2Z8VC

Structure of an ignar-ama1 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
AWVDQTPRTATKETGESLTINCVLRDASLELKDTGWYRTKLGSTNEQSISIGGRYVETVNKGSKSFSLRISDLRVEDSGTYKCQAFYSLPLRDYNYSLLFRGEKGAGTALTVKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen 1
publication title Structure of an IgNAR-AMA1 Complex: Targeting a Conserved Hydrophobic Cleft Broadens Malarial Strain Recognition
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 26
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z8vC00
2GHWB 1XMWA 3DVIA 3BXNA 4WCYH 5GSVA 4GW4B 3C6SA 3L3DB 5F1NB 4XB8A 1EGJL 3W0WA 4MXWH 3QYCA 1R3KB 1CFQA 2J6EH 2E27L 4PS4L 2IMMA 3W0WD 1ADQA 4J4PC 4LGSB 5IVXB 1KEMH 5E00B 1KN4H 4C83B 3GSOA 2MPAL 1J7VR 2IH3A 4ZNEE 5FYKU 4F8QA 2Q8AH 2FYYA 2FATH 3FT3B 4NNPL 2VQUA 1R24A 4QRRE 2X7LA 2GTZB 1VKXB 1BZQK 3MODL 4NZJA 3UTOA 3VE0B 2VR4A 4U1HA 4LSRL 1D5IL 1BQHG 3LCYA 4MSWA 1FG2A 1QFUL 2Q86A 1KIQA 2O26U 3SKJL 3L3IA 2O61B 1IM3A 3ULUL 3WXVL 2EYTA 5C0AB 1QRND 1CR9L 1A3LL 4QXWA 4N5UA 4OGZA 4ZS6D 1IAOB 3RVVC 3VGDA 5HHMB 3QDMA 3AUVA 3MJ8A 1FIGH 4LDLB 1HHHA 3CFJA 3HMXL 1M6OA 3SY0A 4OAWB 3MLXH 4EIZC 3AREA 2VAJA 3LSOA 5E8EB 3VMOA 2JIXA 1Q9OA 4X99B 2R2CA 2B0SL 2MWCA 3BWAA 4LCCA 1MCPH 1LP9F 4Y5YB 4UNVA 3NCJH 4OQ1A 4ZUUB 4JPKL 4DVRL 4E0RA 3QUYD 1E6OH 5C0BD 3ZKXB 4HLZG 4PGZA 4F7PA 3UPAA 4CVWA 1CFSA 2CRIA 5F93C 5GGUA 1HWHB 3F5WB 5C0NC 3V95A 4OJFL 3EFFA 1D9KB 1YEIL 4JQXC 2GJ6D 2VL5A 1BD2A 5JXEC 1S5IH 3NZ8A 4PTTB 2A73A 1KCKA 2MNUA 4OZGF 4EIGB 3JVGC 4OLXH 1BD2D 2IWGA 3U0PA 5EBWB 2GTWB 4O51A 5D7IB 4OFDA 3ARYA 1LK2B 1AD9A 4MWFA 3RIAF 3QXAB 4MA3A 2G5BA 5IG7A 4YHKL 3HNSH 2EKSB 4Y2DB 3V4VL 2Y5TA 5EBLB 5AWNL 4QEGA 1S7VA 2GAZB 4IMLA 2CRMA 1FZJA 2BNRE 3E6FA 4W6WB 3RNKA 1KLGB 2NNAB 3D0VA 1BLNB 3VRJB 2PYEE 3QDGE 3KPSA 3HE6C 1UGNA 4WGVB 1QSEB 4U6YA 1MFBH 2QHRH 1FLRH 4UDUB 3T04D 5CGYD 4LPUA 3OR6B 2FGZA 1DLFL 1V5JA 2IQ9H 3C5JB 5E8OA 1DLHA 2NZIA 5J11C 2E6PA 5JW3L 3VJ6B 3LIZL 4WEBH 1C08B 5C0IB 5HPMB 4CN4A 4YX2H 1X5KA 1TIUA 5E2WH 4ZPVB 1R24B 2W07A 2X7LB 5FOJA 3D85B 4GG6A 5D96C 5IB4A 2CR6A 2HFEA 2EXYC 1NQBA 4FFVD 4AENB 3TBYA 1T1XB 5E9DE 5TPWH 1NH6A 3T2NL 3JTSA 4Z0BL 5F9JB 2HTLD 2R1XA 3D3VE 1QYGH 3ULUF 2NY2B 4Z77A 1MCNA 3DBXA 4K7PY 1DQLH 5CP3H 4P2YA 4BQ6A 4P5MA 3P77B 2ZOKB 1P7KB 5CEZH 3K4ZA 2XQYK 1B6DA 3V4PL 3S36H 4BZ1L 3G5VA 5DI8B 2V7NB 3WIFB 4EUPB 3T1FA 3MRIA 4Z0XA 3CVHA 1CD0A 4NKOA 3SY0B 3RPIB 4UUJB 2OL3H 2OXHA 2OK0L 2FJFB 3AREB 1W8NA 2P5EA 2VH5L 3U82B 3N9GH 4N0UB 1RUQH 4U1MA 3UTPD 5JW5B 4L9LA 4KRNA 5IEHB 5HYEA 3L3OB 3H0TA 1YNTB 4TSCH 1I1YA 4YHIB 4J1UB 4G43A 3QQ9C 3VG0H 3NFNA 5CLWA 1A22B 3GIVB 5B4MC 4E41A 1DQDL 2FWOA 5C9JA 4APQB 4HF5H 4WJ5B 3MJ7B 4BFBD 5HY9B 1MHPL 3QCVL 2WIIA 4E41D 4YHML 1X5GA 1V7NH 4WWKD 2I5YL 4R4BA 2OZ4H 3KPPB 5JHDA 4UIKL 2VISB 5KANG 1YNLL 1ZHLA 3ALPA 2M1KA 3U79A 1RZ8A 4LHUA 2UYLA 2XFXA 2R8SL 4M43H 2C3XA 2GFBA 3FQWB 3MTRA 2VLRB 1T03H 3MV7B 4XXDB 4RMWA 1J88A 5I9QC 1S7VB 3ZL4L 2EH8L 1UFUA 4QOKA 2X4UB 4OTXL 3P0VL 4F57H 5IV2A 4GOSA 3UMTA 5CHNB 3IRPX 4UV7H 3RY5A 1OAQL 1XF1A 3ARBB 3O9WB 4L4VB 1XGTA 3B9KB 5ACZB 1TJHL 5BV7B 2B2XL 5K9OA 3K4AA 3MYZA 4ZYKA 4LL9A 5E8OB 3EYSH 4DUWA 1QNZL 4MS8C 5C0EA 1AD0A 1ACYL 4L3AA 3SOBH 4KVNH 2YHGA 5T1LB 5CP7A 1JV5A 1IGJA 1UH3A 3MBEC 3WS6C 2XA8H 1TITA 3WEXA 2EIZB 1N8ZA 2DDQL 4FXGA 1KJMA 1LNUA 3P4LA 3T0DA 1HXMB 2IPUK 2HFEB 1S7RB 1HDMB 4LBEA 2J2ZA 5I30L 4YHLL 5I75C 2XWBB 5DLML 4NFCA 2VDLH 4QF1B 4DGVL 3GHBH 1AQDB 2N1KA 2ZUQB 4QRQA 3UPRA 5I76B 3UZQA 5KSBE 2GUOB 2R0ZH 2Y1VA 1DL7L 2BNUB 1MWAL 4IRJD 2FEEL 3PL6A 4WFHD 4RMQA 5IW3A 4MNGA 3PL6D 3ZYZA 3BJLA 4U0RB 2VLKE 2LABA 2HLFC 2IBZY 3WIHA 3CPLB 2DB8A 5FUCC 4D3CL 3KPQA 5C0JA 1MQKL 1CLOH 1W2KT 1KCSL 5J8OA 2DBJA 4PYGA 4NKOB 5C07D 1J1PL 4I0PB 5C09D 4S1SH 3R1GL 1KXTB 2VRAA 2FJHA 2CRYA 3ARDC 1MRCH 3O11B 4NQDE 3WLBA 1LE5A 4MQSB 4PJCB 4WUUA 4QHUB 4ZSOE 2ZJSH 4KDTC 3HHRB 4DZBA 35C8L 2AEQL 4WUUD 2XICA 4W70A 4U49A 2ZUYA 3GMQB 4LQFH 4XH2B 1NKOA 4QCIB 2XRAL 3NBNA 1I9RH 5GJSH 3VDAA 1EMTH 1FZMB 3HFMH 4ZFOL 2EO1A 3ZT5A 4PJFA 3VWJC 1YEFH 2AJYH 3ESVF 3I9GL 3LKSB 1F4YH 3LMJH 3MACL 2Y36H 1JGVL 4MCYB 4NJ9H 1DUZB 4LHUB 1IGCH 5HGDB 2G2RA 2CIIB 5BW7C 4PJAF 5I74C 4OV5B 1CXKA 2ATPA 3U48A 4TUKH 5IVOA 2VC2H 1WBYB 4G9FB 3WNNA 4YZFE 4OZGA 5L2KD 3D48R 4KVCH 4NHCH 4Y4HC 5KSUA 1X5LA 1AJ7L 4PRHE 4WO4C 3LPFA 5DVLA 3UYOD 4JZNB 4Y5VA 3BGMB 2XI9A 4Y19B 5HHXH 1AIFB 3TF7C 4P9HL 5D1XD 1GC1H 1MY7A 3Q48A 5I1AA 3S97C 3O0RH 5HHNB 2VZOA 5K9OB 3L3JB 1KN2L 3EO1B 4TRPL 1OPGL 3GHEH 4J6RL 4ZDHA 2HG5B 2FGWL 1QSFE 1PVHA 3EO9H 3MNWB 4RMSA 5TDNA 1BQUA 4G7YH 1ZSDB 1I8MA 3BQUC 3LZFL 3BZDA 4M8VA 5E1AA 4O58L 4QYOB 4XVUC 1IQWL 2XZAH 2PO6A 3C09B 5B8CA 2H9GB 4BA8A 3E3QE 3MLVH 2ED9A 4Y5XA 4IOFD 5CEZE 4DKDC 2WQ8A 4XP4L 2HRLA 1MRFH 3PWPE 1J1XL 3BW9B 4G8EA 4P9MH 1AGCA 1BBJA 4JHAH 5BVJA 2FJGB 4Z7WE 2WLYA 3OR7B 1C16B 1EO5A 1AHWC 3WJJC 1HNGA 1EV2E 3SDAB 1U8OB 3MV9A 1UXWA 4R4NC 3RY6A 4G9DB 2YXMA 4RGNB 1UA6L 2VXSL 4PJIE 3SDXE 1P2CB 1A6VL 4Z7OE 2NX5B 1OGAB 4HUVB 1H3UA 1DDHA 1HSAA 4TPRH 3KYAA 4UDTA 4MB5A 4DVBA 1KB5H 3O45A 1R3IH 5BOZG 1JK8A 4S1DD 4HK3J 2VXUH 