2ZWNA

Crystal structure of the novel two-domain type laccase from a metagenome
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
AEREFDMTIEEVTIKVAPGLDYKVFGFNGQVPGPLIHVQEGDDVIVNVTNNTSLPHTIHWHGVHQKGTWRSDGVPGVTQQPIEAGDSYTYKFKADRIGTLWYHCHVNVNEHVGVRGMWGPLIVDPKQPLPIEKRVTKDVIMMMSTWESAVADKYGEGGTPMNVADYFSVNAKSFPLTQPLRVKKGDVVKIRFFGAGGGIHAMHSHGHDMLVTHKDGLPLDSPYYADTVLVSPGERYDVIIEADNPGRFIFHDHVDTHVTAGGKHPGGPITVIEYDGVPVDDWYVWKDKDYDPNFFYSESLKQGYGMFDHDGFKGEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords two-domain type laccase
publication title X-ray structure of a two-domain type laccase: a missing link in the evolution of multi-copper proteins
pubmed doi rcsb
source organism Metagenomes
molecule tags Oxidoreductase
total genus 98
structure length 317
sequence length 317
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zwnA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zwnA02
4YSSA 2I85A 1M57B 4KOCA 1DYZA 2UXVA 3CVBA 4UANA 3ABMB 1IBYA 3CVDA 4G7SB 4GP8B 4KOBA 3UAAA 1SDDA 2PPFA 4W1TA 4UAHA 4YVNA 4E9TA 5D4IA 4EF3A 1M56B 3OQRA 1PZBA 1AAJA 7PAZA 2PP8A 2DY2A 2IH8A 3IN2A 4BWWA 2WSDA 3FU8A 5B7EA 3TU6A 2I7OA 3NSYA 1PMYA 2XU9A 3CDZB 5A7EA 2ZXWB 5IY5B 1F56A 3CVCA 1ILUA 4HALA 3BQVA 1EZLA 2OV0A 1MZZA 2GI0A 3FSWA 1GY2A 4NERA 4A2HA 1AZBA 4AKPA 1RZPA 2VW4A 4E9SA 1PZAA 2EIJB 1QHQA 4N4YB 4BDVA 1GSKA 1ETJA 2HX7A 4JHVA 1E5ZA 1W6LA 1L9TA 3GDCA 2FQDA 1ET5A 1I53A 2UXFA 2ZWNA 3EHBB 5D4JA 5F7AA 4KO7A 3OMAB 2FTAA 2R7EB 4YVUA 1PCSA 5AZUA 4YSTA 1ET7A 4ZK8A 3KW7A 3OMNB 5I6OA 1NZRA 2JFCA 3FU7A 1PNDA 2MTAA 3PAVA 4E9QA 3ZDWA 2X87A 2YXWA 2P80D 4E9YA 1NDTA 3EF4A 1MG3C 1OOWA 2YXVA 4TXVB 1NIDA 1PLBA 4YSCA 1JZHA 2XXGA 3TA4D 2IWFA 3NJFA 1GYCA 4M4RB 1AS7A 4M3HA 3S8FB 3QJUB 2J57A 3FSZA 2H3XC 3HB3B 4YSOA 5ANHA 2BP8A 3NJJA 2UX6A 1WAEA 5I26A 2GC4C 4YSDA 1CYXA 2AANA 6PAZA 5B1BB 1XB8A 4BXVA 3NJMA 4G72B 5I28A 2AZAA 5FC9A 4DP9X 5B7FA 1AG6A 3QJRB 4KO5A 1NINA 3T71A 1J9SA 8PAZA 3TBBA 3IEAA 2E86A 1SF5A 1NIAA 1ET8A 3MX0B 2VSMB 4DPCX 1IC0A 3AG4B 1PNCA 4G71B 2EIMB 1KCBA 3UGEA 1M9WA 1GR7A 3X2QB 2BP0A 2PP7A 2YAFA 4A68A 1XB6A 1PF3A 4Q8BA 4KNSA 1JXDA 3QJSB 4L0PB 2IDSA 2PPCA 3S3DB 2X88A 5B1JA 1NWPA 1SDDB 4WKXA 1KYAA 1ID2A 1E5YA 2HZHA 3UADA 4HHGA 4YSQA 3HEIB 3WKQA 1PZCA 2QDVA 3ASOB 4E9VA 2IDUA 1BQRA 1IKOP 2RACA 3T6VA 3T9WA 2B08A 2BW5A 1AZCA 1NIBA 1RZQA 1KDIA 1KV7A 1T5KA 1BEXA 1KCWA 2AVFA 3N55A 4K9JA 1N70A 3BVDB 1SHXA 1GY1A 1MZYA 2QPDB 1PY0A 3DTUB 3NJIA 1BYPA 3PXLA 3FSVA 1NWOA 1WA2X 1J5DA 3PPSA 3U25A 2PCFA 3FQ1A 1SF3A 2IDQA 1JZJA 4HIPA 1OCZB 4BXSV 5AFAA 4NB7A 1W6WA 4G7RB 5B7MA 3ZX1A 2BHFA 3SBQA 4DP4X 1CYWA 4BDVB 3H56A 3AZUA 3UAEA 1A65A 3ERXA 3FPXA 4CSPA 1TEFA 2VW6A 1R1CA 1JERA 3T6ZA 1AZNA 2HX9A 4CSZA 1AZRA 2XYBA 4A2FA 1A4BA 2PPEA 2XXFA 1BQ5A 4N8UA 5EHFA 4A2GA 1SFDA 2AZUA 2GHZA 1E67A 3EH4B 4AKOA 3DIVA 2HXAA 1A4AA 3DKHA 3X1GA 3V9EA 3FU7B 3NT0A 1GS7A 4E9WA 2EIKB 3FSAA 3CDZA 1GS8A 2IDFA 3D12B 3PCYA 1CURA 1ASOA 1AQ8A 9PCYA 2CJ3A 1AZUA 4WTQA 3PAZA 4YSPA 4HZ1A 5B1JC 1J5CA 2QDWA 3IE9A 4HCIA 2MRYA 3NJHA 1RKRA 4PCYA 1JZFA 1ZIAA 2PPAA 2DV6A 2BW4A 3CG8A 1N68A 2CAKA 1A3ZA 2HRGA 4ENZA 1WS7A 4F2FA 3WKPA 2YARA 1JVLA 2XUWA 5LDUA 3TASA 2R7EA 3C75A 1IUZA 2P80A 2BWDA 5E9NA 3SBRA 4YSEA 6PCYA 3ZBMA 4DP6X 2WO2B 3GXUB 4BWTA 1OE2A 4PAZA 2BP8B 1NIEA 2XX0A 2GBAA 3OM3B 1NTDA 2HRHA 2TSBA 2YAMA 4X4KA 4YSUA 3L45A 1V10A 2VSKB 3ASNB 1ILSA 3NSFA 2BZ7A 3NSCA 4A2EA 4DP2X 3WI9A 2JXMA 1QNIA 1ZIBA 1IBZA 2BO0A 2VW7A 2Q9OA 3KW8A 1X9UA 1XMEB 2XLLA 1KDJA 2UX7A 2XV3A 2FQGA 3ABGA 4FAAB 1JZGA 4G7QB 3H4HA 4DPAX 2FQEA 5TK4A 2GIMA 3WIAA 4G70B 4GP5B 2GSMB 2B3IA 2PLTA 2YAQA 3OMIB 4RH4A 5D4HA 4GXFA 2AFNA 4KNUA 3SBPA 2CCWA 3JT2A 1CC3A 2W8CA 1TKWA 4QKTA 4E9RA 4QLWA 2FWLB 4Q89A 3S3CB 1GW0A 1OCCB 1FFTB 2YAHA 3H4FA 1HAWA 3QJQB 5I6MA 2JKWA 1EHKB 2ZOOA 3JTBA 5I5JA 5B3SB 1HFUA 3X1NA 3FS9A 1BQKA 1XB3A 4E9XA 3FPYA 1DZ0A 2Q5BA 3NP4A 4AKQA 4BK5C 1AACA 1URIA 4GY4A 1JVOA 1VLXA 3FQYA 2XV0A 2BZCA 4GYBA 1AR1B 1AS8A 5I6NA 5I6PA 1SNRA 1BXAA 1OCOB 1QLEB 2GC7C 1FA4A 3AG2B 1E30A 2IWEA 3QJVB 1JZIA 4KO9A 3X1EA 3V9CA 2OJ1A 1V55B 3NJNA 2A3TA 1ASPA 1MDAA 3OD3A 3WG7B 3NJKA 1J9RA 1JOIA 3RYMA 1KBWA 1UATA 4FA7B 2W88A 3S3BB 2IH9A 7PCYA 1OCRB 1A8ZA 3AW5A 4BWUA 2PP9A 1SHWA 4YL4A 3SQRA 3UACA 3NJLA 2DWSA 1AOZA 1AS6A 1L9OA 2VM3A 3T6XA 2FQFA 4AI7A 2VMJA 2FT7A 1E65A 1KGYE 1YLBB 1ZV2A 3EH3B 4HCGA 1B3IA 1WA0X 3S8GB 1OF0A 3QQXA 2HX8A 2FT6A 3NYKA 3NP3A 2EILB 4AX3A 1PLCA 1OV8A 4DP7X 1BYOA 2H47C 2BWIA 4P5SA 1ZDSA 1SJMA 3QPKA 5F7BA 5I5MA 4A66A 4F2EA 2XVBA 2YAPA 2UXGA 4W9ZA 1JXFA 1ASQA 1ZPUA 5B1KA 3NJGA 5I6KA 2CBPA 1NICA 3FT0A 5I5IA 3ZIYA 2FJSA 3X1BA 4DP8X 2VM4A 1NPNA 2Y69B 2DYSB 1WA1X 2IWKA 2LLNA 2WO3B 4A2DA 2J56A 2IDTA 2EINB 2QPEB 3CZUB 1GS6X 1JXGA 2PCYA 3G5WA 2PPDA 1X9RA 4KO6A 1A4CA 3AG1B 2YAOA 3NSDA 2J5WA 1BXVA 1TU2A 4A67A 3PAUA 2OCCB 2YQBA 5PCYA 3N2JA 2VN3A 4HAKA 3AY2A 2GB2A 1ZDQA 3EH5B 1PLAA 1L9RA 1AIZA 3FYIB 3PLYA 3T6WA 3FYEB 2IAAC 1WS8A 4JKNA 1L9PA 3AG3B 1L9QA 1OE3A 4DPBX 4YSAA 2NRDA 4DP5X 1W8EA 2FNWA 1JZEA 4DP1X 2TSAA 4GP4B 5AKRA 3FU9A 1AANA 1ADWA 2BP0B 2CALA 5I6LA 3ABKB 1L9SA 1J9TA 2Y1AA 4HHWA 4F7KA 4HCFA 5TK2A 3WNJA 2XX1A 1AG0A 3GYRA 1V54B 4YSRA 3IBOA 2DWTA 2QT6A 2CUAA 3QJTB 1SFHA 1RCYA 4KNTA 1BXUA 4UF7C 1NPJA 3WNIA 2J55A 3X1FA 3IN0A 3FQ2A 2N0MA 1FWXA 1HAUA 2H5UA 1CUOA 1MG2C 1NIFA 3UABA 1PAZA 3TBCA 1TEGA 3MBWB 1J9QA 2XV2A 5B1AB 1OE1A 4DP0X 1BAWA 2DYRB 2HLEB 2YAEA 2ZONA 2I7SA 2UXTA 4P5RA 2XWZA 4NAJA 1KBVA 4JHUA 4MFHA 2FT8A 3ABLB 4AZUA 5PAZA
