4JUSA

Crystal structure of a fragment of human hspb6
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
90
structure length
84
Chain Sequence
SVALPVAQVFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Heat shock protein beta-6
publication title Molecular structure and dynamics of the dimeric human small heat shock protein HSPB6
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 84
sequence length 90
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jusA01
4YL9A 4FEIA 3L1GA 1WGVA 3GLAA 3GT6A 3QORA 2Y1YA 1EJFA 4M5TA 2N3JA 3GUFA 2KLRA 2WJ5A 3EUDA 2XCMC 5DS2A 3QORC 2CG9X 4YE0A 5DS1A 4M5SA 3QORD 3VQMA 5LUMA 4PBDA 3QORB 4ZJ9A 3J07A 4JUTA 4PCKA 2BOLA 2O30A 3N3EA 4YLCA 3VQLA 1X5MA 2RH0A 2CR0A 2KMWA 3IGFA 3AABA 3AACA 4I88A 2JKIS 2Y22A 3Q9QA 2WJ7A 4YLBA 3W1ZA 1GMEA 1SHSA 2MNWA 2Y1ZA 3Q9PA 1RL1A 3L1FA 2N0KA 4YDZA 4JUSA 4MJHA 1WH0A 2K8QA 3L1EA 4RZKA 4ELDA 1WFIA
chains in the Genus database with same CATH superfamily
2ZYHA 1MCDA 4S11A 1F3DH 3NRPA 4NQDD 5LNEA 4UT7H 1CLOL 1AHWB 4JPWL 4MBOA 4QWWD 1JFQL 1IILE 3STZB 5TF0A 4AQZA 4ZJ9A 2R23B 1WFTA 3RB5A 3JVGA 4JZNA 4E9QA 4ZUSB 2JKJA 4ETQA 1JS4A 2BNUB 4I0CC 5I73B 1M4KA 4G2AA 1X5LA 4PJGB 3B7UX 1XB3A 5J0BA 3PWLB 1OAZL 4OFKA 4N26A 1F4YL 3L3IA 5HYQA 4LVEA 4MCYB 4W6YB 2E75C 1QFWH 2FZ3B 1NCDH 2XBTA 1PW3A 2FVNA 3S88L 3VFGL 5I8KL 4CA4A 1BIHA 4XNQB 3CFKB 5H94A 5DVLA 3TEZA 2WB1A 3CZLA 3MOAL 5E1IA 4LHJB 3FU6A 4FDWA 3ARZA 3BZ4A 4OIBA 1TO4A 1ZK5A 4PLJD 1NEZB 2XETA 3A6CL 1G94A 4UILH 2X6BA 4WI3A 1MW3A 2DQGL 2WKGA 4X6DA 2ITDA 4GUOA 4Z8FL 1VENA 2X0WA 3D3VB 4GAGH 1VEOA 2GFBA 5FOBB 1IBBA 1A1NA 1RLWA 4GFXA 3CSPA 3AG2B 2YD4A 3VA2C 2AZAA 3GM0A 3PPEA 5KVEH 3KR3H 1HJBC 1SJHA 5D4IA 2ED7A 1FVCB 1LLAA 4DP2X 5CF3A 4DVBA 1JNHB 4WFEE 2QVMA 3DPBA 5C07A 5DQDL 1U8IB 1M05A 1DVUA 3JUYA 4F5CE 1K9TA 1NIAA 1DUZA 2HMIC 4GRWE 5DYOB 3V2AR 4P2YA 4LU5L 3TT3L 4I2XB 3CVHH 3AQZA 4D0CA 3QNXA 3P2TA 3BWZA 2RD0A 2GK2A 3KW8A 3STLA 3QWRA 4E9TA 1MFDH 1YC7A 1GL4B 3RX5A 4DERA 1BZ9A 1QI3A 2AXFA 3V0EA 3WY4A 3WKQA 4AGQA 2CLZB 3D39B 4R2GD 2QGEA 1VGEL 2XV2A 1BVZA 2I7OA 1P6WA 4NZJA 4G8GB 3U25A 5FB8B 3PWNA 1NAKL 5CR8A 1CDUA 4OQTA 1K4CB 4ZZKA 3K0YA 1EUUA 3Q1EA 4JO3H 4X4ME 4ZO8A 4YHZH 3VFVB 4U6YA 1ZLUK 1QSVA 1XH0A 2L4OA 4RDBA 5MI0B 2F54A 4KK9D 4KRNA 3V6BR 4MA7L 1HIMH 1SN0A 5I16A 3RIAF 1IC1A 3QDMB 1C5CL 1X9UA 1JYWA 1IM3A 1OGAE 3ESNA 5GSVB 4K3DL 5DUBB 2IXQA 5T3XD 4OFQA 3SODB 4P0DA 1NH6A 3G5XA 1EFXB 2LFGA 3NZHH 1M9WA 2F6AA 3APCA 3NP4A 5FHBH 4M1DH 4HJJH 3RBGA 1T7ZA 1LE9B 1AJ7L 4HIQA 1CE6A 1R3LA 5DJCA 1KLFB 1X4ZA 5JIMA 4IBVA 3VFUA 3IDUA 5LLIC 1EV2E 1SVCP 2HFGH 3RY4A 3BN3B 3GRWA 1A66A 1L0PA 4GP8B 3KPRD 4U3SB 4HS8L 2HVJB 3BYYA 3MRCA 2G60H 4Z7VE 5IJVB 1JD7A 3LPWA 4KTEH 1INEL 2VXQL 3OAZK 4ZD3H 1CI5A 1SMOA 3KS0J 3FRPG 2ITFA 3THMH 1QYGH 4LLMA 1K2DB 2W07B 2YMTA 4B0MB 4LGRB 5JXAL 4MZ3A 4OSUL 1UURA 3Q3GB 2E86A 5TDPA 1G6RA 1YY8A 3CNKA 3QNZB 1NGXB 4O9HH 3VU2A 2WINB 1OV8A 5KBDA 2R2BA 4ZUUB 2ORBL 1UWYA 5INDA 1QAWA 3CVBA 4XVUC 1H5BC 3OLEA 2YKLH 4NSKB 3KS0H 1ZLVH 1WIUA 1BGXH 2VZ3A 3P30L 1CFVH 2P5EB 1WG3A 4P8QA 5DFWH 3JUZA 3FO2A 4E42B 4Y1AD 4GRWF 4PPTA 3TZVC 4AYFB 4WU7A 4KTDH 1MJJA 4LLVB 4EZKA 4N0UE 3OR6B 4G8IB 2EH7H 4P9HH 4GSXA 4RFEB 1MDTA 1RIVH 1HDMA 4H0IA 4BM7A 4PB0L 3TCTA 3GXDA 3KCWA 3RG1C 1H8NA 4TUJB 4K0OA 3X1EA 3RY6A 4PJCA 5BOJA 2H4EA 1ZCRA 1RZ8B 4GKLA 2IWFA 5C8JA 3BP5A 2FBRA 4EI6B 3IJSA 2B59B 5E08H 4BUGA 1B0RA 1BQLH 4A2FA 3JWNC 4LDEB 3HR5B 1UM5H 3EF7A 1E67A 2O6PA 1T7WA 3U4KA 4MAZA 3KJ6L 2XG4A 3QFJA 1FZMB 5SV3A 4F2EA 1A2YB 1PD1A 2EIZA 2VDQL 4P57A 2JIXA 5ERWB 3C8HA 1AKJD 1CL7H 1J5DA 3I50L 4YXHH 4X7DC 1U58A 2BVOB 3KNBB 5DJXB 1CLCA 2DH2A 2HKHL 2X89A 3BAWA 4X6BB 4DFHA 3BDYH 3NEOA 5D1XA 1FNFA 1A6TA 4HXBH 2NYKA 4A2HA 4PJ5A 2CA3A 4JZOB 3CLEH 3WGUB 3T4AB 4JE4B 2Q6WA 4F7EA 2OBGA 3A67H 5KJRH 2BJML 5DC0A 5KEZA 1Z66A 1IBDA 1X5GA 4LEOB 3FUFA 4PJ8B 1EBAA 4B3EA 5C07D 1D5IH 5EEUA 5DF0A 5AUMA 1DBBH 5F3BA 2PTVA 3QEQA 4RESB 4Z7VF 1E42A 4GKSB 1AG0A 4WU5A 1HOEA 2XWXA 4UIKL 1ED3A 3INUH 4ZW5A 2ATKA 3BISA 3MJ9H 5B22A 2B77A 2A6KA 5LGYA 3AY4C 1IAII 3PUCA 2GKIA 3LJ3A 2PO6B 4QXGL 4OI8A 1HNGA 4NM4L 3OKNB 1KPRB 1PZDA 1O6SB 3U4EB 5F7DA 3Q6GL 1A8JH 4IOIA 3TEXA 3EUDA 4XPHL 4PCYA 2VDMH 3WI9A 4NX0A 4WK0B 3K6SB 1PLCA 2WWKO 4LAJH 3WTXA 2AHIA 4P2QE 1U8CA 2BC4A 3EHBC 4MMXA 5IBLC 3P9LA 4J5VA 4XMKH 5FUZH 1KJVB 4XH2B 2V2WB 1B6DA 1MHPH 4H2CA 5L2KE 1KELL 3TEUA 2XVBA 1XSJA 1EHNA 5T3XH 5A3IC 4ORGB 1IM3D 1ETJA 3RZCC 2X2HA 2P8LB 3IETB 4I3GA 3SKNA 2FYVA 3TGXA 1QFUL 3K80A 4BSWB 5JO5B 2Z8VC 5BVJB 1IGTA 4OJDH 4JQXA 4A7SA 5KVFH 3QJSB 1CFBA 2YC1A 2BMKB 3SKOA 1XFPA 3PJNA 1ZJAA 4LF3A 1XF3A 4MB5A 4MNHB 3I3BA 2H2PD 5T1LA 1IC4L 3AB0C 1AD9B 4P5TB 4DVRL 3LRMA 5DHVH 4I9WD 1BFOA 3D6GA 2JKSA 4YE4H 3WTYA 3TJEL 5JMOC 1CPUA 3EFFB 2EXYC 4E5XB 2ZG1A 4UT6A 3RTLA 2NCMA 5KBKA 1M7DB 3EGSB 3MRHB 1OHZA 4PRDB 5DK2B 3V6ZA 4ZFFA 3KPQA 4QOKE 4AG4H 2IG2L 4AJ0A 4P4RB 4ZUWA 2YGQA 2Y1YA 1G1KA 4F8OA 1DVFA 4JPKH 4QLWA 4LCUA 5JOPE 3KPNB 5EUOA 1NLDL 1REIA 3LRSB 3SPVA 4OFPA 3GGWB 4X98B 4L8BB 1DBKH 3HC4H 1VFMA 5EIVA 3QE5A 2YEQA 2EXWD 1IAKA 