2ZWNA

Crystal structure of the novel two-domain type laccase from a metagenome
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
AEREFDMTIEEVTIKVAPGLDYKVFGFNGQVPGPLIHVQEGDDVIVNVTNNTSLPHTIHWHGVHQKGTWRSDGVPGVTQQPIEAGDSYTYKFKADRIGTLWYHCHVNVNEHVGVRGMWGPLIVDPKQPLPIEKRVTKDVIMMMSTWESAVADKYGEGGTPMNVADYFSVNAKSFPLTQPLRVKKGDVVKIRFFGAGGGIHAMHSHGHDMLVTHKDGLPLDSPYYADTVLVSPGERYDVIIEADNPGRFIFHDHVDTHVTAGGKHPGGPITVIEYDGVPVDDWYVWKDKDYDPNFFYSESLKQGYGMFDHDGFKGEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords two-domain type laccase
publication title X-ray structure of a two-domain type laccase: a missing link in the evolution of multi-copper proteins
pubmed doi rcsb
source organism Metagenomes
total genus 98
structure length 317
sequence length 317
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zwnA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zwnA02
1BQ5A 2WO3B 1JZGA 2AANA 1ADWA 3FYIB 2ZXWB 3IEAA 4G7SB 3FQ2A 2XV0A 1KCBA 1NICA 4K9JA 3NJKA 1AZNA 2FQDA 5B1AB 2MTAA 4HCFA 1BQRA 1L9PA 2CAKA 2BHFA 4BDVB 1V10A 3C75A 3FU7B 3QJVB 3NT0A 2Y69B 4YSSA 4KNTA 2EINB 5I6KA 3NJIA 4G71B 2IAAC 2IH9A 4KO7A 4A66A 3NP4A 2XX1A 1E30A 2XXGA 1MDAA 1NWPA 4E9XA 2GSMB 4P5SA 4DP6X 1M57B 2PCFA 3FYEB 1PLBA 3NJMA 3T71A 2IWEA 2OCCB 2GIMA 3S3DB 1ZDQA 1PZAA 3ABMB 2PPCA 2XUWA 1TU2A 4GXFA 2BW5A 2UXVA 2ZONA 1AS7A 1PZCA 2IDTA 2IDFA 3ZX1A 4DP2X 2B08A 3TBBA 4NB7A 1GY1A 4GY4A 2YAFA 3OM3B 1MZYA 2B3IA 1W6WA 2VMJA 1FFTB 2H5UA 3IN2A 2XU9A 3HB3B 4KNSA 4A2DA 2EIMB 2PPAA 2GHZA 2YQBA 3AG1B 1SDDB 3L45A 4E9TA 1XMEB 1XB6A 1CYWA 2PPDA 4F2FA 4E9QA 1OOWA 2LLNA 4JHUA 3X1GA 3S8FB 4Q8BA 3FQYA 1A3ZA 4W9ZA 1OV8A 2YAQA 3WNJA 3D12B 4DP0X 1DZ0A 4DPAX 4M3HA 1GS6X 1NIAA 5I6OA 4L0PB 1IBYA 3QQXA 1RCYA 2RACA 3GDCA 3SBQA 4G7QB 3CG8A 4GYBA 4CSZA 1L9OA 1SNRA 1PMYA 3NJNA 2VW7A 3CDZB 4A2HA 3PAVA 1PCSA 1PNCA 1OF0A 1NPNA 1BYOA 2YAEA 2H47C 4UF7C 1J9QA 3FSZA 3FT0A 1ASQA 1ET8A 3U25A 1PZBA 1WA2X 3ASOB 3ABKB 3G5WA 3X1FA 1PLCA 3N2JA 4AI7A 5AFAA 1CURA 2YAMA 1L9TA 3FSVA 3KW7A 1ASOA 1L9RA 3H56A 1BEXA 1MZZA 3CVBA 2J55A 2PP9A 2HZHA 2XWZA 3ZDWA 2DWTA 3FPXA 3UABA 1OCZB 2R7EA 4YSOA 5B7FA 4AKQA 2QT6A 3EH5B 4N8UA 6PCYA 1SHWA 5EHFA 2BP0B 1GW0A 2GI0A 1JVLA 1KBVA 2IDSA 2Y1AA 3OQRA 1TKWA 2QPEB 1NINA 2CBPA 4NERA 1WS8A 3GYRA 1ID2A 4BWUA 5I5IA 1OCRB 2BP8A 2JXMA 3NJHA 1PY0A 2FWLB 1EZLA 1AZCA 1MG2C 2NRDA 2IWKA 2PCYA 1ZV2A 1J5CA 1NIBA 2IH8A 1WAEA 4HCGA 5I6MA 5I28A 1X9RA 1WS7A 1GYCA 2YAHA 3IBOA 4DPCX 3NJJA 2BW4A 1GSKA 2GC7C 2PLTA 1W8EA 1A8ZA 4YL4A 3SQRA 4HHGA 4MFHA 2QDVA 4CSPA 1A4BA 1J9RA 1NWOA 5D4IA 1EHKB 5F7BA 1ILSA 1AANA 4E9SA 4YSDA 1UATA 3FU7A 4FAAB 3WIAA 5F7AA 1TEGA 1YLBB 4JKNA 1JZEA 2CJ3A 4AKPA 1OE3A 5AZUA 4UAHA 3FSWA 4BWTA 9PCYA 2TSAA 4BWWA 2VW4A 2XXFA 1E65A 3H4FA 3X2QB 4ZK8A 1JOIA 2GBAA 5I26A 1V54B 3RYMA 1J9TA 3AY2A 4W1TA 7PCYA 2FT7A 4YSAA 1IC0A 3PPSA 2VSMB 3TBCA 1IKOP 1R1CA 3EH4B 1QNIA 1L9QA 8PAZA 1AZRA 1KBWA 1PF3A 3EH3B 2QPDB 4P5RA 3X1BA 3UADA 3AG2B 3QJUB 5I5MA 2JKWA 2PP7A 2I85A 1N70A 4N4YB 1OE1A 1SDDA 3NJFA 4AX3A 1WA0X 1BXUA 2Q5BA 3X1EA 2PPEA 1B3IA 1ET7A 2DYSB 1BYPA 2H3XC 3OMNB 2PP8A 1AZUA 2HX7A 2HX9A 1KYAA 3UACA 3OMIB 1ASPA 1JXDA 2CCWA 2WSDA 4KOCA 2QDWA 2JFCA 2HX8A 3NSCA 5ANHA 2HLEB 1HFUA 1N68A 2P80D 3S8GB 5FC9A 4AZUA 2HXAA 3T6WA 1PLAA 1I53A 1AG6A 3FPYA 3NJGA 2DY2A 1AS8A 3MBWB 5PAZA 3FU9A 4A67A 3NSDA 3FS9A 1M56B 2FTAA 4DP7X 1AACA 4KO6A 4HALA 1KDJA 3ZBMA 7PAZA 1KV7A 2BWIA 4A2FA 3QJTB 1MG3C 1TEFA 5D4HA 3UAAA 1AG0A 1NIFA 1SHXA 1L9SA 4KNUA 4Q89A 5TK4A 3ERXA 4HZ1A 3BQVA 2J57A 5B1JC 2BP0A 4RH4A 3X1NA 2FT8A 1IBZA 1NPJA 2IDQA 2OV0A 3EHBB 3WG7B 2YAOA 1AAJA 2AZAA 1JZJA 1OE2A 1ET5A 1DYZA 2AZUA 2FJSA 3FQ1A 2VSKB 1A4CA 2HRHA 4GP5B 4F2EA 3JTBA 1AOZA 2FNWA 2N0MA 3CVDA 5D4JA 2CALA 1E5ZA 3IE9A 4A68A 4DP4X 4ENZA 3EF4A 3JT2A 3WKPA 4M4RB 1GS7A 3AG3B 3NJLA 4YVUA 5B1BB 4FA7B 4PAZA 1IUZA 2J56A 2OJ1A 3PLYA 3TU6A 2EIJB 4YSTA 3T9WA 3T6VA 3H4HA 2Q9OA 4YSUA 3QJQB 4BDVA 1NIDA 4PCYA 5I6PA 5I6LA 1NTDA 2MRYA 1BXVA 3GXUB 3CZUB 5A7EA 3MX0B 3DKHA 2BP8B 1URIA 4E9RA 2X87A 3S3BB 3QPKA 1HAUA 2WO2B 4HCIA 2CUAA 2BZCA 5B3SB 3WNIA 2UX6A 2VM4A 3S3CB 2UXTA 1T5KA 4QKTA 2UXGA 1BXAA 4BK5C 6PAZA 2GB2A 5TK2A 2DWSA 2W88A 4DP8X 1CUOA 2XVBA 4BXVA 1PNDA 3HEIB 2VM3A 3NSFA 5B7EA 1SJMA 3T6ZA 1RZPA 3AW5A 1CC3A 1QHQA 1A65A 2YXWA 4EF3A 2W8CA 1ZIAA 1AZBA 4YSRA 2YARA 3PCYA 1AS6A 1JERA 5IY5B 2XV2A 3UGEA 1PAZA 3V9CA 5I5JA 1ILUA 4YSEA 1KCWA 4DP9X 1GY2A 1RKRA 2AFNA 1SF3A 3PAUA 4NAJA 1JZHA 4AKOA 2VW6A 4BXSV 1ZPUA 4WKXA 5LDUA 3N55A 2DV6A 2ZOOA 3ABLB 1XB3A 1AIZA 1JZIA 1F56A 3BVDB 3CDZA 2BO0A 3KW8A 4G70B 4HAKA 2BZ7A 3SBRA 3DTUB 1OCCB 2A3TA 4HHWA 1JZFA 3ZIYA 2ZWNA 2X88A 4GP8B 2AVFA 1SF5A 2FT6A 2I7SA 4DPBX 4E9VA 2EIKB 1ZDSA 1AR1B 3NYKA 4A2EA 4QLWA 2FQFA 5B1KA 1JXFA 2UXFA 4YVNA 1GR7A 4F7KA 3AZUA 3NP3A 5E9NA 1SFHA 1SFDA 1BAWA 3PAZA 3TASA 1CYXA 3AG4B 1GS8A 3IN0A 4G72B 4DP5X 2BWDA 2XX0A 3V9EA 2P80A 4E9YA 1J5DA 4YSQA 2E86A 1RZQA 1NZRA 2XLLA 5AKRA 2VN3A 2DYRB 3FSAA 2I7OA 1NIEA 1ETJA 3ABGA 4KO9A 4UANA 1HAWA 2GC4C 3FU8A 5B1JA 3T6XA 2XYBA 1OCOB 1NDTA 2XV3A 1XB8A 3UAEA 2IDUA 3CVCA 4YSPA 5PCYA 1KGYE 1W6LA 3QJSB 1QLEB 1E5YA 4X4KA 4A2GA 1BQKA 1X9UA 1J9SA 5I6NA 1M9WA 1WA1X 4G7RB 1JVOA 2HRGA 1FWXA 2PPFA 2UX7A 1VLXA 2R7EB 3TA4D 1FA4A 3PXLA 1ZIBA 3OD3A 1V55B 4E9WA 1AQ8A 4KOBA 1A4AA 3SBPA 2YXVA 3NSYA 3WKQA 1E67A 4GP4B 4JHVA 4WTQA 3ASNB 1JXGA 3DIVA 2FQGA 4KO5A 3WI9A 4YSCA 4DP1X 2TSBA 2EILB 4TXVB 3QJRB 5B7MA 2IWFA 2YAPA 3OMAB 1KDIA 4HIPA 2FQEA 2J5WA
