4JUSA

Crystal structure of a fragment of human hspb6
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
90
structure length
84
Chain Sequence
SVALPVAQVFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein beta-6
publication title Molecular structure and dynamics of the dimeric human small heat shock protein HSPB6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 9
structure length 84
sequence length 90
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jusA01
2Y1YA 3QORC 3L1EA 4JUTA 2O30A 4M5TA 4YDZA 3Q9PA 4YE0A 1WH0A 5DS1A 4I88A 3GLAA 3VQLA 4M5SA 2JKIS 1GMEA 2RH0A 3GUFA 2Y22A 3IGFA 2CG9X 2N0KA 2Y1ZA 5LUMA 4PBDA 5DS2A 2XCMC 3QORB 4JUSA 4PCKA 1RL1A 3J07A 3L1GA 3L1FA 3N3EA 3GT6A 1EJFA 2WJ7A 3W1ZA 4ELDA 3VQMA 2WJ5A 1X5MA 3Q9QA 3AABA 4FEIA 2K8QA 3AACA 4YLBA 3QORA 2N3JA 2KLRA 2CR0A 1SHSA 2KMWA 4ZJ9A 4YLCA 1WFIA 3EUDA 2BOLA 4YL9A 4MJHA 2MNWA 1WGVA 4RZKA 3QORD
chains in the Genus database with same CATH superfamily
4KBPA 2Y7QA 4PWEA 3TNMA 2YN3A 4FQ2H 4GAGL 5JIDA 1XL6A 2A6DA 4PLJD 1RFDH 4HYTB 5D2NE 2X89D 3LNGA 3R1GH 4GG8A 1L9MA 3SDXA 4WV1B 3C5ZB 3WUWA 3KAAA 2CHXA 1PZSA 4JX0A 4MCYB 2Y5TB 5MENA 4IEFA 1J9SA 3RUGB 5C8JA 5CEZD 1N8ZA 2A6KB 1AH1A 3DIFA 4NFCA 5CP3H 3X11B 4G3YL 3KBPA 3X1GA 3I9AA 4TOYL 5BO1L 3DUSA 3EGXA 4LL4A 4MA8H 3ZIMA 1TEYA 2CDGB 1DBMH 1FL6A 5DD0H 2PETA 2PWHA 2XBZA 1YMMA 3AGVA 2NY5L 1YSOA 5KYWB 4BV1A 3GRBA 1TLKA 3LKSB 2V5SA 3A3YB 4H8WL 2ZSVB 3ARDB 3IE4A 3US0A 1T1WA 4KO5A 1UCBH 1E9PB 2Q7YA 2N7BA 3Q7JA 4I3GA 2WVVA 1ND0B 1J0HA 4X7SL 1HKFA 3AU0A 4Q0XH 4D9RE 3OG6B 4N8CL 2VR5A 1RZ8A 1NCUA 2OR9L 4Z95H 3A5VA 4P3DB 1ROWA 1FV1A 5C0RH 1RP8A 3NJFA 3SDDC 5ID1A 3AZUA 1UEMA 5E94A 1ZHLB 1YDPB 2QGEA 2G0LA 3UGXA 1M05B 5EEZA 5EBLA 2J1KA 4KVPA 1JIBA 1JWUB 4Y9GA 3U0WL 4Y5XC 2ATKA 5I1HL 1ETZB 3MRIA 2XWJB 2GI7A 3BGAA 2FJHA 1G7PA 1QHPA 1E6OL 4PCKA 5IIEB 1GZQA 1IUZA 4LSTL 4X83A 2MOVA 4TVPE 4LSSH 1P84K 1IAIL 4OSUL 2OTWA 4LEXL 5I30H 4D9QD 3NJVA 1N3NB 4GSDL 4YDKL 4BK8A 3UBXB 2EE3A 3L1OH 1NMCC 3BQUD 3MRJB 1TLMA 3IYLW 3QDJA 4PRDB 1IJ9A 4CA4A 5LAXA 2LGNA 2XX1A 1WFTA 3T8XA 3FQUA 5MI0B 3RWCA 5JHLH 2BH0A 3QJVB 4N2HA 2Q8AL 1FVDB 4XMWA 4CKQA 1IEAA 2J44A 3SY0B 3HUJF 1CGTA 2E9JA 3NFPA 1G6RB 3HHRB 1BQRA 2LTQB 1BM3L 3F12B 4MA7H 3RB7A 1G87A 3O4LB 3VAEA 1A22B 4DTGH 3OHXC 1J1XH 1TQBB 1RHHB 3U46B 3VFVB 5IB4B 2A6JB 4TS6A 5GZOA 1TMQA 2EXYC 2OJEB 3QORC 4FQQA 4ODTL 1PYWA 4I88A 5BQ7B 2RIKA 3KGRA 3ZX1A 3GSWB 5CWSA 3SSGA 1GTFA 5GGTL 4YZWA 2A0LD 4N2AA 4I87A 3EO1B 1KEML 2V2WB 2EIMB 3G5WA 3QDGD 4LCIL 4A38A 5KTEH 1JTPA 3PY9A 1S5IH 5CEYB 3AG3B 4XNDA 2FZ3A 3I3DA 3NJNA 2DQIH 2DIEA 3EJCA 4Y4HB 3AG2B 1XSIA 3QUKA 3ARBB 2UVFA 1NSNH 4OJFL 1OSZB 5E03A 5FK9B 5FX3A 2WMPA 5F7HA 4MJIE 3RBSA 4NOBA 4UNUA 4PJDA 4FNPA 4U1MB 5IEHB 2DLEA 4WHDA 3O45A 5LCVH 4GMSH 3O6FB 4Y7OC 3SKMB 5L9DL 1NGXB 2CJTA 5KSUA 3TESA 1OO2A 2JKWA 3I6LD 4GO8A 3U48A 5CZXD 3UIZA 1IGYB 5FYJE 1Q0XH 4AENB 3D69B 5I1AA 4ISVA 3BGFC 3IJHB 1U8QB 2NPLX 4WTXA 3Q1SL 3BVDB 4FNLH 2BLFA 1P7KA 1F3RB 4IK6A 4O02B 1MHHB 4LSQH 2H47C 2XA3A 3FTSA 4O58L 3HLAB 4JM0A 1O9WA 2AK1H 4YHKH 4TXVB 1VPOH 3WAKA 4FJYA 2OMZA 3B3IA 4MNGA 3LQZA 1LD9B 5AEAA 3A4AA 3ZTEA 4YSOA 1BYPA 3SIKA 2GVYA 3W11D 1U6AH 3NIGE 5KBNC 3S36H 2ZYRA 5CZKA 4BFFA 2OA9A 4KHTH 2YC1B 3MLSL 4UANA 2FJGA 4OI8A 1HEZB 3VFSB 2YZ1A 3IN0A 5EFIB 4A63A 2VUKA 5F3HA 5IVXA 3IMVA 2DDQH 4LP5A 3T0EC 3DX4A 2UY7A 2ZUYA 1M6OA 3ULUH 3UZEA 1ZS8A 3SOBL 4DPRA 4YQXH 5IVXE 1F58H 2NOYA 2PYFB 3TEUA 2ZX6A 2CBMA 3GC3A 3UO8B 4M9PA 1QZ1A 5MEPB 3MOAL 3OLDA 1J9QA 3UTQA 2JIXA 1E50A 1Z3GL 3QEGH 4PJCA 2EZ0D 2FX8L 5DO8A 1OF2B 1GR7A 1DVFC 3VI4B 2UY6B 2HZHA 4F37K 2OCCB 4U1KA 4M00A 4A66A 2H26A 1WBYB 3PL6D 1ZWIB 2FECI 1FPTL 2DJSA 2HT3D 1UH4A 1BFSA 2CMRL 2O6FA 1GIGH 3RX5A 3H3BC 1R3KA 2DMBA 3BH9A 2CKBB 2QZQA 3VWKB 1PZUB 3ARWA 2HH0L 4OLZL 4Y2DC 4XWGH 2YRBA 5DJ6A 2HLFC 1ZA6B 4GI8A 5GGRA 5JPMC 4AYEC 2FT8A 5MP6L 1YNTF 4GKSA 3MA9L 1S9WA 2HKAA 4NZFA 5BRZE 4PLKC 2NY2B 1ZDQA 2NY5C 5JW5A 2NYKA 3MRNA 1EEUA 4LEOA 5DD1L 5AW0B 4H8WC 2PO6D 4LSPH 5F44A 2HLAA 4TLTA 3PP3K 1JGDA 2X7LA 3V55A 1QSFD 3GBLA 1T7VA 2WLNA 3RL2B 3O2DL 1HSBB 1OTUC 1UVQB 4PRID 1RULL 2LU3A 3QEHB 1U3YA 4OGAC 1PX8A 1KJ2L 3PDOB 4HA1A 4YBLC 1CFTA 5IJBC 2B4CL 4CADB 1UYWH 2R83A 3K6IA 5GGQL 2ATPA 1FG2A 1IM3D 1I7ZA 1MEXL 2OCFD 1SBSL 3RURA 4H25A 1HAWA 5D72L 1Q72H 1T83C 1RUQL 1FNAA 2AQRA 3DROA 4M8QA 4OJCA 4K3JH 5H2BA 2WLIB 1JWMA 4DCQB 4XP4H 2Z7ZA 3DURA 4F15B 2CD0A 3LQMA 1NEUA 1A3LL 4KFZC 5DGRA 2ED8A 1QBBA 3ZMRA 1AVAA 5I6NA 3OKNA 4ZI8A 4HPYH 1R34A 3BRFA 4S0HA 1J1PH 4FL4B 3L2NA 2B3IA 4YFDB 5I16A 3B9KC 4LLMA 3QG7L 3HA0A 1ITBB 3C60D 1RK0B 4HBCL 4WK0B 3MLWH 5DJDA 3T0BA 3V0DA 1EUTA 1GXEA 1OQXA 2QEJA 2ZCLL 2AQPA 2OL3B 4F7TA 3T77B 3TYFB 1DQKA 1HQRB 1DBBH 4CN6A 2VDLH 3BP5B 4KWUA 4XN7A 4U1NA 1WD9A 3KGSA 5ISZB 2AV1B 5CSZB 5GJTH 4E0RA 1BVOA 2FSEB 2X4QB 1KCUL 4J3WA 5E1AB 3M45A 4DOHE 3B2VL 3ZHKA 1HWGB 3L5WA 5DSCA 3RWFB 2EYRA 4YS4A 3CMGA 3J7HA 3BEVA 5HPOA 5H4YA 5C0JB 1JYWA 2IAMB 5DU7A 2FWUA 4DEPB 2CUAA 2DY2A 1CZ8H 4GRWE 2WYHA 3CZJA 3FUFA 3R7QA 5HJ3B 1L6PA 1YY8A 4V2CB 1JL8A 4RQQB 4NFBA 