2EDDA 4GRWH 1T5WA 2AI0L 1HINL 3HMXA 4WTXA 3CZFB 2VJXA 1WEJH 1NMBL 3IXAB 4JFFE 4XPFH 1KJ2H 4WUKH 3A67L 5HD8D 3RHWK 1QQDA 4FMKA 1L6ZA 4KROD 1AGEA 1LP9B 2Z9TA 3MRFA 3TZVC 3FHQA 4LSTL 3F7VA 2F53B 1MPAL 1QFPA 1YEEH 4HPOL 4JQIL 1EHLL 1SYSA 5AG8A 1TVBB 1MNUL 3QQ3A 2BZDA 5C3TA 1FAIL 3NTCH 5BRZE 2FB4H 4HS3A 4PGCA 4UTBL 5HYSG 1BJ1J 2IQAB 3PQYA 1U8KA 4YHPA 3TA3C 3VI3F 3NABL 4G8IA 2C3HA 4HUWA 4MXQD 3PQYD 4I3RL 1KIPA 4ETQA 2CRZA 2VXQH 3MV8A 4XHQA 3MRMA 5I1GL 5IMKA 2VZSA 5B39G 5SV3A 3TN0D 2G9HA 2H3NA 3MV8D 1OL0A 4JPWL 5IBTH 3HRZA 1C5BH 4M7KL 1N64L 5ADPH 5A16A 1YEDA 4R7NB 3TBSA 3ME0A 4PUBL 4OI7A 1XCQA 3VXNA 1KPVA 2DQTL 4XCFH 3REVA 1R3LB 1I1FA 5JR1L 4P5TD 3MLTA 4PP2B 3ULSB 1MVFA 3C9NB 1YEKH 3QEGH 4ZUVA 3RTQC 1UZ8A 4M7LH 4GRLC 4RWYL 3P9WB 3U1SL 4U6VL 2W0KA 4EXPX 1I85C 2YPKA 1LQSR 4U1NB 2ESVD 5KVDL 5B22A 3PUCA 5E2TL 1ZTXL 5I8OH 4XTRD 4KI5D 5HYJE 4DKFH 1RMFL 3TH3T 2CDGA 2PW1B 2VDNH 5KTEL 1OCWL 3WHE0 3V6ZB 5KW9H 1S7TA 2W0FB 2LVCA 3HS0A 3GDBA 3OHXA 3GJEA 1FYTA 5T1KB 5ICZA 2NW3B 3X12A 1CVSC 1UXSA 5KN5A 1F3JA 4OLUL 5FFLA 2J7LA 1TZHA 2AJVL 4LCWE 5LCVH 4HJGA 3MGOA 3N1MC 1TZIA 2PTUA 5HHQA 3HZVB 1F3DH 1EZVX 3Q1SL 2HT3D 3WN5C 1T4KB 4G6ML 2Z8RA 1E27A 2DMCA 4NPYA 4XPTL 3B9AA 5IMOA 1DBMH 4NBXB 4NRYA 3KG5A 1HIMH 4XNUL 4ZS7H 3KLHC 5AZEL 4MX7A 1BGXL 3GSNL 2NY3D 4LGRB 4NT6A 3O41B 1K4CB 4YNYA 1OVZA 2IJ0C 3HE6B 5EOQL 1DTUA 2AXHA 2R2EA 2DF3A 5BOPA 5JQHC 2R69L 2CK0L 3ECBA 3PWVA 1OW0C 4ZTPH 5IM7A 1JGUL 1KTDB 5J11B 4K71C 3WFBL 4FOMA 5DK2B 1EERB 5F8QC 5TF1H 2ZZUT 3QA3A 3O2WL 4OUOA 1A9BA 4Q9BA 3KR3L 4PJXE 4AG4H 4X6EA 5ISZB 4R97C 3CCHA 3HC4L 1XF5B 1KC5H 4KDVA 4QRRB 1ZVSA 2BOCB 4HS3B 4YHNA 4PGCB 5D96B 5GRUH 3WMSA 4DAGL 5D2NC 3T2QA 4TTGA 3AAZA 3DTXA 4OCMC 3CMOH 4DFIA 4HK3N 1JHLL 2CMRH 1HSBA 5LGHL 5DVOA 4PGEB 2CO7B 1T66D 4ORGB 4P48A 3ZE1F 4OFKA 4J7RA 2WBWB 3QAZC 1G6RL 4NRZA 4JHZA 3KJ6H 2A6DA 2VABA 3BEWA 4NO3B 1NLBH 4V2CB 5F3BB 3MFGB 4MD5B 1AQKH 1JN6A 2WANA 1CIDA 3QEUA 5FDYA 3MYJA 1QVOB 4G5ZH 3MLUH 1UM5H 3S88H 1KEGL 3AY4C 3IFOB 1KTKE 1NC4D 2Q76B 2VERN 2ICWB 5DD3L 3QCTL 4HWZB 5F1KC 4L3CB 4I5BB 4PRIE 4EZMA 3BRGC 5DURB 1BFSA 1X4YA 3CSYB 1RHHA 1I9JH 2BXZA 2R56L 3FB5A 5DTFA 5SX5K 1F02I 3M8OL 3QI9D 5GRVL 5ILTL 4L8CB 1RK1B 2CLZA 2ZG1A 2O5ZH 1NCBL 8CGTA 3DRQA 4L4JA 1A0QL 1H3GA 3WFDL 2D0FA 5ITFB 2OR9L 3LN5A 4LSQH 4HCRL 1INDL 3W39B 1RZJL 4X7CC 3RVUD 3MXWH 4JO2H 1JZ3A 1T04B 3GJEB 2F19H 3MGAA 5DO2D 3FFCE 1OP3H 2MQCA 3SE9L 2JF1A 3QIWA 4FP8L 3WHXB 1UKSA 5DD0L 2P49B 7FABL 3L3GB 5JZ7D 1I7TB 3VFMA 4HJGB 4OD1L 2A6JA 4QRUA 2LU4A 1B3JA 4GRWE 2IANA 3OPZL 1MWAA 4LAQL 1IEBA 1MJ7L 3RWDB 3TBVA 3G5ZA 3TBTA 2AJUL 3GMPB 2IAND 1XT5A 1KULA 3QNZA 3OKEB 4G6KL 4HIHB 2X70B 3EOBB 4MAYD 3QFDA 2BNRB 5BZDA 2WV3A 4MX7B 1FVCB 3O2DH 3QUZA 3QDGB 3U7YL 3T4YB 5C7XH 5ID1A 5HHOD 1VADA 4K8RD 2ZSWA 4NN7C 3UBXI 3GSWA 4KRPD 2BMKB 2A83B 4R6UA 2FSEA 1W72L 4P4RB 3WBDA 1MCHA 5AD0B 3HR6A 5CMAB 2XN9B 3AXLA 2WNGA 1NGZB 2Z8SA 1Y6NR 2YRZA 1CN4A 4HKBA 3SKUD 1P4BL 3C6LB 4X6EB 3HA0A 3CCHB 1FNHA 1VESA 4HUXA 5E2VH 3RWEA 3CX5K 2XPGB 5EN2B 3UZEA 4LEOB 2ZKHH 4ZFOA 5I75B 5TDOB 4HPYH 1Q0XH 3FAWA 1OWWA 5GS2D 4POYA 3ELAT 4YQXH 3WNPA 2Q8BL 2APTA 4F80A 4Q2ZB 1I3VA 4HGWB 4YDVB 1IAII 2V5RA 5JIKA 3S5LA 4X9IA 2ARJA 4D8PB 1XGYH 1ITCA 1HKLH 3LKRA 1OARH 3T3ME 4PJAB 5HVWA 3P73A 3MA7B 4Q9RL 4HFUL 4JKPH 2R15A 3SKMB 4N0RA 4RMVA 1KUMA 3IF1B 3K81A 3LDBC 2CKBL 4UT7H 5F72S 1VGEL 3QEUB 5ECJE 5DJDB 3BFOA 4JFXB 5E5UB 1F11A 3O4LD 5DJYA 3BRFA 3CVIH 3U83A 4HS6B 1NFDE 3BZ4A 3ARDB 1MCIA 4G6AC 5DGQA 1OAXL 1KPRB 4H25B 3BH9B 5F9WB 5EA0H 1RHHB 2DLIA 4KH2A 1C12B 2VR5A 1G0XA 5I2IB 1A6WL 1CF8H 5I1IL 2Z91B 5GGVH 4HWEL 4MNHA 4NM4L 2ZNWA 1RJCA 2IPKB 1S9WB 1NAKL 2AGJL 5CGMA 3UTSB 1U95A 3H2WA 3GB7A 5IF0B 3WS3A 1OAUH 4ISVB 1SEQH 4HKXB 1T2JA 5BVPH 3T1WA 4MQXD 4XMKH 1J0YA 3VWJB 1FPTL 3QR2A 1T89A 2GJJA 5E8PB 3PWUB 1EO7A 1H3XA 2B4CH 4LCYB 4YR6B 1F90H 3MC0A 4FXKB 5IESL 3VW3L 4PGBA 4XWOD 5CINH 3PV7A 2KQMA 3DUSA 4P3DB 3PGFH 1NSNL 5I74B 3OSKA 4UMGA 4ELKB 2IPTL 3C08H 3OAZK 3H9SB 1YYML 5SX5H 1JPFB 1MCQA 1INEH 3SE3C 4JPIA 2V2TB 1FVEA 4L4TA 1WWAX 2VDKH 4Y4HB 3OJVC 2EDFA 2AQ3A 2GY5A 3LEYH 3MRLB 5DJ8B 1CICC 1CFVL 2JELL 1MFEH 5JOFB 2BNQE 2A74A 4MXVE 2LVEA 1QLFB 1H5BA 2LAAA 4KKCC 2BFVL 3V7AE 2NY1C 1SJHA 3OKYA 3TO2A 3AXLB 1FHGA 4U0QB 1SHMA 4AEIH 3OGCB 2GEEA 1IC7L 1EH9A 3BQUB 3IDNB 1J1OH 1HH9B 2KH2B 5E5MA 1HZHH 1G9NH 3MCG1 1I3GH 2W91A 4H1LA 4MDIA 1RJLB 3DSNA 5JHLL 3VFTA 1VEOA 4O9HH 3AMLA 1XF3B 3TNMB 3UJTH 1XEDA 5CSBA 4UV4L 2FBOJ 1A14L 3HZMA 5GGTH 4GSDH 2Z35B 2XG5A 4HIEA 4WV1C 2AEWA 1JF6A 2QBWA 5H94A 1F00I 1T0NA 1U36A 3LQMA 1X5YA 4RFEA 4OCWL 2H1PH 3DO3A 3EJYD 1AHWB 3SKOB 1BMGA 3AVEA 3TCLA 4KQ3L 1I7ZA 2HKHL 1AXIB 1OHQA 2Y07L 1G7IB 5E2UH 3VXSE 3T0XA 4X6CE 4AK1A 3CXHJ 3D0LB 3G6AB 4Z76B 2W65B 3QO1B 1J0HA 2ATKA 5I1DA 4MCZB 3P4MA 2XG4A 2ADFH 1B0RB 2QTEA 4V1DE 3PABA 5C0AD 1X6NA 1XCTB 3KXFB 2QQQA 3HN3A 5ANMA 3ZSSA 2EZ0C 2B39A 1UB5B 2VWEE 4OCXL 2XKSA 1KNOB 1DBJL 4ONGH 4DJMA 1NL0L 2HT2D 2J4WH 1S9XA 5EOCH 2DJUA 4QGTA 4D9LL 5I17B 3I3EA 4XBGB 1G6VK 2HH0L 1E6JL 5IQ9B 2VZ3A 4PG2C 3S96B 1UM6H 1U3JA 4TNVK 