4JUSA

Crystal structure of a fragment of human hspb6
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
90
structure length
84
Chain Sequence
SVALPVAQVFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein beta-6
publication title Molecular structure and dynamics of the dimeric human small heat shock protein HSPB6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 9
structure length 84
sequence length 90
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jusA01
1WH0A 2CG9X 3L1GA 1GMEA 4JUTA 3Q9QA 3J07A 2KMWA 4YDZA 3QORB 4JUSA 3Q9PA 4ELDA 3GLAA 3GUFA 3EUDA 3W1ZA 3VQMA 2XCMC 4ZJ9A 2WJ5A 4M5TA 1WGVA 3L1FA 2KLRA 3QORD 2RH0A 3GT6A 5DS2A 1EJFA 4YL9A 2CR0A 2WJ7A 4I88A 3L1EA 5DS1A 2O30A 4YE0A 4M5SA 2K8QA 3QORC 5LUMA 4YLBA 2JKIS 4PCKA 3VQLA 1WFIA 4MJHA 1SHSA 2N0KA 1RL1A 2Y22A 4PBDA 1X5MA 2MNWA 3IGFA 3AACA 2Y1ZA 3QORA 2BOLA 4FEIA 3N3EA 4RZKA 3AABA 2N3JA 4YLCA 2Y1YA
chains in the Genus database with same CATH superfamily
3KYOB 1D5XA 2GEQA 4OIAA 5HDBE 1AD9A 2JIXB 5FKPA 2A83A 3GBML 4ELDA 2A74A 1BA9A 1IM3A 1NL0H 2DWDA 2OTUA 2WWNA 3B1TA 4H0LC 4HS3B 4K7PX 5C7ZA 1EHAA 1VADB 3L6FB 3UTZA 4PRAA 3DC0A 1NCDH 4F7EA 3H8NA 4FQJL 1VSCA 3S5YA 4D9LH 3ZRCC 2V0AA 2ARJB 3FUDA 1CD9B 1FVDA 2EE3A 3F2LA 5FOJA 3ILEA 1G6RB 2VL5B 4IK6A 5ACMA 4H40A 1RJYB 3DDFA 1NGPH 4FG2A 2YXWA 4CVWA 3LVEA 2VXUH 2CG9X 5LJYH 4I7ZC 1OAZL 3GMPB 5L2KD 1Z2KA 3QH3A 1Y6KR 4LL4A 3ZRSA 1IGCH 5SX5H 2HVBA 1AD9B 5FKPB 1HKLL 1WA0X 1BZ7A 1MDAA 2A74B 1IM3B 1G0XA 1TYRA 2D03L 3NP4A 3R19A 5T1DL 1NBZB 1RZJH 2F5AL 1I9JH 2UYLA 3ET9F 5IQMA 4F8LA 4E9SA 3UTZB 4PRAB 2LVEA 4RDBA 4F7EB 5IB3A 3P3YA 3IAQA 3H9YA 1MHHB 2KDGA 5IFJB 4PLOB 5AOJA 1FVDB 1QBLL 2BP8B 1CJYA 4M5YL 5I1HL 2OCFD 5JOFA 4JEGB 4JG0L 1CB4A 1WP6A 3KLHD 5F1OB 2G60L 2VN3A 2E6QA 2VLMD 1YC7A 2VZSA 1VIWA 1XEUA 3Q9PA 4PS7A 5BXFA 1P4IL 3KL3A 4N2OA 1L6PA 5IWLC 4PJ5E 4P9HC 1KZYA 2YJQA 2DKUA 4JRYA 2WW8A 1UXWB 2MCMA 4DP9X 5FYLH 5I74B 2V5TA 1BZ7B 1GC1L 2FAUA 3S36X 1A6PA 4TTDC 4S1DD 3WFBL 3APNA 1A8ZA 4J23A 1FGNL 5EDXA 1P6WA 4ADJA 4AGPA 2VC2L 5IB3B 2OMTA 3D0LA 3KBFA 4H8WC 3ZZ1A 1JNNH 2Z93A 3RY6C 2G75A 2DL9A 2WXFA 4FQLL 4CJ1A 2DRUA 4U4IA 5C86A 1TCMA 5JOFB 4FFZH 2IDQA 3QYNA 1V55B 5C09A 1XMWA 1AJ7L 3BUIA 2NYYD 4HF5L 4NKMA 2VJ8A 1CG9A 4KNUA 4YDMA 4P2RD 2CGRH 1WWBX 4NWUH 3UO8B 4TM9A 1LVEA 4XOEA 5DS1A 1FGVH 4JRYB 3K80A 2BHUA 2AQNA 1Z5HA 1I8AA 3OZ9L 2D3JA 3EJTA 2VN6A 2YN3A 2EDDA 2XQYA 4KPHL 4TLTA 3I50L 3OKMB 1LMIA 2DDQL 1Q9LB 2OMTB 2YPLD 1PFOA 2Z93B 1ORQB 1MCBA 1VFOA 3VM7A 3BQUA 4HBCL 3I9GH 4YHZH 4ZOCA 2YO3A 2G9HB 3BDYH 4IKLA 4RGNE 5C09B 4WV1A 5AZEH 3U7YH 2RTTA 4U3CA 2H3NA 4HU2A 4FQ2H 4FA6A 1HCYA 4I3RH 4NKMB 3TN0D 3WS6C 1CICA 3TBVA 2FD6H 3M1BA 5KYYA 1WQVT 1A9BA 2X4NA 4DH2A 4CSZA 4UMGA 1DSFH 5F1SA 5K69A 4JQXC 3SE4C 2NR6D 5CJ5A 4JANA 5IJVA 3T6VA 4PJ7E 5HD8D 4L1SA 4G8GD 4KQ0A 4PJAF 1YPZE 1NIAA 5TJWK 2Y7OA 5A16A 3MXVH 1W72H 4HHAA 1MELA 1N0XH 3BQUB 1JBJA 4YXLL 2IH3A 1Z6JT 2E46A 1SYSA 4Q89A 1T1WA 1ZE3H 5JIDA 3L3IB 5ICXA 2GBAA 3HJ0A 4AENA 3GC3A 2YXMA 1QLEB 3EAKA 4NIYE 4WV1B 5EEVA 3S48A 1KTCA 2H3NB 4GQZA 4LXFA 3OLGA 1JNHA 5EBMB 5AB0A 1CICB 3TBVB 1HE8A 3M1BB 5KYYB 4NWTH 2WZ0A 1A9BB 3NCYS 2VQ1A 4GKLA 2PYEA 1DVQA 4FZ8H 5I28A 3AC0A 4U1MA 5IFHH 4JANB 4BFKA 5IJVB 5DK2A 3QRLA 2WSKA 4MQTB 5A16B 2B15A 4HHAB 3NMEA 4WO4A 2ARJQ 3F6LA 3TNNB 2FSEA 4D0DA 5F7HA 2ZOTA 2MHAA 3UJJH 3BI9X 1UEMA 1SYSB 5D2LE 1T1WB 3BE1L 3QHZH 2RBLA 2P1YA 4M43L 1UM6H 5DWUH 5ICXB 4AENB 4B9JA 2CDEA 2YA2A 4OF8A 3GMNA 2X6BA 3WDIA 1JNHB 4GOSA 2QGBA 5IM7A 1GSKA 1J9QA 3MV7E 4IOFC 2TRYA 2BZCA 3UTSD 2V2TA 2PYEB 5DHXB 5GGQH 2NY6B 2WO3B 1N18A 2FJHA 2R27A 5DK2B 4MAYA 2VDPB 5FHBL 3GMMA 2CU9A 2AQQA 2NNAA 4WO4B 2EILB 2FSEB 1GZQA 4N28A 3CLEH 2EDQA 2MHAB 2IPUG 4NDMA 3HNSL 5CP3A 3LIUA 3M8OL 2CHXA 1JZJA 3E2HC 3OHMB 2Q3AA 2CDEB 3GMNB 4BQ9A 1MRDL 2F2HA 3IBEA 1H5BC 3SDAC 1F5WA 3ZE1B 3T2LA 3FZUD 1KC5H 1TJXA 2WWKO 3CH8A 3N1QC 4PJEE 2V2TB 1OB0A 1MWAH 3FSWA 5GS0L 2ZTBA 1MFAH 4WY7L 3S6CA 5FIEA 3QEQA 1IT9L 1GH7A 4WFGD 2EDYA 4GEIA 4XMPL 5FYKH 5CJXA 1NGQH 2FJHB 4BZ1L 4O2CB 4MAYB 3P40A 3T71A 1BJMA 2KC0A 3GMMB 1EFQA 1GOGA 1QFWI 2FH8A 2NNAB 3BUTA 2FJGA 1KCUH 3HFFA 4NDMB 3KEDA 3BUQA 3WMQA 5FF6B 1BQLH 3SDXA 5I75C 1QNZH 4YDJA 1NCAL 3Q2NA 4E41E 5AAPA 2BXYA 3GSUA 1OAXL 4KI5C 2ENSA 3VSUA 1PX3A 1MHPH 4XXDA 2Z1PA 4YS4A 3MC0A 3MBXH 3N5AA 1INQA 4UT9H 5E6YA 4PS4L 2ZWYA 3EXLA 2VR4A 3QEQB 5D7LE 5HI5C 4NQSA 3B2PA 2VMDA 2DD8H 1B3JA 3WSQL 1SLWA 5DHDA 2E9WA 3ULUC 5E9DE 3RI5F 2H0JA 2ENPA 3SDXB 1WZ1H 4HIXH 4MZIA 5IHZA 4GRLC 4YDJB 1VESA 1C8QA 1PDKA 4WF7A 3BVNA 2WQWA 2IFFH 1IBZA 1SY6L 3GSUB 4JKLA 2XWTA 3EO1A 4JZJA 1AE6L 5KANG 1LE9A 5CF3A 1W8OA 1DP0A 2BS9A 3EJRA 4EE2A 4BK5C 1JPGA 4K94H 1INQB 3L4CA 4HLJA 1B4JH 3FCTA 3GRWA 1ES0A 1IFHL 2H0PA 3CVCA 1LD9B 4WW2A 1RPQA 1WK0A 4WEMB 4G59C 4NQSB 4QRUA 3RGHA 3HE6A 1UYWH 4KAQL 1M9SA 3LEXA 4HCRH 1LWJA 4HQQL 3VXSE 5JZ7C 1EHLH 3BMVA 4XP6L 5I1AA 35C8H 3NQIA 5CU9A 2O5ZL 3AM8A 1MCPH 2ROYA 5IHZB 2WNWA 2R2CA 3ZTEA 3BVNB 3S8WA 5T3XH 1PZCA 1A6VL 2EYRA 3JTSA 4WI8A 5F7LB 2CXKA 3EO1B 4JZJB 2A9DA 1LE9B 1AXSB 5FR3A 3VQ2C 1T4KA 