2ZWNA

Crystal structure of the novel two-domain type laccase from a metagenome
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
b'AEREFDMTIEEVTIKVAPGLDYKVFGFNGQVPGPLIHVQEGDDVIVNVTNNTSLPHTIHWHGVHQKGTWRSDGVPGVTQQPIEAGDSYTYKFKADRIGTLWYHCHVNVNEHVGVRGMWGPLIVDPKQPLPIEKRVTKDVIMMMSTWESAVADKYGEGGTPMNVADYFSVNAKSFPLTQPLRVKKGDVVKIRFFGAGGGIHAMHSHGHDMLVTHKDGLPLDSPYYADTVLVSPGERYDVIIEADNPGRFIFHDHVDTHVTAGGKHPGGPITVIEYDGVPVDDWYVWKDKDYDPNFFYSESLKQGYGMFDHDGFKGEFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords two-domain type laccase
publication title X-ray structure of a two-domain type laccase: a missing link in the evolution of multi-copper proteins
pubmed doi rcsb
source organism Metagenomes
molecule tags Oxidoreductase
total genus 98
structure length 317
sequence length 317
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zwnA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zwnA02
2XWZA 3T71A 3TASA 2OV0A 1NIFA 1NIBA 1PMYA 4DP2X 3UADA 4DPCX 2UX7A 3WI9A 1KBVA 1NZRA 4DP6X 4AKOA 2J5WA 4P5SA 4YL4A 3QJUB 1V54B 3JTBA 4CSZA 2FTAA 5TK2A 4E9TA 1SHXA 1JVOA 3ABKB 1GS6X 1J9TA 2DYRB 2YAOA 4HAKA 1W6LA 2ZONA 1JXGA 3GXUB 2ZOOA 4DPBX 1URIA 2PCFA 3IEAA 1JZHA 3PPSA 3H4HA 1FA4A 1ZV2A 2PPCA 2VM3A 1JZEA 2W8CA 4BWWA 2B08A 1BXAA 1SF3A 3AG1B 4GP4B 4TXVB 4A2EA 5B3SB 2JXMA 2GBAA 2Y1AA 3WNIA 2XX1A 1BEXA 4YSOA 2FJSA 4FAAB 1ZIAA 1DYZA 1L9RA 4W9ZA 1E5ZA 4A2GA 1CYWA 4AKPA 2VSKB 3GYRA 2TSBA 3CVCA 2XYBA 1A8ZA 1AS8A 1ILUA 3PLYA 3QJQB 3MX0B 2YAPA 4HCIA 3TBCA 2XXGA 1XB6A 4GP5B 2IDQA 4BDVB 3FSWA 1KCWA 1NTDA 3FSZA 3UAEA 2H5UA 1IKOP 3ZDWA 2A3TA 1OE1A 3NSYA 3FPYA 5E9NA 1AANA 2YQBA 3OM3B 2PPEA 3FSVA 4A2DA 2XV3A 3X1BA 1JZGA 1SJMA 4DP1X 4G7QB 3UGEA 4KOBA 1WAEA 4UANA 5I6KA 4DP7X 6PAZA 2XU9A 4BXVA 2J57A 1L9SA 3CG8A 4WKXA 2GIMA 3D12B 3IN0A 4YSEA 4G7SB 1AZRA 2OCCB 2YXWA 4JHVA 2BP0A 1DZ0A 1ASQA 2CAKA 2VM4A 2EILB 2FQGA 4NERA 1JXFA 2IDSA 1PNDA 2I85A 2GB2A 1ET7A 5EHFA 2IDUA 1KV7A 1AZUA 1BYOA 3NSFA 1GW0A 1J9SA 1V10A 3PAUA 2DV6A 4NAJA 1ZIBA 3EH5B 2XUWA 1IBZA 5I5JA 2QT6A 2YAQA 2BP0B 2N0MA 2IH8A 1WS7A 5B7FA 2DY2A 2YXVA 1MDAA 2AFNA 4E9XA 3DKHA 3FSAA 4GP8B 4YSUA 1A3ZA 2PCYA 3FT0A 5B1JA 3X1GA 3QJRB 5I6PA 4FA7B 1KDIA 2UXTA 4JKNA 3L45A 3S3BB 2BP8A 6PCYA 4KO6A 1SF5A 3T6ZA 3T9WA 4F2FA 5I28A 1AZCA 2IAAC 4YSPA 5B7MA 4A2FA 2YAEA 3NSCA 3H4FA 4YSCA 2AZUA 3FU9A 2IH9A 3HEIB 3G5WA 3DTUB 5D4JA 4QKTA 4NB7A 2FQEA 3UACA 5D4IA 3ABMB 4QLWA 2FT6A 1AZBA 2DWTA 4WTQA 2JFCA 2R7EA 1W6WA 3ASNB 2YARA 3T6XA 2BP8B 3ASOB 4N4YB 5F7BA 2CUAA 2PPFA 1SFDA 3AW5A 1NIAA 2BWDA 5I6OA 1ZDQA 3OMIB 1RZQA 4KO9A 1J9QA 3S3CB 4DP8X 1PZAA 1E30A 4AI7A 1MG2C 4YSAA 4KNUA 1A4CA 1R1CA 4HZ1A 1OCZB 1JZJA 5F7AA 1XB3A 2PP7A 1IUZA 3QQXA 2YAFA 1RZPA 2HZHA 4A68A 4AX3A 3ZX1A 4GY4A 2R7EB 2P80A 3AG3B 4G7RB 4E9WA 9PCYA 4BDVA 1AAJA 2FNWA 3ZIYA 4E9QA 3IN2A 5AZUA 5I5MA 2PLTA 4YSTA 1KDJA 5D4HA 5PAZA 1JZFA 2X87A 2W88A 3AG2B 4K9JA 1X9RA 1HFUA 1OOWA 1L9QA 5I6LA 3AZUA 1KYAA 4X4KA 3WG7B 1MG3C 3WNJA 2LLNA 3NJGA 1NIEA 1CC3A 1J9RA 2HLEB 2MRYA 3NYKA 1WA1X 4UF7C 2I7SA 1OE2A 2FT8A 4AKQA 1FWXA 1BAWA 1OCCB 1VLXA 2ZXWB 3UAAA 1JOIA 2JKWA 1NICA 4HIPA 1SDDA 2PPAA 3MBWB 4KNTA 2XX0A 1E67A 3NJLA 1A4BA 4M4RB 1SNRA 2IDTA 5B1BB 1YLBB 2QDVA 3WIAA 4CSPA 4UAHA 5LDUA 1NPNA 3C75A 2BW4A 1ET5A 1RCYA 1CUOA 2YAMA 1OCOB 5A7EA 1NPJA 2XXFA 4F7KA 1ZPUA 1EZLA 2CJ3A 4G71B 1JZIA 1SDDB 5TK4A 2XLLA 5B1AB 2J56A 4W1TA 1E5YA 3ABLB 4HHGA 1J5CA 3RYMA 2Q9OA 1N70A 5B7EA 4BWTA 1PF3A 4N8UA 1B3IA 2EIMB 3SBRA 3FQYA 4EF3A 4DP5X 4A67A 1AOZA 1TEGA 1GYCA 2VN3A 1PAZA 2VW6A 4BK5C 3NJFA 2I7OA 2VW4A 3KW8A 3EF4A 1TU2A 1ADWA 4ENZA 1QHQA 2BW5A 1PLBA 1WA0X 2VSMB 3AG4B 3EH3B 1XMEB 1J5DA 3GDCA 3FYEB 2IWEA 3SQRA 4DPAX 1BQ5A 1IBYA 2HXAA 3WKQA 3CVBA 4A2HA 5I26A 1OCRB 2MTAA 3U25A 1ETJA 1AACA 1T5KA 4P5RA 4PCYA 2RACA 1OV8A 3PAVA 1AIZA 3CDZA 3EHBB 3OMNB 3SBPA 1BYPA 1SFHA 1UATA 1NDTA 2OJ1A 4DP9X 2YAHA 1ZDSA 1E65A 1X9UA 2PP8A 2GHZA 5I6MA 2UX6A 3TBBA 3FU7B 2XVBA 3IBOA 1OF0A 2BHFA 2GI0A 2NRDA 3NJNA 3TU6A 4KNSA 7PCYA 3HB3B 4DP0X 1GY2A 4BXSV 1AG6A 2UXVA 1KGYE 2FT7A 2DYSB 1BXVA 2GSMB 4YSDA 2E86A 3X1NA 3FS9A 3CDZB 2VMJA 1CURA 2IDFA 4A66A 2DWSA 1AQ8A 1PY0A 1MZZA 4E9SA 3SBQA 2Y69B 3PCYA 2UXFA 1SHWA 1PLCA 3S8GB 3T6VA 1EHKB 2EINB 4HCGA 2AZAA 5B1JC 5FC9A 2QPEB 1I53A 3NP4A 4HCFA 4PAZA 7PAZA 1ID2A 2Q5BA 1XB8A 3NJHA 5I6NA 4F2EA 3NJJA 4G70B 3X2QB 2CCWA 2HRHA 4KO5A 3EH4B 3FYIB 1WA2X 3BQVA 4GYBA 4Q8BA 1GS8A 4KOCA 1QLEB 2CALA 4YVUA 3X1FA 3QJVB 2HX8A 2P80D 2FQFA 1JERA 2TSAA 4GXFA 1PNCA 2CBPA 3OMAB 1NWOA 3FPXA 1L9PA 2FWLB 3NJIA 3N55A 1JXDA 3QJSB 3N2JA 4L0PB 2GC7C 3ABGA 3QPKA 1GS7A 3H56A 1WS8A 3AY2A 3TA4D 4KO7A 3UABA 2UXGA 2BZ7A 2HRGA 1QNIA 3KW7A 3NP3A 1GR7A 1KBWA 2IWKA 1N68A 1OE3A 3DIVA 3PAZA 4E9VA 1MZYA 1ASOA 4G72B 2GC4C 1PCSA 2IWFA 8PAZA 1ILSA 1IC0A 1M57B 2AVFA 2H3XC 1W8EA 4YSQA 4Q89A 3FU8A 3S3DB 1NIDA 1V55B 3ERXA 3OD3A 1NWPA 1M9WA 3CZUB 3NJMA 1M56B 4YSRA 2VW7A 2PP9A 3X1EA 1TKWA 4MFHA 5ANHA 2PPDA 1BXUA 2J55A 1PLAA 2XV0A 4BWUA 2ZWNA 2XV2A 4ZK8A 2BO0A 2WSDA 3PXLA 1A65A 1A4AA 1TEFA 1HAWA 3BVDB 1GSKA 4HHWA 2WO3B 1RKRA 3T6WA 3FU7A 4YSSA 1AR1B 1CYXA 1GY1A 1ASPA 2X88A 4HALA 1AS6A 1PZBA 4JHUA 2EIKB 2H47C 1PZCA 3CVDA 3ZBMA 2FQDA 3V9EA 1ET8A 5AFAA 1AZNA 4DP4X 3JT2A 3NJKA 1F56A 2AANA 2QDWA 3WKPA 1BQRA 4YVNA 1FFTB 3OQRA 3FQ2A 2BZCA 4AZUA 3S8FB 2QPDB 5B1KA 5AKRA 2B3IA 4M3HA 4E9YA 1NINA 2HX9A 1AS7A 1JVLA 1BQKA 1KCBA 3NSDA 2EIJB 3QJTB 3NT0A 4E9RA 1HAUA 3FQ1A 2WO2B 2BWIA 4RH4A 1L9OA 1L9TA 3V9CA 5IY5B 3IE9A 2HX7A 5PCYA 5I5IA 1AG0A