1B88A 4AYFA 1T6BX 3E6HA 1C5DB 5FYKL 1XZ0A 3SPJA 5IJKA 4BELD 4OZGE 5DMGD 1RVFH 5E2WL 4A39A 4L4JA 4QPEA 3ZL2A 1DQVA 1JVLA 4I18A 5FA3A 1K5NA 1S9XB 4XCFL 8FABB 3ZOAA 3DX8A 2FYVA 4L9DA 2P80A 4XB3A 3WTXA 4W9IC 2NX5B 4U3CA 5BS0D 2NR6A 4PV1C 2GTZB 3MLYH 4HKJB 2NY3C 4RGNE 1VGKB 4HWNA 3GTNA 4R4BB 4RA0C 4MSWA 4B9GA 3TONA 1T2QL 4Z8FH 2G2RA 4NUGL 3QW9A 3HUJA 4R7DB 3GKZA 2P5EB 2HTKC 1RURH 4Y4KC 4D94A 2BW4A 4I5BB 5J4MA 3RNQA 3V6ZB 4UQ3A 1WICA 3QYNA 4LLDA 5F1KC 4ICXA 3K71A 1CK0L 3EO0A 5HSFA 3L3DB 1QABA 3GT6A 4U7MA 3DGDA 4HSQA 4S1RH 4YXLL 2F54D 1GYAA 3HZVA 5E6UB 4OCYL 3W0WA 1IJNA 3NZHH 3PFQA 2NXYD 2X12A 3G5YB 1HEJC 3KPMB 3CD4A 3RDTB 1AHKA 3SZ6A 3FU8A 5AENA 3H6JA 3KCWA 4X6CF 4ZSOE 1OP3K 1CGWA 2PYEA 1F4YL 4NSKB 1KENL 1MFMA 3D18A 3QEUB 4POZD 3UTTB 4JMXA 4ZS7H 2NQDA 2X3BA 4FA8A 4Z7NF 3IDXL 4S1QH 4NKQB 1ZTXH 5T1MA 2CSPA 4JFDA 5HDOA 3P30L 5ITFA 1B2YA 2PYEE 4NQDE 5D4QA 4V33A 5GGVY 3O2WH 2JKRM 1A9VA 2NUPA 3QRGH 5KUMA 4E9XA 5I8EB 3UYRH 3ZDZE 3TTYA 1TQWA 5GS0D 4JFDE 1QWNA 5GS1A 4KX9A 4OTXH 3RY6C 1KIQA 3D9AL 4YX2L 3LN9A 5J1AB 1NDMB 3WNPA 5F7YC 5I71B 1WS7A 1G1YA 5D71L 3R19A 4DW2L 3LZFL 2WBJC 2HFFA 2R59A 2JKIS 2XN0A 5TDNB 1AGDB 2L7EA 1CICC 4D9RD 1B0RB 3CIAA 4OZHF 1E9QB 4MTMA 3TCTA 5JR1L 3IDMA 4JHAH 1ZAGA 5IHUH 1MG3C 3RWDA 3UERA 1KGYE 4GO9A 1U93A 1E4KA 4LKCA 2OMNA 4NAJA 2FO4B 4JPVL 2A77H 5IV2A 5D4IA 5EOTA 4ZUVA 4OCRH 1UH3A 4WO4D 3I50L 1HOCA 1RSFA 4J12A 3DUHA 4R7NA 1HXYA 4N0RA 2BZCA 3EDDA 3R0MA 5D7JA 1YAZA 3TBWB 1X7QA 1DVXA 4Y4FA 3ZO9A 1WSST 3M86A 4IGBD 4JFZH 2H5UA 4R8WL 5T33L 1SVZA 3F7RA 3QO1A 1T1ZB 1U8OB 2FAUA 1JPGB 5H4ZA 3W2DL 3GJEB 1DQJB 2F1AA 1F8TL 1HNYA 3N41B 4ZPVA 1PX4A 2I9LA 3UBHA 1ZVSA 3V2AR 4WUUB 3NEEA 4QUOA 4R97C 2NZIA 3ATEA 4LK4A 3G6AA 1P9MC 4JY5H 1P7BA 5LKNA 1TJHL 2HN7A 3KLKA 3VFTA 4GQZA 4TNVF 3T3MB 5JOFA 1T89C 1DFBH 4HS3B 4WNQB 1WDAA 3FW6A 2JCWA 3LZQA 2XWXA 4PJ7E 1P84J 2VW7A 5J13B 3VXMD 3X13B 4N5ED 1A5FH 3E38A 1N0XH 2WXFA 4BKSC 1NGYA 1NFIB 1SXBA 3GHPA 1IGFH 4Y2NA 3ZKXC 5MERA 3OGCA 1CBJA 3DMMA 3BCDA 5JUEL 4PJ9B 1AHWC 3KPPB 2VXQH 4HC1L 4HH9A 1C8QA 4EI0A 1CO1A 3RWGB 4U1GB 1CG9B 2ZUVA 4H5SB 3AB0B 3ELQA 1WBXA 2D7MA 4GKLA 1PKQA 3NSYA 1Y6MR 4BFEA 3BHBB 4GQ9H 4XPTL 2Y2WA 5E8NA 3K2MC 4XOAA 3OKLA 2ZWKA 4ZFGL 4S10A 1XGQA 5JORB 1EBAA 1YNTA 3MGOB 2BHYA 3NIFF 3DTDA 3HNSL 5C9KA 3TEZA 4RMRA 3TA4D 5TK4A 4N0YL 4KH2A 5EH1A 3TF7C 1NCCH 4XR8C 4OH2A 2BVQB 1OM3L 2VLRB 1REIA 4P4RA 5HVHB 4UU9B 4Z7UE 3D39D 1TFPA 3PHQB 5C0IA 2A73B 4PJXE 3ECBA 4WI5A 1AHMA 4LCUA 3RA7L 1XCXA 1ZHNA 1MXDA 3K1DA 2VDKL 4TV3A 3VXQA 2Q6WA 4UOZA 1TQUA 2CPUA 3I6KB 4HUWA 1ZT4B 5GXBB 2ORBL 3LNHA 4EN3B 4DGUA 1YNKH 5C0BB 2PCPA 5E99H 1ZHKB 3VTAA 3DX6A 3FUEA 1NJ9A 3EFOA 3NCWA 4HIPA 1SJMA 1EEZA 3IJ9A 1DJGA 4G6KH 4J7RA 1GKOA 1BCIA 4YFLF 3IJSA 4YHPB 1XF2A 2C9PA 4Z5RA 2N1KA 1QLEL 1ZSDA 5F1NB 4OCWH 5KVEE 3H3KA 2H0EA 4KTEH 4BWTA 4ORGB 1G94A 4NN6B 4XCNB 1KPRB 3KPNB 3INOA 4RZCB 1J5HA 2R29L 3Q3GB 2C3GA 3S5LB 5TE6L 1E5YA 3IKKA 1AI1H 1B4JL 5EOQH 3WNNA 3IGAB 4NO3A 1EO5A 1KEGH 4JFOB 5CIPH 2BIPA 2Q3ZA 1CR9L 3N43F 1E5BA 4AGQA 1HXMA 4E42A 2HT4D 3LRSA 2R8SL 2OI9B 4RFEB 4L1DA 4OAWB 3DTUB 2VR6A 4Y9FA 3CQFA 1QP1A 1M4KA 2OTPA 3G7TA 4UDUB 4HLZH 2Q7AA 4TLUA 3NACH 1R46A 2VM9A 2G5BA 1UH2A 1NFDF 3PWNB 4FG2A 3EUUA 1JERA 2ADFH 4N8CH 3WLWC 5AKVA 2IH1B 2J20A 5F7NC 2R1XA 3MRFB 4X5WA 5B3JE 4P07A 3DXAB 3QCUL 4NC2B 2VTFA 1NLDH 2WXNA 2R0ZH 2OMUA 1PDKA 4XMKL 5FIEA 5K5YA 1LEIA 3O2VL 1D5ZA 1QRKA 2GHWB 5K9KB 1G1OA 1MLCB 1RPUA 2XNAA 3BWUF 3DK2A 4P5KA 1W0YT 2GAZA 3OSVA 4JO3L 2IDCA 5JIHA 3U0WH 2ITFA 3BKYH 4UQCA 2H6OA 1F13A 4IKLA 2OMTB 3ZHFA 4MA3A 3WJJC 1RIVL 3C6LA 2EECA 2APSA 2M83A 2GHZA 5HDRA 4ZO8A 3VXSA 4LLQB 4YHLL 4V1DD 5JW3H 2YRZA 1L9RA 3ESNA 4XHJC 5BRZD 4I48B 4PY7A 4KUZL 2G0KA 3TC9A 4XO9A 2OPCA 4GSDH 2FX9H 3LHAA 3M1BB 2AQ3A 1X5JA 1TJGH 3D0LA 1E28B 3LB6D 3UJIL 1ZRUA 2XQYK 1A9BA 4PGEB 2NNCA 4EIZC 1XTMA 4JDTL 3MV8B 4K8RL 4MYPA 1MFEH 3VYNA 1FG9C 2YQ3A 4G43A 3MRKA 3ZY7A 2GSIA 1ZT1A 3OKOB 2EC8A 1SEQL 3T09A 3UL4A 4PP1D 1A4JA 1I9IL 3FB7A 5GPRA 3QIBD 3VXUB 3V4PA 3FFCA 5AYTA 3CHQA 3PQYA 1KELL 2VDQH 4EI6B 1OGAD 3HE6B 1BQLH 2BIIA 5CBEA 2P49B 3VFGL 1HHHA 5F9WB 4FXGB 1YNLL 1H8OA 3G5VA 3QWRD 4JY6A 1Q4NX 4PJ8D 5A2CA 1EEYA 4ODTH 4KJPD 4KZDL 1XCQB 5SWSB 4QKTA 2AXWA 5GGTH 1AMYA 4RAUA 5FM8A 2VXTL 2J6EA 2K3HA 4CVXA 4MQXC 5IUCA 1GY1A 1HH9A 1DUZB 1I1FB 1UWXH 3ROOB 4ZXBA 2ERJB 4DFIA 2ZCZA 4OIAA 5KYYB 2ARJB 1RJYB 4PI2A 1WE5A 2HJFA 5J11B 5DZJA 3T6VA 3V8CA 3TU6A 2NSQA 5LBSL 3BUIA 3LS5L 4YJZL 2V8LA 4YE4H 2JB5L 43CAA 1CF8L 2FGWL 3UEQA 4TF4A 2FBOJ 3G5XA 4OZHA 4JRXA 1J9CT 1GZHC 1HHIB 1NIEA 5D9SA 1P6FA 4ACTA 3GSOB 4J6IA 4YZFE 4F20A 5HHXH 3U1PA 4F8OA 3DO4A 2XN9E 5KBKA 5K1VA 2QVTA 3G3LA 4GRMB 5EUOB 3RGBA 1GL4B 4HUXB 4XB7A 3Q1SH 1C5CL 4AX3A 4BGDA 4NWUL 3EYQD 4L37B 1Q8MA 5GGUB 4IOIA 2VABB 1MN4A 5F1IA 3L3GA 1TYEB 2XUWA 3M07A 4Q8BA 1V3JA 1FNEB 1Q9WA 4AXWA 1QZNA 5TQ2H 3FB6B 2WXRA 3MBWB 1BVLB 5INDB 1FRGL 4U6XB 4PJHE 4UNIA 1M2OA 1KYDA 4LXFA 1WZMA 2WZPD 2ZE0A 4D3CL 4HHAB 4D8PA 3M8OL 4MXWH 1S3KH 4U2YA 3NYKA 3PLYA 4Y19D 2ITEA 4IDLA 4DESA 1EDQA 3L3OB 2A99A 3FNKA 3ZBMA 4XP5H 1RAMA 