1UD3A 1DN0B 4IBYA 3AUWB 1U93B 1LL1A 4JFDD 5EBLB 1M3JA 1NGYA 4M02A 4MNQE 4RAUA 2V5MA 1ES0B 4YXKL 1LMKA 2WUBH 3ESOA 4L3CA 4WW2B 3WNKA 4QRUB 1M1XA 3HE6B 3QI9A 4IKKA 4JGUA 3LEXB 4OW6A 5LLIC 4DGYH 3CSFA 2BJMH 1CURA 5I1AB 3EYOA 4XI5C 1FNAA 4AJ0A 4F2FA 3RWIA 3FSOA 3WHE0 3RY5A 3ARBA 1XEDA 2AQ3A 1UC6A 1E90A 2E9IA 3MJGX 3OAZH 2EYRB 3D0VB 3JTSB 4KHXL 3S3BB 1BIHA 3SYAA 2XV6B 1R1CA 3QIUC 5I1EH 3U2JA 2WQ8A 3GLEA 4BIKA 5K5YA 1T4KB 4B27A 1FC2D 1NGYB 4KK6D 1BAFL 4RAUB 1U8JA 4L3CB 4R9HA 2VDQH 1BPLB 4OJDH 2EUZA 5C2BH 5I1IH 1T7XA 3QI9B 5EZLB 2E56A 3P0VH 4JY6B 2VXVH 5BUPA 3FH7A 5TE4L 1PVHA 2CM5A 2HZHA 3SY6A 1NANH 3EYOB 4Y7OC 3W0WA 4M1GL 2VDNB 2GPZA 2CLZA 4PBDA 1ZPUA 2XPGA 2QPSA 3RWIB 3EOTH 3QQXA 4XC1L 3ARBB 1NM9A 2ARWA 1QBAA 3FULA 2Y1YA 4N2AA 3WAKA 5EV7A 1KBGH 2HWZL 1WFOA 4JFHE 1YNTF 2XV3A 1TJHL 4XCFH 1S7XA 1SJVA 3NA4A 3I6GA 4URKA 5C3TA 5I6XC 1NMBH 1U8JB 4Z7VE 4KDWA 3P69A 3IKCA 1HAWA 3BFOA 3RWHA 4B96A 1T0NA 3QJRB 5H2BA 1KV3A 3WO4B 2ROXA 1PZBA 1FNHA 3WLBA 4UIMA 2DS4A 1F4WH 3W0WB 2CLZB 3NG5A 2XPGB 4OJFH 2B3IA 1IC4H 1DQMH 3VRLE 4KFMA 4KX8A 4FE9A 1NCTA 1OP3H 5G4MA 4PY7A 5TF1H 2DQDL 2BP5M 4JRFA 4MXQD 2NMSA 1S7XB 3I6GB 1THCA 2HT3D 5HGHA 2K6WA 3E8UL 4MJ5A 3IKCB 3RWHB 2FO4B 1ZS8A 2XBTA 1UB5B 5E7BA 1KB5H 3BJ91 5A2IH 3JZYA 3PYCA 3WLBB 4ONHA 4UIMB 1A6UL 4JO8A 4IBQA 1NLDL 1G94A 3I3BA 3ROOA 4S1QH 1SOXA 1QRKA 5FWRA 1E3XA 4PFEA 2NQDA 4CC1A 2G4GA 3V4PH 3FQUA 3AT9A 3P2DA 3QSKB 4PY7B 1A7QH 4K07A 1D9KA 1QLRA 3SDYH 5J56B 1CK0L 3Q2VA 1D2OA 1GKOA 4EAEA 4GY4A 4PGJA 3ZIMA 3QHFL 3CC5A 4GXVL 4LNVA 5T1LD 2Y69B 4WUUD 1H19A 4MJ5B 1E4KC 5MENA 1ZS8B 5HYSA 4L8DA 1XGUA 4R26H 3ZHKA 3F12B 3GRGA 1HHKB 2CUHA 3LSOA 4FYQA 3BPOC 4ONHB 3WY4A 3C75A 4HT1L 1JRHI 3VGDA 3ROOB 4OZIF 3NJJA 3PDDA 1MWOA 4ZPTA 3GXDA 1QZ1A 2ZPKL 1R3IH 4ZO6A 2GVYA 2NOYA 3HHMA 3FQUB 1I9IL 3QRGL 3SPGA 1D9KB 4GKOA 4FXLA 4J3OC 4LDOB 4RGOL 3F04A 4GRWB 4CMHB 5L0QC 1URZA 3E80A 4U1NA 4MKMA 1I1AC 5EOCJ 3CC5B 5D1XD 3HR5A 3KPRA 3U4BL 1EAJA 4NQDA 3PGDA 5CINL 3RU8H 4DN4H 4GQRA 4LHQB 3JVGC 3LS4L 5I9QB 4P4KA 4L8DB 1XGUB 2E9BA 2K45A 4JHBA 4UM9D 1QSEE 3LSOB 1CPUA 2ICES 4W93A 3J8F7 4YSPA 4P23B 4JO5A 1KCBA 4E9WA 2CR0A 1AC0A 3FTZA 1L5GA 4HC1H 4OQTA 1BXAA 2W07A 4P5RA 1KLUA 1LLAA 4ZPTB 4L4TD 4DP8X 3OKYA 1MEXH 3QS3A 2QELA 3M1CA 5C09E 1JD9A 1MFBL 2XN9A 3RGVC 2H7WA 5KSBA 1JYXA 5LGYA 1VZGA 2OZ4H 1RIHL 3ISWA 3OC8A 4U1NB 3LKPA 4YDIL 5ITBH 4JPWL 1X9QA 3VW3H 2NCEA 2R0KH 3APDA 4UTAA 3KPRB 1NBCA 4JZOA 1YN7A 1TENA 4J3SA 4XN9A 3TYFA 3VDAA 1UWEL 2DEXX 4V1DA 2JKXA 2A38A 4Y19E 1GPOH 3IJ8A 1D7BA 5JW5B 4AVIA 3HPLB 4N90D 1VFMA 1XR9B 1L5GB 1UKTA 1CTMA 2W07B 2Q8BH 2PCPA 1KLUB 5I0XA 2ISDA 2OL3H 1TTRA 1A64A 2X4SA 4RFOH 4H88H 4URTB 2X1WL 4KKCD 2J4WH 1N8OE 2XN9B 3CZSA 1J8HD 5ELIA 5KSBB 4PJCF 1H8LA 4UMSA 3MRQA 5FM4A 1XWVA 4LSSH 2HRPL 4KY2A 3JQOB 4UI2A 4X5WA 5GRVK 1AO7A 5D1QE 3EOYG 5LNGA 4JZOB 4W9GC 2VDMB 1YN7B 5EC1A 3TYFB 2YPVL 1DLFH 1L9TA 3AT8A 5SWSB 3TA3A 5JW4M 5KG9A 4V1DB 4U3SA 4PH8A 1RJCA 4ZOBA 1KXVC 3BP4A 4PJ9D 5EOCH 1IC5H 4OR1A 1XIWA 3QQ3A 3F7VB 5EEZA 2UUDK 4LSVL 1A1NA 1N70A 2A6JA 2CSPA 2UWEF 4G7YL 4BBWA 2PCPB 2AABL 3U1SH 4PV8B 2X4SB 1B6UA 1BYPA 1N5YL 4G11A 4NJ9L 3T6QC 1S9YA 4MSWA 2O4EA 4LQFH 1IKNC 1JXKA 3MRQB 3RURA 4G3YH 3SPIA 2A2QT 1DZBA 2EKJA 2GFBA 4OCXL 4ZZKA 2P8PB 2VN5A 4X5WB 1OM9A 1RZ8A 4ODXB 2EDFA 1S9XA 3H55A 3JV4A 1URLA 3MV9E 3PGCA 4XZUA 4J39A 2WC7A 3TA3B 2YOAA 2NW3A 5KG9B 3UO1H 3SYQA 1X7QA 3NGBB 4QTIH 3MOQA 3QFJD 2AK4B 1DL7L 2QVKA 5DTFA 3TEWA 4N2LA 3NK3A 3SBWC 2P49B 2J56A 1JUFA 3FT3A 3OJ2C 1QFWM 3OXSA 4NGHH 4UB0L 4DFHA 1XIWB 4DOHE 3H4FA 3LAFA 3VG9C 1CCZA 4PREA 1A1NB 2A6JB 4TRPH 5I6PA 5I1KL 2QSTA 1C8PA 2IXQB 3OBAA 1XZ0B 3MV11 1NPUA 5GZNC 1CDHA 3MV8D 1CF8H 2B1HL 4EMZA 5EULV 1S9YB 2ENYA 4XNZC 5KVGE 1UM5H 3LH9A 2GFBB 2UY7A 2X4TA 4PRIA 2MFNA 1RZ8B 1NBVH 4E36A 1S9XB 4NB7A 4R90L 3N06B 4HXBH 3JV4B 4XPTH 3PGCB 1RIUL 4XZUB 3TIEA 1NEUA 4J3OG 4H2AA 1WCBA 2NW3B 3VO0A 2GSMB 1X7QB 3QO1A 4I9WD 5AALA 4PJBF 2ADFL 1TJIH 3TP4A 1JUFB 1U8IA 3FT3B 3OXSB 4K9EH 5ABAA 3HC3H 3R18A 2P8LA 3RVXD 4PREB 4AMKL 1HCVA 2JQMA 3BAYA 3FU9A 3WIIL 4G72B 3GBLA 4KY1H 3ZKXB 1MCHA 1X5HA 5EZIH 4A38A 4C4UA 1AR1C 3IDXH 3ZKND 2XWRA 5EIIG 2ICCA 2J1KA 2QPUA 4MD5A 1SJXA 4GAGH 4R0LC 3RUGE 3VA6A 2UY7B 2X4TB 4PRIB 1J5CA 3VYOA 5AOMA 2BW4A 1IGIL 4UV4L 5ANHA 1MJJA 5DJZB 1NJ9A 1JI1A 5E2VL 3TIEB 2N01B 5F1KC 3EJZC 1CGXA 1WCBB 5F89A 1NOLA 4U33A 4HYTB 3QO1B 1T03L 3C5ZA 4IDJH 3AWGA 5CZXD 4Y4HD 1II4E 3MZTA 2BOBA 4JDZA 1IEBB 1U8IB 4WQOA 3RL2A 2EINB 2P8LB 4UOQA 5HYJE 1ND0A 2W9DH 3L48A 1RHFA 2MTAA 3W5NA 4D3CL 4K8RC 1BQ5A 4WK0B 5GZOA 3VD7A 2PNDA 5JDJA 2WLNA 2F74A 3NJHA 2ZKHL 3MRGA 2J73A 2DM7A 5LNEA 4MD5B 3IGUA 4L2YA 2JE8A 1G6RH 3KPSD 3X1EA 2BHFA 5IHWA 1LP9B 1JDCA 1UASA 1L6XA 5B4MC 4KVNL 3ULVL 2FE0A 1WG3A 1NJ9B 3GK8L 4HAKA 5TFSH 4YX2H 5F89B 4KJWC 5C2UB 3NTCL 1U4FA 1LO2H 3C5ZB 4AIEA 3SE9H 2BOBB 1HTYA 2CBPA 2NY7L 1EBPA 2XTLA 4JDZB 3RL2B 4D9RD 4DPAX 1DVZA 2IDTA 3MJ9A 2ESVD 4M7KH 5GJTL 1ND0B 1AZVA 2MH4A 4X80L 2HRGA 3C5XA 3KM2A 5B39B 1ZMYA 3QO0A 4HKZB 3UAJA 2JI3A 2EVFA 4KK5D 4Y16C 4FEIA 2F74B 1EPFA 5ITFA 5EEXA 3BZFA 