chains in the Genus database with same CATH superfamily
2WVVA 3DX4A 5DJCA 4ZDHB 3FO2B 2XV0A 1B88A 1KCBA 5H8DA 4ZUWA 1AO7E 5L88L 4P2QB 5KSBB 5KYNA 1PS3A 3QS3A 4GINA 1QLFA 5BOZG 4QHKJ 3GGWA 1DUYA 1TR7A 4LAQL 2X09A 4KNTA 1Z9PA 2FX7H 3VNZA 4U3CA 4GBXA 1D5BA 1TTFA 2UYLB 2X4TB 5EA0H 3MGOA 3MBXH 4DN3L 3QQ4B 1KCLA 1KG0B 3DUUB 3S96B 1N64L 1R46A 3US9A 1P84K 4H8WH 4GSUA 2W9EL 2JWYA 1E30A 2E27H 1YSOA 1QQDB 2AI0L 3DRQA 1MRDH 3LKPB 4XCFL 5DK3A 1AE6L 4PV8B 5FK9A 3T0ED 1JL8A 4PJBF 3VGAB 1PLBA 3L08A 3QG6A 2D3JA 1C12A 1CDGA 2OCCB 5DD1L 1G7LB 3QQ3A 2Q86B 4ZYKA 5HVFB 1PIFA 4FQHA 3HG5A 2H3KA 3MRLA 1IC4L 1X44A 1HXMB 3BP4B 4XI5C 3RTQC 4X6DE 3SBWA 4QRTB 3EO1A 3KAAA 4N2AA 4TQHA 1G7QA 1TNNA 2ZYRA 4JGNA 1QLEL 1UJ3A 4PGBB 1XGYH 3NOIA 2DKSA 4RSYA 4Y4HB 1JUFB 4DVBB 1WBZB 4XXWA 3MACH 2Y22A 1UM5H 2YQBA 3LHAA 4OIIL 3SE3C 1YC7A 1BVLB 5T5FL 1KPVB 1NFDA 4MCMA 4PJ7A 5C09E 4LOFA 4OFVA 5H37H 1D6VL 1PSKH 3SDXB 1D9KC 3LNGA 4QKXB 4XP5L 4IGBC 1ITCA 2ZOWA 3BUQA 4LL1A 1AOHA 3E8UL 3D12B 4PJHA 1XEDA 3IBEA 5DEGB 3MRJB 5HDBB 5F71A 1GTFA 1NIAA 4LZKA 5E2VL 3PJNA 1R5IA 1R4XA 3CHXA 3U36A 1NMCB 1OSYA 1WVZA 4HFWB 4PV9A 1A9EB 4ZAKD 3WEXB 4GYBA 5F8QC 3BUIA 1D5MA 1D5ZB 2AXHA 3N0PB 4OZFB 4CSZA 5L2JA 3AVEA 4U2ZA 5F72S 2V2TA 1KFAL 4NPKA 3FUKA 1OF0A 3T1FA 5I0DA 1A1NA 3CFKB 3S2AA 1ZT4B 3MREA 1CURA 2G2NA 1L9RA 4IRJD 3F6IA 2C9PA 2ENQA 2AITA 3D39A 2BLFA 4K5NA 1UGKA 3ZQXA 1W91A 4X98A 3ET9F 4N8CH 3NDZE 3IMUA 4OF3A 1A7NH 3IT8D 2J8HA 1FYHB 1XL4A 1NLBL 1QPKA 3IPEA 4FZEL 1WS8A 4KKPA 1ID2A 3QUZB 4K3JH 1WGVA 3RWFA 1NAML 4TUKH 2VZOA 4L2YA 2Q87A 3VGHA 5JO5A 2FE0A 1KIUA 4HCGA 3VGFA 1X9RA 2DWDA 3FO9B 3PQYA 2CLVA 1J11A 4LLUA 3GRBA 1DTUA 4ZT1A 1A6AA 1EGJH 1LP9B 3PGCB 2UY6B 3ILEA 1BF8A 1HX0A 1TF4A 2VDLB 2BOLA 4PBDA 1N19A 3DOIA 4EIGB 4FX5A 5DFTA 1SOQA 3FU7A 4P23C 3HB3D 5T1KD 1CXHA 2F2HA 3KD4A 3SPCA 1HSBA 3WIAA 1F86A 4R2GD 5KEZA 2NTSP 3I6LD 5FFLA 4AKPA 1PKQE 1Y6KR 2L0DA 3SKMB 3FO1A 3IMRA 1K85A 4GQRA 4J3VA 2B1AH 3FB7A 1BZ8A 5CD3B 3CSYA 3JBG7 2B8OT 4JQIH 1WK0A 1CQYA 4HJJL 1J10A 4NKQB 4RA0C 3QUYC 3WLBB 2EXTA 3J8F7 3LPOA 3QHTC 3X2QB 4NFBA 2MKLC 3QE5A 3IDJA 4OGQC 1RVFH 2Q7YA 3TONA 4E42B 2P4AB 2ZYHA 2VXVH 5I30L 3LKOA 5F0MB 3ROLA 1IQDB 5HYFA 5IT2L 2EUVA 4DTGL 5DMKB 2H3NA 1A64A 1SM3H 1ZHNB 1AD9A 4F7PB 5LNGA 5JPNA 3DOSA 2EUZA 4K7PH 4ISVB 4WV1C 4XPAH 1S78C 4U33A 3FONA 2PTTA 5J3HC 5IWLA 4JO8A 3SHSA 5IVXF 2CLRA 1DDTA 1KXQE 3QEHB 5HHXL 4PD4J 5CF3A 5C6WH 3BAWA 3UAJD 3VXUA 2X3BA 1QSED 3QK0A 4MRBA 4PPTA 5DHVH 1WWAX 3S5ZA 3VWKD 4P2OB 5T1DL 1HZHL 2YGPA 1PEWA 2CWRA 4BH7A 4NUGH 3ZO9A 4HIXL 2H3XC 2W94A 1LYQA 3BWAB 4YXKL 1WZ1L 5B8CC 3QNXB 4GAYB 5CN2A 5FYKU 4CN1A 3RVXC 2VB5A 4RGND 2KI6A 1NFIA 4JDZA 4ZPTB 2FJUB 3RAJH 1NGYA 3DMMD 1C5BL 4CAGA 4LEEA 3RZCA 2V8MA 3LRHA 5DRXA 3SE4C 4Z7NE 1RL1A 5EU6A 4KQ3L 4YJZL 1EEUA 4KJPD 3ZKMD 1YNTB 2KLRA 4IK7A 1TZGH 1Z9MA 1R5VB 1AS8A 1FYTD 1FVCA 3DV4A 4O02B 4PJ6A 1HHJA 4RIRA 5PAZA 3T8XA 3STLB 3VFRA 3FJTA 5BZDB 3HRPA 1RJCA 3TZVC 4XAWH 1R19A 4HIEA 4NN7B 4UQ3B 4BJLA 2CRYA 4RMWA 3EFOB 4Z7UA 4HZ1A 4UQEA 1OW0C 3RX5A 3CH1A 2AJZA 5IHZA 2IDQA 3P4OA 3CZGA 4HDIB 4DT2A 2AZAA 1EFXB 1WT5A 1NBVH 5ADOL 4M7LH 5FX3A 3CUPB 1X5LA 2BFVH 2WQAA 2X40A 3DGDA 3ESVF 1JHKL 3TO4C 2IOOA 1G4RA 3IMBA 4XCCL 2F74A 3I50H 1A1OB 3GBMH 5KJ7E 4L3AA 5DJ0A 3QH3A 3A6OA 4OFIA 3LVEA 4U1JB 3ZRSA 1HE8A 2DI8A 1Q9LA 2D2OA 4LVOB 3IXAA 4M48H 1ZA3B 4HK0A 4X4XA 3BGAA 3L1EA 3MOQA 3HS0B 4P05A 2J5LB 2BVYA 5BZZA 1B0WA 4R7NA 4PREA 3BVTA 3EDJA 3HI5H 3P3YA 4FCAA 4KV5F 1OSPH 1LQSR 3OGOE 1NA8A 2A6KB 4GIPD 3BOVA 5EDXA 1CB4A 2EH8L 4B7IA 2Q9OA 1F1DA 1UWEL 5LNDA 1OGPA 3VRIA 2IF7A 4ZRGA 4Y5XC 2E4FA 5BQ7A 4PCYA 3VI4A 2NY1D 4LL4A 2E9IA 4D0CB 2PWGA 3LY6A 4HKZA 4LLVB 1TYEB 3O6FA 4JCLA 3MLXH 3IPBA 4EZMA 2XWEA 2JKTM 4H8HA 2H6PB 3C5SA 4F9PC 1MFBL 4ZTEA 3V4PB 4R97C 1A7OH 5EC1B 3IE4A 3X3FH 1ES0A 4XWOC 4OI9A 5GGQH 2XN9A 1DBAH 3ARFC 3ESNA 4PJ8B 4EN3B 1YO4A 2MKWA 3HZKB 4XMTA 3MJ7A 2F6AA 2O26U 3ESMA 3GI8H 2GBUA 4FG0A 2Q76B 4I4WA 2VMEA 4XXCA 4YDNA 4TQPA 4N2NA 2UXGA 1KNOA 1OTTD 4GXVL 5FDYA 5JR1L 4G82A 3NMEA 2RH0A 5AZEH 3WV0A 5FLVA 2IG2L 2K6ZA 2GCYA 1OAKH 2YN3A 3QFJB 4P3CH 1D7BA 1PNDA 3GRWH 3U83A 3OSVA 4IBVA 2EDMA 5AYQA 1KGUA 1SN5A 1MRFL 4MBRA 3CQQA 3QUXC 5CKGA 1HQRA 3QR0A 1RIUL 3DSFL 1A3LH 2PO6D 1XCQA 2PABA 3SGJC 1KBBA 3BIBX 3VWJD 4K2UL 3GDBA 4NO0A 4R26L 4R6UA 4ZMVA 4I5BA 4PJ5A 1E2WA 1BAFL 5IIEB 3GNMH 3TC9A 4OD1H 4JFDD 4QO1B 1ETZA 1PYWB 2NY2D 4AOFA 1SF3A 2DQUL 3BE1L 3QWOA 4KK5D 5D1XA 5DEJA 1HXYA 1P9MC 5EOQH 1Q0YL 2P5EB 1IAOB 2BZDA 2VLKE 4MXVF 4EEEA 3RL1A 1TUPA 4QJ5B 3QYNA 2VDRB 1CFVH 2HWZL 3IRCA 3NQKA 4AM0B 1XIWB 3M1OA 2PW2A 3CDZA 4UNUA 4Z23A 1EVTC 4WW2C 4WDIA 3IM1A 1J8HA 1IARB 4M7KL 2XZAL 3QB7C 2V2XA 5E7BA 4Z7QB 2A1WL 4LKXB 4YIQB 1IILE 1CWVA 3H3BC 1T1YA 3SB3A 1GOFA 3F58H 5LBSA 3EG9B 3V0WL 3BEWA 2OI9C 1DBJL 