVA 1Q9WB 4XNYL 1IEHA 2MKLC 4MXVF 4JQIL 5CP3A 1CT8A 3O3AB 5I8KL 5HHVH 1EHAA 4DCQB 5D7KE 4JKLA 4ZUTA 5IW6A 1OP5H 3ET9F 3ARQA 4YE4L 2R69H 4IM8A 5ID0A 4HGWA 2G60H 2YEZA 1HINH 3B8YA 3MV7D 3LS4L 4PY8J 4TSAH 4HUNB 1OAQL 4ZO9A 1NEUA 1I7UB 3BT2H 4PV8B 3I9GH 5GS1B 1AO7A 1H5BA 2R4RL 2DQFA 3KPRA 4J3OC 3H0TA 2XPGB 1P4BH 2FH8A 3BN9C 4FP8H 3QFJB 3ZL4L 5IMOB 5E94B 1RQ5A 1YYMH 1CR9L 1XCQB 1Q8MA 1LO0L 2E8YA 1FO0A 2J12B 6FABH 2NY0C 4PRBB 1P6AB 4BM7A 1OAYH 1Q0XL 1AQKL 8CGTA 3FAXA 5FK9A 3U0TA 3IXTA 4FZEH 3UROR 2ORBH 4WVRA 1JJUA 1FLTX 3V6FB 1A6WL 2YR3A 5HGAB 2PYFB 3IDJA 1MFAH 4KMTH 5K9OB 3GMMB 3QIUD 3AS1A 4Y8DC 4UINH 4XNQA 3MA7B 2Y5TB 1YPZA 3OMZA 4U2ZA 4LEOB 5L9DL 1I9IL 3QUZC 2EC9U 4MSWA 5DJCB 1R0AH 4X7TB 3MLVH 2R56H 3SQOH 2HMID 3Q6GH 4G43B 5FB8A 3HMXA 4JVPA 2IPKB 1E4XH 1FVDB 1AXTH 3QEUB 5F6HJ 3F12A 1G7PB 1I8KB 2DQUH 1IBGL 1XFPA 2R0KL 1NGXB 4XWOC 4D8PA 3AS3A 1MCNA 4WWID 1BJ1H 2B4CH 4P9HH 1O0VA 1NCAL 4OD2B 5CIPH 1JPSH 1NC2A 4NRXB 3UTPD 4S1SH 4LHUG 3P9MA 5K9KA 1X5HA 1CLZH 3LEVL 3P4OA 2Y9RT 4LEXL 3RWCB 4U6VH 1PQZB 1CFQA 3W9DA 2GQHA 3LZFH 2Q76B 3RP1A 1A4KB 3BJ91 1OLZA 1SMAA 1I85C 5J13B 4MNGE 5EPMA 4JFEA 4PJBA 2OTUA 3OHXB 5IB3A 1JWSA 3IFLH 3J7HA 3L1OH 4AIOA 3EDEA 3FT2B 3TYFB 3MNWA 1BREA 4MJ6B 3H7BA 1FFNB 3TO2A 5HI4C 1YMMA 4U2YA 5IR1B 3ZT6A 3MLSH 4F2MB 4HG4K 4GOSA 4ZSOE 1ED3A 4PRPD 4DEPB 1HH6B 5TGBA 5CGMA 4XP4L 3VWJB 2W0LA 4NCC1 3TIEA 4ZTPH 1T0MA 3SGKC 3WFBL 4Z7NF 1K2DB 4HV8B 4X6EA 3Q5TA 3WIHH 5CKAA 1BVLA 2FO4A 2F19L 3BUTA 5D4QA 1UENA 1YDPB 3CGTA 2NXZC 3T2NL 2BVUA 4J1UB 3BISA 4A6YB 1MCIA 4OZHB 2OTWA 5IVZA 1PKOA 1VADA 4YEFA 4HDIA 3TNNB 1N8ZB 5J1AA 1HI6A 5GIRB 5TDPA 5IJVB 5ENWA 2EDJA 1X4ZA 5DJXA 1VCAA 3MLTA 5KS9B 4DW2L 5ISZD 1R5IA 1AR1C 4EUPB 4LVEA 1VKXA 3VG0H 1S9YA 3CLFL 4NYLB 3RI5F 4ZOBA 1GGCL 3G6JE 3EYVA 3ZHKA 3NPZB 2APFA 1TVHA 5EZJB 1YPZE 1T7XA 3FQWA 1U41A 4ODXA 4P4RB 4KRMB 5E7BA 3GIZH 3PNWB 4UIMB 2VXSH 4YR6A 1B2WH 1KCSH 4XVSH 4FQLL 1A1MA 4JPIB 5DMKA 4W4OA 1L6XA 4RQQB 2BDNL 4X6DB 1KCVL 2CLRA 2P7TA 3I3DA 2ZUSA 5H2BA 4LPCA 4XXDA 1YNTB 2KH2B 3LD8C 2BFVL 3OG6B 1VGKA 3BQUA 4EI5C 3H42L 3EO1A 3FB6B 3HFML 5DZOA 2H3NB 5EUOA 3FQTB 4C58B 1PY4A 4NZDA 5D93C 4JKWA 1TCRA 4S0SD 4HV8A 4PLJD 4RA0C 3K8MA 3ULVL 1KIQA 4XBPA 3VH8B 1N6VA 3MUY1 3PIQB 4M8VA 4OJFH 2N7AA 3VFVB 4PLJC 1ZHLA 2AW2A 3CDGB 3BWAA 4JLRB 1YEGH 3BDYH 4RFOL 2YPLA 3CFCH 2EECA 1R24B 4GBXA 1JTPA 3WSQL 2WLZA 5C9JB 5HD8C 1BD2D 3TH2T 3UTOA 3DUUA 4PRNA 1FFNA 2R4SL 4PJBE 3MUJA 1JHTB 1I7RB 1K4CA 3TLRA 5F1NB 3HNTH 4X4XA 3OAUH 5HHOA 3N85H 3HE6D 1BAFL 3G5VA 4HIEB 4MA3A 4PBVC 3MV8A 2YZ8A 1HHKA 1BEYL 2PN5A 4EN3B 4LVHC 2ENYA 3V6OE 3VGBA 4XAKE 3ARBC 3AC0A 1UVQB 2ZUYA 3PP4L 3W2DH 3MXVL 5KTEH 3SDAC 4L4TA 4NUGH 2IF7A 5DR5L 3BQUC 4X5XA 2GYSA 1R3KB 1MNUH 2X5PA 1U36A 2DJ4A 2IAMC 1JYNA 4KROC 1BZ7B 1MI5E 3EDDA 3EZ8A 5D1XB 1W0WA 5DVLA 1KXQE 1Q94B 4DTGL 5DQ9B 1FVEA 4XH2B 4PJ9A 2VXTH 3E0GA 1LK2B 3AM8A 3PWVA 3V0WL 1RULL 2P4AB 4HKZA 3ZDXE 4M7LT 2QQKL 4JFZL 1B4JL 3MROA 2BJMH 4HX1A 3QDJD 4FTVE 4NUJA 3DUSA 4DZBA 3MLZH 3MV9E 1M4KA 5L2JA 3VGHA 3TP4A 4OD3L 2V2TA 2HT4C 3W9EA 2NW3B 3ARGA 4NQDE 4R90L 3FO0L 5DYOA 1P7HL 1A0QL 4RMSA 3EUUA 5JO5A 3VXUD 4GKSA 5F7WC 1MRCH 5GS0C 5DMIH 5MP6L 5KVEH 4K7FA 1LMKA 5IM7A 2RIKA 43C9A 2H6PA 2BOBA 4J8RB 4WDIA 4JPVH 4KU1A 2MCPL 1E28A 1R6VA 2VERN 2PW1A 4J1UA 3OKDB 2OL3A 1NCCH 3HB3D 4JKMA 3O6KH 1X5LA 2FLRT 2OJEB 4JFXB 1RPQA 5FKPB 3N1PC 1E6JL 2YBRB 1MAMH 3V7MA 3RAJL 3GMOA 1DQJA 5EFIB 1N5AA 3JVGC 4MA7H 5IMOA 1O7VA 2DICA 5T33L 1GPOL 4RRPG 1RZGB 5TDOB 1H5BB 1HOCB 5F7EH 3LS5H 4M3JA 4X5XB 3ULUF 3SGDI 5LAXB 4BUHA 1I8MA 4N0YH 3QQ3A 3D3VA 4XAKD 5E8EB 4Y5YB 1NGPL 3CSYA 4JO4H 4ZO8A 3P11L 2LU4A 5T1DH 4OM1L 4JQXC 1F45A 5B3NA 5I19L 1SJVA 5DD6A 3UJJL 5HHOB 2MPAH 2V6HA 4KVCH 5HHQB 4JFEB 1RZFL 1UYWL 5GZND 3T0EB 4UIKL 3WJJC 5L0QB 5KS9E 3W9DB 1H9VA 4WI2A 3RL2B 3MRGA 1V3JA 4MD5A 1J5OH 2BSRA 1G1CA 1XF5A 2NNAB 4N90E 1KPRB 4XBEH 2XZAL 1WWBX 5DLMH 5EIIB 3MFFA 4FQHB 5I17B 5MENE 1XF2B 3G5VB 1XGUB 4HIEA 1XGQA 5IV2A 5SWQA 5D5MA 4MD0B 4P23C 1S7VA 2W59A 4PGBB 3QIWB 5JW4R 2IPTL 1OL0A 3WKNA 5C08E 4MJ2A 5LQBH 3RA7L 1WZMA 3UYPA 1GGIH 5F7HA 1MFCL 1K8IB 1WWCA 2X70A 2GJ6D 1NDGA 4U1MA 4WHTB 2VXQL 4YHPB 2E7LC 1OP3K 5E5MB 2DQIL 3L95A 4UOW0 3OKMB 1I1AB 1BFVH 5A2LH 3FO9A 1A7BA 2KZ1B 4O2FB 1KIQB 4OLEA 4KRPD 5C3TA 5D1QC 5C07E 5DUBA 1YMMD 3MOAL 4D9LH 1CICD 4WV1C 4H20H 1NCDH 2HLFC 5HGAA 3QXWA 4FTVA 5JIIA 3V8CA 1NUDA 4X6CB 3S4SB 5I8KH 1RIVH 2HJLA 1S9YB 5DUPL 1A6AA 4ZD3H 2F53D 3RWEB 3WFEL 2DWEB 3JSSA 4OIBA 2BVOA 2R23A 4JPWL 3HTLX 1KXTB 4G6FB 5KVMC 1BQLL 1EAPA 3DTXB 5IJKC 2CLVA 3KLHD 1UGNA 4DOHB 4HS3B 2V2XB 5BJTB 4CGTA 4PD4K 3V4PL 3CDCA 1KOAA 4XP5H 2B7DT 2Y5EA 4NWTL 3UPAA 3KPRB 1MIML 3SDCD 3C09C 3ZTNL 3R1GL 3DX8B 2N4IA 1YDPA 1ACYH 2NY0B 3QIBB 1FFPB 1CFBA 4LIQH 3D0LA 5C6WH 2IFFL 4EDWH 1CG9B 1P2CB 3GGWB 1P4IL 3WHXB 2B2XH 1FPTL 2W92A 1ZLVK 3KAAA 4PRPE 4HGWB 2ZWLT 1PZ5B 4JM2F 4PGEA 4HULB 4PV9B 