2ZWNA

Crystal structure of the novel two-domain type laccase from a metagenome
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
AEREFDMTIEEVTIKVAPGLDYKVFGFNGQVPGPLIHVQEGDDVIVNVTNNTSLPHTIHWHGVHQKGTWRSDGVPGVTQQPIEAGDSYTYKFKADRIGTLWYHCHVNVNEHVGVRGMWGPLIVDPKQPLPIEKRVTKDVIMMMSTWESAVADKYGEGGTPMNVADYFSVNAKSFPLTQPLRVKKGDVVKIRFFGAGGGIHAMHSHGHDMLVTHKDGLPLDSPYYADTVLVSPGERYDVIIEADNPGRFIFHDHVDTHVTAGGKHPGGPITVIEYDGVPVDDWYVWKDKDYDPNFFYSESLKQGYGMFDHDGFKGEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords two-domain type laccase
publication title X-ray structure of a two-domain type laccase: a missing link in the evolution of multi-copper proteins
pubmed doi rcsb
source organism Metagenomes
molecule tags Oxidoreductase
total genus 98
structure length 317
sequence length 317
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zwnA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zwnA02
4UAHA 1L9PA 3OM3B 3V9EA 4P5RA 4YSDA 1FWXA 2PPAA 6PAZA 1W6WA 1AS8A 3NSDA 2I7SA 4ENZA 4YSSA 2WSDA 3FU7A 4Q89A 2H5UA 1ET7A 2HX9A 4EF3A 7PCYA 2VM3A 1M57B 2R7EB 2N0MA 3FSAA 3AG1B 1AACA 1N68A 3OQRA 2WO2B 4PAZA 1W8EA 1OCOB 2YAEA 2W8CA 3JTBA 3CVDA 3KW8A 4K9JA 3UACA 4G70B 1RZQA 1YLBB 2IWFA 4YSEA 1X9UA 1NINA 2GI0A 3ERXA 3FSVA 5AFAA 1RZPA 1ASPA 1NIEA 1NWPA 2X88A 5F7BA 1OCZB 2EIJB 3PPSA 4DP5X 3PCYA 1QHQA 2OJ1A 3GXUB 4DP4X 1BAWA 2EIKB 1WA1X 5B3SB 1A4CA 2YQBA 2ZONA 3QJQB 4DPBX 3ASOB 5IY5B 1BXUA 3NJLA 1PZAA 1BYPA 1MZZA 2IH9A 3EH3B 1QNIA 4CSPA 2I7OA 5B1JC 3IN0A 4AZUA 2DYSB 1ASOA 1GS6X 2GSMB 5D4IA 2IWKA 4YVUA 1GSKA 2BP0A 5A7EA 4E9SA 1OV8A 3OMAB 2UX6A 2XV3A 5AKRA 1GS8A 2XLLA 3NP4A 3SBRA 2XV2A 1OE2A 1NZRA 2IDUA 4YSOA 4NERA 1IBYA 2XU9A 3NJHA 1QLEB 1GR7A 4DP0X 2BHFA 2PP9A 4N8UA 3CVBA 2BW4A 1A8ZA 3TA4D 3QQXA 1AIZA 2PCFA 4DP8X 1MZYA 5I6PA 2HZHA 2ZOOA 1BQKA 4NB7A 4YSRA 4E9QA 1OE3A 3NJNA 1IBZA 4GP4B 1JVOA 4QKTA 1BQRA 3IE9A 1EZLA 3WKPA 4G7SB 3PLYA 2I85A 2IWEA 1ZDQA 3NSFA 4HALA 4DPAX 1SF5A 5B7FA 1DYZA 2DWTA 3X1GA 2CUAA 3WI9A 1AQ8A 2XXFA 1L9OA 5D4HA 4KNTA 2YAHA 1XB3A 1SF3A 1XB8A 1RKRA 3NJGA 2HRGA 3ZDWA 5B1AB 2CCWA 1WA0X 3IBOA 3T6XA 3T71A 4AKQA 1KDJA 3UAAA 3EH4B 1SJMA 1AG0A 4E9VA 4BDVB 2PPCA 1JXGA 3HEIB 2OCCB 1NICA 3AW5A 3NSYA 5B1JA 1NIAA 2FQEA 2R7EA 1OOWA 1ILSA 1T5KA 4W9ZA 1L9RA 2XUWA 5D4JA 2PP8A 4DP1X 3NJMA 1WS7A 4G72B 3ABLB 3EHBB 3FYEB 4DP6X 1NIFA 4JHUA 1ADWA 2IDTA 4YSTA 3FYIB 3WKQA 3NSCA 1A3ZA 3T6WA 1GS7A 3FSZA 3FQYA 1V55B 1AS7A 1R1CA 4A2FA 5I5MA 1MDAA 5I6KA 2VW6A 3IEAA 4HHWA 1PY0A 2OV0A 3X2QB 4GP5B 1N70A 2IDQA 1JZHA 4G71B 1JZFA 3BVDB 2YXVA 1AOZA 2YAMA 2PPDA 3QJTB 1RCYA 3DTUB 3FSWA 1BQ5A 5FC9A 5I6LA 1WAEA 4A2DA 3QPKA 3IN2A 1KCWA 3G5WA 3ABKB 3JT2A 3WIAA 1ET8A 1GY1A 2YAFA 3SQRA 2XX0A 4A2HA 3DIVA 4W1TA 3X1FA 1NIBA 1OCCB 4KNSA 4GP8B 1L9SA 4AKOA 4F2EA 3X1NA 1OE1A 2GC4C 3FT0A 5E9NA 3QJVB 2Y1AA 1TEFA 1KDIA 1NTDA 3AY2A 1CUOA 1GYCA 1CYXA 2JFCA 2VMJA 1SHXA 3GDCA 2CJ3A 3QJSB 2AZAA 2VW7A 1A65A 1B3IA 4HAKA 1JVLA 3S3BB 4Q8BA 4GYBA 3NJIA 5I5IA 1KGYE 5I5JA 3FU7B 2XX1A 2IDFA 2VM4A 3KW7A 2CAKA 2JKWA 2QT6A 1PLBA 2YAOA 3S8FB 1IC0A 2J56A 1PZBA 2XVBA 5EHFA 1PLCA 1J5CA 2PCYA 3ZX1A 4AX3A 4CSZA 2HX7A 4QLWA 3NT0A 3BQVA 5B7EA 4KO9A 1M9WA 5TK4A 3AG3B 1AAJA 4YL4A 4UANA 3NP3A 3UAEA 5I6NA 5F7AA 4HHGA 3S3CB 2W88A 1GW0A 1TU2A 4P5SA 5I26A 2BWIA 4F7KA 4HZ1A 2BZ7A 5ANHA 4BK5C 1ZV2A 4PCYA 2FQFA 4E9YA 2DYRB 3PAUA 1JZGA 2EILB 2XV0A 5PCYA 3S3DB 2J5WA 3U25A 4GY4A 2YAQA 3HB3B 2IAAC 2HX8A 1SFDA 2DY2A 1ET5A 5B1BB 1HAWA 1JZEA 4MFHA 3UADA 4KO6A 3PAVA 3X1EA 2GBAA 1BXAA 3CDZB 1NIDA 2DV6A 3WG7B 2QPEB 2YARA 4DP2X 1FFTB 1PMYA 1OF0A 2FT6A 1PZCA 1VLXA 3SBQA 1AZUA 1DZ0A 2TSAA 3H4HA 3OMIB 2CBPA 3X1BA 4BXSV 4DP7X 1ETJA 3EF4A 2HLEB 2UXFA 3FPXA 1ZIAA 1PLAA 4YSUA 1TKWA 1I53A 1PCSA 3N55A 3WNIA 2DWSA 3FQ1A 2FNWA 1ID2A 1JXDA 2FQDA 2P80D 1ILUA 5I6OA 1PAZA 3CVCA 2MRYA 2FQGA 2BZCA 1J5DA 2UX7A 3NJFA 3QJUB 5I28A 1BEXA 1WA2X 1FA4A 3QJRB 1SDDB 1NDTA 4YVNA 2XYBA 2HXAA 1PF3A 1KV7A 3FQ2A 2WO3B 3GYRA 1J9TA 3FU8A 1MG3C 4M3HA 2GIMA 1EHKB 1J9QA 1MG2C 2PPFA 2H3XC 4JHVA 4KOCA 2VSKB 3EH5B 3V9CA 1NPJA 1KBVA 1M56B 2IDSA 2XXGA 2GC7C 1E5YA 1A4AA 1GY2A 2UXTA 3TBBA 2GHZA 7PAZA 4A2EA 2LLNA 4WTQA 2XWZA 3FPYA 3WNJA 1KBWA 4A67A 4E9XA 1OCRB 1JXFA 1V54B 3MX0B 2AVFA 3T6ZA 2BP8B 3UABA 3S8GB 3H56A 2PLTA 1F56A 1AR1B 4KOBA 1L9TA 4A68A 2BWDA 1W6LA 1JERA 1AZNA 5AZUA 2ZWNA 1AZBA 2Y69B 4E9RA 2QPDB 1AS6A 1ZIBA 2NRDA 2TSBA 1IUZA 1A4BA 4X4KA 2BO0A 3TU6A 2YXWA 4AKPA 2CALA 2UXVA 2X87A 1SHWA 1JZIA 2PPEA 1X9RA 1KCBA 2FWLB 2FT8A 3DKHA 2H47C 5TK2A 4DPCX 1IKOP 1JZJA 1L9QA 3T6VA 1CURA 3T9WA 9PCYA 4KO7A 2PP7A 2QDVA 1JOIA 2E86A 2VSMB 3ABGA 1XMEB 4BWUA 3D12B 1SNRA 2AANA 1PNDA 3N2JA 4KNUA 3ABMB 3CDZA 3OMNB 1CC3A 5B1KA 4E9WA 3ZIYA 2Q5BA 1SFHA 2UXGA 4G7QB 3H4FA 3CZUB 4BWWA 4G7RB 2RACA 2ZXWB 4A66A 3AZUA 2IH8A 1CYWA 3CG8A 4BDVA 3NYKA 5I6MA 3OD3A 2GB2A 4HCFA 4HIPA 2B08A 3FU9A 4N4YB 1AG6A 2QDWA 3AG2B 2EIMB 4RH4A 1E67A 3ZBMA 4KO5A 4GXFA 1J9SA 3PAZA 1HAUA 4DP9X 3NJKA 4F2FA 3ASNB 5B7MA 1J9RA 2FJSA 4FA7B 3UGEA 4ZK8A 2VW4A 2BP0B 2EINB 4BWTA 2BW5A 3TBCA 1E5ZA 1NWOA 2P80A 3C75A 3L45A 1E65A 1KYAA 5PAZA 1V10A 1AZRA 1WS8A 1AZCA 4UF7C 3SBPA 4AI7A 4TXVB 4YSAA 6PCYA 1SDDA 2J57A 4HCGA 4FAAB 1ZDSA 2A3TA 4JKNA 3TASA 1PNCA 2AFNA 3FS9A 2JXMA 2YAPA 4E9TA 2B3IA 3AG4B 1UATA 1ASQA 2MTAA 1AANA 1ZPUA 4BXVA 3MBWB 1NPNA 4YSQA 1TEGA 1BYOA 4M4RB 1BXVA 2Q9OA 4HCIA 1E30A 1XB6A 2FT7A 2VN3A 5LDUA 4WKXA 3PXLA 2HRHA 4YSPA 4L0PB 4NAJA 3RYMA 8PAZA 3NJJA 2J55A 2AZUA 2FTAA 1URIA 4A2GA 2BP8A 4YSCA 1HFUA