3PWPE 3CFQA 4LE8A 4YHMH 1GRWA 1IAIM 2DM2A 5LB1A 4TVPD 5F0JB 4QRPD 1ZKAA 3SGKA 2F54E 3PF2A 3KM2A 3WXVL 1ZA6A 2X41A 4A6YH 1HH9B 4HCRL 1C1EH 2JTYA 5I1HL 3RGBA 1KCRL 1TOXA 2B4CC 1OZUA 2O5ZL 3NACH 2WYIA 3MNWB 4FD0A 1QTYT 4IBSA 2GT9B 2MCPL 5JHAA 5EOTA 1TITA 1YPZA 3MSPA 4RMTA 1H6TA 3QEUA 5DUPL 5HPOA 4XP9H 4KGJA 5AUMA 1A7PL 4IM8A 4L4VD 5DTFA 2A6JA 3GSQB 1IGTA 4XZUA 3S37L 2Z6FA 2EYSB 4UILH 3TVMA 4EE2A 4N6QA 3QZNA 1JHTA 3OR7B 4DGYL 3PJSB 3DVNA 1BBJA 1M7UA 1SEQL 4UZSA 3BH4A 5E6SB 4XMLH 3BSGA 5JOEA 3LN4A 4Z5RA 4M9PA 3UAEA 2GJJA 5ID1B 1W6LA 3W5MA 3MRDB 4A2GA 3QULA 1I1CA 4OT1H 4U1SB 4XH2A 3VFGH 3ILQD 3ZKND 2HRGA 3UGUA 5IFHL 1X5GA 3CFEA 5E2WH 1BX2B 3NIGB 1V55B 4QGTA 1Y0LA 5AW1B 1KIRA 1A4AA 4PWKA 3QUML 3QARA 4DGWC 4N2DA 2CSPA 4NZFA 3NSYA 1JWMA 4RDBA 1P4IL 2BERA 3GMNB 1EHLL 3FT3A 3ECBB 3DRTB 1GZHA 1A6UH 4P23D 4YSCA 1LE9A 1J7VR 2BNQD 3TBSA 3CMGA 1TXKA 4AE0A 3JZYA 1QVOB 4N9GB 1JMZA 2QHRH 5DC0A 1XTMA 4OCYH 3RY6C 3LIZA 2ZP8A 4I77H 3IVKA 4HS3A 2ARJQ 5CO1A 4EUPA 1SXNA 1Q9OA 3FYIB 1Z9NA 2E7LA 1I31A 4LXFA 1FL5A 4PG9A 4RFEA 3FFDA 3FTGA 4XVSH 1AQKH 1DSFH 4NQQA 5HHMD 5HDLA 1M05B 5KVFH 2XA3A 3QUGA 1S8DB 5CD5C 4M62L 1IC5H 1XZ0B 4CBPA 3P1VA 5IKCB 3OXSB 2FX9H 4LKCA 2LW3A 4RISH 4GMTH 1KB5L 5ACZB 2DJSA 1R75A 1PG7L 3GEFA 1CFNA 1VFMA 3GM8A 2XY2A 4G71B 3UG3A 4UNTA 3FN0L 2Y6TE 2WXQA 3C5ZB 2GK0B 3U7AA 2CJUL 4A66A 4Z76B 3RWDB 3ZMEA 4EIBA 1NWPA 3F84A 1FZKB 5TE7L 3UTTB 4QNPE 3HR5B 5JYMA 5D71L 4Q9RH 1UENA 3APCA 3NJMA 4HBCH 4XPFH 2EIZB 2G9HB 3Q9PA 1PKOA 4I9XA 4UM9D 3ARZA 5JLZA 3V4VA 4IW4C 4MHHG 4WW2F 5HY9B 2B7DT 2PW1B 4UB0L 4PS8A 2ZXDA 2IMNA 4LSUH 4KK9C 4R84A 3D0VA 3KCPB 3SPIA 4Y4KA 2LVCA 2OMTA 4G6ML 4Q0XL 3D0LA 4GW5A 1KMGA 3MXVH 1JGUL 3BCFA 3VRJA 2OSLA 3X14A 5FKPA 1OWRM 3V0DA 4NNYA 4WWID 4ONGH 1IKNA 4LDEB 1KTDA 2AJXH 3T3MF 5CBAB 1F3DH 2E46A 2LLNA 3TEUA 3HC3L 5CJXC 4JHAL 4DIXA 4B9CA 1XAUA 1KTLA 4XMVA 2EYTB 4M6ML 4HWZB 4WEMB 4CUCA 5I1LB 1E8XA 5I6OA 1IBYA 1OT1A 3QQXA 4WK0B 2DJMA 4LK4A 2HRPL 2DMCA 2A77H 3S4SG 4HIHA 1C5DA 1DVXA 3G04A 2OX5A 1NBZB 3NJNA 3V5DB 4A2HA 3K2IA 3PAVA 1TTGA 2QKIB 3ZK0A 5KAQG 3D08A 4YXLH 1BJ8A 4YR6A 5F7EH 1YMMB 3B5HA 2H6UA 3UFIA 2BS8A 2YAMA 1T7WA 5DEZA 4Z77B 5IB3B 4WNJA 1D9KB 2VC2B 4QRQA 4DGUA 3UABA 5SWZD 1SYSA 3KDMB 2CRZA 3OPZH 4MMYB 2AXFA 3RIAF 3GBNH 1MJJB 4G7YH 4XNZC 4JRYE 1DVUA 5L8JB 1TO4A 3QDJB 1BZ9A 2FH6A 4EIZC 1KJ3L 2C7UB 3F83A 3J07A 1PY0A 5C0RL 2FJGB 2Q6WB 2HFEA 2ERJB 4C55A 25C8H 4AJWA 1AMYA 4FEMA 2FX7L 3P4MA 1DJZA 1DEEA 4GRWH 3DTXA 3L4TA 4YO0A 1SEBB 3TN0B 5F3BA 1CL7H 1T0MB 3DXAB 5I0WA 4L8DA 3OF6A 1HHKA 4H8WL 4ORGB 3WE6B 2YRLA 4MNQD 2BP5M 3BDYL 1MRDL 4PGJA 5EZIH 4WEEA 1BD2E 4ZW6A 1BCIA 3HN3A 1CLOH 2ORBH 3CFJA 2VR6A 2K7PA 3ARFD 4IIZA 4Y5YB 5DK2A 1OAXL 4W6XB 4BHUI 2CJ3A 1IRAY 5AZUA 3AACA 1GGCL 1QHOA 1OEZW 4UOW1 5KSUA 3E6FB 1NL0L 2FWOA 4ZFOB 5HPMA 3AXHA 1WGOA 5SX4H 2A99A 3DOHA 1XF2B 1CGUA 4G9FA 5GS0D 1Q72H 2Z35B 4A37A 2W65A 5E2TL 3SEPA 4ZI8A 5I26A 4OZIB 1XGRB 3OB8A 1MFAH 4W1TA 1CR9H 3V0FA 4AXWA 4DOHE 1UD5A 4PRPA 2H26A 2VSMB 4OLEA 1MIEL 4GG6B 1SRDA 5FOBB 2YR3A 4NWUH 3OKMB 4MWFA 3WLWC 4NQEE 4YOKA 1KBWA 4TVUA 1PJ9A 3NEOA 5EO1B 1UD8A 2NY5H 2QPDB 5F7DB 5KSVB 4OV5B 4N20A 4GT7A 3P9LB 3RVTD 3UADA 43C9B 3R7RA 3X11B 1UEYA 3Q2WA 3B9KD 4N4YB 3RVUD 1ORQA 3ZZSA 3SDAB 1NKOA 2JI1A 4U1IB 4LOEA 2JJTC 1C5CL 2X0VA 5CGTA 2EABA 4WU7A 3HTLX 1FGNL 4PJGA 4NO3A 3ZHNA 1A7RH 3SCMA 3II2A 3OLGA 4PGCA 5GS3A 2FJHA 1LEGA 4MS8C 4W68A 2ED9A 4UMGA 3U6RA 1FPTL 1VSCA 4N8CL 2NTFA 5HHOB 4Y9BA 2VERA 1IBBA 1AQDB 1T6BX 3L3KB 4G43B 4WV1B 4AZUA 4IU3B 1IEBB 5E4EC 2EDRA 3VD0A 2G5BA 3FQRB 3RFZC 4J3WA 4CVUA 3M86A 4XVTL 4PSPA 3Q6GH 5DRNA 3GSOA 3TYFA 4O9HH 1E40A 2EDKA 1FFOB 4PJXA 3L9RB 3WJLC 5I8CB 3GMQA 7PAZA 3GXMA 2C1OA 4L9DA 4YHZH 3S88L 5DXWA 3EBHA 4M29A 3DPBA 3DIDA 4EJ1C 4L8SC 4QCIB 5T5NG 4XPHL 2E6PA 3FNKA 2FJFA 4DK5A 1AG0A 2CGYA 3RUGA 5CLWA 1G9EA 5INCB 2J57A 3CE1A 2HFFB 5F9WC 5E4AA 3X1NA 1YYMH 2DJ4A 2F8XC 2YUVA 3EJJX 4GO9A 1A6WL 1AAJA 1DQTA 2HJLB 1UZ6E 3DX6A 3OHXB 4OF5A 3JV6B 3IKCB 5D7LA 1S7TB 3FQ1A 3SJVB 4ZOCA 5LAPA 3VH8G 3OVUB 1ONQA 4MXWH 4PJIA 5I1DB 3FOLB 4Y16B 1BZQK 3JTBA 5FXCH 4HS8H 4X8JA 2B1AL 5KVGL 4JKPL 1KENL 4JQIL 1U91B 4G1MA 4NKDA 4B9ZA 2Y7QA 4F7CA 4Y1AB 2DM7A 2OW7A 4JAMB 1MI5A 4A7GA 3IWUA 5FO8B 3RX9A 1RVFL 4GJTB 1QFUH 1U3YA 2EADA 5CJQL 2DYPD 1CBVH 2WLKA 2ITDA 3K7UA 3ZE2B 3PLYA 4YHIA 2YEQA 1BFOA 1F8TL 3V0VB 3VNYA 4YSUA 1HHIA 3QJQB 5I15L 3HCVA 4K7PL 1HL5A 2PXYD 4QJ4B 3WGVB 5A2AA 4XPAL 4X6FB 2Y36H 1OAYH 1RSFA 3IU3A 4N6RA 2MRYA 1MJUH 4JR9H 5EBMB 3GXUB 5HBBA 5GRJH 1J18A 4UIKL 1RK0A 3F2LA 2WVUA 3QZWG 3BZ5A 3LHPH 2O6FA 1WQVT 1TMQA 4LF3A 1L6ZA 3U0PA 1GJWA 5FUOH 3FB6A 5GS0L 3D69A 3NZHH 2IBBA 4NUGL 4M1GL 3O6KH 2IALA 4PLKC 2DD8L 1RQ5A 3S35H 2NY5C 4ABWA 4CRPA 2G75B 2AW2A 1RUAH 5HI3D 2OMWA 2VDKH 5CJOH 1FGVH 2AKRB 1AXTH 4HWEL 1NC2B 1P1ZB 3RAJL 1SHSA 3F7YB 1C7TA 1U92A 3MLRL 3LRSB 4Y5XB 3L17A 3FFCB 4MZIA 4BXVA 2EE3A 4TVPE 1QEXA 5BCAA 2HKHH 4ATTA 1RJYA 1RP8A 4HIQA 3BAKA 2W8CA 4EKJA 1CD1B 1ZVHA 1UXSA 4R90H 4ZO7A 1Q8MA 3UXFA 4R97B 4XXWC 3HE7D 1BSIA 4XAWL 4ZMQA 1BQLL 4XBEH 5FEBA 1UT9A 4TNGA 5DYOB 1DVFA 2Y2YA 5IOPA 4LLQB 4PRHD 1DO5A 1CVSC 