2X7LA 5F7EH 4GINA 1JRHL 3VXNA 1E8WA 1HC1A 3GHEH 4XHJC 3ZHKA 2LVEA 2VZOA 5T1MA 5J9PB 1ZT4B 2FB4H 3LXCA 3CZNA 5TF1H 3F65A 3NA4A 3H9ZA 1AR1D 4YNYB 1F45A 3BQUD 2P8MA 4EQ2A 3B2VH 2YR3A 4OKDA 2HFEA 3B9DA 4KH2A 1A6VL 1MEXL 3VWKD 2ETWA 3UPRA 1RUQL 2OK0H 1NLBH 4XMLH 1RZPA 4NQSB 5E4AA 3OPZL 1E0OB 1NCHA 1OGTA 2Y72A 5EO0A 4OZGE 4ZOBA 1MCBA 4J12A 1BQ5A 3B2PA 3S8WA 1BZEA 3FULA 2XY2A 1F8TL 1FDLH 2C9XA 4ETYA 5HHVL 4Q56A 4AM0Q 1LL1A 1HH9B 5AL0A 1QACA 1X7SA 3ZUNC 1EZLA 1AGEA 2W92A 2R0LH 2ZCKH 1U93A 1X9QA 3QXVA 1CGUA 5DRZA 3K2UH 2AXGB 3D0VA 3LN4B 2YGPA 2ZPKL 4XC1H 4ZXBB 3BCDA 3DOSB 3QEUB 5J1AB 4WENB 4QXTB 1LE5B 4NKMB 4DGIH 1PG7X 4NWUL 4QY8A 1EGJA 4DN4H 3H9SA 3RGHA 4FQCL 5HBBA 2XPZA 4N3UA 5KSBB 3EJQA 3K81A 2JIXD 4N8CH 3VFRA 3MV8B 2ZONA 4FKHA 4TV3A 5AYTA 4UTAA 4HJ0C 1I7RB 2G2PA 2LOEA 4NUJB 2X89D 5DCCA 4BD4A 3KYOA 5D1XD 1QBBA 4U2ZA 1CFSA 4PREA 3V9CA 4A67A 4L05A 4CVXA 5ACZA 1XMWA 2R0ZH 5GGSA 1NL0H 1J12A 1FNSH 12E8L 3IBEA 1FPTL 1YNTB 3BVVA 2R0KL 1KNOA 1NFIB 3QC5X 1OHQA 1GHFL 2NUPB 3EJUA 1IT9L 3CXFA 4R84A 1RMFH 1LEGB 4BFIA 3ATAA 2FQFA 2UY7B 4GJTB 2FX8L 3VYNA 1RJZA 3LB6D 3W5MA 2HG5B 3C8KA 5D7JB 4JHAH 3W11C 3KJ4B 1DJZA 4R5VA 3PGCA 3AFLA 2CLVA 1OD7A 4J6RH 4LOUC 4OQTH 5JQHC 1A9BA 3L3KB 3MJWA 4AVIA 4WNQB 2L3BA 1KB9J 3Q2NA 43C9A 4XPGL 4X4ZA 4PCKA 2XWZA 4PJ9B 5L8LB 2TRYA 1QO3A 1U4EA 1WZ1H 4H1LB 3MLXL 4HS6B 1K6QH 5EN2B 5C0AD 3RWHA 3FQWA 5DD0L 3VGBA 4FYSA 4ZX3A 1JGUH 1DYZA 4TSBL 3C6LD 4L1TA 3NG5A 5DRXA 4OB5L 3SGEI 5EZLB 5J6SA 3ELAT 2V8MA 2HYMA 1I75A 3P4NA 1X9RA 2DDQL 2VH5L 5KZCB 4P59L 1O7DE 1MCWW 2AI0H 3S3DB 3A21A 4OZGF 1OCZB 3CZGA 3MRPA 2FJFA 4APXB 1E9QB 1CS6A 3U9UB 4Z1PA 2A4ZA 3MN8A 2XNAA 1KTJA 4FQLH 1D5MB 2A6DA 2GEEA 1ASOA 1V3MA 3GRWH 1T03H 3QO0B 5DZPA 5E9DB 2GY5A 1I9RL 1GW0A 1A21A 5L4IA 3WKPA 2X4TA 1D5ZB 8PAZA 3G6DL 2X1OA 4TYUA 5TE7L 3ZK0A 5C0FA 3ZSSA 2MPVA 4R8WL 4BZ1A 3TBBA 5CN1A 3BGAA 1GGTA 4OI9A 1J8HB 4HFUL 1CLZH 5J12B 2J2ZB 4N1CA 2AJYL 3DHJA 4QUOA 1XQ4A 1G6RH 1C5BL 5F8RC 3N85H 2MOQA 5T1KD 4B9KC 4DQAA 3TO4B 1TJMA 2CO2A 2O61B 3M17B 2AAVA 3EO0A 1KLUB 1A7PL 3VCLA 2IWGA 1TVHA 1TETH 4H25A 3GNML 1KPVB 1CJYA 1OO2A 2FCBA 2AGJH 3IN0A 1AYOA 3QP3A 1ONQA 3IDXL 4J3OD 5BV7C 1NGZB 5HDRA 1ZGLM 5B4MD 1OAXL 2WJ5A 2OMVA 3KW7A 4JHWL 4LVHB 1TTBA 4B9PA 3I6KA 2XICA 2NXYC 4IBYA 3BWAB 4MDJA 4KROC 4U31A 5DK3A 1DJXA 1QUNA 4P3DA 3GD1C 5HYJB 2VW7A 4MD5B 3TYGL 1T0NA 1SN2A 3L4XA 3W37A 3WY1A 4RAUB 5I24A 3V9FA 2QVFB 1CF8L 1C08A 2ZE0A 3AQDA 3LSOA 4FFVD 5GGUB 2NNAB 5IQNA 3W0WE 5I1LB 2WXLA 1HHJA 4HD9A 5A2AA 1WUNT 4FA7B 4QDGA 3SYQA 3POHA 1QR4A 4OUUA 1BQHB 4Z7UA 3PAZA 3QDGB 2YPLA 5LAPA 2XFXB 5DMGC 1YDPB 2YUXA 2XX0A 3UC0H 2GUOB 4PUBH 4TVSa 1MAJA 1UOVA 2Z35B 4YS4A 1SUJA 1J11A 1I1FB 2V33A 4NHCL 5EOTA 4BQCA 4ZQKB 3OLIA 2VLJB 5D7LD 5F3HA 4DJMA 3PP4H 1MAKA 2MJWA 1AZNA 2ATPA 2QVKA 4HPOH 2C4FT 3A6BH 1SOQA 3P4LA 1DTUA 2QGCA 2AK1H 3IVKA 4QKTA 4XNMA 1TR7A 5FO8A 1RVFH 1NDGA 4PRIA 2Z6FA 5GGTA 4BE6A 4RSYA 1E43A 1Y6MR 1T6VN 1A65A 4L29B 3SPJA 5F7HA 1MRDH 3W9DB 1XF5B 2YQ2A 2Q7YA 1LO5B 2Q2LA 3WNNA 4B50A 4JKMA 3MXVH 1AH1A 3OTTA 5F96H 3KBEA 3T9WA 3RBSA 1N4XL 3PWVB 2IH1B 2IO5A 4YFLI 2BHUA 2YD1A 4QO1B 3ZE1B 4JAMA 4UV7H 3KL0A 3EO9L 3GLZA 2B8OT 1IAIL 4GG6B 4LBEA 3U7WH 3V0GA 1IC7H 5GS1A 1JGDA 1PX4A 4PJBA 1LEIA 2E7HA 2CJ3A 5C9JB 1OVZA 3N04A 3QZNA 1NPNA 1P7KA 2D31B 4PRAA 4ALAL 1JN6A 4CW1B 1AC6A 1KENL 3LS5H 4G70B 1W0YT 5EO1A 1DJHA 1CGXA 1GY2A 2OTPA 2GPZA 2MWCA 3EZJB 3RUGA 1Y6KR 2H8PA 2XWEA 5I1HH 3D39E 4HISA 3IK2A 1AZZC 1FFPA 3WJMB 1TIUA 4FL4B 4P4KC 3W3BA 1NCCL 1DBAL 2BS8A 2YGVA 2I9LB 1BZDA 2HKFH 1RZ7H 1ETZB 1F58L 1OE3A 1TOXA 4Y19B 1NGYB 2XKSA 3CDGB 3DX9B 4G6JH 2OS7A 4NQTA 2IAAC 2UWEA 3EJJX 2JELH 5GJSH 2MIZA 4YK4B 3QFGA 2RQ8A 3N55A 4JY4B 3IXAB 4DUVA 3HZ3A 4JFDB 3RKDD 5LQBL 1UADC 2QSTA 2Y5TB 3AM8A 3GSXB 5HVGB 4J1UB 2WYTA 1ZK9A 4UT6H 3SQOH 4YBHA 4OTXL 5EEZA 2QPFA 3U30C 2F74B 3B2XA 3GHBL 3KEDA 3DC0A 1T3FB 5EF3A 4APQD 1C5DA 1T7YA 3JT0A 4A7GA 2YZ8A 1EANA 2WBJA 3TPUB 4N5EC 1AFVL 4XOEA 4G7YH 3S36X 2KKQA 4YHOL 2DRUA 3EDKA 4FMFA 3MLVH 2NR6A 2AEQH 1DANU 3O4LB 4OGXL 4JKLA 2JQZA 1AE6H 4LO9A 4EF3A 3UTOA 4MDRA 4HUCA 4IOFC 4EBQH 3B2UC 3VXOB 5TE4L 1SHXA 1OAQH 3LKQA 4YLBA 2ZXEB 5CLZA 5KYWB 4LNRA 4LLWA 3VXRB 1KN2H 4FQ2H 4DKAA 4J3OH 3AXIA 4MJ4A 3GXMA 2K7QA 2CU9A 1TJXA 4LSSH 1T2XA 1XTLA 5JYMA 1XWVA 2YLKA 2FX9H 1Z3GL 4NP9A 2LV4A 2K8MA 3EFDH 3FUEA 4NRYB 5EC2A 5FCUL 2F5AL 2VL5B 4JFPA 5IJDC 3DXAB 2EYRB 2Q7AA 1KACB 1UXSA 3IGKA 3BUIA 4JHZA 4KI1A 3K72B 2JKNA 1KCBA 2IWEA 3SO3B 3D48R 5E6ID 1V7ML 4WHDA 3BT2H 5EU4A 5F21B 5F1KC 3I75A 3NZ8A 2QQNL 2X2JA 1HZLA 1KIRB 5DMIL 3UTQB 3DMMA 4OF7A 4NQQA 3JT2A 3QAQA 2VN3A 2XBZA 1LO3H 3GMQA 1FHGA 4QTHB 2OL3L 4X6EB 4DP7X 1TZGH 3K74B 2QADC 2DBLH 1J9RA 2O6CA 4DPRA 3B7SA 3R06A 4G71B 5CBEB 1R9FA 3FRPB 4GT7A 2OQJB 1OTTD 1V8HA 1EGJH 2CJUH 2EYTA 3MNWA 1JTTA 4N86A 2VR9A 5TPWL 4YHML 5JHLA 1YUKB 3CFEB 5E9AA 3R19A 1XGUB 4ES8A 2VLKE 3FW6A 5CCGE 1YO4A 4E41A 4ZTPL 2EDQA 4HIHB 2ZWKA 3AREA 3LV3B 2VISA 4M7ZB 4UTAH 2GJRA 1NEUA 3U36A 4KHTL 1XO8A 1VGKA 4A2LA 1GS8A 4R0LA 1U30A 4HKJB 1A7OH 4IU3A 2WNXA 2AMUA 2WXRA 1MFEL 3DDGA 1DSYA 