chains in the Genus database with same CATH superfamily
2AJUL 2AJYL 4OZFB 2WKOA 1OP3H 1IGJA 2AC0A 4AITA 5JQHC 4X5QA 4X6EB 5JQIB 3UEZA 4XCEB 2WKGA 3B5TA 1FWXA 2NY0B 4LNVA 4L0ZA 1A9EB 2HWZL 5LWYL 1ONQB 2QKIB 3PJSA 1DFXA 3RUGB 3O3BA 5B3JE 4KDWA 1KCUH 1FYTA 5CJQH 3FB8A 2F2HA 1ND0A 2P46B 3ML9A 3QQ3A 3V6OE 1CG9A 1LP9B 3QXUA 2WO2B 5JHDD 1D9KB 2WCPA 3FTGA 3VWJB 1ZGLP 2YAEA 3Q2CA 2GSIB 3PWUA 4WO4B 1P5UC 2OJZL 3IU4H 3MUUA 3PWNB 5IVZA 5T1DL 3U0PB 4DO5A 2AEOA 2CDGA 4O00A 2OMNA 2WPGA 1KB5H 1S3RA 1M2OA 2XSKA 5HJDA 3TO4D 4N0UE 1U8MB 5AFAA 1G7LB 4CNIA 3EYSL 1DN0A 3TBTB 1RURL 1A6PA 1A7QL 4AK2A 3HHMA 2E5EA 2ID5A 3NEOA 1AQDA 3UPCA 2UYLA 3MRHB 4GI9A 4PLOB 5JORA 3J27A 4LSPL 2CKNA 4B9YA 2EIKB 3TV3H 5KTEL 5FFOA 1WA1X 3AABA 5J0BA 5G2NA 3LV3B 4JFQA 5D7KD 3EGSA 4P3CL 3SE6A 2HG5A 4RMRA 4S1SL 1MCLA 1W8NA 2C4FU 4DGWC 1MAMH 3GSQA 4XCYA 3UPAA 5CM1A 2F54E 5IJCC 2Z7YA 4PJIF 1BPLB 4QHMB 5ID1A 3I02B 4TN9A 3JV6B 4JQIH 4M62L 2NSQA 1MJJA 3SCMA 4YK4B 3IJHA 5TE7H 5GS0C 1IEAB 3G5YA 4YXHH 4KVCL 4G6FD 4HJ1A 4R5XA 5C08A 4DO6A 2UZXA 3VFVA 2G5RA 2BNUB 3U6RB 5J5EA 5TFSH 3KYOA 2Z91B 4AEIH 2ZYRA 1IEBA 1ETZA 4P9ML 1BQKA 3RDTB 3FRPG 3Q2NA 4ZMNA 1T0NB 1CFQA 3BT2L 2PN5A 3NUKA 5CGMA 1YC7A 3MXWH 3ALPA 3KBPA 4HUUB 5DXWA 2QQNL 2X3BA 3P69A 5KG9B 2R23B 4HOXA 2HP4A 1LE9A 2XJLA 5LDSA 2IFFL 4BH7A 5KYXB 3SOBL 2AEIT 3HZKB 5I66A 5D7IF 3FC8A 2Q8AH 4WI3A 3IETA 4XXDA 1S7UB 2W92A 1KEGH 4GQQA 1WPCA 2H7WA 3RWCB 1Q90A 2X44D 4K94H 3IBOA 4CKVX 2XZAH 3SQBB 5HDBE 4OF8A 3NCJH 1NBVL 1EJOL 5D7HA 1YMMD 2KLRA 4P4RB 2APSA 3NOIA 4P23A 1KB5A 1JDAA 4M1CD 4Y2DB 3HEIB 3VFWB 2FO1A 2W80C 4JVWA 1CFVH 3FHQA 5FF6A 1UJ3C 4LMQE 1CI5A 2ICEA 4ACTA 1K2DA 3MBED 4W93A 4FFVC 3IPEA 3US0A 4RGMB 4J3OH 1VZHA 1RU9L 3ABLB 4YUEL 1XIWB 3WJLC 1KWKA 4YSTA 3SE4A 4X99B 3CZGA 1GJWA 2VLLB 3SO3C 2YSSA 1V55B 3BDYH 3UTSD 5I5MA 1SEQL 1J8HE 2UZIL 1NCOA 3IEAA 4HUWB 4C4KT 1Z66A 1GIGH 1QSFE 5FYKE 4LF3B 1CJYA 5F1OB 5F7DA 2WWKT 2VXSL 2BSSA 2WTPA 1JZHA 4UTBA 3U0TB 2IH3B 3TS8A 5KN5B 2BOBA 2DEYX 4LLAA 3D3VD 3JYCA 1R3JB 1Y1UA 4JQIA 4MQXD 4WSJA 1GAFL 5F9WB 2YRZA 4GKZB 4L5FH 3FQTA 2APFA 4F27A 3F6JA 4CGUB 1RUPL 4HH9B 2X89D 5TQ2H 2WOBA 5FUZH 4G8GE 5L6YL 2GCYA 1HH6A 3K6NA 3KYNA 1EXUA 3O6KL 5TH2A 4OI9A 5E8NB 5CEYA 3IWUA 1ET8A 3TN0A 2OMTA 3J07A 2JB6A 2PWGA 3X1FA 1YHPA 1JGEB 1MCFA 2EC9U 3BW9B 3D87B 1CGSH 2CD0A 4JRFA 2E7MA 5FYLL 2CM6A 2VDPL 2VIRA 4MDJA 5CP3H 4BFRA 3QDMB 3CSYB 2BS9A 3B2MA 4CN1A 4R2GD 1N8OE 1XGPA 1JVLA 3S3BB 2EEBA 3CSBA 5AOIA 4A7VA 2VCOA 5I5JA 4M8QA 1DLHA 3MO1B 3G04B 4L8BB 2IDFA 1U8NB 3RUGF 5CCKH 1PD6A 3UO1L 3R7QA 4F5CE 4YHML 2EUVA 2ARWA 4G6KH 2CIKB 3KMDA 5JIPA 5AVVB 1LP9F 4KU1A 1F02I 1Y7VA 1FL3B 2Z4TA 5DHDA 5ADPH 3P4NA 5B7EA 4ONOA 3TCTA 2GI7A 3D34A 3S97C 4MD4A 2XQ0A 4WKZA 3X17A 4EIZC 1G7QB 3GMRB 4PJIE 5D7LB 1I7UA 1U8QA 1DQJA 1Z0NA 4XWGH 4EN3D 3FQRA 1KBKA 3BLPX 3O8XD 4LP4A 3EYUL 4QRQA 3UEQA 5D70H 2CGRH 1QZ1A 2VAJA 4AIZB 2X1OA 5DJ0A 3NACL 4WUKH 2IH1B 4HBCH 1YEDA 1G6RB 4Z18A 1SXAA 3C6LC 1MLCA 2GSGB 4PGEA 3Q5TA 1WDAA 4KRLB 1H6EA 2BVTA 1F6FB 1E27A 4RDQF 1A6UL 4BH8A 1LO0H 1GGBH 3HC4L 4K5LA 4Q6YA 2V7NB 5JW4N 3KPQA 3X1EA 4WUUB 4MJHA 3EH1A 4PLKD 5ICZA 3TJEH 3RVXD 3I3DA 3KPSB 1BVLB 3QXWA 1HOCA 3P4OB 1C5BH 1BOYA 2C7UB 3SDAC 4QEGA 4ZMAT 1E4XH 1N19A 4JQVC 2Y2WA 4RMWA 3DX4A 4JJ5B 3BPLC 5C9JA 5HTSA 5D7IE 4ZSOB 2BWQA 1U92B 1UM6H 2E0PA 2KDGA 3EOAA 3I3EA 3TBWA 4MS8C 2IO5A 2OYKA 4Y2OA 3TJPA 2E6JA 3LHPL 1F3JB 2ADIA 3MLUL 4PJAB 2DDQL 4YDLC 2G60H 1PCSA 3GIZH 3OPUA 3QQNA 4K94C 3NN8A 2NW3B 5EIIB 4NKMA 5CP3A 4UTAL 2MPVA 3UPRA 3TYFB 3Q8AA 4HIJB 2WQWA 4KZDH 4IJTA 4J28A 3VFSB 4DKAA 2BZDA 3QJUB 4X6BB 3US1A 1S9YA 2Z1PA 5DFAA 1OO2A 1Q0EA 1SDDB 5FGCE 1JDCA 1JNLH 4U1MB 5B3NA 3WL9B 4DAGL 4HD9A 4J3OC 5JPMC 3HC3H 1BX2B 2D2CC 5K1VA 4HA1A 5IJKA 1E4JA 2EEXA 1HXYB 4ONHA 2VSKB 1PLGH 2DMGA 4UT7H 5EU7E 4LP8A 1XGRA 1AFVH 4FXKA 1FFNB 1G0XA 4L2LA 1WBYA 3L3JB 2IPTH 1NKGA 3L5WA 4FZ8H 4E68A 3UBXI 1MFDL 5FK9B 3RTQC 4LRNH 2SEBA 3IPBA 4AQZA 1RHHA 3QZNA 3I6SA 4FQXB 4L1BA 3UBXB 3O2DL 4KZEL 5CBEB 4YBQD 5C0CB 5EORH 1INEL 2EKSA 1E8YA 1L9TA 2UY7B 2VN6A 4S1QL 2AHIA 1ACXA 1JJUA 5GRYA 1AKJB 4Y4HB 2AXGA 1LJMA 3QULA 4AQAA 1NCNA 2IADB 4Z7VE 3SIKA 5F7EL 1IUZA 1Q8MA 4ONFH 4LOFA 4IRSD 1NCTA 5FCUL 1PD0A 4J2XA 2NX5E 2Y07L 1S46A 5FOJA 4JO2L 4HKBB 4MRBA 1C7SA 3QUZA 2F53E 3TCXA 4JPKH 2O26U 4YHZH 3T4AC 1NCAH 4B95C 4ALAL 3RFRA 2J43A 1D5XB 2BSTA 3OAYK 4M93C 2IAMD 1UYWL 4FQLL 2G2RB 1K8DB 4QO1B 5HDQH 1CQYA 4FG0A 2WLLA 3GSVB 4G6JH 4GAJH 4WEMB 4XMLL 5EOCJ 1VDGA 1WZ1L 2IAND 3B7UX 1XMEB 3E6HB 5F93C 1QFOA 2KLTA 2JV6A 1T1XB 3RUGE 2BLFA 5HYQB 3PE9A 4P0DA 4ZPVB 4I0CC 5HD8C 3HNSL 3QNXB 2ZP9A 3B56A 4X8JB 2HKHL 5E5MA 1EHXA 1IGTA 4PGDB 1LP9E 5E94B 5TGBB 4X9HA 3KZ8A 4MJJA 4A2MA 5DMKA 3PXHA 1OGPA 3MUJA 4D7BA 2B08A 25C8L 2OSYA 1UJTA 2X5PA 