chains in the Genus database with same CATH superfamily
5BMFH 3DOHA 2Q7NA 1M57B 1ZLVH 2HT3D 1SVBA 2OSYA 1K9TA 1TT6A 2KUTA 3BLKA 2F5AL 1WAPA 3IJSB 4LVHB 4X6DF 4C4UA 4GRLB 2ZPKH 4RX4A 2FO4A 1WRFA 2BNRD 2DQUL 3EJTA 3MRKA 4BZ2L 3STLB 3CV5A 4ZMNA 4YBHA 3SCMD 3GRWA 2YD8A 4ES9A 3BP4A 5FYJD 4AIZB 3FBKA 4XBEH 2GKIA 2PP8A 4LSPH 2NW3A 5ERWB 2QVTA 1CGXA 2EEAA 2OMTA 3ZTNL 4LSVH 3SJVB 2BY0A 2IH3A 4J23A 1OSYA 5IW6B 2EDLA 3C60B 4X5PA 3ULUL 4UV4H 5INCB 4I1RA 1FYTB 4JBSA 5DEJA 4Y1TA 1ZJAA 3EYSH 5GS2D 2E0PA 2I60H 2P4AB 4XAWL 3CXHJ 2MPAL 1MREL 5F7LB 1T21A 3SGEI 2VW4A 1ORSB 3KBFA 1LJMA 1PZAA 4N8CL 5F1IB 4LSDA 4B50A 5AOLA 4P2QB 2WKOF 1B88A 5D7KE 3GDCA 4RBPH 3QT2A 4LEOA 4RGNB 4OF0A 2FQDA 5F6IB 2UXFA 1Z66A 3GZKA 1JRHL 5D4JA 1UQSA 1DANT 4UIMB 2MH4A 5HYQB 1QFPA 4LOUD 2X4SB 3NG5A 4X4MA 4CU7A 1MF2H 1O0VA 4JHWH 1AY1H 2PTUA 3JWDC 4UQEA 4Y2DD 4HK0B 5LN4A 4QRQA 2D2CC 1PZDA 3FQNA 3MNZB 1NZRA 5TFSL 2A74C 3BWAB 1S6NA 3DBXA 3FU7A 3WKMH 4L4TD 3RZWA 4NQDD 4EBQH 4UZGA 2QR0A 1TCRB 2F58L 4APXB 5CCJA 5DD6A 4E9YA 4PJ9A 4ERSH 3ZE1F 5HGAA 1UZ8A 2Q86B 3QO1A 1KSRA 2X44D 1FCGA 1OOWA 4ZYKB 2YXVA 4JGJA 1KLGA 4JFEB 5FUOL 3CAFA 1KLFB 1MCNA 2BVPB 3EGDA 1IAOB 3L9RB 4I4WB 1I82A 5DD1L 5E6SB 5FYKE 3Q5OA 3ZMRA 4M93B 5HGBA 3I85A 2R0ZL 3QPQC 4KI5D 1PZSA 3U4BH 3DO4A 2WXIA 1FGVL 1A9BA 1EZVX 3UAJC 3P0VH 4JS7A 5GRJL 4X7FC 1JGEA 4V1DE 1HSBB 3LOWA 3WLBB 2WLIB 1FL5B 4JJOA 4PJEF 1UACH 3O2VH 1WFIA 4JRXD 4MD0B 4O02H 3NRQA 2X3AA 4XCNB 4ACTA 3G5XA 3CZLA 2KKQA 3TBBA 1KB3A 4IRSB 1K5NB 2Z91B 1E6JH 2A7BA 3L4YA 1ZXQA 1MW2A 1DANU 1DEEB 3BO8B 1I8MB 4MAYD 4JFPA 2Z7ZA 3PGCB 4ZMZA 3MV9B 4HIQA 4CL7A 3MV8E 1EAQA 4Y1SA 3X2QB 4IIQC 1ZKAA 2BP0A 4Z7NE 2DEWX 2VDKL 1H3VA 3FQTB 1MNNA 2YAFA 3WE6B 4KAQL 2A4CA 5BV7H 3PHQA 1IM9A 4I3SL 4JB9L 3D0VA 1IC1A 4Q9QH 1ZHNB 4X99A 3QXDB 2WB1A 4G6FB 5T33L 3RWDA 2YPVH 5DEFA 4FMKA 4HJIA 4HOZA 2HZHA 2MTPA 3H85A 3U0TA 1HXMA 4JRYB 1R5VB 3QEQE 5EBWB 1T03L 1GCFA 3B2PA 4H8WC 2J12B 4KKNA 5FM5O 4FQXD 5IJKA 3T6VA 3TJPA 4DO5A 2B08A 1B0IA 1KGUA 4R0LB 1DDHB 3ZTDC 4ESKA 5D7IF 3J27A 1MZYA 2A9BA 1T0NA 4HXAH 5C9KA 4FJYA 1BYPA 4I5BB 4WY7H 4XR8C 5HD8C 3WIIL 3PPSA 1ZHLB 4XBGA 5J9PA 3TS8A 1VGKB 4X9HA 4XNZB 4ZMAT 1NEUA 2AEOA 2CDGB 1YMHB 5I1HL 5GRUH 2J43A 3E80A 4QF1A 5EU4A 5AENA 1IQWL 1L0PA 5GS0L 4X9YA 3B1UA 5B7MA 1AQDA 4PJBF 4D9RD 4UBDD 3NCCB 2XVLA 5EO0A 4FZ8L 1OT1A 5TD4A 2IH1A 2HA1A 3TH3T 1P7QB 1Q9WA 1R1CA 3LIZL 1DJXA 1SM3H 1RZKC 4NHUB 4C56D 4ZS7H 4IDJH 3W9EB 5I1JL 3DIFB 2BSTB 2PPEA 3DURB 1IL1A 3FB7A 2SEBA 4NO0D 2JKIS 3D51A 2H3KA 3IMVA 4M29A 2G5BB 5F88B 3KLHC 4FF9A 4ZMTA 2FL5A 3MOAL 4OJEH 5J12C 4B97A 1J11A 2JIXB 2ICES 4J6RH 2DQ6A 3GRGA 5DJAA 4Z76A 4E9WA 1GSMA 5I6XC 2GUOA 5AKVA 3P4OB 3D2UA 4RGND 1S78D 1TQBC 3BAYA 3BMWA 3KWXA 3T4AB 2CJ3A 2DS4A 2Y5QA 3WXWH 4ODSH 1MCBA 2CR3A 1KCKA 2OA9A 4OD1H 4WKZA 3Q3GA 2R0KL 1USQA 3SDCC 4I3GA 4XXCC 2UWEA 1MFNA 1FVDB 32C2A 4CBPA 5FK9B 1GIGL 4H25A 3X11B 1FL3B 3HRZA 3L5XL 1KOAA 2R59A 4HGKC 1A7PL 2XUWA 2NNAB 2P80A 3FB5B 3D0LB 4J4PC 4XNUL 3MHZA 3VRJA 5KJRH 4FQQB 3RWJB 2AQ1A 3UBXI 4HSAC 4X4KA 4Y7OC 2DI7A 3OC8A 1HKLH 4OZ4A 2XN9A 1VZHA 4JFED 3W9DB 2VQUA 1A6VL 3V79C 4TULH 1EXUB 3SGJC 4P3CH 1UH3A 4UQDA 4PJFF 5EIIG 3UIZA 3NIFB 5LQBH 5EPMA 2V3DA 4MAZA 4K23L 1H5BC 2HKHH 4K8RD 2NW2A 4PM1A 4G6KL 1NCBL 2JI2A 4Q2ZA 5JIDA 4X8JA 5BUAA 1WT5A 1UZ6F 5FFOA 5EU3A 3MJ6A 5D7JA 1XMEB 3QFDA 1PG7H 3ARRA 5EA0L 2CK0H 4TLUA 3MOQA 4HH9A 5CD3B 1L0QA 2ZOUA 1U93B 2F08A 2ZNXA 3N3EA 3HI1A 3CX2A 1D9KB 3AACA 3WMSA 2VERA 1G7QB 2VMFA 5HHOA 3QZMA 5IG7A 1INEL 3HE6D 1QFWM 3AXHA 4H20H 2FWSA 4X0NA 2HTKD 1PX4A 3UTSA 5C7XL 4IRSD 5JQIB 4MDJA 1KB5H 1MLCA 1NGZA 3AT9A 3VDCA 4NQCE 1PYWA 2ZXBA 1UA3A 3VTMA 3KPRA 4F1SA 5BQ7A 1AP2A 1JPGA 5H2BB 2JLPA 2ZX6A 1YMME 4M1CC 4KKZA 3WMPA 2ICCA 2LW3A 3FRPG 3OGOE 3ZKND 1Q94B 4UB0L 3VNZA 1FI8C 3L7FA 3EFDH 1IC7L 4Z3JA 3TTYA 1T2XA 2WYZA 1DZ0A 4UM9B 4AV4A 1XXFC 3QG7H 5DFVD 4JZJB 2VZUA 3W2DH 1HL4A 3RUGB 1NBYB 5GRXG 2F53E 1XH0A 3EYOA 1FNLA 4U3SB 3TIEA 3HZMA 4F2MA 3GM0A 4EXKA 2A6KB 3JV4B 2G3NA 1FA4A 1U8CA 5DEGA 3O6MH 4L23A 4UAOB 3V9CA 2YMTA 3RWIB 4LSQL 1DUZA 2FWOB 2XQYG 4WFFE 4LU5L 1JZ6A 2P5ED 4Y16D 1OP5K 3T4YB 3CFIC 1I85A 1KBWA 3RPBA 1F6AB 7PCYA 1OCRB 1SBSH 3CK0L 5ELIA 1OK8A 1J86A 4GG8B 4WK4B 3S4SG 2KLTA 4KHXH 1XSKA 3WJMB 2F54D 5GIRA 4IK6A 2Y7NA 3TBTB 1JWUB 4TPRH 3HS8A 4YE0A 4S10A 2GK0A 1IAKB 3OGCA 4JJHA 2DAVA 3PWNB 2OW6A 4G8FA 4MNHA 2ED7A 4FXGC 4NN5C 2M1KA 4HGWB 4R9HA 1BZEA 5DZAA 1VFOA 1KPUA 2CHNA 3MRPA 3QUMA 3E2HB 3FN0L 4HK3J 4N2MA 1OP4A 4O51B 4KWUA 4PR5B 4YZFF 5J4MA 2DIEA 5KSAB 5DVOA 2O6FA 2BWIA 3DA0A 4P5SA 1CLYL 1VADB 3ORJA 1FZMA 1K6QH 4CVXB 2Y23A 5FW6A 4OIBA 1JXKA 4BK4A 5DMYA 4PRBB 1BZ7A 3IBEA 4D9QE 1ZGLB 3F5WA 3IWUA 4UQ2A 1MY5A 1DFBH 3ZIYA 4EZKA 4N1EA 4P3DB 5IMMB 4OZHA 2AQTA 1EAOA 1N3NA 4QJ3B 