4R9HA 4FQHB 3TZVB 3T8XB 3CLFL 4UT6L 1KG0B 4U1GC 3BSZH 3BE1L 5HI5D 4A6YH 3QEHA 5D71H 2FEDD 3V8OA 2WWKT 3CDGA 4Y7MA 3BESR 4FNLH 3B3IA 3VFPA 5FCSH 3GSQB 3O3EA 1FFOA 1PX4A 5I16A 1AE6L 4RIRA 3MPCA 2AK1L 1CZ8L 4FQXA 4KJQC 2PYFA 4Y4KC 4PGDA 5DRNB 5F7FA 4PJEE 5CJXA 4U1LB 1Q94A 4HT1L 1OTSC 3PGDB 5FUZH 2RHEA 2D7OA 4FQXD 5I18H 2PN5A 4FZ8L 1T83A 4LOUD 3QFJE 1U9KA 1CE6B 2C1PB 1EEUA 4POZD 4WHYH 4LF3A 1TVDA 5EU6E 2DQIL 4CJ1A 3GNML 2DD8L 1QSVA 1JF1A 4PB0L 4I18A 1B0GB 1GCFA 3LH2L 4NIKB 4AL8H 3TVMA 3DMMC 4I13B 1MEXL 1CYGA 1DN2A 3W2DL 2YZ8A 3QJFB 4M4PA 4FQJH 4JY6A 5SWSE 1F42A 1EAPA 1FGNL 3GSNA 3RGVA 1X5AA 2BOBB 5D7LA 1XH3B 4GLRI 2QJDA 3RTQB 4N0YH 3VH8B 4GRLB 3RWCA 3EUUA 1BWWA 1LVEA 1CFNA 3V5HB 1KCRL 4WI5A 5F7KC 3RJDA 4NP4H 3KPMB 5TH2A 3VFTB 1EX0A 1JYVA 4NGHL 4LHQB 1XF2A 4PJ9C 3IGAA 4GW5A 3BP7A 4ZODA 5DT1L 5HPOA 1FORL 2FH8A 3V52L 2E6JA 4ZXBC 1A7PH 5JXAH 4HIIB 4RGOH 3QXDA 4WW1A 5HVGB 2YD2A 4TUJA 4JO1L 3M17B 5E6IC 3D85D 5IGXH 4BH7B 3DX7A 3KPRB 3L9RA 2ZG2A 2CO6B 3T4AA 3DXAA 4PJIB 1K5NA 5ESQA 1G6RA 4OZFH 4K23L 2LU7A 2NY2D 4N1CA 3PABB 4JRYA 5EUOA 4Z8FL 1NAMA 3P3YA 4LNVA 5LWYH 4JRYD 4LARH 2PR4H 3U30C 2YPLA 3TFKC 1YEGH 3SCMA 3VDCA 3GBNL 2Y23A 5EOTB 3FQXA 1JYWA 3SCMD 1T1YB 3AU1A 1BZ9A 4X6DA 4JFFB 4KZEH 5FKPB 2F8OA 3MRCB 4MVBC 3BAEL 2ZUUA 2YBRB 4K71B 5SV4A 3FOLA 1Q9KA 2LTQC 2HYMA 4NO2A 3U0WH 3MFFA 5IR1B 4E9LA 4H88H 3X14A 1M7IA 4R97B 4Y16C 4PV9A 1S7WA 4H26B 1XZ0B 3TO4A 1I7UA 3I50L 5D2NB 4APQD 3VFPB 2VOTA 1QFWL 3H7BA 1GHFL 3HNVH 4GAGL 2BSSA 2X4NA 2VUYA 3LD8C 2OI9C 1BAFL 4OB5H 2Q6WB 1BVLA 3QAZB 3TPUB 5DDHB 3LRHA 4FTVA 2FHCA 3O6ML 1LO5B 3HUJE 4DZ8A 1M71A 4K07A 3ZLQC 4MNQA 2VLRD 1FZOB 3QJHA 3LB6D 4O2EB 4QRTA 3FN3A 2QQLH 1EVUA 3MLZL 3CFIC 3GBML 3PDOB 1CL7H 1PQZB 1L7TL 15C8L 1Y18B 1ZT4B 2NXZC 1W0VA 4NNYA 4XVSH 5F1IA 4YXLL 1H8SA 4IRSC 3MGTB 2Z92A 2HT4C 1JNHB 1G7QB 43CAB 1EEQA 4L9DA 1RQ5A 4PJ5B 1P84J 2VN7A 1JGEB 1ZOXA 2HFGL 5DD1H 3UJJH 5SWQA 2MJWA 3ARBD 3O9WD 4L4VD 3B9KD 2CIKA 2R4RL 4IDLA 3CFKA 2DKSA 3QG7H 4ERSH 3MNVA 5T1LD 5H8DA 5C71A 5C0BE 3QZWA 4NZUL 1G9ML 1BM3H 4PJHF 4DW2L 3BT2H 1IGTA 2AVGA 1DZBA 4JVWA 5TE6L 2IMNA 3J7HA 3EFDH 5J56B 1FFNA 2GYSA 4Z7UE 2NTSP 2P8PB 2R4SL 4LCWB 5DUPH 2EC8A 2P8LB 2R39A 1IKFL 3PP4H 3WUWG 3BKCL 4TUOB 3TIEA 4LCUB 5CJQH 3W9EA 3JWOH 3OKNB 1NGWA 1FH5H 3DVGB 4G6JH 4G6FB 3IKCB 4AIZB 4Q7DA 1AXSA 4I1NB 4YGAB 2CKBA 3GJFK 5F70A 5JQ6L 2YPLB 3FO0L 5E8NA 4KPHH 1UB6A 4K94L 3QEQB 1FSKB 4ODTL 1FO0H 3WXWL 4NN7B 1OTTD 1F4WL 2B4CC 2XIDA 2RFXA 3FQNB 4YDJA 2BHYA 2AJXH 1BZ9B 1EPFA 2AK4B 1G7MA 3QIBC 3CAFA 1W8OA 3P4NB 1RURH 4GMTH 2X5PA 1MI5B 1CU4L 5FHBL 2DOCA 4KKAD 4HX1A 1R3HA 4P46A 1LO0H 1CK0H 3VFSA 4CW1A 3ARPA 2H2PD 4N8VA 5J3HD 1R0AL 5D5MA 3IB4A 4JHWL 4X6BA 1A4KB 4HWNA 4DN4H 1X4ZA 5HYQA 4H8WL 2QEJA 1OP9A 1P1ZA 5DMIL 1N5AB 3ARGA 3WE6B 5EBGA 3HC3L 3O6KL 4HS8H 1PEZA 1VFOA 3ARGD 4RDQF 5HHVH 1AR1D 1HYRC 3H6JA 4P2QA 4BSVA 1WLHA 2EDRA 4PRAB 4X8JA 1JWUA 4K9EH 1RZ7L 3LDBB 3PNWA 3ZYJA 4MNQB 5EBMB 1G9NC 1TNMA 4H5SB 4G9FD 4JM4L 3U2SB 4C56A 4F2MB 1P6AB 1JWSB 4GUPB 4K94C 4C56D 4AQ1B 1X9QA 1T1WB 3L1OH 3MA9L 4KGJA 5D70H 4PRIB 2YWYA 4Y19D 3EDJA 1KLUB 2KZ1B 1W72B 1ZMYA 1Q1JH 1WICA 2EC9T 4NQSA 5EC2B 2DQCH 5INCA 4PY7B 2XKNA 3U4BH 3WNMA 5DHYB 2H8PB 1OSPH 1GPOL 4MD0A 4CMMB 1VGKB 1KELH 3FN9A 4NWTL 3AM8C 1XFPA 3BN9D 2ID5A 3FFCB 1MIEL 1HHGB 1YPZF 4QTHA 1FJ1B 2BC4A 4XCYB 2APBA 4BJLA 1QRKA 2HMID 4YO0B 4JAMA 4HH8A 2XACC 6CGTA 5MENA 4WCYL 2FBJH 3ULVH 5EU5A 1T6VN 4MXWL 3V6BR 3S8WA 1YYLH 1FVDA 4ZUSA 1CICB 1EFXB 2ITCB 5FM5M 5DMGD 5DRZA 3SDAD 5ICYA 1TQCC 4MD4B 1KN4L 4X9FA 5CBEA 4RGND 4P3WA 32C2A 4M1GL 1KF9B 4O2FB 3MRKB 1KLFA 2DWDB 2NY1B 2NX5D 3HB3D 3B2VH 3T3PF 1BFOB 3OAYK 3IVKB 5C08A 2VDRH 4NO0A 5ACMA 3S5LG 4JKKA 2P5WE 3D18B 1FNSL 1K3IA 4Z7VA 2XZZA 5KAQF 1PW3A 3VDBA 4YXKH 4Z5RB 3GJFH 3QP3A 3IU4H 3RKPA 1MCOH 1EUTA 3BKYH 4J4PA 4M9PA 4AIOA 1QEWA 2OBGA 3MRJB 4P3CH 4OZIE 5J1SC 2DQJL 3MO1A 4J4PD 4QRPB 3ZE0F 4YBLC 2F5AL 4JJ5B 3KDMA 4WV1B 2F53D 3L5IA 2HJKA 1OB1A 4LPTA 5DJ0A 5TE7L 5T3XL 4JDTH 4EDXB 3MLXL 4XVTH 5C0CA 4RFNC 2BSTB 1NGXB 4JZOA 1MIMH 2JJTC 4K3DH 1NCWH 5C0CD 5DJCB 4LKXB 2E9IA 4L8BA 3FFDB 1Q9WA 2UWEA 2VDQH 1P9MC 4PJ8A 2CDFB 4NQEE 4NO5B 1JRHI 3RX7A 1EZVY 5GGSB 3CUPA 3V0WH 2W9DL 4N1EA 3A6BH 3W9DB 2PETA 5HDQL 4OD3H 4HKZB 3GMLA 3NACL 5C07E 2IEPA 1KENL 1E4XI 4YIQB 3GSVB 4XXCC 5GS0L 5EZJB 2IBGA 4I9WD 3RVVD 3QNYB 1XGRA 5CS7A 2C5DC 1MLCB 5AAWA 1K8DA 2E9BA 5CUSL 3KWWA 1Z3GL 2YD8A 1X4XA 2R1YB 1NDMA 1EEYB 2NW2B 4LEXL 1X3DA 3L3HA 4F7CA 3OX8B 1RUPH 2I60L 3QWRD 1U8PA 4GO6B 4LLVA 2IH1A 1INQA 2GT9A 4FFZL 1DSFH 2DIAA 3JXAA 4YC2C 3G9VA 4U1GB 1M05B 2DQHH 2I9LA 4HUMB 5DQJB 3S37H 3V5DA 4M7ZC 4ELMF 1CBVL 3OKMB 4LLUB 1G7PA 4JAMB 4ODSH 2V2WB 5DRXA 1R6VA 5FB8A 3GMNB 3HAEH 3VRIB 5MEPB 4Y4KB 5C0ND 1XAUA 4PJHA 5IKCA 3E6HA 3VFNA 3VD5A 1G7LA 4F7MA 5JXED 1P6FA 4XP9H 4QRSB 4NHUA 5T1KD 4OSUH 3RZCC 2E7LA 5EULV 3MJ9H 1CE1H 3B6SA 3W5NA 5L2KE 4FMFA 5CIPH 2EICA 2X2YA 4OM0L 5MEOB 3MLRH 2R2HA 4GBXA 4Z7QF 3RZWA 1S78C 4AMKH 1UH4A 3FB8A 3DMMB 4JFOA 4GRMA 4HWUA 4PTUB 3CDYA 4H1LG 5F96L 4OD2B 1IAKB 2LFGA 5DK0B 5E2WL 5D6CA 