3EHBC 5L9DH 1JZHA 1JK9A 5I9QC 4FABL 1NBVL 4M7LL 4BXSV 1U3HC 4JFEB 3VFWB 1EEYA 2W9DH 4FHKA 4HC1H 3I50L 1ZLEA 1AIZA 1JZIA 4JFFE 1DCLA 3LX9A 3SDDB 1F00I 1NCCL 1QO3A 3FT2A 2Z31D 3QBTB 3PGDA 5FO9B 3DV6B 2EDWA 1AZZC 4YDVA 3O9WD 3HA0A 2HLAB 2FT6A 2XJLA 3AB0C 4V1DA 1EDYA 3NIFB 4DPBX 2Q20A 5I6XC 1P84J 2R2HA 4A7SA 1U0QA 2UZYB 4AMXA 4GRWF 3FH7A 4Z7VF 2VT0A 4UTBL 3VDAA 2UXFA 2MIZA 4RWHA 3QIUD 5IREA 1OSPL 1S9KC 2H32B 4QTHB 3GMLB 3NPSC 3O8XA 4KUCF 3UMNA 1IAII 2VDOH 4X7FC 3O11B 1QSFB 1YMHB 4P99A 3IFPA 2DS4A 4WJ5B 2B15A 2XKNA 1RZJH 3D3VB 5DA0B 4ACTA 2VABA 4AT6A 5I1CH 5K39B 4X42A 1ZVSB 4JLRB 3KPPA 2NXZC 5AENA 3ZE1B 4YSQA 2ZXCA 3QDMD 3DK0A 1JNJA 1IM9A 3COOA 3MLXL 4R0LA 3BZ4B 3MRMB 5AAPA 4NIKB 1AGEB 5EZPA 4XNAA 4LGPB 2F19H 4UANA 3UBXI 5ITBH 1IZKA 2NZ9D 4JPIB 4RRPM 5GGQL 4DERA 1NDTA 4HT1H 4QXUH 3WS6A 4YHNA 1B6DA 5K9OB 4LP4A 1HKLH 1R24B 1E5YA 3MRFA 4Y19A 1OHZA 4XNQB 4D8PA 3P77A 2Z4QA 3K0WA 4D7PA 3W82A 1RULH 1OPOA 1OP3K 3HUJE 2VDNL 2F18A 3A6CH 3QQDB 1E3FA 2JQAA 2QADC 3LS4L 4PJ9A 3STZA 5C0JB 3NIDF 1QRNB 4P3CL 3DBXA 2B14A 4GG8A 2H9GA 3GRWL 3M1BB 4OBRA 1MVUA 4P2RA 2B59A 3JTSB 1MFEL 1O9ZA 5IMMB 2MNJB 1KB3A 4HIJA 2K70A 2W0FA 4TXVB 1J5IA 5CMAB 1YECH 2Z8VC 1A3LL 4HJSA 3MLUH 4QEGA 4AW4A 2P24A 2F53D 3QR2A 5H94A 4AYFB 1NCAH 2Z4TA 4ZJ9A 5HDBF 3GNML 3TWCL 3U6XA 3PIQB 4FQQB 4OD1L 3ARWA 5MENA 2X4SB 1U8KB 1ZVYA 2O6CA 3QW9A 4J8RA 2YA0A 3ZDXE 1U58B 2J73A 2AHIA 2ICWJ 1AGDB 4ESKA 5DDHB 3UBFA 5FS5A 1DBKL 4EKXA 4HJ0D 1WTGT 2CO7B 3BH8A 5IWLC 1QWUA 5LXGH 3MZGB 3H9YA 2CRIA 3BKYH 4ZUUA 1WIUA 4DZBB 5FWQA 3JWNE 4HAFA 4FQLL 1AC0A 3D85D 4OH2A 5I6KA 2IXQB 1ZAGA 3FUNA 2DWXA 2L7UA 3MXWH 4KGLA 2JJWA 2GSMB 1U36A 3W1ZA 4WO4D 4OLVL 3TCLB 3WOVA 4YHML 5J9PA 2RAMA 2GY5A 3PHOA 2GJ6D 2IWEA 2PYED 4MDJB 4Y5VA 4JY4B 2O61B 3B2XA 4HD9A 5DJ8B 4A6YL 2ICES 5DK0A 3U7YH 4CILA 1C1EL 1KJ2A 4N87A 1UVQA 4ZFZB 3H54A 1JG9A 2C8NA 2PCPA 3UTZB 4TF4A 4ZMWA 1AC6A 2Q3XA 5LLIC 2NNRA 2VMJA 3UEQA 4XP9L 2ITEA 4LCWB 4OLWH 5KVDH 1N5YL 3D4YA 2EIMB 1VGEL 4XX1G 5I74B 2AK4D 1TPXB 3L95B 3REWA 5CN3A 3U0WH 2VISA 1K4DA 4OZGE 4L9LA 3KVDD 2WTOA 1NDGA 4XMLL 3X1GA 3CDFA 3LEXB 1RZJC 1UZ8B 5C8JA 1OV8A 4TSCH 5E1AA 3WNJA 3LXBA 3KS0H 4WWOA 1GGBH 3OJMB 5DHYA 5J0BA 2IQAA 5HYJA 2EDFA 1O7DE 5E5UB 2ZF9A 4NCDA 3VFGL 2OJZH 4F9LC 2OTPA 3QA3B 5IVOA 3OX8B 3GJFH 4NYLA 5E2WL 4N2IA 4JFOA 4KJYA 1FH5H 3VB9A 3DHUA 3S4SB 3H3PH 4OLYL 4XT1C 1KLUB 3E8VA 1GTNA 1OO2A 2ARJB 4XRCB 4ALAH 4NUJB 4K71C 2DQEH 3EOBB 2IH3B 4LLYA 2DLGA 2VXQA 3KMDA 4B5EA 4FI6A 4MCZB 3ZUNC 4XAKE 3LZFL 2F8IA 3EJZD 1NC4A 5IF0B 4OZHF 1NCIA 1E50A 2APXA 4OCYL 2ZUQC 2QGCA 3B6SA 3CVBA 4KUCD 1KSRA 3WTYA 2DWTA 2OMVB 2P5WE 4KKAC 1P7KA 2EECA 5LGYA 5JIIA 1KXTA 1UH3A 3VFNB 2BOCA 6PCYA 5K9JH 2X1QA 5EHFA 1TJMA 1AQKL 1DSFL 3VI3B 3CDGB 4ZMAT 3T3PE 1F2QA 1CF1A 5A6IA 4P46A 1I3VA 2WSPA 1IC5L 5T33H 2J1ZA 5GISH 2FX9L 1G4MA 3CBJB 4RISL 4GMTL 5K59F 4KKRA 3G5XB 3UP6A 1L7TL 2VQ1A 4U6YB 5HGHB 3O6FC 3UH8A 5I1AB 4JCMA 5E8OA 4WFGE 2OJEA 2NX5B 4IKNA 2Z7ZA 4Z3IA 1LJMA 2XTSA 1RK1A 2DTMH 4FQ1H 5AW9B 5C0ND 3EO9H 4Q2ZB 4X4YB 4XX5A 2BIHA 2EE2A 3HZYA 4RBPK 2WQUA 4V2CB 4MCYB 4Q9RL 4OZ4B 4TPRL 5A43C 4HBCL 3OJ2C 4XPFL 2AQ3A 3ORJA 3V5HA 1P7QA 5D2LB 4WI6A 4I18B 2F7QA 4LIQE 4R7VA 3BT2L 2G2RB 4LSUL 3IJYA 4AMKH 1J1PH 1Z5HA 5TD4A 3MUHL 3PE9A 2A83B 9PCYA 2O5XL 1RH8A 1VRSA 4AYGA 3MXVL 5SWQB 2HKAA 2APFA 5IVZA 5C0AB 3SDCB 3SOBL 5D7IB 4ONGL 5EEXA 2GBAA 2ISDA 2MPVA 3RJQB 1KJVA 3LQZA 4BGLA 2XKSA 2YPLA 5TFSH 2P48B 4KVPA 3WFDL 1T03H 4IRSA 2EVIA 1FLRL 3C2AH 3M8OL 4L18A 3AREC 4BQCA 1R1CA 3WFCL 2WCGA 4FQXA 4GKSA 2WXIA 2X89D 4XMWA 3CZNA 3LN9A 2V9UA 4OCLC 4I0PA 4MYPA 1QBLH 5IW3A 1OAZH 3KJ4B 5D1XC 3SGEH 1FBIH 3GZKA 2DKMA 3KG5A 1LTXA 3NAAH 3TNMB 4E9LA 5HYSA 1DBBH 2A77L 4K23L 3UJJL 1MFCH 3MNVB 3RIFF 5C0IB 5E0QA 4H8PA 3RKPA 5H4ZA 4POZC 1O75A 4A7TA 3KVQA 4YXLL 1PGRB 1HI6A 1U3HD 2R27A 1F1AA 1GOGA 5DMIH 2LGNA 5ABZA 3P3SA 1QABA 1YEIH 3D07A 3PWUB 4H1LA 1LEIA 4DUVA 3H2QA 1X5MA 3BH9A 3MUUA 1DJXA 1FC1A 5CGBA 5LBVA 3F5WB 4DKEH 3OPZL 4J3OH 2MQ3A 4DPRA 3L4CA 4KAQH 3NZUA 1TTRA 4P57A 3BUPA 4G7YL 4AVIA 1XAKA 2ZUVA 3FQNA 1JD7A 3RI5K 1T89A 2H41A 2OR9H 4ADIA 4L8CA 3HHSA 4PJFE 4FNPA 2OSXA 3VXPB 3EGSB 1SJHA 3VXSA 5EC2A 5E70A 2ICWB 4BFIA 4LSQH 1ORSA 25C8L 5IZ7A 5JMRA 2VM9A 1B90A 3DX7A 3KDPB 2R0ZH 2R9HD 3TVMC 5E9DE 4MMZA 4X99A 5A16B 1CL7L 3RWHB 2MOGA 3HC0B 1BFVL 4LCCA 1BFSA 3BQVA 3FUHA 1GIGL 2F1BA 5C07B 4EPSA 5DVMA 3LZPA 5BXFB 5EZIL 3PP4L 2W0LA 4OFDA 5EUOE 1N3NA 2OV0A 3TJEL 4AYDC 3V6OA 4PI2A 2X9ZA 3P0GB 1CLOL 3T2PA 1F4YL 2F68X 1AP2B 4XP6L 2ORBL 5BS0B 2EVJA 1A4CA 3Q6FB 2CIIA 4NHCL 3VH8B 5LVEA 4K07A 4WUUB 4HS6B 1AYRA 3A22A 1Y18A 3N85L 1XXFC 2CALA 1J5HA 4NOFA 3CK0H 4H20H 4K3HA 4LT7A 3NFPA 3N43B 4HD5A 3QXAB 1X7QB 3WKPA 5IV2B 5ANMB 1RU9H 3GKZA 4F7MA 4O2FA 1KY6A 4YGVB 2Z8WC 3SY0B 4PJAE 4HX1A 4FULA 1SMAA 4DQOH 4BIKA 4AUJA 1QZNA 4PWHA 1MFAL 1CR9L 2Z91B 5EZLA 1L3NA 2EIJB 3FMGL 4DO5A 2ATPA 4QF1B 3O41A 1A9BA 2J6EH 2E7LC 5CEXA 2WYHA 2VO5A 2JNZA 3EYSH 4X7SH 4NO2B 5IQLA 2VWEE 4G1EA 4OU3A 2HA1A 4GRMA 2K3HA 2NY5L 4L8BB 4P9HL 4UOW0 2HFGH 5DWUH 4M4PA 1QA9A 1BXVA 3QRBA 4KTGA 3C09B 1T7VA 4ES9A 3FTSA 1TG8A 4UM8B 1KY7A 4Y2DC 