2WO3B 1MCPH 4HZLB 2BHYA 3MROA 4D2NA 1ONQA 4XZUA 3M8OL 4PH8A 4Q0XH 1T66D 4YO0B 1RFDL 3FU6A 1TU2A 5JMRA 5KTEH 3C5XA 5DQDH 4G9DB 1AHKA 1NMCB 3KBEA 2WB7A 3AY2A 4WFED 2JB5L 1BSIA 1GYAA 4J3VA 1EEQA 2RD0A 1ZVHA 1GHFH 4I1NB 2OMVB 4OV5B 2HT4D 5CZVH 4OTXH 1YPZB 4JZNA 2KL6A 1XF3B 1RK0A 2Y72A 1L9PA 5DJZB 3V10A 1U6AL 3RAJH 1LK2B 4PLJD 3JV6A 2QQQA 3TJHD 2R1YA 1GTFA 2C7UB 4RMWA 3QCVL 2Z4TA 1INDL 1FO0L 4KH2A 3OMZA 4NBYB 2VDPB 5CP3H 3BQUC 4IK7A 4F8PA 3D48R 5EU7C 2WUBH 3GEWB 3DV4B 4OCMC 2CHZA 3P02A 4Y5YC 5D7JD 4ELMB 5BVPL 1B0RB 5FYKU 5L88H 5E4EB 5EOQL 2VR4A 2TRHA 5C3TA 4PB9L 4F33B 5FGSA 3H6AA 1OAZL 5DK2B 5C07B 2QL1A 5JXAH 2BSRA 2IQ9L 2DQIH 1OEZW 5HHOD 3GSQB 1X7SA 1ZMYA 2MNUA 3UJTH 1SLUA 3B83A 4G7YL 3EUUA 4IGBB 1D9KD 1N10A 3H3KA 4HF5H 3RKPA 3EJSA 4YDVA 2Y7QB 5IESL 1UWXH 1WAAE 3VUAA 5KVDH 3IVKA 1DBBH 2FVNA 3GSNA 2WVVA 4OB5L 3QUXB 2F7QA 3PHAA 5E95B 4DN4H 3LKRB 5JIQA 1AGCB 1E5BA 5J6GB 5KBMA 2VL5B 2CGZA 3UPRB 4X8GA 4MDIA 3SKJH 1QR1A 1UT9A 4P2OC 4FERA 1PD1A 4YXLL 3WUWA 4JKPH 3T04D 4PP2B 3MJ9A 3MLRH 4QYOA 4XMXA 5KSVA 1DYZA 1A6UL 4YR6A 4ZSOA 2WNWA 4XNMB 4ZOAA 1IBYA 4WJ5B 1E90A 5ICYB 1E28A 4W1TA 3GMPA 3N42F 4UAHA 3MNWA 2XV6B 4QR7A 1H15B 2AAVA 1XCWA 3OQRA 3LHPL 4IOFC 3GK8L 2YGPA 4K9EH 4K71B 1HH6B 1LD9A 3BVTA 1AHMA 1NBVH 4WU5B 3TU6A 4ZO6A 3HLAB 2FEDC 4JAMB 3OJVC 5DQJB 5HYSB 4A6YB 3RIFF 1E8WA 4FNTA 2Z93A 2NX5A 1YYCA 2GG1A 2R2HA 5A2KH 1KCLA 4J3XA 3CVCA 5T5FA 3NUKA 3QWRA 1PY4A 2X2JA 4MS8C 2BWQA 2J5LC 2Y5TA 1G7MB 4YHZH 2JB6A 4PD4J 1ETJA 4KROB 1W6LA 4JFDE 2Z8SA 1CBVH 3OG6B 1C5CL 3II1A 4PRAA 1KXVA 2WANA 3EHBB 4NQVA 3QRBA 5F7AA 4LL1A 3VFTA 3OMAB 4ZMXA 2X4RB 3EYUH 4MQTB 3PXJA 2YOAA 5EZJA 5IEKB 4GUOA 4HCRA 5B3NA 5J13C 5MENE 4HSQA 3TBWA 4MCYB 4WFHE 5ITBL 4PHXA 2EDJA 1OXYA 5DJYB 3FN3A 3VFMB 3PQYB 3QJHB 1BQSA 1BZ9A 3DBSA 4HQQH 1F11B 2Z92A 4HLEA 1S5HB 4FG6C 4N2HA 5CZXD 3A4AA 1B2WH 1JMZA 2H26A 2NT1A 1MG3C 3A47A 2DBLL 4ODHL 5EZPA 4TNFA 2XZZA 4X6CB 2RCSH 4NQSB 5DC4B 4BFJA 2EDQA 1OAYH 4PJXE 4B9IA 3JYCA 2XOTA 1TJGL 1ACCA 1T1XA 1T20A 1U8MA 2VSDA 3HC0A 4OZGE 2XXGA 1G7LB 3MLZH 4Z7UF 5FW8A 2RTTA 4F8QA 2CDFA 3DI3B 1O75A 3AC0A 3QJZA 1NC4A 4W9LC 4HJUA 5EOCH 1CU4L 1P2CA 3HS9A 3FHEA 2IAMD 1BBJB 1HINL 3CVHL 4N0UB 5I1AB 1CD8A 2AXGA 1IB5A 3QDMA 2WBKA 3GSUB 1E40A 1TITA 1NLDL 1BIIA 4L05A 3QYNA 1A14H 3KEDA 4WUUA 1GMEA 2FEEI 4NUJA 4JGUA 1ZVSA 3BDBA 3RUGF 4ZPTA 3FT1A 1CGVA 2WXMA 3V5HA 3NJMA 3PABB 4GQQA 3EJYC 4KO5A 4WEBL 2AC0A 1NINA 2QPFA 4HKZA 4RQQB 4YQXL 4F80A 5L2KA 1G7JA 2VLRD 2GJ6B 2BZDA 2DEXX 5I71C 4HKJA 1UJ3B 5C07D 3EGXB 5EO9A 1PNCA 4KRPB 3BPLB 4LVNB 3HR5B 4R7NA 3PJSA 4RAVA 3B6SB 3ZYIA 3SDDA 2EUVA 1M7IB 4POZC 2PP7A 4HPYL 2BHUA 2ZWSA 2QVKA 3GS4A 5EEVA 4AEFA 15C8H 2VC2L 3QJSB 1YYLL 4HUCA 4L0PB 4Y88A 2A83A 2BP3A 1DDTA 2FJGA 2FAUA 3MLWH 4QOKE 4YHIA 5B8CB 5T1KD 3VXRE 1AVAA 3WJJC 4BFRA 3MRRA 4IYKA 1D3CA 3FT3B 5IB5A 1OAJA 2OR9L 1JGIA 4OCYH 2F19H 3RVTD 1IGTB 1MPAL 1U3HA 3ZRCC 4K7PY 2NY5C 3GHEL 4Z0XB 1GOGA 3OJDB 3QORA 3V4PL 2X6UA 5DUPL 5C0BE 4M7ZC 4JDEB 1JN6B 1NMBL 5HYJE 4OZHF 1HZHL 1E9PB 5E9DE 4Z7VA 4IQHA 2E27L 2ZUVA 4PMEA 3RIAF 3IFPB 4QTIL 4QUOA 4QHPA 4DK6A 1SXAA 2DLFH 4NB7A 2CKBB 4X0KA 3DUUA 1CTOA 3LVTA 5GS1A 1DLHB 1EGJH 2C3VB 3Q8CA 4QRUA 3S5LB 1GKOA 1VACB 4LKCA 1JERA 1PZ5A 3F7YA 3WFBH 5D7HA 3LZFH 4IRJC 4E0RB 1HDMA 4H7VA 4I0KA 2HJLB 2XYBA 1KT2A 3BHBA 3MA9H 4LP5A 4HLZH 1I7TA 5JYMA 3DX6A 4AZ8B 1BQ5A 3J2PA 4NAQA 2NTSP 4LPTA 1YPZF 2P8MA 3QI9C 4OR1A 3V9EA 3WNNA 5FDYA 1K4CB 3O81A 1QSEE 4GT7A 5BMFL 4B9KC 1DQMH 3T2QA 3V8OA 1OP9A 1KGCD 1NEZG 5IJDC 5B21A 1ASOA 1H8SA 1XF4A 2B59A 3EHBD 3NK3A 2ZPKL 1KJ2A 2Q1EA 4Y1AD 1X4XA 3W56A 5SWQB 4NKOB 3B2UD 5B1JC 5LHDA 3L6FB 1UVQB 2DWEA 1O6TA 3K72A 4XBEL 4LSPL 1U8QB 4FQCH 1JZFA 1HL9A 4LSVL 3CG8A 5E2WH 2NY2B 2HRGA 3IDXH 3W3BA 3MUGA 3KPPB 5FGCE 4IM8A 3HZYA 4WO4C 5JXED 3EYSL 2I60L 3MRCA 1WWAX 2TSBA 3DOSA 5ECJE 2A0LC 4FFWD 4N8VB 4FN0A 1ILSA 1ZLDA 5B4MD 3UGUA 3IAGC 2CHXA 4ZOEA 4X9IA 2XA3A 3UZQB 5AD0B 2AXJA 3SO5A 4LCVA 4PQXA 3I9AA 3ECWA 2FR4A 3VG9B 3BWUF 4BV1A 1VSCA 2FZ3B 2ZXAA 4NRYB 1GC1L 4S0TD 5KW9H 3CVIH 1MF2L 4JHWL 5FFLA 4G7QB 5E1GA 2QSTA 4JO8A 5IROC 3V8CA 3FTSA 5L2KD 1DEDA 3BRDA 4C83B 3WKML 3E6FB 4EBQL 4KPHH 3CSPA 1JYVA 4N24A 5EZOH 1BLNA 1ZS8B 3JT2A 4K7PH 3ZQWA 1S7WA 2P8LA 4CMHC 4DEPC 2XZAH 2XWTB 5IEHA 5F1NA 3GXNA 1MNUH 2OK0L 1MFVA 3A4EA 2RIKA 4Y9FA 1JXJA 3VXSE 4WSGA 2Z8WC 4E5XB 3QZWB 1HH9A 2P1YA 1AYOA 1NAMA 3IT8D 1DJYA 3U4BL 4EI5D 5J1SC 1HEJC 4E9XA 1F1AA 1NGXA 3PHOA 3MBWA 1RZIA 1E9QB 1U3HD 3P0VL 4P57A 1JWSA 3WUWG 4X7TA 4BK5C 2A6IB 1EV2E 3HJEA 4MJ4A 1U2CA 1WJ3A 4N5UA 1FLRH 1HEZB 1JZ8A 2ICWA 4PJ5A 5L8LB 4LEEA 3QUKB 2GC7C 3T3MB 1A7NL 1OM9A 2Z31B 4L3AA 2AF2A 3O2VL 4LCWA 2X4TB 3ULUE 1DVYA 3FUIA 4O02L 4WI0A 1BCIA 2C1PB 3RP1A 3T0WA 5HYFA 5A16B 2X6BA 1E6JL 3WG7B 1HCYA 1OLLA 2ROYA 4G6JH 4LIQH 4NO5A 4W6XB 5FV2A 5JPMC 5HGHB 1NUGA 3DDGA 1VJSA 5JOEA 3A0OA 3IDIB 5DHVH 3HAEA 2W9DL 5CFHA 4HWBH 4IMLA 5BV7L 1WC7B 3GZOA 4PJGB 2XN0A 2E9BA 2XNAB 4UTBA 1E3FA 4J3TA 4Q9QL 5I16A 1DVUA 1KIUA 1WE5A 1S7RB 2VNCA 2YPVL 3QDJB 3Q2LA 4R7VA 1E65A 1KGYE 5FYJH 4CVWA 2YK1H 3D4ZA 4HKXB 5CIPB 1X5FA 5E23A 4WVRA 3VI3E 1IGFH 3WENA 1GPOH 3MRGA 4N9GA 