4BKTC 1MRDL 1BIIA 3FFCB 4NOBA 1PZSA 3EYVB 1F4WH 1E67A 3K80A 3ZBMA 3VD5A 4U1KB 4BSWB 1CL7H 1NMCC 3BZ4A 2D7TL 2OTUB 1YY9D 2LAGB 4NYLB 5T1MB 3BSZL 5KUKA 4OM1L 3QJHA 5GHWH 3C60A 1OSPH 2J8UA 4P07A 5EC2A 5INCB 2FJSA 1N67A 1FFRA 2WVTA 3MRQB 3S4SA 3AREB 3DYMA 4LZKA 2BW5A 1HZKA 2V33A 4ODVL 1A6TB 1IKNA 1B4JL 3P11L 4H5SB 5EO0A 5BZXA 1FGNH 4ANKA 1AZCA 2F15A 1G6VK 3O41B 4P5TD 3OAZH 3DETC 2G0LA 4WFHE 4I0KA 4Y16C 4MJ5A 4AVJA 5D2LA 1N8ZA 1JBJA 1B0WA 4U1NA 5F1SA 1DBMH 5FHAH 5IF0A 2C1OB 4JG0H 3GRGA 4I2XA 4I3SL 3O6FA 1MCSA 1S5IL 2KPNA 5I8CB 3TTYA 5SX5K 3A6BL 2V9RA 3SD2A 2EEFA 4HPHA 3GI8L 3CHXA 2ZYSA 2C34A 4XZUA 5HHOB 4P4KA 4IIZA 4R96A 4XTRC 4N86A 1OAXH 3CVIH 1GCFA 1CFSA 2APXA 2CLZA 3RWDB 4DF9A 2ZOLA 1SOXA 1KGUA 4ODHH 5IROA 2DZEA 1W16A 1AD0A 4Y4KB 1AGCB 4UAHA 2ADYA 2FSDA 4O5LL 4M1GH 2E76C 1YNTB 2YEZB 1F1GA 3HUJB 3B1UA 4P5RA 5HHXL 5J1TC 4WI0A 3BQUB 4FQJH 4GS7B 4KHXH 4JG1H 2O1AA 1BD2B 1NJ9B 3L3OA 1CVSC 4KMQA 4Q89A 1MHPL 1T7YA 4PJ9D 5CLTA 1SOQA 1Z6JT 5EOTA 2W0KA 3O6ML 3GMQA 4GEJA 4RX4A 3AG1B 1HVXA 1MHEA 2VDMB 4NQVA 1GPOL 1XGZA 4QRPD 2FD6H 1B88A 4GBXB 1IKNC 1XZ0A 4PJEB 3BVTA 3MNMA 4GG8A 2O93L 2GJ6D 5DJ8A 4DVRH 1MFBL 4M9PA 4PJAF 5CBAA 4LOUC 1BZ8A 3FO0L 3IWVA 5DI8B 3V6ZB 1NDMA 4MNGE 1I1YB 4KKCD 5DD6A 5LGJB 1NINA 2GI0A 2HJKB 4F8QA 5I0XA 2YJLA 1Q1JL 2GEEA 4JY4B 4PSRA 1KFAH 2LT9A 4P46D 4JY6A 3O3UN 3OKLA 1U2CA 3M1CA 2DQUL 1U3HB 2XA8H 4BE5A 1WT5C 3CFIC 1IQDB 5I1EH 1RMFH 4JO4H 5BS0B 3H42L 1DVFA 1KNOA 1V7NH 4KTEL 3UDWA 4N8VA 1FYHB 2A38A 2QHRH 5I1AB 4MGXA 5CIPB 5EFIA 1RUAL 1RH8A 2W9EH 2QTEA 4PLNC 3MRKB 4YMPA 1VCAA 3OX8A 2DM4A 5KUMA 4NDMB 3NFSL 5A7EA 3LN4B 1QFWH 4ZJ9A 5E0QA 5IROC 2X53A 2XVGA 4XX1G 1A6AA 3DUUB 4DK6A 4DFIA 4NAQA 3HI1A 3CFKA 4A2LA 2BVUA 4W9DC 2BHFA 5D7SL 3LH2L 4HPOH 3A5VA 1E6OL 3LZLA 3L3OC 3V0FA 2WTOA 3NZ8A 5E2VL 4FQ2L 4OLWL 4YIQB 2NY3C 4A7GF 3L3DB 1JWUB 2W9DH 3JQOB 3MRGB 1ZLWH 3DXAB 1OE3A 4TNWK 1IBZA 3FQ4A 4M4RA 2GAZB 1LK3L 4HPYL 2HH0H 4QDGA 1GRWA 3WFHB 5E56A 3T2QA 1YY8B 3PY9A 1Z3GH 2MSPA 4HALA 1BOGB 3QDME 1SF5A 5B7FA 4JZJB 2QSCH 4KFZC 4WHTA 2DWTA 5JLZB 1IC4H 2HA1A 1AQ8A 2COVD 2WXPA 3AS3A 1BF2A 2Q6WA 1NA8A 1XB3A 1YSOA 3GHBL 4WJG3 4RGOH 3DURB 1CGTA 1H0DA 1T1WA 2MH4A 4EZMA 1CLZL 3MV9B 1T6WA 3FCTB 2J2ZA 2R2BA 4OLUL 2ADFH 3O4OB 2L7JA 3QQDB 3D39D 3FH5A 2EXWD 2XN9A 1KGXA 4NENB 3R0NA 4XCFH 5D6CB 1HCYA 1RIVH 5BVJA 3TA3A 5HYEA 3LKRB 2MNUA 1T3FB 5I76B 4M48L 3CIQA 1JGDB 5HYJD 1G0DA 5L2JA 3MQIA 4ZS6D 4OT1L 4HGKC 5IMOA 1QR4A 2JCCA 1S4IA 3V4VH 2WV3A 2EDHA 4DP1X 1WS7A 3A21A 5AW0B 3QJOA 5D7LE 2UUDH 1NIFA 4M6ML 1NFIB 4D9QE 4PVBA 3RWJB 5C09B 3ALXA 1SHMA 3KNBB 3R8BB 2R51A 4L1SA 4HX1B 3PPEA 1KPRB 1GGIH 3QDGA 2CO4A 3OB0K 4YE0A 2WWNA 1R24A 1K4DB 2XQYG 1MDAA 1SDAB 3BC9A 2XTJD 2MCAA 4Z78B 4QRUA 1OF2A 2H2PD 1XGQB 2X2JA 2I32A 5MERB 3X2QB 2D0GA 2AK1L 1T6VN 1NAKL 5F88B 1DJSA 4G71B 3ATBA 3B2XA 3MSPA 3BKYL 4TNVK 1TQUA 3LB6C 5IFAL 1QW9A 2MPAH 2V9UA 3QJTB 4Q4IA 1MVFA 5J12B 1TQVA 4WUUE 4YDNA 1XMWA 3GKZA 3VQ1C 3ZQ9A 3ZL1A 4Y4FC 1WAEA 5DS8B 5JMOC 4TNGA 4D0DB 1NFKA 4UT6L 3VXOB 3LZOA 4ZSOE 3SE3A 3N5AA 2WYHA 2Z8VC 3CFBB 4FEIA 3KGUA 1SZNA 1JTOA 1L7IH 5KAQG 4BUHA 5DQDL 4V33A 2PW2B 4H20H 2I9TB 2B1AL 5FW7A 5H2BA 4F58H 1H8LA 1U8CA 4AJWA 1QO3A 4NQXA 5LQBH 5I6XB 3CFCH 4PRDB 4BKLA 2K6WA 2JFCA 4AE0A 2ED6A 1QLFB 1U8HA 4XP1H 3QJSB 1F4YL 3AT9A 3NPZB 5CGYC 3ZDYB 3HG1B 1W0YT 3STLA 4XHQA 4IKKA 1NCJA 5TTRA 3QG7L 2GJZA 1YNTF 1SN0A 1HOEA 1MIEH 3HUJF 5AOLA 5IBUG 3UG3A 3KAAA 4UQIM 1LWHA 2V5SA 1HQ4B 2EZ0D 2XX1A 3LSOB 2R29L 4WO0A 3U4BL 3EOBB 1H19A 4FDWA 1B90A 3ARSA 4LLQA 1C1EH 4FE9A 1PZBA 2NY4D 4MXWH 4OTXH 3MLRL 4UQ2B 3K8MA 3V6OA 1KTLA 5F9JA 3BQVA 2HUHA 5GSVA 3ROOA 4PJEF 2EH8H 5TK4A 1JV2B 1IAOA 3H85A 3HZMB 1J1OH 4AMXA 1YJDH 3ZTNL 2G9HA 4R9HA 3Q1SH 2Y1ZA 4ZMXA 1MWAL 3S3CB 2FEDC 4CVWA 1AQHA 1NC4D 5EA0H 3E7JA 4Z5RA 3BVNA 4RGNB 2VDNL 2DICA 2K6YA 4NM8H 4XODA 3TZVB 3WTWA 1GYWA 3UMTA 5C0CE 1P7QA 1ZV2A 4GJTB 4KY1L 4U6VH 3ZTEA 3PAUA 2EILB 2I5YL 5CJBA 1LL1A 3IU3B 4MTMA 2A6KB 1YEGH 5C9KA 4X7SH 5A6IA 1J10A 2XETA 2HMID 3SE3C 4MLIA 5AOZA 2C9UA 4XO3A 1LVEA 3GFUA 5DUPH 1GL4B 3BE1H 2EO1A 3FL7A 4MB5A 2GEQA 4OM0H 3UAJC 3VSVA 2EE0A 1MJ8L 1SYSB 3CDZB 4AYEC 4IOFC 4XMPL 1FNHA 1KV3A 5CUSL 2X0UA 3KBEA 5FYKH 1Z9SA 3VI4B 4Z3EA 4UIKH 5EU6B 1FJ1A 4AENB 1V8HA 2F8OA 3L7EA 1C08A 2F54A 5CLXA 1AZUA 4NKQB 4HT1H 4L1HA 4A63A 4BIKA 4DEWA 4G3YH 5LGHL 2BDNL 1EV2E 5ALCL 5JR1H 2EO7A 1S6NA 2Q8BL 2W94A 3EF4A 2L7QA 2VDOH 5A3IC 3QAZB 1R3KB 1TKWA 1OWWA 4LVEA 3L1OH 4XNDA 2FNWA 2F7PA 1A3QA 3QIWB 4L4TB 3N3EA 4UINL 3IDIB 2EYRB 3CVCA 5EBWA 5AZ2L 2MRYA 3V6OC 3Q8EA 3TPUA 5KVFL 5BRZB 2YMTA 4Y5XA 3DBXB 2DL9A 2XZQL 3CN0A 3FFCE 5IHWA 2WQAA 3UTTB 3WEXA 4RA3A 1JNHA 1SXZA 2XBDA 1X5XA 1HYSC 1AMXA 2QPUA 4M03A 4UDTA 4ANUA 4LCIH 4EE2A 1AXTL 1T22A 4PJBB 3GRWA 3IJSB 3UO8B 3UTZB 2QLVB 1RVFH 1Z9PA 4W6WB 1C5DB 1DQMH 1KCLA 4O2FA 4XN7A 1XGTA 4NC2B 4KAQL 5T1KA 1BFOA 4FYQA 4BK5A 4CVXB 5A6MA 3QRLA 1BJ1J 5BUAA 5D71H 1IAIH 1FI8C 1JNNL 2O5XL 3L3KA 2R1YA 2Y7SA 2Q20A 4L2YA 3VFGH 4A7UA 4ZNEE 2UXTA 3ZKQD 4POZD 3C6SB 5K1JA 2QFRA 3OAUL 4ECNA 3CFQA 4N6QA 1QI4A 3FMGL 5AW3B 5IR1A 3WNJA 2QADC 3VD0A 2P1YA 3JTTA 4YO0A 4JFHE 3QUYA 4AGPA 