4WEBH 2PCPB 1UA6L 3HAEH 2NY5L 4IHOA 4U1KA 5HYJA 3ARED 5DRWB 2VAAB 3I6LD 5DDHB 1XGTA 4OCSH 3RWGA 3FFCB 3FT3B 3ZKNC 1II4E 4FMKA 1AJ7H 1KPVA 2Y7QA 1LE5B 2UZYB 4HFWB 3NABH 5ESAB 4YUEH 2X9WA 4LPWA 4MAYD 3B6SA 4KMLB 4G8IB 3GSOA 4P2OB 1ZEAL 3INUH 2IADA 3NA4A 4GW4B 5HHMB 2WSKA 1R3JA 5FCUL 5GGVL 1REIA 4XTRC 3HS0A 1J88A 2BNQA 1HSAB 3OJVC 5CFHA 2FJHB 4D0DB 5FO9A 1NCWH 1F2XK 2FDBP 1QVOB 3EGSB 5IBUG 2IBZY 3KPLA 2V5YA 2BNRE 4XPFL 2EH8H 3HI6H 2F54B 1QSFE 1WC7B 1YNKH 3GSWB 4CRPA 3DIFB 4L3CA 4D8PB 4LQFH 1ZA6A 5KJRL 1DN0B 4OIIL 2BC4B 1X3DA 3NCYP 4FQCL 5AYUL 4F9PA 1TJIH 2AK4E 2YPLD 3ARVA 1NAMH 2MWCA 4L9DA 1X5KA 4PJDE 3GSRA 3RWCA 4XCCL 5HDBF 3HC4L 3LZFL 2O61A 3QNYB 1R3JB 4HUXB 5FO7B 3B3IB 3DHMA 1OGTA 3F5WB 1HKLL 1MI5A 2D4FA 2UWEB 4XWGL 5F1KC 5DO2D 4PG9B 2C3GA 4POYA 4Y5VA 4HIIB 4PJBF 3L7FB 5DSCB 4OD1H 3PGFH 1KPVB 2Y7QB 3I2CH 1WZ1L 4M5ZL 5CAYB 1FN4A 3SQBA 2GUOB 4G3YL 5CBEA 2FIKA 3G6DH 4PRIE 3TO4C 5JHDE 4MA8L 3RQ3A 4S1QL 3PQYB 4F8QA 1QSFD 3HNVL 4LHUB 2MCG1 4P3CL 4R7DA 4MXWL 5I1JH 1KB9J 4BZ2L 1A6VH 4RX4D 3T0VA 1ITCA 2VDRH 4EN3C 2EIBA 4K7PL 1T1XA 5HI3C 5L2KB 2GTWA 3CZFB 1CL7H 1RIHL 3QFJA 4C59B 1CIUA 5J7CC 4WCYH 4YK4B 1XGTB 3ZDYE 1FYTA 1FG9C 1ZWIB 5AYQA 5TH2A 1VEMA 1RJLB 3F62A 1QRNA 1KJ2B 5MEPB 3L3GA 1NJ9A 1ZLUH 3IGAA 2J6EL 4PV9A 2WNGA 4M1DL 1U3HA 3NFNA 1TZHA 1N5YL 4PY7A 3T0BA 3KPNB 1MELA 1MQ8A 4NO3B 3QSKB 1FO0B 1YPZF 4QRRD 5KSUA 3D0LB 3QDGD 1RVFL 4F3FA 1I9EA 1NMAH 1D3CA 3HZKA 4JQVC 2DM2A 3S88L 3O3AA 4DGIH 1FBIL 1U8IB 5IG7A 5JIKA 3M1BA 4WV1B 4NWUL 5AAWA 1I8LA 5BS0B 3NGBB 4PG2C 1WV7T 4HKBB 5CCKL 5LXGH 3VW3H 1UZ8B 1HYRC 4K3JL 1WAAA 3JWDC 1CXIA 1XIWB 3L5WB 4NJAL 4Q0XH 5DA0B 5CHNB 4HSQA 1GCFA 4U6TA 2VXVH 2IH1B 1OP9A 1EAPB 3DTXA 4CMHC 5LKNA 2BDNH 1JN6A 4RWHA 4YHPA 2B1AH 2O5XH 5JOPE 4PJXA 3MYJA 4M9PA 2CPCA 4K8RH 2ARJB 3EFDH 1QLEL 5ADOH 3LKNB 5BXFB 1CFSA 3EYFA 3WD5H 1HQ4A 4XCYA 7FABL 3IVKA 1QSFA 4MXQD 2EC9T 2IC2A 4I9WD 1J0HA 1ZLUK 4JFQB 4EN3D 3LY6A 4POUB 3C6SB 3PP3K 5JR1L 2CIKA 4OGAD 4B0MM 1N6QH 1QLFB 5AZEH 2NNAA 1KNOA 4JPKH 4U1MB 4WHTA 2VZTA 2NY6C 3CFCL 4GMTH 3RDTC 4D9QE 4FFZH 3VFSA 3K2MC 1MCOH 4IOFC 4G9DB 1L6ZA 2JELL 1QSFB 2P24A 3FHAA 4ZAKC 3PQYD 5IUSA 2PXYA 5T3ZL 2GCYA 4KAQL 5E1HB 1KN4H 5CSBA 5INDB 5EA0L 1U3JA 3VFUB 1F6LL 4LSQH 3IKKA 4WU7A 2DIAA 2V9TA 4HKJB 3SDAB 4QTHA 3T4AA 1D9KA 5E0QA 5T5FH 2IANA 3CVIH 4RSVA 1VERA 1DJSA 5D2LA 3QHZH 1XF5B 2IH1A 3RVVD 3C08H 4YHYB 1QFWH 1IC1A 4RA3A 5ALBL 1I8MB 3VFRA 1FL5A 4L8DB 4PPTA 1RI8A 5EN2A 1UB5A 1S7UA 1INQB 5MEOB 2BSSA 4NN6C 1NAMA 5ECJE 1CDUA 5D1XC 3X3FH 4WEMB 3GMOB 1UCTA 4WHYH 2B1HH 4O4YH 1EEZA 4KTYA 4UDUA 5TE7L 3UYRL 2OJZH 3RIAF 2WINB 3PDOA 4O2EB 4LSPH 3QEQE 4YGVB 3KPNA 5JQ6H 1WK0A 3FQNB 3U30C 3KPSA 3UTTA 5GRVK 3BRGC 3P0GB 3BH8A 3P9LB 1NFDE 1VPOH 4P2RB 1A3RH 4HWEL 1DLFH 3V95A 5BZWA 1HNGA 1Q1JH 4MQXC 4GT7A 3BEWB 5K9JH 3U2SB 2VN4A 4OZFG 3QNZB 4M7JH 4LGPB 2VABA 3DYPA 2V2WA 2AJYL 3ZLQC 5C0JA 1FNGA 1BBJA 1KN2L 4NFBA 4B41A 5IHLB 4WRLA 2MMXA 1FCCA 4LCWD 3SE4C 4R7NA 4PY8I 5IW3A 2AGJH 4PRHA 2HWZL 4OLWL 1YEDB 3WXVH 4NQVA 3E6FA 2D4DA 3TT1L 1F58L 1IM9A 1WT5C 4G7VL 4LCUB 2V2TB 1NGYA 5BV7H 3U36B 1SEQL 4KKLC 3VWJD 1YECL 3G5ZA 4XHQA 1Z9OA 3QIBD 4N8PA 3T3ME 4NZJA 5I0ZA 4FQXD 5CZVH 4HIHB 1XGYH 4WWKB 5KVFH 2ITCB 2QKIB 3NCYS 4PJIA 4LFHD 5KG9A 1EUTA 5T1DL 2BVTA 3OKMA 2E3VA 5JPNB 5C71A 3BH9B 4Y4HB 3P73A 1Q94A 4MA3B 5DURB 2XWTA 4QT5B 3SKNA 1ADQH 4K9EH 1HEZB 4XPAH 1PKQA 4HEPG 3O45B 4PJXF 5IHBA 4LSUH 5DZLA 3IU4H 4FQ1L 4YXHL 1U9KA 4HXAL 1S7QA 3ZKSD 1AE6H 1HXYA 5FUZH 4DAGH 4I3RH 1CICC 3QDGA 3QXUA 3EOAA 1JZ5A 3HNSH 3KJ6L 4OZGF 4TSCL 4KRPB 1KPRA 3U4AA 1P4LA 1CDJA 3D69A 3NAAH 2W9EH 3S3SA 1OT1A 3RVVC 2GK2A 1GHFL 1NDMB 3CC5B 3NH7L 2DBJA 5I1AA 1T1YA 1RUAL 2F5BL 1MFCH 3OKOA 2B39A 1R24A 2A9MH 4L8SC 4I0CC 5I1IL 5DC0A 3THMH 3G5YA 3MGTA 4Y4HA 3RKDC 4YBLC 2MQCA 3GHEL 4NKIH 3MBXL 1C5DA 2CH8A 4FABL 3QEQA 4M6NL 5DK3A 3D48R 1C7SA 4JY5L 3RDTD 4E0RA 5TQ0H 4WI7A 4X8XA 3RWFA 3F7YB 1KCUL 2FGWL 4HIHA 4I1NB 4S2SB 1NCDL 3A6CH 2O26U 4ORGB 4JZJA 5C07B 3QCTL 3K74B 1KV3A 3T0ED 2GSGA 1F4YL 3IKCA 1AC6A 1VKXB 4YDIL 3SE8H 2PYED 4OT1L 5JW4M 4OFYA 1P7KA 2IALB 4JCMA 4P2YA 1YEDA 2E7HA 3FOLB 3MO1A 5BRZE 4L9LB 4TSAL 1JNHA 1DQDH 2HKHH 4U1HB 3SGDH 4WIQA 4GKZA 1JP5A 5IVZB 4NKOB 3DRQA 4N0FB 2VDNL 2YWZA 3RVUD 1T0NA 3QQ9D 3IJHB 4OLXH 3TZVD 3MGAA 4I5BA 3BVNB 1EZVX 4OIAA 3DSNA 5SV4A 4EUPA 3X11B 4NM8H 4OV5B 1NL0H 4P23A 3SKJL 5C0GA 3GZKA 2PR4L 5D6CB 5BQ7A 4Y16C 1XIWD 5CD5D 5EOTB 3ROOA 3BGMB 4Z76A 4Y19D 3MROB 5C2BL 3MUGA 3IJYA 3DXAA 3MLRH 1PD6A 5E2VL 1QR1B 1M7IB 5SWZB 4YGVA 2FJFB 5LBSL 2WM0A 3QWQB 1AJ7L 4HKXA 1CFVH 4FFYH 1M71A 5LGKA 5I1AB 4Z0XB 3H7BB 1JF1B 1JGLL 1R0AL 3M17B 1OQXA 5IBTL 2E6PA 3EYQD 5EIQA 5KBNC 2AKRB 1NFDF 2V5MA 1MREL 2IBBA 3MLWL 4E9LA 1NEZG 3VXUE 1T3FB 2O5YL 4JM2D 4L8BB 1AXTL 3MV01 1FQ9C 2BSRB 1WQVT 3GIVB 1OTSC 2DLGA 5CJOL 1A7OL 4JFFB 3MLXH 2BVQA 3UTPE 3VE0A 1HEZA 2E5EA 4B50A 1AFVL 3DARA 1U3YA 3ARRA 3ZDYF 