1UD2A 2NY4C 4AGOA 3N1MC 4JFVA 5E1HB 5I9QC 3QZWA 2YQGA 2AANA 1UJTA 4GI6A 3D34A 2IBGA 2YSSA 1YEIL 4HH9A 4JM4L 4RFOL 1QWUA 5HD8D 5A43C 2J6EA 3HS0A 4HHAB 1JDDA 5IVZA 1MOEA 2AQTA 4PWIA 1R47A 4AV0A 2DWDB 2JCCA 5D7IB 4AL8H 1MCKA 4N1HB 2QKIA 3CCHB 1SEBB 3ZHLA 5IVXB 4KRPD 1ORQA 2WBJC 4DEPB 3ZQWA 2GTZB 3IDNB 2BIIA 3NCJH 3O6FA 5C0AE 3FFDB 1YVLA 4E9YA 4FQXD 1E65A 1KJ3L 4G5AA 4HDIB 1D7DA 4DWHA 4JRXD 3T5WA 3QULA 1EDQA 2BFGA 4H40A 3OG4B 1XF2A 2EDXA 5E2TL 4W68A 4X99B 4I77H 3SYOA 2VLRD 1E27A 1U2HA 3GLEA 5FYKL 3BAJA 1Z5LB 3MRJB 2X09A 4BUQA 3KPSB 2HVKB 4W9DC 5JIQA 1IAMA 1B3IA 3BHBB 1EEYA 1I7UB 3KWXA 1R4XA 5CJQL 4RZCB 4N2OA 2BVEA 1GA2A 2V0AA 3CVIH 4PTUB 4ZI8A 1XR9B 3M6DA 2RQEA 4HJGB 1FH5L 3WELA 3CTTA 1EJOL 1NMBH 5TD4A 1X3DA 3X3GH 5F7YC 3S3CB 1P4BH 2JNZA 2OR7A 4BZ1H 3UX9B 2GBTA 4JO4L 1KYAA 3MXWH 3QR0A 4XPTH 4OD3L 3E2HB 4G7QB 3MRFB 5BVPL 3UTTE 2Y7QA 3L3HB 1E4XL 2L0DA 2NNCA 1GRWA 2NR6D 1NCOA 4MBRA 4DKEL 4Q8BA 4ONGL 4Q9QL 3IJYA 3PQYE 4QT5A 5T3ZH 1O5DT 5H4YA 2YS4A 1BECA 5E8EA 1BZ8A 5IB5A 2W0LA 3RURA 4LOVA 3QI9A 4R4FH 4BGLA 5F72S 1IQDB 1MKFA 3VRLE 1BXVA 3NCYS 2DQJL 1YYLL 3EADA 4R0LC 1F5WA 4XX1E 1IEBA 5HHOA 3VWJC 3BD5A 1HNYA 2V9QA 4XE0A 4AX3A 3ABKB 4PVNA 5HGAB 3MBEB 5E51A 5MENA 4A7UA 1PLGL 3MFGB 1G1OA 4ENEC 1WISA 2HJKA 2HSIA 2J73A 3EOAB 4JN2B 5F9OL 1S3KL 2I25N 4MJHA 2OMZA 3X11A 1S6NA 5J8OA 3DMMD 4EDXA 3GSUA 1RHFA 4YSAA 4NKIL 3O45A 4QXWA 5KBLA 4IKLA 2XWBA 1SM3L 1YECL 4LFHD 3RVUD 4N6RA 1WSST 1AO7E 4PJAA 4G7RB 2FJHB 4YSQA 3BPLC 7FABL 4WWKD 5AOJA 5C0DA 5KYYA 2W9DL 3UOAB 4EVNA 2QQQA 3EDFA 2LQRA 2DQHL 3HZMA 5CJOH 2ED8A 3ILQC 3CK0L 1I4FB 4XNUL 4AENA 2F8OA 3EJPA 5DO2D 2WBWB 6FABH 3CVHB 4GBXC 4QCIA 4O58L 1EJ8A 5JW3H 4KZEH 3MGAA 4R97B 4TSCL 5KS9E 4RMWA 3FMGH 3H3PL 3ULUC 5JPNB 3ILPB 2BPBA 3GTTA 2CRMA 4HPHA 1X5YA 4DH2A 3LZLA 2CM5A 2KLSA 1KGXA 3MR9A 1U3HB 1WIOA 3UJJL 3C9NB 5GGTH 3VFPB 2ZKMX 2ICEA 3FONA 1UD5A 1FORL 2XHNA 4L8SB 4NI6A 4FZEL 1I9IH 1MCQA 2N1TE 1OP5H 1BAWA 4J3OG 3BSGA 5EBLA 3IFPB 1B4JH 2YWYA 1LK3L 3WS3A 3IU3A 4PJXA 2P43B 1UQSB 3M46A 4LE8A 1FN4A 3AU1B 5MP6H 1LWHA 1HHIA 2RA1A 4L23A 1K85A 3APMA 1CVRA 5CCHE 3ARDA 1KSRA 3ARWA 4J27A 4JFFA 1U3ZA 4FNUA 1T0PB 3L5JA 5IQLA 2OMWB 3RQ3A 2CR3A 4GAFB 3S2AA 5J11C 1TYJA 3VFOB 3HC0B 1I1YB 1GZQB 1EH9A 4PRBB 1A7QH 1OM9A 3EH2A 4P46A 4FYRA 4PFEA 2QPEB 4R83A 5DHYB 5INCB 4AQAA 1XZWA 1XIWC 1XVSA 5DJZB 1KCVL 4N22A 3GIVA 3VRLF 4UTCA 3JTTB 5D5MA 5GZNA 5IHZA 2YUWA 1P2CB 5IJCC 4MWFA 1N5AA 2ZJSH 4IBTA 4H5SA 3DUSA 5LWYH 4X7SH 1MUJA 2O5YL 3ROOB 3MRIB 4QRPB 1LM8V 3BCFA 4NENB 4GQRA 5C97A 4BGDA 5T1DH 2B2XH 3LEXB 1ZEAL 3FUJA 3WBDA 4F58H 1N59A 2O5XH 4FN0A 5LVEA 3L2LA 4WW2A 1U42A 2R56L 2AJSH 3EGDB 3B83A 4N2LA 3HKZA 4ONFL 4FABL 1G7HA 4NO0A 1SGKA 3G6JB 2Z31A 1DBJL 4L2YA 2JXMB 4NQDB 4U1LB 4OCYH 3SDAD 1V7NL 3IGAA 2DAVA 2PETA 3M07A 3IMSA 3KWWB 3DHMA 3SBWA 3WLWC 2ZAIA 5SWSB 3BVNA 3M1BB 4PWKA 4GLRI 5E23A 5KS9F 1NFDA 2QSCL 3DYOA 3MVSA 2WAQA 4JFXB 1IEAA 1G7JB 1IKNA 4LLUB 2X4QA 4X4KA 3FTUA 5FYKE 4JGMA 3BKJL 2CKBL 4NN6C 3KD4A 3QQXA 4HEPA 3S8FB 3WU1A 2CAKA 4XN1A 5HDBE 5I8EA 3TBCA 3S35X 4YDIL 3PNWA 3OM3B 4N2MA 1PG7L 1X6LA 3LQAL 3QW9A 4GO8A 4JANB 4NS0A 1QRNA 3N1QC 5HHOD 3CSYA 3ECQA 3VG9C 3FN3A 3QCTH 5HHMD 3OMAB 1B6UA 2WJ7A 3HUJA 3O2VH 5ACLA 4ZW7A 2YJQA 2FLBT 4GXVL 3F12B 1CFQB 1TJGL 4R5TA 3QEGL 4HWEL 4FP8L 2ADIA 2YAOA 1S7RB 2A74C 2BINA 3DIFA 5BXFA 3VXTB 5A16A 5I76B 4I85A 4OD1L 3V0DA 3ZKMD 4K9EC 4MS8D 3EKCA 2XKNA 1NAMA 3FCTA 2WYHA 3S5LA 3ARDC 4OF0A 4EZLA 3ZYZA 3MRBB 1WEJL 1T83C 4M4RB 3L16A 5JHLH 4E68A 3HG1A 1VF5C 4FNSA 1MJ8H 1IBGH 4X83A 4R3SA 4K5NA 4NC0B 3NFPB 1S5HB 4RGOL 4C83B 4YIQB 5J6HA 1AOZA 1G5AA 3ZYOA 3EBHA 2OSLA 1A1MA 2FX7H 4R2GB 1BFSA 4OGYL 1DJSA 1O9ZA 1HJCA 2LFEA 5EBMA 4OBSA 3SDDA 5E2WH 1GC1C 5BMFH 3E3QE 5BOPA 5C0JA 1L9OA 1L5GB 4Y5YC 2BY1A 1WV7T 4P2RB 3GK8H 5F89A 2AQ3A 1NBZA 2NY2D 2YD9A 1WHPA 1BD2A 3O8XA 3HVDA 2VDMB 1VESA 3QBTB 3C2AH 4LSPH 3GUTA 2DD8L 4HCFA 2DKMA 5DHEA 1P4IH 4JJ5A 2WKLA 2MNWA 1JBJA 1HSAB 4U1HB 3K7UA 2Z92A 4GIPD 2J6EH 1IGMH 2XT1B 4FFYA 3V0AC 3QRBA 5TH2A 4ZSOB 2H0PA 4P5KB 2CSPA 1PZ3A 1SMDA 3HN3A 4PWGA 3NRFA 1KFAL 2QHRL 1NCNA 1DSFL 2HTLD 1P4UA 2R29A 1F6FB 1CK0H 1E40A 3SGDH 3H53A 2B1AH 1E6OL 1KCRL 2UVEA 5ISZE 1BREA 2OSXA 4JFFD 1OLLA 4JRXE 5DHVB 1FQ9C 1RHHA 1NJ9B 4DGYH 1TZIB 4WF7A 3KPRB 3WL9A 2Z7WA 5D55A 1OAYH 2NX5D 3QHZL 3MRDA 3MU3A 5HDBF 5L2JA 4M6NL 3WSQL 1M2OA 3EH4B 4L0ZA 3B3IB 4YSTA 2PYFA 3TV3H 1JCKA 3DJSA 2YMXH 5FA3B 5GZND 1NWOA 1Z0NA 1ZXKA 4XXWC 3U48A 3GKWH 3L1OL 1CT8A 4Y4KA 2WTOA 1CFNA 1ZS8A 2CQVA 2EDJA 5AVRB 3SOTA 1I7TA 4JVWA 5GQBA 2Q76A 2AS5M 1UVQA 1T5XA 3HHSA 1G9EA 2VUYA 2JQAA 4Q6KA 3UIZA 5ESVA 5KVDH 5AQ0A 4PYGA 1N2RB 4Q14A 3PPSA 3VTTA 2OMNA 1BX2B 1JG9A 3CFIC 1LHZA 1QSED 2P9RA 3FQTA 3LKNA 2R59A 1DQML 1F6AB 1MELA 1DBMH 1DJWA 2R2HB 3GI8H 5EZPA 1GZPA 1QPPA 3D2UA 3PFUA 4Y1AB 3ARFC 4OCSL 4Y5VB 4NO0D 4AQ1C 4DQOH 4JO5A 1FE8L 4FNLL 5HTSA 4AK1A 4ISVB 3U46B 3Q48A 4NUPA 3P0VL 4OCRL 2JVUA 1BSIA 3FN0L 4JZNB 1LEKA 4NQEE 1UWEH 4OCMC 3HN8A 5IG7A 5DWUL 4KWUA 1ZV9A 1AS6A 3CFJA 4DKDC 3L3IB 4HJIA 5HYQB 4N90D 1I31A 3QPKA 4BQ6A 1U8NA 5KSAA 2ZXQA 