chains in the Genus database with same CATH superfamily
1TYJA 4L3AA 3KJ4C 1RUQH 1B0WA 1U8MA 2VABA 3LZLA 2WGXA 3K6NA 3BP5B 4Y5VC 4LAQL 5HD8C 2W9DH 3K2UL 4GB9A 4LCIH 5LLIC 5EU7C 4I2XB 4M93C 3RWJA 4AKOA 2X4RB 3RWCB 3QJFA 5L2KA 4WO0A 3FRPG 4PS3A 1A7QL 1KJVB 1CLOL 3H42L 3MRMB 4LZKA 1WWBX 1A3LH 3MJ8A 3B56A 3SODB 4AMXA 4L37B 4U7MA 3O2VL 3ZKMC 2GY5A 3JVGC 3UTQB 2NPLX 2RFXB 4WWPA 1DZBA 5D7EA 3SSGA 5HYEA 3I2CH 4K8RC 1D2PA 1S4IA 4Z7WE 2EDKA 1A8JH 2OL3L 2H1XA 3QIBB 3T04D 1HI6A 5CUSH 1XIWD 1QBBA 5AKVA 3L5IA 3NGBB 3FQNB 1O75A 2V5RA 3VXSE 1MFEL 1G9ML 5IEKA 4PJBB 2ARWA 1UYWH 4NRYA 1AQKH 2KBGA 3CXDH 4TSBH 4R83A 3MV11 1DBML 4FE9A 4IBLT 3WEBA 1TQVA 3V6OC 3TS8A 2P44B 2OJEB 3RI5K 3ATFA 3CFCL 3L9BA 4Y5YB 1NM4A 5I8OH 4Y4HA 5ESQA 4PP2B 5DFTA 4F33A 4ZFGL 5FB8B 1Z1WA 1U92A 4CN1A 1ADQH 1DVFD 2X4TB 3MOBH 4WW2C 1RURH 4Z0BH 3KNBA 4UMGA 1F6LL 2OR7A 4PJDE 2RR3A 4HJ0D 1IGCL 3X1BA 2JJUA 1F02I 4LLQB 3C6SA 2OYKA 4KRPB 1A3RH 3T4AA 2AQ2A 4J4PC 5C8JB 1XF2A 2OMTA 3KHOA 4UANA 5T3XD 3TO4A 4DP7X 5I6KA 1SOQA 3DIFB 43CAA 4EN3C 2MQGA 2XQYG 1AO7B 1JWSA 3NG5A 3Q5OA 4K9EC 3CG8A 3QWOA 5DFWH 3VB9A 2M2DA 2R0KL 3DJSA 4K7FA 1NDGB 4JHVA 1KZQA 4NHUB 1UWGH 2A6KA 4C4UA 4IS6A 3I9GL 2F7OA 4RWYH 1EEZB 2EYSB 3Q3GB 1V3KA 1IGYB 4JG1L 4D7BA 1AXSB 4Q14A 2WQAA 1U8KB 3HZMB 3HW7A 4AT6B 1XGPA 4ZPVB 2H26A 4MLIA 1GIGH 2XYCA 4GMSH 3WS6A 2AK1L 3WEMA 3UTTE 1GW0A 1VB9A 4OV5A 1J9SA 1MAKA 1XTMA 2DMKA 2P46B 4JJ5B 5BUPA 1AD0A 3GJFB 4JFPA 3U7WL 3NABL 4Y19A 3ZE2F 1XT5A 5I5JA 3A4FA 4Z7AA 3A24A 3QXDA 4JGJA 5I1EH 2N0MA 1WS7A 1M53A 2IIJA 3HZVB 3AUVA 3EG9A 4YPJA 1KYOJ 1BZ8A 2GJ6E 2UY6B 4EVNA 3D05A 3SPVB 5E6SB 3DXAA 3QJRB 3DUUB 4MVBD 4WK4B 1E4XH 2WBXA 4MB3A 4JKNA 5E6RB 1YAIA 3MUZ1 1W72H 5GS2H 1YMMD 2F2HA 2EIDA 3L17A 3DK0A 2AP2A 3E8VA 3US1A 5F9WB 2IAAC 3WD5L 4JO1H 5DEZA 4RGMB 3THMH 3DX2A 5E99H 3LKRA 2XTJC 1MQKL 1PD6A 4GRLA 3SE9L 3MRKB 3TO4C 4GG6E 1USQA 4GRWB 4LASL 4JMXA 4XH2B 5IMMA 2V5MA 3QUMH 1ESOA 2R7EA 3PWNB 5KVFH 3CJJA 4PRPA 5EOCJ 4N4YB 2BXYA 5E03A 4I2XE 2GPZA 1MHHB 5EU4B 3FO1A 4Q6IA 1IAKA 3O3BA 5KS9B 2BWDA 2WYIA 1AP2A 4PJ8A 4POZD 4S1RH 3LHPL 4P5TC 2NY0B 3Q05A 4N22A 2HP4A 3MKKA 4AVIA 2M8XA 4AW7A 4HZ1A 2BHYA 1JZJA 3UX9B 2ZG2A 5L7XL 4P2RD 3U79A 2KLTA 3VFVB 1WK0A 2X6AA 3BKCL 3P77A 4OLEA 4AYSA 4S1QH 1YUHA 4YHLL 3TXAA 1XAUA 5HGHB 5DZNA 3QDGD 4OUUA 2A0LC 2CIKB 3F65A 4NO0B 4PJBE 4U1JA 4YJZL 1OB1B 2AK4A 4WI0B 5BRQA 3SJVD 2BPBA 1Q38A 5EA0L 4FTVB 5I6LA 4I13B 3BVNB 4L1TA 5F3HB 3JZYA 1F18A 2F61A 1A6ZA 4WCYL 3G6AA 4U49A 3V0VA 4QIRA 1AI1H 1BOGA 2BIMA 1T1YA 1FFOB 3ENEA 4PI2A 2H2PC 1WA1X 3BUBA 5AW7B 4ZFOL 2FT8A 3OWEA 1G6RA 2GJZA 3FOMA 2FJUB 2JKWA 3UAAA 5BS0E 5H35B 5IMOB 3U4BL 3B83A 2XN9D 3Q9PA 4N3TA 1WBXA 3LN5B 1VFAB 4XNUL 4B60A 1A4BA 1AO7E 2EDBA 3D3VA 4Q4IA 3D85B 4LSVH 4UCFA 2ZCHL 1XCTA 1FCCA 1ZVSA 3QYNA 2JJSA 1NH6A 3FO0L 4R4NC 4HIIA 5ACLA 2VB5A 3ISYA 4OZ4A 1WIUA 3ROOB 4UAHA 5I0XA 1RCYA 1FJ1A 1T2JA 4C4KO 2CJTA 4PCSA 4P5KB 5I1CH 5LWYL 4S11A 1RZKL 2HJLB 4APXA 1E4WL 3AAZA 3L3JA 1X5GA 4OCRL 4PVBA 7CGTA 3H2PA 2WV3A 3AY4C 1GZHA 3BT2H 3MV9D 1A6AA 1CFSB 1YEKL 2EQDA 2MMXA 4FD0A 3TCLA 1E5YA 2HVBA 1FGVH 1HE8A 5C7ZA 2DQDL 4Z3JA 1Z32X 3TV3L 5D7LB 1J5CA 3SEPA 5DEJA 1KG0B 1XAKA 4IGBA 4PWJA 4BWTA 5LO7A 3B9AA 5HHNB 5BCAA 1XL4A 1GGBH 4YHIA 1CXIA 5F89B 4K15A 1DUZB 5E6YA 3DHUA 4LARL 5HI5D 4YR6B 5CINH 2Q8BL 4JFFD 2NY4D 1ACYL 1RUQL 2YC1A 3V95A 2NYYD 4G6ML 3VFUB 5EULV 1FZJA 1SQMA 2VXVH 3QUZB 5E2TH 3P73A 5EC2A 1XD1A 3W57A 4D9RD 2QSCL 2BW5A 3KYNA 4LCIL 1EHXA 2ITDA 2AXFA 1QYGH 5I19L 3JTTA 3L3IA 2R23A 4PJIA 4MQSB 5DHYA 1CICB 5FA3B 3LZOA 4KFMA 2VKXA 3VWKB 3KPQA 2BP3A 2DWEB 2F53B 2FO4B 2ICCA 2EP6A 4FQ1H 3V6ZB 3JTSB 2IAMB 2MTAA 2ZKXA 3RKDD 4E5XG 1QD0A 2ROYA 1P5UB 4X7FC 5I24A 2QGEA 4AMKL 4F1ZA 4Z7QB 2NR6C 1T5KA 3NEOA 4HUWA 3QIUB 4ZQKB 1MCBA 2RCSH 5JW4M 5KS9E 1KJMA 1BSIA 4OFIA 4DETA 1YAZA 1AQKL 3IBOA 4OSUH 1PAMA 1U21A 5ABAA 3H6AA 1U3NA 3OJVC 4PW4A 1A3QA 4PJCF 5ESVB 1DQIA 5B39A 5KWYC 3OKDA 3ULVC 4DP0X 1EHNA 3NIFF 3TL5A 2VZTA 4XN7A 3R0NA 3O0LA 2AQQA 1KB5L 3RILA 2F5BL 3G5VB 3DVNA 1P4IH 3C5XA 1OCWH 3GGWB 4IGBC 5I8OL 1NOAA 1J10A 4MCYA 3CFIC 5HJ3A 1HS6A 3DTDA 5J06A 2XDHA 4JM0A 4NZTL 4WUKH 1VFOA 4XMVA 4XT1C 2FNBA 4PWEA 4QYOB 2ZX8A 1F1GA 1YQVH 5AZEH 3BZFA 4ZX3A 4LSQH 4ZS6D 4G1MB 4PREB 2YJQA 2XZAH 5HGDB 4XBPA 2EINB 3JWOH 1B4JL 2C9RA 3VXTB 1CFNB 3GHEL 2J88H 3X11B 2I9TB 4EUPH 3MV7D 1UZ8B 4UNVA 4YDLB 3WY1A 4GEJA 5CP7B 5IBTL 3LN9A 1OARL 1HQ4A 2VDNL 1UWGL 4H13C 3C5ZB 4M6AA 4TLKA 5DURB 4Y8DC 3SDCB 4UQ2B 3MXWL 4KO5A 3RL2B 1LNUA 2WWNA 4GYBA 1A47A 1GS8A 2DWDB 3MTRA 1XFPA 3RB7A 1OSEA 1T80A 4WGKA 1DQLL 5CZVH 1FNHA 5GGRA 4WHDA 5DVMA 1JGEB 4XCYB 3ULSA 3NRQA 2G2PA 4PJ6A 4LPWA 4MXQC 5FO7A 3FAXA 5FYJL 3UJIH 3HC3H 2X44D 3QE5A 2WK2A 3LTVA 5F9AC 3VXMB 4DOHE 1UD6A 4P2QA 4YXHL 4L0PB 2E6QA 