5AG8A 3OSVA 1AR1B 2FATL 1UQSB 2JVUA 3BWUC 4WFEE 5I1GH 3RGVC 1L9NA 2X10A 1ACZA 3QT2A 3A6CL 3WTYA 4PP2B 5HHOE 1AS6A 1BQHG 4I0PA 2NRDA 3GBNL 1I7RA 3VRIB 4XP5H 4EZJA 3L3HA 1JF1B 1FYTD 3O45B 4EKXA 4Y2NA 4HIXL 1FNFA 1E9PA 3WS3A 4PGJA 4XNAA 1M4KA 4URTB 3ZT7A 4NJ9L 4WENB 1J8HA 5DZVA 3RY6C 1RZGA 5B8CA 2WWOA 1RP8A 1KBPA 2J4WH 2ZKHH 5CSGA 1FHNA 2C3WA 1NEUA 4M4PA 3WEAA 3SDYL 1PCXA 5HY9B 3KDMA 3D2UA 3RJDA 3ZKNC 2E7DA 1CPUA 3HUJE 4LCCC 3QNZB 1UVQA 4XVUC 5CSZA 1OP3K 2G0KA 3CDGB 3ABGA 3N06B 4UOW0 1JWSB 2RB8A 1BD2E 5L9DH 4N0YL 3ZL2A 2P8LA 4K15A 1A1NA 5E6UB 5A40E 2BXYA 4K71C 1OANA 5IV2A 4G7QB 4G8GA 4YH6A 3H4FA 2JH2A 4BWWA 4H8VA 2UVFA 4KXCA 5EUOE 1CYWA 3X3FL 1J0JA 3BIKB 5AYUL 5E7FA 4HCFA 3JYBA 1Y6KR 1YCSA 5JW4Q 4PJEE 1OHZA 2G2NA 1U0QA 1U58B 2FYYA 3WN6A 1FUNA 3PL6B 1RUKL 2EDBA 1K4CB 1DVQA 3LZRA 3KL0A 2RFXB 4PRPB 1YJDC 1RQ5A 1WITA 2A74A 5B38G 1VA9A 5C6PB 4DP9X 4KZCA 4MZIA 3P9MA 4FFVD 1QLEH 1NGYB 3C09B 3LEXB 1I7ZB 3ZDYF 1BQLH 2R1WB 3DSNA 1OAJA 2X70A 1CXIA 3IBEA 3SCMD 3X12B 1TVBA 4JFDB 1ZK9A 2DJ4A 4LLWA 4UOZA 3ZJAA 1TQWA 3G9VA 5C08D 5BS0E 1R75A 1IC5H 3OKDB 5TDPA 5T3XL 5AB0A 4F5CA 4KVNL 1N6QL 3LS5L 4ZZFA 4FQQA 2WANA 1MY7A 1UATA 3BKJL 1ZEAH 4UAOB 2ODHA 3GSUB 4G8EB 3MBWB 5DHYB 5B8CC 1NDGB 2C3GA 3PQYA 4OD2B 3QDHA 4JLRA 1K72A 2N7BA 2FT7A 1F3DJ 5H4YA 4JFYA 5C0DA 4PJIA 3SE8L 3HB3C 4Q6IB 2ENQA 3LKQB 1A21A 5I5RA 4EQ3A 3NSXA 4KDTA 4MA3B 4NHUB 3DI2B 4I18A 5FKPA 3I50H 4K7PX 1IRAY 5T5FH 1IGFL 2HFTA 4YEEA 3CSFA 2JJTA 3T0VA 4IRJB 2C9AA 2HJLA 4WI7A 3UP6A 2PTVA 3DXAE 4HIEA 3KGTA 2VRQA 3QO1A 4MCZB 5D7EA 3QUMB 4X80L 5AD0A 3QZMA 5JIQA 4MB3A 1CFTB 1G9NH 2YPVH 4YSDA 2PPAA 3DI3B 4P23D 4KJYA 3BUTA 2CCVA 3NSDA 3VI4F 4HQQH 1MKFA 5CZKA 2A74C 1U41A 1ZSHA 4LPUA 3UTQB 4AUUA 5AAPA 4HEPG 2YKLL 3HLKA 4MB1A 4LASH 3A24A 4NM4L 5FO8B 3BVUA 1CBJA 1S7TB 2DQMA 2VLMD 1AD9B 5TDNB 3MV9E 2OMZB 5AW1B 3NAAL 5JW3H 1RUQL 5AUMA 3KLAA 3AFLA 4WWKC 2VDRB 2IQ9L 4OLZH 5LVEA 3P73A 4G82A 4FEMA 2FZ3A 3II1A 4R0LA 3W0WA 4HFUL 3KPPB 4GUOA 3F64A 1YN7A 3KJ4B 4L4VA 5DFWH 5IJVB 1P7KB 2YD1A 2Y7LA 3BO8A 4EQ2A 1DQVA 4E0RB 1LQBC 5BO0D 3TNNB 2HVJB 3HMXH 5IHBA 5C09E 1X5LA 4NNYB 4PJBF 4U0QB 5A6LA 6TAAA 3ZMNA 1I82A 2AXFA 3PWJA 4CSPA 4C8XA 3IN0A 1R5IB 4QRFA 4AZUA 2QL1A 3TN0D 2H8PA 1LDPL 4QPEA 1J8KA 1RI8A 1LM8V 1KXTA 4OCRL 4XPBH 4NO3B 2JJTC 1K8IA 5DHMC 3V0GA 4ZI8A 4ZMTA 1S7SA 1GS8A 2DBJA 3B5HA 3TWCH 1X7QA 1KCRH 1JK9B 4JRXA 5GZOA 1ZA3B 1T66C 4QMEA 3QEHB 1Q0YH 4ZMYA 1MCWM 3L3GA 4CC0A 5KS9A 3WXVL 5I6PA 3ECBA 1EFQA 1FNGB 1ZT4A 4MS8D 4NX0A 5AAWA 1RIUL 2XHNA 4AGMA 1JVOA 4HZLA 1KYUA 2Z0BA 3NCCB 1HILA 2H0EA 4V2CB 1R33A 2UZYA 1EZLA 1YMHA 4N2IA 3S34H 5KZCD 1OAYL 43CAB 4OAWB 4TUJA 4XCNB 1JPGB 1QG3A 3ZQXA 2YPVA 1GZPA 3KBFA 2NCMA 1WBXA 2R0KL 5CD5C 5CCGE 2F53A 3IF1B 4TRPH 3C08H 3L2MA 3NIDB 3ZDYE 3HG1E 1B0RB 4OZFA 4BFBD 2ZT9C 2F08A 3T8VA 4XCEA 2CJUH 1FSKB 4IIQC 4X0KA 1YEHL 4IGBC 1A9EA 3F7YB 2W0LA 2QKIA 1KDJA 1TU2B 4OLXH 3UAAA 4CVZB 3RUGA 1AG0A 2EDRA 3QH3B 1BMZA 1NICA 1RSFA 3MUHL 3WOVA 1E3XA 1QZNA 3RJOA 4MXVF 2FH8A 1LP9A 3SHSA 1JPSL 1F3DH 1RZ7L 1D9KA 4ZOAA 5EU7C 3VWJA 5F7NC 5J6SA 1CF8L 2GSIA 1N7ML 4JDZB 4DWHA 4WO4A 1JP5A 3U0PA 3PWNA 3EDFA 1A1MB 2VITB 1COBA 1TJIH 2ALWA 3WKQA 3NSCA 2HT4C 4RGNE 1TTFA 1YAZA 1G7LA 4F24A 3ZE2B 3HAEB 4KROC 2ZCLH 2CUMA 4RRPA 2VH5L 1RZKL 4JW3A 3CLFL 3MLXH 2ODIA 2RCSL 1RJYB 1TYJA 2ZG1A 2EDQA 3MRHA 4AIXA 3ULUD 3ULVF 4GKSB 1E90A 1BZ9B 1ODUA 2BMKA 2GBVA 3QCVL 2DN7A 3LV3A 3SO5A 2A1WH 2K3HA 3CVHL 5FYJD 5FYKU 3ECVA 3CFDB 4JQXA 2JELL 5HVHC 5JTWA 3IJ9A 1G9NC 4OZIA 1IKFH 3VI4E 5EU6E 3EJZC 3ARTA 4LBAA 2OULB 4OIBA 3PIQA 5FGSA 1M9SA 1UZ6F 4UQ3A 5DRNB 5IMKB 3GIVA 1GY1A 3VG0L 2YAFA 4FNLH 1MI5A 2C4XA 3I02A 3JV6A 3DIVA 3ZVVA 1N0LB 4Y88A 5IHLB 1KYOJ 5HD8D 2L0DA 2Y1YA 2J6EL 1IEAA 5GZNA 5JHLL 4HSAC 1B0GB 1PFCA 4WZ9A 4E5XG 5IMLB 2YD9A 2YK1L 3HCVB 2Z91A 4WI5A 3RDTA 4QGYA 2CJ3A 5JUEL 4TOYL 1R19A 1XF3A 2EYSA 5BRZE 1CE6B 1VGEL 1CD9B 1D9KC 3VWJC 1FNSL 3DHUA 3E2HC 1KGYE 4HUXB 3HBZA 4HUUA 3CXDL 3UTTE 4E42A 1X5ZA 4NZJA 5KG9A 2R23A 1V7ML 3AU0A 2MJWA 2ZP0T 1JPTH 2WN3A 4NO0A 1NCWL 4PJBE 4X4XB 5CJXA 2QGDA 2PABA 2C7FA 1FZMB 5KYXA 1GVIA 3HZKA 1BBJB 2APBA 4XZ4A 1TJXA 2GUOA 2VMFA 3MA9L 4MVBD 3QPQC 1SGKA 3DETD 3ZKXB 3FUMA 2FJHB 3SPIA 1S7UA 3WAKA 3RWCA 1D5IL 1G7HB 2X12A 5GS0L 4MA7H 3QUZD 1R9FA 1F86A 4GRLB 4XNXL 3CC1A 3MKKA 4Y2DA 2NY7H 4KKAD 3VFWA 1H3UA 4H88H 3H54A 4QIRA 2X9WA 5JOFB 4PW3A 1Z5LB 2HLFC 4AT6B 4XTRD 3S48A 4NRYB 4OJFL 4R7NB 3UJJH 3SGKA 3QUHA 4H40A 5FEBA 2OMVB 5EO1B 1U8PB 1XIWA 5LBGA 4F9LC 1M3JA 3GKWL 4MHHG 4QRTA 5E2UH 5F72S 4BKSC 4YK4C 1GMIA 1T0MA 3KHOA 1G6RH 4GAFB 4X99A 1LO5B 2VLLA 3FQWB 4I87A 1PFOA 1UACL 4UIMB 2K7PA 3J7HA 3WG7B 4FQ1H 1H3GA 4MRCA 3HLAA 4YHKL 4HUWA 4DTGH 4DIXA 1WIPA 2Y9RT 2M1KA 2HT3C 3K2UL 4LF3A 3RDTC 3SBQA 1NAML 2Z8SA 3AT8A 3U0TA 3WFBL 3DUSB 2X6BA 3MRMB 3WN5B 5KN5A 1CIUA 5HYSG 2X3AA 1IBHA 3C60D 3RKDC 2N1TE 2HLEB 5AVYB 4GKZA 4YSUA 1M6OA 3N55A 3OF6A 4HH9A 1BM3L 3FQ1A 4NWTH 1ID2A 4LCWB 4PJCA 5CJXC 2ZOKB 1MHHB 1Q94B 5DK0B 1OAQH 1N26A 4LOUD 4MXVE 3KYKL 4IJ3C 2NQCA 5TE4H 4ATTA 5E8DH 1XFPA 4HGMA 4I3RH 5I28A 5IWLC 1ESOA 3MJGX 2JKXA 3DX9A 1BGXL 4NC0B 4U6HB 2VXVL 3X14A 