1FYHB 2GK0A 1OLZA 3FSVA 3QJFA 3VGGA 1VFAA 1F4WH 4HBQA 4XPFH 3W57A 2XA8H 1CN4A 2A0LC 3BZ4B 3Q1SL 2HX7A 2VT0A 2PNDA 5C92A 3GXPA 1FZKB 5HI5D 3FCUB 2MTAA 3F04A 3MJ8A 1YEKL 5DC4B 4GPVA 4YBQC 5JYLA 1W9XA 2ITDB 1A6UH 4LPCA 4MXWH 5I6PA 4X6CA 5I1CH 2CD0A 2GFBB 2A1WL 3M1OA 4OFIA 1A1NB 4NP4H 4H8HA 4WKZA 4MDIB 3EJZC 5AW5B 3PP3H 1KIUA 2G75A 4IRSA 2KLTA 2X05A 4Y4HD 3LIZA 1CDGA 4M43H 4Y9EA 4ZX4A 1E9PA 3QORD 1BBJB 3HNSL 1XF4A 4DVBB 3AS3A 3DPBB 5C07B 4BQ9A 1K5WA 1MI5A 2E5EA 1M05B 1G9HA 2NT0A 1M3JA 1XD1A 3ZTJH 4LK4A 2ILLA 5ID1B 1YQVH 4KAQL 4D0CB 1UWFA 3LMJH 3ECWA 3MMEA 1WH0A 1URZA 3FQ1A 4PVBA 3G3LA 3NRQA 2QSVA 2BSCA 2W0FB 3FCSA 1KFGA 5CD3A 2AXFB 3QT2A 4ABVA 1JZFA 3CN2A 4DIXA 3CV5A 5DD1L 4C4UA 5C7XL 3E6HA 4WWOA 4XVTH 3KDMB 4KKAD 3BZDA 3SDDD 4RGNE 3V0VA 3KMDA 4YWGH 3T6VA 2IPUG 1BD2D 3VW3H 1TQBB 3KEHA 2F54B 2NW3A 2XTJC 1I3RB 4QJ3B 5AEAA 5I16B 4HCRL 3ZKXC 1IM3B 2X6CA 3UAFA 1F3JB 3VXUD 5IFAH 4N28A 2QZ5A 3F83A 1AXSA 4YR6A 4N2KA 1DFXA 1NGQL 1HAUA 5CSBA 2IXQB 1G9NC 1L6XA 1MFNA 3G5XB 2HKAA 3NFNB 3BWUF 1FJ1A 4Q97A 1BVKB 1PNCA 1J0YA 5H37A 5EWIH 3KPPA 3THML 1SJXA 1CE6B 1R3LB 3MCYA 5JIDA 4PG2A 5E9NA 3VD3A 3QYNA 3KLKA 2P7TA 3FB7A 1KC5L 3MJGX 2YRBA 2APTA 4K5MA 3NSFA 1DDHB 4YHYB 2P4AB 5GGVH 1JPGA 1DQDH 5HJDA 2IGLA 3BAKA 1NCJA 4MX7B 4LFHG 3MRCB 1KXTB 1HILA 1T1XA 4MCZA 1A0QH 3OF6A 3I9GH 3MZGB 3S36L 2WM0A 2VXTH 2WVUA 5A2FA 1UHVA 5DHXB 2B1OA 5KSAC 4MXVE 1UACL 5CP7A 2QLYA 4Y4KD 1DZBA 1G6RB 4G5ZL 2YJLA 3BKYL 4XXDA 3FQUB 4ZO7A 2FWUA 2XA3A 4MMZC 4LRIC 2ISDA 2R2BB 2EDEA 4OW6A 4LCWE 1U3NA 2BOCB 1J1XH 1C8PA 5HYSA 1DQVA 4ZMWA 4ZMVA 3TURA 2X5PA 3ARBC 3LZFH 2H7WA 2EAEA 3BQUB 3BKML 3QWNA 3K6IA 5SWZD 2EXSA 2N56A 3CC5A 4NC2B 1N3NB 4XNXL 1NPJA 2X2UA 2DQIH 3FTVA 3QZWG 4DOHE 1MJJB 2APFA 1MCCA 1UM5L 4CAGA 5D9SA 1ANUA 4J7RA 2CHNA 2B39A 3FCGA 3IFNH 4A1RA 2E6QA 1LO4H 2HRPH 2J1YA 2A9NL 2IDUA 2RJMA 3BEVB 1KXVA 3HS9A 4P3CH 5C6TH 4BK4A 2QVIA 3TA3A 3FOMA 4PJCB 4F2MA 5C8JB 3BP5B 3L3GB 3EAKA 5C0BA 2F68X 2V3EA 4ODTH 5FAAA 3Q44A 1B0RB 2YQBA 5E0QA 1SY6L 4KVCH 5MHSD 3GMMA 3N9GH 1YMMA 1T5WB 3BSZA 5B21A 2VL4A 1AZBA 3OAWA 2PYEE 4RMTA 3FB5A 1Q9WA 2Q86A 5EN3A 3ZKNC 3QFJB 1NPUA 2FT6A 5HHME 4AGNA 5ENWB 5ICZA 2EIZB 5K9JH 4A7TA 2JIXB 2YGOA 4KDWA 4WJ5A 5DZ9A 4AQEB 2Y6SD 4ODVL 5IREA 3SKJL 4L1SA 1U58B 2IDSA 5I18H 5KAQG 3QIWA 2CGRL 2EVGA 3FQYA 5DU7A 3QS2A 5D1XB 32C2A 4RDQF 2F8XC 1RUAH 1A6TB 3K2KA 5HDWA 1SYSA 2Q6WB 1S7UB 4F7EB 1MY7A 4IRSD 4UWQB 5GS0H 1NAMH 4OJEH 3RFRA 2ODIA 3V79C 2IOIA 1VZIA 4K71C 3NDZE 3TJHC 2VMEA 3AWEA 5K39A 3CQPA 4HP5A 1MI5D 4PY7A 5AUMB 3IAPA 5F3BB 2DIEA 3QEQB 1S7SA 4HKBA 2KI6A 4XVJH 1TPXB 4WU5B 1ED3B 4GAJH 2X9ZA 2A6KB 1QR1B 2QJDA 2YEZA 4JREC 1EAOA 4MXVF 4PJEE 4DSYA 1T7VA 5AVVB 3TZVD 3MX0A 5GHWH 5F7BA 2VDKL 3J07A 3ECUA 4I1PA 1AZCA 5FGCB 4IGBC 5BO1L 1NCBL 1BM3H 5CZXD 3SPIA 4UT9L 2A9ML 2ZX6A 3US9A 2XJLA 3C5JA 1U8CB 2BC4B 4FXKA 2CJTA 5HGDA 3P9LB 1SOKA 3KPOB 2V17H 4J4PA 3TFKC 1KPUA 4FFYH 3QPQD 2VN7A 2E27H 3FUNA 4QRRD 3GIZL 4CMHC 4LIQH 1IM9A 1U8QA 2DYPA 35C8L 3FL7A 3AJ7A 4UV4H 1MCHA 1DVTA 3FT4A 4G9FD 3IRZA 3SKNB 2ZXWB 3RIAK 4FQ1H 5ILTL 4EI5A 1OPOA 4HETA 1TENA 2J6WA 1S8DB 2R29H 1JNNL 2YC1B 1FL5B 1Y07A 2EICA 2WXPA 3SKOB 3PABB 2H3NA 3OQRA 4LF3B 1BZQK 1XF3B 4GSDH 1BXUA 2WZ6A 4A63A 1Z6JT 5C0NC 5T1LB 4R4ND 1FG2B 3A4AA 4P9ML 4B9ZA 1JAEA 1BFOB 5T5FA 2NX5E 3CLFH 2XN9D 4MAYC 3P73A 2L7QA 2LTQC 1FFRA 3TF7C 5I74C 2WXQA 1JHLL 1Z1WA 1G4MA 4H44C 2X4SA 3NOIA 4RX4D 1KEML 4Z7QE 1NCAH 3PFQA 2CBTA 5AYUL 4ZFFB 3KPQB 1WUZA 1PYWB 2FB4L 2Z3FA 4TPRL 4ZS7H 4ZUWB 3GB7A 3SJVE 5IOPA 3S34L 3S37L 1DVFB 4KGJA 1XCQA 4W81A 1KTCA 4HGMA 4ZOCA 1IL1A 3MRNA 1QLRA 1IGYB 2GYSA 3QDJD 4J8QA 5EUOB 3T2PA 3SPVB 3RGVC 3ZTJG 4XMWA 4QTFA 1ZIAA 1HH6A 1EVUA 2R39A 4QRSA 4HIIA 1DDTA 4JB9L 1IAKB 2X7LB 3VXNB 5EOCJ 3WFCH 1KYUA 2B0SH 3LKPA 3QUYA 4DZBA 2R2CA 5T1MB 3WEMA 1MCPH 1G9NH 1XCWA 2ZG3A 3FQRB 2GSIA 1BJ1J 3LVEA 5H35A 4ZOAA 1E5BA 5K9QG 1Q90A 4NOFA 5I2IA 1GAFH 1HVXA 3R1GH 1KZQA 1GTFA 2HFEB 3BPCB 4J8RA 4D0DA 2KT6A 3SKUD 5IBLD 4G9DA 3UDWA 2WLZA 1IC5H 4JM2F 3V52H 2FL5A 3OXRA 1HX0A 5JDJA 1QTYT 3HCVB 1BIIB 2G30A 4YBLC 3VH8G 2XQYA 4QYAA 5E1AA 2IV8A 5EOCH 2WCPA 1IE5A 3PGFH 5EO0B 2LE9A 4PJEF 4A6YA 4H13C 2PLTA 1BJ1H 1T6WA 4N90E 2CKNA 3CX2A 3MYZA 1B4LA 5DD6A 3RU8H 3L08A 1D6VH 4LSRH 3WNIA 2FEDC 1AGEB 4NPYA 1U93B 3L13A 5DRZB 3IE9A 4S1SL 4ESKA 3D0VB 1YMMD 3OAZH 4MFHA 4PJ7A 2WN3A 3ML9A 2E4FA 5I8CA 1RIUL 4M7JH 1NC2A 5BUGA 1JK9A 2X1PA 2HXAA 5GRZA 5F0LB 5D7LB 3N41B 5I6MA 1T2JA 2HJFB 4FXKC 1TDQA 3VFRB 2DOCA 4ZFOL 1BF8A 1BG9A 2Q8AH 1RULH 4UQ9A 4FG0A 4GT0A 1YEDA 5EU5A 4JRWA 4KXDA 3WKML 3KYOB 2P48B 3LIZH 3HC3H 1KXQA 2FJGA 1CFSB 2DQUL 2AK4A 5G5DA 4WV1A 3QHTC 1CE1H 3L4TA 4PJDA 1JZ4A 4CVXB 5ACZB 5GGSB 3HG0A 4LMQE 1RK0A 3KXFD 2A4EA 4WI4A 3ZDXE 4A55A 3NFSL 3RPIB 5A2IH 2NY6B 2GTQA 4BH8A 2Q7NA 3MA9H 4QR7A 2E3VA 1OIOA 1JPTH 3CMGA 2DMBA 4OQTL 4NPKA 4XHJD 1KNOB 3QUHA 4X8CA 3UERA 4Z7QF 4DKFH 4KK8D 1I1CA 1EAQA 5CS7A 5DZNA 4HOXA 4B60A 4IOSA 5AVUB 5DFVC 3AWGA 1AI1L 1HINH 3T0VA 3A47A 3IMUA 3O3DB 5ANME 5GISL 1JGUL 2QPDB 1NEPA 3SGJC 4FRWA 3FSAA 5D96B 3OWRA 5DUML 4QEGA 3C8KB 