4HD9A 3ABGA 1R3HB 4Z7OB 2JNZA 1VZHA 4TVPH 4U1SB 1DBAH 4G9DA 3RTQD 4UQ3B 1HIML 1QNIA 1C12A 1MRCL 4DAGH 3BWUC 3UCQA 3T08A 3X3GH 4NUGH 4IJ3B 1K3ZA 4Q7DA 3UDWC 2ZXAA 4QHLB 5E1GA 3U7AA 5CBEA 2CGRH 3FT1A 4YHPB 4KJWD 5DRXA 3EUDA 1BCIA 3DPDA 1S7UB 1OAYH 4GAAA 2H3XC 1FH2A 3THML 5HVFB 4YXKH 3VRJA 5FGCB 1QPXA 4C4BA 3HG0A 4ZW5A 4B96A 4R7NB 4LHUD 5EU6B 4YE4L 4XN1A 3U83A 3UYOD 1EXHA 2ITFA 1FZMB 1UURA 2JE8A 4L8SB 3L7FA 2DJ4A 4P23B 5IM7B 3VSQA 1L5GA 1RERA 1H5BB 4U1NA 2PTTB 4HV8A 1RK7A 5EZLB 3RIKA 1KNOB 4TOYL 3MAWA 2CLRB 1AGCA 4G59C 1RUAL 1A7RH 4QHPA 1E9OB 3R8BB 3EBGA 4JFEA 2DI7A 1HSBA 4F8TA 2QADC 4KK9D 4PRAB 5ALBH 1F4WH 4W9EC 4EJ1C 2EVJA 2WO3B 3P4NA 1A7NL 5IESL 1CYXA 1KEGL 4IMLB 5CEZD 4FP8H 1OAUL 2H1LM 3MBEC 2H47C 2ZOTA 3MKGA 3REVA 4XVUC 5AYUH 1M7IB 1L7TL 3R06A 2YSSB 4G43B 5KVFE 3APNA 2ZOKB 5DT1L 3D06A 3I6GA 3LX9A 1OAKH 5KBDA 1JCKA 3AREA 1GA2A 3K0YA 1AGBB 1RSFA 4ZRGA 3DV6B 1QI3A 4KMTH 3W81A 3B7UX 4X7TA 3AU0A 3WAJA 1OO2A 4JX0A 2E4TA 4OM1H 4KTEH 2Q86B 2JQZA 1E4KA 5DJ8B 4PJ5E 3VI3B 3WFDH 3DHMA 4G6JH 2BS71 4KKPA 5BNXD 4P46B 4XVTH 4Z7UE 3F7YB 3BUYA 4KWUA 1YNTB 4QWWD 4V1DB 2EDTA 4RH4A 1NOLA 3VD3A 3QQ4A 5E0FA 1BG1A 1KV3A 4Y9FA 4Z7NB 3DSFL 5LGYA 4ADIA 2CGYA 3G6JF 3T4YB 2H3NB 3TASA 2AJ3B 1YYMH 3W9DA 2VITA 2JQAA 3GMNB 5L0QB 4LSVL 1IARB 4QTIL 4EUPB 2HFGL 2JMRA 5BZDA 1I9IL 1KBVA 3GUTA 3CFBA 3ZTNL 4OY9A 1UD4A 4FS0A 4YL4A 5EH1A 2P47B 4JFYA 5MENB 3QJHA 4FHKA 4PGDB 4JFWA 5IK3B 1EJFA 5DLML 3OPZL 5GHWL 3RY4A 2ZXBA 3CLFL 3RL1B 1AKJA 3T3PF 1J9TA 4MASA 5F7DB 1TVHB 1BHGA 1W6LA 4YBHA 1QFOA 1Z5LA 2QPUA 4N2NA 3BT2L 4HUNB 4AIZA 3QYCA 5KTEH 3PWJB 3D4YA 2JB6B 4JFHD 5MEPB 5DD0H 3S35L 4XRCB 4UQDA 3M88A 5IHHA 4G8FA 4K3HA 1KLGA 3A21A 3VXME 1FN4B 3WE1A 3ZT7A 2ITCA 4AEIL 3MRFB 4Z7OE 2ZCZA 3ML9A 3AQZA 4IDJH 5A2JH 4XP5L 2CH8A 2G30A 2IOIA 2YD0A 4LSRH 5D6DA 1AS8A 5BW7A 1JV2B 3OSVA 2XXGA 4GKZB 5E2TL 5IHWA 1UJ3A 3MOQA 3WIFB 5KYUB 2IANB 5CJXA 5F0PB 2H5UA 4FQHB 4L0ZA 5HYJD 4FQJH 3ZHDA 2AV7B 5C0RH 5I1LB 4XBEL 5K9KB 1NEUA 4ZNEA 3UL4A 2PPEA 5DJCB 1B2WL 2OP4H 1TENA 5FGCE 4FQ1L 3UGEA 1AQDA 1IT9L 1FO0A 1E27B 2BVQB 2DTSA 1X3DA 2DW5A 2WBJB 5F1SA 1XIWC 1KN4L 5LN4A 1B4RA 2LFGA 2XOTA 2KH2B 1F41A 4KMQA 4QJ5B 1GGYA 4XVOA 1I31A 3TF4A 3JT0A 2VAJA 5H94A 4PMFA 1JXJA 4DN4L 1G9NC 4FULA 3HI1A 3G04B 5HGBB 4ATWA 4IRJB 2WKLA 5GSVA 4C54A 4QJ4B 5CBAA 4OGQC 4PH8A 4JE4B 1DVFC 3MO1B 3CLEH 4HJ0C 5BRZA 4TMPA 2XPZA 1A4KA 4XN4A 3TBVB 5I1DB 2DMCA 2QT6A 5F3BA 3GKWL 1FYHB 2WBWB 2OW6A 4XOCA 5FV2A 3WFEH 1BVZA 2PCYA 3ECWA 4LSQL 4KUZL 5HJGA 5E9DB 3FUMA 3TPUB 5BW7C 5KSVA 2FUQA 2JI3A 3NVQA 3BJ91 1BX2B 2XZAL 2GK2A 2ZD0A 3VI3E 4LCWA 2HFEB 2Y4SA 2ICEC 5CJXC 5CF3A 4JNXA 5CEYA 1RFDL 3NIDB 1FL6A 3BHBB 3V0DA 3P3TA 1MRDH 2A38A 4QOKD 1HQRB 3ET9F 4V1DE 1IEBB 3K7UA 4G8GB 1D5XB 3P2DA 2NCEA 4NJAH 1UEYA 4HWEL 1QLRA 1HEZB 3I9PA 1KGCD 2ADJB 4NO5B 4LRNL 3QDGA 4L3EA 1FL5B 1FDLH 1TTBA 3N0PB 1KSRA 4BFRA 3FFDB 5F7BA 3QAQA 4MJHA 5E8OA 4HT1H 3SJVA 1EHLL 4YPGA 1SFDA 2HYMA 1NIAA 4MVBC 5MENE 3IVKB 5JW4N 4XXDB 4LL4A 5FOBA 1AGEB 4XHQA 5D8JH 1PZAA 1C7TA 1GMIA 3BWAA 4IIQB 4WENB 4Y1SA 4U1IA 5IVXF 3VFSA 3IJ9A 4MWFA 1DBAL 1X5AA 2O5ZH 3JV4B 1XB3A 5KUKA 2XY2A 2YAFA 4ALAL 3HLAA 1QRKA 4A68A 1AY1L 4NJ9L 4ZYKA 3RDTD 2YZ1A 4H20H 4JGMA 5KVDL 1PEZA 1SLVA 4Z3FA 1KULA 2VRKA 4BINA 4KUCD 4MMXC 5HHOD 1Q0YL 4DEPB 4XOBA 2CKBH 4K23H 4PRNB 3BRFA 2VLMD 4L9LB 3RUGA 4FG0A 3EDJA 3IFPB 2P5EB 1E8YA 3ELQA 5CWSB 5EZIH 1M42A 4IEFB 1Q94B 5DJDA 3U0WL 2MHAA 4KH2A 4M4RA 2EIEA 3IS0X 2G75A 3K3QA 4H1LA 4POZC 1MG3C 3TT1L 1R33A 1NIEA 4HX1A 1AH1A 1CC3A 5T8IA 1EK3A 2FAUA 3UC0H 3PFQA 1BVNP 1O7VA 3DDFA 3MRBB 4AKQA 3S0PA 4YWGH 5AOJA 5I1IL 1JOIA 3S96B 3L1OH 4HISA 2JH2A 2Q76A 3D0VA 4C4KT 4A7GA 1BVNT 5IP4A 4UYQA 1S7QB 3WEOA 4CW1B 5B1BB 4AQAA 1AMXA 1FV1A 5IVZB 2P7TB 2OTWA 1TTAA 1WCBA 4NKMA 3D08A 4CSPA 3ULUH 1CTMA 3DVFA 5I1GH 4MNQB 1KCSH 2Z34A 3PV7A 4JK0D 1CUOA 5JHLH 5A7EA 3ZL1A 3MA7A 4ZMZA 4MMZB 1DBBH 2X7LB 3E8UH 4TSCL 5LNEA 3FMGH 4O9HH 2DQUH 1SDDB 1ZWIB 1CFTB 4W1TA 5DJYA 3FTGA 2UWEB 5AVUB 4IBZA 2X1PA 4M5TA 3WN5B 4LQFH 3O6FA 3ARFB 1FPTH 4Z77B 1MJJA 2ENYA 3K6OA 4ZI8A 2EICA 3V5HB 5IF0A 4NUPA 4J8RB 3QUYD 4MB5A 2ZUSA 3D33A 1SM3L 2BC4A 4WVRA 3N1GC 3FT9A 2NXZB 1SY6L 4EDXA 2VM9A 2ZX7A 3US0A 5LB1A 1N2RB 5BO0D 1QSFE 4XWGL 3VW3L 4Y1TA 4UWQB 2C1OB 4H8WH 4FYTA 3NIDE 4B9CA 2YN3A 3EFDH 3OV6A 3EGXB 4KXZH 2OYLA 3GHBH 1J5DA 2ZWKA 4F7PB 3S2AA 2OFQA 4LLUA 2NNAA 2VXQA 3QYMA 4G8GE 1U8IB 2FSDA 3VG0H 4AOFA 4DZBB 4FGMA 3U46B 3WKQA 1WAPA 2HKFL 1W0VB 1HVXA 4GQPH 1FE8L 4MQXD 3RIFK 4D7PA 4X80H 3T6QC 1I7RB 1LL1A 5IV2B 3RWHA 1H3WM 5EFIA 3KVDD 4ZOCA 2BIQA 3CC5B 1NBYA 2J71A 3EHBB 5D5MF 3UMTA 5HI5C 3K6SA 2OZNA 2AXJA 4MJID 1NDTA 3QUXD 3F85A 1Z7JA 2EYRA 2NY4C 3CWGA 2NYYC 2EKJA 2H0FA 2IH1A 2UX6A 1CF1A 3ES6B 5EN2B 2EVHA 4MRBA 1WC7A 1WRFA 5C0CB 4L5FE 4A1RA 4LSRL 4WFGD 3GMQB 3MCLL 4KGLA 5ERWB 1CXKA 5JZ7D 4KZDH 2WANA 3IF1B 2VN5A 3CN2A 4QRRB 1QASA 3FFCD 4ABVA 1Q9LB 3LEVL 1EWHA 4RISH 5BRPA 1QR1B 4NO3B 3RKDC 1HL8A 3TBYB 5JQ6H 1Y0LA 2X1OA 3S7GA 3T0EB 3ZGHA 3H7BA 3IJYB 1IGTA 4DNLA 4RBPH 4E9SA 4B3EA 2ADGA 3B34A 3EH1A 5EBMA 4BZ2L 2C7UB 4W70A 1PLCA 4PYGA 3ZE2B 2XHNA 4R5TA 5CU9A 3WE6A 