1JDDA 3QFJE 5GRUL 4HBQA 2Y3NA 1H3WM 1E7UA 4PRPE 3QDMA 5IK3B 2YC1A 3O6FD 3OZ9H 4MB4A 4M3HA 2Q0ZX 4JFOB 1TTBA 3REWB 1PZ2A 3NIDF 4JRLA 5ITBH 5AKSA 3K4ZA 3Q8CA 5F6HJ 1FL6A 2ZXAA 1MRFH 4P4KD 4NP4L 2CU9A 4B41A 2WAHA 4OGYL 3IDGB 5AWNL 4TSAL 4YEFA 3QDAA 4B7IA 3ULVE 3ILPB 1KY7A 3BRGC 1U8NA 3FZUC 1MJUL 4WTZG 4L8DB 2XC8A 4WTQA 4A67A 1Y6NR 4KBPA 3S35X 1EEQA 5IROD 1BSIA 3T6ZA 4YXLH 4PGZA 3UABA 4K3HA 2PLTA 1FL3A 2H32A 1J8SA 2X2YA 3NFNB 1QKZH 4CILA 5E5RB 5EEUA 1KCUL 4M5YH 3ZYIA 5CJQL 4FGMA 5FM4A 2FBJL 1G7QA 3CLEH 5D7LA 1JV5B 1H8OA 3TM6A 1ZIBA 4XXWC 3V0VB 3HVNA 2NY3D 2BCKB 5A2LH 2E8YA 4U4BA 5EZIH 1HCVA 5J06A 1UUSA 2R69L 5F9WC 4JE0A 2D0FA 2MKLC 3GZQA 4RX4D 4UV7L 3ZE2F 2WNWA 1U3JA 2IH1A 1HYRC 1G6RA 4OGZA 4XNYL 5DCCA 2P52A 1JZIA 5C0RH 5JOPD 4Z7QB 5BXFB 2X1QA 3FHAA 3KPMB 4GMSH 3RTLA 3WDHA 5EEVA 4KJQD 4XOBA 4JDEB 3T6VA 4AMWA 2WMPB 5DZ9A 3FSOA 5ERWB 1UD3A 3ARGA 1UFGA 2V7NA 4CN4A 3AB0C 3N2JA 2B9BA 4KNUA 2RALA 2ORBH 4JFVA 4NPYB 4WUUA 5B1KA 1C8PA 3KPSA 2YA2A 1BVLA 3GXIA 3ARDA 2VO5A 3P4OA 1FV1A 3Q01A 2C7UA 2ZWLT 3GLAA 4G7RB 1UM4H 4B5EA 3ZYOA 1DVUA 2IH8A 4JJ5A 4PI2A 1MAML 4ZSOA 5DZLA 1U92A 1ACYL 4FXGB 1DVFD 2VR9A 4P2YA 4W9EC 1RY7B 3U1QA 5DUML 3UG4A 4HWZB 2YMOA 5F0MB 5GRJH 4PJAA 1J9SA 3PAZA 4P3WA 4TMPA 1G9EA 3SY6A 4DK3A 4M8VA 5CU9A 4F2FA 2DQHL 4Q56A 2NW3A 5EIIA 5EOQL 5B7MA 4YXHL 3QO0A 5G55A 3PYCA 1JN6B 2KS0A 4P5MA 4TV3A 3W9EB 3P2BA 1ES0B 4FNPA 1IGYB 5C0FB 2BRQA 3GJFB 5F71A 3EJYD 4AI7A 1X4ZA 4BBWA 3TF4A 1SDDA 2BVPB 3WSQL 4U1MA 3S36X 3T08A 4OZHB 2K9UA 3WL9A 3DPDA 4WHCA 1MCCA 2YAPA 5FO9A 1GXEA 1BX2A 2B3IA 3U83A 4HIHB 2YGQA 4JFEA 2MTAA 3CIAA 1HXYA 4IMKA 1WF5A 2P8MB 5ETUB 4N1CA 1DL7H 1J88A 2ZICA 4RMSA 4FNRA 4CKQA 1FFNA 2R15A 2Z7ZA 3UYOD 4WKXA 3SODB 4YNYB 2Q8AL 4PWJA 4YSPA 5GRWA 4CU6A 4YDMA 1KPUA 5FK9A 5CJOL 1KEGL 2C8NA 4O02B 5F89B 4FQXA 4K94L 3UBXA 4Y8AA 2XZAL 2CG9X 5CBEA 4PY8I 4AEEA 5C2UB 4MMZC 4PGCA 43C9A 5C0CA 5GS1B 3R4RA 5HJGA 4A7GA 4PBDA 2KZKA 2UY7A 3X3GH 1VEMA 1AKJA 1EGJA 1GHFH 4Y4HA 2LV4A 4BV1A 2PXYB 5IB1B 2OMUB 4W9CC 2ZUQC 1GSMA 4UWQB 4H0GA 4YQXH 4ZOCA 2XN9D 4J6IA 4ZMVA 2Y36H 3G9AB 1IT9H 3TA3D 1W6WA 3VM5A 5BCAA 3MPCA 1HHIB 2QV2A 5L88L 1S7RA 3IJ8A 4ENZA 3K1KC 3E1F1 1IGCH 3UTSB 3ZZLA 4A7SA 2ZNXA 2WJ7A 3UTPE 1AACA 3OQRA 3NIDE 4TLUA 1D5XA 1W8EA 3BDYL 3H6JA 5C0ND 2APVA 2G2RA 1K8DA 4P57B 4QO1A 3GB7B 1HC1A 4YZWA 3I9GH 3GSVA 3VD9A 3BH4A 3B5GA 5KBMA 3OR6A 2IWFA 2X4PA 3QDGD 3QCUL 3E6HA 1AGEB 4PJFB 3H2QA 1X9UA 3W37A 3T4YB 3IRPX 1RV6X 4ZPVA 2VDMH 4X8JA 3FN0H 2ILLA 2P47B 2W9LA 4G1EA 4PGDA 4IU2B 3QWNA 3QRBA 5E94A 4WGVB 2AV1B 3B34A 4N8CH 2FEDD 3IMVA 3O9WC 4JN2B 3FFCA 2WLNA 3EYVA 4KNQA 2J71A 1CGYA 2P9RA 4BSWA 4XAWH 4NYLA 5T1MA 5DGRA 2UUDK 1PDKB 9CGTA 1CGSL 4ZXBC 2DYSB 3ZE2E 4FQXC 5E5UB 2AQSA 5INCA 2W59A 4R2GB 4ESKA 2EDKA 4YFDB 1GSKA 1QLRB 1B0IA 5EU5B 4PBWD 3KWTA 1A6TA 4H5SA 3BISA 2ZSWA 2CHNA 4JM2B 4N9GA 5HBBA 4OIAA 3LNGA 5HJBA 4HP5A 4Y4HC 4YSOA 4IOFD 2W0PA 5E4IA 3T0EE 1DBJL 4FLRA 3L5XL 4YHNA 4IS6B 3VWKC 2ERJB 2CR6A 5I1HH 4KK8C 4XRCB 2ZOOA 3EBIA 4YDJB 3UL4A 4FC3E 3U6XA 4U1SA 1MQKL 2CHXA 4ZMQA 5BO1H 5I8CA 4HV8A 3JZYA 1Y0LA 3ZQWA 3APDA 1OAKH 5AB1A 5HHOA 5I0YA 2AGJH 4G6MH 4EI5C 5IQMA 1FVEA 1SN5A 2P5PA 1KGCE 5K9OB 4ZX6A 4Y7MA 4L1TA 4RSYA 3RWDA 1MFMA 3X1GA 1T80A 3L7FB 4Z7QF 2CK2A 2WW8A 4ZTPH 3W57A 3VRLF 2FJGB 4J3XA 3DV4B 4HBCL 4U6YB 4WUKL 1I9RH 2FGWL 4Y4KA 1AGCA 4JMXA 4LSQH 1BBDH 1D5RA 1XB8A 5T1LB 4AV0A 4L9LB 2MOVA 4NI3A 2YA0A 4P2OC 2E9BA 4XR8C 3RWHB 4N68A 4BGDA 3BQUA 4G43B 4PJ7A 2X38A 4AGQA 5CS7A 4OLVH 5IQ7H 5TE6L 1BD2A 1NJ9A 3CQPA 5T1JA 4JFZH 1P7QD 1E4KA 4B9KC 4DZ8A 1LO0L 3VXUA 1ODAA 3DOSA 5AB2A 1WBZB 4FFZH 5A2CA 1R3IH 2IIJA 3AREC 1C5BL 4FQIH 4A55A 1OAZH 1JVKA 4AIEA 5D4JA 1OZTG 1X5YA 2OW7A 4DKDC 2WVSA 3M86A 4HVBA 5DI8A 1XQ4A 3R19A 4ZNCD 1UM6L 3BDBA 3G5XB 2QVFB 2HJKA 5LB1A 2VL5B 3KPRB 1PQZA 3QZPA 4Y8DC 2UY6B 4MXQD 3L9RB 3U1SH 2RR3A 4Z1PA 2F54D 4G8AC 3V0AC 2LABA 1K5NA 2G60L 3GIZL 3KEDA 3N50A 4FMVA 1PY0A 1BG1A 4JR9H 5DD1H 1U3HA 3GXNA 1D2OA 3K74B 3BVDB 4KZDL 4OZHF 2JJWA 4FTDA 4H26B 2AEPH 1JCKA 4TL4A 3CK0H 3G5ZB 5I1AA 1OW0C 4NRXB 5CIPA 2WP3T 3EDJA 5FC9A 5LBVA 1JNLL 4Y9GA 3MRKA 1S78C 2H1PH 4UB0H 3WELA 3WTVA 3EW3B 4NQCB 3F6LA 3HC3L 1HHKB 3BAWA 3JT2A 3KM2A 3LN4A 4XB3A 4XVUD 5K1NA 4HXAH 1BEYL 1PLGL 3VTMA 2IBGA 4UT7L 2WNXA 3AXIA 3DUUA 1ZXKA 1KTDB 1AFVL 2YXMA 4FNUA 4GP8B 3WIFA 1KCWA 1WFUA 3BP7B 3X1NA 2GC4C 1KMGA 3GS0A 1NCBL 4GS7C 2BY3A 2YLHA 4X4ZA 4N2LA 3AY2A 4R3SA 5DUJA 3ETTA 5T1KD 2H3NB 4XOEA 1E4KC 4LCWE 1EEZB 3EJUA 3HS8A 3ETBJ 3L48A 3L3DA 4JB9L 1NLDH 4YIQA 2XG5B 5DRZA 3WCYA 1JWUA 1T5WB 3MRGA 3X11B 3NMEA 1LDSA 1UGNA 2WBWB 3GS7A 2FO8A 3OLIA 1SYVA 4GW1B 2G3NA 3WFHA 1ZHKA 3OKKA 4GBXC 3FU7B 2VM4A 1YECH 4OR1A 4IRSB 2VR5A 5J89A 3MJ8B 2YAOA 2XZCH 3BWAB 4BFKA 2JE8A 1BOGA 1KN2H 1ZHNA 3QUYD 4OBSA 4JZJA 4B3EA 4LO9A 4OGAD 4A38A 1PLCA 4ONFL 2MHAA 2FBRA 1ID5I 4KQ3H 3VFRA 2HX7A 4PV9B 2AAAA 4D94A 2FH6A 1NMAL 2FB4H 2MWCA 3B7SA 4I0PD 3ELQA 3PRZA 4I85A 3TIEB 1OGTB 3DURA 4S11A 4CL7A 4YHZL 1J86A 1NCAL 2E7HA 4GKLA 4YL4A 1M6UA 3RBGA 3MV9A 3F7RA 2IANB 4PJFF 3WYRA 5T3ZL 4QHNB 4ORGB 2ZSVB 4E2OA 1J8HD 1MSPA 1ORQB 3QQDA 4G6JL 1IBGH 4GAJL 4NENA 5D6CA 