5IHZA 1RK0A 4PBXA 5FYJL 4JG0L 1RSFA 1EXUA 5GS0C 4PYHA 2GY7B 5FOBB 4RFOH 4M1CC 3UDWA 2C4FU 3HE6D 5FM5O 3MNZB 5KG9A 4MDJB 2HVKB 4OGAC 4UT9H 3QIUA 2H32A 2HA1A 4UIMB 3QIUD 4YBHA 1EO8H 4EOWH 1HOCA 4BFIA 5DD6A 1IARB 5J89A 5T5NG 3QUXC 4PJ9B 2GQHA 5ETUA 3MRDB 5EU7E 1MJJB 3UJIH 1XGQB 4QHNA 4ZXBB 4KAQH 2Q1EA 3ZDYF 4FFYH 1ZVHA 2X4RB 4JANA 5FV1L 3R0MA 1F58H 2MQ0A 4JGJA 3OAYH 5ISZD 1NGQH 5E6IB 4QRRD 4YDLB 2VKWA 2CDEB 2EXYD 5A2IH 3VXUE 3X13B 2CLVA 2DKMA 2IGFL 2YR3A 4J3XA 2Z31C 2HN7A 3FB6A 1Q9WB 5CEYA 3DURA 2DYPA 4D9QE 4YHYC 3VFOA 2R2BA 5DFWH 1JHKL 1A3QA 4PRBA 1A6AA 3C60C 3FT4A 5JTWA 2V2XA 3U30B 1WF5A 3JV4A 1VFAB 4NOFA 2ILLA 4LLDB 3WL9A 5GS1C 2QQKH 4GAYA 1A4JB 3C2AH 1RIUL 4OIIL 1YN7B 3U9PH 3ZDXF 5K59E 4PJ7E 5FCUL 3ZKMC 2Z93B 5EO1B 2LTQB 2BDNH 2WQRA 4OCSH 2J5LC 1J05B 4FQLL 5DURD 3UBXG 3ROOA 3ULVE 4RMUA 3S34L 4WVRA 4O4YL 4JG1H 1N6VA 5DRWA 1OAKH 2MSPA 1DBAH 2AEPH 1CQKA 2O5XH 3UTZB 4HKJA 1N2RB 3QQ9D 1ZLVH 4F57L 3BYTA 5B4MD 2VLJA 4OM1L 5DJZB 3RL2A 1LEIB 1U92B 1Z9LA 4PJHB 1BVKB 1ZS8A 3LD8B 2OI9B 4NC2B 2XNAB 3KYKH 2B8OT 4NHUB 5FO7A 5IW6A 2EDWA 4OKDA 1YEHL 5I71C 2A6IB 3UYRH 4R90H 3MRHB 4FA8A 3SOBL 1BHGA 1KJVB 2PCPB 3OKOB 2F54B 4OGYH 4L5FL 3WV0A 4FQPA 5HJ3B 1MJ8L 5SWSB 4XBEH 3BDBA 3F58H 4IRSB 4F58H 3GHBL 5D7JC 2BNRD 2APVA 2PYEA 1NJ9B 3DECA 2ZUXA 1A7OH 4LHJB 3QDGD 4EI6B 2VIRB 4QXUL 5KS9E 5F7LB 3JUZA 1P5UA 1GIGL 3QULB 1J0ZA 4U6HB 5C8JB 5C1MB 4UNTA 1REIA 5E4IA 4MS8D 1RI8A 1HILA 3I3BA 5ALBL 5EU7C 5T33H 3HLAB 5E0QA 2X40A 1AFVH 4XP6H 1CIUA 3MBED 5D72L 5FK9B 1ZGLM 2NY5H 2MCPH 4UILL 4TOYH 1BZ7B 1B0WA 5FECB 3ROLA 1LEGA 4BFGA 4XNXH 5E9DA 4JO4L 4KHTH 4Y8AA 3OQ3B 4N5EC 5FAAA 2F15A 3EYOA 5E9DD 5A2KH 1XR8A 1QBLH 2XWJB 3D3VA 4Q6IC 4OF3A 3U7WH 4QNPE 3SDXF 3PWNB 4JFEE 1QBML 3C8KA 1GVIA 5KVGL 5IB5A 4LSVH 3EZ8A 2D7TH 3OJDA 4G3YH 3BPCB 3DARA 2HLFD 1YEFL 4OCYH 4YUEL 3R06A 4HK0A 3N1FC 4JRWA 2PXYC 2XXCB 2SEBA 2FR4A 3F12B 3QIBB 2XTLA 4X5XB 1N5YH 1NFIA 2DKUA 2OTUA 4GAJH 5K9JL 1IGCL 2W9EL 3IFLH 4WNQB 4F33B 3ARDD 4PJBF 4M5ZH 5HI4C 5LBSH 2YC1B 5BZWA 3OKKA 3K8MA 3ULVC 3QXUA 3TT3H 2PNDA 4GQPH 2K9UA 2VLJB 4NSKA 1Q9LB 3RIFK 3UTSD 5DD5H 2PF6A 1O7SA 2NCMA 3WJLA 1PYWB 4M61B 3IDGA 3SDCC 3O0RL 3VWJD 3VXME 3ARTA 1YPZB 4NUGL 1FRGH 2VXVH 3RKDC 3TT1L 1RJYB 5EZIL 1D5MA 2DL2A 3KYNA 5BW7A 2JCCF 4HIXH 4YDIH 4X4XB 2HTKD 1EJOH 5IFHH 5DSCA 3HUJB 3H9SD 5T5FL 1T0PB 4S2SA 4FQQA 1KBGL 4GXVH 4WO4A 4M93C 2XZAL 2J6EA 2VDOH 4Y4HD 5IMMA 2VDMH 4WO4D 3T2OA 4P23C 4MJ6B 1EFQA 3RUGF 4I0KA 1YECH 4DUVA 3GMOB 3IDUA 5LAXB 4I2XA 4Y4FA 3QZWG 4PD4J 1MRFL 2UZYB 4YJZL 4LK4A 2RR3A 5C0GB 3QHFH 4QGYA 2NZ9C 2X4PB 3VD4A 1HE7A 4Q0XH 1LO4H 3L7FB 2YK1L 5EU4A 5DMYA 4YAQA 3IDMB 1BJMA 2V5TA 3HTLX 3I85A 3BQUD 1DBKH 1UZ6F 5L9DH 1CDUA 5L88H 1F4XH 4XVUD 3NGBC 3TWCH 4HEME 3ZTJH 1IBGL 2NTFB 1MHHA 2ED7A 3D39B 1JGDA 4LASL 3EYOB 1SM3L 1XR8B 5I8KL 1MCCA 4ALAL 5KSBA 2YWZA 5FYLL 1RUMH 3VRLE 1GGCH 3LN4A 5HDLA 4JDZA 2KPNA 2NY6C 1AI1L 1U93A 4KK9D 3VFWB 1WWCA 2IG2L 3MXVH 4WFFE 5I19L 3WJJA 1UJ3C 2VLKA 2R0WH 2R0LH 3NFSL 3I6GB 1KOAA 5L2JB 5CWSB 2VLKD 1TQCB 4HK0B 4N8VG 3AB0B 4R4ND 2WW8A 5IEKA 4DQOL 3BEVA 5LVEA 1RIVL 2AXFA 3OZ9H 5F8RC 4M8QB 5FKAB 2G60H 2B1HH 2HRPL 3QHZL 3HR5A 4NQDA 4M3KB 3KGRA 1NUGA 3DIFB 3RWGA 1MHCA 4UOJA 3TIDA 3P0YH 2CJUH 3OKKB 5F21B 1T21A 4YHOH 2K7QA 1CCZA 4JFDB 5GJTL 2IALA 2AV7B 2EIEA 1FBIH 2R9HC 4UB0L 4BH8A 2P1YA 2VXQL 4JDVA 1PZUB 3FT2A 5IJKC 1OD7A 5GZOC 2DQEL 2E3VA 4PBVC 5IBTL 2XKUA 5CZVH 4DKEL 4WHTB 4YBLB 4WW2F 1U8LA 3WLWC 4NQVB 3TZVD 4XPBL 4ELMB 4HH9B 3P9LA 4XCFL 4OV6F 3ARFA 2RAMA 1KTLA 4RFNB 4XMLH 4WI6A 1TETL 5DC9B 1I1AA 4M7LL 4WFGE 5JPMA 1DVFC 3TA3D 2W60B 3QDJE 3STLB 1AGDA 1LO3L 1ADQH 4LRIC 4PRHD 4U6XB 1VA9A 3TYGL 5DMKB 3O4LE 1K6QH 1Q8MA 2VDNL 2OSLA 4Y4FB 3M1BB 5EU3A 2FX7L 4TTDC 3MREA 3QUKA 1ZEAL 4ZUTA 4HV8A 2AXGA 1YJDL 1NMCC 4UU9B 2YS4A 3DX9B 1QSFA 1P69B 4CADA 1VDGA 3UPCA 1QSFD 5LCVL 3RDTC 4A2MA 3BVNB 1J8HE 1PZ5B 4OZHF 5IMLB 1IT9H 3UTTE 2EYSA 1NCDH 4KTEH 3RTQD 1S7SA 5J9PB 4GRLD 2FECI 4OZFB 5EUKB 1U6AL 4FQIL 1NANH 5CP3A 1IJ9A 3K2UH 1H15A 3L7EA 3DVNB 4TNWK 1KTRL 4O5LL 5GRXG 3OKLB 5F6IC 3O6FC 3SE8L 3STZA 5I1CH 4M1DH 1CDHA 3GKWH 4ZS7L 1A2YA 3O8XC 4I48B 3VFRA 1MJUL 3PWPA 4JDZB 2P42B 4XP5L 1BX2B 2I27N 2OL3A 3FQUB 4Z7WA 4ZAKC 1R5VB 3RZCB 3R0NA 4NFDA 3BPLC 3U0TB 4YHZL 3NFPB 3EOTH 5E8DL 3KPNB 3GMRB 4HDIA 1SVZA 3BRDA 3KPRD 3VXPA 1IEAA 2I26N 1U58B 3HE7C 3NIGF 4P2RE 1A5FL 3MZTA 3SDXA 5E03A 2FX9L 4TVPL 1NUDA 2X05A 1R5WB 1E28A 3IETA 3QG6A 4M7JH 4X83A 1ZA6A 3AS3A 5FA4A 3QQ4A 1WIOA 1HHKB 1KC5L 4MHHI 2CGRL 2OZ4A 4HBQA 1YJDC 3KLHD 1W0WA 2P5WB 2WUBH 4LPXA 5J1AA 1N59B 5BS0B 2BY3A 5CEXA 5D1QA 4ONHB 2I9TB 5AUMB 2KBGA 4K7FB 4JFFD 3LV3A 4LLQA 1QZ1A 2F58L 3WO4C 3QUXB 3VD9A 1TJGL 4XGZB 5H2BB 5C0RL 4G5ZL 2IF7A 3AFLA 3RVTC 3ZYOA 4LCIH 1UM5L 5IVXE 3N85H 5BRZA 4PLKC 5L0QC 3GZKA 1KTLB 5BRZD 1S8DB 4NUJA 4ZD3H 2QQNH 5JPMB 1RPQA 5BV7H 2Z31B 5E5RB 1MOEA 4X0KA 4IIQC 5SWZB 3D2UB 5IT2L 1A6TA 4YHYB 2JCCA 3KJ4C 4UQ3A 4HFWA 2O5ZL 3WFHA 2ZCLL 3C60B 3L5WA 3FQRA 5D9SB 2ZCKH 5D6DA 3MREB 4H20L 1FFPA 1H3WM 5C0AE 2NY5C 1U8JA 5GS1B 3H42L 2AXJA 4EI5A 1WBZA 4G8FB 1A02N 