3LH2H 3MGOA 2LTQC 4OLVH 2J88H 4PJBB 2GJJA 1UQSA 4OF8A 1LDPL 4M7LH 1JPSL 4JDTH 5D1XD 5IQ9B 3S9DB 2XZCL 1AD9A 3MRBA 5HVWA 3DSFH 4N8VG 2FJFA 3X12A 5I71C 1TQCC 1CWVA 4L8SB 3P9MB 1YN6A 1J9CT 3GEWB 2WBJB 3VG9B 4NQEE 2CRYA 3T77B 3PIQA 2R0WH 1H0DA 1UM5L 3TFKD 3L1OL 3VGEA 2YD8A 4JM4L 5IIEB 2E9BA 5EZLB 3QDMA 1VACA 5GRYA 1ZVYA 4J7RA 2CXGA 3X3GH 2AEQH 4JFHD 4XNZB 5IFAH 4PJ8D 4JQIH 2L0DA 2OL3B 2X4SB 2PF6A 1AR2A 4A2MA 4ZFGL 5KSVB 5F96H 1A7PH 3LV3B 4ZAKD 1LO3H 3BPLB 1LO2L 3G04B 1YEHH 5KW9H 2QJDA 5DYOB 3ARWA 5F9DC 1ZHKB 3PNWA 4OGAC 4MCYB 2Y25A 4QYOB 3U2SA 1XCTA 5LWYL 2QR0B 4JM2C 3MA7A 4XNQB 1NKOA 4YBQD 1XCQA 1CL7L 3PXJA 1T83A 3ZL4H 2HVJA 2GW5A 1KLGB 3IT8D 5JW3H 5J3HC 1RHHB 3MRPB 3NZHL 4N8VA 4X99B 2D9QB 1ERNA 2UWEE 3IXTB 3MRKA 1J8HA 5FM5O 5C08B 1S5IL 3LDBB 4ZFZA 3S35L 4GAGL 4ELMF 3VMPA 5DMGD 5J1AB 1GRWA 1RVFH 2VC2H 4XP9L 3S88H 4LGRB 2CO6B 3D2UB 1GGCH 4JJHA 3E8UL 1GGTA 5CCKH 4R4BA 4K07A 3TCLB 4LLQB 3VXQB 2XA8L 4RIRB 1T1WA 4RGNE 2VLKB 4HBCH 3PQYE 3CIQA 4LSRH 4WFED 5F44A 5DJ6A 3SKOA 1XAUA 5D2LB 4Q9QH 1BQHG 1G0XA 2HRPH 3RIFK 1CLYL 3JWOC 5EG6C 5HVHB 3KPPA 4ZSOB 5KSAC 1QLEH 3JWDL 2A9NL 3EBAA 5ADOL 5CBEB 3P4NB 4JKPL 3ULUD 1ONQB 2LE9A 1DL7H 3NTCH 2QL1A 3QP3A 3V5DB 2D7MA 3B43A 3LCYA 4F7MA 4LSTH 3I75A 3OAYK 1T0PB 4M4RA 4QHLA 2NY6B 1BIHA 4N90D 5HBBA 1FGNH 5LCVH 4ZTOH 3DMMC 2I60H 1TVDA 4UI2A 4XNMA 2ICEB 5D1QD 2DYPA 2JK5A 4PRPB 1KCRL 1GJIA 1ZVSA 4RZCB 5E56A 3IS1X 4X4MA 1S5HA 5ITBL 4LSQL 4HLZG 3OAUL 2R2EA 4BKLB 1YNTA 1BAFH 1ITBB 1EEYB 3DGGA 5DFTA 1AO7E 1I1AD 1IC4L 1UJ3B 4BQ8A 4Z95L 3SDDB 2APXA 1CBVL 4LCCC 3E6HA 3G5XA 1XF4A 5IMKB 1IL1B 3GSQA 2ESVE 2EE9A 4YAQA 5ANMA 1G7PA 4Y4KD 2UY6A 4D0DA 3DUHA 5T3ZD 5FOBB 4G8GB 3MLYH 5C70A 2XQBL 3L3HA 4FXLA 5DC4B 4KWUA 3CFDB 1B6UA 1FYTD 3GB7B 4TTDD 1EVUA 2CJUL 2FYYA 4P9ML 1G9MC 4MSWB 5DJCA 3ARFC 5IB5B 4GXUM 5E4EC 3DVNA 5GS0H 4E41B 1FL3A 3OKYA 5DJXB 1E4XI 2A83B 5ENWB 3GFUA 4RWYL 1RZKL 1GXEA 1KT2B 3BH8B 4WUUB 5B39G 4QXGH 3S3PA 2IFGA 3O2WL 3UDWC 3F58L 3RY5A 1FP5A 2HMIC 1EO8L 4G5ZL 2VOTA 1P53A 4R4FH 1SJXA 3QUYA 4M7JL 4YIQB 4CN4A 2XWBB 4L29A 1ND0A 4OZHF 4EBQL 4PREB 1T0MB 4M93B 3S37L 2AQ2A 4NOFA 4KXZH 1MRCL 3U30B 1L7IH 5GS1A 3KPOB 3W0WD 4PJFB 4OI9A 1MWAB 3TBWA 5BS0D 3BZ4B 3L3HB 1WWWX 3KLAB 3BO8B 1H8NA 2VXSL 3WIIH 1F4WL 2DIBA 3B8SA 5E6YA 2CKBA 3REWA 4YHKH 1WIPA 1JWMA 2WZPD 1WISA 2NXYD 3IDMA 1TCMA 1T7YA 4Y4FA 4UB0L 4LFHG 4QTHB 4C56A 5T33H 3QJHA 1LEKB 2FGZA 3A67L 1RU9L 2CSPA 3Q6FA 3RNKB 1EGJH 1WFNA 4DKFH 3P30L 1J0IA 1MI5B 2QTEA 1XGYL 1PVHA 5MEQA 3R0MA 3U7YH 3ALXA 3ULVH 4Z78A 3KYNA 2LABA 3GMPA 1DANT 4O51B 4OCMC 2I26N 3FO9B 4DKEL 2GJ6A 4JGUA 4E41A 3KYAA 4CVXA 3O41B 5DHXB 1YEGL 3BDYL 4RFOH 1OARL 4NO2A 4TNWK 4BSVB 3MXWL 5JA9A 5C86A 2GEEA 4H88H 1IGML 3EGSA 3RU8L 4I77H 4J3UA 4HWZA 1TVBA 2Z8VC 2VLJA 3FN9A 2QEJA 3KNBA 1S7VB 5FKAB 4LLAA 1OSPH 2CKNA 1U6AL 1EHLL 4MDIA 1OP5K 4G8GA 4HMCA 4PJXB 3L6FA 5EIIA 4KRPC 5ANME 3TBSA 1FZOB 2DLFH 2NMSA 3D0VB 5F7YC 2NYYC 2V5SA 1MIEH 3EAKA 4ODHL 2XN9A 3OB8A 1HSBA 4YBHA 3D9AH 3NH7H 1YQVH 3QEHA 3IFOA 4ETQB 4E42A 3QUMA 2Q6WB 1R3HA 5JUEL 1G7IB 4KTEH 3FFCA 1KEML 4KJWD 1B88A 1WBZB 2H2PC 3V6FA 4QCIA 4BFGA 3HE6C 4DFIA 5M95B 2XV6B 4Y7MA 1KCLA 3AY4C 6CGTA 4F3FB 1RAMA 2BERA 4HZLB 4BUGA 3ULVF 4QRPB 5E8PB 1FC2D 1X5ZA 4PRBA 4Y5YA 2AV7B 2B20A 5IVOA 3WHXA 1NAKL 3N9GH 3CVHH 3IGAB 4WO4A 3MRFA 4JVUA 5CJQH 1RJCA 3QCTH 2EKSA 2QSCH 2F8XC 2ICWA 4XNYH 1Z0NA 5DD1L 1BBDL 5B8CB 5DUPH 2YRLA 1ZANL 4MJIE 4F7TA 4BSWA 1KGCD 4HWBL 2C5DC 2GITB 1T04A 3BZEA 4ZPVB 1DTUA 3BSZL 3O2VH 2UVFA 2DI7A 4MNGB 3LQZB 4PJ7E 1Q9OB 5C0IB 3TBYB 2EDBA 4FQXB 3MACL 5DQDH 4RAVB 2GIYA 5IW6B 4NHCL 2W60B 5D9SA 1GC1C 4Z7QE 1BZQK 1NCCL 1GGYA 1Q9WA 4MD4A 1UWXH 2YPLE 5E9DB 4TQEH 4YO0A 1MAML 4P5MA 3BPNB 1J1OL 4N5ED 1S9VB 3T0XA 4UILH 2EZ0C 3MRRA 3HC3L 4JRXD 1CDGA 1JNNL 3J8F7 5CBAA 1CDIA 4HIJA 1QKZH 3BEVA 5HY9A 3R06A 3QB7C 2QSTA 4L3EE 1NUFA 3HB3C 3L95B 3UP1A 4N0CD 5E2VH 1H3PH 4JFEE 3QNYA 2HJFB 1EUUA 4KQ3H 1K8IA 2X70B 5F7KC 4JO4L 2J8HA 2P43B 3C5SB 1CFVL 1GIGL 2E7LA 1QBBA 2DKMA 4E41E 5HHXL 3SDYL 4L3EB 3QIWA 1NH6A 4NSKB 1G9MH 2PO6C 5FA3B 5IBTH 3K4AA 4IS6A 4ONHB 3MLVL 1MFDL 1BJ8A 1NMBL 2HFGL 5DK0A 3SE3C 4PTUB 4KK8C 2F53B 1SYVA 2JE8A 3CFBA 4NKQB 4YJZL 3QHTC 1E4XL 1MCHA 2JIXB 3O2DA 2W1NA 5GSVA 1JPGB 2PO6A 4R8WL 5EU5A 1YYLH 2BOCB 2A6IB 1HHIA 5FHBH 4L8CA 1A2YB 2P44B 5AD0A 2D7TL 3MV8B 3RFZC 4H1LG 2VSCA 5EZLA 2DKUA 3VD3A 4LPUA 4P2QB 1LDPH 2BZDA 4M7LL 4CAGA 5EU6B 3S35X 5KVGL 1AHWA 4HS6B 3CSYB 4RISL 4Y8AA 2YSSA 5SX4H 4WI9A 5C6TH 3NFPB 2Q7NA 4NC1E 1FAIL 3IAPA 3QIUA 4O2CB 2EZ0D 4I48A 4XXCA 4N5EC 4KJYA 3SDAD 1AKJB 3U4EA 2HVKB 3DMMA 1BVKA 5F9JB 7CGTA 4D9LL 3SCMA 4OFYD 4YHOH 3MGOB 4HPYH 2AABL 3OSKA 1ZOXA 3ARDC 2XT1B 4U1JA 3MRIA 4EJ1C 4WGVB 5I8OL 1NPUA 3DOSA 4S1QH 3GJEA 3GBNL 2JB5H 4XWOD 5B22A 3GKZA 2HFEA 4N0FA 4HH9B 3FB8A 3WFEH 4O58H 4QNPE 4V2CB 2V2XA 4C54A 2AV1B 2VZ1A 3A6OA 3EFFB 5I18H 1QA9B 2W65A 3WFBH 1KB5H 2FBOJ 1G6RL 