3TEZA 3OHXC 2FT6A 3UTTE 2W0FA 3IMRA 1FZOB 3FB6B 2H47C 3DHMA 4XVUD 3GWJA 3PWPE 5F7BA 5IB4B 2EABA 4QWWD 3WJLA 1WUNT 4AQAA 3NABH 3T0XA 3F3HA 4L3ED 5GS2H 2DYPB 2P8PB 4DHLA 4PEEA 3SE3C 1MAJA 3P4LA 4AQEB 4ABVA 4WY7L 4TVPD 1NCAL 4JZOA 1RY7B 2EC8A 3D33A 3MBXH 4RESB 3WDJA 2YR3A 1R5IB 5GRUL 3VFRA 4O4YH 4FXTA 1BVNP 2KT6A 3L9YA 2PCXA 4PFEA 4U1SB 4PN6A 1JI2A 3MV8A 4RZKA 1BM7A 3O4OB 5T1LD 3BUYB 1B0GA 1Z5LB 3CCHA 2WXQA 2H4EA 5D72H 3WLWD 1SM3L 1F13A 1J48A 2IAAC 4IDJL 1X5YA 4Y5VC 4ZS7L 3H7BB 4NM8H 2C9QA 4XP1H 5A2FA 2CIKA 2NRDA 4KK9D 5EZIL 3KVPA 3CGTA 1W8EA 1NFIA 4DP1X 3V6BR 4M61A 5F89A 4J6RL 4LL4A 1QPXA 3DJZA 1IE4A 1FN4B 2WMPA 3KE0A 3O6FA 5TF0A 3VWJB 1N59A 2V33A 4LDEB 3M46A 1DVXA 1HWGB 1W80A 3HE7C 5GGRB 1E50A 5GRWA 4ODSL 3WXWL 2L3BA 1ZLVK 1WWBX 1SDYA 4OD1L 2ADJA 3GYRA 4K3DH 1FL6A 4YSRA 4XVTH 3TEUA 3VQMA 3D4GA 3ZW3A 5EBGA 4FA8A 1SDAB 1E9OB 4AVIA 1Y6KR 3D39D 3CQFA 3DPBB 4YDJA 2XWJA 1RZ8A 3UP6A 2WIIA 3HBGA 4HS6A 1RJLB 5ICZB 2BJMH 4PJ8B 1FWXA 2H5UA 2CRZA 3GIVB 4MMYB 4MNQD 2H1LM 4QNPF 4JFWA 5D5MA 2H2SC 4PJCB 1UUNA 4HVBA 4I18C 5KJRL 4QY8A 3S35H 2IF7A 2JE8A 3VM7A 1I3GH 1U33A 2OR8A 2BNQD 2AQQA 1Q9OA 2XTJE 2G9KA 1LO0H 4ABUA 4Z7QB 2EP6A 1A5FH 1Q0EA 3P9MB 4JHUA 4P3CL 3CSTA 1BREA 5LQBL 5HTSA 1CO1A 1VF5C 5A7BA 4BKTC 2HKHL 4PB0H 4KITB 1JV2A 2A6DB 4RMQA 3ELAT 5JPNA 1PG7X 4A7SA 4WDIB 2WTRA 4RBPK 1PG7L 1MVUA 2CK0L 5D7LE 4HIIA 5E5UB 4XCCH 3KYOA 12E8H 2NNRA 1P9MA 5IOPB 1M56B 4EN3C 1IEBB 4M6OL 2AABH 2CJTA 1H0DA 2R1XA 1XBDA 1V05A 1AGBB 1ZSDB 3IMSA 4UQAA 2CR0A 4XCEA 4H20L 3T0BA 3U7AA 5LXVA 2YA0A 3BVVA 3GMOA 1TZHA 2I7OA 1FAIL 2OBGA 5CP7A 1KB5L 3S48A 1BMWA 1O5DT 3EYQD 4RAUB 5C08B 5IQ9A 5JIIA 3OKEB 4HWEH 1MRDH 3WFHB 4FFYA 4N86A 1I3RA 2DM4A 3B9VA 3GRWH 1QATA 5MERA 1CPUA 3PDOA 1KN4H 3U9UB 1IAIM 4MKTA 4UYPA 3LEYH 1BD2E 4P46D 4UM8A 3QUYB 4IMKC 4EJ1C 3EFDL 5FOBA 1U2HA 3EO0A 4FJ6A 3MRDB 1GTNA 3QG7L 1I4FB 2ZT9C 3ZHFA 3W2DL 4KRMB 2OX5A 3ZO9A 2XQBH 3VFVA 4UQ9A 1CB4A 1F3JA 5G4OA 2OTPA 4Y4KA 1YO4A 5AVSB 2X1PA 3K0YA 3IFNH 1LILA 2WY3B 3O6ML 5SWZA 2J2ZA 1T2QH 2DYPD 2E4TA 2EJ1A 3ZE2F 4PRHD 4ADJA 1P7HL 4ZMOA 4JW3A 2YSSB 2N1TE 4JEGB 4PJIB 1HVXA 3BYYA 3P2BA 4Y4FB 1ZK5A 1CT8B 2HTLD 3ARBC 3TYGH 1SBSL 3FTXA 1UXWB 3RTQC 4KHXL 1E8XA 4AGOA 4HKBB 3GMNA 2WNXA 2XCMC 1XF5B 5C0RH 5CCGE 2MCMA 2F9BT 1JNHB 4TPRL 4M6ML 5JTWA 5IWLA 4N0RA 5T1JA 5HYIA 1S7QA 3I74A 3MV11 3NFNA 5JQHC 1MVYA 3MTRA 1KMGA 1BWWA 1QFWH 2BVEA 3FOLA 1D5RA 3WCYA 1EHLH 1FDLH 3LPPA 3QJUB 2J25A 4WFGD 3SKOA 4L8SA 3LEXA 4JM2B 3BC9A 5AWNH 4ZUTA 2QQKH 3DVFA 5T1DH 5A2IH 4L4VE 3BT2L 5I76B 4FFVD 1K6QL 1QLFB 2YRLA 3SY0B 2F53A 2G5UA 2VAAA 1A6TB 5DJDA 5CSZA 5FC9A 3WFEL 3AADB 2JJSC 4DP9X 1T7VA 1DQLL 5T8IA 1PPIA 1DFBL 1TTCA 2E59A 5FDWA 1XGPA 5D4QA 2HMID 2NY4C 1MCPL 4K8RH 4Y4HA 1AHWC 1NBZA 1UH4A 2PTTA 4F15B 4YOKA 2G3XA 3LNEA 3BXNA 2DJMA 4M03A 4B9FA 4QHLB 4PBXA 4Q0XL 3RWGA 4WTWA 5KTEL 5DQDL 1T1ZB 2OQJB 2O6CA 3KHOA 3MMEA 3WXVL 1GHFL 2EADA 5CZVL 4OTXL 4WKXA 1ZWIB 1ED3A 3V0DA 1RHHB 2WXRA 4FE9A 4PLNC 1SYVA 1ETB1 1I1FB 1WLHA 3RAJL 4PS4H 1CDGA 2AXHA 3FC8A 2VDRH 4NZTH 1CICD 3DXAE 4QRTA 5JHDE 1QEXA 3SZ6A 5BZWB 2BW5A 3T0EE 4TTGA 1KYUA 2W65A 2XIBA 2WUBL 5FA3A 4XMWA 2PKDA 2APSA 1OT4A 5L88L 2WVUA 5E03A 2I26N 2IBBA 3JZYA 1SHXA 5LAXA 2WXLA 3KWWB 2XDHA 3FU3A 5GRYA 3TZVA 3KXFE 4XVOA 2NLJA 5KSBE 4WV1C 3GO1H 1RERA 5F7DA 5JXAL 2DQIL 2IDQA 5B3JE 1TQTA 2VLKB 2YD9A 4I77H 3SY6A 1SOKA 2WLHA 4HF5L 1RZFH 5C0AA 1C16A 2MQ0A 3QNZB 5KVDL 3ABZA 1DBBL 1G6RB 1S9WA 3EO1A 1XTLA 1QO3A 2X1QA 1QRNB 4DN4L 5C08D 3KLAA 3RVXC 3UBHA 5IMOB 3CNKA 2XXFA 1F6FB 2FEEL 1FBIH 1W72H 3SKJL 2I07A 3RGVA 2YOCA 5CFAA 3VXNB 5BS0B 4JKPL 4C59B 4R4FH 3QUYD 3MLRL 4R7DB 1OW0C 3D07A 3MJWA 2IDFA 4BE6A 4FG0A 4JDVA 3U0PA 2QBWA 2PNDA 3HHMA 4ZUVA 1F4WH 4LDCA 1OT2A 5GGTA 3G5ZB 4HP5A 4U31A 5EC1B 1AO7B 5EIIB 1D5ZB 4NWUH 4PCYA 1RKRA 4TUJB 2JI3A 2WLJA 4K9EL 1NBVL 3AWGA 3BWZA 3C5ZA 3RB7A 3APFA 4ECNA 3D85A 1QSVA 3MBED 1WAAA 4X6BB 4UV7H 3GXUB 3Q2CA 3V6FA 3FDWA 3WHE0 4XNDA 5A43C 2HVKA 2V8LA 3TN0A 3LZRA 5KS9A 3P11H 3FU0A 3JUYA 5LLIC 1IFGA 2QHRH 4WTZG 3IXTA 1AXIB 4E9LA 3ML9A 5DRXB 4ATWA 4YHZL 3TO4C 1IC4H 3HG1D 2X4NA 2ZXQA 2ZOKB 3N40F 3W81A 1CBVL 1OAXH 1UM6H 3LEVH 1ZIBA 3PJNA 1F1GA 3V0JA 4JFTA 2YMOA 1R3HB 2VTFA 3HMWH 4XNBA 1LO4H 4H44C 3OAUH 3QDGA 4OGAC 2J73A 3B43A 4JM2D 3AS0A 3S2AA 4XP5H 4ZXBB 4DW2H 2DI8A 1TNNA 4G8IA 3VGBA 3TBYB 3PGDB 3FRPB 5C9JA 2DDQH 5DYFA 3ATFA 2GTQA 2PLTA 4R84A 4OAWB 2P5PA 2RMNA 4HQQL 4OVUA 1RLWA 4P2QE 1QBBA 4B7LA 3K6SA 5JW4Q 5AKSA 5DU7A 1B2WL 3K0WA 3C6LB 2VDMB 4N2AA 5D2LA 2XPGA 3VXME 2RCSL 5F7EH 4Y9BA 1OAYL 5G2NA 2XTSA 4YDMA 3THMH 1CLZH 3BW9B 5HDLA 2K0RA 4P9HH 1O7SA 4PCSA 4CVUA 3BP4B 5EOCL 4XWOC 3CN3A 2L04A 2NW3B 4H26A 1XB3A 2OMTB 3ZSSA 4ZMLA 4DKTA 5FO8A 2IH3B 3LH2H 3CLEH 3LRHA 1JVOA 4UQ3A 4AGLA 3FQYA 4GSXA 1A14L 1OVZA 2E56A 4JL2A 1FVEB 2OSXA 5I6PA 2UV3A 4TUOA 2EDOA 5T3ZD 1FF5A 1SBBA 5H35A 1SMAA 1J0YA 1JAEA 3X1EA 3IGAA 1X5JA 3IDGA 2A3TA 4MNGB 4QT5A 1UKSA 4CVZA 1AR1D 5AW8B 2GBTA 1J9RA 4LEOB 1S5IH 3STZA 2JI1A 3OJMB 2VZ1A 5C0AD 4UQCA 1A1OA 2YBRA 1UQSB 5DLMH 4DOHB 4ODVL 1EA9C 1SOXA 1YN6A 4EKJA 3SGDI 1DVFA 3GZQA 4EIUA 4EI0A 3CTTA 2VM3A 1KPRA 2G60L 