4UTBL 3VTTA 1EVTC 1SMOA 3LRSA 1IM9A 4PAZA 1VADA 2C9UA 4L1DA 4EI5A 5MP6L 5DS8B 4KX9A 3SKMA 2OI9C 1KPUB 5MI0C 3QDJD 3ZOAA 2E59A 3NSJA 4H88L 1AXTL 2IADB 1LTXA 2IG2L 5IIEB 2XA8L 5FUCE 2XWEA 4GT7A 5J6HA 3WTTA 1N0LA 5DQ9B 4KI5D 2VKWA 1RJZB 3VMPA 1XBRA 1U2YA 2J6EA 5TH2A 1JZ4A 2Y23A 2CUMA 1BVLA 1VEPA 1IILE 2GI7A 5DA4A 1IC7H 4ZS6C 2BVOA 2NTFA 4ZOBA 5F7WC 2K70A 4NM4L 4UOW0 2WTRB 1M3JA 3QPKA 4YEFA 2EXWD 4AWJC 3KPPA 1FIGL 1PG7W 5FKPA 1QBLH 2D0HA 4M5YH 1GZPA 2DTML 4OCXL 1OPOA 4LVOB 5AW5B 3VWJD 1G43A 4FZEH 4ZZKA 2E7DA 5TQ0H 3KHQA 3QARA 4R4FL 4N2BA 3Q7JA 3QUKB 2Q8AL 3L95B 3QJZA 3DX6A 4NKIL 4AH2A 1FFQA 1MCNA 5FYKE 5G4NA 1MRDL 3DVGB 3WTYA 3IT8D 1FNFA 5BV7L 1FLRH 4NJAL 5JIKA 5LBVA 3LXCA 3ETSA 2PP9A 4NRXB 2NUPB 3JWDL 1ZANL 3Q13A 3ARPA 2QQLL 4QY8B 4PJGA 1BXUA 4YNYA 3GEFA 4LBEA 4YDVB 4CDGC 3EO9H 2L7JA 1MW0A 2Z93A 4HH8A 5DZJA 1UVQA 3V2AR 3EDDA 4KZ0A 4NCC1 4GXVL 3RTQC 3PL6B 5ANME 5I76B 4AK1A 1QVOA 3INUH 4QHUB 3TCTA 3C6EA 5AAMA 3T1FB 1RUPL 5CCHE 4BSVA 3FONB 4UOZA 5ITBL 1ASPA 4BD4A 3S2CA 1JNJA 1PZBA 1J1PL 1LDPH 4KJWC 3NACH 4A2LA 3L3OB 1I8KA 3KLAB 5I73C 2KZ1B 1IAII 1CXEA 4H20L 5AFAA 5EF1A 1C8QA 1MW3A 2JK5A 4OT1H 4ZMYA 5KJ7E 1JGLH 3BH9B 2AANA 3IDMA 4N28A 2GABA 5T3ZL 4WW2F 3UG5A 2EXTA 3D0LA 4PRHB 4LPUA 5I75B 1WZKA 4XMZA 4R26L 2B3IA 4HXAL 1TCRB 5C0CE 4JZJB 2Z91A 2EVIA 1IBBA 1XEUA 3W56A 1INQB 1KXQE 4K7PL 3ASWA 4OAWB 2VLRA 4UTCA 1A1NB 2MH4A 3UZEA 4L4VB 3WXVH 3DOSB 1I1YB 3SQBB 4KK9C 1BQLH 2X12A 3ARGB 4QRRE 1THAA 4WEBH 4WO4A 2J25A 2N7SA 1EXGA 2AXGB 1XGQA 4MNHA 2CDFB 5ENWB 2FWOB 3W38A 2KMWA 4JRXD 1HSAB 2X41A 3SDAD 4U7SA 4FCAA 3RVWD 4JVUA 1TLKA 5CMAB 3L1OL 3NZ8A 1UUSA 2Z7ZA 2PW1B 5I74B 3ZE2E 3FTUA 3CFKB 3NFSL 2JELH 4XNZC 1BAFL 1NIFA 4HUCA 2IO5A 4JO8A 4PTUA 1D9KA 3OC5A 2BFVH 4PRBA 3PP4H 1SEBA 3L9YA 2CWRA 3WJLC 1CI5A 5TE7L 2J5WA 4R7DB 4L4TD 2YLHA 3ULUL 4U0QB 3UBXB 1A0QH 4ZAKA 1NC2D 5EU5A 4NUJA 4TKWA 3F58H 3VFPA 2XWJB 5AAMC 4NWTL 4HSQA 4DKTA 2Y2TA 3FMGL 3WIHL 1F45A 1ZHNB 2DQUL 4QWWC 2Y36H 1H8SA 5FF6B 5DYFA 1UKQA 3VM7A 1CE1H 3IEAA 4D0BA 4KKAD 5E0QA 5B4MD 3M7FB 4UYPA 2MCMA 3X3FL 1BXAA 4J3OF 2E76C 3EIFA 3NA9H 3LPOA 5AW6B 2OMYA 5EG6C 4AVKA 2FJSA 2WLZA 4MA3A 4OZIA 4X5WB 3MRRA 3FH8A 3C5SB 5D71H 4ZUSB 4W9ZA 5HPMA 4O2CA 3UBHA 3V0WL 4OJEH 3D25B 3D4ZA 2ZTBA 4JFDB 5I1KH 1OQOA 1G7LB 5A7BA 2FIRT 4IU2B 4HCIA 1A4JA 1KGXA 3CH8A 5C08B 3VXSD 5C2BH 4HAFA 5HHQB 1BIHA 1D6VH 4PGBA 4WFEE 3ZO0A 4NCC2 2PR4L 2R39A 2V37A 4EQ3A 4ETQB 3VA2C 1DCEA 2V2WB 2I5YH 2LQRA 3TFKD 1JPEA 5J1AB 3VYNA 1YYLL 4U6YA 4IHBA 2NOYA 5K9OB 5T1LB 3GJFK 2J57A 3D2TA 2XETA 4HPYL 2EUZA 2GIMA 3Q6GL 3UEQA 5EBLA 4EI6A 1AZRA 1G9HA 1U2HA 1YNKL 4X8XA 5JHBA 4JY4A 4Y5XB 2W07A 4ONOA 2TRHA 1R5IA 1JYNA 3PNWB 3HNVL 4K5OA 4GO8A 4PGCB 2X4NB 3TYGL 3N44F 1OK0A 2APFA 5ILTL 1BZ9A 2AEWA 5IROA 4W9CC 1TPXC 2OTPA 3F5WA 3PAUA 5FHAH 2D8KA 5IB3A 5AKSA 1PEWA 3OGOE 3WOVA 3QZWA 1GC1H 2VR6A 3ISWA 4J12A 2JKNA 4RISL 3G5YB 4JDTH 1WBZA 4HKZA 1TJGL 4N8CH 5HDQL 1OGAB 5JQ6L 2OS7A 3SYPA 3RNKB 4ZXBC 3O8XB 3I02B 3APMA 5E70A 1K2DB 4X5PA 5SWZB 1TVDA 2UXTA 5CCJA 4WV1B 4Q9QH 4BFEA 4LEXH 6PCYA 1L9NA 4KJYA 4BK4A 1LWRA 1BF8A 1NCNA 2A83A 2GJ6D 2QR0A 3GMPA 1OSZA 1CL7H 5D7IA 1MIMH 2R8SL 1D7FA 1BBJA 5B7MA 4A2FA 2V9TA 4YSCA 3STLA 4XBMA 1J1XL 5IMKA 3G5WA 3GPEA 2E8ZA 3N6YA 3BAEH 4P49A 4PB0H 2Z7YA 5CJOH 2XQBH 3BGAA 3OKOB 3MZGB 4QLWA 5B38B 4NT6B 4JAMA 1YDPA 4YHMH 2FIKA 4FQ2L 5T5NF 1UCBL 1H3VA 4NGHL 2X1QA 5IVOA 4F58H 4U3SA 3EOTH 1N6UA 3S3CB 4PG9B 4AY0A 2QKIA 3MA9L 3APFA 1P69B 4S0SD 4DGYL 4JY5H 3MRCB 3SIKA 4ZUUB 2E7BA 3KS0H 5C97A 4F1SA 3G08A 5TQ0L 4OCMC 2HZHA 5AAWA 3MX0A 3G9AB 3IDIB 4GY4A 4RA3A 3GMMA 3Q8BA 4W9FC 2X2UA 1BJ8A 4UT6H 1IAOA 1RIUL 5E5RB 4JL2A 1DHKA 2NDGA 4UM9A 5GGTH 2VH5H 3IYLW 3K4ZA 1ROCA 3O3UN 4UU9B 5CP3A 4OJAA 1ZLDA 1ZLWK 4TNVK 2XQ0A 2OM5A 3FU3A 1NCBH 3H54A 3P54A 3QIBD 4Z6AT 5EDSA 2IC2A 1HHHB 3TN0B 4YZWA 3TBSA 5H4YA 4Q9RL 2B9BA 1S7VA 4JKWA 4WGWB 5CN1A 3EJSA 2Y9RT 5JHDE 1PZ3A 4PJCE 4WHTB 1CFBA 3HMWH 4A7UA 4PIBA 1T1WA 2WC7A 4IOFD 4HK3N 3BUTA 4KX7A 4QAWA 3BYTA 4APQB 2VDMH 4XPFL 1NICA 3RDTC 5CCGE 1S46A 5JNYB 5I15H 2YMXL 1BXXA 3L9RB 1OT2A 1MVUA 3NPZB 3TA3B 1DDHA 1D7CA 2OX5B 3ULVF 5LAPA 1HL5A 2FATL 3M1CA 3CFMA 1IKNA 4I4WB 5EO0A 1I8MA 2BSTA 3QUYA 4AV5A 1DO5A 4KRPD 4LIQL 2QDVA 2F9BT 4CILA 1PZ5A 5EEVA 3AS1A 3ROLA 3LQAC 3QZBA 3NEXA 5F7HA 1AO7D 2YAMA 1OCOB 4MX7B 3AGVA 2IALA 3NN8A 3W0WB 1RSYA 5C0JA 3BH8B 2TRYA 5KSBB 3ESVF 3HNTH 3LXAA 3D2UA 3MLXL 4OZFG 1DJWA 3WXVL 1OP4A 2EEBA 3R1GH 3FQTB 4FFVD 3T3PB 4L18A 5D7JA 5TPWL 4ODTH 5B3NA 1EHAA 3H53A 2P52A 2UZIH 2CLZA 4I89A 1OGAE 5FWRA 2CR6A 4YLBA 4YHYC 3S34L 5J6SA 3LS4H 3VH8A 1JD9A 2IGTA 4GS7B 2CCVA 4MGXA 1S5HB 3RWEB 3CFEB 4XPTH 2CHXA 5SWZE 3TZVB 3W2DL 1NEZB 1YEJL 1NCCL 2JELL 4MJIA 4LSTH 4GUQA 3ZTJG 1EAJA 1EJOL 1QHQA 3LKQA 2FJHA 3ESPA 3DURB 3BDYL 1JHKH 4LVNB 2XZCL 3OXSB 1T22A 2ODIA 3GDCA 2XZQH 4R96A 1N10A 5FO8A 4U31A 2WNWA 1YPZB 1SUHA 4LFHD 4BELD 3BP4A 3ARXA 4KI1A 1QI5A 4A2HA 2Y3NA 4WJG3 4PHXA 2MKLC 3FC8A 4JO2L 3GLEA 4X8JB 2F1AA 1UWYA 5JR1H 4FMVA 4UUJB 3BWUF 3PAVA 1OV8A 3QUYC 3DX3A 4FNUA 4M43H 1AIZA 2ATAA 3GT6A 4E0RA 4NM8H 2C3VA 1PY4A 4LCYA 4QRUB 1EH9A 1QBMH 1R5VB 1ZDSA 4IQHA 