4UIMA 2OI9C 2VISB 3S6CA 3LEXA 2F19H 2IALA 4OCYH 4U0RC 2CKBL 1IAII 4DZBB 1H3VA 1P4BL 3MJ7A 4NKDA 4MAYC 3EYVB 4DGYH 3RVXD 4P4KA 5JW5A 5DRNA 4PJFE 1G7QA 1RJYA 1GGBL 2P47B 3QCVL 3HR6A 1FNSH 3IJYB 2JCCF 2AK4B 5KS9A 1DFBH 3FFDA 4A2LA 1AQKH 4AH2A 5A16A 4YWGL 5IJVA 2YOCA 5I75B 2VR9A 5MHSD 1NMAL 4G8GD 2BHYA 4OCRL 4S11A 3VG0L 4WY7L 1X5GA 4GRWE 4I5BB 3VGFA 1FSKC 2BSED 5TQ2L 2EYRB 4B5EA 5C8JA 4NRZB 4LKCA 4YK4C 4LRIC 4H5SB 2XYCA 2Y1VA 2YKLH 1SY6H 5F9WC 4NCC2 4JVWA 5JOEA 32C2A 4PP2A 4Z7UE 4NJAH 4K9EC 2W60A 2EIZA 4Q0XL 4HBCL 3KDMB 3V6ZB 4U1HA 4YDVA 3RTQA 5E2JA 3OKKB 4KZEL 4P3DA 2P49B 1QA9A 1UVQA 3QO0B 4XMKH 4DQOH 4P2QD 5DXWA 1TDQA 1V3KA 4ODBD 1JZ2A 1J1PH 3KR3H 2XZQL 5L2KD 2R9HD 4KFZC 2VLJE 3MRNB 2AJ3B 4PRAB 2VITA 3LOWA 2IMNA 4OLUL 3MV7B 2BCKB 2OR9H 1RMFH 3OXSB 4KI5D 3CPLA 4HAFA 7FABH 3I6KB 1CGSH 5HHQA 4U1GB 1X9QA 3FMGL 5IGXL 1IT9H 1GOHA 2OTUB 1KIPB 1ZV5A 4WHYG 4HZAA 3VD4A 1HYSC 4KQ4H 4LL9A 3I02B 2EC8A 1NCTA 4Y0GA 5DWUH 2QKIA 5GRVL 1N64L 4MJIB 1K85A 3BKYL 4AQ1B 1DBKL 4X6FB 4NO5B 2FJGB 5D2NE 3H9SB 2HT2C 1WIUA 4E42B 1XGPB 5CP7A 1A1OB 3QWRD 3AREA 3BAEH 4NQSA 5DEZA 2G75A 2A73B 4R26H 5T5FL 1A6ZB 3MOQA 3QNXA 5D2LF 4ZNEE 3JWOH 3DWTA 3PP4H 5B39B 2H8PA 2GAZA 4OB5L 3F7QA 2PUQT 3IETB 3T09A 4DVBA 1H5BC 1S7QB 4R7NB 1ULVA 5CZKA 4X7DC 3MLPA 3B4NA 2VLJB 1MCDA 5FKAA 3HI5L 4ODSL 5C08D 5I8CA 4MXWH 1F4XL 3L9RA 4HK3N 1JZ7A 1BQHA 5ACZA 4NZRH 3BIKB 1UH4A 4NYLA 1CXEA 5C09E 4E5XA 1TETH 1IM3A 4OZIF 4Y1AA 4HC1L 4JY4B 2OJZL 1L4IA 4X5WA 3BOVA 1HZHH 4GG6A 4Z7WA 2WBWB 2VXTL 4UMGA 4FZ8H 5L0QC 4GSDL 3V0WH 2OBGA 3UZVB 4OF6A 4OQ1A 1IEAA 4JFZH 3P9LA 2ITCA 1UEMA 4K71C 2YUXA 4Z7VF 5IFJB 3VXRE 3UTTB 2EO9A 4G6ML 4P2QE 4QXWA 3H6JA 5JMOC 1SY6A 2NY4D 5JXAH 2IQ9L 1VFBB 5HYSG 4G5ZH 2IAND 2BNQE 5TE4H 1JI1A 1FC1A 4I0PD 4OCWL 1CD9B 1WWAX 4TULH 5J06A 4L5FH 4YO0B 4ZOEA 3IF1B 4CJ1A 1K2DA 2UZIH 2VISA 2XPGA 1AY1H 3MRQA 5BO1L 4RFNB 2I27N 5CWSB 3B5GA 5KVEL 3IFNL 1HH6A 5TGBB 2NZIA 1MWAA 3TBWB 2NX5B 5I76B 4FQXA 3TBYA 1PYWB 4XVSL 4JO1H 2FL5A 1F58H 5HYFA 5GJSH 1E6OL 1I9RL 2FX7H 2J5LB 1CVSC 3D18B 2FATL 5GS0D 4M1GH 4DKAA 3TWCL 1AD0B 1FRGH 5E08H 4HKJA 4XVUD 3QO1B 5F7EL 4GKOA 3MRMA 3SJVB 1N7MH 5HYQA 3OF6D 1HYSD 4GBXB 1KT2A 4WUUA 1RY7B 3KPSB 2L7JA 3ARYA 3O4LE 3B9DA 4NKMB 5GRJH 5I2IA 4HHAB 5J6HA 2VLLA 4HUKB 4OD2A 2OQJA 1EBPA 2FEDC 3MXWH 5FF6B 4FQQA 3DVNB 2JJSC 4JRYD 1D9KD 2X4QB 1X7QA 5E1AA 1ADQL 3UAJC 3BP5A 1NC2D 3TPUB 2VH5L 3ES6B 4MQTB 2DKSA 1T20B 4OKVB 3MV11 4AENB 5EO1B 2QQNL 2VDMH 3MRLA 2P8LB 4MB3A 2BNUB 3CFJB 3VI4E 1V7ML 4PP1C 1D5IL 3QWRA 4HWNA 1JZ6A 3L5HA 3W2DL 5I1DB 3QG7L 3MXVH 1U8PB 4H8WH 3RUGE 2ZSWA 2OXGA 2NXYB 4R2GC 2Y23A 4G6JH 2A0LD 5HGDA 12E8L 4YX2H 5JHLH 3ULVE 5F8RC 4EQ3A 2FEEL 5LVEA 3DVGB 5IMLB 2KUTA 2PYFA 3IDJB 2F9BT 5E2UL 1FORH 1YY8A 4PRPA 3ILPA 1NCNA 1C5BL 2ICEA 2VLRE 2WWMD 4GUPB 1LE9A 3FL7A 4AMKL 4QNPF 2AXGA 1B0RB 2VZUA 1C1EL 1C8PA 5TE6H 3N9GL 1RULH 3O81A 1RUKH 4UV4L 5C92A 2YS4A 3VXTB 4HDIB 3T0DA 2OTWB 5F9OH 4QLRA 5HHOD 2EEBA 5E94A 1ZWIA 2A2QT 3W0WA 1OAXH 1RUPL 2NCMA 1RIVL 3P0VH 1A21A 1CLOH 4HWBH 1UXWA 3O4OB 2FSEA 5F6IC 3HUJE 3O3BB 2SEBA 3VFWB 2X09A 3RWHB 4I9WE 4E41D 2CKBB 4LARL 5C3LD 3ULVD 1YC8A 1DQDL 3PWJB 4MNGA 4IDLA 3EOYG 3ZE0E 4MQ7A 3BZ4A 2VLKA 5IESL 5T3XE 3BN3B 4S1RL 4P4KD 2HWZH 4OLWH 1B0WA 4V1DD 3GJFK 3GSNB 5FECB 2MHAB 1E6JH 1IEBB 4WV1A 4X9FA 5C0AE 1IAMA 4C4KT 4H1LA 1BLNA 4MJ6A 1CI5A 3FT2A 1YECH 2PR4H 4Y4KB 4RX4A 3SY0A 3LVEA 3NFSH 3P4MA 4DUVA 3MRCA 3RL1A 4WFHE 5D7JD 1QPPA 2F8VA 5JQHC 1UA6H 1H3PL 3QFJD 4CMMA 3F5WA 3MLRL 3CSPA 3MV8D 1U3ZA 1QBLH 3GKWL 3S96A 2VLRB 1HXMA 3O4LA 1DVFC 5D2LE 3GM0A 1OW0C 5TH2B 3BMWA 1MHPH 1LD9A 1NC2B 2Z31B 4UAOC 1G9ML 3RTQD 1PAMA 4FQJL 3CFKB 5HYSA 4J2XA 2VQ1B 2YD4A 4G9FD 1D9KC 1QD0A 3WLBA 1NMBH 2HFGH 3VGGA 4Y19A 2R56L 4K9EL 4WNQA 1RZFH 1JGDB 1I3GL 4LCWA 4XBGB 3D0VA 5ICZB 4D9RE 3Q6GL 3GB7A 3DRTB 4PRDB 3BKCL 1MHEB 3L6FB 1VA9A 1KG0A 4JN1H 2BNQB 2Q1EA 4RMUA 3ECBA 1QBMH 1G9NL 2WIIA 3O6LL 2VDOH 3TZVA 1JYVA 2IPKA 2DQUL 3UTTE 3GSQB 2VIRA 5D6DA 3RWDB 4FG6D 1MAJA 1MVFA 1MVUA 4HIIA 2NY3D 4YHIA 4NJ9H 4M61B 5CP7B 2Y5TA 4P9HL 2XZCH 2CQVA 1J18A 1JUFB 3TT3L 5E8OB 5I30L 4K94L 5F9AC 5KSBF 5E00B 2VLKD 2GSIA 3ULSB 1FAIH 5CD5C 3O6MH 2O61B 2R1WB 4NKMA 5GGSA 3N1MC 5DMYA 2VLRA 3GHEH 4NKIL 3X12B 1EO5A 3I02A 5DGRA 5CEYA 1VGEL 3H3PH 3BP6B 3MREA 4JM4H 3VGDA 3B2VL 4QHLB 2R0ZL 1R3LB 3HCVA 1MJ7H 3VA2C 5E4IA 1U8NB 2NY4B 4BH7A 2QADB 2P42B 3DX8A 3EO0B 1M05A 2H26B 5F7FA 4PGCA 4KV5F 4ZD3L 4XGZA 4YDIH 3SE8L 1JIBA 4NZTL 4BK5A 1MHCA 1UEYA 3C9NB 5HSFA 4Q9RH 5C0BE 15C8L 2R69L 3BZDA 4KY1L 1FNHA 3HZYA 4UT6H 2CLVB 1AIFB 3SE9L 2DLHA 4M62H 2R29H 3BZFA 5FYLH 1KLFA 1EHNA 1K8DA 4HIXH 5I1GH 1S3KL 3FKUS 4U1NB 3I9GL 3BPLC 3MV8E 2ZOLA 3BUYB 4PJDB 1HDMB 3B9EA 1BIIB 1F5WA 4DGYL 4AG4L 3RNQB 4YBLB 1A9BB 1EBAA 4IEFB 1MUJB 4CDHA 3F6IA 5D7LD 1OAUH 1JWUB 2D31B 4N1EA 5DUBB 4U6XA 4QXTA 4FQIL 1SHMA 1BWMA 1IEAB 1YEIH 4EZMA 4Q97A 4AH2B 4GG6B 5KS9F 3ZKMC 