3QZWB 5IFAL 4WK2B 3ZKQD 1MCCA 2IC2A 3L4WA 3GTTA 4H7VA 1OWWA 4G6KL 3KPOA 1BLNB 4AV4A 2MHAB 5HYQB 3MCKB 4X9FA 4NBYB 2CUAA 2EP6A 5BOPA 5BZWA 2J7LA 4ZTOH 2W91A 2G4GA 1M71B 2ZOLA 3B3IA 2I9TB 2UX6A 3Q05A 1IVTA 5DQJA 5JHBA 3SDYL 2WVVB 4EUPG 4Y0GA 1WCQA 1XEUA 1QEWA 2FLRT 4MBOA 5DJCB 3RWEB 4APQA 3MRQA 5E6RB 4JY6A 5LWYH 1SQ2N 4YDZA 2JB5L 2IPUK 3EF7A 4U1NA 2IGLA 5IB5A 3Q6GL 4MA1C 2FO1A 2WVSA 1PFOA 2XFXB 5I75C 3LMJL 5L4IA 3MOBH 3PCYA 1HN1A 2P28B 1EFXD 1NCNA 4J3OC 2BOBA 4GBXB 2YGNA 1D5BB 4JREC 4YHZL 3DX9A 5IBUG 2W59A 3EJRA 2BS9A 3OG4B 3V7AE 5DT1H 5E00B 1FHGA 1YYML 2ADGA 4N22A 1EJ8A 3QG6B 4HOMA 5AVYB 4ZYKB 4WKXA 1PX3A 1OTSD 1P7BA 3QQ3B 4LOUC 1LVEA 4NJ9L 3AXIA 5HHNA 5L4FA 4LFHD 4FQHB 3MRLB 2X6UA 1N6QH 3BISA 3HVDA 3KYOA 2MQ0A 2YC1B 3LNFA 4HAKA 2Y2WA 2YPVH 1YNLL 5IW1A 3CFIC 3EO1B 4HS8L 1FH2A 1G7QB 4L3EA 5HDWA 3OGCA 4HWBH 4BK4A 1LMIA 1ERNA 1UJ3B 1Q9KB 2HLFC 5TPWH 3K6IA 1UADC 2OSYA 4HMCA 3WBDA 3HG2A 2XTJE 5E03A 1NFDB 4PJ7B 1CBVL 3B2VH 1TTCA 4ZODA 4F7KA 2ZT9C 4PJEA 3GKWL 2WLMA 1A66A 3NP3A 3B8SA 1MFUA 5I9QB 3TS8A 4PJHB 2F53E 3ZYZA 3UTQA 1NANH 3BDBA 1T2JA 2Y36L 3IN0A 4G72B 3UYPA 1R5IB 1MSPA 5C0CB 3U36B 4HPHA 2X6BA 4WTWA 4WLCA 5FYLE 4EN3D 4PV9B 1CGXA 1KGWA 1LL1A 4M4RA 4XTRC 3LHPL 4DVRH 5L2JB 4QRSA 1DLHA 3FOMA 1N0LA 2UUDK 5DWPA 4J12A 3T1FB 2VDMH 3L1OL 4B9GA 3NZHL 4GSDH 2JK5A 1A1NB 3O6KL 4PJCF 3ZSSA 4QI3A 2D03H 4IIQA 2EIEA 3MREB 3S35L 4AL8L 2IDUA 1MREH 3GIZL 4LSVL 3TBTA 4WFFD 1RUAL 2VDKL 1DVQA 1OLLA 2W92A 2WTRA 3GS0A 4YAQA 3D39B 3DX0A 2X9WA 4TRPH 4E41E 4TUUA 3VQMA 4N0UE 4P06A 4X98B 1JYVA 1I4FA 4S0SD 1CICA 1H6EA 3ZTNH 2RIKA 5CXPA 5KOMC 1ECYA 5CINH 4O51A 1PZDA 3S36H 4FJYA 1MCJA 2EIBA 4JHVA 4WI4A 4FXGC 3ASNB 5HYIA 4XWGL 3D25A 1SXSA 5F1NB 4OIFA 4W9FC 1T1WA 5EU3A 5KANG 3MV8E 4YUEH 4L4JA 4NKMA 1SVZA 4UBDC 2ZTBA 4HJEA 4QYOA 2DWDB 4FXKA 3GXTA 2EO9A 2CLVB 4LLUB 5DFVD 5BQDA 3RBSA 2IMMA 1EEZA 1JZGA 4XBEL 1A6AB 4WWKA 3IJHB 3BD4A 4AY0A 1ETB1 2TRYA 1G7JA 2AK4E 3ESUF 3VYOA 5L9DL 1J48A 2FECL 2MTAA 4XVOA 1KGXA 4FQIL 4NQTA 1EAQA 3KS0J 3FU7B 4F3FA 2QADB 1HOCA 2W9DL 3B4NA 4X83A 1HSBB 1MCQA 4HC1L 4ZS6D 4J3OF 3EYFA 3ARED 3MLZL 4C4BA 3DJZA 4M6NH 5JW4M 3FRUB 3TT3L 1E3ZA 4DZ8B 3FO1B 3FB7B 3QHFH 4X7DC 1NOFA 4Z8FH 1MKFA 1ZEAH 2RB8A 3BX7C 3ISYA 4N90D 1MF2H 1PX4A 3D50A 3VG0H 1IAKA 4Y2OA 4DP6X 3IDJB 1FO0B 2Q7YB 2O6DA 4PCTA 5TJWK 3AT9A 4XVJH 3SCMC 1DVYA 3QPXH 4JZJB 2C3HA 4MJ2A 2OS7A 4KXDA 4UDTA 3RDTA 3ROLB 3S3DB 5ALBH 3PNWA 4GKLA 5AOIA 5GGTH 1JNNH 2PNDA 2WYZA 5JPNB 5I18L 3DOSB 4P2QE 1RZJL 4R4FH 1MLBA 4KKBD 5HYEA 5KSBE 2WB7A 3VFUA 3OM3B 2PF6A 5I1CL 1MZYA 2E74C 2PTTB 2FWSA 2QVMA 4HSCX 4CMHC 2CLRB 4MJ6A 3LNHA 3QIWC 3WL9A 1MFDL 4KK6D 4KJWD 5CUSL 3VXUB 4D0DA 3OKKA 2XV6B 5ITBL 3VACA 1JPTH 1W80A 3QWNA 4I3SH 2IBZX 4BH7B 4HT1L 4QXUL 4BCXA 3EXJA 1XD0A 1UQSB 1T0OA 1HKLL 3HC2A 2DM4A 1EZSA 2P47B 2XQ0A 3RHWK 1NFIB 4JDZB 3ARVA 4HJGB 4FS0A 4PS4H 1EBAA 5D70H 4ZQKB 1TQTA 1NGYB 3GSRA 3RZCB 5EEUA 2TAAA 2E76C 1JNLH 3CG8A 1D6EA 4UTCA 1MJ8H 5EU6B 5F9AC 4IJTA 3VD5A 2EEXA 1IFHH 2R51A 4OJAA 2ZCHL 1INDH 2ROXA 3DV4B 3KLQA 4MAUL 1FVCB 2AXGA 4RIRB 3T8XB 1HHJB 3BPLC 4YBHA 2NY0C 4AVJA 2QSVA 2RBLA 3VFRB 3ABKB 3VUAA 4RBPH 4YXHL 4AI7A 4Y7OC 5AFAA 1O0VA 4OSUL 1RZIB 3H56A 3SDXE 3F7VA 4S1DC 1FNEA 4HIEB 4MJ5B 3WNLA 5F9JB 4AYBA 3CDCA 4EI5C 2R7EA 2ZIDA 4JANB 3ZT6A 4Z7UB 2NCMA 1TQVA 3BZFA 3O2DH 3CH1B 3GLAA 2AJZB 1GMEA 3VTAA 5IHZB 2LHAA 2QPEB 1TJIL 3P4OB 4NERA 3I2CH 1UWFA 1Q38A 3ARGA 3C5ZD 2GTZB 4M43H 1AGFA 5GZND 4WFEE 3H85A 3UTTD 4P59L 5LXGL 1JDCA 1LNUA 1TVDA 4E5XA 4LDLB 4PTUA 3GMPB 3MV7E 4JFVA 1WD9A 3IBOA 4R7DA 4TSBH 4IHOA 2GTQA 1TJGH 3E7JA 1UM4H 5KVEH 3IXAB 2VDRL 1Z9OA 1CL7I 4X4XB 4HK0B 1JRHH 2ZG1A 3C8DA 1EUTA 1HCZA 3G6DL 4BZ1A 4ELMA 4R7NB 4AEEA 3ZKXC 1NMAH 3WIHA 4PREB 4EIUA 3V2AR 3U7YL 2G0KA 3AJ7A 1R17A 2XCMC 5DZPA 3WXWH 3L7EA 3H1ZA 1XVSA 3AQYA 1WFMA 3VRIB 2I07A 1CE1H 2HT4C 3EJQA 4R8WH 5BQ7B 3BC9A 2LU4A 4LEBA 3VI4B 4OF0A 3II1A 5DFWH 4OLWL 4NC1C 5SX5H 1QFWH 2V9QA 2NZIA 2LFEA 3NABH 1CZ8H 2EDBA 3H4FA 3NSXA 4GS7C 4P4KA 2BNRB 3L7FA 3U0WL 2QQNH 5AOLA 4HQQH 1VEOA 2HTKD 4JN2A 2BC4A 3JWDH 5ETUA 1LP9E 3B9DA 2JCCF 3SYQA 1A47A 2E9WA 3T2QA 3MJ7B 1J1XL 3S48A 4JM0A 5IJDC 1A6TA 3GB7A 5I1KH 3MLYH 4G6FB 4I4WB 2FAUA 4J3OD 3MDJA 1DLFH 2OJZL 5DJYA 1H8LA 3L9EA 4QAWA 3TYGH 3W39B 5I5MA 1KNOB 2PP7A 1FH5L 3U4AA 5EU7C 4ZMNA 3QO0A 1CGSL 5KSAA 2GCYB 5CGYC 4ALAL 4B95C 3MRKA 4RMQA 1CFQA 5KS9F 4RWYH 1HCYA 3VMPA 2V5TA 1B3IA 1OARH 3HZ3A 2WINB 1SOSA 3OMNB 4DK3A 3EBIA 4KZCA 2PP8A 4BINA 1XCQB 2YRZA 4BSWB 3E2HC 4APXA 3QDJD 4KRMB 1G94A 4NO0B 4L05A 4ZO6A 4I5BB 4PJ5B 4B9PA 5BUGA 3QP3A 2H0JA 4IBQA 4FHJA 4ZPVA 5K9JL 4JPWH 2IOIA 2HLFD 1MH5A 1ETZB 4XN8A 2NOYA 2JMRA 3KPRA 3LH2H 3O8XC 2DQMA 2W1NA 3QWOB 5D1XB 3TN0D 1HXYB 4PRIA 1EFQA 4OCWH 1A5FH 2M26A 2ITFA 3RL1B 1W8OA 5TDOA 4Q4IA 2YGOA 1CTOA 3EJYC 4KY2A 1PZ5A 2PW2B 1PD6A 4MNGA 1Z9SA 3I3EA 4WDIB 2EXWC 4R0LC 2N7SA 2V2XB 4FMFA 4NAMA 2E3VA 3Q7JA 2BSED 1T1YB 2Z7YA 3F6LA 2AV1B 3P3TA 3I9IA 8CGTA 3BJLA 3EFFA 3WS6C 1LO0H 3GPSA 4XOBA 2VXQH 2XWDA 2X5PA 1DEDA 1Z6JT 5AQ0A 4W9EC 1ZA6B 2D4FA 1DL7L 2C9XA 5K93A 3GQFA 3WSQH 4PJ9C 2WP3T 4DEUA 3IJEA 3K4DA 3EJCA 4B96A 2ODIA 