4XP9H 3EG9A 4F20A 2DV6A 3MRGB 3P54A 5MEQB 4GIOA 2XXFA 1S9VA 5T8IA 2V2XB 4OIIL 3G5XA 4I48A 5TD4A 3B37A 2FX9H 1WSST 4M3KB 3QHTC 1L9RA 5D6CA 1CGVA 3F62A 1PSKL 3HI6H 1IGFL 2QHRL 4JO2H 3EBHA 1D5BA 4PJGF 4A2DA 4FA7B 2ZX8A 4HULB 3SOBL 6CGTA 4UWQB 1F8TH 2M1KA 4HIIA 1N64H 3KLDA 3QO0B 3IMBA 3UERA 4AUYA 5ITFB 1QX1A 3EBAA 4O02A 3EG9B 4JDTH 2F1AA 2LQRA 3MOAL 3C08L 1IGTA 4N0CD 3ZGIA 3PFQA 3NIDE 5J12B 3BWSA 4ABQA 1S9VB 2ZKXA 5AW9B 3G5XB 4I48B 4MRCA 3NSDA 5FKAA 1T6VN 2XWXA 5KBPA 3RPIA 5D6CB 4EOWL 4WJKB 5KWYC 2ALAA 1CTNA 2IQ9L 1JZHA 2EYTA 3ES6A 3DX7A 1ADQA 3A4AA 1D5BB 1IM9B 5DC9B 3U4AA 1ICTA 3CZJA 5DJ0A 4HIIB 4L0PB 3SBPA 1V5JA 1AQMA 3I75B 4OCYH 3HVDA 2WLHA 1CGUA 1GS7A 4XPHL 1FAIL 5T5NF 1E27A 2H8PB 2VR3A 4M7JH 3BMWA 4IM8A 1PZSA 2E27H 1IGTB 3MMEA 4S0TD 2J1XA 4MXVF 4XXWC 2G0KA 5C0JA 4HWUA 5FKAB 1CXFA 4N8VG 5DJ2A 3W2DL 5I1JH 4LO9A 3RPIB 4ODTL 4JKPL 5JHDE 1E5BA 3ES6B 2EYTB 1KYOK 3QDJB 3IS1X 5I1DA 3RJDA 1IKFH 4WK4B 2EDNA 2DLIA 2FL5A 1XGRA 3QPXH 4HFWA 3RE0A 3KLHC 3L4UA 5E2WH 1RJZB 3VFGL 1T04B 3IJ7A 1YEWA 1ZKAA 5LWYH 4PJAA 1GRWA 2IGFH 3WTWA 1CFQA 2O30A 2NDFA 3S35X 4GW5A 1E27B 2FO1A 1CTOA 4GSUA 5L4JA 1CF1A 3FCGA 1BM3H 1YVLA 3JWNH 3MMEB 1F58L 1NWOA 1QLEH 4P2YA 2HFEB 2V5YA 3ZK0A 4S1DC 5E6UB 5DJ2B 5C7XH 2PO6A 3NZ8B 2A1WH 1DVUA 2ZP0T 3DDGA 4JKKA 1LTXA 1ZT1B 4HVBA 1RLBA 2NXYD 4HUUA 4OD3L 3SCMA 3ML9A 1UACL 1ACCA 5GRJH 3C60A 2W94A 4Q14A 3IU4L 3MCYA 3OPUA 3K2UH 2FL5B 4HFWB 1XGRB 2VDRB 2NSXA 4BK8A 2NYYC 2YD9A 4ZFZB 1NAML 4PRNA 4HOMA 4MAUL 1FO0L 3TLRA 2IPTH 3UG5A 4PJAB 5IZ7A 5IBLD 2ZZUT 1CFQB 4PIRF 2FBJH 3CFCL 3QAZB 3FTUA 1NCUA 2APTA 3IRPX 3KJ6H 1BZEA 3O8XD 2COQA 3KYNA 3U2IA 4OFKA 2N59A 4XPGH 4F9PA 4YHYB 5ABZA 1UA7A 4PS3A 1OKEA 4LOUD 2PO6B 3FN3A 4ZJ9A 1OWWA 3SCMB 4HUUB 2E7LC 1B88A 4R96A 5GGTL 3ESMA 2Z3FA 4KJQD 3C60B 3WY1A 3I9PA 1BVLA 8FABB 1U30A 3RWGA 5LN4A 4ZW5A 4HJ0D 3LXBA 4ADIA 2VDPH 4PRNB 3RNQA 3JTTA 1AXTH 4JHVA 1TYEB 1CD0A 3MJ7A 4RFEA 1ACYH 1OPOA 2Y6SD 2WXNA 3BAEL 1JRHL 3OWEA 2VISB 2CRMA 1IVTA 1ET8A 5TQ2H 2VAJA 4LSUH 3T4YA 2NR6C 2P5EB 2PCXA 3KJ4B 3OMNB 3W3BA 1LO0H 2XCMC 5K59E 1UOWA 3BQVA 4L8BA 4MS8D 4B6ZA 5HD8C 5MENE 4NFDA 1J1OH 3FRPG 1JXJA 1MCSA 3QQNA 4HX1A 4EBQH 4ELME 2I25N 4JFFD 1H6FA 3RNKA 3VI4E 4U1JA 1OOWA 4NLHA 1BVLB 2IANA 4FJYA 4F33A 5DFTA 3OG4B 2NZ1A 3TEUA 1NGZB 1KPUA 5TPWH 1GW6A 2O61A 3RNQB 4OVUA 5B38G 1BQRA 1FRGL 2M83A 3IJEA 2YD4A 1I3GL 3MJ7B 3Q3GA 4RFEB 5K33A 1I1FA 3HG1B 1SGKA 1YUHA 1X5ZA 4XN7A 5CP3H 2VQUA 2FQEA 3T4YB 3UX9B 4JY4A 1QW9A 1LYQA 4L8BB 4NQDE 4AG4L 4H25A 3IYLW 2XY2A 3VA2C 1WITA 4IU3B 4QRRE 4QHNA 4HX1B 3MKGA 2JK5A 3QJZA 1ZLDA 1SDYA 4LDCA 4WZ9A 3RNKB 1PAZA 2ICWA 4U1JB 3GDBA 2IANB 3N40F 1AIFA 3CCHA 4F33B 5J1AA 1YMMD 2X4OA 3VWJD 1KN4H 1ZA6A 3HS0A 2EEDA 2O61B 1KTKE 2D8KA 1DQKA 3WL9A 5AW5B 3KVQA 4FQHB 3QRBA 4OZHB 3IJEB 3JT0A 4C4BA 4ETQA 1I1FB 4RFNB 4JFPA 2EXWD 3LRHA 3QQDA 2LV4A 4ONGL 4ZS7L 1KCSH 3NABH 2ZT9C 1U6AL 1QPKA 4JY4B 5PCYA 4X98A 4RBPH 2RGSA 4QCIA 3OZLA 4P5TD 2AQPA 4H25B 5C08A 4ENZA 3H9SD 2YPKA 3QIBD 4V1DE 5HGBB 3F7LA 1Q4NX 2Y1ZA 4QHNB 3L13A 4PW9A 1CLCA 3T09A 4YWGL 3TBSB 1KXQE 5F3FA 3P4NB 3GS4A 1KGYE 3CHQA 2APVA 3L4WA 1AIFB 3HEIB 5L6YL 5E5LA 2X4OB 3EF4A 1ZA6B 3VXRA 4GYBA 1IIIA 2J7LA 3NIFB 1REIA 1UQSB 3WL9B 2WNGA 1RUQL 1OF2A 4YHOL 5FUCC 4DAGH 4ETQB 1CLZH 3FZUC 4JFPB 4YN3A 3A22A 4KC3B 5MEOA 2VDKH 3QQDB 3TYGL 3Q8CA 3S5LG 5KANI 1S7SA 1ZK5A 1AO7E 3LEVH 2IAMD 4MJIA 4QCIB 2WXPA 4OFYD 2XETA 2CH8A 2VXSL 4HCIA 4IMKC 4X4YA 1OXYA 2AF2A 2VZTA 5GISH 1ERNA 2MCPL 3UP6A 4KJYA 2FB4L 2C3GA 2O6EA 5DD0H 4Q9QL 1T2QL 3MYJA 2Z91A 5DRZA 3VXRB 3MLRH 4AW4A 3U48A 5KVMC 4PRPD 1A1OA 2D3VA 4UTCA 2C26A 3NPZB 5T5FL 4Q52A 4WWPA 4HPOL 4NKOA 3DECA 5MEOB 3NRFA 1WA2X 3GZKA 4JZNA 1UGKA 1S7SB 4UZSA 3QORA 4X50A 4XC3H 4MB4A 3RZCD 2AGJH 3GHEH 5EU7C 1CXIA 4ZNEE 1FDLH 1JGLL 2X6VA 2VMFA 4FXGC 4YFDB 4ZUWA 2J1ZA 4MJ4A 2J5WA 1LK3H 1MHEA 1MJ7L 4KJYB 1S5IL 3U36A 4TOYH 1ZANH 4EXKA 4ZFOL 4O9HH 5JUEL 2Z91B 5DRZB 4XWGH 3UGUA 3UFIA 1QQDB 1A1OB 3M86A 2IPUK 3FHEA 4ZQKA 1A25A 4ATTA 5I6KA 3LDBC 1MRCL 4NKOB 4FFYA 4WTZA 2CHWA 2VDNH 2DIAA 4GJTB 5DZLA 1KTJA 1SHWA 4JZNB 1QATA 3LTVA 5ETUA 4RVBA 1AIZA 3QORB 4JVUA 2WUCH 2I5YH 1H3TA 2A99A 1BVZA 4ZTOH 4DO4A 5HGGS 4GS7B 1BCIA 1BD2A 1OGAD 4MB5A 4OCSH 1OK8A 1MHEB 3F64A 2BDNL 1YNTA 4XN2A 1G7PA 1CU4L 1RZ7L 3MODL 4LCVA 2NY0B 3GI9H 3N85L 5CILH 1T3FA 3OGOE 3U36B 1T7YA 2WXGA 2I7OA 2ZG2A 2MNWA 5BS0A 1WS7A 4K0OA 3SDDD 3OJDA 3GLDA 4ZQKB 3D2UA 3CSYB 2PR9A 4QYOA 5BVPL 2E7CA 1AG6A 4QD2E 2C3WA 3CDFA 1CYWA 2ZYSA 2KUTA 1SLVA 4I2XA 1A4CA 4LE8A 5DR5L 3ARFA 4F91B 3LD8B 1SVCP 1BD2B 3QB7C 5ECGA 5J6SA 3IEAA 1HILA 4PJFE 2VR5A 1OCZB 1WAAE 3PWNA 2AJXL 2FYVA 2CO4A 3B9KA 5F7DA 1XCXA 4YBHA 2WLMA 5JHLH 3NH7H 4N9OB 4V33A 3IAGC 5BS0B 5DA0B 5L8LB 2LU3A 3QULB 2ZSVA 4LGPB 3GUTB 4JRXA 2VR6A 3OJDB 2OMZA 3D2UB 3CSPA 3BUBA 1I3RA 4QYOB 4IBWA 2K7QA 3QJFA 4AYSA 2OYMA 1YEEH 3GNML 4JKWA 5FA4A 4KK6C 4JO4L 2X3CA 3HKZA 4QRPD 2HLEB 1MQKL 4J3XA 4JMNA 3KL5A 4ZT1A 2CJUH 5E8EA 3OPZL 4IJTA 3MAWA 2FWSA 2AJVH 3ARFB 5DDHA 3BHBA 1HEZA 1HILB 4MCMA 2YKLL 4YDVB 2DN7A 3MR9A 1FFRA 4GQ9L 4X7DC 4Y2OA 3PWNB 