2P24A 3MLSH 2I85A 2VLKB 3L3KB 4F58L 1YEGL 3DARA 1KCLA 3CZKA 3MO1A 1W80A 3WHXA 5L8KB 2OFQA 2P5PA 3CN3A 3QULB 4K15A 5EF0A 5JPNA 3AREA 4UQ2B 4APXA 2OXHA 3QQ9D 3MJ7B 5B8CA 2XWDA 1N6QH 1J12A 3QT2A 3SOBH 3VCLA 2EDLA 2YUVA 2X0UA 4RMQA 2NW2B 4JG5A 4AGOA 4LGPB 3MOAH 1JNNL 1NAML 4Q6IA 1JYNA 5ICZB 2CO4A 4P5SA 3QHZL 1SY6A 3AG1B 2IQAA 3C8DA 3KPRA 3Q43A 4WW1B 5EU3B 4N8PA 3L1FA 4MCNA 5IEKB 4OGYH 1AD0B 2HVJB 3FU9A 4HSAC 3FHEA 3GB7A 1SJHB 1Y6NR 2FL5A 2ZPKL 1T1XB 3P3YA 4LMQI 4M7JL 1FPTH 3MROB 5EN2A 4ELMF 2BINA 5ADPL 5AFAA 2KZBA 1DBKL 4M1GH 2IO5A 3EJZC 2VZTA 3ZTNH 3OF6A 5HYFA 4I2XB 4LCYB 3AMKA 3QQNA 2CO7B 2WKLA 3WE1A 5ACLA 3MZTA 4L8SB 5AALA 3P0YL 1V27A 1FO0H 1YY9C 1JSYA 2GUOB 1XF5A 1LTXA 2OSYA 4NHUA 4HCGA 3MPCA 3GM0A 2ZOLB 4J4PD 3V0JA 2YUZA 1BAGA 4TQHA 2IFFL 3D0VB 4F80A 2XPYA 1RUKL 1FFTB 1RZ7H 2JXMA 1YEFH 2Z0UA 3I9PA 3P2DA 4HD5A 4N0FA 3UTZB 3QCTL 4G6AC 5AL8A 4C54A 2JCCF 1G1KA 1MFAH 3L45A 5DHEA 1OTTC 2B59B 3FQWA 2YN5A 3MBEB 5F8RC 3WIIL 4X7TB 1RULH 1MIMH 4XXDA 2BP0A 2L8AA 2WUBL 2QGDA 4TPRL 5AUMB 2C9QA 1U91A 3UO1H 4EF3A 1R0AH 1EMTL 3HS9A 4D0CB 3P4MB 2B4CH 3T0EB 5A2LH 3ILQD 1BREA 2ZUQC 3OZ9H 4XZUA 1SBSH 5B38G 2QL1A 2F53D 4YNYA 3IF1B 5F6HI 3WGUB 1BVZA 4IHOB 4G7YL 3T65B 4PJAA 5KVFE 1A3LH 4NRYB 1LEKB 3DHMA 4JB9L 5IVZA 4QWWC 1A7BA 1L6XA 2FEEL 4XOCA 1OGSA 3K3QA 4TL4A 5E8PA 4PMEA 3PGCA 3RWHB 3C5JA 1I9JL 4IJTA 3OBAA 4OBRA 1VFAA 4QRAA 5AZEH 2FH6A 1FZJA 5KS9B 1UM6H 3VXPB 4JFQA 3QG7H 5EOCH 1IU1A 3GSVB 3NVQA 1N70A 3P02A 2RD0A 1E0OB 1NFDA 3GHBH 4NQCD 2A3TA 4B7IA 5JPMB 1LP9F 5F7EH 3LN5B 4FQLL 1K2DB 1F3DJ 4HGMA 4PJGE 3PWPA 3WL9A 1E4XH 3MRLB 4ODSH 4U3SA 3BFQG 4NZRH 3K6FA 3IAGC 4RAVB 4WWID 2WINA 5DHDA 3ISYA 2UYLA 1HDMB 3QYMA 4CBZA 3B2VH 2WWKO 2DBLH 5DC2A 4OIBA 3H9HA 4OM1H 4FTVB 4WNJA 2QADD 4LLWB 1CQYA 1LO2H 2CGRL 4JG9A 5I1CH 4HK3J 4GIPD 4M43H 4A04A 1BMWA 2CK0L 2GJ6A 2PP9A 5CHNA 3UACA 2E9GA 12E8L 2ROXA 2A1WH 1EO8L 2X4NA 1CF1A 4DN3H 2GJZB 4FFTA 1WZLA 3WS6A 2PW2A 4UB0L 1KGXA 2OMWA 2GJ6E 1CN4A 1OVZA 4ZQKA 3S7GA 3SGJC 1INQA 3H9SD 3KPLA 4OZ4A 2FQFA 3MLTB 4M48L 3EO9L 2XQBH 2PXYC 4XCFH 3DOHA 2J8UF 3ETBJ 1EVUA 3DV6A 4PBDA 4CC1A 4GRLB 2QPDB 2HXAA 2GQHA 4AY0A 3IMBA 2O6DA 3DOIA 1JNHA 4JRFA 2VERN 1R3JB 3WJMA 4JHBA 4UZGA 5B38A 1FNFA 4XP6L 4YAQA 2UZYA 4UYPA 2Z92A 1JOIA 1EHXA 2NXZD 4FNTA 1GH7A 4PSRA 3TNNB 4M6MH 3B9KB 3UG5A 1YPZF 2QZ5A 4PIBA 4KVCL 1QFWM 2L04A 3CN0A 3K8MA 4YXLH 1IAKA 5IR1B 3ZKMD 5T5FH 4OFVA 2DN7A 4CSZA 3WU1A 2NY7H 3BISA 3B6SB 2H6UA 1PX3A 2ITDB 1TQVA 5AOLA 1MUJB 4UMGA 1HJBC 4FKEA 2CDEA 3CCHB 1JGEA 4P23C 1O75A 5LN4A 4YHZL 2RCSH 3BPNC 3FHQA 4JFEB 5T1DH 1X5GA 1KTKE 2FLRT 3L7FB 2WXMA 1U8KB 1XTLA 1ZK5A 2V7NA 3IDXH 3IXAB 4KMTL 4OD1H 4OF7A 1B9ZA 4TVUA 2D7TH 1J8SA 4NKMB 1OW0A 3M6DA 5T1KD 2F2HA 4NQSA 2EEXA 4XN9A 4JPWH 3C6SA 4Z7OE 4NP4H 4TUJB 4TVPL 1YMHA 2X87A 2YXWA 2EYTA 3D5OF 3HI6L 5HPMB 1ODAA 1YUKB 4YWGL 3WXVL 3MKKA 4HKXA 5IG7B 3GJFK 1ZJAA 5C0FA 1UT2A 1F90L 2WQUA 4I3RL 3IU4L 4QOKA 4PVMA 2Y7SA 3L6FB 4AVKA 1YN6A 4DKDC 4DQOL 4PV9A 5F8QC 4J8RB 5AOZA 2C9XA 5C2UB 3TO4C 4P2OB 1I8LA 2OP4H 4N2NA 25C8H 4UM9D 4MXVF 1SYSA 3WFHB 3V5KA 2KDYA 3N0AA 4L1SA 1HH6B 2Z91B 1CGSL 1CDBA 4MBOA 1H19A 4FKHA 3ARSA 1JPSH 5AAMC 8CGTA 1J8HD 3U0TA 4AW4A 1O6TA 5T33H 32C2A 4HV8A 2C9AA 4YEEA 3D3VE 3W2DH 1FE8L 1F8TH 3MCKA 3VU1A 3EH2A 2VLJE 4RISL 1IEHA 3FH8A 5J89A 1GPOL 2HPTA 4PRHA 1F0LA 2HUEA 2WW8A 1MNUL 4LSRL 3W9DB 3EJTA 4QGTA 5E6IB 4U0RB 2COQA 3CSPA 1YYMH 3IXTB 5F72S 3VQ1C 1C9SA 2XSKA 2DQEH 3VRIA 1U3HB 5BV7H 1SJEA 2PCYA 3HHSA 1H6FA 4P3WA 4XVSL 3W9EA 3ESOA 3FU5A 4C4KT 4ZMWA 3IWUA 4LCWE 2BVYA 2YK1H 4XPHL 4B9YA 4H0HB 2WTRA 1MCDA 1I7RB 2W0FB 4PRIA 4G70B 3OKKA 1Q9KB 5IW6A 1AGEB 43C9A 4XCYB 4JREB 1N10A 5C70A 1CDIA 4IRSD 3FSVA 4HJ0D 5I8OH 1UXLA 4JCMA 1NBZB 4MCZA 5HHOE 4ZW7A 2AK4A 2KKQA 2NUTA 4HPHA 4KKLC 4XNZC 5FYJL 1CFNB 1FGVL 3FSZA 3OQRA 1GGUA 4HUKB 4NQEA 4XPTH 4XMVA 4NGHL 2ZUWA 2XTSA 5C09E 1GJWA 4L1BA 3DOSB 3UZQA 1JYVA 2VW6A 4KUCD 2IF7A 4KPHH 4KJYB 4HIJA 3V9CA 1SHMA 1Z32X 3NQKA 2HPOA 4BWWA 1SM3H 2B1HL 2WLJA 3MRDA 3PGDA 3CH8A 4HJJL 3MV9B 4K73A 2XXCB 5G5DB 4YOKA 3JWDL 1KT2B 5M95B 3KVDD 2XIBA 1ZS2A 4NHCH 1MCKA 1R33A 3L9RB 1U8CA 5INCA 2JCCA 4HCRH 4Q9RL 1FO0B 4BFNA 5F9JB 4U49A 1KUMA 3P9WB 3C60A 3LPFA 2DLGA 1T6VN 4AIOA 2VR9A 4NN7C 3ZO0A 1C08A 3I6SA 1OD7A 1PJWA 1H6TA 2E76C 4R97B 2W9LA 4HT1L 1PNCA 3P4OA 4Y9BA 2XN9D 3BUDA 4JKPL 1FVCA 1KTJA 3NN8A 4F92B 3HI1B 1BWWA 1S7UB 3QI9D 1D6EA 2Y7MA 3H42H 1SNRA 5F7WC 2X9WA 1KJ2B 2VL5A 4U1IB 4PJ5D 1PD6A 3CUPB 1JPTL 3NIDE 4BZ1A 2VLLA 3NTCL 4K0OA 2ZKHH 5HYQB 1IQWL 4WTZG 5DA4A 3IS0X 4DQAA 2DWEA 3QFJB 4AQ8A 3IGLA 1MY7A 1J5OH 1TZ8A 3O6LL 4JQIH 5C0EA 5C08B 2QSVA 4ONHB 1W8NA 3QUYA 2C9RA 4A7VA 1S3RA 2X4SA 4WGKA 3MR9A 4HUUA 1LP9A 5SWZB 4YGVB 2EUWA 5DUBB 5I15L 3JVGA 3G6JB 3QUZB 1BVNP 4P48A 4FQXD 1VCAA 3FONA 5KYUA 4HXAH 2Y36H 1N2RA 1PIFA 2X4TA 1KXTA 4LCCA 2F5BL 1UD2A 5D4JA 1QA9A 4KKAD 4YIQA 4XNXH 3F7VB 3MX0A 4PJEE 4XVJH 4G9FB 3MMEA 1CD1A 4AV0A 1ASOA 2J6WA 5DT1H 3GPSA 1P7QD 1BHGA 2E0PA 3QJZA 5FEBA 1BXAA 3FQYA 2EE0A 3NT0A 2OSLA 1AS6A 2GITA 2NZ9C 3QCUH 4FF9A 4P9HH 3FQ2A 5KSBF 2NY4C 5CKGA 