5CCHE 2LLGA 2J5LB 3EXJA 3MLVH 5I76A 2ALAA 1KLGB 2VXUH 3D2UD 3HB3D 3LRLA 4IBUA 4JHZA 4ABUA 3S0PA 4TUKH 3CX5J 4K7FA 2YAQA 2IBZX 2A0LD 4UOW1 1NFIA 3FU0A 1X44A 3LJ3A 3RWJA 1B3JA 2VQ1A 2R83A 4G8GD 3KNBA 4M56A 5C0EA 1JL8A 4FFYH 4HX1A 1EJFA 3MNDA 2GT9B 2NXZD 4GRMB 3VD2A 1T5XA 2QPEB 2DD8H 3JV4B 1CTMA 1XGQA 3QRGH 1VLXA 4CBPA 4JFSA 5MERA 2K7QA 3AQXA 3OMIB 2CBPA 3DHJA 3VRLE 1FVCA 4KK9C 3MCG1 4P5TB 4LARH 5D7KE 4OFPA 1ETJA 4J2QA 1FGNL 1NM4A 1WISA 5EEXA 3FPXA 5DUBA 3L5HA 2Z3FA 1TPXB 2HTKC 5I8EB 2F19H 1KJ2B 4D0DA 4GUQA 4OY9A 2RMNA 4PH8A 3VXOA 3CHRA 1DBML 2X4TB 5FHAL 4JG0L 4C83B 5JW5B 4R26H 5LN4A 3CFBA 5CF3A 4ZUWB 2PW2A 3QJRB 2I9TA 1NDTA 2PR4H 3E80A 4XPFL 4CDHA 2BPBA 1PZ5B 1FCGA 2V2TB 3O4OC 3UTOA 3CHOA 5CFAA 2OMYB 3FBKA 4PRDA 2EKJA 3OKMB 4KK6C 1J9QA 3KG5A 1UT1A 1OAXL 1XD1A 3CVIL 1XH0A 2DH2A 3HG1A 4GKNB 5AW9B 1M56B 3QZOA 4EVNA 4HKJB 2A6IB 4DFHA 3L3IB 1PBYA 3GTTA 4RFOH 5C8JB 1HQ4A 3LSOA 2J7LA 2PCPB 2HPOA 4KX8A 4OZHE 4M1GL 1CR9H 4JE4B 2A6JB 4TF4A 4WU7B 4NO5B 2DAVA 3EZ8A 3WJMB 2H0JA 2LVCA 3EGXA 4FQJL 4KHXL 4JG1L 1ZTMA 4UQ2A 1GKOA 2Z7UA 3H56A 3DX1A 2I9LB 4W9FC 4YC2B 1JV2A 3LKOB 4LPYA 2F8IA 1U3ZA 1LEKB 4Z77A 3MFGB 5GQBA 2ZKWA 3CAFA 4LSDA 4DVRL 3MJ9L 3TZVA 5H37H 3U2JA 4G83A 1WV7T 3MRLA 1HH9B 1KCBA 1JXKA 5FV1L 1KFAL 3MNWB 2TRYA 2KL6A 2N01B 1FG9C 2LGNA 1CURA 2ATKB 4OIFA 5IEHB 2DLFH 4ELKB 2XA8L 3BAJA 3W0WD 3H3PL 1SYSA 1EAOA 5DR5H 4ZBJA 1RMFL 3CDZA 4W9JC 7FABH 3GWJA 3CC5B 3WLWD 3UTSE 3CHPA 3VI4A 3GGWA 5I6XC 1V7NL 4YDKH 4NSKB 5EU6A 3CZUB 4L4VD 3FRUB 3RWGB 2Z31C 1E8XA 1MUJB 4ODWB 4AENA 5SWZA 4NC1C 3ZRSA 3S88H 1MCPH 4QR7A 1SQ2N 3B6SB 4M29A 1TZGH 4AVHA 4UU9B 4HK3J 4PJFE 4KITB 4XVSH 2K3TA 1ZXQA 4XXCC 5D6DA 3A0OA 5A2AA 3REVB 4KMTH 1DBKH 5LCVL 1UOWA 2JCWA 4HPOL 4N28A 4L4TA 1T83C 2P5WA 5DJDA 3IDIA 4JO8A 2EYRA 2Q2EB 3NZHL 1IC1A 5KSVB 5D4QA 2CGZA 4LVHB 4Y9FA 3TBCA 2P80A 4JRXD 5GZOD 4AYFA 4LRIC 1MRCH 2HT4D 3L1FA 4YS4A 2FX7H 5D96B 3UTTA 3MHZA 1PKQE 4UT9A 2Q76B 5H35B 2HH0L 3GBMH 4PJBA 2YKKA 3IJSA 1SJEB 4LL9A 5J13C 4LEXH 4RGNC 1SRDA 2COQA 1Z3GL 3EGDB 5J1AB 3TZVC 3P30H 2E7LC 2F0CA 3VNZA 3JV5A 3MMEB 3IB4A 4CVXA 3X13B 1IC4L 5BUGA 3ULVH 2ZUWA 5G4MA 1BVKB 5C3IA 3OKOB 1OVZA 3D6GA 4NAJA 2V7HB 3C6SA 3WIIH 2F53D 3D39B 4OUUA 4PN6A 5K9JL 3H9HA 1WAPA 3D06A 3WY1A 4PREB 1SXNA 4G5ZH 2EH7H 3DJTA 3BPOB 4WK0B 5HYJB 2BFVL 3W38A 3GSNH 2X9ZA 4KXZI 4XCFL 5AW4B 4B0MB 1UQSA 1TZHB 6FABH 2OI9B 2NY0D 5DA4A 1OY3B 4TSBH 3MV8B 3ZKMC 1LO3L 1D6VH 5LCVA 1L6ZA 1NGPH 1OTSD 3VRIA 3WGUB 5TPWH 1BXXA 1WFIA 3O3DA 4PSPA 1JF1A 4QHPA 3V4VL 3FNKA 4NNPH 1GC1H 2H5UA 3QAZC 2HX9A 2AXJA 3A4AA 5D6DC 3H6AA 7PCYA 1D9KD 2XTJB 3IFLH 3VFUB 5IQLA 3VWJD 4BRJA 3WNMA 1KT2B 4XNZB 3QIWC 3B9KC 1GGIL 3M45A 4KGLA 4WO4D 3QUMH 3RZCB 4EDXB 3DV6B 5ICYB 3JTBA 2P49B 4KKNA 4K5OA 3QNZA 3CZSA 1YN6B 4HEME 4MQTB 4TPRL 1KBGH 2OR9H 3DX3A 1MJ7L 1JWSA 1O9VA 3VE0B 2HFEB 3HI6L 1UXWB 4X6CB 2CKBL 4MNQA 3DECA 5EU4B 1DUZB 3LQAH 2L8AA 5I9QC 2DL2A 2PWHA 2CO6B 2NZIA 3ME0B 1HL8A 4JNXA 3MRNB 2WVVB 2ZONA 4DPBX 1K4CA 2VDRH 1JYVA 5F96L 2RFXA 3MYZA 2JKNA 5HVGB 2Y5TA 3KPRE 4KX7A 2WKLA 3GK8H 3KYMB 4H20L 2MFNA 1BAFH 4BFOA 4DGIH 3LEXA 1I7ZA 2HJFB 5D4IA 1MI5D 5LQBL 2R1WA 4K8RH 4ZRGA 1TJGH 4JHBA 3CZNA 3BLBA 4JFDA 3GMMA 2DYPB 4XP1L 4XT1C 1WTLA 5GZND 3ARWA 5IW1B 3VSTA 3TPKA 5C0GB 2RBLA 1OQOA 4RBPK 3O11B 2WB7A 2EYTB 2HTLC 1UWGL 2NY4B 1HESA 1KIRB 3RDTD 1QEWB 3ZSTA 2P5EA 4DP8X 1QBLL 4UV4H 4OJYA 2BXZA 3QUKA 4BSVB 3GSUA 4G8EA 1C1EL 4ABVA 1PSKL 2CM5A 4NB7A 5DHYA 4MXWL 4NQCE 1NDGA 4OD2A 1HKLH 3V0HA 1AO7B 3ZDZB 2PO6C 4LT7A 4NO0D 1WFNA 4Q6IA 3LKQA 5GIRB 3QG6B 3V7AG 2VKXA 3HFMH 5GXBB 2DLTA 2CCLA 1NC4B 1J1OL 2F61A 1YJDL 4MA3A 3QNFA 2NNCA 4NHUA 4WAFA 4MAUL 3Q1SL 1N2RB 1RPQA 4EI0A 1AQKH 2B2XH 1L9OA 4ZFOL 3BGFB 1HZHH 4IRJA 3KPNB 3PS6A 4NM8L 5DVLA 3IDYC 3DMMB 4MCZA 4PW4A 2OAAA 1RKRA 4H1LG 4Q0XL 3IDXH 1FIEA 4U6VL 5EDXA 5SWQB 5B1AB 1CFTA 1PGRB 3MZGB 3ZGHA 5DJAB 4WJ5B 3PL6C 4X7SL 4Y2DD 1JZ5A 4G6AC 4B9CA 4FF9A 3STZA 1UOVA 3PG2A 3LXUX 1Z9MA 3RURA 4C47A 1XCQB 4I4WB 5DJZB 5DUPL 4OM0L 2CJTA 5HGAB 5B1JA 5JO5B 5K59F 1JZ8A 3O4LB 3C09C 2AK4B 3FHEA 5FO8A 5FYKL 1L9RA 3OWRA 1M1XB 1S7TA 1XIWD 5ENWA 2OK0H 3FOLA 1AD9A 2BNQB 5TDNA 2OMZA 2IANE 5SWSB 5GJSH 3ULVC 4HT1L 3MLYH 3QI9B 1BZOA 4QWWC 1Y6MR 3F65A 3P02A 1IVTA 5JR1L 4P59L 1C5CL 3MV7A 1J9CT 2PYEB 2F8VA 2VDOL 3KPPA 1VEOA 3DX7B 3U46A 4N5EC 4LLMA 3SB3A 5IJVA 1P7KA 4R83A 1KB9J 1MCDA 1I4FB 3TT1H 3VSUA 2JI3A 3AU1A 3MGOB 4LSTH 3S3PA 5C2BH 3MZTA 3TNNA 2HVJA 4J23A 4Q6IC 1ZVSB 4IHOB 4BSJA 1AOZA 3OF6D 4NNYA 5FFGA 5JIIA 2FYVA 3TF7C 5I71C 3DTUB 2E59A 3N85H 4I13B 1PIGA 3BSGA 2TAAA 3L95B 4ZQTA 3SDCC 3F5WB 1WHPA 4F57H 1BREA 4OQ1A 3UYPB 1MNUH 4A2DA 1IBDA 1YUKB 1TOXA 2VE6B 5CZXD 4NO3A 1GC1C 1WJ3A 5KVDE 1XBDA 4IRJC 1SLXA 4HLJA 1DQML 1NGWA 1BYNA 1PJWA 3V6BR 3MAWA 1F18A 4S1RL 5LBSH 5DURD 3QDMD 4HWBH 1ZA3A 4UM8A 4Y5YA 5GRXG 3TVMA 5D71L 4ZX5A 3QEHA 1U91A 3QJVB 1TEFA 4KMLB 3IMBA 3MOQA 1Z9OA 5E08H 4W70A 2ZKXA 2NNXA 1N3NA 1DQQA 1IGJB 3MLWL 3OJDB 3PGCB 4AMKL 4UDUA 3KLKA 1FNGA 5EBLB 2WN2A 1S9VB 3VGBA 1G4RA 5DLLA 3M6DA 5F44A 4GH7B 4HS6B 4ZOEA 5E6RB 3SPHA 4Z3GA 4RISH 3LQAC 3O3BB 3MRPA 3QCTH 5I1GL 3TBVA 43CAA 4M5SA 4OAWA 