5F7DB 3B9KB 3VH8G 5HYQA 3X1BA 3OC5A 1QHPA 3K74B 1TZAA 5SWZD 2IJ0C 4MLIA 5DJXA 5AVSB 3IMRA 1PZ2A 4NXSA 4PJ5D 2ZSVB 1FYTA 1Z5LA 4JRXB 2VZOA 3OWRA 5EBWA 1UKQA 2OMZB 5GIRA 5AYUH 1NMCB 1RZPA 1ESOA 1I3RB 3QJFB 5FA4B 4OZIA 2Y07L 1RSFA 2J55A 2IOMA 2X0UA 2LABA 5KYXA 4M48L 3TVMA 3HIZA 5E8EB 4AL8H 1OD7A 5J13B 1BBJA 3R7RA 5I8KH 1KCLA 2X42A 3BHBB 1HEZB 4GRWH 3EH5B 4ABVA 4LCIL 4WUKH 1JPEA 3MR9B 4XCCL 1FE8L 1UENA 3ZYZA 4A2FA 4Y2OB 2QZQA 2FWOA 3NRPA 1DQLH 3BW9B 5HYQB 1HNGA 4ZAKD 3HAEG 4MA3B 4L1BA 4PRHA 1QR1B 1HXYA 3RAJL 2W0LA 4U3HA 3WNIA 1Z5LB 5GIRB 5I30H 4MXQC 4Q58C 5EBWB 1RUPH 3ZTJH 4OB5H 5F96L 4OFVA 4TQHA 4FI8A 3BP6A 3AG4B 2HT3C 3L16A 3SYCA 1U36A 5I18L 4DW2L 3WKPA 1TJGL 3R1GH 5KYXB 3BZ5A 2YMXL 4JFSA 4DPRA 5DFVD 1BBJB 3A0OA 2B4CC 4TLKA 4AZ8B 3VYNA 3W11D 5IEKB 5HGDA 1BYOA 2WVTA 2XT1B 4MGXA 5E6IA 3FT1A 1RUAL 3MGOA 2FWOB 2NT1A 4RGND 4QXUH 2GK0A 1D2PA 3UOAB 4JREB 4P3CL 2OJZH 1MJ8L 4KZEH 2H1PL 3D52A 3MUGA 4PRHB 1E3FA 4TLSA 3CU7A 1KBPA 1HXYB 3JV0A 2YFNA 3ARED 2LTQC 1GOFA 4HMCA 4KKZA 4P2QE 5HP5A 4WNSA 1HH6A 1S3KH 1XBRA 1ZPLA 2W60A 4RMQA 3U79A 5KZCD 5JHBA 5AAWC 5F97E 1DQVA 2Z6FA 4OQTH 4U6VH 1T5XA 1XX9C 4TNVK 1U2YA 4YSTA 1QRNA 3FFOA 4GUPA 3BRGC 3WIHA 2AANA 3DTUB 1EJOL 5ANMA 4QXVA 2PMZA 4PJCA 2F18A 1HESA 3AY4A 3D1MC 4FG6D 5HGDB 4Q9CA 1A5FL 1MHCA 2Y36H 5E6IB 5PAZA 2Q76A 2Q1EA 2QQLL 4NENA 2QKSA 2GK0B 2VDMH 3F7KA 5E94A 2QQKH 1JGEA 4OLUH 2ID5A 3G08B 5L8KB 5GGSA 3L17A 4DTGH 5GXBB 3B9EA 4YHML 1UD4A 2YA0A 2HPTA 3EGDA 2W60B 2OK0H 1F13A 3QUZD 5D1XC 1T5XB 3M45A 3V7AG 4PY8J 4KJPD 2UWEA 4XNYH 1DBBH 2W88A 1QRNB 4N2CA 1G1YA 4GUPB 4WFEE 1Y7VA 4I13B 4L9LC 4LPCA 5LAPA 3BH8A 5ANMB 3WJLC 25C8H 4PGBA 1ZVYA 3HPJA 3T65A 5BV7H 1ZV5A 3WENA 4PJCB 5HHXH 2GHWB 4X99A 1HWWA 4G43A 4NRYA 4CA4A 5BRZE 3WFDH 1E9QA 1MHCB 3GI8L 2VKWA 1X4XA 2ZUXA 5DC4B 2Q76B 2VDLH 3I6SA 3SE3A 4NENB 3EOAA 2PPCA 1FQ9C 5E94B 1JGEB 2GCYA 5GGSB 4HJ1A 4MRBA 4RRPG 6PAZA 5I23A 1ZJBA 1DE4A 3MV7D 4MB3A 4DPBX 3SGDH 5IHHA 4EIBA 3VFWA 1AHWA 4U7MA 3C8KA 4HEMA 4X4XA 4KTEL 4J3BA 2YLHA 2FEEI 2UWEB 3FQ2A 4KHTH 3BP5A 5GHWL 1IAMA 1DJGA 5BCAA 3UH8A 3LYRA 6TAAA 2J3SA 3T65B 3TWCL 3HPJB 1TZOA 2OCJA 3QZWA 3Q8FA 2JTDA 3JWDC 4NJAL 4X99B 5F9OH 2C9PA 2HMID 2XWJA 4H44C 4NRYB 3OAYH 5D7JA 1E9QB 3TV3L 4PJHB 3ML8A 5CCKH 2NX5D 4NUPA 3FQNA 1F1AA 3OF6D 5DUBA 3MCG1 4KKCC 5DRNA 3L7EA 3LIZL 1B2WL 4AEHL 1DE4B 1ML0A 4XCNA 3A4DA 5D72H 4PJBA 4JHUA 1AHWB 5DS8A 4OCLC 1FNEB 4X4XB 1NC2A 1OHZA 1VPOL 2AITA 4G1EA 4HEPA 2PWFA 3D07A 1N59A 2FGWL 2HLFD 3HE7D 3PQYB 1PD0A 3V5DA 3MRFB 3FUNA 1A6AA 5HHME 3GBMH 4H8WL 3ZE2F 3CDCA 4UU9A 3QZWB 1UWXK 2B3RA 3D50A 3NESA 2Z8VC 4PJ9C 3ZMRA 2XWJB 1VEMA 4NQQA 5D7JB 2P80D 3JT2A 4QNPF 3H9HA 4HK3J 1IL1A 1QKZL 4FQJH 5JHMA 5DUBB 4BKLA 5DRNB 1CL7H 2CIKA 2YBGA 1R24A 3FU3A 2Q7AA 2NPLX 4XCNB 3FK3A 4UTBL 2OTWA 2XTJE 4PJBB 1RK0A 1UWGH 4Q4EA 5HJ3A 5DS8B 1YEGL 3SGKA 3K4AA 2VUOA 5SWQA 1ZGLP 3HMWH 5D7LD 1OAZH 4G1EB 1U2CA 2ZCHL 1JNLL 2M2DA 4KKAD 1N59B 4UNIA 3CXHJ 2XXCB 3V5DB 4C59B 1FG2A 3MSPA 5F21B 1M53A 2D03H 4UU9B 3NSYA 2UX7A 4N2MA 2VXQA 3GYRA 3QUKA 4XX1G 2F5AH 5E9DD 5MP6H 1AQKL 1JZ2A 2WK2A 4PCSA 5CGBA 1ID5I 4X7SL 3H9HB 1IL1B 4NN5C 3IMUA 4BKLB 1KGXA 4FXTA 5M95B 2PW1A 1BYNA 1FSKC 3LRLA 1R24B 4M5YH 2C4FT 3KVDD 3MRNA 4NM8L 1MIML 2NY5L 4JG0H 4KXAA 3VE0A 3NJXA 1ZT4A 2OTWB 2G60H 2WSDA 3I6KA 2DB8A 3FU5A 1RK0B 5HJ3B 2JJTA 1P4IH 4B7IA 5SWQB 3A6OA 1QSFA 2JMRA 1EVTC 2IWKA 3S2AA 3VXSD 5C0BE 3DO3A 3S3DB 1FF5A 5C08E 5MEPA 1FG2B 4XH2A 3UMTA 1IAIM 3Q8BA 1GC1H 2AAAA 2DYRB 4OAWA 4WI6A 4XBEL 3QUKB 4UT7L 5D1ZI 3DMMD 3SO5A 3V6ZB 3WFBH 1LEKA 2R59A 4WTWA 3RVXC 1FGNH 3QEUA 4ALAC 4XP5L 3ZZQA 3VFUA 1O7DE 3MFFA 4XN5A 1U33A 3AUVA 4LKXA 4DVBB 3EF7A 3S36H 3ZKNC 2DQFA 1QMUA 2PW1B 3TWYA 4H0HB 4FFVD 5F8QC 4YVUA 3MRNB 1ZHKA 1H3PL 2MWCA 5DF0A 2F53B 1ZT4B 3VE0B 4ANKA 4ZFGL 1CR9L 1AJ7H 3HRZA 4HF5H 4PJGA 3QUGA 1BDYA 4HPYH 2P46B 1QSFB 1PNDA 1KIUA 4MJIE 1S3RA 4Z18A 2F8VA 1GW0A 3UIYA 1UZ6F 4I85A 5CZXC 4U0QB 5MEPB 3EJCA 3KYKL 4XH2B 4Y4HC 3OZ9H 3HHSA 3PABA 5D7IE 4XBPB 5JW4Q 4KRPD 5HHOA 1QACA 3K8MA 4DT2A 2N7SA 1JIBA 2Q0ZX 1DDHA 1PMYA 4MJJA 3DVIA 4JMXA 3I50H 2DDQH 3VFUB 3GXNA 3LZFL 4ZK8A 3MFFB 4IHOA 4LKXB 4HBCH 2F8XC 3DGGA 2DQFB 3AABA 1MCIA 4QLRA 1QUNA 3DK0A 4A63A 1ZHKB 2AEOA 2H4EA 1U8CB 1KJMA 4DVRH 2E47A 1W0VA 4PJGB 4UUJA 4F37F 3TGXA 3DHPA 3BAWA 5G5DA 4KI5F 3P9MA 1GMIA 3GM0A 3ZSTA 5F3BA 4X2UA 1YMHA 1W2KT 1GAFL 1R33A 2L8AA 1XF4A 4LESA 3OKNA 4WFHE 3PABB 4IBUA 5T1KD 2BSRA 5HHOB 3VMNA 4F7TA 1DDHB 2FLRT 4OBRA 1NAMA 4W9HC 3AT0A 4IHOB 2NY2D 3ECWA 3FFCE 4QF1B 4YXLH 4F2EA 5AW1B 1A7NL 4KK5C 5DQJA 2O72A 3VXNA 3ULUF 2GK2A 4JFHD 2XG4A 5KSVA 3B9VA 4MBRA 1DHKA 3BIAX 2ZOOA 1MF2L 1W0VB 4X7TB 4N85A 5G5DB 1YEJL 2JLLA 3P9MB 5F3BB 2Q86A 1SJMA 1YMHB 1A2YA 1EZUA 3IDIA 5AD0B 3OKNB 1BD2E 3TZVA 2WXKA 3ATDA 1OGSA 3DIDA 4NZ8A 2QGCA 3HUJF 1QPXA 3ZSSA 2OKMA 2Q9OA 1NAMB 3BWUC 2F54B 2VLJA 1FNSH 3CBJB 2IFGA 5E99L 1PLGL 2OJEA 2YXFA 5BS0E 4M43H 5KSUB 1UVQA 2XG4B 1NKOA 4HSAC 4A2HA 5A1AA 3UGEA 2V37A 4LLWA 4N0CC 5KSVB 1N6QL 2ENJA 5I0VA 4Z3FA 3BEVA 4X9FA 5T3ZL 4NEHB 4KTDL 4Z7OE 1R9FA 3REVA 5JOPE 1KPVB 4I2XE 3WE6A 