3VFPA 4ZS7L 3HKZA 1YPZB 4GW1A 3MROA 3QEUB 1EANA 4TYUA 1G1CA 1HH6A 2ZUWA 5DTFB 2ZXAA 1IGTB 4XZUB 1DQJA 3AG3B 3FB5A 4CSTA 4JJOA 3AABA 4FNTA 5GGUA 1HINH 2GJZA 2QGDA 5CIPA 2O93L 3DVNB 1BBJB 2LT9A 4NUQA 5TFSL 4PVNA 2XN1A 1T03L 3UAFA 1AO7B 4P49A 3SE6A 1I9RH 4Z5RB 4ZX6A 1QWNA 2ADYA 4DAGH 5H35A 3H4HA 1M2VA 3SDAD 5EFIA 1RJLB 2YQ3A 4KKZA 1OD9A 3QULB 3OZ9H 3PGFH 1U3JA 2K3TA 2PTVA 3CFEB 2X4RA 1DBBL 5A7EA 3JWDC 5JIPA 1MFCL 2BP8B 1KIRB 3FT4B 3NEXA 1JWMB 1JJUA 4Y8AA 5JW3L 3MODH 3NIFF 3FT3B 2BDNL 2JJUA 2Y07H 5HHOD 3MLSL 1KELH 4I13B 1LE9B 1ULVA 4R7LA 4DESA 1S46A 5G4MA 3ULUD 2L8AA 3WKMH 1X7TA 3KLAA 4MB5A 1G9NL 3LSOA 5JA8B 4BGDA 5FF6A 3IVKB 4ECNA 5FB8B 3H6JA 5C0DB 4EUPB 1DQIA 1Q9OB 4DKEL 5I2IA 5A2IH 5IP4A 6PAZA 1T5WA 4PR5B 4Y5VC 2GB2A 3MJ9H 4PG9B 4RFEB 3QHZH 3EYQD 3E0GA 3FFDB 3FTGB 1I8KA 1LE5A 4IMKA 4KZ0A 4ZMLA 3ZE1F 1IGML 4EXKA 2IPKA 2VAJA 1K6QH 2NW2A 2V8LA 2CNYA 2VC2L 2FO4B 5GHWH 2XN0A 4KXAA 1NGZA 4YSRA 4LKCB 4BSVA 1NCWH 1VFOA 4KI5C 3M46A 3RNKA 2BY0A 2F5AH 1ND0A 4OF8A 1CLVA 4MRCA 5IBUB 1FDLL 3LZLA 4OFYA 4XOEA 4Q14A 1RKRA 4W4OA 4Y16D 1I7RA 1QASA 1CLZL 1QNZL 3FU5A 3P0YH 3QPQC 5DRWA 5JLZB 4Y1AD 1G6RH 4QDGA 3V4VB 2FECI 4DEWA 1T4KA 4H1LH 3QFJE 4OM0H 2UUDH 1I7TB 1RUPL 3MUZ1 4Y4KB 1U3ZA 2HG5B 2OMTB 1K8DA 3LQAH 4RMVA 2H1XA 5D7HA 3MFGB 3ZIYA 4H20L 3QQ9D 5DS2A 1TVBA 4GP8B 2OSLB 3VU2A 3VGGA 1YEJH 3IRZA 5LDSA 4NNYB 1NJ9B 2YZ8A 4DQOL 1KTDB 3PL6C 4QLWA 3SZ6A 1O5DT 2R69A 2L04A 2OZ4A 1ZANL 3QCUL 1IL1A 2OM5A 1KTLB 2J6EL 3FO0L 3TASA 2DQHH 2P5EE 1U6AL 5D1QE 3CFTA 4JJ5A 2B0SH 4K3DH 5C08A 3AM8C 4P46C 2XX0A 1FHNA 3WIFA 1CFMA 2BSCA 3WFZA 4HIHB 3GIVA 4P5KA 3G04B 2OX5B 2LTQC 4JDVA 5HDRA 5KN5B 4Z7QE 4ODTL 3WKNA 2QBWA 3THML 4JPKH 3HRZA 4DCQB 4YR6B 2BRQA 4DW2L 1CXLA 2LU5A 4GAGL 1WBXA 1EAPA 2VN5A 3G6JE 2X3CA 4QRQB 3V0AC 2YD2A 1S9WA 1WFOA 3H9ZA 2A9NH 2B77A 1ZIBA 1M7DA 1SYSB 5GZOD 3EUDA 4JRXA 3KXFA 4XCYA 5LWYL 2FX8L 2UWEF 3GO1H 1A4KA 2WHVA 3UDWA 1K4CA 2GFBB 3A4FA 3LDBC 2OULB 3E3QC 2K9FB 3LZRA 5A6MA 4MNHA 1HNFA 1G7HA 4OCXH 5JMOC 1KFGA 3MOBL 1JXJA 1X4YA 3L3HA 5DLMH 3U9UB 1K8IA 3P4MB 2IPUG 4LLAA 4PLJD 3ZO0A 1G1YA 1U21A 1DEEB 3OMZA 3DTXB 1QFOA 5DURB 1QX1A 4JFED 4YO0B 5M94B 4LCVA 5F3BB 4NQCA 3PXHA 1TVHB 2VXTH 4L8DB 3CHRA 3KPQB 1HHKB 4C4KO 3ECUA 4FF9A 4IRSC 3APNA 3VGDA 3PWJB 3UOAB 3UYRL 2YD8A 3JYCA 5AW8B 4FQXC 1F4AA 2BHFA 4BDVB 4I0PC 3L5WA 3NIGE 5ERWB 3LPGA 3TIDA 2VQUA 1MHEA 3CFJB 3FH8A 5DLLA 5AB2A 3FULA 3FAXA 5KAQF 2KHAA 2EINB 2K7QA 5DK2B 1N6QL 3GZQA 3FF8A 5DZAA 4HZAA 1OPGH 2YPVL 2WZ6A 2NW3A 3QRFM 1YAIA 4N68A 5KSUB 4HWBL 4B97A 2VR4A 2VLJE 4UT6H 4KO7A 5HPMB 5FM5O 1QSFD 2A0LD 1GAFH 2WAHA 2IWGA 2WLLA 2WO4A 3NP4A 2DQGH 5TPWL 3VFMA 3QAQA 3LKNA 2KQNA 4GQ9H 4PB9H 3D3VD 1AR1C 3ALWA 1E5AA 5HGBB 4NZUH 2R1XA 4AQ8A 3IGLA 4PRPB 2H26B 3AUVA 4NUMA 3LQAC 1T6WA 2J8UA 2XG4A 1AS7A 1S7QA 3OAYK 5IBLC 3BZEA 4MWFB 1CCZA 2Y06L 4F7TB 2G5RA 4U7SA 1DQQB 2VL5B 4NRYA 3HMWH 3L3DA 1FFTB 4BZYA 1I7UA 4XBMA 5HYSG 2BJML 1TQSA 3QYMA 1TYRA 3QT2A 3EOAA 1UD4A 3AG1B 4ANWA 4E9TA 3KGUA 4N5UA 1ORQB 5I8KH 1ZLWH 3TPUA 3IS1X 2VDML 1YEFH 4JHUA 4GSDL 2I24N 3D6GA 2WUCL 2LLGA 2ZWSA 5CU9A 4AQEA 4QRRD 5AKVA 1IGYB 2A4CA 4NO3B 5D2LF 1B0GA 5EZJA 1S6NA 3KPLB 2EDJA 3JV0A 1ZS8A 4BQ6A 4PGCB 2AEPH 1R3HA 2EXWD 2K0RA 2FJHB 2PR9A 5LNEA 1LEGB 3H55A 1OCWL 5CCKH 1KWGA 2WXNA 3V6OC 3U6RB 4N26A 5D2NC 5JPMC 3F64A 4F57L 4J5VA 4ENEC 3QI9D 2NTFB 4FTVA 3ZTNL 1NM4A 1INQA 2EDHA 1GYUA 3WO4B 1BPVA 4FDWA 5D7IF 4UI2A 2P5PA 2YAEA 1WAPA 4YZWA 4OQTH 3BW9A 1G1KA 4FOMA 1ET8A 5DRNB 3GSOB 3QRGL 5AVZB 5CM1A 3TYFB 9CGTA 4YUEL 4F1SA 1NEZG 4PJXB 1G9MH 3GMQB 2C1OB 1MZZA 4UTAH 2FEDC 2HTLC 3H6AA 4EZLA 1A6PA 4DF9A 1QHPA 5T5FA 5BW7A 2FJFB 2Q2EB 4HAGA 3RUGB 2QT6A 1YYLL 1TQUA 1QUNB 1GW0A 5DJDA 4HETA 1TKWA 4G8FB 3W81A 4WFHE 3IK2A 3DX6B 1DJSA 5EBLA 2QV2A 1BECA 2JKIS 2XZQH 5D7LB 5D8JH 1BVKA 2AJUH 1OCRB 5IROC 3HNVH 1M1XA 3BP5A 4GUQA 2PCYA 1ONQB 4Y1SA 4PJIB 5D5MA 1PG7X 3K0YA 4M6NL 4UQDA 4AQOA 2ICEA 2LVEA 1DANU 2A6DA 3HI6L 4PRNA 4X8JB 2NY0B 3C2SA 4Z8FL 3WD5L 3RPKA 2BW4A 1YMME 4F7CB 1JF6A 1MI5B 1S7UB 3SQRA 1QKZL 2EDEA 4GB9A 3HE6A 4WIQA 5IK3A 1HOEA 4XVJL 1E9OA 2ITDB 3QPXL 4LCWD 1CLCA 1QMUA 5F7YC 4XPTL 4YHIB 5ALBL 1CF8H 2XPZA 3FUJA 1BFOB 3JSSA 2Y1VA 4HUWB 1HHGA 1JNNL 5EO9A 2WBKA 4FCHA 3U79A 4PBXA 1HHIB 3NDYE 4R4FL 4APQC 3HCVB 4XC3H 1JI2A 3B2UD 1CN4A 2OTUA 2QSCH 3W0WA 5K9QG 1MCBA 4N6RB 5HHPA 2WLIA 4H0LC 2UZIH 5ISZA 3SZKC 2JKXA 5EMYA 1O7VA 1RK0B 3GF8A 1NAMA 1IKFL 4LF3B 3HI1A 4KKLD 5I0ZA 2VAAA 1NUFA 3JTTA 3U0PB 3DXAE 3S9DB 2IFGA 2F61A 4PB0H 3FB6B 4M61A 4U3SA 4I3SL 2B1HH 5LGJA 1FRGH 1IC0A 4Z7WA 5L2KD 2V5SA 3CNKA 4P0DA 4PEEA 2E9JA 3QNZA 2VXSH 4WHYG 4KZDH 2OMWB 4GAJH 2DZEA 4LEXL 4PS4L 4RGOH 1KN4H 1T66C 1ADQH 4QRBA 2NYYC 1MJ8L 4U05A 4KI1A 1IFHL 2Y7OA 1MLCA 4NUPA 4RMRA 3HR6A 2VMFA 2APVA 2JI2A 1INDL 3QORC 1ET7A 4JG0H 4WUKL 2DYSB 2NY6B 2DI9A 4OZIE 1UXSB 4YE0A 3T2LA 2YOCA 2CH8A 3UTSA 2NNAA 1LO3L 2RCSL 2X1XR 4NS0A 4KFMA 4K3EH 3S97C 1DQVA 3NSCA 4GG6E 1DVFB 2WAQA 3ES6A 1U8JA 4WI0A 5IOPB 4F2ME 1BQSA 4K8RH 3BWUC 5BO1L 3T0EA 4AEIH 1MHPL 3I9AA 2NX5D 3CZLA 4AG4H 1G9MC 4YPGA 1HT6A 4PGDA 3P4LA 4JKMA 3P9WB 1E9QA 3N1MC 3NSDA 1VZIA 3OJVC 3GC3A 