1XTMA 3N41F 4TNGA 3MLWL 3BN9D 4QRQB 5FHBL 4N1HB 3T6XA 2VMJA 3KYKH 1DSFH 4BUGA 3DBXB 4AW7A 4DF9A 3OVUB 1WWWX 2QR0B 3S88H 3U7WH 3QCTH 5DD6B 3F7KA 3DJTA 2V7NA 4OCYL 1ADQH 5HGAB 2F19L 5C6WH 1WZKA 3O4LE 4FTDA 3QO1B 4PLKC 1A7RH 1YEDB 2ATKA 3KPSD 4OKVA 5LG1A 4PI0A 2X05A 3MV9E 4JM2F 4F37F 2IBZX 5F9WB 5DI8A 1KLGB 4W9ZA 2HCZX 3I9IA 3CFMA 2V3EA 5CAYB 3EGSB 4GEJA 2IAND 3EGDB 1J8SA 5GSRA 4ONHB 4LHUD 4FHBD 4JANA 5D70H 3BCDA 3FOMA 5E94A 4BSVA 2AJVH 3HN3A 4PS7A 4JKMA 1AYRA 1A9BB 4PGEA 3G5WA 4H2CA 1DBJH 5SWSA 4JM0A 1AO7D 1X9RA 3ESPA 3C5ZD 2YAOA 1BXVA 1JGEB 1EGJL 3KPMA 1OTSD 3H6JA 4U1KA 3G6JF 4PSRA 3VWKC 2D31A 3IU3A 3PDDA 5HVHB 3WFBL 1ZTXH 3LZFL 4NENA 3T6WA 3MA9L 3G5XB 1DTUA 1ZVNA 2FO8A 4YXKL 4QOKA 4MQXD 1PQZA 3VXRA 4PRDA 3NJVA 4JFPB 4BBWA 25C8H 4FLHA 3AT8A 3EIFA 2MWCA 1I8IB 5C09D 4YIQA 3VSVA 2DWYA 5BNXD 1G87A 1DQML 4F9LC 3GNMH 1I1YA 2BP0B 3QR0A 3ULVC 1T5WB 3OLGA 1LO2H 5I6LA 2LFEA 3KDMA 3PHQB 1IM9B 1J9TA 2OL3A 2BOBB 1KBBA 3D0VB 3PGFH 5DZ9A 5AOJA 5CEYB 4X99B 2WGNB 4U1HA 1ODAA 3RWDB 4QXVA 3IBOA 1GZHA 3CC5A 2CKNA 1M05B 3H2QA 2EQDA 3U0TB 1HXMB 4KNTA 1BXUA 3A67H 5E2VH 2ZE0A 4FQCL 3WNIA 4ETQA 1HQ4A 1DBMH 1JV5B 4MA3B 3IDXL 2QVFB 5AOIA 1RPKA 3QQNA 3QR1A 2W95A 3TBCA 4MCZB 5J1AA 3UG4A 3MV7B 2NUTA 1BAWA 3C6LD 2ENPA 4M7LH 2EXYD 4XNYH 2YRZA 2ZZUT 3B9KA 1VFAB 4XBGB 3VMPA 5J9PB 3FTUA 3V0VA 3WTUA 4X50A 3FQRA 4QF1B 3HMXH 5PAZA 3GSXA 2OXGA 1AQDB 3BIBX 4F58H 4UU9A 1BFVH 5EO0B 4M6NH 3GSNH 4U05A 5KW9L 3CVIL 1Q9WB 4KZEH 4WHTA 3D69A 5D4IA 3QIUD 4JFXA 5IQ7H 5J56B 5AAWC 2XTJC 3V52H 1KBGH 1IL1B 3FB7B 2SEBB 4G7VH 4TUKH 2V8MA 1UHVA 3D3VA 4X7EC 1SRDA 1QAWA 3UP1A 3FHAA 5LCVA 3MJ9H 1GGBH 3LRLA 3NIFE 4K7PL 4MTMA 2F8OA 5EZOL 4HW6A 2A38A 1PD6A 2DM7A 4Z76B 5DJAB 5I23A 2GUOB 5I24A 3D2UB 2XZAL 4ZFOL 2VLME 2VWEC 1ID5I 3ILQC 3S36H 3AUVA 1XD0A 4N68A 1MNUL 4RRPM 4ZUUA 2F74B 4JO1H 4XTRC 3Q3GB 2VB5A 1QW8A 3O41B 1N5AA 4Z6AT 2UWEB 4GG6B 1E5ZA 32C2B 1L9TA 4AYFA 3ZTJG 3TV3H 4JUSA 3IFLH 4H25B 2VITB 3HRZB 3P4NA 5IVXE 1G7HA 4MA8H 2EDKA 4QRPE 2ZCKH 2KQMA 1FLRL 3WN5C 4JREC 4QLRA 4PY7A 2QFPA 2WQWA 1XHHA 1N0LA 2K9UA 5CLXA 3T08A 4HBQA 2JJVA 1E2WA 1OD9A 3FQWA 3OMNB 1PTZA 3H7LA 4OZ4B 4ADIA 4Z3HA 1ZA3A 3QIBD 2MTAA 5I82A 2ARJA 4NO2A 5CCKL 5K93A 5EPMB 2WZ0A 3HC2A 4G6JL 4O2FA 1OF2A 4FQLL 2NW2B 5DJ0B 1SN2A 2NQCA 5A1AA 4Q2ZB 3D30A 4X8JB 4ZTPH 3DRTA 3BVNB 3GMMA 5EU3B 5KUMA 3RKDC 3DVNA 1NIDA 3NCEB 3GMLA 3QFDB 4HWBL 2HLFD 5F9AC 4HH9B 1KYOJ 2KLRA 2QHLA 3HI1B 5FYJL 2ZYSA 1L4IA 3VXSA 2YK1L 4QMEA 3E9UA 2G5RA 1ZT1B 4XN8A 5IBLD 1IGFL 4PJ7F 1I75A 5H37G 5IG7B 1H6FA 3JWNH 4BZ2A 2E7HA 2MJWA 3HB3B 3CXDH 3IRPX 3V4VH 3P2DA 3MJ7B 4MDJB 1U8HA 4WWPA 3HR6A 3FUMA 3QHZL 4NHCH 3MRIA 5AUMB 1PFCA 3FUKA 3CFNA 2CGYA 2OI9B 3NABL 3ZKMD 3SCMC 4KGLA 1C7TA 5BQ7B 3OX8A 1AP2B 1JPGB 5F0LB 3L3GA 3MNMA 2WPGA 3SYPA 1QACA 4ODWA 2B3RA 5HHMD 3S2CA 3MBXL 4U7MA 1Q1JH 4H2AA 1TJHH 1PEWA 1F4AA 2V0AA 3HTLX 3WDHA 4UT9H 3UTPE 1KTJA 2JJUA 2WZAA 3SDAD 1W9XA 4NN6B 3NIGF 1HNFA 4A68A 1BMZA 2BK8A 3EYOB 5FO9A 4FD0A 3GUFA 3HZMB 4X6FA 4HPOH 1IBGH 5FO7B 4F2MB 2VQTA 5FWQA 3B9KD 2EXSA 5D72L 1U8CB 2NY1D 3LD8C 2X88A 4J3OC 5DEGB 1G0XA 1ZOXA 5I74C 4WW2A 4K94H 4HHGA 3NIDB 4NM8L 2R9HC 4XP1L 1DUZB 4I85A 4AUJA 5HGDA 3BP6A 1OCWL 2Z7UA 3FH8A 4YE4H 1YNTA 1U8IB 3AS1A 4NPJA 3VI3A 2B1HH 2CU9A 3OXRA 4PWEA 1G4MA 1UD3A 2YA1A 1AZCA 2Q3XA 3UTTA 1UT1A 1F5WA 1MUJA 4TV3A 1VHPA 5JOFA 1TQCC 2FGWH 1KDIA 4K2UH 3PWPA 4FLSA 5F8QC 1BF8A 3X17A 1N70A 4LXFA 1RZGB 1CK0L 3AQYA 1FZJB 5C0CE 2G0KA 2GK0B 3OGCB 1NWOA 1JF6A 4K3DL 3CHSA 4G8FB 2ZCHH 1P84K 2EDHA 1VRSA 4MNHB 2EDRA 4N2GA 1I31A 3X12B 5IQOA 5ALBH 2EEXA 4PW3A 3C5JA 4R96A 1KPUB 3QUMB 2ZX8A 4G7RB 2V2WB 5I1KH 2BJML 1XH2A 3NFSH 5CGMA 1CYWA 1UT2A 3T0EC 3B2DC 1NEZB 1J12A 1F6LL 1FZMB 2GBUA 4NQEE 3ZKXB 1CQYA 2Z3FA 3CZEA 5CEXB 1BZ7B 4ZJ9A 3S35X 4Z7WA 5E6IB 2WTOA 3B3IA 3F5WB 1CGYA 4WTXA 4JQVA 3S35L 3PIQB 5A6LA 2EE9A 4UQ2B 1IT9H 2V4LA 1LO0L 1N3NB 2XWEA 1A5FL 1P1VA 2GHZA 3L3OC 2ZF9A 3MROB 5ESAA 2YD2A 3JYBA 3T0DA 1ONQB 4I88A 4PB0L 3S5ZA 3CZGA 3CFBA 3N1FC 5E6ZA 1OOAA 3NPSB 2HP4A 1FIEA 3CDZA 3HUJA 1I9EA 3L3KB 3BEVA 3LX9A 5EU6E 2OMUA 3REVB 3S7GA 1G9MH 2P44B 4XCCL 5KVFE 4F7CB 5HPMA 4JZNB 2LFGA 5B38A 2P3YA 1NCNA 2AABL 4OFYA 1FNEA 4LLQA 2OCJA 3VXQB 2JQMA 3LQAC 2R1YB 2YGNA 5ESVA 4IKNA 4F2FA 1OK0A 4FG4A 1ZT4A 1E2VA 1J5HA 4CKQA 2SODB 2RALA 4U3HA 3HLKA 3K6IA 4KTEH 4ZFFA 4AT6A 1MRDL 1NFDF 2ZUUA 1OPGH 2JELL 3GQFA 4HMEA 4NI6A 5AYUH 4TVPH 3GRWL 2EDYA 4P5TC 1KWKA 1EFQA 2BSRB 4HJGA 4L29A 4FQXC 1UWGH 2Z1PA 3HZKB 2L4OA 3LEYL 3NSCA 1CF8H 3KS0J 2YD0A 1MCEA 2O5ZL 3BWSA 2X3CA 2DQDH 4P23C 4YDVB 2D9CA 4GUPA 1GL4B 3IXAA 2XLLA 2UX7A 2WVVB 2WXPA 3ABGA 2XQBL 5EF2A 4LVHC 3DO7A 3I84A 2OTUA 5T1MA 3TPUA 4GRLC 3F12A 2YGOA 3BSGA 3L4WA 3VFPA 3IFNL 3WTTA 3MA7A 1T2QL 1ZD6A 1OKEA 1D6EA 4GIOA 1NSNH 2RFXA 2X9WA 3LIZA 2WXKA 1QR1B 4KKPA 3B7UX 4AGQA 1AGDA 4P5MA 1I8LA 5D4HA 3OKNA 4GXFA 2W60A 4KNUA 5J89A 2Q8AH 5DUJA 3WUWB 2K8MA 3FQXA 2DM2A 2K70A 2VO8A 3TYGL 2P9RA 3C60C 3CFKA 3SBWC 4YR6B 5BO1L 1WDAA 2ZP9A 2EH8L 1M53A 4A2MA 2BIPA 2E7LC 1E28B 3S3CB 3GMPB 3SDCA 4P2YA 3MNWB 5E1QA 4Z7OB 5C0RL 4FQ2H 4LMQI 1WFNA 4NGHH 5FM5M 2I9TA 1N7MH 5I5JA 1QFWL 3FO2B 