3AY4A 3GO1H 4MJIA 5DFVC 5K9KA 3G6JB 1A3RH 3RUGA 3ILPA 1FDLH 1X5XA 5LQBH 1MH5B 5HHME 2CUHA 3WKMH 3DGGA 5GGQH 1WZ1L 3IRZA 1MCLA 1KV3A 5TE4H 3OGOE 5I1HL 1AO7B 1P4IH 3SPVB 4P57A 5I8EA 3IDIA 1KPUB 2J5LB 3P30H 1V7ML 4RAVA 1KFAL 4BSWA 4DGYH 4NQCA 1NGYB 2D7PA 5HYJA 1CVRA 1FE8L 2EE3A 4PJDE 5BJTB 3NAAL 1T2QL 2BERA 1OF2A 3QRGL 1S7XA 3EYFA 2WBJC 3CVHH 1MFAL 4K3EH 3JWDL 5J6GA 2C7UA 5KSAC 3VWKA 3KYMA 1G1CA 4IOIB 5I71B 1JPTH 3A6CL 5FXCH 4LCWD 1B4JL 2Q20A 5IBUB 1ZT1A 1D6VH 5GGSY 1A7RL 3BP5B 2B20A 5AG9A 1JZ7A 1UWGH 2XY1A 3H3PL 3VCLB 4P2OC 3QG6B 5I1EL 5F88B 2YSSB 5E2VL 1TQBC 4NDMA 6FABL 4G6FD 2A1WH 5DEGB 1KCUL 4QT5B 1S9VA 1U91A 2WM0A 3P11H 4MJ5A 2DAVA 4N8CL 4CDHA 5IVZB 5D7JB 5F7EH 3RIAK 5E94B 2BVOB 1JUFB 4YQXL 5CEXB 3I2CH 2BRRL 3VXTB 3QEQD 1S5HA 5KVFH 3ZO0A 5D1QB 1XGYL 1P7QA 2N7BA 3FOMA 4MGXA 3OXRB 3CLEL 2YD5A 3LHPL 3RHWF 4NZTL 5CFHA 4PJBB 3LQZB 4PG9A 1QSEE 3U4EA 1AXTL 4HW6A 1MI5D 3NIFF 5LG1A 4JZJA 1JFQH 4M6OL 4YPJA 3INUH 1KCVL 4M6NH 4OCRH 1I8IA 4LPYA 4AM0B 4TULH 2ZOLA 4LPCA 1CQYA 1V3MA 2HWZH 1IC1A 2QLVB 4M03A 2OR8A 3SN6N 4YWGH 1CGVA 4XC1H 1S9KC 4S1RH 2GSGB 4OZ4A 4YPGA 4N9GB 3PJSB 4KJYB 4L3EB 3JWDC 3VXUB 1PKQB 4WW2A 3MRPA 4LU5L 1T1ZB 1A8JH 1ED3B 4Q6IB 4NKMB 1MCBA 3CK0H 1PEWA 2EH7L 1EHNA 3DROA 5IJVB 1IQDA 5F7DB 4UQ3B 1K85A 2FO4A 2Y5EA 2A9MH 1BEYL 1H0DA 4NWUH 1SJVA 2DICA 1MFCH 4OGXL 1IFHH 4WI2A 3IDJA 3T77A 4XMKL 3BIBX 3R8QA 3HCVA 2BSRB 3GK8L 4LKCA 3WFCL 1IM9B 2PXYB 1YY8A 3V79C 1F90L 1DUYB 3VXRB 5DWUH 4Z7NF 4ODBD 1BQHB 5CINL 4K3JH 4G6AD 1XR9A 3Q6GH 3P2TA 1CLCA 4PRID 4ODWA 2GSIB 1RVFH 4KY1H 2J8UF 2X9WA 4HWBH 3HI5H 3K1DA 2Y06H 3WIHH 3QRFM 1NUFA 4N0UE 2XWTA 1OF2B 1UWEL 1T22B 5MI0B 2MHAA 2WWKO 4RNRA 4GKOA 3QO0B 5I0ZA 5LKNA 4X8XA 5J6GB 2HVJA 3MCKB 3SDCB 2HFFA 2FIKA 3PGCB 1YMMB 2PW2B 3BKJH 5FHAL 3U6RA 3ES6B 3FFCD 3SJVB 1TCRA 1D9KC 4XRCB 1KB5A 2UY7A 2Y7QA 5I8CA 3DV6B 3FQTB 4IDJH 3QUML 2DM4A 5DC4B 4M6AA 3HG1A 1I3GL 3UC0H 4AY0A 3MLWL 3MV01 3MRBA 5BO1H 1A6UL 3VD3A 1KJ2A 5CZXC 4P23B 3RNQA 1ZHBB 3F7QA 1HQRA 4NYLA 3MV7E 4Y2DC 1JP5A 2BY1A 4U1JA 3DPBA 1CICD 1EFXD 4R0LB 5GGTL 4F9LC 4HC1H 5F7NC 4WU5B 1IKNA 2EE6A 5CJ5A 3I02B 3CH1A 5HGHB 4JQVA 4XNYL 3KPSE 2BCKA 4KKCD 2VXTL 1WC7B 3U4EB 2NY1D 4ZPTB 1GGYA 3GSRB 2ZUSA 1CLYH 4OFVA 3IJYA 2RCSH 4RSVA 4XT1C 5TQ0L 1I8IB 2GW5A 2XZQL 1HXYA 4RCAA 3S35L 2FX8H 4EVNA 1DQJB 3JBG7 1MUJB 4Y89A 3QT2A 4PJGF 2X4OB 3NGBB 4U7SA 4M6ML 3D9AH 5ADOH 1M7DA 1ES0B 1NCCH 5IWLA 4BQBA 1CWVA 1JL8A 2WP3T 2QKIB 4TQEL 2VDPL 2EEAA 1BIIA 4CU8A 4GG6E 4QRPD 4JM2F 2VKXA 2NY6B 4XAWL 2YUVA 4WWID 3EO0A 3GMMA 2CK2A 1DQML 5EOCL 3MLSL 4F7TB 1EEZA 1ZAGA 3V6OE 3CD4A 3BZEB 1UJ3B 4ODXB 4PR5A 1N4XL 3T77B 1EGJH 1AH1A 5FGCB 4U33A 1G7JA 3MR9B 1ORQA 2E27H 3BZFB 5E6YA 4PS4H 4ZS6C 3N1QC 4X7FC 3DX8B 1IZJA 4IS6A 3RWJB 1NFDA 1ZLWH 4OBSA 4PRPA 5I0DA 1UWXH 4G7VL 2DBLL 2MPAH 4QXTA 4A6YL 1H8NA 2E6QA 3CXHK 1CFBA 1F6AA 1VACA 4BUHA 1MAJA 4NNPH 3LOWA 3MODH 3HI1A 3NN8B 3HPJB 4XBPA 2EZ0D 1XGUA 2BVPA 1TVHA 1I3UA 2BVUA 3AREC 3LKOB 1D5IH 2DQFA 4LSRH 5FUZL 5I18L 5JOPD 4LSPL 4PJCE 1H8OA 4WDIB 3HC0A 4OZHB 1QFUH 1X5ZA 1NMAH 5J7CC 4YE4H 3SKJH 4PG2A 4LCCC 3WXVH 2WUCL 1U0QA 2DLFL 4PB9L 1JZ2A 4WFED 3ORJA 3BO8A 2WINB 1I3RA 2FIKB 3MOBL 1CR9H 1A3LH 1GZPA 2EXWC 2ZP0T 4JFPB 1S7UA 3Q2CA 3U6RB 1RULL 2IBBA 2NLJB 1JMZA 4NQXA 3PHQB 2J88L 2OTWA 5I8CB 4W6YB 4Y1AA 1TNNA 3B8YA 4K2UH 1MCFA 2J3SA 1DVFB 3DHMA 4PRNA 1ZHNA 4KJQD 2EO9A 4Y4KD 1Z9SA 5IB3A 5JA9A 1OTSD 3CFDA 4HHAA 1TTUA 2N56A 1MHEB 1T7WA 3L6FB 4NP4L 2IAMA 2B1AL 4NKDB 3CZJA 2HLAA 3PWJB 4G9FE 3QCUL 2BNQA 3ARVA 3DSFL 4JPKH 3T0BA 4DVRH 2IADB 4P4KA 4CL7A 3NOIA 5JXAL 5EH1A 1NMCB 3MRRB 4OJFH 4Y19E 1YEIH 2OJZH 1U8QB 2CLRB 1SMOA 3RDTB 5T1MB 5T1DL 2DM7A 3IDYB 4Y2OA 3WIIH 3DX6A 4HBCL 3HI6L 4KK8C 3WFEL 1A6ZB 4YFLF 3GUTB 5CGTA 4G8GA 4XZUA 5ID0B 3PWLA 3Q5OA 4GXUM 5ERWA 5F6IB 1F6FB 4NNXA 3O6FB 4HJJL 1M7DB 4YHKH 3PHSA 3DO7A 4NRXB 4L8SA 5CBAB 3V4VH 1X7QA 4JFQA 5D93C 5AWNH 1DEEA 1WFUA 3HPLA 4PJ9D 5DYOA 2JJSC 4RQQB 3KAAA 1T7XA 4MA7L 3VXQA 4WU7A 4ZXBD 4JFYB 5FO8B 4ZAKB 4D0DA 1L7IL 3BPLB 4LLMA 2F5BL 3U9UB 4W68A 1FL5A 1QFOA 1DLFH 5E6ID 5J6HB 5MEQB 5D2LF 4BSJA 5EFIA 3F62A 3BIAX 3VXSA 3HE7B 1CFTA 4I3GA 4X6CA 1WAAF 5ACLA 1YUHB 43C9A 3CGTA 4P49A 5JW3H 1RV6X 1Z5LA 3LIZH 4PRPB 5DVNA 5HDBF 3K8LA 4M4RA 3I6KA 4W4NA 1ZV5A 4V1DD 5KJRL 5BXFA 1IGYA 3ZYIA 5FDWA 2NX5E 1OGAE 2L7UA 3T0EA 4N0CC 3SE4A 2HJLA 3TFKD 1KT2B 2D31A 4Z0BH 4NKIL 2VMFA 4OF6A 2YA1A 4NZRL 1FQ9C 4PREB 3RL1A 3QHTC 1C1EH 2V6HA 4MVBD 3WO4B 2ADJB 3BO8B 4WIQA 3RWIA 4RZCB 1H3PL 5DQ9B 3MQIA 5F7UA 4Y16A 2GK0A 3IFNL 2VUOA 3FB7B 3V4PH 5L0QB 4BZ1H 3DRTA 4Y16D 1CL7L 3IU3A 5GSRA 1LP9E 3O2DA 2F53E 2W92A 5D1ZA 1K2DB 2OK0H 2ZCHL 1MLBB 4PJEA 1ZHNB 5IHUH 3FONB 3QDJB 4KJWC 3UX9B 2VH5H 4IIQB 1DEDA 4HHAB 2JB5L 3QFJA 1DN0B 3KJ4B 4OLZL 2EDLA 4HQQL 3QFJD 5FO9A 4OZGE 5EU6A 5E7BA 4N68A 1DQDH 5EU6D 4U3HA 2GJZA 3J8F7 1MHPH 2F54D 5J57B 3QCVH 1DQQA 5GRZA 5GGRB 2I5YH 2JJWA 2EDJA 4XCEA 1XIWA 2V9RA 1V05A 3MMEB 5HYSA 2CPCA 1OAYL 4POUB 4UIKH 4HXAL 4C4KO 3MSPA 1SJEA 5SWSD 1YDPB 2XQBL 1JHTA 2NXZD 5EPMB 1YNLH 2ZPKL 5KSVA 4OF7A 1QTYT 2HT4D 2E9WA 1DBBL 