4K15A 1QBML 1NM9A 5IGXH 1Y18B 2N0MA 2CDFB 3ZT6A 2CLVB 2GI7A 5FM8A 5F0JB 3LPGA 43C9B 4LNVA 1A3QA 3T0WA 4BWWA 2XU9A 2W8CA 4RISH 1IQWL 4KKCC 1MIEL 1XH2A 4JRLA 4RFNB 1H9DA 3RP1A 3RWHB 3FQWB 2KZWA 4LVOC 4KZDH 3HPJA 4OZHB 3MLTA 3QIUC 3NJGA 2HLFD 3P9MA 3QHFL 4J4PD 4XCFH 2Z34A 1IGJA 3V7MA 1YPZE 2F1AA 1YYCA 5DRXB 3QUYC 2BSEA 3QA3A 4G6MH 4IJTA 4KY1H 2LABA 1F1AA 2L7JA 2Y1VA 5AOZA 5H37H 2QQLL 3IDGA 1GGYA 3MRPB 1U33A 2FJFB 1RURH 3EYSH 3CUPA 4NNYA 5JNYA 5CEZL 2O1AA 2XNAB 4HJ0D 1OARL 1E6JH 3Q8CA 4EE2A 1OXYA 5C70A 3O9WA 2YA0A 4NQCE 5KTEH 1TU2A 2X4TB 5C0FB 5KN5B 1IBZA 4KK6D 2NOYA 2B16A 3CDYA 5FUCC 2X2IA 3S5LG 4JFEA 3HG2A 3ZR6A 3WNMA 3ZKSD 4NC1E 1RUKH 2WSPA 1ZVYA 3FFCA 4M48L 3MCLL 4LSQH 1A7NH 3QIBA 4JR9H 2D7OA 5C09E 1U8JA 2W5PA 3B43A 1J88A 1ICTA 4PI2A 3BKCL 4HV8A 4XPAH 4Z7WA 4YUEL 3RJQB 3D06A 4K8RD 1M9SA 4I0PC 3IFOA 2IAMC 4HAKA 3PDOA 5GGQH 3WIFB 1VFOA 1M3IA 3WNJA 2BCKA 1BXAA 1VEPA 3NABH 3VCLB 1TVHB 3B9AA 3W11D 1ASQA 5SWZE 4ZYKA 2R1YA 1JDCA 1RFDL 4RH4A 2NY3C 3ZDXF 3S35L 4LOUD 1MJUH 4WUUD 1T66C 2Z9TA 4NI3A 2OMVB 1Q72H 5L4JA 1ILSA 3OSVA 3I6KB 1J0HA 2TSBA 3GTVA 3PL6C 4MDJB 5JOEA 5EOQL 3H42L 1QUNB 4P3DB 2X28A 3A4EA 1T0NB 2NNXA 1P5UC 1GJIA 2OMXB 4KKNA 5AZEH 4M5YH 3FUKA 2BY0A 5TTRA 3B4NA 4PUBL 3BC9A 2FQGA 3LSOB 4MLIA 4XPBH 2WV3A 1MFMA 3MLZH 4OD2A 2X6MA 3CIAA 5B7EA 1AZRA 1I8IA 3BSZH 3MTRA 5D2NC 1QATA 4XCCH 4AKQA 2VR5A 3CN4A 3VSUA 3WLBA 1RU9L 5D7HA 4OUUB 4Z7UB 1O6VA 5F9DC 1UFUA 4BZ2A 2EXTA 3BWSA 4JQIL 4TUOA 2P1YA 3HE6A 3PV7A 4ZMQA 4FHJA 5EU6A 5BRZD 1YPZF 5E99L 1ZVHA 1XGYL 4B6ZA 4KHXH 4LQ1A 5EOTB 5DK0A 1NCUA 1NTDA 5F3HB 3FPYA 5LG1A 3RE0A 3NIFB 4UMSA 1ZGLP 4AQ8C 2MPAL 1A8ZA 5CKGA 3IVKB 2MCMA 2GI0A 3L48A 4XNMB 5EU3A 5FO8B 5D1ZC 1NDGB 4PRIB 2NZ1A 1JNLL 4LLAA 5LHDA 4UV7L 4X6DE 5DI8B 3PHSA 4AUJA 1NMAH 3V4VA 4WQOA 1AVAA 1HWGB 4JN1L 4LHUD 2BIHA 4HBCL 1VSCA 1Q0YH 1T21A 2IH3A 2E7DA 2Q7YB 5JQIB 2VWEC 4JHBA 4R7DB 4PG9A 3JTSA 2FHFA 1VDGA 2W9LA 3H2QA 2NXYD 4KROD 2PPAA 4OJAA 4Z76A 4GXUN 4J3BA 3OKDA 4LBEB 3U79A 3RWGA 2W1NA 1JGDB 1ZLDA 4ZUVA 1D2PA 1LEIB 1J0ZA 4FQXB 1E5CA 4PRAB 3CFBB 3C5ZC 4DAGL 4WO4A 2TSAA 3NDYE 1PKQE 5L7XH 1ZANH 3JWNE 4QRRE 1BEXA 2C9VA 4P07A 3RWEA 2WLYA 4G9FE 3RA7L 2VLRB 3SQOL 3HJ0A 5FDWA 1EXUA 4PWEA 4FNRA 5DMGD 1N0XH 2OCFD 4RMQA 4U0RB 3CMOL 3MA7A 1UYWH 3IGFA 4RMSA 1KBGH 2ZSVB 4S0TD 2UWEB 1SRDA 4JFYA 2RIKA 4JFWA 5T5FH 1J5IA 3H3BC 1HKLH 3VMPA 4K2UL 1ZKAA 3QFDA 4XTRD 5ESQA 5I28A 4FLOA 2NY5C 1NSNL 4L3EA 1EIBA 1TQCC 1DCLA 4OCXL 1FIGL 3O9WD 3PWPD 4LQFL 4JFUA 3T0EA 1C5DB 4XP9H 1HHKA 2J8UA 4QRAA 3QISA 1R3JA 1ZHKA 3TH2T 3O6ML 2E8YA 3RAJH 1QLFA 5FFGA 2EDTA 1PLAA 5CKAA 3QDJE 4JFED 4DO4A 5C0RL 3ZLQC 4ZAKA 1H6FA 1Q0XL 4K8RH 3CSGA 2JB6B 4EIUA 1N6QH 4RQQB 3UZVA 1XB6A 4Z7OB 3LKQB 5LGKA 2LLNA 4LNRB 1UA6H 1HHGB 2NDGA 4LLWB 3U9PH 1T22A 4IRJA 2H9GB 4WY7L 1TITA 4JG9A 4OF5A 3ZTNH 4X6DF 4YJZL 5T33L 1UJ3B 4GNKB 1MQKH 5EC2B 5CEZE 1F4AA 1XDTT 3PAVA 1ZMYA 2F7RA 4L4VA 2K0RA 4O5LH 3VG0L 2F0CA 4YZWA 3KCPA 4PH8A 2BSTA 5I15H 2B15A 3BE1L 2DBLL 2ZWSA 3S48A 2DF3A 2FBJH 1QSFD 4PRHD 1AHWA 2E7LC 1YCSA 1MN4A 2F19H 4A6YH 3NZ8B 1CICA 4P4KD 4N0FA 4NZDA 5DYFA 3B9KA 4L37A 4AYGA 4ZUSA 2GQHA 1SXNA 2WLKA 2BNUA 3DMMB 3RKPA 4XMUA 2BP8A 1JMXA 1IUZA 3OJ2C 1EQWA 3PWLA 3QUMA 5BV7L 3VM7A 4KDVA 4MB4A 1BMGA 5H37G 5BOZG 2VSKB 4ELKA 4WWKB 4KUZL 4TULH 3WMQA 3R06B 2VQTA 3MLUH 4XNQA 1MG2C 3T8VA 3P2DA 4XAKD 5F0PB 3IU4H 5BW7A 1K5NB 1M7XA 2W60A 4OQ1A 2EYTB 3MNWB 5IKCB 5ITBL 1JGLL 3P0GB 5CGYC 5EU6D 4PN6A 1WK0A 3FAWA 5FFOA 3AREB 3UAEA 2VISB 2W91A 4HG4J 1I7ZB 1YEJH 3ME0A 3KYNA 3TXAA 5FOBA 3UACA 1L7IH 1VGKB 5CNHA 1LO2H 3U4AA 2WNWA 4OY9A 4LCIL 2PXYA 4WCYH 5E1QA 2C9RA 4HUUA 3LZQA 1OW0A 3X3FL 4K3JH 3KXFE 1LXMA 4Y5XB 1N7MH 5IMOA 1ODUA 2PR4L 5L0QB 5GPRA 2CR6A 3VGAC 4Q52A 1MHHA 3CVDA 5I5IA 3OBAA 2K6ZA 3ZDYB 2N7SA 3LQMA 3QZWB 3IMRA 1U8IA 1MREL 3N42F 4HH9B 3U1SL 2CO4A 3HA0A 5DYOA 1W91A 3E8UL 5F1NA 2CRIA 5IVZB 1J8KA 3N44B 4P23C 3VD9A 1ROWA 1U91B 4I2XA 3UBXI 4L0YA 4PJ5E 5HDQH 3BRGC 4Q58C 3ES6A 3O2DL 5C0CA 2JCCB 2QPUA 3TEWA 1OP3H 2QKIB 3V4LA 1HYSC 3T0EC 1WP6A 1HESA 3W82A 5I75C 2FIKA 1OSYA 2JLLA 2EDYA 2W0PA 4X42A 4N0CC 1NC4A 4FQJH 2OLDA 3FS9A 3O6FB 3Q5TA 1K4CA 3QULB 3H85A 1ECYA 2ZAGA 4POZC 3SBPA 3HNVH 4OUOA 4F8NA 1XF2B 2OZ4L 3MLRL 2JMRA 2QADD 4EAEA 3QDMA 1ZT7B 1P9MC 3Q7JA 1E27B 4UIMB 3KL3A 2VDLH 2EDNA 4YC2B 3GBMH 1ZY9A 3R4RA 4LP5A 5EF2A 2X41A 2MOVA 1EFXA 3CJJA 2Y22A 5C0GA 4HUWA 1EEYB 2BRRH 3JWDC 4N87A 4YMPA 2A6IA 1GGCH 3PDGA 4JO2H 5GRUL 4KU1A 4MGXA 4N8UA 2DV6A 3FHAA 1Z9LA 5I73C 3IMVA 2R8SH 3UO1H 1YEHH 1H3WM 2NYYD 2NY7L 1T89A 5IJVA 2ZKHL 3D1MC 2HT3D 3N43F 2AXWA 5FYKU 2Y7QB 4RMBA 3ZRFC 1IKFL 4WTWA 1GPOL 1VLXA 3NTCH 4J3SA 4O00A 2DY2A 5JIHA 1PPIA 2RFXB 4KDTA 4BELD 3BAXA 3QNZA 4QT5B 1I3GH 1MJ7H 2WINA 5CLYA 1RIHL 4KQ3H 1WBXA 1X5ZA 4WUUE 2XY1A 5IB5B 4JHUA 4IHBA 4ZRGA 2OMYA 4LRNH 3QI9B 4CKQA 2C9QA 1NBYA 3CC1A 4NSKA 4DK6A 2FH6A 1LQBC 1B2YA 1KCUH 4F8PA 1P7HL 5C08D 3DSNA 5HHOB 1OTSC 3SSGA 2A77H 5GZOA 3RDJA 4MA3A 4LLVA 1F4HA 4OI7A 3MOBL 4UZSA 25C8H 1F86A 2WKOA 2HJKB 4BKSC 1X5XA 3MGTA 1G4RA 3OMZA 3B9KD 2EACA 4TUJA 3X11B 4FNTA 1DL7H 3RDTA 