3MNDA 2VDOB 4ENEC 3H9SB 1EHLL 3FFOA 3IRZA 1FDLL 2RH0A 1LD9B 3PQYE 5CILH 3K1DA 4RGNC 4GG6F 1SJVA 5DRNB 5AWNL 5F6IC 3VI4E 4XNAA 2QQKL 4OU3A 4NZJA 5T1DL 3LXBA 2ZCLH 3EH2A 3QPQD 4GQRA 3SGJA 5KVMC 5C0IB 4UNIA 4N85A 1RU9H 3UAJD 1E30A 1KTRL 3RX9A 4HUNB 1O7DC 3P54A 1AQKH 2OMNA 3RVVC 3FFDA 1TG8A 3C8KA 4JRWA 5DVPA 3OAYK 1U8PA 4NO3A 1THAA 4K8RL 4JPKH 2MFNA 4HIEA 1BMGA 1LXMA 1X6LA 5D93B 4PJHE 5K69A 4DVBA 1AMYA 4OFVA 3AUWB 5EZJB 3I75A 4N2NA 2DW5A 1U92A 2IXQB 4NN7B 2B9BA 3NJLA 4YC2B 3Q2VA 3TBWB 3A22A 3AM8A 4PJAF 1N4XH 1O9ZA 2ZQKA 3CH1B 4AIOA 4A7QA 1PZ3A 1E27B 3N44F 1KEGH 2LAGB 5FKPA 2WLLA 4M93C 2VDNL 4CNIB 1BZ9B 3JT0A 2Z92B 4PS4L 4XN7A 5C8JA 3NACH 4GW4B 2VDRL 1KTDA 4P2AA 3UZEC 3W0WA 1SXSA 3ARGA 4NCC1 1RZJC 2NUPB 3LZLA 1UOLA 4LFHD 1JXFA 4EEEA 1T1XB 3HC0B 4YDIH 3VVWA 4WSJA 3VXTB 3US1A 2BVOA 2CDFB 4JO5A 1NICA 4Q4EA 5G5DB 4S2SB 1JHKH 4O9HH 1P2CB 4ODUB 5KN5A 4M7JH 1TCMA 2Q2LA 4IRSC 4CC4C 1RLBA 3LRMA 1BJ1J 2AXGB 3BGMA 4XWGH 3TCTA 4I77L 2EO1A 3CFDA 5CIPH 1CD0A 1RZFL 2HUHA 4NP9A 1PKQA 4J6IA 3L1FA 3FFCA 3OPZL 2VIRB 5HD8D 4DH2A 5L4FA 2VLJA 2WLNA 4JG5A 4WUUB 4PG9A 2JXMB 1ZVSB 1CBJA 5CCHE 1R24A 2WWOA 3V5HB 3ZKNC 4PRIE 1NGPH 3FYIB 4HKZB 1X6NA 1FFQA 4BFKA 4NZRH 1G7JB 5HJ3A 1FBIL 2ID5A 3FO9A 4R5VA 1KY6A 1W72L 2AV1B 3IJEA 4HKJB 1OE3A 4Q9BA 3VSQA 1PFOA 3QK0A 3MLTA 4TRPH 4JE4B 2AXFA 3LKSA 2VGLM 1JNJA 4R7NB 4EDWH 5ISZE 4NFDA 2H9GA 4RAVB 4R4FL 3DXAA 3SDDB 5JHDA 4R0LC 5GQBA 2VDLB 4NNPH 4FXGA 4G3YL 4MD4A 1VPOH 2E9GA 2QGEA 1VA9A 4OGQC 3O8XA 2ZXDA 2A83B 1F4WL 2FJGB 4YHIB 1V54B 3CBJB 1P5UB 1CMOA 4PVLA 3MRRB 2W38A 1KGJA 3KXFA 4XNZC 3QWNA 4NWUL 2VLLA 4OLYH 1JTPA 3BSHA 5EUOB 3SDXE 1CXLA 3US9A 3X1FA 3SOBH 4EPSA 4NKIL 3IN0A 3MRQB 1ITCA 3VFOA 3MVSA 1KTBA 5TGBA 1ACYL 2DPKA 4Z7WF 1WTGT 3QORB 4G8GD 1PY9A 3CFTA 4HOWA 1FC1A 2G3ZA 3BJ91 4UV7L 4WHDA 2DQJL 1XCQB 1M2VB 4GS7B 1MFAH 4R5TA 4UZSA 3CFJA 3P11L 4HJJH 4Z7VB 5KOMC 2ZKMX 5ESQA 5T3XD 3SD5A 5E99H 2QHRL 3KLDA 1T5XA 4CADA 5CNHA 2EACA 1HHKA 3IKKA 3MLUH 4J4PD 4MMZA 1IC4L 2PWGA 4G9FD 4X0KB 2ESVE 1UM6L 1OAXL 5E8EB 5EN3A 2VJXA 5K9JH 2O6DA 4LOEA 1LO4L 3ZDYF 1QVOA 5EEXA 3HZVB 3U6XS 3UAAA 2PPFA 3DV6A 4ZW7A 4LKCB 1W0VA 1PZ5B 3F7YB 3H54A 4XP5L 4DW2L 5KBDA 1TMQA 3T4AC 2AJ3A 5F9OL 4EUPG 2QZ5A 1HDMB 1WTLA 5I5RA 1KT2B 3BHBB 4P2RE 4JPIB 2DDQL 3DX6B 3BQUA 1LTXA 5ES4B 1OGAE 1LO3L 1XGTB 3P9LA 4JVPA 1KXTA 3GTTA 3TT3H 4UOQA 2VABA 5CEZD 4JCLA 4L1BA 4B9YA 5F7EL 3WHXB 5A7EA 4KMTH 1XF4B 1GVIA 2B59B 2IIJA 5A40E 4KX9A 1KJ2B 3THML 1A2YA 1CLZL 4LPWA 4UDTA 2YN5A 1PGRB 3MODH 1L0XA 4JDZA 3V0EA 4ZQTA 4H0IA 4P9HL 2R0WH 4PLJC 4AKPA 3TJHC 2DWEB 3K72B 1J7VR 1Q0XH 1NMAL 1KJ3H 1E3XA 3FZUC 4X80H 1FCCA 5J6HB 5A2CA 4HLJA 5I1IH 2VM9A 3W0WD 3LH2L 3CLEL 1WHPA 4M1CD 4G8EA 4WGVB 4WK2B 2OMWB 3OHMB 3GHBL 3MUGB 4A1RA 4HT1H 4EN2A 3G6AA 5I1LA 1NAKL 3HZYB 1OSPH 4ALAH 4ZODA 2X5PA 2GCYA 3CC1A 1MLBA 3L1GA 2IJ0C 3MRCB 1VKXA 3DOSB 1GA2A 1GOFA 3II2A 2VJ0A 5I6OA 2R1WB 5F7HA 3PAVA 1D9KC 5DC2A 2XETA 4Q74A 2WOBA 5AL0A 3KEHA 1S5IL 3AROA 3N1GC 1FFPB 2FR4B 1SQMA 2FD6H 4F9PC 3MRLB 4HUUA 5DLML 3KYMA 2C1OA 2Z0BA 2HFEB 3QJFA 2XRAH 2J6EH 4OBRA 4FULA 4D0CA 3VXMA 4U6YA 1A25A 5KANG 5KJ4A 3T3ME 2ICEB 4M4RB 4F7MA 3IETA 2W92A 1W8NA 1DSFL 2HFFA 3IJ7A 3KYKL 5I0WA 4PJDA 1OWRM 5J1TC 1BXXA 4PG2A 5AZ2H 1CLOH 4MHHI 3U7WL 3S88L 3F2LA 1BLNB 2IG2H 4F7PA 3VD1A 2P8LB 1A7RL 1RK1A 4JZJC 3N50A 3WSQH 5IEHB 2VMCA 1WBYB 3KLKA 4BM7A 1A66A 3GBMH 1KIPA 1H6UA 4G72B 2AZAA 3V4LA 1YY8A 1QASA 4PJGE 3TEWA 1HL5A 5FW7A 2KQNA 2BP5M 3OF6A 3APNA 2DJSA 3QDJE 4UAOC 5D70L 5D96B 1NAMB 2AJVL 3ZHKA 4MGXA 4OZIF 4EDXA 2EVFA 1NIAA 1QI3A 2X6VA 3PHOB 1EQWA 2EXWC 2L0DA 4QRSB 4AGPA 5L8KB 2EIMB 4Z7AA 4P57B 1JWSB 3DC0A 4X7TB 1HX0A 5D1QA 3RGBA 2O61A 4F1ZA 2VH5H 2WC7A 4HWNA 4X5XA 2CO6A 3RZCA 2AKRA 5CR8A 1RXLA 3SKNA 5CBEB 3E1ZA 1ZTXL 3GFUA 1YA5A 4Z9KB 4KNQA 1A3RH 3O6KL 5E2JA 1B4LA 1KYAA 4WI0B 4OH2A 4OGZA 3MXWH 3HCVA 3RQ3A 3RWEA 2J1KA 3O11A 8FABA 3M07A 4LT7A 25C8L 4OD2A 3HS0A 3E2HC 2P5WD 5KSAC 4EI6A 4B96A 3O4LA 2DL9A 3HAEB 2GY5A 3TC9A 4AEHH 3GNML 4BELD 3ETBJ 2BERA 4IMLB 1LO2L 1EZUA 4LSSL 1G5AA 2DMKA 5K1JA 4JE0A 3PGFL 1QI5A 1CFSA 1LP9E 4PBVC 3TBVA 2TRYA 5I16B 1KIUB 2XWDA 3VW3H 2H6PA 3BFQG 2V9TA 4M62H 2X1WL 1HKFA 1MAKA 4FEIA 2HN7A 1XWVA 3EZ8A 3VFWA 3A67L 4N9GB 5E2VL 3WL9B 2IO5A 2CA3A 1DBML 5DD3L 1CFMA 1CJYA 3QISA 3IDNA 3CVHA 4OCLC 2CXGA 4Y19D 4V1DB 4FQIH 5T3ZH 1PBYA 3WNLA 2KC0A 4A7GF 4M7LL 1KULA 4KDTC 4XNYL 5E1IA 5D7EA 1LE9A 1H3WM 1I9JH 4U4IA 4AGMA 3UTOA 5CJXC 2PXYA 1MW1A 2FX8H 4FTVD 2WXHA 3ES6B 3VFRB 3HMXL 3BIAX 3KGRA 4NBXB 1X9QA 5DK0A 4F58L 1FGNL 1XIWB 3SKMA 1BFVL 2B4CC 5F3BA 4M6NL 3GSNL 3OBAA 1F45A 3MV8B 3D12B 1KXQA 2W0KA 5I2IA 3GBLA 1B0GB 4P2OD 5E4EC 4Z7NB 4D3CH 4KZEL 3I6KA 3R1GH 1CVSC 4MJIE 1KTLA 2IBGA 3L9BA 4ELKB 5IQ7L 4HV8A 3P77A 3I3DA 2VXTH 3GJEA 4PIBA 3RIFK 2GY7B 3DOIA 1KBGL 3ARFA 4JR9H 5CXPA 2CIKB 4G7VL 4TUKL 3IE9A 1T04A 3K7UA 4BCXA 3MNVA 1ZIAA 5F7NC 4Z7QE 1SY6A 3VYPA 4K5OA 3MJ9L 4IGBC 1NFIB 3T09A 4B3EA 5EUOF 1UD8A 2WXGA 2X2IA 5LDUA 5BJTA 4NKDA 2QPUA 4OJFH 2WMPB 3O6FB 5IVNA 1PSKH 4IOFD 1K3ZA 4PAZA 1DVSA 3QUXC 3EJZC 2YPLA 3MAWA 1MXDA 5GGTH 5E56A 1VEMA 3EOYG 4JO1L 3TVMB 2ADJB 4UTCA 1FL6B 