5E5MA 2CDGA 1UWEL 1IGJA 3TV3H 3JV4B 1BX2A 4OCSL 1KTDB 5F88A 2WBJD 2FYYB 5H35A 1BJ1J 4MJID 3HA0A 4UV7L 5ISZB 4KZDH 1HH9B 4RNRA 2OTPA 4ZDHB 3TH4T 3GIZL 4JZNA 4DVRL 2YC1A 4APQB 1ZEAH 4LCWE 3T4YA 3V4UL 2GAZB 2DWEA 5JPMB 3GM8A 3E6HB 3G5XB 3ULUE 3SGJC 2HFFB 2VDKH 4KJPC 3QJFB 3LN4B 4MD5B 3EJYC 1OCWH 3RL2A 3OF6A 3IRPX 4N0UA 2W07A 3NTCL 1IBGH 3ESUF 1G7JB 1KENL 2R9HC 3VXMD 4UZGA 5E03A 1D6EA 1I75A 4UQ3A 5BVPL 4HS8L 5CUSH 1CD1A 5KJRH 1AXIB 5AYUH 4IDJL 4QWWD 1KPUA 1TZIB 1FGNL 1SJEA 3ZTJG 4GRWH 3OWEA 4RCAA 2H32H 5I2IB 3IDUA 1Q38A 2ZUQC 1R3IH 4LRNL 5KSBE 2JELH 3D3VB 3BKYH 3MR9A 3OJDA 4OCXH 2QSQA 4ZXBC 4UU9A 2APVA 3KPQA 5T3ZH 1Z9LA 4Y2DC 1NLDL 3NCBB 4GKNB 4KK6D 4BH8B 4PJAB 3OXSA 1NUNB 3MV7A 5IQ9A 5SWZD 4PLKD 3N85L 2C4FT 3KYOA 1NDMA 4MS8C 1HK6A 1OD9A 1YMHA 3TC9A 4CNIB 2VDQL 4MD0A 2A38A 5D5MB 3OZ9L 1DQJB 1QQDB 4X98A 2NW2A 2YPKB 2FR4A 5AWNH 1MCBA 4G42B 4GRMB 4PS4L 1U3HC 3G6DL 1IFHL 4ODUB 3UX9B 2IMMA 4ZFGH 1HILA 1VFMA 3SKOB 2DD8H 4CMHB 3QDGB 5GS1C 4P57B 2H6PB 1VFAB 1MRDL 1UT9A 4BFBD 3JUZA 2J3SA 1YEHL 3RVXC 5KW9L 4P3CH 4J4PD 3MBED 2NTFB 4JE4B 5F89A 1NBZA 3X3FL 4R4BB 1FCGA 3HMXH 4LNRA 3CDFA 5GS0L 4JKKA 4HC1H 3SGJA 3QPXL 3OKEB 2VDLH 3L3OB 3T2NH 4M6OH 2XRAL 5J11C 1XGRA 3QT2A 5EULV 2K7QA 3TN0A 2XXCB 2ZG3A 4QXGL 4WWKA 2OP4H 4AEHL 3S35H 5C07D 1NSNH 1MFNA 3KLDA 2GK0A 4GS7B 5D7LA 3TA3B 4DW2H 4Z9KB 1LDSA 3ARDD 4KHXH 4WTWA 4R6UA 3WS6C 1PEWA 3Q5YA 4TTDC 2F58L 4OV5A 4RFNC 1NGWA 1JYWA 3RDTA 3KVQA 3RX7A 1GC1H 3D85D 1AKJD 1UB6A 2EIDA 3HAEB 4KGLA 2XA8H 4Y2DA 2AS5M 3IFNH 4K3JH 5DMIL 2BOBB 4J8RA 1OSZB 3OPZL 5CSZB 3CD4A 1VFAA 5GJTH 1LEGA 1KIRB 2XNAA 5KN5A 1S7TB 5IJKA 2X89D 1WUNT 2FATH 4ZAKA 4YXKL 1P7KB 5EZIH 1JGUL 2VR5A 3QNXB 3GUTA 4JKPH 2BFVH 1QRND 4OBRA 3EO9H 1N7ML 5KVDL 2R8SL 2X40A 4I18A 2NY6D 5CJ5A 3KXFA 3GMNA 1KJMB 3MRJB 3MUHL 4X4YB 3DMMD 1OTSD 4R96B 5D7IA 1MCCA 4UNVA 1RFDL 1Q72H 3VXSA 4U1GC 3QRFM 3CLEH 1AGDA 3MR9B 3OJDB 4QTIH 5DS8A 2AV7A 4DKDC 3C8HA 4MXQC 3OTTA 2CUHA 3K2UL 4JPKL 2XKNB 3EYQC 5L8JB 4GMTL 1MCPH 5I6XC 5DJAA 5HHMD 5I6XB 3QXDB 3G6JB 5KSBA 2IWGA 3VJ6A 5D1XA 3LKRA 4X7SH 1IGMH 1NAMB 4M8QA 3H9SA 3K46A 4OLZH 4TUJA 3C8KB 5CZXC 4JFYA 1I4FA 1T03H 1Y6KR 3IFOB 4WWKD 3VMNA 4ETQA 5DD0L 2HRLA 1QYGH 4L4TB 4WU5B 3KJ6H 2FIRT 4QRRA 4AT6B 1J86A 5I1HL 3KJ4C 1P4LB 1X5YA 3GJFH 3D2UD 3QG6A 1T66D 5ALCL 3VI4F 3C08L 2ADGB 3IU3B 3MLYL 3T4AB 4AYFA 4UQ2B 3SGEI 4OSUH 5E8DL 3BYYA 3TH3T 3W11D 1TQBB 4LIQE 2EIZB 3HLAA 2BHZA 1BQSA 1JI2A 1U8HA 4Z7WF 1D6EB 1KEMH 5ICYB 1IILE 1F97A 2A6JB 5E2UH 2VTFA 1T1ZB 4Z7NE 1H15A 4PB9H 3THML 2VXQH 3GNML 3CDGA 1YEFH 4NT6B 3MX0A 2VQTA 4QHUB 1N0XH 5FUOL 5EU4B 3GI8H 3O8XD 3JTSA 3KG5A 3BGMA 4Z76B 2V5RA 3FQUB 2XNAB 4IRZH 1FH5H 3GMPB 1KTKE 5TDPB 1VB9A 3QI9D 5CBAB 4APQA 2C3XA 4U6XB 1TCRB 1N8ZA 4WHDA 4IBLT 3A6CL 1G7QB 4U6YB 1OAXL 3JV6B 1G6VK 1LP9B 3DYOA 1EMTL 5IROA 2YD5A 5JHDD 3IJHA 3MLZL 3T1FA 5I16A 1TJGH 2HTKC 4KTDH 5T3XL 1BIIA 3AXLB 3UBXG 3RBGA 3MNZA 5J4MA 4I13B 4YFLI 3LKPB 4NQVB 1MLBA 4XVJH 2AJUH 5C0IA 4YXLL 4G8FA 1CICB 4JFDA 5KSAA 2X6MA 1UKSA 3L3JA 4V1DE 5IWLC 3HZYB 4P4RA 4PJ8C 3SEPA 5IKCA 1LP9F 2ZJSL 1N59A 3QXAA 4CADB 4F2MA 1JPST 4NWTH 1FNGB 1UH2A 3ZTNH 4LVOB 2ZPKH 4QOKE 2EXWC 4G7VH 4H1LH 2ICWB 5BCAA 1I8IA 1HDMA 5BV7L 1CGYA 1CXKA 1U8HB 3OKEA 3HC3H 4GAJH 4F7CB 1NL0L 3SKJH 4F9PC 2NYYD 2B2XL 3TF7C 3T3MF 1JWSB 3QAZC 2BNRD 3WDJA 1CD8A 4APQC 4EIZC 2FD6L 3PGDA 1JGEB 3PL6D 2AJSH 1HNFA 4DKEH 2ICWJ 2Q7YB 3BPOC 2C1PB 3OKOB 3PWNA 1ZLWH 5C09D 1OARH 3QUZA 4HQQH 2D7OA 4XP1L 3VWKC 3NABL 1T1XB 1S9WA 2VMFA 2YXFA 4YHIB 1MJUL 4X6EB 5FFLA 4KDWA 1FSKB 4JFED 3DURA 4YGAB 1UYWH 4MHHG 5AD0B 4MAUH 4P46A 5T1LB 1S7UB 5DMJB 5LGJA 4ODVL 1DUZA 1OSPL 2JKXA 2PO6B 3CX2A 5CJOH 2B0SH 5EU5B 2WIIB 4HJ0C 2IGFH 3WBDA 3ARZA 2ZZUT 3MJGX 4UOW1 1MCWM 1DEEA 1NCWL 2JIXA 2DJUA 4JCLA 4OGZA 5D7IF 4R96A 4NC0B 5D7IB 1IGYB 4XPFH 4R0LB 2PTTA 1WAAE 1U3HD 2BY3A 4NOBA 3RX8A 4Y19B 2EDRA 3RVWD 1R5VB 3F65A 5CEXA 3G6AB 2IPTH 1TJIL 3V7AE 2Q8AH 4K94H 4F15B 1CF8L 1TJHH 2XICA 5K33A 4EOWH 2OR8A 5IEHA 1E4WL 2A9ML 3LMJL 4ZPTA 4XCCH 3BPNC 4OI8A 4JRXE 4YQXH 4QRPE 2RB8A 2EDWA 3MQIA 1FV1A 3H3KA 4OUOA 5ADPH 3LIZH 1QLFA 4MLIA 1QHOA 2VKXA 1DANU 4QEGA 4V2BA 2HKFL 4HIJB 1MJ7L 4KXZI 3CVHL 4HPYL 3VXUB 4FFVD 1AGFA 3IDNB 1U8LA 4ENED 2Z0BA 5FYJU 3QPQC 5GHWH 4H20L 5HJ3B 3PG2A 1UFUA 2VZSA 4L1HA 4AIZB 4BQCA 1OGAA 3PL6A 4M4PA 4MCZA 3LQAH 1WAAF 2I07B 4O58L 4YHNB 3QDJB 3HNVH 1ZT4B 4RAVA 4N9OB 1I3UA 4KDTA 2YEZB 3SE9H 1BQLH 1ETZB 3NACH 1HINL 5HHNB 3DX7B 1E27A 3L5WA 1W72H 4HBQA 1FGVH 3VXSD 4JGJA 5HHPA 2A6DA 4L4TE 3FB7A 4LHUD 1A9BA 2ZCLH 3GK8L 2FZ3B 2XN9D 3UEZA 2L7UA 1MCSA 4UTAH 4NQCB 2RHEA 4LNVA 5E6ZA 2IFFH 2MTPA 3O3DB 1JNNH 4LVOC 4KRNA 3WFCL 4WO4D 1RUMH 3PV7A 3ARTA 3ZKMD 4OCRH 3SDDD 4CN1A 3BD4A 4HZLA 1U95B 3BZEB 5DEGA 5CILL 1FFPA 4C55A 2BK8A 3E8UH 3OGCB 3T3PE 1T7WA 3PF2A 3ARPA 2C3WA 2V17L 4EXKA 4FFYL 4LBEB 1INQA 4BK4A 4KZDL 5I9QC 4EVNB 5TJWK 4UT7H 1K9TA 3NIGE 2HLAA 3VXOA 