3U6XS 2Z31B 2NYZA 2Y07L 4WHCA 1PSKH 3B2UD 1S7SB 3V52L 4C47A 3HS8A 5GS2D 1XCTB 4I1PA 1MXGA 5D8JH 5EU5B 4FCAA 3K0YA 1A6UH 2J8UA 4JW3A 2AQTA 4MB4A 4PGBB 1W91A 3O3UN 4QXTA 4ZDHA 5E0FA 1AQKH 3T8MA 3BFWA 3FQNA 3C08L 1LE5B 2QQNL 1H3VA 3HG1E 3MBXH 1JCVA 4QAWA 4NENB 5DD6B 2G2PA 1QHOA 2DIBA 3DHPA 3EF7A 1KBVA 2O4EA 5FWRA 3CHSA 3ILDA 4AMXA 1SVBA 3T8VA 1ACCA 4RNRA 3HJEA 5J06A 1W8EA 2ESVD 3GEFA 4K8RH 1S5HB 4PR5A 4FULA 2ADIA 1YPZA 1D2PA 3OAZH 5BNXD 4X4YB 2BNQB 1R24A 2ZD0A 1UWGH 1I9IH 4WTZA 4ZMNA 1HHGA 2I26N 4RAHA 2V2TB 1MELA 4KX8A 2EXWC 3O9WD 4O5LL 4R2GC 3G5ZA 4XCEA 5HHPB 2VR8A 4IU2B 3TBYA 3L08A 5GJSL 4QEGA 3ENEA 3EZJB 1GGTA 1UXWA 1TIUA 5B22A 2LAAA 4BUQA 3WO3B 3PWJA 5IW1A 1IM9B 5IFAL 4Z23A 1PQZA 4WO4A 1ZA3B 4OKVB 2KI6A 5AKTA 1OAJA 1KLUA 4J3OG 4W68A 3WN6A 5BVPH 5EIIG 4E9QA 3EAKA 1CDYA 4GSXA 1SJVA 3MRMA 4NDMB 1U8HB 4XNQA 5DJYB 1W6LA 4TRPH 3U7WL 1D2OA 1DVSA 3RKDC 5IB2B 2R1WA 5GZOC 2R9HC 4AGLA 2NDGA 1MSPA 3MV7E 2WV3A 4OUOA 3GGWA 3FUDA 3LS5H 5LAPA 5SX5H 4DKFH 2H1XA 2AXFB 1AYRA 3DBXB 2JB5H 4IQHA 5JW4R 5JW4N 4RFNB 2YD6A 1XF4B 4H1LG 4L9LB 2BSSB 2JJTA 3AWEA 1DN0B 3E2HC 3MAWA 2ZAIA 4FFZA 1GJUA 1HVXA 3TCLA 3VXMA 3JV6B 1WA2X 1ZLDA 1B6DA 1FQ9C 3RTQD 5C0CA 3AGWA 2CRMA 3C9NB 3L7EA 1BYOA 2E5EA 3ZN6A 3JV4B 1GGBL 4WW2B 3IBOA 4YMPA 2EIZA 2VC2L 5DURB 4I77H 1YEIL 3BDXA 2NDFA 1G0DA 3MV11 3GUTB 1T4KA 1IC7L 4ZMTA 1TKWA 1AD9A 3ILPA 1FLRL 5ESAB 4L05A 1KBWA 1II4E 4ZFFB 3M8OH 3MODH 2D7OA 4JGNA 3IFOA 3A67L 4XX1G 3RY4A 3WD5L 4K94L 4LRIC 4Y16A 3JWOC 5D93B 3VNYA 5JNYB 3SODB 2Z35A 4GKOA 5DYOA 3INUL 3KXFB 2DQFA 3JYCA 4L3AA 1YEGH 4QRFA 4ZPTA 1AZZC 1VRSA 3BT2H 4EDWL 5CN3A 1BVKA 3D39A 1UB6B 3HZKA 2XWCA 1EZSA 3LN4B 4JHUA 4KZ0A 2C8NA 1XGRA 3U4EB 3OD3A 2EIBA 4ZQTA 2X2JA 3T0XA 2BIHA 2J7LA 5HHNB 1FL5A 3GS4A 5TF1H 5CD3B 1BMGA 4BKLA 2CCLA 4OGXL 1EHLL 4X6BA 1IT9L 5T1LB 3HBZA 5D4HA 2DD8H 5EIIA 2J88L 4W93A 1PCSA 5BV7B 4KKCC 2IH9A 1ILSA 3KLAA 1NCOA 4LRNH 2QLYA 2HFEB 4NO2A 1XXDC 2XZQH 3BAWA 2BOBA 5DZNA 1MJ7H 3GBNL 3UZEC 2H6PB 1FL3B 1SQMA 2IWKA 4JVUA 4MMXB 2C3VB 1BM7A 1I8KB 4FZ8L 4ELDA 2W91A 4Z7WF 1UXSB 3D09A 3S88L 1KB9K 3UZVA 2ENJA 4GBXB 4OFIA 3WFCH 1IFHL 1T7ZA 4TSCL 4N24A 2VSCA 3TA3D 3L2MA 1TYRA 3GXTA 1KXVA 2Z8WC 4H1LA 4I0CC 4OUUA 5IROD 4GB9A 4NAMA 2FH8A 4I8DA 4WWKD 5AVXB 2WQ8A 4O2EB 2FHCA 1O9VA 1JD9A 1PEZA 1L3NA 4E9LA 4ZMXA 3N55A 3QRFM 1NINA 1K5WA 1P69B 2IFFH 1HC1A 4PGZA 4WUKL 3FOLB 4BCXA 2PPDA 4I0PD 4EE2A 3EJYC 5DEFB 2XQYG 1DR9A 1SGKA 4WU7A 5IHHA 1MRCL 2FECL 3HEIB 1G9MC 1LYQA 5C0AA 4Q2ZA 5HJDA 3TFKC 1DE4A 1TG8A 5DJ2A 3LD8C 4UQ9A 3VYPA 2ODIA 3DRTA 3I3BA 1Q94B 1BQHG 2VDKB 2VMDA 3DHJA 4S2SA 4XNUH 2OKMA 3ARXA 4P4KA 5E00B 1E2VA 1YEDA 3MJ9L 1BIHA 4L4VD 5IW3A 5FKPB 3RX8A 3L4WA 3UC0L 5BPPA 3NG5A 5BRQA 3U36B 1N68A 4JPIA 2DKSA 3BH8B 3J27A 1MH5B 3T3PF 5HGBB 3MRQB 4LARL 4N2MA 4HWBA 4GAYB 1QLEB 2FWOB 3SKOA 4ES9A 3JV0A 5HVGB 1D5BA 1WZAA 4YLCA 3D3VD 3N6YA 3ZGHA 1YEJL 3GLDA 5DWUL 2VLJD 5DLML 1MFBH 2UVEA 3FRUB 4I1NB 3TJEL 3VMNA 5DRZA 3VQLA 1HSAB 4U4BA 3CPUA 2VN7A 1P5UA 5CJ5A 2XTJB 3S8GB 5JLZA 4ZTOL 5LJYH 4MD4B 5DQ9A 1EHNA 4C56E 2PTTB 4WEBH 4BFBD 5JHDB 1EQWA 3T4YA 5KSAD 5FOJA 4WHYH 4FQLH 4K5LA 4Z7UF 4ZUTB 4OVVA 5BRPA 1N0LB 2BP8A 3OAWA 5TQ0H 4LCWD 4CGUB 3SQBA 2OLDA 5CUSL 5I1KH 3VI3F 3V0HA 3DPBA 2X4OA 1DDTA 3FT4A 3RVUC 5KSBA 4DO6A 1LL1A 5C2BL 3GMQB 4FG6C 1MF2L 1QPKA 2OYPA 1WO2A 2J8OA 3A4FA 3FPXA 2BIOA 3U1SL 5JQIB 3TZVA 4N6RB 2ID5A 4D9LH 1NDGB 3MRBA 3HVNA 2OULB 5HHOD 3RU8L 4LVHB 4ZUWB 2CGRH 1OGAA 5EA0H 3CDGA 4FFVC 4HMCA 4PUBH 1R9FA 3S35L 1AZCA 1HZHL 3VG0L 2F8IA 5C09D 3K46A 2Y3NA 3F5WA 3T2NL 2XQYA 2F15A 5HP5A 4LLVA 4F9LA 3RVTD 4AQ1B 4DGVL 2FO8A 5KVEL 2ZUQB 2QV4A 3MC0A 3C2AH 5D1XA 3CDZA 3B1TA 3ULAB 3V0VB 4XODA 3PE9A 2XVLA 3EO9H 4PWJA 2N01B 1HWWA 1RZIB 3QC6X 1RJZB 3S3BB 5KAQF 3QHFL 4UV4H 1BQHA 2AEQL 4WI8A 5DRWA 4EZLA 2YLHA 4Z18A 4MKMA 5HVWA 2DPKA 1CLZH 1BAFH 3F58L 3MDJA 2P42B 3IRCA 2YQGA 2DM7A 5FLUA 1RMFH 4HQQL 2A7BA 3C2SA 4DGWC 3VB8A 5IJKC 1CXLA 4QHMB 5EPMA 4I18C 3V0FA 4XP6H 3VFWB 3MKGA 4JFUA 2RJMA 3QDGB 4WLCA 3RZCA 5PAZA 5GS0H 3MACH 3RG1C 1G7QB 4GUQA 3IDJA 3SGDI 3QG6A 2NR6C 4MJ4A 3ZZLA 2X88A 1FZMB 2XWBA 4PY8J 5J6SA 2JKXA 4M1DL 4Z0BH 1LO3L 2ZWNA 3K2UL 3WXWH 5G2NA 3ETSA 4MMZA 5I74C 4A2MA 2JKTM 5FCSH 1QLFA 1L4IA 3KPSE 4NZJA 1GS6X 1TQCC 3F2LA 5EZOL 4Z77A 2G5RA 4H20H 2IDFA 1OAQH 4LQFL 2VXUL 1EJFA 3CLFL 4BSJA 5FHAL 5CXPA 4JFFA 3EDKA 5D7LD 5HGAA 3EYFA 3SZKC 1T21A 2JELH 4K94C 3D8MA 1A2YB 1U21A 2EDRA 4JZNB 1YO4A 3VWJB 3LPOA 3X1EA 2GUYA 4MAZA 5FECA 1KDIA 2BY1A 4KMTH 4TQIA 2QR0B 4CNIA 1B4LA 4XWOD 3MREB 1IQDB 4Y19A 3TT1L 2VO5A 1AO7B 3OR6A 1V3MA 1I8IB 1WBZA 3HAEH 2A4ZA 4GUPB 4LSUH 4YBQC 1DBAL 2NY0D 1U8JB 4QO1B 3NJMA 4KU1A 5DO2C 5EORH 5FXCH 1MRFL 1YEHH 3ZT6A 4G7RB 1BQKA 3TT3H 3TIDA 3D4CA 3WXVH 1N4XL 3H6AA 3IK2A 5HDBE 4LEBA 2R4SH 1WAAF 4I3RH 2V9QA 3IU4H 4LSVL 5AZ2H 4Z1PA 1RJLA 5KW9H 2QMKA 3FCGA 2XG5B 1WIOA 1G0YR 2HG5A 2A9MH 1LEGA 4MJ2A 4ANXA 2TSAA 4NYLA 5GS1C 5DS8A 4C4KO 5AD0A 3HZYA 2HX9A 1MWAH 2YBGA 4QGYA 3LDBC 4WI0A 3MNZB 4HUVB 4WQOA 5DVKA 3QIUA 4ZW8A 1D9KB 1ZK9A 3RVVC 1CGSH 3IDIB 3D2UB 5J57B 3PNWB 4DETA 1TTGA 3QZWG 