2TSBA 1A2YB 4JPQA 4HWBA 2DBLL 1K5NA 1K2DA 2P5WA 2H32A 1FCCA 1LO5A 3M7FB 2AQRA 1YEFH 3TZVB 2ERJB 3ULUL 2NCMA 2ZICA 5FFLA 3QJOA 5A2JH 2DWTA 5FHBH 2CUMA 2VLJB 5ID1A 5ILTH 2ZG1A 2BK8A 2O6PA 3Q2CA 3ZX1A 4Z76A 1AHMA 3PJSA 2OJEB 2X6MA 5C0RL 3HNSH 2K9FB 1UVQB 3M8OH 4AYMC 3M07A 3BEVB 4YZFE 4BRVA 2YEVB 4S2SA 4A7UA 1ZHNA 3BZDA 2FECI 1UD5A 3FO0H 3REVB 3RFZC 3WE6B 1K5NB 1K2DB 5B8CC 2P5WB 1C5DA 3OKEA 1LO5B 4WY7H 3DBSA 4HJIA 4JFEA 5HHVL 2I69A 4XMPH 2JLPA 4BZ1H 3OM3B 4K71C 4F7KA 1T20A 3WE1A 1X5YA 2B7DT 2B1AH 3L9RA 4Z76B 4HUXA 4OT1L 4X7EC 1GZHA 1CDIA 4FGMA 4K5LA 1Z32X 1FNGA 1FYTE 1WYJA 2CWRA 3CH1A 4FHJA 4WEUD 2WXQA 1J1XL 3NJKA 4AVHA 1MCOH 2BNRA 1OAXH 4S2SB 1NFAA 4OZIE 1ZHNB 4I87A 4L3EB 3FDWA 2XHNA 4YNYB 1CLYH 2BY3A 3DV6A 4PS4H 3L3OC 3LQZA 2NXYC 3OKEB 4CRPA 5HBBA 3CC1A 3KPTA 4JFEB 2PP9A 3BIKA 3S88L 3O45A 5D8JL 5I1LA 3TFKD 1T20B 3IRCA 5G2NA 2IBGA 5F9AC 5C09D 3B8YA 3WSQH 2OR7A 4GKZA 4XO9A 4HUXB 4JFZH 5IBLC 1T89A 1FAKT 4NQXA 5CAYB 2FJFB 3V0IA 2NQ3A 4F8PA 4N0RA 3MRPA 1U41A 4M7LL 1FNGB 5DYOB 3CH1B 1FZKA 4HOXA 2DLGA 2LLLA 2J6WA 3WTXA 3O8XC 3EH4B 2BNRB 1SY6H 2R1YA 1JD7A 3SQRA 4DP4X 4HALA 3L4VA 4NRXA 4LOUC 3VD0A 1VA9A 5C3IA 4TNWF 1XL6A 1L6ZA 3DV6B 3GSQA 3LQZB 4H20H 1ZTXE 1IFHH 4KJQC 2CHDA 3VB8A 4X6DF 3VD3A 3BIKB 3O45B 4KAQH 1KBKA 1YYLH 5F7EL 5I1LB 4HQQH 4LF3A 4UT6L 4HJ0C 3L1OH 4LSQH 4D0CA 3L2LA 4OLWL 4WENB 4GKZB 1IZKA 3VVVA 5LXGL 1YN6A 4NQXB 2O5ZH 3QUML 1V8HA 4R2GB 1WISA 1NGXA 2Y6SC 2ZWZA 3O11A 3QDMA 1FZOB 1FZKB 2OSXA 3CFKB 3A4EA 3MACL 1JE6A 3BZEB 5D1QD 4YQXL 2RH0A 4P05A 1PD6A 1P9MA 2WM0A 5HYFA 5ACZA 2L7QA 4MS8C 3S96A 4F15B 4QRSB 4NRXB 5K93A 1PG7L 1WFUA 2E0PA 3GGWA 1JHLL 3GSQB 1TETL 4FHKA 4BCYA 2VXTL 3KPLA 2W0PA 2XVBA 1Y1UA 3V5HA 4F24A 4LF3B 3UTTA 4AQOA 2Y25A 4D0CB 2J6EA 1CD1A 3SO3C 3ZTNL 3EJQA 1YN6B 4OZGF 2KPNA 5E56A 1O6TA 3QJHB 1EGJL 4UINH 1NGXB 4OQ1A 3RBGA 3O11B 3DNKA 3QDMB 4NO5A 3WN5A 1KOAA 4E5XG 3VQ1C 2ADGA 1TU2A 2DAVA 4FXKC 3KL0A 4KHXH 1L7TL 2CCVA 3V0WH 1ZIAA 3ARSA 3MV9D 3PNWA 4H8VA 5ESQA 3RIAK 4J3OF 4XO3A 2R0ZH 3S4SA 3V0VA 1KJ2L 2XWCA 1PL3A 4WO4D 3GGWB 1BAFH 3U4KA 3O2DL 3KPLB 5FV1L 2VMEA 1TOXA 4UZUA 4KNSA 3WEXB 5BMFH 2FEEL 3UTTB 4AGLA 3B2XA 1SFDA 5TE4H 3VWJC 4HD9A 1S7QA 3ZZLA 2QBWA 2A73A 1CD1B 3V4VA 2QSVA 15C8H 3S5ZA 4BRJA 4R7DA 2EXSA 3S2CA 4J8QA 1SUJA 3B7YA 1IBBA 2A6IA 1YNLL 2EXWC 3WN5B 5KBMA 4F57H 3D25A 2ADGB 4JQVA 2YD3A 4P99A 1E8YA 5JW4R 1DBJL 4X0KA 1QO3A 3PNWB 5ESQB 2HWZH 1KEMH 2YRZA 4HXAL 4ZBJA 5HGAA 3KBEA 4P5TC 1TJHH 2XJLA 4MAYD 1UM4L 3S3SA 4LBAA 3V0VB 4R4BB 3QIBC 5JYLA 1NKGA 3K2MC 2ZXAA 3KGSA 5A6LA 2IDFA 1DVFA 1SEQL 1H3XA 4ZOAA 1S7QB 1GGUA 4M4RA 2A73B 3K6IA 2OI9C 3HN8A 3T0EA 2VLLA 2WBXA 4R7DB 3TCTA 3O4OC 2BNQB 2CLVB 4MNGE 3WFCH 3T2PA 3WGVB 1ZRUA 1MLCA 3MA7A 3D25B 4CKQA 3ETBJ 3F7YB 1QBBA 1ZTXL 4U05A 1AZZC 2VM4A 1CGTA 1E67A 1QO3B 1WLHA 2IAMC 3DRTA 3FXIC 1EX0A 2XX1A 3QEQD 5HGAB 1IE5A 5D7SL 4N87A 5SX4I 2WNXA 6PCYA 1JPSH 4PB9H 3DETD 3KLSA 1OSPH 4AT6A 4YO0A 3T0WA 1V7ML 3IGAA 3P11H 4N0FA 3FKUS 1AD0B 4MAZA 1BQUA 3H3KA 1DVSA 2DMCA 3RWFA 4YDLB 3NCXA 1DVFB 1EAQA 4FQPA 4M4RB 3ELQA 5DRXA 4AOFA 3T0EB 2VLLB 1BOGA 3EYSL 3PE9A 1CBVL 2I32A 1AFVH 5F0LB 3JWOL 1DCLA 3ARDA 2GEEA 1MLCB 1J86A 5FGSA 3MA7B 2I9TA 4IRJA 5GSVA 3K2KA 1AQDB 5F44A 4GQQA 4QY8A 1PF3A 3DRTB 1E7VA 3RTQB 4XAWL 1E65A 4PP1C 3RZCC 5I16A 4G7RB 1CK0H 3NP3A 2XA8L 3WU1A 3KWWA 3QHFH 5FYKU 4GXVH 4AT6B 1U3YA 1JI2A 3P2TA 4G8IA 4NQEA 4CKVX 1AYOA 4YE0A 5GRUL 4Z3TA 3V4UL 3IGAB 5FC9A 4Y5YC 2VE6B 4N0FB 1NIDA 4PJ8A 3A67H 4LSPH 2WXRA 2X89A 3RHWF 1SQ2N 3QT2A 1D6VH 4HT1H 3ARWA 4C4KT 1AGBA 1BOGB 4G70B 2APWA 3N42F 2ZPKH 4I9XA 5EOQL 4IRJB 1I9IH 2H0EA 3V8OA 4G5AA 4QY8B 3QRGH 2O5NA 3QUXA 5I16B 5EU6E 4MS6A 4RGOH 4WKZA 1QSFE 1A3ZA 2MQ0A 3HE6D 1OLLA 1JZFA 2VOTA 3KWWB 3G9VA 3BESR 4KRNA 3AB0B 3HG4A 4NQEB 4G8IB 3U4BH 5CINH 2KZBA 3NN8A 4W9CC 3CFEA 4OBSA 4MCYA 5ICUA 2LLGA 1YYCA 3F6IA 3LS4H 2VERA 2APSA 1KTDA 2MRYA 4JAMA 4J2XA 1BQHG 1SYVA 2Z8WC 2XKNA 1Z9SA 1WBYB 3PCYA 3SDDC 1AGBB 3FSAA 1UD2A 2C1PA 2OYLA 1XSKA 3PP3K 2TAAA 4DHLA 2FATL 1MFBH 3MBWA 2HLAB 2X09A 5AW8B 4PJGE 1RCYA 3MLZL 5LBVA 3QUXB 2UVFA 4WKZB 3QI9D 4YDIH 4JPWH 2PXYA 2XYBA 4N2KA 3L3DB 2WZPA 4O4YL 4NO3A 3MRCA 3K91A 3NN8B 3CFEB 1HSAA 2LE9A 4K94C 4MCYB 1LDPL 2JXMA 1KTDB 4JAMB 5FB8A 5D93B 1SYVB 3ARBD 4FQXA 2XKNB 3AROA 2K8MA 3CQFA 1X9RA 3TV8A 1S9WB 2C1PB 2WBKA 5CLWA 4KRLB 1F42A 3KYMA 4PJ6A 5CSZA 4NUQA 5IVZA 1M71A 3MBWB 2WD0A 5E9AA 2YS4A 2K4WA 4UANA 2HRPH 5CGYD 2XZQL 1W6WA 1E4HA 4LHJB 4ZMXA 3RVWD 4NO3B 1GVIA 3MRCB 4KQ4L 3VWKB 3CZGA 1HSAB 3G9AB 2JXMB 1RPKA 2CO3A 3APMA 1ONQA 3Q01A 4MXVE 4FQXB 1V7NL 1MCJA 3WXWL 4MMZA 4B9KC 5HYEA 4ODWA 1XH3A 1TQCB 4LSVH 3CN3A 3VSQA 5EA0L 5E51A 4RIRB 3ZN6A 4AEIH 5D4QA 3KYMB 2AABH 4PB0L 1M71B 2QQNL 5BZDA 4NJ9H 3LHAA 5EO1B 3PFUA 2YD7A 2VW4A 3E0GA 5L2KE 4PW3A 1WVZA 1T22A 2KMWA 4B0MM 4KKNA 1WC7A 3MLXL 2Y06L 3BJLA 1Q94A 3U0TA 4BZ2A 4IW4C 3T0VA 3IM1A 1F41A 2WKOF 4Q8BA 2J12B 4GNKB 5CFAA 3QDGE 1ONQB 1DL7H 3QRFM 4K8RL 2VLJE 4ZAKC 3D2TA 1GSMA 2PWHA 3WIHH 4O5LL 5IWLA 4HJSA 3BKYL 4M03A 4MMZB 4UB0H 4LMQI 3QUYD 4ODWB 3T3PE 4AE0A 5I71C 1XH3B 1FLRH 4NKQB 