4AZ8A 5IW1A 3MRFB 4XCFL 1MREH 1ZHKA 4X80H 1KB9K 4XPHL 1TENA 4JY6A 2XIDA 1IL1A 3RVTC 3JWDH 2A9NH 5E8NB 3MA9H 3RWEA 2VKWA 4RAUB 4LSVL 3SN6N 1JMXA 1MHHA 4HPOH 2RJMA 2NR6D 4GXUN 5F9WB 3CH8A 5INDA 4X5LA 5FHBL 1FN4B 1AFVH 4UQ3B 1Z9SA 2EH8L 3HI6L 1Q9LA 3HMWL 2Q6WA 1ZVHA 1FNEB 1KELL 5HDQH 2NZ9C 1IT9L 1NGQH 1H8SA 2D7PA 2B5IB 3S3JA 4JO3L 2QLVB 4XPBH 2ZG2A 4PRHE 4RISH 4F37F 2J8UF 3MCLH 4FFWD 3DSFL 1PSKL 1NAML 5C6TL 1A02N 1R3IL 5SX5H 5JDSA 3TNMA 1MFEL 2P8LA 5I8EB 3QZWA 5HPMB 3BHBB 3CXHK 3MRBB 4LMQE 5C1MB 3HE7B 1KN4L 4LBEA 4LCWB 4XBGA 3BKJL 1IC4H 1FZJB 4PGJA 1JFQH 5DVKA 5I17A 4FQHA 1IFHH 4PYGA 2NY3C 4G3YH 4MA8H 2RGSA 5F96L 3L5XH 1QFWL 2FWOB 2XQBH 2DMCA 3MFGB 3EDJA 1F8TH 1JCKA 2DQCH 3DBXB 3G9AB 3MUZ1 5MEQB 2HT4D 3PGDB 4X0KA 3BIBX 4HKBA 4YC2C 2FNBA 5CINH 1XR9A 5DHYB 1TETL 4Z0BL 5FV2A 5IB4A 2ZOLB 5J6GB 1S78C 3CVHB 3QUYB 3UO1H 4G9FE 1PX3A 2P5EA 2Y07L 3KYMA 4WCYL 4LSPL 1IKFL 2LAGB 3CK0H 5DRXA 4U7MA 4GG8B 1AIFA 2BXZA 1JPFA 1GGBH 1OW0A 2OP4L 3EJJX 5J89A 1YEKL 1DLFL 1EIBA 5EU7C 1EO8H 4XGZB 1V7NL 2ENSA 2J2ZA 3SGEH 2IAMD 5JA8B 1TTUA 1U8MA 1M05B 1MCKA 4YIQA 2P48B 1DP0A 1V8HA 3TM6A 4EBQH 4Y4HC 2JJTC 1I9JH 3ARFA 2YKLL 1UH3A 1FZJA 4S10A 4PRID 1T0NB 3X17A 3NVQA 4MWFA 3TBVA 4QRSB 4LLWB 4LSRL 3DGCR 4JO1L 3LV3A 3QIWD 5D6DC 1E0OB 3HPJA 3I50L 2FIKB 4X6CE 1A4JA 1BOGB 2FX7L 1U8OB 4PJDF 2BVOB 4RGMB 1JGUH 3RPKA 1UM4L 2IEPA 4PJ8A 3PV6A 1TTFA 2EICA 1SEQH 4JANB 2G2RB 4HCRH 3A67H 1MAKA 3ZT5A 4E5XB 2A73A 3TJHC 1PG7W 3MJ6A 2OR9L 4BKLA 5B8CC 4XNXL 3K81A 2VIRB 3RWDA 3CFEB 5IQ7H 3B3IA 4BFEA 5J56B 1MHHB 2C1OA 1LEIA 3WL9B 2I60L 3SO3C 3MCG1 2H2SD 4XAWL 3RRQA 5J1SC 2BC4A 1ZLSH 4FFZL 5BW7C 5IF0A 1RK1A 2E9WA 2CR6A 2DS4A 1DBKH 4HUMB 5GGRY 4F7MB 3RU8H 2R4SH 4TUJB 2KKQA 3HNTL 1BD2E 2QQNH 2WP3T 4DEPC 3Q2CA 1ZVSB 3QA3B 4CJ0A 2H41A 3KHQA 1U0QA 5I1HH 5IEKA 2CXKA 4MS8D 4PLKC 3D69B 1PY9A 4R2GD 2LV4A 4HMDA 1D6VH 3U79A 4OV6F 2W9EL 5KTEL 5CLTA 4HHAA 5GRWA 3RTQB 3O6FD 12E8H 5ALBH 5JHLL 1MCFA 3FO1B 5GS3A 4EQ2A 3O9WD 1A6PA 1DBAH 1FE8L 5JUEH 1YN7B 5DR5H 2FECI 1I7RA 1KJVB 1JHTA 1K4CB 4JDZB 1MNUL 3V5DA 1FDLH 4F58H 1M71B 2UV3A 1NKRA 1LWRA 3SJVA 3SKNB 5MERB 1YEFL 2EYRA 5C8JB 1ZGLM 3FB7B 1I1YA 4Y16A 4TSBL 1ZHLB 3UZEA 1ORQA 3VXNA 1F02I 3OKLB 5E6IB 1FL6B 5FYJE 1S8DA 1RUKL 4R0LC 1CICA 4JFDB 5KSAB 1RZKH 1RJZB 2AK4A 2JJTA 3ARGD 2EE3A 2QQKH 5CJQL 4PJ7F 1J8HB 3O2WH 1UWXK 2YA2A 3SKMB 2BJML 5DRZA 1Q9KB 3HE7C 5I16B 1KB5B 5I66B 1S9XA 5ID1A 3W0WB 1YUHB 3MJ7B 1N5AB 2W0PA 3RDTB 3FZUC 2L4OA 3BSZH 2IAMA 3O2VL 3IDNA 1S7XA 3FT4B 5EU3A 4L9LA 1KN2H 4NNPH 3MACH 3EIFA 4PRHB 2E6JA 3RKDD 2GK0B 1IGCL 1IMHC 1CS6A 3EFFA 4AM0A 4PJ5D 2VDNH 4JFPB 1F4WH 5I15H 4LSSH 1JL8A 4KKAD 2IG2L 3V5HA 4BFIA 4FTVB 2Z92A 4ORGA 4P23D 2WWKO 4UTBH 3ZE2F 2CMRL 1RU9H 2Y72A 5JOFA 4O9HH 1A47A 4LK4A 4G80B 2J8OA 3IU3A 2ADGA 2X42A 4QRUA 4ZYKA 2BVPB 1C5DB 3HZVB 5I1DA 3EYOA 4KJYB 3HE6B 5KVFL 2XG5A 2AJSL 3UTSA 4X9IA 1YN6B 3P2TA 1ZSDA 4IRJA 5LBSH 2HTLC 3ISWA 5ESVB 5FYKU 3QISA 5CMAB 2NY1C 1BGXH 4FQJH 4JFYB 4ODUA 4N0RA 1WJ3A 3ES6A 2G9HA 3HAEG 4K7PY 1MFDH 1Y0LA 4PJEF 3BKMH 2MPAL 4KVCL 3O4OC 4KC3B 4WFFE 1A1OA 4NQSB 4G8EB 1TLKA 2BP3A 4UIKH 4I77L 4BH8A 3WXWL 2VDML 3IXAB 1ZHBA 4HXAH 2IGFL 4Y1AE 1K5NA 5FUZL 1ED3B 1JPGA 5GSVB 1D5IH 4HGKC 4GG6E 1J05A 1J7VR 2Z31C 3NPSC 1G7HB 3UTSB 2F5AL 1RZJC 2DF3A 4MJ5A 5D70L 2D9CA 3U0WH 4EUPG 3KXFB 3O11B 4HK0B 1RZ7L 5F21B 3OR6B 1EFQA 4KGJA 1U91A 4P2QA 4YX2L 5AEAA 3U7WH 3OJMB 1CF8H 2HT3C 1QBAA 1DBBH 4O5LL 5E5UB 3LMJH 3WNPA 5JPNA 2DQDL 3FONB 2XG4A 3EHBD 2P24B 1X5AA 2NY0D 1CFQB 2DQGH 4H0GA 3SJVD 4H8WC 5K9KB 4ZXBD 4FG6C 4GO6B 2DQIH 1K5NB 5FM8A 4NRXA 2V9RA 3VFVA 2WQ8A 1YNLH 3GO1H 4M6NH 1U42A 1UM5H 5JORA 1AGBB 4UV4H 2R0ZH 3BN9D 4G8EA 5GGTL 4I8DA 1A7RL 4GXVL 5DK0B 5GHWL 4KUCF 5DJZA 2DI9A 4QWWC 2YUZA 1BBDH 5I8OH 5ISZA 3TGXA 5H35B 4P2RD 3DX6B 3LQAL 5CMAA 3QEUA 1E28B 1K3IA 1KTDA 1A22B 5H2BB 3BDXA 1LP9A 5ILTL 3SKMA 4OI7A 3ZO0A 1CE1H 2K3TA 4LARH 2F8OA 1NFIB 4M62L 1MLCB 1P84J 1Q9OA 2HKHL 4P49A 5DQDL 1JPTH 4DJMA 4ELMB 1T89C 5JTWA 4ODXB 2Q8BH 3OKLA 3S97C 4FQ2H 1YPZB 2C4XA 1T5WA 3UTTD 3GK8H 4WI4A 5KZCB 4OLXL 4TNVK 5D7JC 5F89B 2NTFA 4KDTC 1J0ZA 1DVFA 2JLLA 5I8CB 4UILL 1SYSA 3GSXA 4AK1A 4BQ9A 4RGNC 4GKZB 3C5JA 3RWFB 1YEIL 3GRWA 4YNYA 3VXMA 2EXWD 4QF1B 4W6YB 4GAGH 1WBXA 3ARBD 4YWGH 5HGHB 2JJSA 1SMOA 5GIRA 2VC2L 1AXSB 4UDUB 3GRWL 4XP9H 4DOHE 4WY7H 3UZQA 3TNNA 5C09B 3C60A 4IRSD 4U1LA 3G5YB 5SX5K 1GIGH 3STZA 1ZS8B 3K8LA 2G75B 3B83A 3GJEB 4TOYH 3SE4A 1WLHA 3WE6B 1L0XA 2PYEE 3IS0X 4PJGF 2EDNA 2LTQB 2HTKD 3VJ6B 5DGQA 1GZPB 4L4VB 5IT2H 3BKCH 4ISVB 4PJGE 3MLUH 5FCUH 5GGVH 4OZIB 5SWSB 4LHJB 2VDKL 5H37G 4N8CH 1RZJH 3AS0A 1QBML 1OCWL 4DCQA 1A1NB 5DQJB 2AJXH 5HI5C 2D03H 1NLBH 4BJLA 2F74A 2XTJC 3QUML 4LSTL 1MH5B 1KELH 4H0IA 2VITB 4UDTA 3RGVB 5IGXH 5C9JA 3HRPA 3W0WE 4P5TD 2XN9B 3HG1E 2AAVA 4FQCH 4J12A 1A2YA 5JMRA 3RZWA 3F7PC 4XCNA 4NN5C 1OHQA 1B0GB 5KAQG 1KCRH 1LEGB 4ALAL 4ZOAA 2H45A 3MODL 5ITBH 