5DEFA 5DQDH 2RFXA 3CZSA 3H42H 3D9AH 4ZNEE 5GIRA 5D7JC 4LVNC 2HT2D 4IOIA 1OAQL 3MRIA 1QO3B 3FT2B 4TSBL 1DHKA 1PJWA 1TEFA 3UAAA 3PGDB 3GSNA 4AMWA 1SDAB 1XZWA 1TJGL 4YDVB 1TTUA 2BVPA 4CBZA 3JXAA 4FYTA 3QCTL 4V1DB 1NPJA 5DJXA 5F1OB 4WEBH 3WG7B 3HZVB 2R2HB 2DBLH 5D7KD 3QUHA 4PW4A 1MCIA 4L48A 1IVLA 5F21B 1RFDH 5FECA 3QXDA 1NMAL 1L6XA 1KIQA 2R2BB 2MTPA 3H9SD 3MRRB 5EU4A 5C0AD 3SDCD 4B60A 3WXWL 4G6AC 3NTCH 3ULUE 1W2KT 1CICC 3IFPB 4JO3H 1LEKA 5MEPA 3HMXH 4R8WL 1PAMA 4Z6AT 2VABB 4AT6B 1MWAH 1CBJA 4ZAKA 3EZJB 3KPPB 4AC2A 1DBML 3EF4A 1U9KA 3ZT7A 5DRZA 3N1GC 1F97A 1IM9B 3N5AA 3NABL 1GZPA 4MD0B 1MCOH 2Y9RT 4QHNA 3L6FA 1BGXL 4R0LB 3SKJH 4BFEA 4JN1L 2ZP0T 4FA7B 5DD3H 1F42A 3JWDL 3OKEB 4GT0A 5DUBA 4FXKC 2VDPH 3O81A 1ESOA 1YEGL 3QJXA 5DHEA 2YWZA 4IRJA 4PY8J 5BRZE 4ZG1A 3MRFB 4N8VA 4Y19B 5FOJA 3MLYL 2RA1A 1WFJA 2V33A 4D8PB 3P77B 1GJIA 1AJ7H 3LIUA 1KPRA 1UUSA 1YYCA 2Z4QB 3GXDA 2C9AA 1JHLH 3SJVE 5ICYA 1UB5B 5DHXB 1EZVX 1WH0A 5JNYA 1P5UB 4BHUA 3FUDA 1SYVA 1X6LA 3STZB 1I8LC 3P4NB 5IQNA 1URIA 3OKOA 5AZ2L 3DBXB 3MLTA 4L1HA 2H9GB 4PUBH 4BZ1H 4RWYL 5IR1A 2YEVB 1MVUB 5KBMA 2YXMA 1HAUA 1A14H 2B59B 2OCFD 3ME0A 4P2RB 4F7EA 3QEQD 4HCIA 4QXWA 4HIJB 2W0FB 3C8KA 1I3UA 4OGAC 2CNZA 4YC2C 4X7TA 3ZIMA 4B7LA 1F4XH 1PY4A 1Q1JL 2P24B 3FFOA 4D9QE 3ZE2E 3D51A 3DJRA 5H94B 3ULVH 1WRFA 1QR4A 2OYKA 3TOPA 4QKTA 4K94L 4Q9QL 4F37F 4QUOA 1BOGB 3ATFA 3IYLW 4I88A 4MYWB 3RDTC 2G9KA 4CVZA 2ZAGA 3TEZA 3OV6A 3LH2L 4AGNA 4DP8X 4J8RB 3JUYA 1U8QB 3NSFA 4I9WE 1I3RB 4M8RA 4OCWL 5ESQA 1A5FL 1RZPA 3ETBJ 5T1KA 1Z0NA 1PBYA 3O4LE 4KXZI 5C0FA 2R2EA 1ZIAA 3BH8B 2D0GA 1FIGH 4ZXBC 4P9MH 1GGTA 4AIXA 1DFBH 1KJMA 3UTPE 4AW7A 4KX9A 4ZUUB 4KRPC 3BLBA 4K8RC 2DAVA 4IKJA 4HPOH 2RALA 4RA3A 3MPCA 3BWUF 3AY4A 5D1QA 4BK5A 1NH6A 5CEZH 4NQVB 4WUUD 3CJJA 2WXHA 1UA7A 1GGUA 3ZHLA 4NAJA 2IADA 5J9PB 4FLOA 1LO0L 4KVNL 3ZTJH 4O2EB 2F58H 2ALAA 3PHOB 5F7LB 2DQJH 1SVCP 3PABA 5DK0B 1KJ2B 3QWRD 1UVQB 1J5OH 1RZKL 3FFCE 4MA8H 4N0CC 4C58B 4L0YA 2WBJC 5CILH 1PEZA 1RIHL 3WSQL 3US1A 4HH9A 2YHGA 3T4AA 2QV4A 4KTDH 1NDMA 2CDGA 3PWNA 4KC3B 3HZMA 4QLRA 4HHAA 1PZ2A 1Y7VA 2P7TA 3D09A 3VXRA 2FSEA 3REWB 1QSEA 4GI9A 1HINL 2VISB 4NN5C 1K4DB 5FA4A 4L9LB 3VWKA 1G7PB 3GMRB 1T83C 4L5FE 4ELDA 5FO2A 1NSNL 4PJBA 4YVNA 3VSUA 1XHHA 3U2SA 4AV5A 3D30A 3UPCA 5C8JB 5L0QB 1I9RL 2FDBP 5D6CB 5E1AB 3AZUA 1UT2A 1S7SA 4K7PX 3U4BL 3GHEH 1IGJA 5KYYA 2IQAB 5TE4H 3ZHFA 5HYJB 3PHQA 4LU5H 3DMMA 2VCOA 5JOFB 2ZUSA 3UEZA 3GXIA 2G3MA 4NYLB 1I8IA 3ZJAA 2J25A 3ARGC 4E9YA 4JFOB 1E4WH 4KJYB 5AYUH 1EWHA 5MP6L 4ELKA 3M88A 4YEFA 2NZ1A 2GI7A 1C8QA 4LLYB 3VSQA 1OVZA 1CE6A 1OCOB 2VQTA 2Y07L 4M7ZC 1T22B 1KELL 3MUGA 3UO8B 2WWMD 2AP2A 2C4XA 4YSPA 1NC4B 1HIMH 3WKML 3U4EA 3QJFB 4XC1H 3C8HA 5T1MA 5I1IH 2XSKA 1X9UA 2XWBA 3B6SB 4LHQB 1SLWA 8FABA 4AGLA 1P7KB 1YRKA 3PXLA 3L54A 1H15A 3MJ9L 4KKCC 1KXTB 3QHZL 4MKTA 3VSVA 3DETD 5LJYH 1JFQH 2VLJA 3NCJL 4M1DH 2I9LA 2IOMA 4HCRA 4Q6IC 5T3ZD 2CKBB 2JQZA 2GJRA 3QC6X 4FJ6A 4M02A 3N0AA 3S98A 5KZCD 1GH7A 3GSVB 4XHJD 3W11C 3HG1D 3ULVC 3BUYA 1AGCA 1NCWL 1MAKA 2IGFL 4DOHB 4E5XG 4NNPH 4ETYA 2VQ1B 4QY8A 4P4KC 5G4OA 4U1GC 5E8OB 3CX2A 3R7QA 2OJEB 4CJ0A 1T1XA 3MRPB 2AANA 3OHMB 5EU5A 2GBVA 2ZXWB 3IEAA 3OAYH 4J6RL 1PD1A 1BJ1H 1CJYA 1DJGA 1GYVA 1FVEB 1S4IA 4X5XA 5FCUL 1AGBA 2IBZY 3WTVA 5J1AA 3GLZA 3P0YL 4ODUA 1H6UA 2HSIA 3I84A 1D5IH 5F1IA 3GJEA 3VD1A 1G6RL 3BXNB 4I2XA 1QRNE 3LPWA 3E80A 4P5MB 4K55A 4HLEA 4GKOA 4Y88A 5KSAC 3LQAL 3V6FA 1JYWA 1G7IA 3QDGE 4PRDA 2NYYD 5IVZB 4DUWA 3AT0A 4HUXB 5KVMC 3PYCA 3CFNA 5KYUA 5E9AA 5DR5H 1HNYA 4Z7UF 5E2UH 5C0CD 3L9YA 4KPHH 3RA7L 2YPLB 5BV7B 2WLNA 4G2AA 4KFZC 1WAAE 3QORD 4IRSB 1V3JA 3TURA 3MNZA 3U1SH 3KBFA 2UXVA 4FQXB 4M5ZH 4Z78A 2B08A 2N3JA 4FJZA 4I0PB 4K3DL 2B0SL 5HYSB 4LOVA 2AQTA 3D52A 4B9KC 3KJ6H 4IOFC 5EEWA 1B0RA 2JLPA 4OD3H 4HUUA 3GTVA 3VM7A 1OM9A 1HDMA 4F2FA 4H8UA 3L4YA 2E5EA 2O5YL 1KB5A 4AYSA 5IHBA 1HI6B 2YA2A 4ZMXA 5F7HA 5DJZB 2VDQH 3BKCH 2PO6A 2X4PA 2AQPA 4MA7H 2R1WB 1DZ0A 3KEDA 1LEIB 4ZSOA 4XN2A 3I85A 2IQ9H 3NCWA 1XGTB 4NZTH 3VYPA 1N8OE 3BH9B 4NC0B 3TF7C 4W9GC 4JFDA 1J8SA 4CKVX 4ZX4A 4X6CF 3FQXA 1IGFL 1WEJL 4P57B 1B9KA 1DQDL 5DVKA 5IUSA 4U1LA 3SE3A 5IVXA 4S2SA 3FQNB 4XODA 1J8RA 4S11A 1OXYA 3PP3K 4L8CB 3NJXA 3FCTB 2VLRD 2W9LA 4UF7C 4LCWE 3Q2CA 4IGBA 1L0XA 1AQMA 1SJHB 3VXSB 3ROOA 5EC2B 1DANT 2QQQA 4WVRA 2VLMD 3V9FA 1NEZB 4OCXL 5DLML 1ORSB 2H4EA 3MBEC 4G6AD 1AYOA 1UCBH 2V17H 2B16A 1J0IA 3MR9B 3CVHH 1X5IA 2V5RA 5KJ4A 1TZHA 3DX7B 4J4PD 3GLDA 3GM0A 4MMZB 4X99B 2G60H 2XNAB 3W9DA 3L2LA 2Z34A 2WNGA 1R0AH 3BPOC 3C5JB 2QTEA 3EH5B 3FKUS 1B4LA 4I0KA 4LCCB 4U1HA 3OQRA 4M93C 2YS4A 1N3NB 1T20A 3DVGA 5AVUB 4QRPA 4QWWD 1BW8A 2KBGA 4QOKE 2QZ5A 3GYRA 1D5XA 3ULVF 4FG6D 1S3KH 4N85A 5T3ZL 5I5IA 1PY9A 2FWLB 2DI7A 1X5YA 2CIIB 3C6LC 3IJSB 2C9SA 3PY9A 1H3VA 1T21B 5IEKA 1WS7A 1Y18B 2D7QA 4IK6A 1VIWA 3NJJA 2QQLH 3FQWA 4LLMA 4UT6L 4YK4C 4POYA 1AFVL 3NFPB 1GAFL 2XG5B 4F7MB 4O2FB 1NBQA 5C86A 3QUKA 4G8IA 4UT7H 2X05A 4E9SA 2EAEA 3IU4H 4Y89A 4YSDA 1UATA 2PWDA 4JPSA 4Y2LA 4YHPA 3FT9A 5EZLB 5IQ9A 4H26A 4HGMA 2CR6A 3VI3E 4FXTA 3OKDB 1A9BB 5HI5D 4G3YH 5CEXB 3RL2B 2BXZA 5IFJB 5C0EA 1GGIH 4AH2B 