3BHBA 2R8SH 2O5YL 2YRLA 4AT6B 1P84K 4ZFFA 1FL3A 1PG7W 3O3DA 4MQ7B 1E4WL 4JFQB 3THML 5I15H 3ZL4H 2EH8H 1CXHA 1UM4L 1N26A 5CJOL 4LSSL 3OKDB 4MA1C 3P0VH 4OTXH 3VFVA 2M2DA 3V5KA 3VXQB 1FO0L 4XMPL 5KSAB 2ADGA 1OSZA 1SBSH 5INDA 5L8LB 1OAQH 4JKWA 1TJHH 2B2XH 5GXBB 1K4DA 3FRUB 3JUYA 3MROB 5B38A 1QNZH 3NH7L 5CSGA 1E4KA 2VE6B 4GG8A 1ACYH 4Z78A 1WCBB 4P2OB 3UEZA 2YD1A 4YH6A 2R23B 3RX5A 3LRSB 1U2CA 3B9VA 1TQBB 3U36B 4JY4A 5H35B 1EAJA 2DDQH 3K2MC 1BFVL 3OG6B 4HZLB 4YHLH 4K7PL 2Q7YB 3QISA 4KMTL 5FGRA 5JO5B 4DGVH 1WBXA 2D31B 3C5ZB 4G80A 4CNIB 5GPRA 4HS8L 4OKVA 1FNFA 3RL1B 3QIBD 1NDGB 3CSBA 1DL7H 1VCAA 4OLEA 1F6LL 1NCNA 1MWAH 1ONQA 4IMKA 4L1DA 4OI8A 3RWIB 4E5XA 4U1SB 2GIYA 2J8UB 3FN0L 3T65B 4XI5D 5IFAL 2XTJC 4D3CH 1RJZB 1MQKH 2G75B 2J12B 3WSQH 4IRZL 1KIRB 1J1PH 5GRYA 1N3NA 3RWFA 5JUEL 4R26L 3FO9A 5A2LH 1HEZA 5FYKL 1LHZA 5ISZE 5HGAA 3ZDZF 5HGGS 4GH7B 3SBWC 1ZHKB 1ZA3B 1CXIA 35C8H 2AEQH 2GCYA 1KXVC 3U4BL 3IDXH 3KS0H 2QHLA 2XRAH 3QUMA 1QRNA 4X7SH 1RZFL 5IIEA 4HUNB 2VLLA 2QSCL 1Y6KR 1KELL 1BF8A 2JJVA 3I84A 1CL7I 4B53A 3D25A 4TYUA 1RZIA 4I3SL 3KPLB 3I9GH 3BUYA 1ULVA 3MACH 2JLLA 2VQ1A 1GOFA 3ARRA 5EC1B 1E4JA 2P7TB 5GGTA 2DI7A 2AJSL 2OQJA 4ODVH 4KMQA 3BHBB 4EXKA 4K55A 3F8UB 4JN2A 2OP4L 4KI1A 5B39B 1EBAA 4XNQA 1TMCB 4DEPC 3IXTB 4PJDB 1RHFA 4PJFF 3D69A 1AJ7H 3JTTB 1U3ZA 1AP2B 2PO6C 3EYVA 5B8CC 1NBZB 4NM8L 4IOFC 3QUYA 4UQ2A 5C0BA 5A3IC 4Q9QL 1FL6B 4PJGB 2ICEB 4XPAL 1I8KA 4Y5XC 1T6WA 5INDB 4P9HH 3LEXA 5DUML 1CT8A 1I4FB 2AKRA 2GJ6A 2XQYG 4Z7UA 3ZT6A 1AC0A 3ESUF 1VFUA 3Q6FA 2PTTA 3D39D 1OPGH 4J6RH 2FGWH 3F7YB 3CFEA 4JM2B 5F89B 5JLZA 5D8JH 2AJ3A 4CGTA 2Z8WC 5GZNC 1MREL 3E1F1 3SGKC 1DFBL 1RU9L 1VERA 3U46B 4N0FB 3LZFH 1WWWX 4PRDB 1CDCA 1H3TA 3RY6C 4O58H 4F7EA 5DHVB 3ULUC 1IQWH 2C3WA 3IFPA 5D2LA 3HMWL 5IQ7L 4FFWC 4HIJB 3TYFA 1WAAA 3EHBC 3IKKA 2C9AA 4S1DC 4A6YA 1RFDL 3KNBA 4D0BA 5LGJA 4XP4H 3G5XB 4JRXB 4IJ3C 4LNRA 1L9MA 1J1XH 4X6FB 4DGIL 5I1KL 2W9LA 1GOGA 1ONQB 3BXNB 3F6IA 5GSVB 4GAFB 3C6SB 1MVUA 3V4UL 4E42A 5EIIA 3W0WB 1MRDL 1MIML 1CFQB 4ZTOL 1ZT7A 1S9YA 2XN9E 4JFDD 3PXJA 2VXSH 3GSOB 2X41A 1A6VH 1N3NB 2IH3B 2YKLH 1ORSA 3A6BL 5JIPA 2OJEA 4OD3L 1HHJA 2FYYB 3TP4A 1HEZB 4U6TA 5F9OH 3BISA 4KUCD 3FCTA 5EWIL 4M48H 4U1HB 3MRGA 4HG4J 4XCCL 4KTDH 2AI0H 4MSWB 1FG2B 4OT1L 3ZSTA 2VLME 2D4FA 2Q86B 2OLDA 1KIQB 5H37H 3L3IB 3MUGA 1IM3B 4MAUH 2D3VA 1OTUC 2EYTB 2RQ8A 1U8MA 1GSMA 4PJAE 3D25B 5IW1A 1P9MA 2ED8A 2V7HA 4X7EC 2VQ1B 2X4TA 4LSTH 5IK3A 4YGVA 1MPAH 5FUCE 4HPOH 4IHOA 4JQIH 3QDMB 1ZVYA 3MJ8B 2IPUG 3SGDH 2C1OA 4QO1A 1MNUH 1HHHB 1T3FA 3CFJB 1FAIH 1M6OB 4XXCA 4CVXA 1CD1A 3BDYL 2KUTA 4UTBH 4L29A 5TGBA 3LSOB 3NABH 1JPSL 3S7GA 2HKFL 1QR1A 2PKDA 3MJ9L 4MHHG 2FHFA 1Q9OB 2JIXB 4I3RH 4J2XA 3BWAB 4LCCB 2EE9A 2AJZA 1G7HA 1IC5H 5I1GH 1FZKA 2R1WA 4OI9A 4E0RB 3UTSE 4M7KH 1N64H 3TBWA 4F7PB 4WWKA 1CFSB 3TJHC 5GGUB 3EFFB 1SEBA 1R5IA 2VL5B 4PUBH 1UACH 1BD2B 3NZ8B 1K8IA 2A73B 3CFCL 4JLRA 2DQTH 2X4SA 3RU8H 3U0PB 5JR1H 1O5DT 3V0VA 4O51B 1U2HA 2CQVA 1AD9B 4RWYH 3U1SH 3C2SA 4U6VH 4MWFB 3LKQA 1Z9OA 3H9SE 2Y72A 4OCLC 3IFPB 3RZCD 4MA3B 2G5BB 5IG7B 4NC0B 5KVDH 5EDXA 1ZTXH 3BYYA 1I9IL 2Y5TB 1TLKA 1NCAH 3UJIL 1RMFH 2I07A 3IJHA 4IMLB 4B41A 1FZJB 5KTEH 1OCWH 1S78D 1GAFL 1UJTA 3E6FB 3RNKB 1F58L 4LSUL 4TVSa 3GSUA 3D0VB 3NA4A 2E9JA 3SDDA 4MLIA 3KPSB 3EYUL 3IYLW 3EIFA 2Z4QA 4U6YB 3V0AC 3SDDD 1ACZA 4E42B 5GS0D 3GI9L 3V8CA 4OLUH 5D4QA 3WFZA 4CU6A 4KI5F 2AJVH 1DLHB 3MLYL 1D6EA 2P5WD 3MOQA 4X80L 4M1CD 2MOVA 3H9HA 3TC9A 1YQ2A 5GHWL 5BS0D 3LAFA 2DN7A 4OGAD 5CD3A 3Q1SH 1ORSB 4G6MH 1HHJB 4OZIA 5D93B 2WK2A 3C6LC 4UBDD 4XX1E 4XPTH 5I1JL 4O2CA 3NA9L 5EZLA 3B2UC 3QUXD 4GG6B 3OF6D 5IB4B 3TBYB 1BGXH 3GSNH 3CFBA 3PV6A 4H0IA 2VITA 4ZOEA 3P4OA 1NBVL 3JTSB 3MRQA 5EOQH 4LLYA 3R8BB 2R1XB 2R69H 4JO3L 4IRJA 4KDWA 1L0XA 3QH3A 1CGXA 4Z77B 3CDFA 5M95B 3DBXB 3WDHA 1IGIH 4DN3L 3WFBH 4M5YL 4P5MB 2Z31D 4CN1A 1P4LA 3Q3GA 3VI3E 2YPVL 1R3JA 3O2WH 3D2UD 2AEPL 3KR3H 4NQED 3X11A 5C07A 3P9MA 3LQAL 4K8RL 1UYWL 3G5VB 5C09A 3C60D 3T1FB 3HC4H 3MRIB 4Z0XB 4X98A 5ENWA 3CVHB 4R7DA 1AKJD 5A2FA 4L29B 4WRLA 1LWRA 5FYJD 2DIBA 1NGPL 3KYKL 5F9WC 2P5EB 5LGHH 4QHMA 3K46A 3KXFE 4HSQA 4U1MB 4JCMA 2ITDA 4L9LB 1N7ML 1QA9A 4DUXA 1LMKA 5JNYA 3UYRL 3H0TB 1I1YB 1G6RH 3ZKMD 2EKJA 4G43B 3G6DL 2JE8A 3NFNB 4E41B 2FWOB 5C9JB 1AO7D 2WIIB 2OS7A 4NJAL 4YFDB 2OMBA 5L6YL 5F7MC 4R4BB 1DE4A 5JHDB 3DYMA 4F58L 4ZUWA 1KEGH 1FO0A 5J4MA 1ZHLB 4R3SA 4Z95L 3QIWC 1RZ8B 5DD3H 3LEVH 3QCTH 2UYLB 2XFXB 3V7AG 2GFBB 5I1LA 2VO5A 2JB6A 2R56H 5L2KA 1NEUA 1QFHA 3M8OH 5F1OB 5ILTH 1F13A 4R96A 1FV1A 1MAML 4PV8A 1A0QH 4QOKB 1A1NA 2OR9H 2A9NL 2Q3ZA 4HCRH 5IV2B 1AFVL 1INDH 1RZJH 5F7HA 5JOEA 3HZYA 3LQAC 5D1XA 4HULB 1WJ3A 2NXYC 3QUZC 2ZG3A 4KRPC 3I75A 2ERJC 4PBWD 5ITBL 5TQ2L 1XGTB 1QLRA 5B3JF 4OLYL 3SE9H 4R2GC 1MCWM 5GIRA 4NFBA 4ODUA 1C7TA 4FP8H 4ZYKB 5D7JD 5DD0H 4U1KA 1QBLL 7FABH 2DLTA 1MFDL 1PFCA 3CMGA 1ZGLP 5DA4A 1AD0B 5C0EB 1JF5A 5HYFA 3REWA 1WIPA 2VAAA 3OPZH 5CP7B 1JV5B 4LAQH 1IGJB 5CD3B 1MJ7H 1RUKL 2AJUH 2ORBL 3WEXB 1T5XA 1N8ZB 4FXGB 1KJMB 4G6KH 1LNUB 4MA1B 4LBEB 4RMTA 2AV1A 4CN6A 3EYQC 