3R0MA 4M1DH 3PV6B 4FNLH 2XY1A 3ZE0B 4WEEA 2MOVA 3VNZA 1EEQA 4N2KA 5I1KL 2XXCB 2Q2LA 3GC3A 2FH8A 3PWLB 4G8AC 4Q2ZB 2GHWB 2NY0D 2W9LA 5K1JA 3X1NA 4ODVH 2OKMA 3FS9A 3EJTA 3CDZB 2I32A 1JMZA 5TDOA 1I3RB 4MQXC 2Q3AA 2YPLA 3FH5A 3QH3A 2CRYA 1J7VR 1V5JA 3B8SA 1KYDA 1T7ZA 5I1HL 4C57C 4NC2B 4KTDL 2FJGA 3QUXC 3T8VA 1J5HA 4H4NA 3S35X 3M86A 3GBNL 4WK2B 1MHCB 2E3VA 1V3MA 4NO0D 4P57B 4P9HH 4Y9CA 1EAQA 3R7QA 1WFTA 4FTVD 2B20A 4BZYA 2CXGA 5JZ7C 1JN6B 1KC5H 1IFHH 3EBIA 4XCCL 2OXGA 1XXDC 3NFNA 2DQGH 4MQ7A 5AG8A 3WMQA 3IDNA 4WTXA 1PQZA 3LQMA 3E6FA 4FG2A 1JERA 2TSAA 3S37H 1SYVA 1N19A 2MPVA 2EADA 1NWOA 1UASA 2BNQE 1DVXA 1ICTA 4M00A 2AJZB 3F7PC 1IGFH 2R9HD 1HH9A 4LF3B 3IKKA 2V9UA 4P06A 1SHMA 1C1EH 2QLYA 3D85D 3W0WE 2J8UA 1CFQB 1ZY9A 3UCRA 2F5AL 5KSBE 1MUJB 1FF5A 3SO3C 4GSDH 2W0FA 3FDWA 4K94L 1BWWA 5HYSG 4ZFOB 3CZGA 1K85A 3T3PE 1JDCA 3T0WA 4FKEA 4G72B 5C0ND 1K4CA 2IGLA 3BAJA 4CBPA 5GJSL 1J0HA 1YY8A 4U1KB 4KI5C 4LKCA 2YEZB 5J7CC 4HCRA 1B0IA 5E6IB 5GZNA 5EF0A 4Q89A 4N1EA 4D3CL 4WJ5B 3S3DB 3DGGA 5D7LD 3BAEL 2QFRA 4PB0L 4Y88A 4J2XA 4YIQB 4YN3A 1RZ8A 4OKVB 4FFZA 4ELDA 4RIRB 1SEQL 1UT1A 4D9QD 4NCDA 1D6EB 1ZE3H 4MB1A 4BCZA 1ZHKA 2I07A 1J05A 2J8OA 2A6JA 2EXWC 4AITA 3MLSL 3PREA 1F97A 1CLYH 5KOVC 1NAMH 4MKMA 2B4CC 2WD0A 2GEQA 4I3SH 3VWJC 4F58L 2NY1B 3F7QA 4XO4A 4AYFB 4UTAH 2BO0A 4CN6A 1OF2B 2VUOA 2Z1PA 1VGEH 2HFFB 3GZKA 4GAGH 4JO5A 4QHMB 4WWKB 3ZIMA 2JKRM 1O0VA 4LVHB 4CC1A 3D39B 2FX8H 5LAXA 4N0RA 4WFFE 4JHUA 3HHSB 2V7HB 3TEZA 1CICD 1CGYA 3JV0A 2ZUXA 2G2RB 2D0GA 3RWGB 3VWKD 4EZLA 1T5WB 3PUCA 2F53D 1M05B 3SDAA 1S7RA 5HHXL 3MFFB 1PSKH 2C4XA 2IAMD 4NIKB 4K3DH 3O2WL 5GGTL 1MAMH 1NLDL 1QHOA 3FOLA 4KQ3H 2ZXCA 3ZE0E 2AHIA 5B1KA 4U1HB 3L08A 1VFMA 1HYSD 3QIUD 3BKYH 1ORQA 5ICYB 3PWVB 5DC9B 3QO1A 5E08H 2P5PA 2QGCA 3GMLB 3QUHA 3DYPA 1VJSA 1MDTA 5DVKA 1H0DB 2G3ZA 4YXLH 4LRIA 4KK8D 4XCNB 5F0JB 1ZS8B 1BQKA 4NZFA 1NC2A 3FUJA 3W11D 5I1JL 2AMUA 4OJFH 2VQ1A 3KBEA 15C8H 3TIDA 3U30C 4ZW3A 3U6RA 3HAEB 4H2AA 4UINL 4JDZA 3RPIB 1X7QA 5CJQH 5IEHA 1C8PA 5F21B 5IY5B 2E27H 2HX7A 4M7KL 4EE2A 3EFFA 1LLAA 5GGVL 4OV6F 3EBAA 1ZA6B 2QMJA 3VXOA 2PTVA 2Z92B 5CLTA 1SOSA 4WU5A 3B2VL 5C0DA 4NKOB 4YMPA 1FVCA 1BIIB 1T2XA 3HG2A 3OHXB 4HU2A 3UIYA 1XSIA 1QA9B 4H5SA 5JPMB 3S3JA 3DX8B 3JTBA 1CO1A 4Z7IA 4K8RH 4X98B 3VXNA 4NZRL 4Z0XA 3I84A 3PHSA 3P9WB 4KGJA 5EUKA 1XR8B 3WXWL 5DURD 1DUYB 1BZ7B 2WCPA 3C5ZD 5ESAA 4R6UA 4NPKA 2HLFD 1T0MB 4JM2A 1TETL 3SDCD 5CR8A 1VERA 1WO2A 5F7YC 3VXUB 1UZGA 3SDAC 1KPRB 2P26A 4KZEL 3AG1B 3RVWC 3V6BR 4ODTL 2O61B 2W92A 2HAZA 1G7JB 2CJUH 2O5XH 1B0GA 1T5XB 1NGPL 2YOAA 3BPLC 1E5ZA 3L3GA 2R2BB 2IWGA 1PD1A 2AJUH 3CX5K 1FRGH 5L4IA 4PJDA 1R0AH 3IGAA 1LO5B 3S48A 3TIEB 4TUJA 3QVAA 3ZU8A 3CVCA 1QHPA 1ILUA 4QCIB 4PV1C 3VXMD 3BGMA 5E5UB 3GRWA 4QKXB 1MCWM 4J3TA 3RFRA 5GJTL 1J8SA 5IVXE 2L7EA 3D87B 2EE9A 2F7QA 3I6KA 3O6KL 3QNZB 1JHKL 4YFDB 4Z78B 5E9NA 2F1EA 3EYUL 1K8DA 3D4CA 4N0CD 3L5WB 4K9EH 4KKAC 1TQTA 3B7YA 1ORSB 3HCVA 5B4MC 4J3SA 2XZZA 3QEGL 8FABB 1KBGH 5B3JF 4CADB 1LEIA 5A16B 1A9BB 5EIVA 2GFBB 1U8HB 3DROB 4IBSA 3O3DA 4OFVA 1JDDA 1L9SA 3UTTA 5EEXA 4YSEA 3LPPA 2K3HA 1BQHA 3WDHA 1KIRB 4BH7B 1ZVYA 3SGJC 2XTLA 5EU6D 3ZSSA 3WNMA 3OZKA 4LNRA 4DKAA 2XFXB 4NERA 1RUKL 4P23D 3VD9A 2A6IA 3EGSA 2R69H 2J5LC 3D39E 1MLCA 1T03L 3P0YH 1YECL 3GSVB 3TNNB 5JW5A 1A1OA 2DMBA 4N5UA 2MEJB 3KM1A 5CILH 3TFKC 1KTKE 3QFDA 1SZNA 2OMWB 3LD8C 2DV6A 4DGIH 3EH5B 4ODVL 2OMBA 3F7VA 4RMWA 5E7FA 3UO1L 3B7TA 4HKBA 1KJ2H 3G5XA 4AGLA 4W68A 1O6SB 4JEGB 5LBSA 4J3OH 4M7ZB 4QRQA 1KDIA 1KTJA 3MNVB 4TSAH 4WNQB 2AEQH 4HQQH 2HMID 4GG6A 2NY2B 2EE0A 3ZRSA 5FGSA 1XQ4A 3P0VH 1P7QA 1IB5A 1AD9B 3V55A 2CO7A 4JHWH 2IEPA 3BGFC 3MACL 3BP5A 4OCSH 2YD5A 2N59A 4YSPA 4I2XA 4X6DF 3RWCA 2CZNA 3UH8A 2EXSA 1UWEH 1QTSA 2BIPA 2LU4A 1LEKA 3VFRA 3QA3B 3HEIB 3IFLH 1JGVL 1KJVA 1E6OH 2DBJA 3MRMA 4AQ8A 4HUXA 5I30H 5IWLA 2ESVB 3ESOA 1JGIA 4P46D 2N7BA 5D4IA 2WOBA 4L37A 4OLXH 2CR3A 3JZ7A 4V1DD 5E4IA 4AMWA 3GIVA 1W6WA 2LU5A 1DFBL 1NCHA 2RFXA 4NZUL 3T6XA 1RK0B 3HBGA 1FUNA 1OD7A 4RDQG 1G4RA 2QKSA 2ZXDA 2IF7A 1N0XH 3BKJH 5I8EB 4X7CC 3N43F 5I6OA 3QIBA 1TYRA 1RZFH 1DE4A 3EUUA 4HUUB 1A4CA 4GW4B 1HINH 3V4VL 2XVLA 4PJBA 3TH4T 1T7VA 1QLFA 4YQXH 1R5WB 3QQXA 5MEND 3GXTA 3K4AA 4AXWB 4OIFA 3VXUE 4NKDA 2CJSA 4I77H 4RETB 2NY6B 2Y25A 4Z7VA 3CX5J 3N9GL 3K6DA 3RI5F 4U6XB 3V4PL 3MYZA 2MIZA 5FB8A 2ZX9A 4JKPL 1H6FA 3D9AL 3OZ9L 5AVZB 5EWIL 5D5ME 1EGJL 5BS0A 1MQ8A 2WWKO 4J3VA 1CDBA 1JVKA 4B5EA 3DO7B 3P3SA 4I9XA 2YPKB 3CAFA 3DIFA 1WFUA 3GSXA 4N2CA 3VB8A 4HUMB 3VFMB 2CMRH 2CO3A 3QNXB 5I0YA 3TV8A 3SKNB 3KBHE 3O4OB 4QXGL 3D07A 5E8PB 1QWHA 2X53A 4Q9BA 5GIRB 1BAWA 2EYSA 4LLWB 5FKAB 1AXSA 2F19L 1FNSH 1ED3A 4FQLL 2FX8L 1OGTB 2E9WA 4AT6A 4MA7H 1N7ML 5F97E 5GRUL 1UGKA 4IK6A 2ED7A 4QXTB 3UMNA 5ITFB 3WL9B 5LXGH 1PFOA 2J4WL 4JJ5A 1A2YA 3BMVA 4PEEA 4X6FB 3U9PL 3QIBC 5DQDL 2WBJD 1NPNA 1CDHA 1NCIA 2ZP0T 3C75A 4K3DL 4RQQA 3NGBC 4G80A 1HHIB 2B0SL 4PGJA 1R34A 2HT3D 1EZLA 3HZVA 1MWAA 4G9FB 5K39B 4X99B 4PVLA 3SPVA 2XFGB 4XCEB 2EKSB 2O6EA 1G7IB 2YGQA 4IOFC 1W91A 1OAXL 2B16A 5KOMC 5AB0A 5LN8A 1OP5K 1ZLVK 3IGUA 7TAAA 3GSNA 4Y5YC 4IRJD 1CGSH 4BFIB 3VU2A 4JREB 