2X10A 5GPRA 3SJVE 3NA9H 4PJIE 5HPOA 4LP4A 5HHOE 1CN4A 4PP1D 1SYVB 2YD7A 1DN0A 2QBWA 4JM2B 4NCDA 2RR3A 3QJHB 5F7NC 3V6OA 1CBVH 4LDEB 2LVEA 2F54A 4Z7UB 5IFAL 1BFTA 3LB6C 1IGIH 4OGXH 5FA3A 4RQQA 1I8KA 1NQBA 3L5XL 2R0LH 2JB5L 4X6BB 3WDIA 4IRSA 3UAJD 4CBPA 2ID5A 1LO3L 1HSAA 1WBYB 3BD3A 4HT1H 5CSGA 1A14H 4Z78B 4BZ1H 5HDOA 1KB5L 2P5WA 3V6BR 4KMQA 5JW5B 3R06B 4ZQKA 2VNCA 3RNQA 1S3KH 5LWYH 3VFGH 1YJDH 1KTRL 1ND0B 4Z7UF 4AEIL 2Y07H 1NGYB 2GT9A 5J6GA 4LCUA 4H1LB 1RZ8B 3QDHA 2FX9H 3UJTL 4MD4B 3MLTB 4XVUC 4RMRA 3O2DL 1DSFL 3REVA 2OX5A 5CD3B 2XN9E 2YD2A 4QRSA 4U7SA 2ZCKL 1N26A 1S5IH 1Z6JT 3DX9A 5DF0A 3BIAX 2EYTA 2M2DA 1RJLA 2DQHL 3WUWB 5HI4D 1PZ5A 4U6HB 1UWEH 2H26A 3FN3A 3NCMA 2XWBA 4L29B 4R97B 1MCLA 2R2HA 5L2KE 3LRGA 4PIRF 3FQRA 1AY1L 1UXWB 4LDOB 1ZGLB 5F97E 3FCTA 3C6LC 4IIQB 5F9JA 4PJAA 3CFDA 5CEYB 2ADFH 3FOMA 1UWGH 3VXTA 4GMSH 2NY4C 4Q9QL 1UM4H 1CLYH 2B1AL 2AXGB 1RZ8A 2X41A 4PJHE 5BRZA 3ULVC 4LLYA 5AZ2L 3SDDA 1EGJL 5KVDH 4U1SB 2R8SH 4OAWB 1UJ3A 4DKFL 1B90A 4N1CA 3T3PF 1NBQA 4L8CB 3X13B 1AO7D 1HHIB 3D3VE 5FYKE 1OGTB 3CLEL 4OFDA 4XTRD 5GRJL 2KQNA 1T2QL 4J4PC 1ZLSL 4YHYC 4LASL 5C0BA 1ZA3B 2MQ3A 3BPCA 3FB5B 3G6JF 4R3SA 1CD0A 1NLDH 1K4DA 2ARWA 1RZKC 3VFUA 3IVKB 1IZKA 2I24N 4HWZB 4KAQH 3O4LD 4OKVA 3KPLB 3LRSB 5DD0H 4DK3A 1X44A 4Z95H 5F88B 3IB4A 5E1AB 1V7MH 4J3VA 3OGCA 2JJUA 1JTTA 1KNOB 4G43A 5FB8B 3ZSSA 1EPFA 4GW4A 3UPRA 3PWUB 3T0EE 2AVGA 1N4XL 3C6SA 4OSUL 1RZIB 1DBAL 3N50A 5DJ0A 5ISZE 3RWIB 1OTUC 3SDCC 1V05A 2CIIA 5D5MF 4PJ9D 5BMFL 5HYQB 5FECA 3D5OF 3WNKA 4RRPA 1NANH 3HZKB 3ZE1F 4M6OL 5FUOH 5E8NA 1OT2A 1NFKA 4PJCF 1K8DB 3L7EB 3AB0C 2VZ3A 2XWJA 3VDAA 35C8L 3IJSA 5E8EA 1N6UA 3T2PA 5EWIH 3P0YL 4ONFL 4XB8A 1XIWA 5IW1B 2EXYC 1BF8A 4HJJH 1NSNL 3F58H 5IBUB 1KJ2A 2VWEE 4YHNA 2R1XA 1EK3A 3H7LA 4Y19E 3CSBA 1QFHA 3FCTB 1QR4A 3KYKL 4KKCC 3H0TB 4PREA 4MXVE 4FNLH 4NGHH 2DLTA 3VXME 3WO4B 2OZ4A 4I2XE 5DEGB 2OXHA 1UC6A 4YDLC 1D7FA 4QYOA 4TUOA 3SDXF 1KBGL 3JWNC 5GGTA 2R23B 1G6RA 3BP6A 2YWYA 3VXMB 5I15L 1NJ9B 4S1RH 3E2HB 3U9PL 1NEZB 2AGJL 1F13A 1OY3B 4P2RE 4N8VB 5F3HA 5GJSL 4JZOA 1SJHB 3STLB 1L0QA 1U93A 4YPGB 1JV5A 2NY7H 1J1OH 1A7NH 2A1WH 5E8OA 4JY4A 4TNWF 3SDXB 4O9HL 1R5VA 3UCRA 3MV7E 1XR8A 1K6QH 4J4PA 4RDQF 4Y5VC 3BIKA 5DJ0B 2PTTB 4HX1B 4K23L 1I1AA 1Q72L 3O6FA 1FZOA 3S98A 5HYJE 3O9WA 3R8QA 1F6AB 3MRHB 4OZGE 2ED8A 3G08A 2DM3A 5EO1A 3IFPA 1I1FA 2JCCE 4LLUA 5JLZA 2ZKHH 4G6AC 5D2NC 5MI0B 4PJXE 2Z93B 2YD9A 1JNLL 4WNQB 5F93C 1F3JB 1PG7L 4HMEA 1XGUA 1WTLA 4NN6B 5FF6A 2R2EB 4M6MH 3LDBC 5HYSB 4JN1L 4FQ1H 4NO5A 1QG3A 2ADJA 4YXHH 3Q3GB 2ATKA 3UBXB 4HUXA 1RUQH 3PHOB 5FO7A 2VR4A 4GRLB 3QUXD 4JQVA 2OL3L 4U7KA 5E70A 4CU8A 3QUZD 4Z8FL 1QSEB 3AROA 4BELD 4CU6A 4ZPTB 3PE9A 4FOMA 4KI1A 1RZ7H 3NIGF 4EN3A 4UNTA 5E8DH 3B6SB 2ED7A 4CW1B 3OR7A 5DEFB 4Q74A 4XPTL 3SY0B 3M17A 4KKAC 5E5RB 1TJHL 5F72S 5KVGH 4UDTB 2ZUWA 3CPLB 1I1AC 4XB7A 3B9AA 1F42A 2HT2D 2FJHA 5DDHA 1C5BH 4PTTA 1LO5A 3CX5J 4XCEB 1J05B 4LLMA 4M3KB 2WUBL 1YNLL 3GO1L 3H3PL 5IKCB 4XNUL 2G5BB 3ZE1E 1SVZA 2HKFH 3FZUD 4YDLB 3VH8A 1NAKH 3MRQB 5DJ6B 4NM4L 43CAB 1IAOB 4NO0A 2AKRA 3RWHA 2VQUA 4EDXA 3HE7D 4YC2B 4UNUA 1GL4B 5J13C 4XP6H 4Z0XA 4Z7VA 3NCFB 2VAJA 2WUCL 1H3UA 1VFBA 4KK8D 2DLEA 3FN0H 4LKCB 5ILTH 4Q6YA 4OM0L 2EYTB 4U1KB 4GAYA 3LQMA 2AERT 3B5HA 1I7TB 4WI5A 1MEXL 5D7IE 1O7SA 2NY3B 5JO5B 3VXSE 4YR6B 4ZFZB 3LB6D 4KUZL 4OCYL 4MNHB 3VGAB 2ZJSH 1FGVL 3DVIA 4QHUA 1HWHB 4PJ9C 4XPGH 3BE1H 4NT6A 2DQEL 5IVXF 1T5XB 2ZCLL 4NDMB 4JG0H 3PWPA 2GSGB 3O9WC 4I2XB 4OZHE 5ACZB 3X14B 5HTSA 2FX8H 5SX4I 4GAJL 4MNQD 1ZE3C 2P5WB 1FJ1A 2UZXB 1KJ2H 5EC1B 2VB5A 5HGDB 5FYJD 1DQLL 4MNHA 1RUML 4HWUA 1JNHB 2QV2A 4UQ2A 1J1XH 4QO1A 3U46B 4YAQB 3GKWH 1P84K 1QFOA 1S7XB 1GZQA 1NMCC 2BNUA 2ZNXA 3CFJA 4M43H 3QXVA 3C8DA 2DTSA 4ZFOB 4WTXA 1T21A 3IDXH 3DX6A 3ARXA 1FNFA 2UYLB 4TRPH 1R3KA 4UT7L 3QULA 2LVCA 1BOYA 2H2SC 1JGLH 3JV6A 4X6FA 5K59E 4Q9BA 4U31A 5D7JB 1BQUA 1D5ZA 2YA0A 5IB2B 2IQAA 1OVZA 2OI9B 2DBLL 3MLWH 3E3QE 5FYKL 3TIEB 1BVKB 3SOBL 1AKJA 3U4EB 4ONGL 3D25A 5FA4A 2EDDA 1Z9MA 5EU6E 2VDOL 4JJ5A 2YN5A 3V52L 4LCYA 2CRZA 4OUUB 2OR7A 3TJHD 5CP3H 4PFEA 1H15B 3VXSB 4HFUH 4IOIA 1CGUA 1RMFL 3O45A 1P1ZA 2D7TH 3DUUB 2C7UB 4PRNB 1ONQA 4OFPA 1W8OA 3MRNA 3QUXB 1CZ8L 2D0FA 3VFMB 4XPBL 3QIWC 3FO1A 3HKFA 3TT3H 4KJWC 5F7DB 3O11A 5JXEA 4YFLF 5SWSA 2XTJE 4JRYE 3O6ML 1MFEH 3C6LD 5D7LE 1XF3B 3QUKA 3QWOB 1HXYB 4ESKA 4NQDD 3LIZL 4JFDE 4KROB 4TUKH 5HHME 2WQRA 5FEBA 4LLVA 1EV2E 1ZHBB 2R0WL 2ADJB 5DT1H 3GJFB 4D2NA 3BQUB 3Q1SL 3CFBB 4BQ6A 3BP7B 1FZMA 3VDBA 3HAEA 5GRXG 2D7QA 3H3BC 1F3JA 2J1KA 2I25N 1OTTD 1CDHA 3MSPA 4TVPE 2YMXH 4P2OD 5C0CE 2I9TB 2YBRA 3JWOL 4QOKA 4HXBL 4NC2B 2DQJH 3OAZH 3GBNH 1NUGA 2OZ4H 1TMCB 2HFTA 2QSVA 1EVTC 3AAZB 2A77L 3FFCD 3HI5H 5IM7B 3NPSB 4KHTL 3SDXE 1G6RH 3HG1B 3ROOB 4NZRL 4G80A 5D6CA 4I2XA 1MFBL 5H8DA 5J9PB 3L3IB 3UO1L 2CKBH 3L3OA 1TQBC 4AG4H 4P5MB 3PWPE 1IKFH 3CK0L 3PV6B 5DD5H 1JV5B 4ELMA 1VFUA 