4XCNA 1BMWA 5I18L 3QQ3B 2E46A 3LQMA 1IC0A 3U7AA 1J5CA 3IF1A 3ZHNA 1UWEL 3QA3B 4MMYB 5FA4B 5D7LD 1ADQH 4LSRH 1ZANH 5D93B 4DVBB 3KJ6L 3I75B 2ZKHL 2J4WL 1NUNB 4K8RC 1TQCB 1HWHB 2BHYA 4RFNB 3F7YA 5DZJA 1TU2A 1EAJA 3SPVB 4CVZA 4KQ0A 2VC2B 4HHAB 4X6CF 1AQDB 1FO0H 5AOMA 3QH3A 4F7KA 5J6HB 4PS8A 3LNHA 3VXTB 1OP5H 3CTTA 5K9QG 1BECA 4GI6A 4LU5H 1E8ZA 3OHMB 4QRPE 4ACPA 4BK4A 1L9MA 4HG4K 1WWCA 3ARGD 1VFUA 2IAAC 3EGSB 2GFBA 3CUPA 1LILA 4JDZA 3OC8A 4KPHH 4WUUD 1HAWA 3RX7A 3KPSD 1A1MA 5DJYB 2VITA 3ARDD 3B2UC 4OQTA 4XCYB 2VXQA 1NBYA 3TGXA 4EIGB 4KO6A 5DQ9B 4NZ8A 5DRWA 4LPVA 2VQTA 3OXSB 2FRGP 3HAEA 2WM0A 2VR6A 4XN2A 4OD1H 5D2NB 5ID1B 3GHEH 4AY0A 1NFDB 1MJJB 3SCMB 3EFDH 3SBWC 1T1YB 3IJHB 1QLEL 1X5HA 2Z35A 3G5YB 1BQLL 3EJTA 3A23A 4GKSA 4HMDA 1JTPA 1R3HB 4JKPL 1DP0A 3BAYA 5BV7L 3HJEA 4WU5B 1UCBH 2YIHA 4X8CA 2YR3A 3WENA 1VZGA 5LBSA 1A1OB 3CFDA 3WS6A 4UZSA 3WNIA 2XOTA 1IC5L 3NFPB 3C5JA 5I6OA 5J57B 3QQ4B 5K59E 3U4KA 4IDJH 2NLJB 5DRNA 1ZEAL 2V0AA 1QPXA 4BINA 2VUYA 1AXSB 4U4IA 1N0LA 5DTFA 4FYTA 4F8TA 2Y0SA 1FSKC 5E8EB 5JDSA 2YD2A 4OJAA 1B0GA 2P7TB 2XZZA 4JFED 1RULL 2R59A 3UMNA 3SGDI 2QGEA 5CU5A 1TSRA 1FLRH 3HCVA 3IETB 5L7XH 4JKLA 1BVNP 1JK8B 3OVUB 4PY8J 3H7BB 5DVNA 1F2QA 1LO2H 1R6VA 3C6EA 1CE6A 5T5FL 4KJWC 4OZGA 3GO1H 1A4AA 2AQRA 4FQXD 4P23B 4LAJH 3LS4H 4L05A 1SXCA 7PAZA 3EF7A 3UAFA 1J1PH 1IM3B 4X4XA 2XWZA 5C0CD 5JW4M 3QORB 1G9NL 4I3GA 4TQEH 1DVSA 2ICEB 1FZMA 1K2DB 4D9LH 1IL1B 1E2WA 3MX0B 1NKOA 1BBJA 1AKJD 3UJIL 2GITB 4Y4HD 3S98A 2WWMC 2VABB 1MCNA 4ZMPA 4K23H 4N2KA 4LEOA 1ACCA 2HT2C 1AZNA 1GOHA 4PR5A 3PV6B 3MUGA 4NPKA 3LKSA 5EN2B 1ZTXE 1G7HA 3NA9L 4LASL 5DFTA 2FSEA 2E9JA 1NOFA 4G7YL 4KK8D 1YC8A 1B2WL 3CNKA 3MV01 5FCSH 4Z76B 2BO0A 2D3VA 2X4QB 3T0EC 3D39E 4DEUA 3EFFB 2KH2B 3TFKC 3VGEA 3WS6C 5JW3L 4WQOA 1A2YB 2ZWYA 2ZG2A 4J6RH 5CR1A 3PP3K 4MNHA 5HYJE 4LCYB 4ZW5A 3MU3A 3KPLB 1BWWA 4OLZL 5C71A 4X5RA 5JOFA 1HDMB 1Z5LA 3QNYB 4AT6A 4Z8FH 3NEEA 3MV8E 5D72H 5BZWA 5I30L 1F8TH 2OMVA 5EO1A 1JOIA 3N1GC 3FKUS 4BWUA 5EU3A 5F9DC 3D12B 2AANA 2DIJA 2GCYB 3KYNB 3CZFA 3A67H 1U9KA 5DT1H 3HMXL 4UIMA 2AMGA 1IC7H 2OMTB 2XTJE 2JB6B 4JPIA 2ZXWB 5ITBL 3KS0J 3T6QC 3FFCD 4M7ZC 2YA1A 3LEYH 3V55A 3S37H 2BHZA 2GB2A 3OD3A 4K7PY 4R5TA 2VIRB 5INDB 4MDJB 4XPBL 4ZT1A 5CILH 3DUSA 3MRMA 3F7LA 5AVWB 3WN5A 2EDWA 4RH4A 1PG7H 2MNWA 3TWCL 1IJ9A 2ADGA 1KCRL 3I6LE 2WKOF 2XTSA 3NVQA 2A83A 3IS0X 1CD0A 1E5UI 4LCWA 1NBQA 4X6CE 2NCEA 3JSSA 2KZBA 2ZOKA 3RB5A 1MHHA 4P2QB 1Q0YL 5DK0A 1DLHB 3THMH 4N9OB 4ZX3A 3ZKXC 4K5MA 1JCVA 4H4NA 4MAYB 2R8SH 5JOEA 2Z9TA 3C8KB 4U6HA 4U1JB 4OFYA 5JXEC 3QAQA 2D7PA 5IK3A 3P4NB 4GRLC 4QXGL 4JFOA 4WFED 1X7TA 4F7TB 1ZLEA 2HFFA 4LQFH 1PL3A 4DPRA 4MD4B 3BP5B 3C2AH 1I7UB 1DQJB 5DD5H 5HHOD 4BZ2H 4TRPL 3PWVA 3FQRB 3IDJB 1BAGA 4IU3B 2AVGA 4QRQB 3C08L 4XNUH 1XHHA 2I69A 2E8ZA 2KZ1B 4YDVB 2B16A 3ILPA 5DJ0B 4DESA 2P3YA 3RYMA 1A3LL 4L8DA 2J55A 2CJUL 1IX2A 1FQ9C 4B9PA 3WFZA 4NT6A 4YSCA 1EUTA 2WBJB 4Y4KD 1YO4A 2BRRH 1MY5A 3NFNA 1YDPA 1CICB 4ZFFA 3SKNB 2IG2L 2R56H 1TZOA 1OGSA 4BH8B 2F6AA 4LP5A 3BQUD 4QYOB 3KPQB 2CDEA 4FERA 1BD2D 4PVMA 1JV5A 3NCFB 4O02H 4R90H 3WN5C 3QJFB 2FUQA 1ZHLB 2BCKA 5KSBA 3EO1B 4WW1B 1F41A 5C9JB 1ET7A 1G43A 1TVDA 1ZGLM 1NFDF 1TJIL 3D4YA 1CDCA 3T0DA 1Q0XH 3EOAB 1M57B 4JKWA 3JWNE 5BXFA 4D0BB 3D30A 4Y2OB 2ED7A 3KPMA 3HG5A 4UQEA 4JDEA 4GQ9H 2WMPA 3BN9D 3CVDA 2WBXA 3KW8A 3D4ZA 2DKMA 3AUVA 5CJ5A 3WO3B 5IREA 2OMWB 1JRHL 4OKVA 2BINA 4MMXB 4XPHL 2A1WL 4JX0A 1U3HD 1SOSA 4IYKA 3O4LE 4HS3B 3SKUD 5TF1H 2AK4E 4X9YA 3GXUB 1MELA 1OB0A 1UD2A 2NZ9D 4FXGA 1L4IA 4NUGL 2BNQE 4LSSL 2H9GB 2NT1A 5SWSE 5B3SB 1A4CA 3FH8A 4HWZA 4O51A 3QJQB 1VHPA 5CNHA 1PZAA 3AS0A 4FCHA 4K3EH 1RZJH 1MCEA 1OK8A 4FXKB 1ASOA 1GS6X 3FUEA 4S2SA 5FKAB 3SJVB 2DQTH 4Q74A 2IWKA 4QHLB 1IIKA 4NZUH 3W9EA 3CFEB 1OP4A 4PMFA 4HU8A 3ZO0A 1ES0A 1IGYA 4XO9A 5C0FA 2WC7A 1B9KA 1RZIB 4YR6B 4NQDA 3GJFA 3TEWA 2XU9A 3P4MB 4BZ2A 2BVPA 4TM9A 1FC2D 2KMWA 4FG6D 1HTYA 3WGVB 2EKSB 3WXWH 1RJLA 4FKEA 3TA4D 4QF1B 3QQXA 2KLSA 3TO4C 1AIZA 4HIHA 5ESQB 1JPTL 1PW3A 2D3JA 5ILTH 2AXGB 1WK0A 1GZHC 2XRAH 3MLSH 2IOIA 2P8MA 3HE7B 4KK9D 4YSRA 5FUCE 5IBTL 3FOMB 5IQOA 4AG4H 3BKMH 4MD5A 3ZTCC 4R97B 5KANI 1BQRA 3KLHD 3WKPA 3L4CA 3D0LA 1H3PL 1E8WA 15C8H 3QUZB 5D1XB 4PIRF 3WIHH 4QOKB 5C3TA 4B9FA 2VNCA 3ESVF 3TH2T 2BSTB 4XC3H 3BAXA 1N0XH 2QQLL 3FUIA 4L8SC 5GS1A 4FJZA 2WLLB 3HZVB 2XQBH 1S9XB 3MV9D 3II3A 4H88L 5IB1A 2PXYA 3PDGA 5E4AA 4M7JH 4RDBA 3LIUA 2Q3XA 3WKMH 4KK6D 5E5MB 5KEZA 3UJJL 2VXTH 3WHXB 4KXAA 1HHIA 3IGAB 2P45B 1WEJH 4MWFB 3D85B 3BYTA 2A5UA 5E2UL 4AQEB 4CMHB 5JDJA 3RB7A 2OA9A 1OIOA 4PJ8B 1EAPB 1ILSA 1T5KA 4FQ1L 5C70A 1I8UA 2VZUA 4MJIA 2PP8A 4P57A 2WUBH 5GGTH 5GGQL 4AWJC 4X98B 1DLFH 2DMKA 1QTYT 5HP5A 4PJFA 1AGEA 3PV7A 4JO5A 4XP9H 4BD4A 4HOWA 3FYIB 3S4SB 3T4YA 5J9PB 3D4GA 2YN5A 4D8PB 1GS7A 2DM2A 1DJZA 5I6KA 1Z3RA 1QUPA 4HHWA 5AOJA 1RJZB 3ISWA 4M02A 2AV1A 3FO1A 5EWIH 3I9IA 2GIYA 1KTJA 3F6IA 1DQKA 4JN2A 4HLZG 4NKDB 1BCIA 1OAQL 3VXMA 4U1NB 4X8GA 3RFZA 1GJUA 4I3RL 5IF0B 1ED3B 5DO2D 2XQYA 1CU4H 1ZPLA 2BNRB 1QATA 1BQ5A 3CLWA 4GT7A 3RX5A 3NTCL 4M1CC 5D2NE 1NFDE 1AE6H 1QLRA 3OZ9L 3MUZ1 5EU5A 3E0GA 4P4KB 