4AEHH 4D8PB 4H0GA 3FN9A 4TUOB 1O7DC 3FQYA 3MGOA 5FFOA 5E1AB 1NJ9B 6FABH 4KRPC 3LRGA 3IAGC 2QVKA 3N06B 2VW4A 2B1OA 1YEIH 5HVHC 1HN1A 3MR9B 4XH2A 3KGUA 1SN5A 4U1MB 1WA0X 4K5PA 5E9DD 5D1XB 4GIPD 2CUHA 5SWSB 4GKOA 1II4E 3F7LA 4MJ5B 3EZJB 5D70L 1CDIA 1YEEL 4AYMC 5ICUA 2AKRB 2L8AA 1HHGB 4FFVC 4K7PX 4MD0A 5EZJB 4HZLA 4CJ1A 3ALPA 5G4MA 5GPRA 1OAZH 3MLVL 5DD5H 5JPNA 1T89C 3FTZA 3U0PB 5E8NA 4LLVB 3VFVA 3PGFL 3V4UH 4G8GD 2GITA 1TJXA 2EEAA 2E0PA 4UQEA 1G1CA 1WIOA 4LP5A 4UINH 3HR5A 3X13B 3BIKB 4UQBA 3ULVH 5FYLL 2O5XL 3B7SA 1IJ9A 5E6UB 1IQWH 3UYRH 3ZZLA 1WUNT 1WPCA 4ILDA 4NN7B 2CIKA 3CQQA 4LSUL 5E2VL 3GDBA 1WD9A 2R1YB 2IQAA 1GY2A 5ALCL 1OVZA 4XXWA 5F72S 3VTAA 1JZ8A 1GCYA 3O6LL 1OLZA 5F0MB 4GO6B 3SY0B 3BVNA 3ATDA 1OTSD 5BZWB 4YHOL 1B6DA 5AVXB 4C56E 2ZSWA 2GYSA 1ETZB 3EKCA 5F9WC 4F8PA 1L7IH 3FQXA 1ZA3A 4ANXA 3HJEA 1PYWB 4PFEA 4RGMC 2EO7A 4K9EL 1ADQA 3B5HA 2Q6WB 2NY5L 5D6CB 1H8LA 1CXFA 5MERB 2B59B 3QHTC 5H35A 3CHSA 1SMDA 5GGSY 2DWYA 4XODA 1W2KT 2AZAA 2AJSL 1CYGA 2PYEB 4TLUA 3C5JB 7PAZA 4XB8A 4KXDA 2P5ED 3D85A 1WH0A 2JCCB 3PRZA 3GLDA 3NJJA 4QHNB 4YFLI 1K8IA 5T1JA 4LOEA 1R3JB 3NQIA 3BQVA 3QZMA 4Q8BA 2NY0C 2O5YL 1RIVL 4P5KA 5EIIB 4ELMF 4GINA 4S1DD 3P0YL 1V27A 5TQ2H 1F4XL 1TMQA 2EYTB 2K78A 1F00I 4B3VA 2E9GA 25C8H 1I7UA 2V3EA 3CMOL 1CFSA 1XGTB 3N91A 1CVRA 4DGIL 5IGXH 3NDZE 5DO2D 1JXDA 4WSGA 1YN6B 1NCDH 3P4OA 2FEEI 2HKAA 2CLVB 1KJ2L 5I8CB 3OAZH 4G9FE 1DUZA 4KKQA 2G5RA 4OZGF 2UXGA 4O5LH 4XXWC 4HK0A 4ZOAA 3NP3A 1HX0A 4PUBH 2FYYA 3FULA 3O6MH 1TQCB 4N85A 1ZSDB 2OQJB 4MNQD 2BIOA 1OE3A 4JJHA 4QNPE 2YPVH 2GBTA 1W72A 4XMXA 2R0ZL 2GC4C 4MCZA 1ILSA 1NFDF 3FZUD 1W0YT 1Z3GH 4GQ9H 3L16A 1JHTA 1M71A 4CA4A 4YSQA 3II3A 3WFBH 1Q1JH 1JK8B 1LQSR 3OD3A 3VWKA 2F8OA 1M9WA 5LGHL 3NJMA 1U8JA 3ARFD 5FYKD 4JPQA 4NO2A 4LU5H 5ACZA 3JTSA 2R9HC 4G8EB 1IE4A 2PPDA 5DK2B 2XTJE 1JNHA 4F24A 1PLAA 1S9VB 4JDVA 1BLNA 3QUMA 2OXHB 3KR3H 3HBQA 3ME0B 2VL4A 5INDA 3MOAH 2NXZD 5J4MA 4TL4A 3WLWD 5FFLA 4GRMB 2BNRA 2E56A 4R90L 4Z9KB 1PKQB 2Y7NA 4YQXL 1GY1A 5C0NC 3Q06A 2QLVB 4L23A 4X5QA 1N64H 2V5TA 3QPXL 4LDEB 1CXLA 1QO3A 1IAIM 5FGBA 3FRPB 3QRGL 4GW1B 4DH2A 4PJ5A 3NRPA 1RJCA 3KYAA 5GRZA 3NJKA 5AUMB 4GJTB 2GSIB 4YVNA 4Z7UA 1T2QH 1VENA 3NH7L 4X9FA 2FH6A 3HG5A 5EN3A 5FECA 1OW0C 5C0BB 1RV6X 2JI1A 4R0LB 3EHBD 3T65B 1GZQB 1BFOB 2CA4A 2O6DA 4XGZA 1IEHA 2BVYA 3CXHJ 3O41B 5HGDA 2WZPA 3ZRFC 3QUZC 5IKCB 3VXTA 2OTUA 3QJTB 2OPCA 5C0CD 2WO2B 5CP7A 5J11B 1MCQA 3B9EA 12E8L 3D09A 4G7YH 3I74A 4HGKC 4NC0B 1CICC 3ZQ9A 2W0LA 4UQ2A 1EO8H 2O1AA 3VWKC 4A38A 3GKZA 4QRRD 1CDCA 2LR4A 5DRNB 1Q8MA 5HHPB 2DWDA 4X2UA 4MA7L 2IAMC 5BMFL 5ID1B 1P5UC 4KBPA 3L4WA 2PYEE 3ZR6A 3MLYH 1T4KA 3UTSE 4DP6X 2YO3A 5FDWA 1H8NA 1HYSC 4F91B 1FBIH 1KCKA 1YEHL 2UZYB 3QIUC 4XCYA 4OI8A 2H6UA 1CBVH 3QEHA 4HU8A 5HYIA 2WXKA 3OKMB 3LEYH 4KK8C 4KV5F 1IVLA 3WAKA 4TL5A 3ABZA 5INCB 4Z3EA 2V6HA 5KVEH 4OD1L 3W11C 2QBWA 4GAJL 2NUTA 1DEEB 4TLSA 4WI8A 4BGDA 1KWKA 2JKXA 2HVJB 4GBXA 2HKHL 1JZHA 3HPLA 2BOCB 3HHMA 1SF3A 1GGCL 1WD8A 1HL4A 5F7UA 1NL0H 3EJPA 5EPMB 5D93B 1A14H 4KVPA 2C9VA 4GLRI 3UZVB 1ZIAA 1L9RA 1S7UA 4GSQA 1CYWA 2O30A 4F80A 3P30L 4J39A 3TBCA 1BW8A 5LGKA 4OGAD 2JJWA 3HLKA 1AOHA 4M62L 3T77A 3TWCH 5IB5A 2E9JA 1G6RL 3A3YB 3GF8A 4NDMB 4W93A 3VFNA 4DKFL 1M1XB 3FSWA 1ZXQA 4YDLC 4OLVH 2PTTA 4TUKH 4GFXA 3EJCA 3C5ZC 4HS6B 4N86A 5EZLA 5GS1B 5AVWB 2CLRA 2HLFC 1YCSA 35C8H 4QT5B 2ZKYA 3CGTA 3SDCC 5D4QA 1UB5A 4EO5A 1NCAH 3TBTB 4WFED 2GTWA 1F42A 1INEH 1WAEA 2X70B 5GZOD 2X4SB 4JM4L 4AM0Q 4AM0B 6PAZA 1HZHL 4B41A 3S36H 5J57B 1HHJB 3LQZB 3OSKA 4G43A 2AQTA 4JR9H 1U4FA 1MJUL 4LP4A 2HG5B 3VJ6B 3F84A 3O81A 2JWYA 4DUVA 4LKXA 3EJYD 1AGBA 3DV6A 5F7EH 4JHBA 1PKQE 2UZXB 4D94A 4QEGA 3NCYP 4OGYL 1RZIB 3HE7A 5T1MA 5T3XH 5F88A 3PL6D 3L4VA 4YHNA 4N0CC 1TTCA 2X0WA 3IJHB 4N0YL 1S78D 3R4RA 2Z1KA 4IJ3C 2YHGA 3VI3A 5BV7B 5FPIA 1T7XA 5HI3D 3ULVE 4P46A 2DY2A 3MRPB 3WKML 1GYUA 1XGRB 7FABH 5LNGA 1IU1A 4LSSL 4S0HA 5C0BE 3J07A 5JQIB 1FAIH 2I60H 3GXNA 5L4JA 1LO0L 1PLGH 2WTOA 2K9FB 1A1MB 2BP8A 5MHSE 1H3GA 4S10A 4P23C 3KWWB 4L8SC 2QTEA 4PRHD 3T4YA 3SDXB 5FV1L 3HA0A 1G1YA 4JFUA 1H5BC 4Q0XL 1WGOA 2ZKWA 2QHRH 4AG4L 1UA6L 4EUPA 3MV8B 1NKOA 3KWVA 2YD8A 4A7VA 4TQPA 2D03H 1KN2L 4XR8C 4E42B 3BP6B 4L4VD 3U7YL 5MENA 5C9JB 2H9GB 4PGDA 5C0AB 5H2BA 5DR5H 3ARGD 5IK3A 4KKLD 1JNLL 4NQTA 3ZKND 3VI4F 1TVHA 3SE8L 5FFGA 4GPVA 2AC0A 4AGNA 3PWJA 4NQEE 1NM9A 4RFNB 1I8LA 3PABB 1JNNH 1N59B 1VDGA 1MCDA 2CUAA 2N01B 3C9NB 2PPFA 2KERA 5CZXC 5E94B 3BAXA 4LAJH 3VSTA 1ZDQA 1BD2E 3OMIB 3U1QA 2HMIC 1ZRUA 1AGDA 1NCDL 2GVYA 2A9NL 2XBDA 3MRFA 3QCUH 1WZAA 1KBKA 1FYTA 1LP9F 4L48A 4HIHB 4UV7L 3PWPB 4OU3A 1KCRL 4HEME 3GSQB 1CFVH 1QLEL 2ZKMX 3MJ7B 4U1LB 4AX3A 1F13A 1JV2A 2ZG3A 3GMRB 5GGVY 1Q9WB 3ESNA 4GKZA 2WWKT 1X5XA 1CGUA 3D18B 3FT2B 5HDWA 2XG5B 2FX9H 4HF5H 4P46C 3GSUB 4JFTA 4FQHA 4MZ2A 3UAFA 4GQ9L 1BJMA 1TCMA 1OAQH 5I1LA 1UXSB 1GAFH 3WFBL 2ADFH 5ABZA 1CMOA 2FB4H 2CR0A 3V8OA 2FD6L 4YHZH 1Z0NA 5GRJH 3TGXA 1LGVA 4X4KA 3WG7B 1UACL 1WFIA 1YN7B 2WBJA 4HKXA 1VEMA 1NC4B 5L0QC 4DTGH 1ZTMA 4QR7A 5DGQA 3LKPB 2R0WH 4NEHB 3KR3L 4JFDD 4E41B 3S5ZA 2EDLA 1N5AB 3S8WA 4TULH 3MOAL 4MCMA 2Z0BA 