3E6FB 3MYZA 5C7XH 1C5CH 2Z92B 1KACB 2PO6D 2XFXB 5IHZA 1YZZA 3EJZC 1HI6B 3K8KA 3G04A 4F7EB 3T65A 4HUWB 1LQSR 4NKOA 3WJJA 4ETYA 5FYLD 3IAGC 2WANA 4K7FB 4ELKB 3WEXB 1KLUB 2KZWA 3MNVA 5JXAL 3AAZA 1BBJB 4KHXL 4F15C 3MO1B 2APWA 2HT3D 4OCWH 5T1KA 4TULL 3QEQD 1OGAD 4YH6A 5GSRA 5H37H 2W38A 4Z7OF 2C3VB 5J9PA 4ZS6D 5IIEA 1SY6L 5L88L 4WW2B 4GQ9H 4RGOL 4AEEA 1U2HA 2ADFL 1G9EA 5FGRA 1X5JA 5IVXA 1UWGL 4TNVF 3IDGA 4XCFH 4MJIA 3DI3B 2JB6B 5E95B 4JRXA 1H3GA 4QRPA 5ETUA 2BY0A 5EU6A 3MGTB 1AGCB 2CLZB 1JHLL 2NR6C 1WFUA 2J8UA 5EBWB 5J12C 5BVPH 1G7IA 3T0EC 3NBNA 4MZ3A 3RVTD 1R3HB 1QSZA 1NGQL 1HCVA 3FMGH 4NHUA 2VLKE 3DV6B 2R2CA 4LCYB 2NPLX 4XRCB 3QUKB 4F7PA 2BVEA 5SV3A 1CXHA 3OAZK 1KFAH 2WW8A 1MCPL 2DJSA 3UPRB 3TBSB 1OB1B 4YDKL 2IANB 5DWUL 4CN6A 2NW2B 1ZXQA 1UADC 4HF5L 3QA3A 4LVHB 4DUWA 1INDL 1HHHA 2DDQH 3P9WB 3P4LA 3B2UC 1CTOA 1UJ3C 3BAEL 1I1FB 3ETBF 1QYGL 3KPQB 4UU9B 2ARJA 3VFSB 3MYJB 5AWNL 4M1CD 3QQ4A 2CLRB 1D6VL 5C0CD 1TFHA 3MRDB 3LKOB 2DD8L 1T89A 2FEEI 1QEWA 1C08A 3FO2A 4WUKH 5EO9A 1F8TL 3BEVB 1LEIB 2HH0L 1MRDH 2IQAB 5IB2A 1SEBB 3FQWB 1F4XH 1PG7X 4OLYL 3ZTJH 5DRNB 2Z8RA 1U93B 4YPGA 3VD7A 1S7RA 1VHPA 4LCIH 1H3XA 3Q6FB 3V5HB 4MQSB 3M1BB 1T5XA 4NDMA 3LN4A 5EOCH 1F90L 4JANA 4X6DA 3F7VB 5EBMA 1R5IB 1F2QA 5DHVH 4GSDH 1Z5LB 4RBPH 3HPJB 1DQMH 4TN9A 1J87A 3C87A 5CEZL 2YA1A 3SPVB 3BO8A 4HJJL 1U3HB 3EYUL 2JF1A 3TVMC 2R2BA 4OZHA 4XX1G 4I3SL 1MCJA 2HFEB 4XZUB 1JYXA 4I3GA 4AIXA 3DJ9A 3SE3A 4Z7VB 1U8IA 4IMLB 1W72B 1DE4A 3I6GA 4KKLD 5KSUB 3S37H 3PABA 3SCMB 5BO1H 4NO0B 4N9GA 3RPIA 3G9VA 3QHFL 4NNYB 1P7QA 1R5WA 4LAQL 2HVKA 3DMMB 1QUNA 2XQYK 1FL6A 3OPZH 3GI9H 4CVUA 3TBTB 1U8JA 2D31A 1JWUA 3CJJA 1RHFA 4NBZB 1FIGH 3HPLA 4TVPH 5GRUL 4X7EC 2Z9TA 2NY7L 1UACH 1I9RH 5EZIL 1T1YB 1FL3B 2ZCHL 5CJ8A 1WSST 4HCRL 4K3DL 4WGWB 1BVLB 2DAVA 4PJIF 4Y5VB 4ZUSB 4URTB 2VDPL 5DHYA 1OM3L 5C0CB 4PGDA 3IDYB 1ETZA 1VENA 2R15A 4QRTA 1QPXA 3C2SA 1AGEB 4QHMA 1MJ8L 3DLQR 1MHCB 4WI6A 1IARB 3PQYA 1P5VA 5FM4A 2P8PA 1SBSL 3OKNB 4XAWH 5ANMB 4FMFA 5DFVC 2AEPL 1XF4B 5IMKA 3BKML 4ACPA 4GRWB 1PG7H 5CJBA 5LGHH 3TA3D 2NY1D 4PTUA 1U8LB 4L3CB 2BRRH 3CZJA 3VXUA 5BV7C 4ODTH 3BPCB 3FB5A 3BH9A 3U48A 3F12B 3RGVD 4Z8FH 3RUGF 3G08B 5A3IC 2GY7B 1EJOL 1RK0A 4Q9CA 5BZDB 5DURD 5IFHH 4Y4HD 4NJ9L 4KV5E 1ZLVH 5ESAA 3DIFA 1XR8B 4HG4J 25C8L 4U05A 5B38B 4X4ME 4O5LH 4W70A 4L4VD 1LO4L 2DQDH 4Z7OE 4PB9L 1Z3GH 3LKNA 1FFOA 4K3GA 3HS0B 5HYJB 3GMQA 2JJVA 1CDCA 5I9QB 2A74A 1ADQA 3GI8L 4N0UE 1SBBA 2QQQA 5FK9B 1Y6NR 5IOPB 2KBGA 4OZIA 4MZ2A 4P2CG 4N9GB 3RPIB 3ARFB 2EH7L 4XHJD 5K59F 5I75C 2QSCL 4XP6L 3O3BA 2X89A 4IMLA 2GI7A 4RIRA 4XC3H 2W0KA 1CLOL 1ZANH 4NZTH 5C2UB 5C0RH 2HN7B 5D2NA 2R1XB 1INEH 3O8XC 1V3MA 5C0NC 1I7UA 4KY1H 2FHCA 1CFTB 3S96B 3QEGL 2MFNA 3U0TB 4WFGD 3BGFB 4JEGB 3JV0A 3U4BH 1T6WA 5DJDA 1IQWL 4JO2L 5I1GL 1ES0B 2QHRL 4NHCH 2OMNA 4QF1A 3I6GB 4GUPA 2OYPA 1BZ9B 4L1DA 3C60C 4Y16D 4HUUB 5IVXE 2Z91A 4X0KB 1WVZA 3CXHJ 1JVKA 3D87B 1DQLH 1GAFH 2D2OA 4OFVA 2C9AA 3O0RH 2N7BA 5A2JH 2ZSWB 3RVUC 1I3RB 3GRWH 5FOBA 1CU4H 4R7DB 4KRLB 1T2XA 5CILH 5IOPA 4L3ED 4P5TC 1G9NC 4ZUTB 1P7QD 2NZ9D 4DN4H 3U1SL 2J8UE 3V7AG 4TOYL 2HJLB 3ORJA 1OQOA 2GFBA 2X4TB 3IDXL 5KSVA 5A2FA 3LD8B 3SDYH 5HHXH 2Q86A 5EZOL 2GUOA 2M1KA 3NZ8B 4XP1H 3RJDA 2GCYB 2J7LA 5D71H 3E3QC 4ZOCA 5D7KD 5SWQB 3RWIA 4R3SB 5E6IC 1XF2A 5FYKH 2X4QA 4XNMB 2AXFA 4FQPA 4N8CL 2H1PL 4WHCA 2Y06H 3T77A 1IAIL 4M03A 1ACZA 3PDDA 4LSVH 3MJ8B 4HPOL 3V0AC 5FHAL 3GMRA 2X4OB 3LKSB 4HEME 1YY8B 3TO4A 2CK0L 5ACMA 1YJDC 1MJJB 5GGUA 3WFHA 2EDOA 4HS8H 5CUSL 5JIHA 3U7WL 1C12A 1EJ6A 3PHSA 5L7XL 4JO3H 5DD6B 4U1SA 1SM3H 5CS7A 3VI3F 5AAMA 2EO1A 5I30H 5E4EB 4ZSOA 3S34H 2PW2B 1PLGH 4U3XA 4JY6B 3WNNA 1KIUA 1NC4B 4OCXL 4WU5A 4TPRH 3QQ3B 5IROC 1VGEH 4AENA 5A3ID 3MBEB 4OZIE 1F4AA 1T3FA 5F6IB 2Q3ZA 2VDQH 1A7RH 4G8IA 4GXVH 4LCCA 2M26A 4HUUA 3TEUA 5I1KL 3UJIL 3LKRB 4JREC 2Y6SD 4OAWA 4CU7A 1QHPA 2GKIA 3BJLA 5AUMB 2Z4QA 5INCB 2G9HB 1OWRM 2OJEA 4NO3A 3RWGB 2ITDB 1YY9C 5FAAA 2JB6A 5HGHA 3WNMA 2YD6A 4HH8A 1QR1A 4MNQB 2G60L 4P59H 43C9B 4F33A 5HVFB 5I18L 2VYRE 4UT6L 1MWAL 5J0BA 4GKSB 4LDLB 3EYOB 4FS0A 3WV0A 4F9LA 3P77B 1GSMA 3VFGL 3FJTA 2ZOKB 4WFEE 1ZGLP 2Q8BL 1G7MA 4PYHA 2GTWB 3CZFA 3QPXH 4HUVA 2A6DB 4Y1AB 1N3NA 5DD5L 2PKDA 1E4JA 1YYML 5JXEC 4RBPK 1EAJA 3DX7A 3O2DH 5DJYA 3KJ4B 4DGVH 4UTAL 3JZ7A 2J5LC 3C5ZD 3QCVH 2YHGA 1FNLA 4AEHH 1DBML 4ELKA 4HLZH 1OAYL 3ALPA 4ERSL 3SPVA 2N56A 5JZ7C 4G8FB 2X4SA 2XY2A 5DI8A 5I74C 3SGKA 2F58H 1IC7H 1VEOA 3OAYH 1XIWC 1MFAL 5GRZA 2MQ0A 1I9JL 2I9TA 3WN5C 3OX8B 3DUSB 1EEYA 3RBSA 3T1FB 2VLRD 2VUYA 1H0DB 4UV7H 1AGBA 4HAGA 4LF3B 3QDMD 1NMCB 3C5ZB 2AEWA 4PJAF 2PTUA 4GMSL 1FHGA 4X80L 4TYUA 2QADC 4XPHH 3MJ9L 1D5BA 3TVMD 4PJ5E 4XXCC 2B4CC 5EBGA 3KR3L 3NCCB 4QOKB 5D1ZD 4WTZG 1IM3B 2AJXL 1MSPA 3EKCA 3K1KC 3MCKB 2VL4A 1KENH 1BZ7A 3OR6A 1DZBA 3VFMA 5MENA 4R4NC 3NIDE 3WFZA 5D5ME 1KC5L 4LMQI 5E2WH 1A9EB 5HYEA 2XXMB 1P9MC 1EXUB 2BVQB 3HLAB 1DUYA