5CEZL 4KZDL 2KLSA 3X12B 2VDOB 3ATAA 5D5ME 5BZDB 4W9ZA 1OSEA 4ES9A 1JTPA 3RY6A 4N0YL 5DFVC 1T22B 1TO4A 2YC1B 1TSRA 1WC7B 2BXZA 2OA9A 3K0YA 1J7VR 4WNQA 3W11C 1Q94B 4L3FA 3AADB 5JW4N 2QVMA 3D12B 2E9JA 1I9RL 4RGNC 5I76A 5FAAA 3ZT6A 5KUKA 2FEJA 4BWTA 4G9FA 3AREC 2XWDA 2I27N 1FVCA 3HR6A 3LJ3A 2EDXA 2CKBA 4AMKH 5ADOL 2K1MA 5DEGA 4L1HA 3WIIH 2PCYA 4QOKB 4MMXC 3KWTA 4L4VE 4QGYA 2L04A 2OSYA 1QFWH 3L4TA 1ECYA 5MEND 4B3VA 3KPNA 4P2RE 5IF0A 3EYQD 4X4MA 1WA1X 4OFPA 2Y1VA 2K8QA 1A4KA 3CZUB 5CWSA 3WEMA 2C3HA 4FG6C 4JLRB 2UZIL 4RWYL 2H45A 3Q13A 5E2VH 3ESVF 3I02A 3BXNA 3DX3A 1OQOA 5AB9A 3HMXL 3J2PA 5I76B 1OAYL 3CFMA 1T03H 2IBZY 1HS6A 1B0RA 2BSED 5DD1L 2W65B 1J0KA 3MBEA 5DGQA 2ZXQA 3WY2A 1GJWA 4JUTA 3WXVH 4DKFL 1FVCB 3SGJA 4I4WA 5DEGB 3NSJA 3ZGHA 4J2QA 1SDDB 4EZLA 4GMTL 4W4OC 1J0ZA 3QUZC 1N4XL 1KFAL 5BPPA 4KJPC 1USZA 1ETB1 4NQDD 2ZKHH 3WI9A 3OKOA 4AGNA 3KPNB 5IF0B 4P4KD 2QMJA 3NCJL 2F1BA 4E0RB 4QRRD 1A4KB 2QV4A 3KCPA 2XZCH 1JCKA 4KVNH 3ULVH 1CGSL 1AOZA 1EXUA 3GK8H 1U8KA 5FYJU 1I7ZB 3I02B 3BXNB 1F45A 2GHZA 4G8GE 4WGKA 3QQ9D 4Y1AB 5LHDA 4Z8FL 1B0RB 4PGDA 4ETYA 3V52L 4AC2A 5IR1A 1XV8A 2NY7H 3MBEB 2H26B 3SBQA 5GJTH 4OCNC 2E3VA 4I4WB 3FOMA 4BWWA 4U6HA 3ZE2B 1DBML 4X80H 1U92A 3D69A 1P4BH 3BSZA 3OHXC 4IOSA 3O4LA 4XZ4A 3ARYA 4MQXD 4E9QA 2BO0A 3OKOB 1A02N 1FPTL 3ECQA 4TQEL 1R3HA 4FTVB 4V1DD 4X0NA 4BSWA 4K2UL 1F4AA 3TF4A 3KEHA 2HA1A 2HSIA 4XB8A 3GTNA 2HMIC 4YDZA 1EXUB 2EDTA 2EVIA 4I18C 5AW0B 3V79C 2ZP9A 1TEFA 3O6KH 5BJTA 4PGDB 1PSKH 5IR1B 1IGFH 4LIQH 2QHRH 4UM8A 1L0PA 4DUXA 1MW0A 3FOMB 5I73B 1TYJA 2VXQH 3HG0A 3IDGA 3QCVL 4U6HB 5GPRA 1HDMB 4N0UA 1U92B 3D69B 3C2AL 1UJ3A 1L9NA 1NPNA 3QDME 3O4LB 1AO7D 5DD3H 4BFEA 2W91A 2DPKA 4JO3L 5F7NC 1JZIA 3IDNA 2HLFC 3HE7C 3BT2H 3C08H 1R3HB 3BPLB 3TX4A 1N12A 3IWVA 2YUVA 3OSKA 2WQAA 3MLSL 2MJWA 1SHXA 4OCWH 5H4YA 3O6MH 1M2OA 1DUYA 2MKLC 1ZJAA 1VFAA 4OJEH 3VX1A 3WJJC 1H5BA 5DVPA 5BJTB 2BSSA 4TF4A 2IQ9H 3B5HA 3E38A 4L1DA 4UM8B 2VAAA 4RWHA 3NZUA 3IDGB 3WO3B 2ICEA 3PAVA 5DURB 3H2PA 1RURL 2ZCKL 4KKAC 1UXMA 3IDNB 1UCBL 3BLKA 1CXHA 5CUSL 4ECNA 4OM0H 4B9YA 3O6FA 3SE6A 1RUKH 2XKSA 4HUCA 1O9WA 3KH4A 4ICWA 3E2HB 4I1NB 4M5ZL 1DUYB 3W2DH 3CDGA 4JKPH 4Y0GA 1E30A 1G7IA 1H5BB 2I07A 1ID2A 3MOBH 2BSSB 2Z31D 4YK4C 3LZNA 4DZBA 4F2ME 4GT7A 5H94A 1RZKC 2ED8A 3A6BH 1FCGA 3L5XL 9PCYA 2FR4B 1G7HB 4N4YB 3DI3B 4X9IA 5EF0A 4YEFA 3VFGH 3R7QA 4M8UA 3FTVA 1YG9A 5F88A 3AU0A 4HLZH 3TOPA 2ATKA 5A7EA 4XOCA 2Q20A 3IGLA 4NS0A 1QD0A 4EXPX 1F58H 3O6FB 4X5LA 3G6JE 5G4NA 4YSOA 4LEOB 3DMMC 3DLQR 5JMOC 2EUVA 5EU7E 3AVEA 3CDGB 1YDPA 1ZD6A 2PW2A 2I07B 1G7IB 4OD3H 3QUHA 1UACH 4TKWA 5DVLA 2GI7A 2WLJA 4FFVC 3T0EE 2A0LD 2FUTA 2A4EA 2R2HA 2BVQA 2R9HD 3NJNA 1NAMH 5I5JA 4X7CC 4MAUH 5HVGB 4X5PA 1HU8A 3HUJA 4L2LA 2HKFH 1JHTB 4RSYA 5F88B 4AKQA 4CW1A 1O0VA 5AYQA 2ATKB 2LLNA 1IC1A 2IALA 5I8CA 1OY3B 4PCKA 3NDZE 5CJBA 1UEYA 2X6UA 3H85A 5DEFA 4KRPC 4AE1A 3BD3A 4F8QA 4AYFA 1YHPA 1NFKA 3WEOA 1QWHA 3MFGB 4LFHD 3V10A 1YDPB 4UZGA 2PW2B 2J5LB 5GZOD 5GGTH 1I8IA 1KIQA 1G87A 1RK7A 4RDQG 4QEGA 2PPDA 1KGJA 2GAZA 1MCRA 4JPKH 1G4MA 3EFDL 3AS1A 1IJNA 2R2HB 2HUEA 3BCDA 3OLIA 2WTOA 3EHBB 1AP2A 3HUJB 3U4EA 4QXGH 3DX4A 1W6LA 5K39A 1ZLWK 3CSGA 3FF8A 2XY1A 1JRHH 3K3QA 2IALB 4JN1L 4YR6B 1T0OA 5I8CB 2GSGA 3GSVA 4BJLA 5IHLB 5ACLA 4HJGA 1QBML 2EADA 4W9KC 3CV5A 3PXHA 3ZKMD 2VO8A 5DMGD 4AYFB 3LN9A 2QTEA 3HHRB 5L88L 2NY2C 1OE2A 4XBGB 2GBVA 1ZWIA 3ROLA 1I8IB 1KIQB 4WWOA 3UAJD 5DUPH 4KITB 2IWGA 4KK8D 2Q87A 2GAZB 3UXFA 2GITB 4POUB 3EGXB 3FQRA 4AKOA 4NQCE 2YSSA 4NPKA 1AP2B 3ABZA 4GMSH 1FRGH 5TK4A 4ZMTA 5AG8A 5K39B 4LCWA 1LWHA 2DJMA 4NPJA 5FO7A 3FQXA 1IU1A 3QNFA 2GSGB 3GSVB 3T8VA 3WN6A 1NIEA 4HJGB 3SPVB 1GHFL 1RVFH 2GBUA 1P69B 4TUKL 2R1WA 4FMVA 1LO3L 1K4CA 4S10A 3QIUB 3AU1A 2AEQL 4NAMA 3ROLB 4GSRA 3F05A 5L4FA 4X5QA 2X10A 5JORA 5DD6A 1P1ZB 3D05A 3FQRB 2YSSB 3G3LA 1Z0MA 5CJQH 2X40A 4CDGC 1P4LA 2OMNA 3FU6A 2GC7C 4RZCA 1BLIA 2X05A 2IG2L 4LCWB 2QGEA 3EFFA 1F90L 5C0AB 5FO7B 4ZS7H 1C5BH 1YEDA 1A7BA 4NBYB 1TO5A 5CJOL 3ZDXF 3WFZA 2VTFA 2R1WB 4OLYL 4CSPA 5IUSA 5KTEL 3RP1A 4MNHA 1K4CB 1JPFA 1NICA 3MQIA 3GSOB 5E4IA 2FUQA 4P2QD 4DKDC 1XGQA 1ZA3A 3QG7L 4DUWA 1NCCH 1E40A 1QFHA 2W81C 5JORB 4NAJA 5I6XB 4Q0XL 4NFCA 3PV6A 2OZNA 4DQOH 4QTFA 2AJ3A 5EUKA 3SQBA 4X6DA 3RY4A 1P4LB 4M93C 1MN4A 4RZCB 1KJ2A 4YHOH 1RUQH 5ICYA 1ZOXA 2QPEB 5KS9B 1KSRA 2ITEA 3ECBA 3EFFB 3MCLH 2A77L 2WGNB 3O2DA 2DJ4A 3HA0A 1HQ4A 2XRAL 1YEDB 4XGZA 1JHKH 4GAAA 1IBGL 4HAGA 2VGLM 3ASOB 4NT6A 3CHOA 5FK9A 2VXSH 1VERA 2PPEA 1KYOJ 4JJ5B 2YUWA 3LH8A 5D70L 4YSCA 1JPFB 2MCPH 2FB4H 2TSAA 1XGQB 3BSHA 1ZA3B 5I19H 2FX8L 1INDH 1FG9C 1E43A 4Q9QH 1T2QH 2D2OA 4RRPM 1E4KA 5EUKB 3SQBB 1M7DA 2ZX6A 4X6DB 1KJ2B 5T5FH 4WFED 3PUUA 5EEYA 4HPOH 3ECBB 2NY1B 4LEXL 4TQIA 1HQ4B 5E70A 4OF0A 4OZGA 4UAOB 3SCMD 3GKWL 4XGZB 2F7QA 4FFZA 2F8OA 3VXMA 1VLXA 4NT6B 1NDMA 2AKRA 2G3ZA 5FK9B 3EYFA 3I85A 1UOVA 1I53A 5LCVL 1GKEA 1RZFH 3TFKC 3WKQA 3X3GH 4F27A 1Q9WA 3GSNA 4TN9A 2VLKA 4MMYA 1AKJA 2X38A 4BFRA 1S5IH 1H3GA 1I1AA 2RQ8A 4JCMA 4BHUI 4NLAA 4AQAA 4WDIA 2RCSL 4FX5A 5JUEH 2H6UA 1AGDA 1M7DB 3CFBB 