2FBJL 4ODXB 1MEXL 5C08D 1A9VA 5DFAA 2O6FA 1IM3B 2J1YA 4OM0L 3EDFA 3H3PL 3A6BL 3QZNA 5GISL 5HGBA 1I3GH 5KBNC 2DQCL 2JF1A 4ZZFA 3T09A 2IQ9L 4WHCA 2ZAIA 4G6KL 1JI1A 1I8LC 3IPFA 4K3EH 1I85C 3QZPA 3K6FA 4HGMA 5EOCH 1K4DB 4LLYB 3WIAA 2PYFB 2R2HA 4P5MB 4E5XB 2ZYRA 5T5FH 5I1DA 4HJEA 4ODHH 3SDDB 5IQOA 5T1LD 2C8NA 3QHFH 4BUQA 3QO0B 2P5WB 4OCWL 3RY6A 3RWDB 3UZQB 5IOPB 1DVZA 2A2QT 2HWZH 4DFHA 3TPUA 4GUPA 1ZT7B 5FS5A 3ABLB 1CB4A 1T1XB 2C9SA 2GTQA 1QSFA 2Z4QA 1ODUA 2HFEA 1XR9B 3BKMH 3H2WA 4KRNA 5J6GB 3TEUA 1E5BA 1PF3A 3P2BA 1S8DB 4BRJA 4PJFF 4H1LH 3BFOA 1UD2A 2ZUWA 3RURA 3BHBA 2D7PA 1KENH 2Y5QA 4Y2DB 3EYSH 3MYJA 2GIYA 1IEBA 1NOFA 1UXLA 4UT9H 4TPRH 4UV4L 4BFFA 2XWXA 2WY3B 2X4OB 4Q58C 4XC3H 3L6FA 1HEZA 1CIDA 3NZUA 4DEUA 2WBJC 1OGAD 4LGSB 4XPBH 3IDXH 2DH2A 2VDRH 3SDXE 5FLVA 4RSYA 2HT3C 3O8XD 4NUMA 1SJVA 3F12B 3NCFB 5J12B 3HE6B 3MV8E 5SWZD 3FFDA 3EZ8A 2WN3A 3O4LE 3LNDA 2EH7L 5CO1A 3GMOB 3FUNA 3LEYL 3N85H 3QI9A 4XXDA 1AGEA 5C0AE 2FZ3B 3NCCB 4QPEA 2PWFA 5IJVA 4IRJC 1TKWB 3UBXI 2J21A 3VD2A 4NNYB 3CDFA 4ZMNA 3IXTA 3JV4A 3N1QC 2YKLH 3UTPE 4PCYA 2B1HH 3SGEI 5EO1A 1TO5A 2DIAA 4HFWB 3KL0A 5KSUB 4FEMA 1JPFB 4N24A 3CFUA 4DKEH 5L9DL 1TTFA 3FN3A 4KI5F 5ADOH 4JZOA 1S2EA 5CKGA 4X9BA 2BHFA 2GI0A 4XC1L 1WEJH 4HJUA 4L9LA 4W9GC 4ONGL 1BEYH 3VSVA 1S9WB 4H0IA 2G9KA 1T66D 2EUWA 2PMZA 5CWSA 5EBWB 3PWPE 4CMHB 5C07B 4IEFA 3FCUB 1V7NH 3AM8A 2XKUA 4KQ4H 4MTMA 4H8QA 1DQJA 4MSWB 5K9JL 4N1HB 1KFAH 4YSDA 4GMTL 1D7DA 4W9DC 3NMEA 4CVZB 2K7QA 3WHXB 2D31A 1IFRA 1C5DA 3LZNA 4G83A 3NAAH 1JI2A 4GUCA 4B97A 4Z5RB 4QDGA 1XVSA 4Z23A 4WUUB 3JYBA 1I1FB 3K1KC 3ECBA 3VXRA 1EHKB 4KVNH 3TTSA 3B3BA 1U3HB 3KYKL 3LDBB 4RAVA 4HCFA 1G9NL 3SYQA 5AW9B 3VH8G 4G11A 3W9EA 1GJWA 2W60A 1PZSA 4W6YB 4E41E 5IVZA 4ODSH 4GT0A 2VR5A 1ZS2A 4UZGA 1U8CA 3ISRA 3Q6FB 2XICA 5JOEA 1JF1B 3CFJA 3TN0D 5J13B 1PKOA 4IIQC 1OTSC 5E2UL 1JK9B 1FLTX 1C16B 1K5WA 3E1F1 4MMZA 2X7LA 2HX8A 2P80D 1F3RB 3ZUNC 4AYGA 4NQVB 1ZWIA 3Q1EA 4JY6B 2DQMA 1E43A 3PHOA 3IPEA 3GBDA 1N4XL 4LCUB 3IDJB 2DAVA 3NQKA 3VGGA 2R1XB 3I3EA 3Q1SL 3NJIA 1VACA 3BAYA 3WN5A 4POUB 4ZX5A 3TA3D 1E6JH 3ARFA 4DEPC 4Z77A 1SOKA 4X8CA 3V5HA 1WFNA 1QWNA 1RMFH 4J8RA 3IKCB 1KTRL 4L9LC 2P5WE 4N1CA 5HHVL 2BNQD 1FAIL 2DM4A 2ZJSL 3CSYB 4H26A 1LMKA 2ZUYA 4FLOA 1I8IB 3N43B 5T3XE 3NZHL 5KBLA 1JPSH 3QQ9D 3EJJX 1N2RA 2JTYA 1BJ1J 4FLRA 3W0WD 3KPMA 1FO0L 2K6WA 2OJZL 4S1DC 1P4LB 2J8HA 2N7AA 4URKA 1D5IL 3EGXA 3HG1B 2AV1B 5HY9B 4F7EB 5ANMA 1ZJBA 3P02A 3DRQA 1TFPA 2FE0A 4FXTA 1SJHB 3U46A 2OMXB 5FUCC 4RAUB 4UOW1 5DO2C 1W0VA 3ILQD 3LSOA 4LPVA 4ZS7H 3SYCA 3L81A 4TVUA 4JFXA 1I7RA 2VDRB 2QVIA 3RIFF 5C0EB 1I82A 1NGXB 4ES8A 1HKFA 3CC5A 3TZVD 3OF6A 2TAAA 4K07A 5JOFB 4YGVA 3I3DA 3BLPX 5K9QG 2DQEH 32C2B 3N50A 1TJIL 4LOVA 5FK9B 1JD7A 4MMZC 5IG7B 3KPLB 3CIAA 5F0LB 3WUWG 5EN2A 5ICZA 4A6YH 2OCJA 3KPSB 5C0CA 3TWYA 1B6UA 4PY8J 3FZUC 1KXQA 1LK2B 3CE1A 4JFVA 3A6CL 3ARDA 4F7MA 1RHHB 1YMME 3OLGA 5B3JE 3IF1A 3WN5C 3DJTA 5AD0A 3ARFC 1WP6A 3Q48A 4HS3B 4WFFD 2L04A 5F1NB 1QR1A 2EH8H 1C5CH 3LKNA 3PDOA 1B9ZA 4AEFA 4POYA 1N6QL 2DZEA 5EU3B 1BZOA 1CXHA 1TTRA 2CKBA 2XKNB 2Y1YA 3IJYA 1TZGH 2ZICA 4MJJA 1J8HB 3EGDB 1OWWA 4DVRL 4ZMPA 2NXZC 5FOJA 1MNUL 1UXWB 1I1AA 4FZ8L 3WLWC 2CK2A 4UILH 2EIJB 4C83A 4ZT1A 3MXVH 3NT0A 4OH2A 4QI3A 4Z7WF 1ZCRA 5KJRH 4JANB 4PLKD 3B9KB 1P4UA 5DEFB 3BQUB 1KPUA 1FH5L 1P1ZA 2R2EB 4HEPA 5IIEA 5K1NA 3LV3A 4GOSA 1S5IH 1CZ8H 2VJXA 3MRQA 4RGNB 5KYXB 4P2RE 5DHVB 5DQ9A 4ZDHB 5I71B 3GK8L 5DUML 2PXYD 2ZCLH 3MN8A 4FOMA 3EHBC 2CBTA 3PUUA 3AUWB 3WEAA 1GMEA 5JHLA 4WHYG 2HWZL 2VYRE 4K2UL 4X6DE 4ZFFB 4GKNA 1T20B 3TT3L 4M6MH 4ZFZB 3V0JA 5AZ2H 2EDMA 4FNPA 1EFXA 5H8DA 1YEWA 3L95A 4ZPTA 4K3JL 3RX5A 5JO5A 2RQ8A 3LN4B 4JG9A 1C5BL 3ZT6A 3T0EC 1NCUA 1CG9B 5JXAH 5B38G 4XPBL 3B2PA 4GP5B 2NUPA 4I48B 4AQZA 1SYSA 2ARJA 4QY8A 4EBQL 5DD1H 4RMTA 4YDVA 3ZDWA 1D5BA 2IH3A 3CCHB 4LNVA 3FPYA 5D1QB 3ZMEA 2AXHA 2WKGA 5E1IA 4PGEA 4NRZB 3OM3B 4OIIH 4F2MB 3CBRA 3O2DH 2C5DC 3UOAB 5KANG 3GLAA 4RX4D 1Q9OA 2CIIB 4XZUB 3OC8A 1OGPA 3FO9B 5DK0A 4Y4FB 3MV9E 4LIQE 4OW6A 4Z18A 5E6ID 2AMGA 3D12B 1A6WL 1FVDB 5GRXG 5EO9B 3UP6A 4AL8C 1JPTH 2OCCB 3QWQB 1JGDB 1ASQA 2CAKA 3LAFA 4OGAC 2NSXA 5ADOL 2X40A 3BH9A 4HXBH 2H7WA 4XWOD 5GGUB 2GCYB 4PRIA 4NZJA 3RKPA 1HXYA 2P49B 3KPSE 4LVOC 5EZOH 4A6YB 1YEFL 2NY1D 4G5AA 4HA1A 5EUOF 5TF1H 1D5RA 4OAWA 2I9LA 1Z9OA 2CRMA 1A1NA 1KEMH 4WWKD 3DOSA 1JRHI 3WYRA 1EMTH 1I1YA 3D39D 3QULA 4JKMA 1TSRA 4MDRA 5F2FA 1OSPL 3RAJH 5GZOC 1IAMA 2J6WA 2VIRA 5B7FA 2YXVA 4TQEH 5ENWA 4PRDB 1Q9KA 1A3ZA 2MFNA 4TM9A 2OR9L 3T8MA 1IEAB 1IQDB 1CDUA 1J8HE 5GRVL 1AR2A 1RHFA 2VXQL 4U05A 4KO6A 4WU7B 4Y8AA 2DLIA 3STZA 4DHLA 2VXSH 4X7SL 3EJYC 3N3EA 3SKOA 5JIDA 1I7ZB 2VDOL 1BMGA 4OVVA 1Z2KA 3QORA 1TR7A 3S88H 4PJ9B 4EIBA 3ZQWA 3PL6C 3WGUB 3BXNB 4WWNA 1S78C 3BAKA 5JW3H 3IWVA 4XN2A 5DZAA 2XWJA 1U0QA 1I1RA 1K6QH 3HC4H 5AW0B 5HI3C 3RWIA 4RGNE 1XH3B 1HXKA 2P48B 4PP1D 2P45B 4WNJA 3VGAB 5DWUH 1E8WA 3IU4H 4JDEB 3L3OC 5FF6A 2X10A 2HJFB 3DRTA 3UJJH 5FDYA 5HHME 4MHHI 3CQPA 4FN0A 4NYLA 1S9KC 1IZKA 2VDLB 4NN6B 5CGYD 5I75C 4XP9L 2WKOF 1BQHG 5GGSA 2ZX5A 4ZUSA 1TZAA 1T21B 4ORGA 5IBLD 4JZJC 5TFSH 2NT0A 3D25A 3FN0H 