1CTNA 3VI4F 4LLWA 3MRQB 3U7YH 4QRQB 3UPRB 3A6OA 1RIHL 4AYFA 5DJ2A 4U2YA 1C8PA 3IFLL 5DJ6A 3Q5TA 2APXA 5IOPA 1W72H 4M5ZL 5C92A 2BK8A 3PL6B 4N5ED 3VXUD 1FNEA 3WKNA 2BVQA 4MNGB 3TGXA 4JCLA 3KPRE 5C0JB 3KPQB 4D9QD 5T3ZL 3ZE1E 4KRLB 1O7VA 3JV6A 4ODHL 1N6QL 4R7DB 1ZGLA 2FJHB 5JDJA 3WLBB 4P9HC 1IM9D 2NMSA 1LE5B 2YEZA 4P59L 2Q8BH 4WUUB 3VGAB 3QWQB 4KK5C 1BPVA 3O2VL 4DZBB 1LEKA 5C6PB 4NZDA 1T20A 3K0WA 2DM2A 2ZWLT 2DTML 4Q9RH 4NBZB 4MQXC 5IB1A 5HI4D 1HH6A 3OAUL 5F6HJ 4ZFZA 3UAJD 2XTJB 3ULVD 1D5BA 1WV7T 2HJFA 4KHXL 4PJFB 4D0CA 4XPHL 1SJXA 5CSZA 1T89C 3KYOA 1GGBL 2V9QA 1QBBA 2W0LA 4M9OA 4P5KA 3G5YA 4HJ0C 4W6XB 1OAXH 2G2RB 1PG7L 3W11C 4BKLA 3FTGA 1SMAA 5D2NE 3SDCD 2ATPB 5EIQA 1ND0A 1A6WH 4OZGB 4Q0XL 3SJVD 5I1IH 4HWEH 1FV1B 4NM4H 5KSUB 4OIAA 4CDGC 1NAKH 5E08L 1Q72L 3TN0A 1NC2A 3CXDL 3SHSA 2CD0A 1FC1A 1VFBA 4Y5VB 3GJFA 1NC2D 1FPTH 2X09A 5I1AB 2X89D 1AGBA 4KQ4L 4X5WA 4P23D 4PFEA 1B2WL 1H5BC 1LK3L 2D03L 4U1KB 5IESH 3VW3H 4ZDHB 4P5TA 5KS9A 5TDPA 5E7FA 3FO2A 1GGCL 4DTGL 5JORA 3NZHL 1NSNH 1JMXA 2W59A 2IPTH 3GGWA 4ENEC 1YYMH 1OP3K 5BQ7A 5TDNB 2WWMD 4DEPB 4PD4K 3BIKA 1I8MB 2ESVA 4PJ5E 3L95A 5E1AB 3TV3L 2R0WL 5B38G 2PO6B 5F3HA 5B8CB 3VFUA 1FC2D 5TFSL 1A6PA 1HI6A 1KSRA 4Y5XB 2YD7A 3L5XL 3PHOA 1CFVH 1U42A 2JELH 1T7ZA 1IL1A 3QPXL 3B83A 1RZKL 5C86A 1UCBL 1HHIA 1U8IA 2D7QA 3L3KA 4G8EB 1EA9C 2BFVH 3P0YL 1AGCB 1BBJB 1KXQE 1T2XA 5BVJB 5I73B 2HP4A 4JFEA 1IC7H 2H26A 3MV9B 3RP1A 5JW4N 3BPOC 1UXWB 2NY6D 1HYSC 2YD3A 4JFED 1T7YA 3RAJL 5GGRY 4F9PA 1WTLA 1BOGA 1F45A 2DLGA 5DF0A 1HSAB 1DDHB 4NKQB 4UDTB 4UV4H 2OX5A 1RZGA 1A14H 3O45B 4LVHC 4DVBB 1JK8B 1FNAA 1QSZA 2AQ2A 2YD4A 2YPLE 4IJ3B 3QEQE 1T5WB 3BD3A 2MKWA 3WUWA 3HAEA 8FABA 1F8TL 1N0XL 4OCWH 5JMRA 5MERA 2AK4E 1IAIL 1BQLH 4KV5F 3HNTL 4YEEA 1ODAA 4KQ3H 1MI5E 1CGWA 1F4AA 2HKHH 3MJ9A 2Y07H 2A0LC 5IJKA 2FIRT 1QQDB 2R9HD 5CIPA 1AGEB 2DLEA 3MRFB 3X3GL 3F7VB 4ESKA 5GZOD 1URLA 2N4IA 1IC4L 1T0MA 5J13C 1MY5A 1SYSB 2EDHA 3VXMA 3QQ3B 4KKNA 5C2BL 1RZKC 3WLWD 3FKUS 5DEFA 1IGFL 3VXMD 3PQYB 4OCXH 1U8KB 4YHPB 3LS5L 4G8IB 4U3CA 4FQXC 4EQ3A 1NL0H 2XY2A 4HUWB 5CJXC 5T5NF 1A1MA 1MCKA 1HCFX 4LOUC 1KIPB 3OXSA 1A7QL 4ETQB 3MV8B 4POZC 1T83C 2DWEA 5EIVA 2HH0H 1E6JH 1GH7A 3MRMB 1AR2A 3OJ2C 5IMKB 2G9HB 2H3NB 4ZQKA 2VZ1A 1DVFD 2P8MA 3HRZB 4X7TA 4I18C 1ZWIA 4MNQE 5A16B 1YEDB 3FRPG 4UT6H 5TJWK 1NAML 3TBSB 3TVMC 3ZE2F 3ALXA 3BE1H 3EDEA 3MRNA 4NOBA 1XCQB 4P5TB 1NC4A 3VXNB 1KPVB 3DUUA 3REVB 1I1FB 3LKPA 3RGVC 3MLTB 5ESAA 1F97A 4GKSA 5DS8A 4TTDD 4ZUVB 1AE6H 1UZ8B 2AK1H 1CZ8H 1QOKA 5ICXA 5AYUH 4JR9H 4BQCA 4HT1H 1JWMA 2YPKB 3QI9A 1J5OL 2A38A 3GSXA 4NC1C 1NBYA 3EOTL 4RBPK 4FZ8H 4PP1C 3OB0K 4DCQA 1WQVT 2VZVA 2CDGB 2DQIH 3GNMH 2DD8H 4F37F 1V3JA 5DR5L 4UOW1 3LH2H 1S7TB 1A7NL 1MEXH 3HS0B 3OHXB 5HGBA 1U3HA 3N50A 3O6FD 1FYTB 1U8HA 5ICZB 4OUUA 1HNFA 4JFHE 1FGNH 3X12B 1NEZA 1U3HD 4GW1A 3O8XD 5EZOL 1UXSB 4HD9A 1F3JB 4QXGL 2WUBL 5KN5B 3IT8D 5IB2A 1TZHB 2H26B 5FF6A 1WT5C 5D7IF 3JWNC 2NY7L 4EN3A 3MGOB 3ZHKA 4CVZA 3FZUC 1TZIB 5HHQB 3MX0A 4EN3D 4WFFD 1TZGH 5IROA 1C5DA 1CGSL 3FO1A 2MQ3A 2P47B 3AMKA 2DQUL 5DQDH 1E27B 4MAYA 4NPYB 1RUAL 5IMOB 1GGIL 4NRYB 3HE7D 4NGHH 4UINH 1PKOA 3TJEL 1HQ4A 2DS4A 1OP5H 3FMGL 5FIEA 1FORH 4J8RA 3V52H 4NT6B 5HHOA 4WHYG 4YNYB 2MCG1 2FL5A 3SCMC 1FSKC 2R2EB 3BP6A 3E2HC 1S7QA 2QSQA 3PIQA 2P44B 3ECBB 2QQNL 4JO1H 4WI3A 3PWVB 3M45A 5IM7B 2EC9U 1ROWA 5BV7L 3LPGA 1WGOA 3ZHLA 2BJML 3RIFF 4BZ2L 5F7WC 4M62H 3QA3B 4C59B 3DNKA 1A9BB 4K23H 1GZQA 1QHPA 3G04A 1SYVA 3CX2A 2H6PA 4X9BA 4AH2A 1XGPA 4YHNB 1ZVSB 3TO4C 4Z8FH 1RZJC 2MKLC 1LE9A 1F5WA 5EO9A 3AAZB 3DTXB 4MA8L 3GO1L 4KZDL 3RVTD 3GBNH 1HSBB 4QRPE 3WNLA 5A40E 3BP4A 4PLKD 3UTQA 5DJXA 2DWEB 4UAOB 5GGQL 1N0LA 3O3AA 1AGFA 2DQGL 3BAEH 4NRZB 4P2QE 4WFGD 3BGFB 3SO3C 2A6DB 2VABB 3BEWB 4KWUA 4EDWL 1XF4A 5EO0A 3QDJD 5EUOF 3LKNA 4JHBA 1JN6B 1DANU 3O4LA 2Y4SA 3MYJB 3MRNB 1WZLA 2A2QT 1L0YA 4OZFG 1LD9A 3I50H 1FLTX 1UQSA 3DV4A 5C0FA 5I6XC 1YMHA 1QFWH 4X6DF 3SKNA 1GHFH 1OGTA 4OLVL 5DUBA 4KTYA 4GKNA 5DZNA 1N6UA 5E2JA 1BAFH 1J8HA 3FB5B 5DTFB 3TH2T 1LILA 4O02L 5JOPE 1J8HD 1NANI 5IP4A 5FA3A 2CLZB 2R29L 3UTTD 3DRQB 3GIZL 3LN5B 1CGUA 4URTB 2WBKA 4WFEE 2F74A 3O3BA 1A1OA 1K3ZA 3QDHA 4MQTB 5GISH 4Q97A 4KKLC 5AYQA 3MLZH 3GBMH 1I7RA 2WLZA 1L7TH 3QIWB 3MCLL 2WBJD 1Y0LA 4XAKE 1BBDL 3VFMB 1CXLA 1TJIL 2A6JB 3NVQA 4QRUB 4RBPH 5KSAD 1PX3A 2IANB 4S0TD 2HFGH 1MWAB 1IEBB 3TBVB 5MENE 3G5ZB 3TBTB 3OB0H 5J0BA 2R4RH 4P2RA 1U8NA 2B7DT 2AQ1A 3QNZB 4EKXA 4HMDA 3K3QA 3QFDB 4FQ2L 4G42A 3S4SA 5BZDB 1A9EA 4P2RD 12E8L 4PPTA 1KJ3L 4QHLA 5HHOB 2OTPA 4QTIL 4P2OD 1YC8A 2NXYB 3QUZB 4KRPB 5ID1B 1VADB 4NZUH 2UZIH 2ZSWB 1G9MH 2ERJB 3IAGC 1YNKL 3PF2A 3GSWB 2MTPA 1KIUA 5IHLB 5TE6H 4R2GB 2FSEB 1RD6A 2E8YA 1UEMA 4HLJA 3RRQA 2R4SH 2ICWJ 4J3TA 3NIDF 4HZAA 3RWHA 1MCDA 4GKZA 3BH8A 4YDKH 2BVYA 1IKFH 4P46C 1JPGA 3BKCH 5I66A 4HKBB 1EIBA 1ITBB 4NWUL 3IAQA 5AAMA 4GW4A 3L3DA 1PG7X 5F1NA 1IGML 3VA6A 3IAPA 4HUXB 3RWEB 3GRWL 4WI9A 4NCC1 1UVQA 25C8L 1R3KA 4ZFOB 3MZGB 2WP3O 5JQ6H 3FO0H 2V17L 4K94H 5E00A 4ODTH 4OQTL 3WXWH 4C83A 1F4WH 4HUUA 1CXFA 3S5LB 2IFFL 2ARJB 4OBRA 3WDIA 