4EDXB 3GSUB 2LU7A 1S5IL 1MIML 3O6LH 2XWBB 3EXLA 3FMGL 2VKWA 2WVTA 3D85A 1TZHA 3NJIA 4AT6A 1K4DA 4PJAB 1EO5A 3HR5A 5CHNB 4K7FA 2RAMA 5I19L 4BZ2H 5C0DB 4L3FA 4EVNB 5BRZE 2V6HA 3DWTA 3MRMA 2ZKXA 5DUPH 2EC8A 5J06A 4TVPL 1SF3A 3HZMB 2BRQA 1I9IL 3DTXB 5ERWA 3DSFH 2ZTBA 1H8LA 5D71H 4NNPL 4M7LL 2OJZL 5MI0C 2BVOA 3KNBA 4J3UA 4X8XA 4V2CB 4H8UA 2NY2B 2O30A 5F70A 1WBZA 1OSPH 3S3PA 2PXYD 2JF1A 4UUJA 2XWRA 1OB0A 4FCHA 4OM1H 3BFQG 2ICEB 3H9SE 4XP5L 5FLUA 1FI8C 4NNXA 3V4VH 4S1QH 2XFGB 1PDKA 4LEOA 4UCFA 5CCKH 4DKTA 4B5EA 2ZQKA 4PS7A 3VO0A 3WFEL 3VH8B 5ADPL 1V3LA 5EBLB 4J3WA 4XOCA 4GKSA 3IU3B 4ILDA 3WS3B 1VERA 5L8KB 4PJXB 1A7QL 2WLMA 1DLFL 4XNBA 3JV4B 5IBTL 1UZ6E 3DYPA 1ZLSH 4HCIA 3VXSA 1HHIB 1CD9B 3RVTC 1XF1A 2NY1D 3GI9H 3VI4E 4Y4FA 5DZVA 3VWJD 2VTFA 2WUBL 1N5YL 1LO0L 1FRGH 1CTMA 3OKNA 4I3SH 4J3XA 3U0PB 4EXPX 3TOPA 2EEDA 5A2JH 4JFFB 2JJTA 2VXUH 5L88H 2XQYG 4XAWH 4PJFB 2PABA 4JFZL 5LCVA 2EIEA 1RZFL 3M7FB 4WNJA 4X7SL 3WS6A 4ZUTA 1EERB 5EUKA 4ORZC 1LQSR 2J8OA 2B2XL 1KYOK 5T1DL 1N26A 5EH1A 2GC4C 4KDTC 4P46B 4AQAB 1CFTB 1UENA 1KJVA 3GIVB 4B41A 5IHZB 3L8QA 3NAAH 3AG3B 1TEGA 4MWFB 1N5AB 3WN5B 2KZ1B 2EECA 4P48A 4H5SB 2HPTA 4ORGA 2CM6A 3NEXA 4Q4EA 1SDAB 1CLYL 4E36A 4UOZA 1MUJB 4JGJA 4NKDA 3KPMA 4HT1L 1FNGA 3ILQD 2G5BB 2BMKA 1FVDA 2MQCA 2E46A 4JFQA 1KTKE 5I30L 1N59B 4GUQA 4WEBH 5I6XB 2DIBA 3TL5A 3GSQB 4AC4A 5BUAA 4MASA 3ULUD 4WW2B 5KVGH 3PWPE 4EIGB 1T7XA 1GTNA 1OM3L 1NUFA 2XQBL 5J13B 5I5JA 3EFFA 1PZAA 1A3RL 1N70A 1UXLA 3KBHE 1G7HB 4NO0B 4HC1A 2Z31B 2WZPD 1URIA 1OAUL 2OTUA 3VFWA 5JTWA 4GOSA 3EGSA 3SKMA 1FGNL 5A7EA 5DK2A 4XX5A 3WD5L 3VXPA 3IGAB 2K6YA 5K9KA 4J39A 4KJYA 4P4RA 4WW1A 1WCBA 5TK2A 5AVSB 3D07A 2V7NA 3EYQC 5I1AA 2QFRA 3BVNB 3LNEA 1HHHB 1NFDB 3V4UH 1CDHA 2VN4A 1ZSHA 4AV5A 1IEAB 2FUQA 4IIZA 2X4QB 4WGVB 4NO2A 3LZNA 3ISRA 4HF5L 5I0YA 5FKAB 3TNMA 1P84J 5J9PA 4L3CB 4KJWD 5B39B 1TQTA 4K73A 2X4RB 4N20A 5I82A 3P40A 4OT1L 3L2MA 3PNWB 4NN5B 1X4YA 3AMLA 4YNYA 4QRTA 3JWDH 2ERJB 4RWHA 5L6YL 4PS8A 1SVZA 3L4CA 4K07A 1QRNB 5E8PB 3RX8A 3KYKL 3CSYB 3WO4B 3T4AC 1QKZL 5GZOD 1XIWD 4HLEA 1YRKA 2ICWA 3HUJB 4ZTOH 5IQ9A 1OTUC 1UUSA 1JPEA 1UZ6F 4PJ8C 4IDJH 2EDRA 4A68A 3VI4F 3DNKA 3AROA 3NJKA 4JO1L 2ADIB 4KXZI 3UAJC 1JHTA 3QUMH 3SPGA 5JMRA 1KB5L 3DIFB 4N9GA 3V0IA 5BXFB 5KSUB 1QLEH 3RDTD 2FX7L 4JK0D 5E2WL 1KULA 3S5LB 15C8L 3FHQA 2PO6C 3BAEL 1ZTMA 3D85D 4MJID 2AXGA 4LOFA 5ESAB 2FWOB 3P0YL 4NUGH 1U95A 5I1JL 3W38A 3DOSA 4TQEL 3HG1B 4A38A 1CIUA 4NJ9L 4QXTA 1LE5A 4NKMA 4FG2A 1SMAA 2KERA 3C6SA 3HIZA 3PXHA 2TAAA 5AYQA 3UYRL 1WFNA 4R90H 3BD4A 3FQXA 4ZMNA 4NBYB 5EBMB 1AGDA 3SDDB 5C0JB 2ZX9A 3DVGB 4CNIB 2YPLE 4PRPA 5F97E 1CTNA 5F89B 5IVNA 4G6FB 4RIRA 3F7RA 3TWCL 1NBZB 1BD2B 1ZA3B 3FUHA 3O8XB 1ET7A 4Z95L 1E5AA 4BFKA 4QXUH 1OPGL 5KOVC 3OAYK 3GUTB 1RL1A 3L4YA 5DXWA 5IT2H 4XT1C 4JJ5B 2CPCA 4ANKA 1TEFA 1F1DA 1J5OH 2Z92B 2VITA 1FL6B 2QQKL 3FT0A 3VXUB 5BS0D 5CSGA 1RZJC 1NFIA 2XN2A 4WEMB 4P5TC 5TH2B 3RWFB 1OAYL 1UM6H 4IMKA 5GS2D 1JXJA 4NQXA 5J6GA 1JZHA 3ULUL 5C6PB 4AJWA 2QTEA 2UY7A 7TAAA 2VB5A 4TVPE 1EK3A 2ZCHH 3QYMA 2R2EA 1FFOA 4GXUM 1E50A 4HUXA 1DO6A 2PCPB 4Z3EA 1DUYA 4GRLA 1KIPA 2OFQA 2E7BA 4MJ2A 4KQ4H 4P2AA 4PJ9A 3MRDB 2QEJA 4HS6A 5L2JB 4HWBA 5E94B 2VDKB 3WJJC 2AV1A 2PYFB 4UYQA 2ED9A 1RUML 2ZUQB 1SOSA 4FAAB 4TSAH 1CU4H 5A6MA 4C56D 1CT8B 4OGAD 4PJBE 1CFNB 1ZS8B 1FIEA 2A99A 2ENQA 4TUKH 4Y4KB 1I7TB 1VZGA 2ZOKB 1JXGA 5E8OB 2Q76B 3UTZB 1KGCE 1UVQB 1T5XB 1ZJBA 3HHSB 1BVNT 3NIGE 3R8QA 2ZKYA 3RUGE 5ESVB 4GQZA 4HSCX 2WXFA 1W72A 2MMXA 5JHMA 1TQSA 1E9QA 2GBAA 4EN3A 1XMEB 1JWUA 2ALAA 3FQTB 2FO1A 1Z0MA 3NPSB 3LKNB 5GGVY 5PCYA 5FWRA 4QHPA 1AD0A 3L3JA 3TP4A 1GZPB 2P3YA 3D2UB 1TVDA 4HFWA 4Y2OB 2N7AA 3BD3A 4F7TA 2K3TA 3MNMA 3WEBA 4HLJA 2XC8A 3WEOA 3C5SA 4S1RL 3DBXA 4C54A 3RGBA 2D3LA 2D3NA 1U92A 1J8HA 5LBSA 1HZHH 4M5ZH 4XPFL 5L9DL 2J2ZA 3F7YA 2AV7B 5CEYA 1LEKB 1KBPA 3UP6A 4ZXBC 3B6SA 4L4TE 5IG7B 5IIEB 4Z7UF 1KBVA 3QK0A 2YPVA 2G3ZA 3CFJB 4MXWL 3INOA 1KGJA 4DN3H 1MWAA 5CLXA 1J5CA 1UZ8B 2PPDA 3QJFB 1VFAB 5BZWA 2MNJB 4GKZA 3NCFB 4WRLA 3FU5A 2WIIA 1HE8A 3MJ8B 3F58H 3VQLA 3MRQB 3VXMA 4ACTA 3MV7D 3QWOB 2UZIL 4IMLA 5EG6C 4A04A 5I1EH 1H6EA 2M8XA 4WKZB 4G7VH 4JFHD 1KIUB 1INDL 2VE6B 2G75B 5GGUA 4IRSB 2D7QA 4NZRH 4HGWB 5I1LA 3DURA 3D52A 3IWUA 1E9PB 2G2RA 3DJTA 5AW3B 5IQ7H 4ODSH 3SE9H 2OR9H 2Q87A 1IZKA 1YEFL 2WGNB 4LSUL 1XAKA 1MI5B 3GZOA 1XGZA 5AZUA 4XE5B 3DARA 5DSCA 1BJMA 3WO3B 5D7JC 1USZA 2XFXA 2YBGA 3KJ4C 5LG6A 3W5NA 4FADA 3KLSA 1E2WA 3L1GA 3SZKC 4U3XA 2XVKA 3GO1H 4PP1C 2YUVA 3MMEB 4JG1L 2J1ZA 3DBSA 1I1FA 4QMEA 4PJ9C 4PJBF 3ARFD 3FCSB 4ZQKA 5CD3B 5FYLH 1WZKA 2VLJA 3HBZA 3OGOE 3ULAB 3J7HA 3NIGF 4AYEC 3MLSH 4K9EL 3RUGF 5IEKA 1BAFL 3TESA 1NKRA 3F00A 1PNDA 2EH8H 4L5FL 3CXHJ 2K70A 2Y2YA 1PIGA 1AQMA 5E1GA 3AAZA 3FH7A 4R96B 3ZRSA 2BWDA 4Q0XH 5EFIB 2IANE 5EWIL 3B34A 4E41E 1GS6X 2NW3B 5JHDA 4KZ0A 3V0WH 5DLML 1DE4A 4CDHA 1ZVSA 4UDUA 2YKKA 5GS2H 4JMNA 4JE0A 1NWPA 1NGPH 2VDNL 4PJHB 1G7PA 4W93A 2Y36L 1G0XA 1LO5A 2H1PH 5F1IA 4QHKJ 1C7TA 4BKTC 1MPAL 5CCJA 4QKXB 4LCYA 1AHMA 1GC1L 1ID2A 2A0LD 2OXGA 1PKOA 4DHLA 4UQAA 3BUBA 2Q5BA 