3IFPA 1UOKA 3J27A 4Z7UF 3JVGA 1X5IA 2D7OA 1D7FA 2VW6A 3IDJA 4Z3HA 4A67A 1MRCH 5AVVB 4OZGB 1AACA 1VGEL 1YQ2A 4UQAA 4PIBA 5AOLA 5GSRA 5EIIA 1QAWA 3VXMB 2D2CC 3BKML 3NSCA 2GIXA 2AKRB 2CR3A 2HT2D 3EYFB 4XVJL 4WV1C 5KVEE 5I1CH 3GSNB 2BDNH 4MMYB 1MNNA 2IV8A 1AKJB 1CU4H 3CSBA 3CVDA 1RZ7H 4G9FE 4RMVA 3WLWD 2ZUSA 3X2QB 5L0QB 4G83A 2X3AA 3N85H 5IFAH 1I1AB 5KVDL 2FWLB 3LNIA 1IEAA 4AQAB 5D1QC 3L45A 5E1QA 1AGDB 1QSVA 1XL4A 2WBJA 3IFPB 3K6DA 5J57B 2KZKA 2QSCL 3IDJB 5BVPH 2BPBA 5AUMA 5GRYA 4NYLA 1ETJA 2HFFA 5EIIB 5F7BA 4PBVC 3EUUA 3II1A 4EN2A 4U1KA 4GINA 4UV7H 1BZQK 1HIML 2WJ5A 4WJ5B 3RVUD 3RGVB 3TS8A 3EADA 2KZWA 5D1ZA 3HOGA 5E08H 4XXCA 3IPFA 5GGRA 4Z77A 2CHNA 2XTJD 3QG6A 5DJYB 1EERB 1IEAB 2ITFA 1BZ8A 2OMUA 1ZXQA 2WBJB 3TJEL 1KB9K 4QNPE 1J8HE 3Q6GL 1TNNA 5IK3B 3THML 2HFGL 1RKRA 5AUMB 1GJIA 4NYLB 3GNMH 2HFFB 4UYQA 4WO4C 5KJRL 2B4CL 4KDTA 3OMIB 3CNKA 12E8L 1JGDA 4YSSA 1MQKH 2KI6A 1JV2A 3OPZH 1AZRA 4Q6IC 2FCBA 4U1KB 4JFXA 2UY6A 4ZNCD 1F4XL 1MH5A 3K71A 3GPEA 2PF6A 4GQ9H 5D1ZB 4NM4L 3DVGA 1C1EL 3KAAA 1KXTA 3EYUL 4G6AD 4GUQA 5CHNB 2PP7A 3QG6B 5GGRB 1A6ZA 3GZPA 4RX4A 3ZHDA 1AGFA 2O5XL 2OMUB 1UADC 5KJ4A 2XPZA 3EDKA 1WZMA 5E24E 2F7PA 1MFEL 5HVHC 1AI1L 4FOMA 1YECL 4MAYC 5C08D 1E5UI 4OF3A 1R5VA 3SBWA 3W56A 3CSTA 3FN0L 3PHQA 5LQBL 1N7ML 1SBBA 2Y07H 4Z7NF 1CIDA 4M48H 1JV2B 3E8VA 4MWFA 4N68A 5GZNA 4F7MA 3SE8H 5CBAA 1G1CA 4X8GA 4JFXB 5AVQB 3ZE1F 2UY6B 3CHXA 3K71B 3IS0X 3VXRD 4LCIH 4CVXA 2H0FA 4XCCH 3F5WB 2YEZA 1KT2B 1SM3L 3DVGB 1KXTB 4ZOEA 5FXCH 1MWAA 4ODHL 3M1OA 4B60A 2D3NA 3RRQA 2FYYA 4BDVA 1A6ZB 3L3JA 1I8UA 4N0UE 1AGFB 3FNKA 3MV8E 4JFVA 4CC4C 1YJDH 4MJID 3LCYA 2WXOA 2AXHA 4M61A 3POCA 3DETC 5GGVL 4DWHA 4YLQT 2GYSA 3PHQB 5D55A 3O0LA 5FGCE 4Y5XC 1FN4A 2J8OA 4PRDB 4DW2H 3VG9B 1K72A 3GBNH 2CPCA 1G7LA 1VFBA 4PCYA 1EO8H 3N42B 4MWFB 2EUXA 1O5DT 2YMXH 4PLJD 2CO7A 2G2RA 2L3BA 4PHZA 3TBTB 2FHCA 2EJ1A 4PGZA 2HJKA 4CVXB 3QR0A 3Q05A 4XNZB 4Z3IA 2YEZB 2MOQA 4G6JL 3DJ9A 3ULSA 3AZUA 1UZ6E 1RUAH 4O58L 2CGYA 1Q0XL 4BDVB 3VQMA 2DQCL 4P2AA 3L3JB 4PGCA 3FT4A 1G9NL 3B1UA 3D9AL 4LEEA 1TNMA 3US9A 2BW5A 4M61B 3DIFB 4PLKD 3STLA 4NZJA 2D0GA 3OMZA 4N2HA 4WFHD 1MZZA 4JM4L 4F1SA 3CBKB 3O2VH 1JYNA 4L23A 4H7VA 1FN4B 4PRBA 4BH7A 3BKJL 3FN9A 3CVIL 3JWDL 1G7LB 4FG0A 4NSKA 1VFBB 5DHEA 5C0CA 3NSXA 1EJOH 1O75A 4NNPL 1C7TA 3FFCD 4P2OA 3IDMA 1DBAL 2CO7B 1L0XA 1R3JB 1AR1B 1FVEA 4POZC 4RESB 1M2VA 4XPAL 1D7DA 3ULSB 1PGRB 2BP3A 2FX7L 2QQLH 4B9ZA 2X1XR 4KVCL 2WPGA 1L9QA 3CZEA 1DQJA 3T04D 4PGCB 4XO5A 2N1TE 3FT4B 4PY8I 4HD5A 1TTUA 1ZY9A 5DQDL 4BK4A 4HCRA 4R3SA 3G5WA 1S46A 4HMEA 4WW2C 5SX5K 4NXKA 5BW7A 1XGTB 4LAJH 3STLB 1BD2D 3GJFB 1I82A 4GUCA 1E2ZA 5TTRA 4X5RA 4Y7MA 2ZX9A 2DH3A 3D09A 4BH7B 3GO1L 3DUSA 4A6YA 4NSKB 3PU7A 4XP4L 4GPVA 5C0CB 2X7LA 3PWVA 3K4ZA 4P2OB 1DZ0A 1FVEB 1BFVL 5BS0D 3T8XA 4TSAL 3WFEL 1M2VB 4AM0A 5I5RA 5I66B 1PG7W 3PWPA 3D2UD 3LN5A 2R15A 2SEBA 2DQEL 3TU6A 3OG6B 3KYAA 4H1LG 4PHXA 4M1DL 2WKOA 1CFMA 5FECA 3D85D 4KQ3L 5JOPD 4R3SB 1OAUL 2IGTA 2ZQKA 5EG6C 2O93L 3ARFD 3NACL 2KT6A 1Y6NR 2Z64C 4TVPD 1W16A 2V17L 3VFTB 3LMJL 4DKTA 3AQXA 3S34L 4X6CF 4KTEH 2VDOH 3F3HA 5LBSL 2DEYX 4A6YB 3SQOL 1T4WA 3HTLX 4B0MB 3CWGA 3B9KD 2X7LB 3PWVB 3ARBC 2NUTA 4LVNC 4Y16B 2Y7SA 4NJAH 5FCUL 4PI2A 3ZPDA 1KYUA 2XG5B 3TV3H 4JRXD 3FRPA 4AM0B 4BZ2H 3PWPB 3LN5B 2SEBB 3N1FC 1EV2E 4O51A 2RACA 3V6OA 1F97A 2WSPA 3GBEA 1EAOA 1A14L 2EIKB 3QXWA 4Q6YA 5D7HA 5FECB 1SLXA 2WQUA 2C7FA 4GO8A 4WW1A 4RLDA 4P9HH 5CGYC 5B38A 2WVUA 2WMPA 4JB9L 4M62L 2GJJA 4ENED 4AYID 3RVWC 4ONFH 3PPSA 2VO5A 1EEUA 2XNAB 3AAZB 3HB3B 4RNRA 5DT1L 1NCJA 2DIJA 2NUTB 1TSHA 5E9NA 1YYML 4ZI8A 1FHNA 1FLTX 4J3WA 2JJVA 3US0A 2IPKB 3X17A 4HWEH 2LU5A 1FYTD 4U49A 3VNZA 3E6HA 3FRPB 1KF9B 1MPAH 1MIEL 3GSWA 3MHZA 1S5HA 3NT0A 4XXWA 3IBOA 1IJ9A 4G6KH 5AVRB 1GTFA 3MN8A 4O51B 2VDQB 3HC0A 4JQIA 4YPGA 3PP4L 5FW6A 4GSDL 3GUFA 3LKRA 4QKXB 3FH5A 3TVMD 4UTBH 2QDVA 2KS0A 4W81A 3WYRA 4KH2A 4MQSB 3KXFE 3DX9A 5B38B 1YEGH 1OQXA 2WMPB 4CN4A 5I1GL 5L7XL 2D7NA 4DGVH 2P28B 3GMQA 2N0MA 4HLZG 2DQGH 3HNVL 4NUJA 1JNLH 1WICA 4TUUA 4BUGA 1R75A 5IJKA 4RNRB 3Q5YA 4GSXA 4OCRH 1OCWH 3KDMA 2X2YA 1Z7JA 1AQKH 4M7ZC 3QUYC 3E6HB 3NIGF 3QP3A 3LB6D 3GSWB 4OCMC 4PJIF 1RD6A 4IBSA 3RX5A 3PHSA 1MCWW 2Z7ZA 3HC0B 4YPGB 1KB5A 1A7PL 4NM8H 5K9KB 1MIMH 3LKRB 3UCQA 1NBYA 4DGIL 3T3MB 1XAUA 4AVJA 4ZX4A 1OWRM 4OFDA 4LAQL 1XB3A 3DX9B 4FJ6A 4M6OL 1ZHLB 2ZYHA 1U3JA 1HQRA 3O0RH 4HA1A 1B9ZA 3S97C 2YRLA 4KMTL 3GMQB 1L4IA 1RSYA 5E6ID 3KG5A 4IU2A 3S5LA 4NX0A 3TEXA 3V4PA 1J9RA 5CR8A 4NN7C 2X2UA 3Q2WA 4XBEH 3ZDZF 4HOWA 1UA3A 2Y23A 4UT7H 3BP7A 1J5OH 3EIFA 4PJXE 4XP5H 4CMHC 4AYBA 1CBJA 5IEHA 1G9ML 4Y8AA 5AOKA 3DV4A 4PVLA 1E5ZA 1KB5B 3V0HA 3O3BB 1QRND 1H3PH 1NBYB 2R0LL 5I9QC 4ZFGH 3GXTA 1EFXA 1NFDF 1CR9H 3BGMA 4NFBA 4AQZA 4LSDA 4F58L 1M7IA 2E7HA 1NCOA 4NC2B 5IV2B 4Z7QE 5JQ6L 4OGAD 2DIEA 2HVKA 4PR5A 2YGPA 3S5LB 3V4PB 2DTML 3SZKC 3KYKH 4FI7A 4FZEL 2PTTA 1KCWA 3AQZA 2ZXCA 2EVJA 4C55A 5TDPA 4Y89A 2VRQA 3RDTA 3CPUA 3LZFH 5FYLE 2LAGB 1QW8A 3TIDB 2E7BA 5IEHB 2CE6A 3DJSA 3DV4B 5F3HA 1MCQA 4JRWA 3QA3A 3CQPA 4XR8C 2YPLB 3LVTA 2IGLA 2XZZA 