1AY1L 1TVHA 3UCRA 2XWEA 4KITB 2EVIA 4KKRA 3ZDXB 1CL7H 2F58H 4PJ6A 2Q5BA 1E4KC 1MJJA 2DQTL 3V4PL 1LDSA 3UDWA 1FE8H 5EZIL 3A4EA 4H0IA 4HJSA 5PCYA 4Z7VF 4AL8L 4KUCF 1I3RB 3VXRD 5HYJE 4WDIA 3D33A 5D7JC 1BEYL 3BPNB 2PP8A 4Y4FC 3FSAA 4IS6B 5D55A 4CGTA 2D2OA 1YHPA 1MPAL 4J3BA 1CBVH 4A2EA 4AIZB 4BH7B 2J6EL 1ZGLM 2YHGA 3ZR5A 4C4UA 3Q0HA 2ZOUA 1I1AA 5J9PB 4JRYA 1S7TB 1PAZA 5GRUH 3ULVE 1RZFH 3EFDH 5J0BA 2F19L 2PO6B 2WLLB 3VFRA 1WJ3A 1U8NB 4G6FB 1VFBB 1CFVL 1M7XA 1YA5A 4N85A 5D7IE 2JK5A 5FYJH 1NAMB 2F53A 1JGLL 3B7YA 3UGEA 2IBGA 1OOWA 4C83B 2K3TA 3CVDA 3FK3A 4MB1A 3C5SA 1AMXA 3TVMB 2V7HA 3SD2A 3AW5A 3DMMC 1MJ8L 4FHBD 2Z1KA 3JTSA 4XNYL 3CSYB 3REWA 2P5EE 3A6CH 1U8IB 1XWVA 4HIHA 4HJJH 3KL0A 1SHWA 3N91A 2KZKA 3QIWB 4I3SH 3PABA 4BFIB 3EHBD 3I85A 3JWDH 5E24E 4N2FA 3VA6A 2GG1A 1AG0A 2CH8A 4JDEA 2V9RA 5FO7B 3BVNB 3MV7D 5DQJB 4MJ5B 2DYPD 4Y1AE 4HDIA 5HY9B 4NZ8A 4H8HA 1T0NA 1UZ8A 3OKDA 1EJOH 5TPWH 3MRGB 4NQCA 1DHKA 5KAQG 1WWAX 4R0LB 1RI8A 5L6YL 3QZWA 1ED3B 5DWPA 1Y07A 5C07E 5IQ7H 3SYOA 1OT1A 1G43A 4QRSB 1MW3A 1NL0H 4JKPH 1OSPL 1ORQB 1X5AA 1CTNA 4OCSL 3C5ZD 4V2BA 1IAIM 5D2LE 3UTTE 3VDBA 5F89B 3UYPA 1N7MH 3FFDB 5E1QA 5GRWA 3KJ4C 3V6FA 1Q0YL 1QSEA 1T80A 2J71A 3ZVVA 2X10A 5F7MC 2ODHA 3TBSB 3S3JA 5I76A 5IVOA 4TNEA 2YA1A 1PZ5B 3NAAL 3D6GA 4K7PL 3SEPA 4DUWA 3DJRA 4E9TA 1DCLA 2F1BA 4GP8B 2EINB 2VIRB 2YARA 3SJVA 1QG3A 1K3ZA 3ME0A 2VN5A 3HKFA 3ARDD 2Z65C 2X70B 3X1NA 2IALB 2J5WA 1SY6L 1J8RA 3SDAB 3CHPA 3HFML 3H9SA 3EYSL 4XNZB 3SQOL 3NRQA 1MCSA 3ZT5A 1JGUL 2ITCB 4JM4L 4S1SL 5BW7A 2AZUA 3BI9X 3JWNE 5ABDE 1I1CA 5I15H 3SCMB 3Q01A 4RSYA 2FYYA 3DKHA 3EH3B 5F9OH 2Z0BA 2YEQA 5F88A 3VI3A 2WSPA 4ZRGA 2F5BH 4AYGA 2I24N 2UWEF 3MV01 3IDGA 3O6ML 4HU2A 3K6DA 3FUKA 4FN0A 4NNPL 3G08A 3L3HA 4Z7QB 1NGWA 1J5CA 1OK0A 4MASA 1XO8A 1KBBA 2GC7C 5C0ND 2HRLA 1DLFL 4GS7C 4EI5B 3BWZA 2YQBA 3H56A 5C97A 1NAKH 4F8QA 1KNOB 4XCCH 4AT6B 4QYAA 1M2VB 1QLRA 3ZE1B 1M56B 4Y9CA 1P2CB 1I8AA 1FUNA 3CDFA 3CFKB 3VGEA 2OMXB 3OXRB 4UTBH 4QXGL 1V7MH 3DVGA 3CSGA 4P2AA 3GSRA 2OYMA 4P5TA 2YPLE 1FAIL 4LOUC 1PTZA 4PJBB 3OL2A 1FZKB 2C7FA 3AROA 2F54B 4J2XA 2O5ZH 1AS7A 1F11A 1GZPB 3UP1A 3LJ3A 1YEEH 1I4FA 3EYUL 2IBBA 3O41A 2FIKA 4HEMA 3BZFB 4HGWA 4HX1B 1KB9J 1H5BA 4YDZA 3KNBA 3PCYA 4NWTL 1GHFL 3KYKH 1XH1A 2GIMA 1A0QH 4UT6H 5HI3C 1RZPA 5D2NB 1YUHB 3KEDA 1UM4L 5ESQB 3PYCA 3C6LC 4ZYKA 4F1ZA 4ZODA 1QO3B 1Z0MA 2K70A 4XRCB 1JGVL 2A6DB 4YAQB 3SDXB 2V2XB 2WQRA 1J7VR 1W72A 4WTQA 4DK3A 3M17A 4LQ1A 5DVMA 3PRZA 4IEFB 1IGCH 4NBZB 1MQKL 3BZ4A 3CPLB 3DIFB 1JHTB 4CMHB 3DSFL 3SKNB 1UWEL 2CDFA 1U3NA 4UM9A 4YSSA 2VLRE 5B7FA 1J0KA 3CHXA 3ARBD 3VE0B 4Y1SA 3EIFA 1KCVH 5EC1A 4R7LA 1OCWH 3QDME 2AEOA 1S7WA 1IBZA 4KKPA 1WPCA 4GRWH 4BJLA 4X7EC 1T1WB 4LSDA 3ARUA 3O6FD 5E2JA 1XSOA 3GJFA 3HR5A 1IZKA 2OZ4H 1ORSA 3ZE0E 4HF5L 4MDRA 3U7WH 3ZYOA 2CPCA 5C0BE 1OLLA 3R18A 5MEOA 4X6EB 4AM0Q 4HPOL 3UX9B 1RZ8B 4HJEA 4HWUA 3ARGB 3PJSA 4YSDA 4HXBH 4ZK8A 1MI5A 5A3ID 4NQXA 3O8XD 2NSMA 3O3AA 3QNZA 4W9HC 4C56D 1FN4A 1WAAA 5ID1B 3HAEB 3FU6A 4IGBB 2FNBA 4QYOA 5FYLL 1D7FA 5IQMA 2FJUB 3IGKA 2GK2A 3N44F 2YXMA 4RGMC 3WEAA 3MJWA 3UBGA 1MI5E 3NDYE 3VXNA 4ZXBC 1EFXB 3SGKA 3TWYA 5GIRA 3QJHA 2Y6SC 5EWIL 3MLUH 35C8L 4AEIL 1CWVA 2ATKB 3JYBA 1O5DT 4FQJL 1BZDA 3SYCA 3OWEA 2FD6H 5LGYA 1GZQB 3MHZA 4O4YL 3RVXC 3GO1H 4PGDA 4KK8C 2BDNH 2HVKB 4MNHA 4MQ7A 4QRRA 2Y5QA 2VC2H 4X5XA 3DYPA 5IFJA 2QSQA 6PCYA 2DWYA 1TPXC 1IGML 5FDWA 2Y2YA 1IC7H 2I60L 3FN9A 3I75A 3TH3T 2A4CA 1MWAB 2Q3XA 4EIUA 1PZCA 2FQGA 3QDJB 4NC1C 3QEQA 4Z7VA 1PU0A 4R2GB 5LAXB 2KYIA 2ZUTA 3A67H 3T8XB 3RWCB 1CUOA 1H3PL 2CU9A 1X6LA 2IXQA 5ICYA 4R9HA 1E43A 4GXUM 1IEAB 4B53A 1OHZA 3QEQE 1A7NL 1IGIL 1U92A 3NFPB 5F6IB 2WO2B 1CFBA 2G5UA 4BXSV 3HNTH 4FZEH 5GSRA 4IRZH 4M5ZL 2UV3A 2OSXA 3AITA 4HUMB 4M7ZC 1RERA 4XP1L 1FFQA 4XT1C 1IT9H 3BAXA 1GJIA 4BK5A 5CWSB 4L1HA 1VACA 2KS0A 4MJIB 1NOLA 5JPNC 1X5IA 1IGTA 3AREC 2BJMH 1U2HA 3QWQB 1FLTX 4RRPM 1AFVL 4A55A 5JXEA 3K7UA 4K23L 3ROLA 5B8CC 1X9LA 2FZ3B 5I5JA 3CC5B 1FJ1A 5IOPB 4FYTA 1E90A 2Z3FA 2OXGA 4HOMA 3O3BA 4PAZA 4PJ5A 2JF1A 2YD1A 1HQ4B 2Q8BL 2RQEA 4PJDB 4Q6IC 2R23B 4XPFL 1VKXB 1A4BA 5TJWK 5DQDL 4DIXA 3FZUC 1C16A 5ANMA 3EJSA 2BY2A 1G9NC 1CU4H 3QUMH 3KWXA 4E2OA 5KSUB 1BIIB 1A6WH 1OAUH 4G8GA 3CFUA 4B9CA 2A5UA 2BHFA 2E7BA 4AC2A 9PCYA 5DC4B 3GLEA 1QATA 4ISVB 3LRHA 4WUKH 1DUYA 2J1XA 4PLJC 3S3DB 1XB3A 2GIXA 4G8GE 3DO7A 1HKLL 3FRPG 4BUGA 5I17A 1MCWW 3DIDA 1QI5A 4NXSA 3V4VH 3TURA 3SDDA 1QNIA 4FFWD 3ZE2E 1TZIB 4FRWA 3NIGB 5D5ME 4K2UL 3VRLF 5FDYA 3VFNB 3QFDA 2WUCH 5BMFH 4FX5A 3QJFB 4BKTC 1JZHA 2LLNA 3MJ9H 1D7BA 2NQCA 4G5ZH 1S46A 2B5IB 2KZWA 4KVNL 4QRPE 1QBMH 2CJUL 3HG0A 4H4NA 4BM7A 1MCLA 1QW8A 2P46B 1OWWA 4AQAB 4YHYB 2CO6A 3M7OA 1KC5H 3O4OC 4MAYB 2JJUA 1HCVA 2ZOKA 2EEDA 1H8NA 2AAVA 2ZWLT 4GSRA 5IVXB 1WC7A 3KH3A 4PTUA 2HT2C 2PNDA 2WXPA 1M6OB 1K8DA 4X98A 1ZS8B 4JO5A 5DC0A 4DZ8A 3I2CH 4A6YL 5JOPE 1LWHA 1UWYA 3TJEH 3Q5YA 2EDYA 4YL9A 4V11A 3SGEI 5ISZD 2IMMA 3IJYA 4PSPA 1L7TL 4YL4A 3RP1A 3UTQB 4GLRI 4KXCA 2JIXB 4PJCB 4GG6F 2UWEA 2AP2A 4YGAB 4ZTOH 5T3XE 4HSCX 3VFUA 1S9YB 3EOAB 3NCJL 5F7BA 3JV5A 2IAMD 