3M46A 5DMIH 4FNSA 3K81A 3MBEC 4JM2A 4NQUA 5E0FA 1I1FA 5D7JB 2PXYC 3BH9A 5L8LB 1KY6A 4QXVA 2CUHA 2G2PA 2H26B 2PWEA 1IGIL 4YWGH 2ZOLB 4FQCH 3FT0A 4L23A 1KXHA 1CUOA 1TTRA 3HG1D 2BIMA 2A9ML 1EO8L 3I85A 4XWOD 4XRCA 5KYWB 3F62A 4PJHB 4OB5L 2H2SC 5C6TH 4YDJA 1NANI 4R84A 2V3EA 3DX6B 3AM8C 4Y5VA 1UG9A 4H1LH 3FUKA 2DQ6A 3NJIA 1QKZL 1UUNA 3HR5A 2CAKA 1P1VA 3WKYA 4HCRA 3RVWD 4PP1D 5EOTB 3N41B 4MQXC 4MZ3A 3CLEL 1CD1A 1I9IH 1ZS8B 3L81A 2A77H 4NQVB 1F00I 1HWWA 4ZS7H 2NW2A 4IK6A 1YEJH 4OCXL 1E6JH 3K5RA 2D7QA 3N9GH 2EIZB 1LO4L 5EZIL 2BSDA 1RZJC 1VESA 1JZ4A 3UC0H 4EBQH 1OCWH 2WXIA 12E8H 5T1LA 3TBYB 3T09A 4L9LA 3RWHA 1TTUA 1BFVH 3IS1X 4DKEH 4GMSL 4HEMA 2IVFC 4RGND 4G43A 3TZVD 4BUGA 4OCYL 4Y9EA 4ENED 3QXDB 1YRKA 5BNXD 3MOAH 2VDLH 2XICA 2OZ4H 5JPNB 1L0YA 4HUCA 5HHMB 2ORBL 3OAWA 2FQFA 4QT5A 1AKPA 4R2GC 1Q72H 4OCLC 4E36A 2R2EB 1B6DA 3M8OH 1DVFB 2VLME 4GY4A 5DVKA 4BJLA 3M17B 2G3ZA 5G5DB 1P53A 1YPZB 2X1PA 1WCBB 4YHLH 5EFIB 4GINA 1S3KH 4PY7B 3G5XA 4N2MA 2JQAA 5EU6D 2R0WH 2VL5A 3KPRA 2Q7YB 4CC4C 2UY6A 3AQDA 3LIZL 3L9RA 3S5LG 1A66A 5SWZD 5GRJL 4HXBL 1MW2A 2ERJC 3FFDB 3O0RL 3CPUA 1PZCA 1A6AB 4GFTB 4MJ2A 1FN4B 4F2MA 5A7BA 1BW8A 3HI1B 3CFKB 5GJTL 4E9LA 4ZAKB 8FABB 5I0DA 3EJSA 4P9HL 2NMSA 4TQPA 3K2IA 1EERB 1I8LC 3NZ8B 2LW3A 4NPJA 1F58L 1WC7B 4EN3C 1L3NA 5EF3A 2N59A 3BRFA 2DPKA 2P5WD 3ECQA 3O8XC 3G5ZA 4L4TD 2WO4A 4JS7A 4NLHA 3V5DB 2PYFB 4LHUB 2OCFD 1JXDA 2P80D 5KVDH 4K0OA 3CXFA 2CA4A 3P0GB 4NQCA 4ABQA 1HHKA 1F1DA 3UTTD 4FQPA 4MA8L 4AH2B 1BEXA 4PB9H 1FA4A 3FTWA 1RHFA 3CH8A 5I1IL 1KTDA 1WUZA 3P0VH 2VJXA 4L9LC 4U1GB 4WI6A 2VRKA 1U3YA 1KZQA 3OAYH 3BP7A 4FABH 2Q6WB 2WXOA 3AXHA 1YNKH 1KJ2H 4PLKC 4RMBA 1D2PA 3RVXC 4P49A 2H3NA 5IVOA 2PPFA 5DK3A 2GJJA 2XG5A 4P2QE 1T5WA 3D18B 3PGFH 2EUWA 4OFIA 3Q2WA 3D1MC 3LIZA 4GW1A 1R3LB 3RL1A 2H4EA 5BVJB 1I9JH 3E8VA 1GHFL 3SZ6A 4XBPB 3MJ8A 2XG4A 1KN4L 3PJNA 5IW3A 4YQXL 2FE0A 2Y36L 1AR1D 4QXWA 1J5OL 1V54B 5MHSE 3NIGB 3BMVA 1G4MA 4PV9A 2OZ4A 1IGCL 2VERA 3CN3A 3PP4H 3TIEA 1OGTA 2NXYB 2QLYA 2MCMA 2ZWNA 2JQZA 1AZBA 5SX4H 4ORGA 2ZSVA 1PG7W 3G6DH 1ORQA 4QRUB 3GXDA 2FJFA 3ESMA 5DHXB 2V17L 4LLVB 5FYLE 4HDIB 3F01A 4QRBA 1QRNB 3ZL4H 1KLGA 4J3OG 1FL5B 4AGOA 1NGQH 1DDHB 1FG2A 2VDML 32C2A 3FN0L 1I31A 1BQHA 2EDJA 3T9WA 1GYUA 1SY6H 3DVNB 1M7XA 4YHIA 4MNQD 5SX5H 1HSAB 3LHAA 1FFQA 1WZLA 4ORZC 1JZ7A 2Z92B 3UBGA 1E2VA 4YBQC 3JV4A 4EZLA 1GOFA 5EF2A 2NY5H 4EUPB 2A9CA 1WLHA 4PBXA 5K39B 4R7DB 4AQ1A 1NCCH 4K7PH 2NNAB 1A64A 4X6DB 4IRZH 5D5MB 3WY4A 4H8WH 4KKRA 4BKLB 5FYJE 3M7FB 3KM1A 4JDVA 4M5ZH 4IRSC 4HJGA 3ASNB 1JHKL 4PJHF 5I8EA 3KXFB 3T3MB 1XBRA 4JFDD 1CXFA 5DEZA 3UGEA 2PMZA 4ZK8A 1U33A 5I1HL 2X4TA 4O58H 4C83A 3C75A 3GBEA 4QWWD 1JFHA 2B15A 1KIUB 1V3MA 4XC1H 2OLDA 3N41F 1A6ZB 2O4EA 3QZWG 2P5ED 4MDIB 3L5IA 4BHUI 4OSUH 2YMXH 5A43C 2WXRA 1H6UA 3MVSA 3AGVA 3OKMA 1LE5A 3Q6FB 4MJ6A 2J5LC 1IAOB 4JREB 4PLJC 2B1HH 3SJVE 1EEYA 1WWWX 3RVTD 4AGNA 3B2DC 2B0SL 4GKNA 2QPSA 3GRBA 3MGTA 2Y06L 3V4UH 1EXGA 4M8RA 1QVOB 1XB6A 4ZTPL 1MW1A 2A6IA 1N5YH 2I24N 3ISYA 3L3IA 5BMFH 2J88H 5C8JA 1I1RA 2CHWA 3R1GH 5DWPA 1I9RL 4JM4H 1VCBC 3V4PL 4LSQL 1BBDL 2PCPA 1UA6H 1P7QB 2A6JA 3BIBX 1YY9C 4J3SA 4WU7A 4IRJD 4N25A 4NO5A 2CO2A 3WJMA 2C9QA 4ODUA 3NPSC 3HNTH 3LRKA 1RK0B 5IQ7L 3A4DA 1CVRA 4JFZL 1OPGH 2I9LA 3SDDB 4KUZH 4HJJH 3IFOB 5L2KB 1YPZF 3LKOA 4FFZL 2FCBA 2XVKA 4OGXH 4FQIL 1LEKA 3P3YA 1OAZL 4P5TC 1Z9SB 5D1XE 5EN3A 1SY6A 5KBDA 2JKRM 1N64H 3IAQA 1VFAB 2B4CH 4E41B 3L7EB 2HVBA 2XN1A 2DQJL 3ETSA 1ZLUH 1TPXC 4XMWA 1ZSDB 1HH9A 1VEPA 1EQWA 4PG9A 3SE9H 5FM5M 3VXRB 4JKKA 1X9LA 3ATAA 4HK3N 1O6VA 5E6ZA 2ATKA 3MRIB 4W9HC 2WXGA 4GMTL 5DD1L 2WK2A 4ELKA 3ZZ1A 1IFGA 3ARBA 4IM8A 2FX9H 4HUNB 3MV7D 2C9RA 4IRZA 1MCHA 5JHMA 2JIXA 1HNGA 2DWDB 4N6RB 4HEPA 1MWAB 3H2PA 1SVBA 1HL9A 2YD0A 2BP3A 2AEPL 1S8DB 2WIIB 1GKEA 2EIJB 3NK3A 4FLQA 4JL2A 2VDNB 1MUJA 4K8RD 3SKOB 3TO2B 3WEXB 1FP5A 1JNHB 1ZV5A 3HIZA 1NSNH 4JFFB 2V2WB 3NIFB 3RY4A 2H1PL 3B6SA 1L3WA 1T22B 4X4YB 4WV1C 3PDOB 4UU9A 1DQDH 4HXAL 5IY5B 1MZZA 4YOKA 5GGVY 3ARRA 3REVA 3OG4B 3ZW3A 5C7XH 4PRIA 1BFOB 4FJ6A 5F7FA 4XMUA 4PJ9C 2GSMB 2QV4A 3MNVB 4GIOA 3Q6GL 1XH1A 3VD3A 4P2RA 5EZOL 4N3UA 2B77A 2X9XA 3W56A 1KTBA 3B2UD 3UYRH 5IIEA 4YC2C 3RVVD 3SBRA 4HJSA 1OE2A 3TVMD 1FC1A 5F70A 2YGPA 4C4BA 1O5DT 2BVYA 1AC6A 4QTFA 1LNUB 3EAKA 2Q76A 4TULH 1HHJB 2OL3L 2NR6A 4U2YA 3F7VB 2VYRE 4KKCC 1T7WA 3S7GA 3Q1EA 1KCVH 1A8ZA 2BNRE 3N1MC 3NIGF 2X2UA 1CLYH 2HRPH 4NFBA 5MEPB 2PCFA 3EGDA 1L7TL 2FEEL 5DEFB 5J1AA 4P46C 3MMEA 2JJSC 3NJNA 4TQIA 5LXGH 1I7RB 4AJ0A 3OB0H 2DS4A 4KQ3L 4QJ4B 1NUGA 3EBHA 1BVKA 3BESR 3OKOA 1ZLVK 2Z0UA 5HVWA 3WS3B 1OGAA 2NY5C 4N85A 4RMVA 5KBPA 5DVOA 1KLFB 1TTAA 1YYLH 4XVTH 1RZGB 3S8WA 1KELH 2N7AA 3UTPD 4H8WC 1VFOA 4X5LA 3S5ZA 2YXFA 2MOGA 3LPWA 4EEEA 1IBGL 1W91A 3UERA 4WW2B 1TZHA 3RPKA 3MLVL 1SF3A 3MV8A 2VXUL 1D3CA 1ZY9A 3ENEA 2HRGA 3NESA 2QBWA 1A1NB 3RIFF 4TVPD 4TUKL 3IGKA 1FBIH 1SM3H 4LSUL 4XX5A 5ACLA 2FHCA 3ARQA 3LMJH 2OX5B 4NUJA 4UMGA 1FZKB 3JWNH 4MAZA 3VFUA 4KJWD 1KT2A 2G5UA 2WZAA 3FU5A 4XPTL 4FFYL 3RI5F 3VDAA 3RZCA 4W9ZA 4X6DF 3KL3A 5D5MF 1P2CA 1PIFA 5LN8A 3ZZQA 5ICYA 1Z32X 1G9ML 1O9WA 3QRGL 2VT0A 3VQMA 3RX8A