1ITCA 4P4KC 1EFXB 1EK3A 3BGMB 1ZSDA 4NOFA 4ZDHA 2BOLA 2QKIC 3CPLA 2YIHA 2VR8A 1M7IB 1DBKL 1UCTA 4HC1A 3GEFA 4XCEA 2ODHA 1CDCA 3ILDA 3HZVA 3LNDA 4HFUL 2HVKB 3SKMB 1JDAA 4PR5B 1Q1JL 3QQ9C 3VMPA 1GAFH 5HHQB 4ICXA 1XT5A 1Z1WA 2Z1KA 5CD5D 2PTTB 4L48A 1EH9A 2OZ4A 4MCZA 2VLKE 3HKFA 4N8UA 3RDTB 5AQ0A 1HJCA 3QXUA 4MQXC 4K3JL 5GGUA 3KWVA 4ATWA 1A7NH 1W0WA 1R3LA 2ZSWA 1ZHBA 1PKQA 1Z3RA 3ZU8A 1AS8A 5EOTA 5JXAH 2OSLB 4ZDHB 1ZSDB 3CPLB 4WU5A 1HSBA 1IKOP 1MF2H 4FNTA 5KBLA 2H9GA 1KDJA 3ARGA 1YEJH 3X3FL 2OL3A 3HZVB 2AXJA 3C09B 3WAJA 1CWVA 2EEAA 2ZKMX 4AXWA 1DJYA 2AJZA 2WXJA 4YIQA 2ODIA 4MCZB 1U8PA 4QRTA 4ZUTA 5JYMA 3UTSA 4F8TA 1T80A 5K9JH 4D9LL 5C0DA 3G7TA 1YMME 4LHUD 1S2EA 1YO4A 5GGUB 2V4LA 1NC2D 1W0WB 3D3VE 3VM5A 1R3LB 2ZSWB 1ZHBB 1PKQB 4XMXA 5DWPA 3ZUNC 4DESA 5GJSL 5GRXG 3R0MA 2KZ1B 1NGPL 1OSYA 3NGBC 3IDUA 5F93C 1KY7A 1HSBB 2H9GB 5T3ZH 3NRQA 2HFTA 4H8UA 3ARGB 1V27A 2WYHA 1WDAA 3G6DH 4J6RH 2OL3B 4WWNA 1IGCL 1YEKL 3L5WA 5D9SA 4FLRA 3CIQA 1THAA 3QC5X 2R8SL 3L5IA 1RZJL 4AXWB 2AJZB 1TMQA 3EJSA 4YIQB 3ARXA 1U8PB 3N6YA 4RMBA 4LSRL 3QNZA 4J4PA 4K3EH 4QRTB 3REWA 3UTSB 3HC2A 3ULUH 1BF5A 1U3NA 3S37X 3RQ3A 5TDNA 3VJ6B 5C0DB 1GJUA 3B2MA 2X1OA 4KTGA 1TPXC 3DVNA 3VU2A 1G0DA 4LARL 4XVSH 5C0RH 4BFFA 3QGVA 3UPRA 3L95B 4HH8A 5DEZA 2WQSA 3LNHA 1PW3A 1TUPA 3KBHE 1EVUA 1C5CL 1XCWA 2UXVA 3F8UB 4KXZI 1KJ3H 1U91A 2EZ0D 4TXVB 1EZSA 1VF5C 3HI1A 1RU9H 4GI9A 2F15A 2DYPA 3ESUF 1XAKA 3MRHB 5D9SB 5HYSG 1BGXL 4DK5A 4APQD 4ZS6D 5AB2A 2Z31C 2JQZA 2J20A 4HMDA 3NYKA 5HHVH 5E95B 3ARUA 3QNZB 3REWB 3LV3A 4C8XA 2BSCA 2YKKA 3S8GB 5TDNB 3OAZK 4OT1H 1D6EB 3F65A 3VH8B 4JFOB 1QSFD 5JR1L 3HAEA 3UPRB 2QVFB 2GI0A 1J1XH 3EGSA 2XBDA 2LOEA 2MPAL 3RKDD 3FU7A 1XGZA 2RIKA 4ZMLA 1L9OA 3HI1B 1FGVL 1CFTB 3M6DA 5EZPA 1F2XK 2DYPB 2Y5TA 1NCNA 5F7FA 2QR0A 3DX8A 4BQ6A 2YAMA 1T6BX 5AW6B 5B1BB 1NC4A 2A0LC 5D8JH 3ASWA 4LPTA 5IGXH 4JG9A 1GGCL 2R9HC 2ZXWB 3FT2A 4YL9A 5KOVC 1OVZA 3I9GL 3QIWA 4ABUA 2JJUA 2VM9A 3OB8A 4KKQA 4PSPA 5FYKE 4FXGB 1I1YB 2XV0A 3HAEB 32C2A 2Y22A 1IQWL 1SOQA 4V2CB 4FQ2L 2YQBA 4I3RL 3MNZA 4FYSA 1CN4A 1LEIA 4HS3A 5AW7B 3FU7B 3EBIA 5A43C 3AWEA 2V9RA 2GJ6E 4UQBA 5HPOA 1DSFL 1SXCA 2R4RH 3WNNA 2Y5TB 3EKCA 4W9FC 1DYZA 2BX5A 1OGAE 3DX8B 3HLAA 4AGQA 5J11B 5GZOC 2FRGP 3HJEA 1IX2A 3LDBB 1NC4B 1LP9F 1G6RA 3MXVL 4JFDA 5F7EH 1QABA 1W72L 3VXPA 2QFPA 4BA8A 4UT6H 4FAAB 3FT2B 1OP3K 1ASQA 4A7TA 1G4RA 2ZNWA 3WMPA 5IMMA 3QIWB 1EUUA 5LXGH 2F5BH 3T6XA 4ERSL 1E6OL 3GMOA 3UBGA 4XVOA 3MACH 3ZKQD 1HEJC 1KYAA 1CDUA 3MNZB 3TEYA 1UZ8B 3INOA 1LEIB 4YDKL 1RIVH 1KLFA 1CDBA 2G2NA 1NBZA 3N9GH 4S1SL 3ETSA 3FQTB 1X5AA 3L54A 5E6ZA 3V4LA 3ZKMC 4FNRA 2HX8A 3PRZA 5DMGC 2WANA 5C0CE 2JCCF 3K4DA 4FZ8L 3ZR6A 1CS6A 5JIQA 1MHHA 5IFJA 3HLAB 1TETH 2DI9A 3UAJC 3BOVA 5HPMA 4KK8C 2BP8A 3RILA 2P45B 4ZMAT 2A4ZA 4JFDB 4LRNL 2D0HA 3V95A 2CUAA 1E4JA 3VXPB 2I85A 3JUZA 4ODVL 3ZDXB 3MJWA 3UJJL 5BRQA 2IWEA 1K3IA 3ZTNH 4PV9A 5IMMB 5CCHE 1UM6L 5DWUL 4W9JC 1G5GA 4N6RB 3GMOB 4RRPA 1UXWA 4LLDA 3ZIYA 1DANU 1TF4A 3P1VA 1L7TH 2ZAHA 2ATAA 1KLFB 5A2FA 1N6UA 3L9YA 3TZVD 2CO6A 4KDVA 4QRPE 4YZWA 3HBGA 1XSOA 5EU4A 3QDGD 2RD0A 5IVXF 3KHOA 1KJ2H 2VLJD 5KBDA 5T3XE 2BC4A 3OKDA 1CC3A 1A3LH 3P3RA 3O2DH 1KN2L 4A2EA 3VGFA 5HPMB 1QI3A 1J1PH 4TQPA 5J0BA 2DM4A 4DP0X 4P2CG 3PHOB 3PWPE 3S3JA 4DQAA 4ZMYA 3KW8A 4N25A 4PV9B 5SWZE 3CN0A 4TVUA 4OTXH 1JZ7A 2FO8A 4C56E 5HDBF 4LLDB 3FB8B 5EB9A 1DBJH 3GDCA 3QPKA 4LGRB 3T4AC 2R2BA 4NPYA 4HXAH 2CO6B 2ZUVA 5GS1C 5CCGE 1MAJA 5EU4B 1V54B 3OKMA 1QP1A 1DJWA 1Q9LA 4Z7UA 4JRLA 1ORQA 1OLZA 2BC4B 3OKDB 3WCYA 1A4BA 4W6XB 2WTRB 1L7IL 4I77L 4L1LA 4TVSa 1NGQL 3IB4A 3RWDA 3OX8A 1PCSA 1PZDA 1QEXA 2G9HA 2YJLA 4U1IA 1JF5A 1F4YL 1GYAA 4L4VD 3V6OE 3IPBA 1BQLL 1P2CA 1DVTA 3GSNH 2DLTA 4WCYL 4J3OH 1JGIA 3JXAA 2XFGB 2K70A 2J57A 4C54A 2RB8A 1R0AL 3T6ZA 2H2SD 5IW6B 2CNYA 2R2BB 4NPYB 2I9LA 4MKTA 1ODAA 5D7SH 2VLRE 3MBXL 1FWXA 5DA4A 4X42A 1BVKA 4Z7UB 5BO0D 5CLYA 2BOCA 1SMOA 1V7MH 3CFJA 4G9DA 4HAFA 5C6TH 3RL1A 4ZSOB 2MSPA 3RWDB 3L3IA 1G7QA 1WFMA 3QAZC 3MNWA 3OX8B 2QPFA 3RX8A 4U1IB 1JMXA 4WUUA 3CVHA 3V0FA 5EBMA 4TULL 4W9DC 4DP2X 1P2CB 2CXGA 2NY5C 1OZUA 1BREA 1WZ1L 3LZRA 3N40P 2F8IA 4HIXL 4QPEA 3AS0A 4DERA 4YHYC 4YHNB 2WP3T 3DXAE 4QR7A 3H2QA 1E9OA 2Z8RA 4U4BA 3SCMC 2CM6A 3L5HA 1HHGA 2I9LB 4AJVA 5J06A 3B5GA 4QI3A 3BAXA 1VEPA 2WV3A 4K94L 2XA8H 1BVKB 2LTQB 3TNNA 4FFWD 3VU1A 5GRUH 2BOCB 3QXVA 4G9DB 3CFJB 3UTQA 4WSGA 3RL1B 2QZ5A 1UATA 1UYWL 4YBQD 1G7QB 4MXWL 3MNWB 4QJ3B 3TASA 2DM2A 5D1XA 2BCKA 1EHLL 2WXHA 4WUUB 3CVHB 5LBGA 3U1PA 1MI5E 2JB5L 1X44A 1J5HA 3ARZA 3FT0A 3P3SA 2G3NA 4F9PC 4L9LA 3KZ8A 2HKHL 2QLYA 1M6UA 1RJLA 4IGBD 5EOQH 1GGBL 1E9OB 3PL6D 4GH7B 4YAQA 1SZNA 5FOBB 1HHGB 1BM7A 2W59A 1HINH 1WIOA 2HT2C 3QEGH 5AVWB 5DI8A 3DX2A 1EJFA 1TQVA 4GW1A 3DO7A 2XZAL 4P3DA 3X14A 3UTQB 5FEBA 3RIFF 3WLWC 4YXHL 4H0IA 5CGTA 2ETWA 5D1XB 2BJML 3QDMD 1OCOB 2BCKB 2E8YA 3FT9A 4HW6A 4LL1A 3L08A 1L3NA 3OLEA 4UQ9A 1N2RB 2XIDA 2X9ZA 4V2BA 1NUDA 1ITBB 1Z5YD 4L9LB 2C7UA 1E7UA 1FH2A 4LPWA 1RJLB 1E5AA 4IYKA 4M8QA 4YAQB 3EO9L 2CR6A 1AGCA 3MLZH 4PJ7F 4LCYA 2FZ3A 4L4TB 1YPZF 2OXGA 3ALWA 4O2CA