4G43A 3V4PA 2FEDD 2VERN 2FJFA 2JCCF 2B8OT 4K0OA 1U91A 1TJIH 4KI1A 2BZ7A 1MVFA 2XWJB 1FNGA 2CCVA 4YDJB 1YQ2A 4HS6B 4MX7A 4GSUA 4PVMA 3TV3L 3ZKSD 2DQEH 3BWUC 1ZLWK 3IFLL 3WY2A 4MA8L 4MS8D 3QI9B 2ZCKL 2YKLH 4JN1H 4M9OA 5SX5H 3KPTA 5BW7C 3SHSA 43C9B 1F3DH 1FNSH 3BAKA 3L2MA 5E70A 4LL9A 4QY8B 4M8QB 3UL4A 1FHGA 4AXWB 1RSFA 1MIMH 3OTTA 4XN1A 1PX8A 1Q9OB 1RUQH 5C3IA 1MFCH 3QA3A 5DYOA 2A77H 2ADGB 1T3FB 4K71C 4NQQA 1JV2B 4D8PA 2Y6TE 1JIBA 5BRZD 2XY2A 4BFBD 1D5BA 2CGRH 2IQAB 2KPNA 5D7KD 1MVUB 1GW0A 4HIIB 3QJQB 3VACA 3KYOB 4FG6D 2AEWA 3QXVA 2ZOOA 3EDJA 3W5MA 2MOVA 1H0DB 2R1XB 1CI5A 2AQPA 2I9LB 2VDQB 4GKZA 4PVBA 4C55A 3FPYA 4KJWC 4KROC 3MXVL 4XCEB 1ND0A 5B39A 3CXDL 3GMOB 4PJIE 1TZHB 3V4VL 2DN7A 5CP7B 5I8CB 3EHBC 4JFFA 4NHCL 1VERA 4QJ4B 3GJFA 3MCG1 5EU4B 4LOFA 2DKUA 4QRPA 4MZIA 2J72A 4R97B 3AG2B 3FUEA 1I3RB 4XOCA 2J8OA 4DGVH 1EXHA 4ZX3A 5MERB 1NKRA 3PDOB 1NUFA 1QTYT 4JJ5B 4JQXA 2RAMA 4AYMC 1OAUL 2IDCA 3JWNC 3PL6A 1Q1JL 4ODXA 4UM8B 1PJWA 1TJHL 4PV9A 3EO0B 3NJKA 1V7NL 5C0GA 3RJQB 5FOBB 4FA7B 1CFTB 4UT9L 1UFGA 5FYKD 2OMZA 4QHMB 3EJYD 1UKQA 5CLYA 3V5KB 3OL2A 2OX5B 3K4DA 5GGSA 3ZE1E 2JJTC 3VFVB 4LP4A 4N2BA 4HPOL 1IBGL 4OCXH 4Y4KB 4YMPA 3POHA 3ARVA 3QNFA 1RP8A 1J0JA 4MB1A 5EORH 1D5XA 5SWZB 1JPFB 4V1DD 2J2ZB 4K94L 4AM0B 2G4EA 4YDKH 4LLUA 1WA0X 4POZD 4BUQA 4KFMA 4Y89A 4R4BA 2EILB 3ILDA 4LRNH 1ACZA 2X6MA 5DK3A 3JUZA 5E9AA 4H5SA 3LXAA 1MW0A 1KIQB 4NCDA 3RNKA 4XN5A 3WU1A 2BOCA 1P1ZA 3ILPB 2ATPA 4N2OA 2FGWL 2ZOLA 3GMNB 3HA0A 1KN2H 4K2UL 4NP4H 1XIWD 3LXCA 1FSKB 3JSSA 2YXFA 4FCHA 3ISYA 3NFNB 2QKSA 1E6OH 3OXSB 1YMMB 3FOLB 2ZCHL 1VB9A 2Y2WA 3L16A 4YH6A 2I27N 1S9YB 1N19A 2H2PC 5FYJE 1UJ3C 4MZ3A 5ALBL 4MMXA 2FHFA 2FYYA 3DETD 5D1XE 2YD6A 3SKOB 5KYYA 3LEXB 5I19H 1KY7A 2WSPA 3NFSL 4KRPC 1A4CA 3BPLC 3K8MA 4LVNC 5F70A 3SD2A 4ZUTB 5IB3A 4GIAA 1J05A 3QEQD 1A6AB 5LGKA 2WBJB 1QP1A 2F53B 1QMUA 3HG5A 3Q8FA 5KZCD 2VAAB 5M7QA 2DD8H 5EC2A 4JRLA 2DQFA 1IT9L 2FHBA 3UAFA 1A3LH 5B8CC 3JTSA 3OJ2C 2EVGA 1XGPB 4WI7A 3W37A 3DHPA 1XZ0B 4Y4HB 1FVCA 4O02A 4IRJD 3BXNB 3WIFA 3ARXA 4P9MH 1KB9K 2OW7A 3RWGB 1Z3RA 4GBXA 4I0PA 1CVRA 3WFCH 3UBXA 2QSVA 3MLSH 2Q3ZA 4Q14A 3HI5H 2DQTH 1G9ML 3MMEB 3QI9D 2E9IA 1DQIA 4ZAKA 4JRFA 2QT6A 3RDTB 3ATEA 1ED3B 1T1WA 1FORH 3MJGX 4WEMB 5ADOH 1CD9B 3MRBA 5INDA 4QRTB 2YPVA 3FQ2A 2Q6WA 3SE3A 4YPGA 5BS0E 2VKWA 5FA3B 1Z9PA 5CJBA 3B1TA 4KTEL 4NQEA 2ITDA 3I50H 3ARDB 5AYUL 3GKWH 3TZVB 3V55A 1P6WA 5F7DB 3PPEA 3NFPA 2J20A 1UWGL 2DQMA 5KBNC 3B56A 4RFEA 4YHMH 3WYRA 4WO4D 4KI5E 3H9ZA 4E42B 2DQDL 1KFAH 1AGFA 1C16B 3M7OA 1S9WB 3EO1B 3Q8EA 3T65B 1QO3B 1DQJA 4Q9CA 1RZ7H 3L54A 3OKOA 3WNPA 3KLAB 3LKOA 4JGNA 4HXBL 3ZR6A 3HE7B 4FLOA 3OKKA 4HUXA 4TVUA 1JYNA 1XCTA 1BQLH 1NSNL 2I07B 3RGVB 1CR9H 4PGBA 3D1MC 3NGBB 5J5EA 4LCIH 2Q8AL 3ZE0B 2NY2C 4RISH 5IROD 1Q4NX 3S0PA 1TIUA 1GJWA 2XFXB 1OB0A 2JNZA 5IV2A 4JDVB 3U0PB 1XZWA 1ETZB 4ZUVB 1DO5A 3RURA 2J1XA 4NGHL 4XXDB 1TLMA 1T6VN 1N7ML 3CSYA 3P4MA 5H8DA 3VD5A 3BX7C 2AMGA 3KPOA 4LCUA 2CUIA 4NPYA 1L0YA 5FCUH 3IM1A 3Q1SH 4QHNA 5CILL 1EUUA 4I18A 3M88A 4R2GB 2JKTM 3IDJA 1J8HA 4PJFE 3QYMA 2WYHA 4KO7A 3VG9C 3D85B 5GGUB 4APQA 4DO4A 1GJUA 1P4UA 4JFOA 5EF0A 5AZUA 3RBGA 5JORA 1CE1H 3RE0A 2WUCH 1LK3H 1RV6X 3QULA 1RU9L 4QAWA 2HVKB 3TN0B 4YX2H 3F00A 4M02A 5KS9B 1RUMH 3BZFA 1AQKL 2B1AH 3IXTB 1I1AA 3B7YA 4C47A 4ABQA 4XPTH 4IOIA 1AZVA 1IBFA 2FUTA 2X87A 4NQCD 4WENB 5J06A 2X4NB 3WTWA 3NSJA 1J8RA 5H4YA 2WM0A 1SZNA 1A7BA 4JPKL 2APVA 3O6LH 5KYXB 1BFTA 4FFZH 2BY3A 3DK2A 4J3UA 5IQLA 3FCSA 4G83A 1N4XL 3T1FA 1GYCA 5C9JB 5DEZA 3J07A 4B9JA 1KEGL 1J5IA 3C8DA 2GTWA 4N6QA 3S8FB 5I1DA 1OM3H 1J18A 3LKNA 3NACL 3K6SB 4DSYA 3BGFB 2YJQA 1WAEA 2AANA 4Y9EA 3VI4A 4WFFD 4WGWB 2X3BA 5ENWA 1J0HA 4X4ME 3U7YL 1JFQH 1S7SB 3T77A 4YDIL 2Z31C 2N7AA 2CE6A 1KB5A 2W9EH 1BG1A 4HFWA 1P4BH 5EU5B 4HUKB 1JHKL 1EVUA 4O9HL 4M7JL 4H26B 1ET8A 5FAAA 1G6VK 1LE5A 4XWGL 5FO8B 5AB0A 1JPSH 4MWFA 4JFSA 1TTRA 1N8ZA 2Y1VA 2FEJA 2H8PB 4JFDB 2VZVA 3F04A 4UQ3B 4QRFA 3UGEA 4Q9RH 3DDFA 3CZFA 1INQA 4XMPH 4PJHA 1QSFA 5C0JA 3U9WA 2Q87A 4KNSA 1MCLA 3D5OF 4AQ1A 2PUQT 3NBNA 2PPCA 4ONGH 5H35B 3S3DB 3US0A 1NGPL 3E38A 2C9XA 5DT1H 1NOFA 3ARBA 3IGAB 2UY7B 4NZRL 2VR9A 3IDGB 4J3SA 3VDAA 3WKQA 1I8AA 2J8UA 4CVZB 3JWDH 4D9QD 1MWOA 4TRPL 2QTEA 3STZB 4L2LA 4BHUA 3C6SA 4EDWL 5CD5C 2YBRB 5BZDA 1JP5A 4WI4A 1HQRA 2XZQH 5BVJB 1J5OH 4NNPL 1YN6B 2FRGP 2AVFA 4HOXA 1VPOL 4WJG3 4GAJL 1GGUA 3FSVA 4OZGB 3VVVA 4MASA 4W9JC 3G04A 4NYLA 1X5XA 1NFKA 5HJGA 3PV6A 1E0OB 3V9FA 5EEZA 3EH1A 2R69H 2JKNA 4OLYL 5DZNA 1TTGA 3HE7D 4IHBA 2V7NB 1A9VA 2E7DA 1AXTH 4OKVB 4H4NA 2JJSA 3WD5L 2K6ZA 5F71A 5GZNC 4CSPA 5DI8B 1M2OA 4JHAH 2NYYC 3AWEA 3O4OC 1WYJA 3AGVA 1TYRA 1MFAL 5GSRB 1XAKA 4HJJL 4JANB 4URTB 4YUEH 2YUVA 3FOMB 4P06A 2PWFA 2X2YA 3ROOA 2G9HB 3DIVA 1Q1PA 2H2SD 4PGEB 4U6TA 3QXTA 4LCYA 5SWSB 4JO4H 1OHZA 1MJ8L 3BAJA 3NT0A 4W9GC 3NCMA 5K9JL 3AXIA 2IFGA 5ISZA 4U1KB 5GS3A 2D31B 1FV1A 2B0SH 3VWJC 4AH2A 4PRPD 3DHUA 4NENB 4OW6A 3PAZA 4YSPA 3AQXA 1XF1A 1SEBA 4X5WA 4QOKB 1FFOA 5E5RB 1FUNA 4PRDB 3VXRB 3RTLA 1E8ZA 4EE2A 5I75C 2MOGA 4PJ8C 3TT3L 4NSKA 3AREA 4EN3D 4G1MA 4WLCA 3QEGH 2YWZA 1I1YB 4XP6L 2BWDA 4LKXA 