2RGSA 2H26B 4OZFG 1KFAH 4PRPA 3QXAA 5E8EA 2ESVA 1W16A 3DTXB 4FXKC 1RZKL 3P77A 1RV6X 1UJ3A 1QEWA 1KB5L 3LOWA 4KI5D 3SPGA 1R3KB 3SOTA 5BRZB 1OARL 3QORA 5DJ6B 2X6CA 1MF2H 1FBIH 2JB6A 4PRPE 3HI5L 3ULVD 1R4XA 3P4LA 2HVBA 1L0YA 2JKNA 5DMIL 3RU8H 1S9WB 1CXHA 2IGFL 2R69A 4MLSA 5KVMC 2HMID 1L5GB 3S35H 3QWNA 3WLBA 2BIMA 5ADOH 3TN0A 2NX5D 4FFYH 3VRJB 5ESVA 3FRPA 2GEEA 1JGDB 3QIBB 5AOIA 2Y06L 5KVEH 4DGVH 4ZW6A 4DK6A 3QBTB 5AW6B 3AABA 1TCRB 3BWUC 4OGZA 1UG9A 3LKOB 2P5ED 3VGAC 2E7LA 3PHOB 4J8QA 5K39A 3ARYA 2K6WA 1CT8A 4XN4A 2AEQH 2K4AA 4A1RA 4NKIL 3F58H 4FS0A 4YO0B 1NCWL 1CFTB 1JFQH 2XBTA 4P2RE 4YHMH 4PRBA 3WS6C 4BZ1L 4OFYD 2ZWYA 4Y1AD 5A16A 2XZCL 3MA7A 1B0GA 2A0LC 4H25B 4HH8A 4LP8A 1E8XA 4XC3L 2XFXA 5FUOL 1E6JL 3MLXH 4OZIF 4CW1A 3RDTD 1OT2A 3QXWA 3DURB 3GSNA 1ZT7B 3BUPA 3CFCL 3QO0B 4NB7A 5GGVH 2VM4A 1XBDA 5F96L 3UTTD 3U6RA 5KBPA 5DVPA 2J56A 5I6PA 3PPSA 1R5IB 4M1DH 3D06A 3RTQA 3AQDA 2D9QB 3KJ6L 2E59A 1PF3A 4BQBA 3NSFA 4B7LA 5CKAA 1GMIA 1YQVH 3HC2A 4XN2A 3E6FA 3KL5A 1QBLH 4JFHD 1TQTA 5KN5A 3LVEA 2VXUH 3GMRA 1C5BL 2DLFL 5ERWA 3BP4A 5FHAH 2E7MA 4LLMB 5CFHA 5CZXC 5GS3A 5DJDB 1X9RA 1CYGA 4OZFA 4DOHB 2AGJL 1CFQA 5IKCB 5E6YA 1F2QA 1YEKL 2XPGA 1LMIA 4UT9H 3QUXA 3WIAA 5I2IB 4G5AA 3ILEA 5KWYC 5ALBH 3IVKB 4GRWB 4XVUC 2VXVL 3F6LA 2YRPA 1UFUA 4JHWH 5D1QA 3T0EE 1AC6A 2IQ9L 1D5MA 4PWHA 4QXUH 1QR1A 1AXSB 1EH9A 3BMVA 4OZGB 2Q76A 5HI5D 3W11C 1PFCA 3RB5A 3LKPA 4AKPA 1I75A 4N3UA 1AR1D 1BF2A 1Q38A 1HE7A 2YPKB 3E6HB 4AYFB 4K71C 5BJTA 2CXKA 2X4RB 3DJZA 5E8DL 3L95B 1XMEB 2GT9A 4Y2DA 4LFHD 3SE4A 3FFOA 3LHPH 4NN5C 1RIUH 4RGNB 5TDPA 1H8LA 4FYSA 1G7JA 3PPEA 5DS1A 2XU9A 3DX8B 3NSCA 3P73A 4WUUD 4BQ8A 2I25N 3GUFA 2V17H 1NCAL 5KS9E 2VMFA 3MNWA 2NY6C 2AEPH 1BFOB 3MGTA 2IC2A 2IH3A 1A7QL 4GY4A 2CUHA 2VC2B 1DSFL 2G75A 1KLFA 3OB8A 1I8LC 2YPLD 3TP4A 5I0VA 2G2RB 3HUJB 4ZMLA 3F04A 2BVOA 3KL3A 5IROA 4UQ3B 2APVA 3PL6C 3K71B 3EO0B 2HT3C 3ARFA 4HIIB 4KFMA 5EU7C 3WV0A 1PFOA 3ULUD 4PJ9D 1T4WA 3W0WB 3PG2A 2CUIA 2IVFC 3CU7A 3L5XL 5GHWL 4ZSOB 3FN0L 4I0PA 1UA7A 1YJDL 1SXZA 1QNZH 5A7BA 2HYMA 4AI7A 2H3XC 2ZTBA 2TAAA 1JAEA 2PYEB 4NQDB 4X7FC 3D18B 2ZXQA 4JO4H 1HHKA 2BW5A 1ADQH 5JTWA 3V4LA 3VDAA 5AOJA 1BPLB 4N2CA 3ZDZB 3KGTA 2W59A 2XXGA 3LIZH 3CFDA 4JFDB 4L4VA 2BP5M 3MFFA 4M6OL 2VLRD 2ZP0T 3JUYA 3MUHL 2O5XH 5AVZB 3SYQA 3RUGF 2D2CC 2IH8A 2J73A 4MX7A 3QDMD 1LO5A 4FFZL 5FFOA 3BEWB 1QVOA 3I6GA 3PXHA 3HRZA 4BDVA 2H2PC 3HBQA 3MCLH 3EH4B 4BSWA 3LDBB 2VGLM 4OIIL 1E5CA 3QJQB 2HFFB 5CILL 3QH3A 4P46D 1KJ3H 5C0BD 5K9JL 3PUCA 4L4TE 2C1PB 3LXBA 1ACYH 4QT5A 4U6TA 3IDMB 5E2TL 3OMNB 2H9GA 3RWDB 2W95A 3FB8A 3QXUA 4GIOA 1FNGA 2WZ0A 4KRLB 3TBCA 3VDCA 3D2TA 5IV2B 5EOTB 3N42F 2WSDA 4FABL 1I9RL 5J1TC 3RGVB 1HOCB 4QRTA 4YLQT 2HJLA 4R7NB 1HXYB 3OAUL 4MJ6A 2X40A 3GZPA 4OCSH 1R5WA 4HKBA 3X3FH 1OGTB 4KJQD 3TL5A 4O9HL 5HVFB 1YECH 1Z3RA 4XPAH 4XTRC 3C60C 1T66C 3FBKA 3OKEA 2A4EA 2X0VA 4WU5A 5TE7H 3VW3L 4FQHB 3BAEL 2I9LB 2B9BA 1ZVSB 4MS8C 4PJ7B 1NZRA 4K7PH 2R56L 5HI4D 2ZJSH 1WFUA 3DX9A 4RMWA 3VFTB 5I1LB 3I84A 5KYXB 3N1GC 1A3RL 3ECQA 4W6XB 3VO0A 2VMJA 3BVUA 3A22A 1Q1JH 2WTPA 5JDSA 3QA3A 4GG6A 1U8LA 3SN6N 1GGIH 3EYSH 5H37G 3SHSA 3VJ6A 4S1SH 2NCEA 1LQBC 4Y4KA 1AZUA 1NGYB 4WSKA 4Z3HA 4R3SA 3BWSA 2EYSA 5MERB 3OGCB 5DFTA 4CRPA 3A4DA 4AQ8C 4MKTA 5FKAA 5FF6A 4XMLL 4LZKA 5DMGC 2QLVB 4QXWA 3QUYC 4F2MA 3GM8A 4ATTA 5AVYB 4CVZA 3HHMA 3O6MH 1OAYH 1TETH 1LK2A 3OKLB 5AVWB 5E6ZA 1XGQB 1YNTB 1MAJA 4HJ1A 2BIQA 1IVLA 1JTTA 1DLFH 2MSPA 4LVNC 4PJXB 2P5WA 4LCCC 1UZ6F 2JQZA 3VD1A 4TMPA 2B0SL 2XY1A 4KXAA 4P4RB 3U25A 5IMOB 3WFEL 1K4CB 2OK0L 1JXKA 3KLHD 3TJHD 1ZDSA 1EWHA 1J88A 3VG9C 3GK8L 3KBEA 4AQEB 3V5DB 3SPVA 4LCUB 3MXVL 4NBXB 5D7LA 4R90L 4NJ9L 1FAIH 3ESUF 1X4YA 5HDQL 2YD3A 5MEQA 3CLEL 5EUKB 1NGQL 4HUWB 3PGFH 5KVFH 3GMMB 5L88H 1VJSA 2NXYC 4EUPG 2PCPB 2VXSH 2Z64C 4WEMB 3VXUD 7PAZA 4IIQB 2Q20A 3RVWD 1BZQK 1G7MA 3RL1B 1GHFH 1NGPH 4MMYA 5D1ZI 2GBTA 4OZIA 1QUNB 1ZE3H 4HWBL 1PCXA 2X2YA 3HE6D 3IJSB 1D7CA 3FF8A 4BQ9A 4Z5RB 4HCFA 1UM4H 3FQTA 2Z7WA 4POZC 5IWLA 1ZSDB 1NBVL 4EXPX 5B3SB 3CFBA 4LGRB 3I02A 4IU3A 3D34A 1JGVH 1QYGL 1MVFA 1N19A 1UQSB 4FP8H 4DVRL 1G7IA 1HHJA 1PZBA 5SWSD 3GXNA 1NLBL 3WN5C 5I75C 1DQQA 2NSXA 5H37A 4QRPD 3FUMA 2JI2A 1QSZA 2Z7YA 1HXMB 1U36A 3E9TA 3ALWA 1BJ1J 1XVSA 2IWEA 5IK3A 2VR7A 4KV5F 4B0MB 1PZAA 2AKRA 2OQJB 5D7EA 4AUJA 3D30A 2VITB 1UJTA 5I0YA 1J0IA 1L9PA 5BQDA 3DGGA 3MRRA 1JWSA 5DS2A 4KJWC 4GS7B 4X7CC 3TV3L 2ZONA 3OKMB 1C7TA 4KRMB 3GBML 4UI2A 4HIQA 2G5BB 2XVKA 4DP2X 5JOEA 5JOPD 1YC8A 4PCSA 2RALA 3Q8EA 1WTLA 3BAIA 1U3ZA 2E75C 1GVIA 2P52A 4P2QE 4WO4C 2XLLA 4LO9A 4WIQA 2P8PB 5FW8A 3HKZA 3RIAK 4N20A 3VXRA 2QQKH 4ZMOA 5T3XD 2F1EA 4A2HA 1MHPH 4L2LA 2ZF9A 4L18A 1L7IH 3Q5OA 1SF3A 1D5ZB 1BD2E 3QQ3A 4C55A 4L5FE 1NWOA 4QTIH 4OFPA 3DI3B 3FTGA 4OV5B 4MAUL 1BMZA 1OE1A 4DVBA 3NSXA 2BZ7A 3CVIL 4P5KB 3VI4F 4U33A 1H9DA 1MHCA 1ZHBA 1CLYL 1HEHC 4MA3B 4O4YH 4EJ1C 2ZSWB 3C6LB 4ZJ9A 5C08E 3GKWL 2FT7A 2D8KA 1C12A 3QNXA 4YUEL 3VXSB 4EUPA 4IBVA 3BT0A 3VACA 4F9PA 4UQBA 4AEEA 2F5AH 2JJTC 2P8LA 2VLKD 3TIEB 3SPCA 3V0IA 1FIGL 3GIVA 3WJLC 4N5EC 4MZIA 3BXNB 