3LKRB 5JIHA 3FT3A 1IMHC 1CU4H 2GTZA 5FHBH 3P73B 1VKXA 4HAGA 1IVLA 1G0DA 1RVFL 4KY1L 3VE0A 4HWBL 4ONFL 1YEJH 1BECA 4JHWH 1PLGL 1F11B 5DJYB 2O61A 4YBQC 3ZTNL 5C0AA 3BZ4B 1UQSB 4H8WH 1C5CH 1EBPA 3NCMA 4GKNB 5DMIH 1IAOA 3HC3H 3O6KH 5BMFL 4XB7A 4J12A 5HHMD 4MNHB 5D5MF 4TNWF 2Z8VC 1U95B 4OAWA 3GB7B 3WS3B 1X5IA 1RZ7H 4BELD 4FABL 3UC0L 5E8EA 5BO1L 3ETBF 4X99A 4JM4H 2EDEA 3FHAA 4AJ0A 2FD6L 4Y5YA 4UTAL 1ZLSL 4PGBB 3MA9H 4ZUUA 1FG9C 3DUSB 4HC1L 2ENSA 1J87A 3SO5A 5E95B 3F5WA 1D9KA 4JPIB 1FVEB 2X9YA 4Z18A 4L4TB 4PJHE 1Z9MA 2BHUA 4PTTA 5D7SH 1D9KD 3LVEA 4J3WA 3UBXA 3AS0A 5EBWA 4C58B 1GPOH 5B3NA 2GTWA 5D7IA 2FX8L 1LK2A 4NWTH 4M00A 2F54E 2A74B 4RMRA 1EHAA 2A77L 5CZXD 2EKSA 1WK0A 3HB3C 4YK4C 1H5BB 3SQOH 1JZ6A 5EBLA 4F9LA 2GAZA 4Y2DD 1SJHB 3TO2B 3BGAA 4XC3L 2AP2A 2L7JA 1KLGA 1CTOA 2NNAA 5E99L 1BLNA 1PAMA 3VRJA 5SX4H 2DM3A 1QSEA 4JRXD 5E5MB 1TCMA 4UDUA 4H1LB 1QSED 3OR6A 1UVQB 4MDIB 3C5JA 4R8WL 3I6LE 3VJ6A 4HUUB 1C08A 5C0IA 5HPMA 2UZXB 3HZMB 5EORL 1YA5A 4HIEB 4M1GH 5GRJH 5H94B 1T0NB 4Y0GA 4ZPVA 3D85A 1OT1A 1H9VA 4RFEB 2BXYA 4AENA 2OM5A 2FDBP 3WD5L 1T1XA 4YDLC 3B4NA 3TCLB 2CH8A 3BPOB 5F9JA 1I7ZB 3SGJA 1FNSH 1GGUA 3VGEA 5FUOL 1NMAL 4YE4L 2BX5A 4PJ8C 4LIQL 5C6TL 2ATKB 5I1DB 3P4MB 5L7XL 3SGEH 3P77A 2ZOKA 2DQJH 4MB4A 4JPVH 4LVHB 1P7KA 5ANMB 2F5AH 1Z0NA 1E0OB 4X4ME 5DI8A 2V7NA 3WIFA 4EUPA 1A21A 4Z7VF 3QDMD 1S9XB 5T3XH 5TE7H 3RPIA 4UUJA 4K2UL 2FJFA 2PUQT 3KS0J 4LLAA 3RVXC 4S1QL 1B88A 4QWWC 3HZKA 3ARED 1EUUA 4N0UA 5JW5A 1BIHA 2E7CA 5IEHA 2JIXD 3L3OA 1YNTA 4YHIA 4J1UA 5J13B 3GIVA 3QEHB 3CSGA 2AABL 4BZYA 2W9DH 4APQA 4WJ5A 1QLEL 3MJ7A 5HY9A 5HDQH 3CDGB 3NACH 3UP1A 1KENH 2VLJE 3B3IB 4U7KA 1CLZL 4B7LA 2EXWD 5GS0H 3O3EB 1FFOB 1NLDL 5I16B 2OJZL 4RIRB 4ZOAA 3KPPA 1S3KL 2PYFB 4FQXB 4PGDB 1Q94B 2Q87A 3UBXB 1YPZE 5CUSH 1Z3GH 4XHJC 2VISA 3WIIL 2E7LC 2UWEF 1VFMA 4LEXH 1ZANL 2I60H 4B50A 5CAYB 4LF3B 3HRPA 1JF1B 4GBXC 3FQWA 4FFZH 4I18B 2VLRA 3TVMB 3MV7A 4XXDA 1BFTA 1CBVH 2FLBT 4UZGA 3MV7D 4JY6B 1EAPB 2X4UA 3GSNB 3RGVB 5D7LB 5HHPA 5CHNA 1QFWM 1B90A 3RWCB 1CFNB 3UDWC 2D0GA 2NY4C 3ARBA 3KPSD 3O9WA 1ERNA 4L4VA 3B9KA 2VYRE 5ACZA 1JNLL 4WY7H 1H3VA 3QIUC 5TH2B 3T3PE 4JY5H 3BOVA 4KK8D 4OM0H 1VPOL 1PSKL 1XF2B 1MAKA 3IGAB 3BP7B 4GW5B 5T1LA 2I24N 5F96H 3EBAA 4ZO8A 3QXDB 4WW1B 2EIZA 2VSDA 4FZEL 2XZCL 5FYJH 5J06A 2JJSA 4JG0H 1HXMA 4TUJB 1S7RA 1HDMA 2XWBA 4QF1A 1SQ2N 3DX7B 3D39E 1AQDA 3ZE0E 3L9RB 3V6OA 5I76A 2GUOA 1TXKA 3T4AB 3DXAB 3HAEG 5ESQB 1K5NB 1C1EL 1G6RB 2DJ4A 3EDFA 2BNUA 2QSTA 3UO1L 4JRYB 5EUOB 3MUJA 4X9GA 5K9QI 1NAMB 2MFNA 3CPLA 4JFZH 5EB9A 3SCMB 3E2HB 3FQXB 5KZCB 4OF8A 2N7AA 4D2NA 3AU1B 4I0PA 2FZ3A 4X6DB 3O11A 5IHUL 4MYWB 5MP6L 4W81A 4I0PD 4N0CD 2DJSA 3HZKB 3QQNA 2IGFH 4PJCA 3FOLB 4FQ1H 1Q9KB 4QHUA 4NO2B 3MFFB 5KVEL 2J8HA 2P5ED 3X14B 5ALCL 3GMQA 4XH2A 1M7IB 4JFDE 1X6LA 4QCIA 2EDOA 1JHKH 4YXHL 3SEPA 4PV9B 5CKAA 1S7WB 3TO4B 4WI8A 1I7UB 5FM4A 4XP1L 1OM3L 3EOYG 2XOTA 1FZMA 3H7BB 4FHBD 1JRHL 4KUZH 4AEHH 2DL9A 2BSSB 1G9MC 1OAZL 2X4NB 3LKSA 1RIUH 3F7PC 4I77H 4QLRA 4OIIH 4MCYA 5JHDD 1E4XL 4ELME 1DUZA 1BVLB 3BDXA 3H9ZA 4LSDA 5HGDA 5FCUH 2CIIA 2PTVA 3SO3B 4FTVB 4LHUD 2ADIA 4KJWD 4OV5A 4DZ8B 1M71B 4LRNL 4FQLH 1WBYA 4G9FA 3S34H 5I15L 4O4YH 3QJHB 4QRTB 4ZFGL 4JZNA 5HHPB 4OM1H 5I6XB 4NNYB 1LDPL 5F1IB 1W0VB 3BGMA 4QOKD 3WNKA 4Y19A 2Z92B 3X3FL 4Z7QE 3RI5F 4OLWL 1SBSL 4GMSL 1AIFA 4XWGL 4I2XE 5BCAA 1CD9B 5HHNA 4GQ9L 1YZZA 5SWQB 3L3JA 1NEZG 3EO1A 2CIKB 1YEHH 2HG5A 4QHKJ 2BY0A 3CFKB 5KVMC 3MNWA 3MNVB 1MCSA 4L5FH 1QKZL 2EIBA 3MUZ1 1ZSDA 2AW2A 4MZ3A 2Q3AA 3MOAH 3BPNB 1MJ8H 3GRWA 3QZWB 1LO2L 4QYOA 1IGTB 4HUKB 4H8WC 2H9GA 1FFNB 2ICWI 4OQTA 3IJSA 4FRWA 5HVFB 4IEFB 4QXUH 3ZDYE 3TIEB 3BW9A 1GIGH 3W9EB 5T3XE 2IFGA 1NGWB 2FJGA 2EDTA 4HWBA 3OR7A 1AXSB 1C16A 2CKBB 2J6EL 3KHOA 3SDAA 5ALBH 1U8OA 5E8NB 4W4OA 1UB6B 1KEML 4U2ZA 4G9DA 5D72H 3WSQL 3AB0C 4UILH 4YDJB 2RFXB 1P2CA 2FZ3B 4R4FH 2Q8AL 1G7MB 1OGAA 2NX5A 4HUVA 2FATL 4JO4H 2DI8A 1OGAD 4LP5A 4NBYB 4HX1B 1R3HB 4P46B 3VFSB 4CW1B 5F1SA 4XVJH 4N8VB 3IDXL 1AC6A 5D5MB 1QBMH 3CZFA 5BS0E 4X6BB 5KVGH 4ORZC 3EJZC 3ZDXE 4X7SL 3IXAA 2P48B 4HLZH 5HYQB 4WGWB 1J8KA 4KK6C 4WHDA 4YUEH 3RBSA 3WJLC 1P1ZB 2XTJD 4WI4A 1LP9A 3ARGB 4KRMB 2F53A 1J18A 2CXKA 4LAJH 5K9JH 2W9EH 1FIGL 4HC1A 4ODVL 1TVBA 2HTKC 1G1YA 4P2QB 2UV3A 4BSVB 1JZ8A 3IS1X 2ADIB 3SBWA 4X8JB 1JWUB 2IQAA 3PNWB 5IHBA 1FCGA 3MJ6A 1NCTA 2YA0A 3WCYA 4C56B 1MCPL 5SWZE 4LDOB 3E8UH 3ARZA 4RA0C 3PDDA 3NCJL 3LN9A 2AERT 1E6OL 2AEIT 4NUGH 4Y4FC 1ZLVK 1GYAA 4R7NA 2RBLA 5FYJE 3TT1H 5EZIH 4NQSB 1S5IL 1Q0YH 5INCB 5D8JL 4OLXL 1R3LA 1UKQA 2VNCA 2XKNB 3G6JE 4PP2A 3ULSA 3QWRA 3C9NA 3ARXA 4MD0B 4WTWA 5T5FH 2VN4A 1EGJA 4U1NA 1KBGH 1AO7E 3CSPA 5EG6C 3EOAA 1PDKA 4N90E 3ARQA 3HNSL 4QTHB 3D6GA 2PO6D 2BC4B 3S4SG 3K8KA 3IJSB 5A3ID 2PW1A 1VSCA 1II4E 3V6ZA 4JQXA 2W0FA 4KK9C 5MENB 5JXEA 5HSFA 5T1KA 5FYKD 1MFBL 2QHRL 3JVGA 2NW3A 5EU5B 4A2LA 1FLRL 1OT2A 2YK1H 3SGKA 3V9FA 1B4RA 5JW4R 1FVDB 1JZ4A 2IQ9L 4ZUSB 5GZND 5DRZB 5ICYB 2CXGA 3MV9D 1A64A 4WEBL 4JGMA 5CBEB 3HZVA 2YKLL 4YX2L 3ULUD 1T4KA 4YK4B 32C2B 1IBGH 4FFWD 1WFNA 4LASH 4Y88A 2K7PA