3MTXA 4X9GA 3S98A 1PAZA 2ESVD 3PWVA 4G80A 1IAOA 5LCVH 3KPPB 3AUVA 4GG6A 4U2YA 2XN9B 1E4WH 1JGVL 3NK4A 2P7TB 3LEYH 5C9JA 5J12C 1H8OA 1B2WH 1J87A 2EP6A 2BNRA 4YO0A 5IESL 3ESVF 1C8QA 2UUDH 2EUZA 1UC6A 4RWYL 2V5MA 2G2NA 5IBUB 3OB0H 1DJIA 1RZKC 2Y69B 1PEZA 3CFCL 1HILB 4WKXA 3TO4C 1WTGT 4G3YL 2Y06H 3WJMA 2JB5L 2Y7SA 3T77A 4FZ8H 4F3FA 2BS9A 5ID0B 2XRAH 4MXQC 4W4OA 2VXVH 4GUPA 1OAJA 5CP7B 2VLMD 3BZEB 4MAUL 2HVBA 1BVNP 4CVUA 3DX9A 3KGTA 4LZKA 1PLBA 4XXDB 2HRHA 5HHPA 1MFAH 4LVHC 1D6EB 1EJFA 3ULUE 3BIBX 2I85A 1NGWA 3IXAA 4JFDA 5IROA 3U0WH 2CK2A 2LHAA 1KJ2A 5TFSL 1IGFH 5D1QA 4EN3D 3GSXA 4LT7A 4HC1H 5KW9L 2ITCB 1WZAA 5B8CA 2VC2B 5C86A 2C1OA 4XMZA 2VERA 1NUDA 3CSTA 2V9UA 3CC5B 4LSVH 4MYWB 4YHKH 1T3FA 3WY2A 3N06B 4KVCL 1MDAA 5DD3L 5ICXB 3TPUA 2XTJD 5D9SB 5TQ0H 1UASA 1F2XK 3Q01A 1EAPB 1U6AH 3O4LA 3HLAA 4D0BB 1MRFH 2ICWJ 2VSMB 3TCXA 4F2MB 5FR3A 3AQYA 3VXOA 3ESOA 5C0BB 5E4EC 2GABA 1B90A 1E2VA 3V55A 1VIWA 5I18L 5IFHL 5D2LE 2KDYA 2A38A 1YMMB 3WIIL 4JKWA 4UQBA 4N8VA 4NRYA 5JZ7C 3FB5B 1Q9WB 2VRKA 4JDEA 2Q86B 4G1MA 1NAML 5ICZB 1NANH 1T04A 1NCGA 3IDYC 1GZHA 3U1QA 5ES4B 3HMXA 4J23A 3NSYA 4WJ5B 4LGPB 1GKOA 2FEJA 3A24A 2CG9X 4RMVA 4WI0A 3BO8B 4YE0A 3F7VA 5I0DA 4DGWC 5K33A 4U6TA 1A14H 32C2B 1VEMA 2P49B 5AWNL 3T3PB 1U8MB 2F8IA 2IFFH 2OI9B 3V4PL 1IFRA 1G9MH 2AXJA 3L6FA 3L4ZA 5AW0B 2AABL 3KGUA 3P1VA 4X6EA 3BFOA 4F80A 1EHXA 2YA2A 2H0FA 1W16A 5EBGA 5MENE 2MNUA 3CFNA 5K39B 1EA9C 1TVBB 4HWNA 4U49A 1MFCH 1S7SB 2I5YL 4HKBB 3TN0A 4UOQA 3ARBD 1XR8A 4F5CA 1R19A 4ODHL 4XWGH 4B0MM 2V17L 2D7TL 2NQDA 4JQVA 3G7TA 2OYPA 1IFGA 1AY1L 1Q1JH 1THCA 3MGOA 4PR5B 4GQ9H 1SYVB 3UYPA 3LS4H 3SZ6A 4FL4C 3RVXC 4HKJA 3ULUF 1O7SA 1S7QA 4XN4A 3BXNB 2IEPA 3ETBJ 3C5JB 3FUMA 5EEYA 3S9DB 5HGDB 4X4MA 1KEGH 5BS0E 4UU9A 1KPUB 3HBGA 2JFCA 3ULVC 3BIAX 3T3MB 3K1DA 3T6WA 1IM9B 1U8QB 3J27A 4LOEA 3GS4A 3RY5A 4NFDA 3F85A 4OFYA 4YOKA 3FT4B 2MCPL 4HHAA 1W15A 4KKBC 1OGAA 2Y5QA 1BEYH 3GEFA 2WXIA 4LBAA 4UTBL 3ZKND 4MQTB 3MLYH 3FQNA 5G4NA 4YSSA 2GC7C 2H3NB 4BYHA 1JERA 2CO6A 2ZXAA 3UEQA 1SEBA 4KMTL 3T2NL 3SQBA 3RL2B 3L5HA 2GTZA 3P73B 3FFDA 5EZOL 2NNRA 5D2LF 2W9EH 2BNRD 1R24A 4HWBH 4FG4A 3BSHA 2X4SB 1TQVA 1FZOA 4Y88A 4L5FE 2B0SL 3D50A 4IRZL 1HSBA 2W0KA 2WNGA 1E8YA 4Z7VA 5IOPB 3GB7B 2X4UB 2P5WD 4BK8A 1XCQB 5DEGA 4AEIH 4BUHA 4DPCX 1IL1B 3MRNB 3R1GL 3ARXA 4H8VA 1MFUA 4NFBA 3MRJA 1XGPA 1U3YA 4V1DD 1HH6B 1W72H 1YJDC 2EE2A 1FYTD 2HVKA 1OCWL 2PWDA 4QRSB 3BHBA 4HIIB 5ICUA 2KLRA 1YHPA 2GJ6E 5CZVH 3BMWA 3AT0A 5CINH 2EVFA 3LKPB 3B5GA 5D5ME 3SO3C 1XR9A 2PP8A 3TNNB 1BQUA 2GSIB 2Y4SA 4GEIA 1EZSA 4I18A 1JZEA 2VR8A 3D69B 1GIGH 1H3GA 1OANA 3OSKA 4FD0A 5D6DC 5BRQA 3SO5A 5HI4D 5IW6B 4JCMA 3LNDA 3TF4A 3SCMC 1KN4H 4PV8A 1UD8A 3GMRA 4D0DB 2B1HL 3EOBA 3CHRA 4FFWC 4O4YL 2WGXA 5LBSH 4KKLC 4WHCA 3OXRB 1T4KA 2NT1A 4Y2DA 3F84A 2N59A 3L3HA 4Z7NE 5E1AB 5FLVA 3TVMA 2EILB 4M7JL 3APFA 3E1F1 3HI6H 5E2UH 4KPHL 1M42A 4UINH 4DNLA 4G6KH 3OKKA 2YPVH 4Y0GA 3K5RA 4RGNC 1JYXA 5AB0A 5DD6B 1FC2D 1MWAH 5CN3A 3E9UA 1FUNA 4ZK8A 5I66A 3GMPB 5D6CA 4NM8H 2ZCLL 3OLDA 1A9VA 3CHOA 5IK3B 5EEWA 4M7ZC 1DQTA 1QHQA 3LEVL 2X9WA 4MNQE 1MCEA 4PJ7B 2PTUA 2X40A 5DWPA 2OJ1A 5EORL 4W9HC 1DVSA 4MAYD 5EO9B 4LCCB 5I8CB 5DD5H 2GIYA 1NC2B 4QHNA 1DP0A 4XCNA 3N5AA 3QUXA 1UWGL 4GO6B 4YXKH 4WGKA 2XZQL 1OOWA 2O6FA 4Z3IA 1SBSH 3TASA 3U2JA 1XH1A 3KL5A 2I7SA 4WWID 1I1AC 2K4WA 5HGAA 3H4FA 3NCCB 1P53A 4JFHE 1OGPA 5E5MA 4RETB 3OZKA 4U1SA 1BF2A 1YEDB 5EU5B 3WE1A 3EOAA 1JXKA 3K1KC 4XP4H 1JXFA 4Q89A 3OHXA 1HINL 1NIBA 3QO1A 5CGTA 5I1IH 2FJGB 2AK4B 5G5DB 4WV1B 3ZYJA 1F11A 2HUHA 2EINB 4HIEA 1F90H 4M1GL 4MKTA 1FLRL 1NCWH 3QPXL 4PJDB 5EHFA 2Q8BH 1RK0B 3HE7C 3T2LA 1AMXA 1WFJA 1BOGB 4PLKD 1FVEA 4BH8B 4Y2NA 2SEBA 4XWOC 1AS7A 1E5UI 3VGFA 2FJHA 3CPUA 4WFED 1TTAA 4BFJA 2XKUA 4OIAA 3U83A 3HLKA 1JF6A 3BJLA 3NEEA 3X1BA 4DAGH 5K9OB 4AW7A 2ENJA 2OULB 3TN0D 4DEPC 1YNKL 1I4FA 5E8DL 2RTTA 5D1ZI 3PJSA 5I8OH 2WXJA 1N68A 4KROB 3BFWA 4AKPA 3IJ9A 3ATDA 2C7FA 1FGVH 3CE1A 3F6LA 3QG7L 2GB2A 2FYYA 5IB3B 2JJWA 3MREB 2CUAA 1QWNA 3ILPA 4B95C 5J56B 1QZ1A 1I53A 3RWIB 4PTTB 5F7FA 5M95B 2HX9A 2H3XC 1OY3B 1WAAE 5D5MF 5TE6H 3BGFC 4MMYB 2HRGA 3WFBL 1SXCA 2EO1A 3ZDZE 4K7PH 3HPJB 4L8SA 4PV1C 4BFFA 2ATAA 1CB4A 1YEGL 5D7SH 5FGRA 1JWSA 2FEDD 4X4YA 4JFTA 1IGJB 4TLSA 3DUHA 2HH0L 5L2KA 4HALA 2FTAA 2DLFH 4YHNA 3CHPA 2ESVE 2PWFA 1OGAD 4OIIL 3A6OA 1ZTXL 4Z7NF 2AEOA 5B1KA 2EC9T 2KQMA 1CC3A 2C3GA 2C34A 2VDLB 2Z0UA 3L7EA 1LD9A 3NK3A 4JDTL 4TL5A 5I1GL 2H6PA 3IDGB 4U1KA 4N2CA 4U1NA 3OZ9L 3VYOA 2IVFC 3H55A 3CUPB 4NNYB 5JNYB 1W0WA 3E2HC 3VSTA 4UBDC 4OLVH 3CDFA 3GRBA 4GMSH 1F3RB 1FBIL 2H47C 3O9WB 1TU2B 1I1YA 2HJLA 1XSIA 4OM0H 5INCA 4K9JA 3QQNA 1MFBH 4LPUA 1UD4A 3LNHA 3FKUS 4JFEB 1NFDF 4WI9A 2M2DA 4HS3A 4WHTB 4XNDA 2EDWA 3QIBB 1DN0B 1HL8A 4JUSA 2O5ZH 4BKLA 1U8JB 4M62H 1CXIA 4BFGA 3NACL 4HV8B 4YHLL 4Z7WB 4ZFGL 3ROOA 1CDCA 3D4GA 5FFLA 1U41A 4NENA 5DFVD 4YGAB 1JUFA 1HE7A 5MEPA 3LEXA 4XI5C 3PDOB 1RK1A 2W88A 2YD3A 5FV1L 1KJ2H 2BCKB 1W6WA 3SDCA 3ZZQA 3QJUB 4NO5A 3MBEC 4ZYKB 2R1YB 5DJ6B 3CPLA 4LSTL 2LU3A 2IJ0C 2V37A 2AJUL 3EGDA 4JY5H 1K8IA 2KUTA 