3V6OA 4NNYA 2H0PA 2RTTA 3HMXH 1WZ1H 4G8IA 1H3PH 3NCYP 4G43B 1CPUA 3QXTA 3NCMA 4F8TA 2FGZA 3AFLA 4G9FE 5CN2A 1A4JB 3FB7B 2XG4A 5ANHA 1JRHH 2XACC 4ONFH 1QFUL 2KLSA 4G71B 5FCUL 2CLVA 5CGYC 1IGIH 4S0TD 1P1VA 4MNQA 3FMGH 2IG2H 4LAQL 3KYNA 1NFKA 2H0FA 2ZIDA 4AIXA 1I1YA 3A23A 1YC7A 4P8QA 4ZOAA 2FB4L 4S1DD 5CBEB 1MW1A 1HHHB 2CG9X 4Y16C 2O5NA 3DVNA 3RZWA 3N85H 4FQPA 3G5VB 1L9SA 2XZZA 4PVNA 4LGSB 3F05A 1T0PB 5DJCB 4W9FC 1UB5A 3P2BA 4FQCL 4RAUB 1HINL 3AACA 2BSEA 4WV1A 5AAPA 2O5YL 4IOSA 4MCYA 4H13C 2Y5TA 4K23H 1KYAA 3RUGA 5HJGA 5I1IH 1HH9B 4YXHH 2XT1B 2A6KA 3CFTA 4OCMC 5FYKE 3PFUA 4IW4C 5E9DE 2CDGA 2LU4A 2Z8RA 1VB9A 3O3DB 5EBMB 4AE0A 3FTZA 3L3IB 5KYWA 4BZ2A 3FXIC 3IU3A 3G5XB 4JRXB 2IADB 2BWQA 5IGXH 5D9SB 3QI9B 2ZSVA 4IBLT 3MBED 5K59F 1UD3A 2FJFA 4FD0A 1E9PA 2OTUB 4EZKA 1ND0A 1XH2A 2BVTA 1CD9B 2F08A 2BFGA 2WBXA 1TTCA 1NANI 2HKHL 4M6NL 3T0ED 5AQ0A 1F4XL 2V5TA 1W6WA 2IPTH 1HKLH 4HIEB 1KXVC 4PJHB 5IM7A 1WFJA 4IOIB 1AKJB 3BP6A 2OJZL 2LU5A 5F1IB 3ZDYE 3UAJA 4PWIA 1YDPA 5FA4B 3VFPA 4AXWB 4KO9A 4IM8A 3L1GA 3BQVA 4Y89A 1PLAA 2VMEA 3GBDA 2HT4C 4M7KL 1R19A 2W80C 3S8WA 5I6XC 2JLLA 4D8PB 3KLLA 2ZXAA 3PV7A 3ABKB 4FQXB 4KVNH 5IFHH 5B1CA 4FGMA 4JO2L 4KI5F 1WGVA 3E80A 4NS0A 1SXNA 3UJTL 3L1EA 1PW3A 1K4DB 2OV0A 4ABUA 5CCHE 1ET8A 3C75A 3MO1B 3WHXB 3FTWA 4MS6A 1N3NA 2VERA 3UPRA 3MRJA 4IBQA 3CDCA 3X17A 2OXHB 2R0LL 4PRDA 1QHQA 3HC0B 5J12C 3S9DB 3KM2A 4X9IA 3QSKB 5E9NA 3VCLB 4A6YH 2VL4A 1FH2A 3K5SA 4GI6A 1FVDA 3AY2A 2ZG1A 1JNJA 3F01A 3ARRA 1BP3B 3BSGA 3H4HA 1WGOA 4Q6IB 2AQQA 3QUHA 4UNTA 5I18L 1JN6B 1SBBA 2VH5H 3KPRB 4TSBL 3T0AA 4RIRB 1KPUB 3PP3H 4Q4EA 1YYCA 4NXKA 5AOMA 4OLYL 3O4LA 3GB7B 1INDL 2FL5B 5D1ZA 4ELKA 4R26L 4OGAD 1RHHA 3VFVA 5IB4A 3BE1H 1KB5H 1MVUA 4WI2A 2A6JA 3FQXB 1F5WA 2OJEA 1P5UC 5B3NA 4JK0D 3TLRA 4OLVL 1ILUA 2E8ZA 5DGQA 5BQ7A 4OCLC 1VESA 3HI5H 3BGMA 3GSWA 3PIQB 2YBRB 3AM8A 4FMFA 4J3SA 3L4ZA 3SDYL 3EO1A 2V2WA 4JANB 5TGBB 7PCYA 1XF5B 3TFBA 3AAZA 3AUVA 4UBDD 4YDLC 1D5XA 1SHXA 5IOKA 4YSTA 5K9QI 1NQBA 4Y4HA 4G8EB 3BSZA 4PP1C 1OSZA 5FK9A 1WZKA 4AEHL 3T6QC 2JXMB 4GW5B 2QVMA 2WC7A 3TZVC 4AWJC 3DWTA 5FHBL 5I0WA 2O1AA 2AVGA 4YVUA 2UXFA 2JTDA 2DIJA 3IJEA 4AG4L 5JQ6L 2EDDA 3FQWB 4O2FA 1OOAA 3SKMA 2YD4A 4MFHA 5KVGL 2ICWJ 5KYNA 5I1JH 1PVHA 2BP0B 5C7ZA 2F7IA 2YKKA 3PS6A 3SKJL 3B9KD 1S7QA 4ZUSB 3WDJA 1DO6A 1NCWH 1SDAB 2JI3A 4F9LC 1QMUA 4GW4B 1IGYA 3D69A 3Q5TA 1IC5L 2PR4H 3IJHA 1E9OA 3ZTJH 5D1XC 4XC3H 5FUOH 1E6JH 3DHUA 2W0KA 3L48A 4NUJA 1UWXK 2XRAL 4YHOL 4O51A 3GIZH 2QV2A 2XCMC 4G72B 4O02A 4PJAB 4BD4A 1MHHA 1SUJA 2PWEA 3QPQC 5F96H 1LXMA 2EC9T 2COVD 4X0KB 1OTSD 2BMKA 4BFOA 1RHFA 5J6GB 4HS6B 3KJ6H 2OYLA 4OB5L 5L8JB 2V3EA 1MRDL 3C5JB 1RZJH 3DV4A 3RZCC 2C26A 3PWVA 2Q86B 5IHBA 3F62A 1LO4H 2UZPA 2A9AA 2WXQA 4PJGB 1A7RH 3RWJA 3IPFA 1HEZA 4ERSL 5EFIA 1NC4A 4D7BA 3L2LA 1UATA 4U3SB 1KJMA 1N26A 3O0RH 4HGKC 1THAA 2WINB 4AV5A 3T3MF 1MFCH 5AWNH 3ZKSD 2VXVH 4TUKH 3H9HB 2FLBT 2O72A 5HHMB 4WWPA 3APDA 4P2OD 1HTYA 4UMSA 1OF2A 3FTXA 3MNMA 1L9OA 3VI4A 3BUBA 2GJ6B 5CHNB 5ITBL 1WBYA 3GMLA 2XVGA 1H3GA 2QHRL 1ZWIA 3ULUF 2X4NB 3JSSA 2YGVA 2D4DA 5C3TA 2PW2B 3CFEB 4GSQA 4OD2A 3AQYA 2CKBA 3BDBA 1MCQA 3VWKA 3SO3C 2H1LM 3KPOB 4R7VA 4ZQKB 2FBJL 5ILTH 1INQB 2LLGA 4OZ4B 1ZA6A 4DGYH 3CVHL 1UUSA 2PPEA 4FI7A 2R2EA 5CZRA 3DV6B 2YGQA 5FYJU 1VFOA 1DQDL 1F3JB 1NCAH 1DANU 2ZUUA 2IANE 1JNHB 3HLKA 5E6ID 2VISA 3TBVB 1SXSA 3S98A 3CFJB 1W72L 4G1EA 1XD0A 3KDMA 2Y23A 4PB0H 2A9BA 1HILA 4XP9H 1QKZH 1KTRL 1NCBL 4F27A 3BAJA 2PMZA 5ENWB 1BSIA 5GRVK 3RL2A 5MHSE 1HSBA 1E4WL 4LASH 2HJKB 3QEHA 3CQQA 4YSEA 4UTCA 1G4MA 3CSTA 2C3XA 3TJPA 1NTDA 4AVJA 4PG9B 4KRNA 5B4MD 5C0GB 4ZFZA 3QJXA 5GHWH 4CADA 5CAYB 2AS5M 3UDWC 1YJDH 3TA3B 4JFWA 2WAHA 1MCWM 1JUFA 5K9QG 2VZUA 1JPFB 1Y0LA 1CICD 1VIWA 3QWOA 1EGJH 2CHWA 3LH2H 1JGEB 1U8PB 3KWTA 3LQAH 4DCQA 1XV8A 3IDUA 4MLIA 2WK2A 2X2IA 2JMRA 3EW3B 1DJHA 4F7MB 2DMGA 4JFVA 2V7NB 4Z7OB 5AKRA 3BP7B 1GS8A 3MV9D 1MDAA 3HE7A 3NH7L 2D03H 1I1AC 4K71B 1PAMA 3C6SB 2SEBA 2WZAA 2C7UB 4RESB 5CP3A 2O26U 1RK0A 1RUAL 3UADA 3WSQH 4X9HA 4G7VL 4LHUG 1WD8A 2GFBA 3ILQC 3ZHNA 5IJDC 3RWIA 1G6VK 2E47A 4X6FB 5DFAA 3AS2A 1HQRA 1BX2B 5K9JH 4ZAKA 2NY6B 3GI8L 3BP5A 4RWYL 1AQ8A 1N5YH 5C0DB 2AV1A 5CSZA 2X4QA 1N67A 2ICWI 3RWFA 1N64H 1SYSB 5CLZA 4OLWL 1BGXH 1WCQA 5C0JA 2Q10A 1BD2D 3LKNA 2P8MB 4YSPA 4DAGL 3FO2B 4MD5B 4FABH 2DQDH 4NKDA 3HBGA 2W65A 4BCZA 2VAJA 4XN8A 1ZD6A 5HJ3A 1KGWA 3PHSA 1JNLL 1E8YA 1I3VA 1T20B 3LS4H 4WTWA 5EU6A 3U0TB 3E1ZA 4RQQA 1A6VL 4GIAA 5E1HB 3QFJD 2CR3A 2WNGA 1C5DA 3IAQA 4HV8B 3FL7A 3CFNA 3VTTA 5C08D 2DTMH 2F8OA 1AO7E 1RZQA 4FCHA 1ECYA 2R2CA 3GRWL 1S9XA 3OR7B 3E8UL 4PEEA 1NBYB 5SWZD 5HYSB 2CIIA 3HZ3A 4BRVA 3QUZD 1C1EL 3T6ZA 2GW5A 2NX5A 3VD4A 1EANA 4P5MB 1A3RH 1GW6A 2GTZA 2VZVA 3VRIB 4HKJA 3BDYL 3HC4L 4Q7DA 1SJEB 3HHSB 3HN8A 4NRZA 3D1MC 4OF0A 1BOGB 4R4BA 1L0PA 2QADC 2CXGA 4R7DA 5HHOB 4G9FD 4YDIL 4W1TA 4I5BA 3ZUNC 3V6ZA 4Y5YB 3STZB 3NZSA 5EO1A 3FHAA 2W0PA 5C09B 3K91A 2KZ1B 5DUML 4A6YB 3L3DA 4MCZB 3K72B 2AK4B 5JHLA 2NUTB 2IOOA 2Z31D 3ESPA 4DFHA 3ECWA 1NC2B 1G6RH 2J21A 5BW7C 3KPMA 4P9MH 5TE4H 1DL7L 4RMBA 