5C86A 2OL3B 4KMTL 1MFDH 2PYEA 4H0HB 4KBPA 2XX0A 2Y06L 5CP3A 5C0BB 3JV5A 5BOJA 5FYJU 3MODL 4XOBA 1VAHA 3CC5B 1WEJH 3RY6C 5EH1A 4AEEA 2AMUA 1BVOA 3LDBB 4O5LH 1CXEA 1SVZA 1KJ3L 4JFYA 4X80L 4ETQB 3RFZB 1A7OH 4ABWA 5I1IL 1R4XA 2MCAA 2YUZA 3ZDXB 5GJSH 3V6OA 2ESVA 4G59C 1X9LA 1XSIA 4U6XA 4X7DC 4YBQC 4CJ0A 4U1JA 2FSEA 3BVUA 4HT1L 3V0FA 3W39A 2VZTA 5J1AB 4FNUA 2PW2B 1OSPL 2M2DA 4ZPVA 4ALAL 3HNVH 4XO8A 3UEQA 2NUTB 4AYEC 4CU6A 1SXBA 1NBQA 1REIA 3UTQA 5IFAL 2X0VA 2XJLA 4AJYV 4X5QA 2VRAA 4JY6A 2YAQA 3V0VB 4RH4A 2X4UA 3FQRB 4YN3A 2F6AA 1RZKH 2UWEE 1U58B 2OXGB 3GSXB 1OGAA 3MPCA 4UU9B 1TZIB 2FD6L 4IU3A 4RDQG 4X83A 4E9RA 1Y0LA 1E43A 3FUFA 2XRAL 2J6EL 4FNRA 2F7PA 2HRPH 3NDZE 1KIRA 1M7DA 1IGMH 1R19A 4JFDD 4WHTB 2EXTA 2Y3NA 1NGQH 1HHGA 4C57C 1P4IH 2JKWA 4WFEE 3QFJA 5DLLA 1EHKB 4Z5RA 1FYHB 1QUNA 2BM3A 2XN9E 3RTQD 3MACH 5MEND 1BVZA 4W4NA 5AZ2L 3C9NA 4IKIA 3QUYC 4JQIH 2CLVA 1CLOL 2EECA 4QXTA 4UT7H 1G7IA 3F85A 3VA2C 4WFHD 4D7BA 2IG2L 1DSWA 4H1LG 4NZFA 1F8TH 1CG9A 1RVFL 3CFCH 5GGVY 4OGYL 3HI6H 5D6DC 4IS6A 3WSQL 1QLEB 2DMGA 3GBML 3TO4A 2ZX7A 1MCJA 3DSFL 1OGTA 4B60A 5DZJA 3SEPA 3Q2WA 5JDSA 3VXUA 3PWJA 2ADIB 5T3XH 1G0YR 1M3IA 1ULVA 1GGYA 3BPOB 4G5ZL 3S8WA 2O5XH 5TDOA 5TH2B 1N5AB 4Q56A 1WF5A 2WZ5A 4KJQC 1N64H 4XPAH 2R2BA 5ETUA 2X40A 4AYFB 5HHOE 5FR3A 1UATA 2VDOH 2W88A 3P4NB 4IU2A 4Y4FC 1CF1A 1HXKA 2NY6B 4MA1B 4UOW1 3UTSE 4YL4A 4LLWA 3RPIA 4FXLA 2VH5L 2EE6A 2XI9A 2XXMB 4B27A 4OQTH 3SQRA 1W2KT 5DFWH 4PY7B 2LABA 2UZPA 4XPHH 4MXWH 1N0LB 4JNXA 4KMQA 2HVJA 2Z6FA 1KBPA 4AI7A 3KPRE 2X89A 2ZG1A 3FQWB 2B9AA 1ZA3B 1OHQA 4HCGA 1FC2D 2MEJB 2ARJB 3MXWL 1XGQA 4NO2B 4Z7UE 1K5WA 3LNDA 3NYKA 4O2FB 5HDWA 4LGSB 1OF2B 3U2SA 1JDAA 5C0FB 2BPBA 4GO9A 4JY5H 5CEZH 3SYQA 3DRTB 1WBZA 2R2CA 3GMMB 5AW1B 3DVNB 1F00I 3MO1A 4AEHL 1H3XA 1WV7T 5DQ9B 2GTZA 1ESOA 3U4KA 2FO1A 3ZK0A 1OAKH 5HYSG 1ES0A 4F2ME 4LCCA 2OMYA 3EJUA 1C1EH 3LRGA 3VXSB 3BKMH 2GITA 2CBTA 4M62L 5D1ZB 5JHLH 4GIPD 3HOGA 2QPEB 4KY1H 4TSBL 3NCJH 4F8LA 4F15C 4QTHB 2OSWA 2GJZA 3DYPA 1U8HB 2JKSA 4W6WB 1LM8V 3AXLA 1Y1DA 3IMBA 2CLZA 4W9EC 3W82A 5F93C 2PYED 1QYGH 5ADPH 5T3ZL 2AJSH 4BK8A 1E8YA 2EEBA 4RMUA 4NUGL 1EFXB 4JHZA 2Q8BH 1I9JL 2JK5A 1A4KA 3S5YA 1PX3A 5C0BD 2FX8L 3CFEA 5HYJD 1HCVA 3T8MA 5E9DD 4D0DA 3RVXD 2NDGA 2EDTA 3ZO0A 5FO9B 4HHWA 4X6FB 1U41A 1QZNA 1DL7H 4D3CL 3R1GL 3UC2A 1RPUA 4FHKA 4WW2B 4PJXF 1IV8A 1LP9A 2AERT 1TSHA 4YHNA 4JR9L 5HHQA 1IKNC 1SFHA 2W5PA 3ZT5A 4OZGF 1JZ5A 5HGDB 3VD3A 3BP6B 4BQ8A 2PTVA 4OZHE 5JDJA 2J55A 3VI3B 4Y2OA 1MSPA 5GGVH 3HNSL 4MD5A 4RLDA 3EBHA 3IMTA 1EPFA 1YEEH 3UTTB 1AQHA 4J8QA 4G11A 3UABA 1MUJB 4OJFL 5JOFB 1KZYA 3ETBF 3NK4A 1X5HA 1PSKL 4LBEA 1K3IA 4JFHD 4U0QB 3PWPB 2AJUH 4MBRA 4XNXH 4DP0X 4RWHA 4GMSH 4EUPB 1TLKA 5FECB 5GGTL 1HSAA 2HJFA 1QSED 2XY1A 3N1MC 4ANWA 1G7PA 4BQCA 5I15H 1JD7A 2X38A 2ZOWA 3LXUX 2C9UA 3EO9H 1TJIL 4IHOA 2Z34A 3C5JB 2A2QT 4R96B 1PD0A 2DQEL 3K71A 2A5UA 1V5JA 4ZMQA 1MI5A 4I48A 2YKLL 2KHAA 3IK2A 4LHQB 7CGTA 3TO4D 4OIFA 1FNSL 5DDHB 3B3IB 1HZLA 5AW9B 3F7PC 1EGJA 1MIML 4MJIA 4M8UA 3FMGH 2WVSA 4XCFH 2XICA 3EOBA 1RUQL 1QW9A 1MFCL 5LB1A 2A77L 2WKGA 3RI5F 3HPJA 5ESAB 2B5IB 2C7FA 3O3DB 1UOWA 3QYCA 3UROR 5E2UH 3CFBB 3U79A 4OJAA 5ANMA 5T5NG 4GKSA 3CDZB 4S1RH 3HFMH 2CGRL 3SODB 1RUPH 3TA3B 1F56A 4W9KC 4EIBA 2OMUB 1LMKA 1TZOA 2D0FA 1ILUA 2XG5A 3EW3B 3ENEA 4RMVA 1H3UA 4RMBA 4RGMB 4ICXA 2KDGA 5HPMB 2XBDA 4NERA 3ZPDA 3QPXH 2CXKA 2VDKB 3FK3A 4JKLA 4RA3A 4C8XA 5B38B 1WISA 4BDVA 4U33A 4DETA 1FNEB 2IGLA 4LLQB 3GLZA 3C2AH 2IALA 2EO9A 4UTAA 4OLEA 2ZAHA 1QEWA 3FTGB 1ZT4B 3VFUA 5JHBA 4XWOD 4ZSOE 2NR6C 5EULV 4ZFFB 3AGWA 3PS6A 4W6YB 4ZXBC 3IDYB 3QH3A 4XMUA 4DGVL 2BCKA 1BZ8A 4K3EH 2JFCA 4AVHA 3S5LG 4AYSA 4HJGB 4L29B 4X6DA 2XTJB 3K6OA 1G84A 2LU5A 1Z32X 3FCTA 3IXAB 1BFOB 3C6LC 4Y5XA 3BDXA 1KUMA 5E00A 2EXYC 5EN2A 3LKPA 3QJOA 3R0MA 3U0WH 3OSKA 5E8PA 5T1MB 2NX5E 5IFJA 3TPUB 1WWCA 4RVBA 3TJEH 1JCVA 5EORL 4TVSa 5D7LB 1AS7A 1TENA 1F90L 3CIQA 3ZTCC 3J8F7 4YDKL 1D6EB 3I3BA 2RFXB 1DHKA 4MXQC 1VFBA 4RFNB 1AGDB 4P5MB 4G6MH 1NGWA 4MS6A 4XHJD 5L7XH 1EFXD 4LRNL 3FQXB 2DOCA 1WK0A 2E8YA 2XBZA 3CFKB 3U36A 2VSCA 2ZYHA 6PAZA 3QUZA 5EF1A 4TNWK 5CO1A 2WKOA 3T0VA 1KN2L 4NP4L 5I1CH 3QJRB 1RD6A 4QRRD 1LNUB 5JMOC 4QPEA 2EE2A 2O1AA 4HH8A 4J7RA 3F6IA 3GBDA 4P4KA 5EG6C 3SDYH 2I9TB 4Y1AE 4ZFOA 1E6OL 5I0DA 1ZEAH 1T4KA 1SF5A 1DE4A 5D2NA 2C4XA 1NCDH 2KZBA 1KTKE 1BD2B 4I1PA 3MRFB 2F1EA 4XMKH 4DKEH 4NOFA 3GXDA 5FUZH 1UOVA 4OIIH 3JVGA 1VGEL 4UIKH 4UYQA 5AVQB 1XR9B 4MJ5B 2GIXA 2VISA 1FJ1B 4JKWA 4P99A 1XL4A 1YEHL 1GZPA 2AW2A 3DIDA 2IDSA 4MVBC 1C12A 1OIOA 5JW5B 2DD8L 2YIHA 2QV4A 3DECA 4NCC2 2JF1A 1A3LL 5IMKA 5DO2C 3FFDB 3EYVA 1CGUA 3T3PE 3P3UA 3VWKD 1A1NA 1U8PB 3GMQB 4NO3B 2EVIA 5IR1A 1KCSH 4ELDA 4PJ9C 4RSYA 2JQZA 5FM4A 1FFNA 3T9WA 3QDME 5IMLB 4P9ML 5TDPB 4DVBB 1I7ZA 3I75B 3WFCL 5F9WC 1U92B 2VQ1B 3MLSL 5F1KC 1PAMA 5MEQA 3HI5L 3WKYA 2DQTL 2P7TB 1BPLB 1A64A 5DHVA 3KL5A 4WWKB 1J1PH 2F1AA 3ZQXA 2NXYB 2PCFA 4GNKB 4HIXH 5FKPB 2WLLB 3VGDA 3ULVD 5L2KE 2VXQH 1EEZA 5FS5A 1OCZB 2BNRA 2ZKXA 3II3A 4PJEA 5AFAA 3O9WB 1L3WA 5DURD 5IBUG 5ADOL 5C8JB 5DVNA 3SCMA 4UNUA 3ROLA 4E5XG 3QZWG 3VRLF 5I0YA 2EYSB 3ARGB