3ECVA 4DETA 5CMAA 5D7KD 2B9BA 2XTJE 4KKCD 2JXMA 4RNRB 2YUZA 2JTDA 3QNYA 4ANWA 1QSFB 3L1EA 2X12A 4PRHB 2OP4H 4PAZA 3ORJA 4NJAH 5C3LD 2J88H 1R0AH 3BVWA 3FH5A 3TVMD 4PWFA 1JTOA 2YLHA 4KHXL 5D7EA 5HVFB 3OC5A 4OD2B 4X4XA 2ADYA 2HLAA 4XB8A 1LDSA 2YXVA 3I6SA 2KHAA 1I8IB 4KKZA 4CVZB 1B0IA 1WAAF 4FGMA 4LASH 3WEAA 1HEHC 1KJMB 4WJG3 3WLBB 2OAAA 3DGGA 4R97C 2DMCA 3ZDZF 5CFHA 5EF0A 5JPNC 2I9TB 2RCSH 3HE6B 4OKVA 1A6WH 3P4MB 1J0KA 3UROR 1CDYA 3HMXH 5EU6B 3U30B 4JANA 1A4BA 2WB7A 3HMWL 5F8QC 1U3HC 2X4NB 4ENZA 3ZXAC 1NMAL 3QUXD 4KVNH 5DK0B 3QRFM 3B8SA 4X5WB 1ES0B 4YX2L 2JWYA 3T71A 5JR1H 1A4KA 2V5TA 3R0MA 2HWZH 2DQTL 2X3CA 1G7QA 5T5NF 3QJHA 3EBGA 4NQUA 3ZE2B 2E9WA 3GSNL 1SBBA 3HC2A 2FJSA 5DEJA 4QLRA 2VW4A 4BDVA 3TBTA 3WDHA 4QHMB 3BMVA 5C9KA 1JCVA 2UX6A 5CBAA 3V4VB 1HQRA 1L9RA 4X6CE 2UV3A 4FXGA 5FIEA 2IDCA 3MRBA 1M2VB 1T21B 2IH3B 3DV4A 4L3AA 2ZAHA 4AM0A 3L7FA 2YD0A 4EKXA 3RWCA 2NY3D 3RWDA 4NWTL 2D9CA 3KGRA 4PG9B 1T66D 1OOAA 3JTSB 4P99A 3LHPL 2XV0A 2YD7A 4ZOEA 3PL6D 1MWOA 5IJKA 1VPOH 5D8JH 3VB8A 4TLUA 3BZFA 4FQIL 3UADA 2ITEA 3OKDB 3LD8B 1ACYH 3RWGB 1M1SA 3RVVC 4ZUVB 3CZFA 3O2WL 4HXAL 3E38A 3BUPA 2WQ8A 3ZO9A 1YNLL 3IYLW 3GTNA 1A64A 5CWSB 1UT1A 2XTLA 3LRKA 3DX7A 4HQQL 5DMYA 4P2QD 1JK8B 1VKXB 1NIFA 2IGTA 3WV0A 5FDWB 1EXUB 4ZSOA 3HW7A 4RBPK 5L2KD 1X4XA 3HB3B 4M6ML 2EE3A 1GGIL 2XG5B 1SJEA 5IY5B 1FNHA 2KBGA 1RK7A 4PCSA 4MZ2A 3SE3A 1M71B 1CVSC 4U6XA 1SJMA 2FD6L 4JFYB 5FEBA 2GSGA 3CG8A 1UA7A 1XH3A 3QQ3B 1WJ3A 2VRQA 4Q9RL 5ESQB 2F5BL 1EMTL 2QFPA 4HUKB 1J1PL 2ZXDA 3JYBA 1ZLVK 1UD6A 4P9HC 4BQBA 1GGBH 3DPDA 4Y7OC 3PIQA 3DUUB 3K8KA 2NQ3A 4F9LA 4G83A 4UB0L 3HNTH 3ZKQD 1HHKB 1L7TL 2J8UB 1ZHKB 3ZOAA 4DESA 1RPKA 1QLFB 3MFFA 3S96A 4CC0A 3FDWA 5CJXC 1NBVH 2DQDL 1TKWA 4ZAKB 4RGMB 1G5GA 1WS8A 4QOKD 4V1DE 1CURA 3FZUC 2BVYA 1IKOP 1A4CA 3OG6B 3NCYP 1T2QH 3ZUCA 4Z3HA 3ILEA 1JRHI 1YY9C 3UZVB 3A23A 3ZL4L 4TNEA 3L2NA 5JOPD 3EOTL 3U4BH 4O02L 2FE0A 1CD1A 4ERSL 4IRJB 2QV4A 3GJFA 4PW3A 3SDCD 3QQ9D 2GJJA 4PP2B 1E8ZA 4ELMB 2P44B 2R2HA 3QARA 5C08B 4X6CF 1TTFA 4JM0A 2XZCL 5J4MA 4YDZA 1JHKH 3AS0A 3BVUA 4Y1AA 2VDRL 2BSTB 3HI5H 3L5WB 1Q94B 4G42A 3S97C 2D4DA 5L4FA 4JZJA 2PWGA 2XZZA 4OLWH 4TULL 1I9EA 1OALA 4Y16C 2YK1L 3GC3A 4ISVA 5FHAH 4G6AD 1A6ZB 5CO1A 3U46A 2FT8A 1CICB 5LO7A 4IW4C 2DJMA 4N0FB 1LNUA 2BIMA 3B9KB 4L37B 5K1NA 2BP8B 1FO0L 1I8LA 1QVOA 2CMRL 4G43B 4NZTH 1FCCA 3QUMB 1WAPA 1X6NA 4HPYL 1QLEB 1OE1A 3T04D 3FF7A 4ELKB 1C1EH 4R2GC 4GI9A 1QNZL 4K3JL 2BVQB 4MA1B 3PU7A 1N7ML 2W60B 5HDOA 3N91A 3ZX1A 3KWTA 1FZKA 2WQWA 3C12A 3QZOA 4B7IA 4TTGA 1UGNA 3FB6A 1AKJA 3SDXE 1NKOA 5E24E 5E5UB 1QD0A 3HRZA 3US0A 2DEYX 1ZLEA 3ME0B 3KYNB 4UQCA 3VA6A 5E6ZA 1OWRM 4MNGB 5AG9A 2PXYB 3EGXB 4AIZB 3LY6A 4HUUB 4MDIA 1CLOH 3L45A 4JPWH 2DIAA 3TT1L 4PGDA 5IMOB 2VQUA 5F6HJ 2DJUA 3CIQA 4U7KA 1BBJA 1RUPL 2WBKA 1MHHB 3ELQA 2ZF8A 4ADGA 1NUNB 1XT5A 2AERT 3Q8BA 3TV8A 1DLHA 1OAZH 4FQJL 4W9FC 1F4YH 3QZLA 5ICYA 1KB5B 3VQMA 2Z8WC 4NC1C 2E6JA 5ANHA 3RTQC 5KG9A 1MLCA 5F1NB 2NUTA 1J5HA 3S88H 2W38A 4Z0BL 3IPBA 1KGYE 2DJ4A 2XSKA 1J18A 3VFGH 4PWHA 5I8KH 3DETD 4K3GA 3ES6B 2NY1B 5C0CB 4N2HA 3VWJB 2W0FA 1GYVA 2OX5B 1JVLA 4YDKL 4F9LC 3L17A 1URLA 3A6CH 3DKHA 4M8RA 2FIKB 1AXIB 2DQGH 2W59A 2P8PA 3ARGD 3DRTA 3KDMA 4I5BB 1NC4B 4MCNA 1OT4A 1W8EA 1ZD6A 4OLYL 1THAA 5DVMA 1EFQA 2MCG1 2YN5A 2EVIA 3NCMA 3FH8A 2WQAA 3L9EA 2JKLA 5IB1A 5GRJH 2IPTL 1NIEA 1XD0A 4IEFA 5FKPA 3FU7B 1I3RA 3I2CL 2XZAL 4UANA 4KZCA 3BPLB 4XODA 1GGCL 1WZLA 1F3JA 2V2TB 4UNIA 3MV9E 1D9KD 4N8VG 1DVZA 4DEUA 3IDIB 5DQDH 4DK5A 3UTSE 3RB7A 4F2FA 4LKCA 3NPZB 1HTYA 1TFPA 5AAWA 3NFNA 4FLRA 1ZE3H 4UMGA 1BVKA 5C0GB 4HUWB 4LU5H 3TT3H 1BHGA 1MNUL 1TJIL 3CU7A 5D4HA 4Y5VC 5FW8A 5JIPA 4AW4A 4HSAC 4KX9A 2OCCB 1DQLL 2A6IB 4AZUA 2X4PA 5TQ2L 3GINA 5HHQA 1VGEH 1DDHA 3JVGC 2ARJQ 4MX7A 1MF2L 1QPKA 4NPJA 3T0DA 2F58L 2FJUB 5IHUL 4KITB 3DVNA 4UAOB 3B7RL 3OAUL 1KXTA 3P3YA 5CIPA 3NA9L 4KFMA 1TSRA 3IF1A 3SDXF 5SX5K 1TZAA 1E5ZA 2P80D 4MA7H 3A3YB 4FG6C 3M1CA 43CAB 4KK5D 1C5CH 2JJUA 4P23D 4HULB 1I8KB 2W81C 5IVOA 4PY8J 5JA9A 4K3DH 2QDVA 3FQUA 2NY5L 2WOBA 4JUTA 4QTIL 4S2SA 4YAQB 5BUPA 1SUHA 2FR4B 4N9OB 2BOCA 4YPJA 1BZOA 2FO4B 1WBXB 2XPGB 3DECA 3VB9A 3MODL 2H1LM 2OMYB 2FEEI 4GQPH 5D7KE 1NBYB 3B1UA 3BQUA 1AJ7H 2WQUA 3CXDL 4PB9L 3DSNB 3Q5OA 1J05A 1MH5A 1WC7A 1N3NA 3AU0A 1MXDA 3OKEA 5SX4I 3VWKA 2RMNA 4FA6A 4MA3B 1OQXA 3BP4A 3MAWA 2J3SA 5JLZA 1CDBA 5EZJB 5F6IB 1NDMB 2B3IA 2VDOB 3MGTB 1INEH 3BEVA 2FR4A 2V8LA 1WRFA 4ODXA 1OD9A 3RDTB 3L3GA 4M7KL 4I0KA 1BM7A 5D71L 1M1XA 4LB8A 5JXAH 4OSUH 3W0WD 3N0PB 4MJIB 3D85B 1ZHBA 1TZHB 3WIHH 4AT6B 1K4DB 1T5WA 1ZLWH 4K7FB 2KPWA 2CDGA 2APWA 1LWRA 3MRMB 2ORBH 3VI3E 5JDSB 3UYOD 3LN5A 3UAAA 5MEOA 3BEWB 5ENWA 2ZWLT 3OB8A 5FUCE 1EDYA 5IMLA 3ARUA 3P69A 1TT6A 3P30H 2VLKA 4GRMB 5DMJB 4AEHL 4AQEA 4N24A 4GI8A 1TQBC 3L3DB 1Z5HA 1PSKL 1X44A 5HI3D 2QGDA 3H7LA 2G9HA 1WBZB 2RALA 3C08L 3LPOA 4UUJB 5CJ8A 4L8CB 5A2CA 1S7UA 3N1GC 4E0RB 3EUUA 4PB0H 4HU2A 1BBDL 1FRGL 2GIMA 3G5ZA 4I3SL 4NNXB 1PDKB 5AAWC 2XDHA 4J3VA 1L4IA 5KBMA 4XAWL 5ACMA 4HU8A 4HOWA 4L9LA 4IBWA 4X5LA 1N6VA 2BH0A 3FXIC 2ZUSA 2EUWA