2EUZA 3WKML 3UZQB 1KIUA 2EDFA 2YMOA 3ZDXE 4LHUA 4P23A 2AW2A 3GMNA 4HIJB 5E5LA 5BVJB 3JTTA 4XOEA 4ZBJA 4HUCA 4TUOB 4NSKA 2CGZA 1NCIA 1KB5B 4WFED 3TO2A 5EO0B 2ED7A 1RUMH 4LHJB 3ZSSA 1TJXA 2B0SH 2L7UA 1OCZB 2FHBA 3LZLA 4HS8H 1B9KA 3BKJH 1U8CB 5INCB 4NO0B 2X2HA 3CK0L 5F7LB 1EHAA 2CJSA 5I8EA 2XKUA 2B1AL 4DP6X 5DMKA 3CLEH 1C08B 3WNIA 5LBVA 1NGQH 3ZKMC 1NDMA 4UTAL 2CALA 4GP5B 3P4OB 5TDNA 5EZLB 2NMSA 3VH8B 1HL9A 3NN8B 1B0RA 1E9QA 3OPZL 4AQOA 4D8OA 5LCVA 4P5TC 4JS7A 3B2DC 1NBVH 1HT6A 1BXVA 3B2XA 2FO4A 4ANWA 5EUOF 2NCMA 3BPCA 3WLWD 3KG5A 5TDOA 3ABLB 5DC9B 3LRKA 4KQ4H 3N3EA 3ES6B 4X42A 1JF6A 2V6HA 3TBWA 4B3EA 3PF2A 5KVDL 2V37A 2ZCHH 3VD2A 5C0EB 4AJWA 5CINL 1T1ZA 1U8OA 4QHLB 5E1GA 2X4SB 1DQJA 1XIWB 4TTDC 1SFDA 3MR9B 4LT7A 4XE5B 5CCJA 4BEIA 4EMZA 5LLIC 5BZDB 3VFOA 4WUUA 4PJEB 2I5YL 3FONB 4HIXL 5KYUB 2YFNA 2VDML 1KPVA 1N2RB 5E56A 3TV3H 1ZY9A 3LNIA 1KXTB 3S5LG 2HTLC 4P59L 3BJLA 4XHJD 1A7PL 4QDGA 3DJSA 3MX0B 4GINA 2O61A 4CKVX 3FT2B 3MMEB 4M8UA 1CD1B 2FQDA 2R69L 1IBGL 5BUPA 3HTLX 1QFWH 4MDIB 1DZBA 5ECGA 1NFIA 2JSFA 3Q8CA 3OKYA 2WN3A 1DVQA 1JF1B 4H0LC 2GCYB 4DP9X 3G6DL 5DURD 2N7SA 3KYMA 1DO5A 1BF8A 1FAKT 2NY1C 3MLVH 2D9CA 1CG9A 2R0WH 2VRKA 5M94B 4MZ2A 5J1SC 4MAUH 4IRJB 3CVIH 5LGHH 3WKPA 1IKFL 3HOGA 2QELA 3QJRB 1MCOH 4TNVK 1ET7A 3HG1B 1V7NL 3VSVA 4CILA 3ASNB 4KAQH 5KJRH 3MGOA 2QSCH 3S97C 1BG9A 2YWYA 3RPIA 2BVUA 4ANVA 1ERNA 2DYRB 4BXVA 5KZCB 4ZDHB 4M61A 3RLSA 3NEOA 2EDBA 1M7DB 3DUUA 3T4AB 5AG8A 3MOQA 4AJYV 5IESL 3KXFD 4N0UE 5AW8B 1KTCA 4KNSA 4KNUA 3SGKC 2BVQA 2W9EL 1QTSA 3GBEA 3T6XA 2FQEA 3V0EA 1E2ZA 4ZG1A 3PHQA 2G3XA 5CZVL 2A73A 3GSNL 5LG1A 3CXDL 4K9JA 4Y2OA 4L3EA 5I75B 5IF0A 1RLBA 4JGMA 4IRSC 15C8H 4RNRB 4MQXD 1FGNL 3PWUA 4LKXB 1AR2A 4PR5B 5AKSA 2OMYA 3ULSA 2WSKA 2ADIB 1YPZB 3WDHA 5I24A 4G9DB 2R15A 2F18A 2QDWA 5T1LD 1ZJBA 1HHGB 3JQOB 1QFUH 3EOTL 4EN3A 2H32H 4Y88A 2WKOA 5FCUH 2QPUA 5IMKB 3GMPB 3Q2NA 1ZHKA 1FFNB 1M7IB 2MOQA 2XIDA 2K7QA 4XCEB 4AM0B 3TBYB 4QCIB 1O7DC 4OKDA 5F1NA 5IW1B 2ICWA 3H3PL 4CSPA 5I66A 1DCEA 1KPRA 1NEZB 3KPNA 4RZCA 4JEGB 3EHBB 1A6PA 3Q3GA 3S5LA 2CM6A 4ZW5A 5BOJA 1XGTA 4DP0X 4JKNA 3LEVH 4XNQB 2Q3AA 2O5YH 3FCUB 3MV7B 2WP3T 3TYGL 1ES0B 4JFOA 1KBGL 3NZUA 1R5VB 3NA9L 2IWGA 3N9GH 3QPXL 2R1WB 4F2EA 2YD8A 5DK3A 4W9EC 4BK5C 1ADWA 4UT7H 1NBCA 1TXKA 4O00A 5K9OA 4RFEA 3GGWB 4OAWA 5ABZA 4XC1L 4X6DA 2PP7A 5JXEC 3MYJA 3SDCA 3GMOB 5D6CA 4UDUA 4UNVA 4ONGH 2VAAB 4NQQA 4X6DE 3SDXE 2XI9A 2Z8SA 3LH9A 2OL3H 1VZHA 2YJLA 5CN1A 4KOCA 3RJDA 4M6NH 2IH1A 5MENE 1F4XH 1IC0A 2R39A 4KHXH 4NNXA 4QRQB 3MRFA 1SN0A 3DXAA 2EIZB 2OJZH 2Y25A 4M3HA 3W57A 4DEUA 4AV4A 5CU5A 1U8MA 2X09A 3GLAA 4Z9KB 4QNPE 1X5XA 2KT6A 5JXAL 1YMME 1T4KB 2BNRA 1TKWB 1AD9B 4LDEB 1MIEH 1MLCA 5K9KA 2J5LB 2BRQA 4P04A 4EOWL 1IL1A 1FVEA 3IFOB 1KCRL 3FT3A 1NMAL 3MOBH 1EAPA 1ZV5A 4ZX5A 4IYKA 1K9TA 5CEXB 2AJZA 2K8QA 1GC1L 1U3JA 5DD5H 5DYOB 1MREL 3LXAA 1ODUA 4NM8L 4LLQA 3LAFA 4KKAC 4ZMAT 3EJZD 3ULVH 4I48A 2XTJD 1OP5H 3HZKB 4FLQA 1GYWA 2G3NA 3ELAT 1A8ZA 2UX7A 3BD3A 4FQIL 5JHDD 1E28A 3X3GH 1O7VA 3ZU8A 3FCTB 1FL5B 4F3FB 5CF3A 3SKUD 1D5IL 4B0MM 4LLYA 1F56A 3MV8A 4TSAH 3S3CB 2DKUA 2OMVB 5MHSD 4U6HA 1E65A 5D70L 5FV2A 3OKOA 1BVNT 3B2UC 3SB3A 3VXUA 4OQ1A 4J27A 3KLAB 2AABL 5I18H 1DEEA 4FC3E 4G6AD 2XV0A 4NO2B 4DGIH 3WIHH 4EI6A 3K8LA 4AEFA 3FTYA 5LQBH 5DMYA 2XWZA 1NCTA 2DYSB 1H9VA 5FO8A 3U83A 1VCBC 2AJUH 3P11H 1KBPA 3UZVB 5A2FA 1H3UA 1WEJH 1AQDB 1MCPH 3QDJE 4QXVA 1XCQA 5IMLB 1HYSC 3EOYG 4H1LB 3WDIA 3WTTA 5LNGA 3JZYA 3MLZH 5TH2B 3SE9L 1KGUA 1VSCA 1R3LA 3OAZK 4MA1C 1BLNA 2WVSA 4R6UA 1UJ3C 3LCYA 1DUZA 1SOQA 1AZNA 1AAJA 1I1FA 4OCXL 1JXJA 2BWDA 4KX7A 4X8XA 4QWWD 3CMOH 5CJOH 2YXFA 1N12A 2V0AA 1A25A 3U4BL 3EDJA 4WU7B 2VR3A 4WENB 3ESMA 4YK4B 4D2NA 2ICEC 5JQ6H 4AG4H 5D96C 4LPYA 1DE4B 5DJ2B 3DRTB 3TN0C 3GSOA 5C6TH 1OPGL 4N2EA 1ZLWH 3SKJH 3UFIA 5KSVA 4K8RD 4P4KB 1DP0A 4H2CA 1YEDB 3C5XA 3NCCB 3A24A 4GRMA 3ZMEA 4FNRA 5EUOA 4HUXA 1SMDA 3ZZ1A 4X9BA 3C87A 5F9AC 4G8FA 2E7LC 4JPIB 3I9GL 5HYIA 1KG0A 1OL0A 2IOMA 1Z5HA 4LVEA 4XMPL 4U1JB 1M1SA 5FGRA 2PWFA 4PJDE 5DJ8B 3FB6A 4ADIA 1BVLA 4JBSA 5INDA 5SX5K 1D5BB 3VWJD 3L5JA 4PIRF 2MOGA 4N9GB 1I85A 4HHAA 5LXGH 2AJXL 3O8XB 5HGDB 3V79C 4YDJA 2V9TA 4C56B 1AO7D 1UD4A 5I19L 3MXWL 4B95C 1MFDH 3L3OA 4JFTA 4LRIA 1HESA 5EOCJ 1CGUA 2L7JA 5JLZB 4QHUB 1CTOA 2MNWA 1RZGA 2NW3B 5DQ9B 4ALAC 4ERSH 3RTQC 2DWDA 1YYLL 3QULA 4PGCA 4JL1A 4WAFA 2PXYD 4UQ2A 5IHUL 2BP8B 3CXHK 3IFNL 3MJ7A 4JMNA 1JP5A 4YDLB 4R5XA 2FVNA 3FT4B 4G80B 1JZ5A 4G59C 4PJIA 4HHWA 2NW2A 3S5YA 4MNGE 2WY3B 2G4GA 3TZVB 4KKZA 2CR0A 3RILA 1NOAA 4WW1A 1UM5H 3CDGB 3KE0A 2FRGP 5M7QA 3KS0J 4HFWB 1D9KD 4PJIE 3LMJH 4L0YA 1BYNA 1AD0A 2HVJA 3QUXC 5DEJA 3D2UD 4BSVA 1DQLL 5I6LA 1T1XA 1RXLA 1THCA 1C7SA 3MROA 5IJVB 1ZSHA 3F5WB 2CBQA 2E46A 4U2ZA 4LPTA 4LLVB 3ATBA 3DYMA 2VXQA 5D1QC 1M71B 1MCFA 4I2XA 2WZ6A 4LCYA 2X1WL 3WEOA 4PRAA 1HCYA 5D1XB 1HNGA 3CDZB 5DHXB 3VUAA 3SBQA 4GOSA 2HKFH 3CVHH 5A1AA 2UUDK 2FSDA 4HLZG 4L8SA 1BQHB 2DMCA 2GY5A 5DRWB 4I4WA 5GGSA 1BV8A 1USZA 5LXVA 2ADYA 4PJCE 2ZOLA 4PFEA 5L2KA 2R0KL 1WA1X 4IDJL 2WAQA 2IGTA 4JRLA 1W72H 3SE4C 2ETWA