4PYHA 1G7LA 4IU2A 1WBYB 3CDCA 4L8CA 1JPSL 3LRKA 1G7MB 4BSWB 3G5ZA 3AG3B 3ARGC 5JMOC 3DETD 4KKLC 4M7JH 2IGFH 3MROB 4QTHB 5HHQA 1BFTA 3ZKNC 5DYOB 4XVSH 1M7DB 4J28A 5JHDA 4PJCA 5G5DA 4L0YA 3ARUA 3VXUD 5LQBL 2EC9U 3GXDA 3QG6A 4NS0A 5J1AA 2MWCA 4OI7A 2YOCA 3L4UA 5I74C 4XX1G 1W9XA 3OR6B 4MNGB 4YDIL 5K9OA 5EOTA 1HOCB 4MMYB 5T1LA 1ZXKA 3ZKXB 3V6FA 4IKIA 1AIFB 1FORL 5D1QE 4F92B 4UF7C 1ZPLA 4M1GL 1E9PA 3FUFA 1XF3A 2J6EL 3ETBJ 4F2ME 5I5RA 3MNZB 2X4UB 3ARQA 3SQOL 3O9WB 3HBZA 2J12B 1QSEB 3FB7A 5KUMA 1MELA 4NPYA 3SB3A 1BPVA 4PGCA 2FCBA 1LYQA 5LCVH 1E67A 3NJLA 3B4NA 3LVTA 2ZYHA 3CLWA 3WHE0 4M6OH 3O3AB 3FQWA 1DL7H 3V0AC 3ILPA 4PY7A 1JV5B 5FYJD 4XO5A 3MJ9H 2Z31B 2IOMA 2Z65C 5TE4L 2F1BA 1OGAA 3SE3A 1LO4L 2DDQL 1WV7T 2WLYA 2XXFA 3D51A 4FF9A 3RNKA 3I02A 1BREA 4EPSA 4A04A 1KB9K 3WMSA 1F6AB 1SVZA 1X5ZA 2CRIA 4GRWF 1S6NA 5CEZL 3WNPA 4KAQH 5DJXA 4KHTH 4UDTB 5C3TA 1BBDL 3L13A 5D9SB 2DQJH 4FQCL 4HPOH 3KXFA 4JPSA 3WS3B 1HCZA 1U9KA 4LHJB 5F9JA 5IHZB 4RRPM 4NI3A 1L4IA 4MXWH 3DBXA 4Q56A 2JKIS 5KS9F 4YDKH 3GSOB 4A67A 3BE1H 1TEGA 1GYCA 4IKJA 6CGTA 4JFOB 1WWWX 4HHAB 5EEZA 2PW2B 3N0AA 1OP3K 1B9KA 1C08A 2P8MB 2WVVA 4HMCA 5EIQA 3C6LA 4P9ML 2WXIA 3IDGB 3WEXB 3CPLB 1R3LA 4NT6A 1MHPH 3U4EB 4AYID 5LBGA 2ZIDA 1MCOL 1IGJA 3GI8H 3EH3B 4OZGE 3VFOA 1E3FA 2VLLB 2C34A 4HS8L 2G5BB 4Y5XC 3UYPA 2NY2D 4OR1A 1R24B 3WLBB 1NMAH 2BOBA 4PG9A 1U8NB 4P4KA 3EOBB 1FHNA 1QX1A 1NLBL 3BVTA 3K80A 4MAUL 1NFDE 2OSYA 4HJGA 3RY5A 4O4YH 1QFWI 3HNSH 5IQLA 5AL0A 1KPVB 4NP4H 3BEVB 2ZCKH 4Z95L 5DU7A 3IDIA 2ESVD 4JFZL 4XCFH 4AJ0A 1F5WA 4K5MA 1DEDA 1J5OH 4NSKB 3VDAA 3V5KB 2B1AL 1L9MA 5DEGB 3O8XC 4UU9A 3ZDXF 5JXAL 4TNVF 5DD6B 2FX7L 4OB5H 4WV1C 1KGYE 2X6UA 1DQQB 3VE0B 3ZPDA 2JVUA 1HHHA 2J1WA 3EYVB 1ND0A 4XNYL 2DJSA 1EDQA 3WY2A 2A9DA 4CVUA 2EECA 3QP3A 4A66A 4OLWH 1MCPL 4M8QB 4KXAA 5FIEA 4WHTA 4BQ8A 1S9XA 5E5LA 1RULL 1OPGH 2P24B 1FZOA 2NY6D 4KDVA 5A2LH 3K5RA 1M9SA 2JKTM 1ZEAH 4WW1B 4DQOL 3T6VA 2V5SA 4CVWA 5JNYA 5B1JC 1E50A 3TA3A 4MNGE 4ERSH 2Q5BA 3F6IA 3FNKA 3RZCB 5IW3A 4F2EA 4ANVA 2BNQA 2LU7A 4RDQF 3BPNB 1T66C 1IAIH 2D7TL 1QFUL 4Y1AB 1L0XA 3L3KB 3G6JA 3DNKA 1LO2H 4ONFH 3QXAB 1S7SB 1QSEE 3BZDA 4MX7A 4K4KA 3W0WA 3X1FA 2ZUQB 5EZOL 5A2BA 8CGTA 2B39A 4IU3A 1R9FA 3QXUA 4UB0L 4PJEB 1F90H 1KEML 1MF2L 1QACA 3GNMH 1EMTL 2VZOA 2NYZA 2H0PA 2JJVA 4HJSA 3VI4B 1FI8C 2ZOLB 1Y1DA 3MNWB 4R84A 3QWNA 2Z7UA 3JV5A 1XDTT 2DM2A 1PJ9A 1KMGA 4RZCB 4F7TB 3QXTA 3VFGH 1HC1A 4XMKL 4AUJA 3B7RL 3RWEA 3CFEA 4FFYH 4DN3H 3KGSA 3TZVA 1X6NA 2BVPA 3W1ZA 4Z7QF 4H0HB 3TN0C 4KV5E 3EO1A 1PG7H 3BYYA 3ILEA 2WUBH 1Q0EA 4G9FD 4N2EA 1HOEA 3GB7A 4RMRA 3IPBA 3DURA 3UPRA 1M57B 5JORA 4ORZC 3OXSA 1UD3A 2BS8A 3QS2A 1HJBC 4XPGH 1N8ZA 4APQC 4MYWB 4P3WA 4GFTB 3PS6A 1DLFL 4L3CA 2B4CH 2EDYA 5HJBA 1A22B 1MOEA 2XXMB 4C59B 3T2NL 3TA3C 3X1EA 1ZJAA 4X83A 5ANHA 4JPKH 1COBA 2J55A 4Z1PA 4UUJA 3REWA 1NBVH 5EORH 4FQXA 2CHWA 1G9MC 4J3OD 3QEUA 1TIUA 1JGUL 4RFOL 1DVQA 4LSPL 4QRUA 4P2CG 3CZFB 4AQ1B 5JLZA 1A5FH 5LUMA 3QQ9C 2XTJD 2XWRA 2IPTL 1K9TA 3CK0L 3GTNA 3Q43A 1J11A 1D3CA 3F6JA 5SWSD 5IR1B 1JP5A 1SXNA 1U42A 2FQDA 5JIPA 1S7WA 2MCPH 5GS0L 3RFZB 1J5IA 4HWNA 4FYQA 2YGOA 3EBHA 1GC1C 3OPUA 5LKNA 3WKPA 1BQRA 1WWCA 1FFTB 1WUZA 3ILQC 4OCLC 3KE0A 2EZ0D 2ATPB 3FCSA 1PPIA 4UT6A 3QZOA 1ZOXA 3KG5A 3AB0B 5GGTA 1ZT4B 1BG9A 4G8IA 4UT7L 4GS7C 3KPOB 4MKTA 1HT6A 3QCVH 5CSZB 4AUUA 3DYOA 2MQ3A 2PXYA 3K71A 1REIA 2XWTB 5F1KC 3UEZA 3D30A 4WI4A 1KIUA 3DC0A 4HUVB 1MHCA 3F01A 4NAQA 2X4QB 4P57A 2PO6B 1P4BL 2YXMA 2IPKA 3D0AA 4LVNC 1EV2E 1G5GA 2XQYK 1ZTXH 4N90D 5BZZA 5HDBB 1L9OA 3KCWA 2PETA 3V9CA 3RGBA 3VXQA 2DRUA 4M5ZH 4JZNA 4NWUH 4WTZA 4ZTPH 4HW6A 5HDOA 1CBJA 2ICWB 1U8OB 3HI6L 2XTSA 1F8TL 3LQAL 4DP2X 3T0AA 4DPCX 1QRNA 3WI9A 5D7SH 3AADB 4HMDA 4ZD3H 1XD0A 3RA7H 4HLZG 1V54B 1TQWA 3P9LB 2YFOA 3S3PA 3OR7A 1SJXA 4PJ7F 5HHOE 43C9B 4Y1AE 4GW5A 4M6NH 4LF3A 2PYED 1BFVH 4G1EB 5ID0A 3FB6B 4DCQB 4CC4A 1F1DA 4GI6A 5IJBC 2PCPB 1JXGA 3VXQB 1CLZL 2RB8A 2NY7H 4PLKC 2VABB 5HJDA 1ZV2A 4PJEE 4FJ6A 1SN2A 4UOJA 1KLFA 1X9QA 3MCKA 5IVXA 3WNIA 3FBQA 1OT1A 3QJFB 3VI4E 3TESA 2EEFA 3MHZA 4GH7B 4OZFH 4DSYA 4U1KA 4G3YL 3VSUA 1R17A 3CSFA 3UFIA 5E6IA 3WY4A 3D52A 4WY7H 4TQ8A 4N6QA 4UNIA 4YIQA 4BGLA 4OKVA 2W38A 4RIRA 1WZ1L 2IDQA 3CDGA 1YZZA 2AEPL 3MLRH 4YZFF 4R5XA 1D6EA 1IL1A 3I75A 3OMZA 3UXFA 4NENA 2ZXEB 3FSOA 1JWMA 4JB9L 5KW9L 3QS3A 2V17H 4AYFA 2WLMA 2XV3A 4PS4L 5ETUA 1NMAL 1T7WA 4G7QB 3ZTJH 5IEKB 4NRYB 2OK0L 3GI9L 2AQRA 3D39A 2CDGA 3L7EB 2XU9A 4HIEB 4YH6A 4OD3L 3ZMRA 2C9XA 1UM5L 3WSQH 1MPAH 4G7SB 1MJ7L 4NP4L 2BLFA 4QXUH 1T5WA 3DGDA 4XCFL 3KPRA 4JQVC 4Y4HB 3II2A 1O6TA 5ESQB 5HI4D 4F33B 1U92B 1YNTF 3I6LE 3TF7C 1NAKL 2BMKB 4TF4A 4MS8C 3VVWA 2HT2D 4XE0A 4FI8A 4U1HA 3C6SB 3T4AB 1BYOA 4Z7NF 5ICYA 1F4YH 1XF2B 2BRRL 3GMLA 2DM3A 2LAAA 1A7PH 1H0DA 4XOEA 2DLFH 3QWOB 4XCNA 2L7QA 2XBZA 2ZAHA 1ZIBA 4K7FB 1BLIA 1CK0L 3WFCH 1SVCP 1IV8A 1Z9NA 1P9MC 3BUQA 2LGNA 4E9XA 2I69A 4XP6L 5E6IC 3PJLA 1HZKA 5C7XH 1PS3A 1OPGL 3X1GA 1XGPB 1XCWA 4OTXL 4HIQA 3ZE1B 3OGCA 4HJ1A 4TTDD 3ULVD 2Z92A 2CM5A 1EANA 1I9JH 4MZ3A 4OV5B 1KXVC 4N3UA 4XWOC 1AE6L 4JPVH 2AABL 4A7SA 5C0BD 1M2VB 3GIZH 2Z3FA 2VQTA 4ZTOL 3OHXA