4G1EB 3HMWL 4LNRA 4Y7MA 1YEEH 3FU3A 2YJLA 3U30C 4LLDB 2XXFA 3L8QA 2QFRA 5I8KL 3HAEA 1ZGLP 4YHLL 5C0BD 2NSQA 3AY2A 1YEFL 2CU9A 4P23A 2VYRE 2OMYA 4MHHI 1Z3RA 2BNQA 2V4LA 4MMXC 5EU6D 1SXAA 4M7JH 1T0PB 4CA4A 2NNFA 4BV1A 5I0XA 4YN3A 4LPVA 1MVFA 4LPXA 3A4EA 4W4OC 2ZOLB 4KRPD 5B39A 1MCNA 4YLBA 5DQJB 1LDPH 4K8RD 3C60C 2IANA 2P46B 3BPCB 5DHMC 3ARDD 1QEWB 1QW9A 4HULB 5ITFA 3NG5A 4APQB 5I24A 1JSYA 2CDFB 3MRQB 4LCIH 1PQZA 3ZYIA 3BD3A 3NJFA 1B2WH 3L48A 3VXME 5BOJA 3LRKA 4OQTL 5IB5B 5C0AE 1BYPA 1A2YB 4KROC 1UH2A 5KVFE 3OMIB 4UTAL 4HIIA 3DX9B 4GQQA 5DCCA 1KLFA 1YHPA 2A74B 5H37A 2ZX9A 3AC0A 1X9QA 4AENA 3TEXA 2GSIA 2ADGB 4LAQH 4N3TA 4JPVH 5I19L 1TMCB 1QFHA 4JFHE 4YMPA 4ODSH 1V3LA 3H8NA 3TJHC 5JIQA 2XZQL 5D8JL 4Y4FC 2AJUL 1DQMH 4IKIA 4IJ3C 3KL0A 3FS9A 4JBSA 3AWFA 4DN3H 2KKQA 4BA8A 1N64H 1JWUA 3HC4L 3KYOB 4CJ1A 2A6IB 7TAAA 2AI0H 4XCFH 2EACA 2ZP9A 3HG0A 4M7LT 1AE6H 4A2FA 1VJSA 2OYMA 2W81C 1SHXA 4Q89A 5DD1H 4AGQA 2EQDA 3VXTA 3IDUA 4KY1H 4X9IA 2BP0A 3JT0A 4X6DF 2QGEA 3GI9H 5C70A 1IC4H 1T1ZB 1BZ7A 3LN5A 3MHZA 4UMSA 5FYJD 4XCNA 4EBQH 1TT6A 1I9EA 2V3DA 5I5RA 5EH1A 3L3OC 3WS3B 4GMSH 1S3RA 1QLEH 2BNRD 1MCPH 4X9BA 3NCYP 1UACH 1EJ6A 1TQCB 4XC3L 4L3CB 1IV8A 4OIIH 3RVWC 3TZVA 2N1TE 4KDWA 4N9OB 4Z3GA 3IE9A 4UOQA 5IMLB 4WY7H 3UYPB 1JGVL 1FO0L 2C7FA 1CS6A 4UQAA 5A3IC 1VERA 4LDCA 4MVBC 2IAMB 2UZIL 4HUCA 4LBEA 4KKCD 4M4RB 2DQDH 1F90H 2G30A 3FHAA 4G6FD 4QRSB 1DLHB 3E8UH 1JP5A 3FOMB 3LYRA 1N0LB 4PB0L 3VW3H 1CIUA 2BRRH 3TO4A 2ZUYA 3IF1A 1VA9A 1F6AB 5C07E 2JK5B 4JZNA 2F8OA 4WENB 1ZMYA 4IIQB 3W11D 3ULVD 5ID0B 4WW1A 1EGJA 3TBTB 2VXSL 4JK0D 1OTUC 4NQSA 4D8OA 4KZDL 4ICXA 2SEBB 1TCRB 4GAJL 4UZUA 4YAQB 5F6HI 5D93C 1NIDA 5SWZA 3WFBL 4Z0BH 5BS0E 1ADQL 1SZNA 1U8PB 3BPNB 4QTIL 5KUKA 1I1RA 1UA6L 4HXBL 1U33A 4QXGL 4WUUE 1P4LA 4RAUB 3GRGA 2XJKA 1HWWA 4O51B 2B2XH 3MKKA 4ZOEA 3BQUD 2APTA 5J12B 3S3BB 1RZGA 4PJ5D 5KWYC 1BG9A 5JHDE 1YDPA 2WO2B 3D25B 4JG0L 5EU3B 1T1WB 3G08A 1XSOA 4JQIA 2BZCA 4JVWA 5IVNA 2DEYX 3LH9A 4UIMA 5E99H 3REVA 4NKMB 3W38A 3OAZH 4O2CA 5CEZD 4QYOB 1TSRA 4FXKB 1LK2A 3VQLA 1NLBH 3FTXA 1EEZB 2I32A 2A4ZA 4JY5L 4K3EL 4MNQA 5IHUL 3KPSD 4WWKB 4ZBJA 4AQ8C 5TK2A 2XYCA 4K8RL 1NAMH 5TH2A 3B5GA 1ACZA 1A4JA 2X4UA 2XVBA 5LHDA 4F9PA 1QSZA 3DROA 3O3BA 2X38A 2UZXA 4OZGB 4F3FB 4S1SL 3ARFA 1HOCB 2APSA 5CP7A 5DC9B 1WBYA 2AABH 4GXUM 5E7FA 3D9AL 3EYFB 3VDBA 2YFOA 1QATA 3KNBA 1PCXA 3S3JA 4UU9A 4WNQA 3RNQB 1ZHKA 5J06A 1ZTXE 2XZCL 3IFLL 3PWLB 5F89B 1ILUA 3ZTCC 5CNHA 2EO7A 2QGBA 2VR7A 1GSMA 2AFNA 2COVD 4WEBL 1EHNA 1IAKB 2FHCA 4Y2OB 4O4YL 2FK9A 2HVJA 5F93C 5CZXC 2NY3C 2N7AA 4N0RA 4K7FB 3WNKA 1QR1A 1R3IL 2PETA 2ICWI 4XBGA 4UDTB 3RDTB 5LDUA 4H88H 5T1JA 1F6FB 3APDA 1A22B 3SGJA 4JO3L 2BZ7A 1MLBB 3F04A 1MWAL 2OBGA 1AO7D 4ODXB 4GO6B 2JJSA 1YNKH 2EH7L 3B9KA 5AW6B 5I30H 3BEVA 4DQAA 2P5WB 3B7YA 1MCOL 3WL9B 1NKGA 5IT2H 1P9MA 1JDAA 1YY8B 5J7CC 3NYKA 1XF5A 3OKKB 3OXRA 5DD3L 4DNLA 3RPIA 3N9GH 3AQDA 3N44F 4I1PA 4JCWA 2VDPL 4X5PA 2DMBA 1O6VA 1ACCA 3IGAB 5FYJL 1P69B 3NCBB 1M3IA 4WW2A 3MBED 1BJMA 3H7BA 3N3EA 5HHXH 1VACA 1AJ7L 3LB6D 1JHLL 1BMGA 2A4EA 2ZOKA 1BJ1J 3GSRB 1KEGL 1KPUA 1J5DA 4GO8A 5T1DH 1WLHA 2C26A 2FGWL 4Y2NA 4HIXH 4PJDE 2CHZA 4GH7B 5DI8B 1WCBA 1WZ1H 4PUBL 1U2CA 3NA9H 1PL3A 1S9VB 2WWNA 3AFLA 4U6XA 2AXGB 4Z7NF 4OLXH 1KV3A 1C5BH 3L9BA 3S8WA 5PCYA 2BHUA 4EXPX 4PVMA 3C6LD 1F4XL 4G8EA 1NFDE 4PJ7E 4KQ3H 3MRHA 3TBVA 5DO2C 1E28A 3VFOA 3ULVL 3BP6B 4M1CD 2NPLX 2PPFA 3HE6C 2UX7A 4W70A 5C09D 1VLXA 1XMWA 2R7EB 4N25A 4UTBA 5B3JE 5CWSA 4PJHE 3LEYL 2N1KA 2QLVB 3BZFB 1C08A 1I1AD 3SBPA 2WLZA 5DGQA 3ARBD 3UCQA 1P6AB 1FLTX 1TZIA 2Y0SA 2FQGA 1AGFB 5FW8A 3B83A 4W6WB 4DP1X 1LM8V 3P9MA 1GYWA 3US0A 4P9ML 4MAYC 1LNUB 5FA3B 4E5XB 3FDWA 3OKYA 4MQTB 5L6YH 2WO3B 1I7ZB 2GYSA 4HPOL 1OD7A 1ZHBB 3ZZ1A 5ADOH 1KZYA 4IHOB 5CEZL 4JHWL 1SVBA 1HYRC 2F5BH 1SUJA 5CZVH 5JORA 2CLZA 5EIIA 2DYPA 4Y4KD 3D39E 1XR8B 4R4BA 2F58L 4ELMB 3U4KA 1YVLA 2FWUA 4JGUA 3WUWA 4DHLA 4OGYH 3SE8H 3L7EB 3OWEA 1WPCA 1MQKL 2CDEA 1QWHA 4A7QA 1WWWX 1KCVL 2H2PC 5AVSB 5TDNA 3C60D 2W07A 3GRWA 3T2OA 4X2UA 2OP4L 1RLBA 3H53A 3L7FB 3MCG1 2V6HA 2N59A 3PQYE 1M57B 3CFDA 1A9VA 4JN2B 3X3GL 3T71A 4BM7A 1CK0H 5CFHA 3GHEL 4N86A 2C1PA 5TE4L 3GB7B 4KROD 5D1ZC 3TBBA 2DL2A 1UOVA 5DJYB 3L5IA 1YEDA 3QS2A 5K9KB 1A1MA 3IN2A 2XU9A 4KNSA 1JGLH 2FEJA 4MDRA 5E9DB 1E4WL 5AYUL 2PPAA 2WK2A 2DLEA 2CK0H 3L45A 2EE0A 3MRKB 2NQDA 3S35X 4F27A 3FQYA 5E1IA 1FE8L 1HJCA 3CCHB 4Y4FD 5JW4N 1Z9LA 1CIDA 1EXGA 4NX0A 5F3FA 1LMKA 3HE7A 1JPFA 1K5WA 5I1IL 3HN8A 4APXB 1RCYA 4JM2F 3GDCA 3TFBA 3A4AA 3O3AB 4PRHA 4ZPVB 1MRFH 1S7VA 1MH5B 3F7KA 1JFQL 1RIUH 4A6YA 1EQWA 1JGDA 3KPRB 3K6OA 1E8YA 4JM4L 4PRIB 4TN9A 3VG9B 4H13C 4K2UH 5CJXA 3MTXA 4R26H 4XX1E 4ZAKC 5CGMA 1HCVA 1PZ5B 3FSVA 4MNGB 1Z9SB 1ASOA 5IMKA 3VXUE 5T3XE 3NGBC 2KERA 1EHXA 2DQUH 2PP9A 4JFYA 1XF4A 1Q0YH 2X9XA 3HG4A 5I71B 1T80A 1T5XA 2MOVA 3VRLE 1LWJA 2FATH 2FD6L 4Z18A 1MW1A 3G6AA 4RRPA 4NZ8A 5LCVH 1NINA 4QRAA 4IRJC 3QIUA 1D5IL 1FL3A 5A2KH 2XZAH 2WNXA 5E23A 1CYGA 5F1SA 3NJHA 4P8QA 4F93B 2E7MA 2NNCA 3AXLA 1IQWH 1N8ZA 4B9FA 1OTUD 1VFAA 4YL9A 4RAHA 5FDWA 5E8EB 2Z92A 3VFPB 4DPCX 4GW1B 4X4MA 1GKEA 1X5FA