2Z8VC

Structure of an ignar-ama1 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
AWVDQTPRTATKETGESLTINCVLRDASLELKDTGWYRTKLGSTNEQSISIGGRYVETVNKGSKSFSLRISDLRVEDSGTYKCQAFYSLPLRDYNYSLLFRGEKGAGTALTVKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Apical membrane antigen 1
publication title Structure of an IgNAR-AMA1 Complex: Targeting a Conserved Hydrophobic Cleft Broadens Malarial Strain Recognition
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 26
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z8vC00
3SDXA 2J88H 3K1KC 4PY7A 2GUOA 5D2LF 5HTSA 3GM0A 1F00I 3VFUA 4BZ2L 2AEWA 4AQOA 4EN3A 1KFAL 4MNHA 5FYKL 4JKWA 1QO3B 2NR6C 1CFQB 3ARWA 4RRPG 4JB9H 4YPGB 5TQ2L 4E42A 2IAMD 4DJMA 5ESQA 1UJ3A 3PIQA 5FO7B 1A2YB 4PP1D 4OLXH 2YPVL 2MJWA 1JJUA 1V7NL 5EU6D 2J2ZA 4HIHA 4JFFA 3UTQA 3O6KH 4OFKA 5MP6L 5FA3A 1NCUA 4TPRL 3VFTA 3TBVB 1D5IL 4ZTOH 5KSUB 3M1BB 2XT1B 3UTSB 4HH9B 1RPQA 3TA3B 4MCZA 4X4XB 4WUUB 3T4AA 2WBWB 4WO4A 2XTJD 3IFLH 5DJAA 1YEGL 3CX5J 1RZJH 4JY6A 3MRLA 3U2SA 3X3GH 3LMJL 3NFNB 3V7AG 5I1CL 1BBJB 3LQZB 4OIAA 5IFAH 5F7HA 5IHZA 3LEYH 2FB4H 4MQ7A 2RFXA 3LY6A 3IDMA 3TA3C 1WCQA 4UTBH 4PLNC 5C6WH 2DLIA 5DZOA 3QDMD 4FFZH 4OIBA 5F1SA 4KZEL 3QQ4A 3MUGB 3VA2C 4BK4A 2SEBA 2VDLL 5HHOB 3REVA 4PBWD 5BZWA 4JFQB 3RX8A 1A7QH 4YHNA 1AXSA 1OWRM 3VH8A 1QRNE 4M00A 4OLEA 4K3HA 2VXSL 2G75B 1J11A 4DZ8A 2Z8VC 2GJ6D 2BNRD 5DJXB 3VFRA 5FM8A 1L0YA 4JY4B 3UC0H 2B20A 3VGEA 2DQJH 2IPUK 3RA7L 3NIDF 2J7LA 5AZ2H 3O4LD 1LDSA 5D6CB 4G6KL 3VG0H 1OARL 5BVJB 4OZ4A 4QRQB 1BFTA 2CXGA 1AGFA 3EDEA 1T83C 3O3EA 4BKLB 5D72L 1F4HA 4G9FA 2QV2A 5KG9B 1FE8H 2VQ1A 4N90D 1U93A 2IPKB 5EBLB 2BY1A 4JGMA 1JYWA 3EOYG 4KJYB 2X7LB 4F57H 2ZUWA 4R8WL 2DN7A 2PXYB 4XP5H 1A64A 4RAUB 3LRHA 2F53D 3UZVB 1B6DA 4R7DB 1BOGB 1AKJB 4OF0A 5C8JA 1FAIL 3OL2A 4I3RH 3JSSA 4GRWE 4LKXB 3PV6A 1J05B 5D7KE 5CHNA 4MJ5A 3AXLA 1TCRB 1V3LA 1U41A 2C4XA 2AJZA 3DUSA 3NACH 1G6RL 3D2UD 4KDTC 1DL7H 4KXZI 3VD4A 4Z7WB 2PXYC 2R2BB 2VIRB 3DYOA 3C5SA 1B2WH 3VD5A 4EQ3A 4JRWA 1NEZG 4DK3A 4H0HB 3DX6B 1CD1A 1U8NB 2FO4A 4Y1AD 3EYQC 2OX5A 4PJ9D 4KVNH 3G6AB 1A8JH 1HH9B 3H42H 4N8VG 3JV4A 2FCBA 1HINL 2GTWB 4JLRB 1U8QB 4NWTH 2R0KH 2GCYB 5ITBH 3AS3A 3ILQD 5D93C 3VGGA 3IFOB 1MREL 4NT6A 1F3JB 2VWEC 4U49A 3TF7C 2FHBA 4LLWB 1WITA 4OZFA 3G08A 4XVSH 3VJ6A 4QRSA 4D8PB 5LGHH 4HCRL 2DD8L 2W9LA 4DQOH 5HI5D 4ZG1A 3WD5L 4OD2A 15C8H 2NY3B 3P0VH 4JHWH 4RQQB 3OKLB 2J4WH 1A6ZA 1M71B 2BNUA 3UTOA 3ZTJG 4PJ5A 1WLHA 4FZ8L 5KS9B 5F8QC 3PWNB 2YBRB 4CN6A 4HUWB 4NKOB 2UWEF 1IFHL 1ES0B 3NH7H 5DD0L 3FN9A 1CDIA 3I75A 3OKMA 1JZ7A 5EG6C 1FL6A 2YR3A 1NEZB 5J13B 2ZNWA 4MD4B 1I4FA 1T20A 3OSKA 3SE9L 3ZDXF 3SDCB 5H35B 2PTTA 3GHBH 5KW9H 3HHRB 5DURB 2NNAA 4N8VB 1DCLA 1HHHB 4HAFA 1T22B 5D9SA 3C5ZC 3TCXA 1ZGLP 5BRZE 2JJVA 4KROD 3LKNA 2CJUH 4U1HB 3EJZD 1INEL 1QBAA 2BNQD 2R23A 4HS6B 1MJ8H 2GSGA 3C6LD 2B1AL 5F7DA 1QKZL 3RGVB 2LTQB 5DJCA 3ZDYF 5J13C 3QEQD 2FO1A 4R2GB 3K2UH 3SDCC 3TO4B 3OKYA 5C09A 2CRIA 1UKTA 2LU4A 2C3GA 4AIZB 2R56H 5ISZB 4Y19D 5J1AA 2DQTH 5K9KB 5IBUG 4KDWA 4U1LA 3OR6A 1DN0B 4XNMA 4OZFH 5EWIH 3LKSA 4FP8H 4KI5D 4XPFH 1QRNB 2IPUG 1ZK9A 1JHLH 4NUJA 3RGVC 1Z9LA 2LTQC 5IG7B 4R2GC 4P5KB 3TO4C 5JQ6H 4UIMB 5F9WB 2UZIL 5CLWA 4NKDA 3MRDA 1A0QL 1MFEL 2APBA 4NM8L 4L4TA 2QKIB 4M1DL 4DWHA 2LQRA 3VXNB 2QL1A 4I2XE 5IGXH 5SV3A 3S36L 4FFYH 3TV3H 1LO2L 4XCNB 1ORSB 5TE6L 1S9VB 2EEDA 2OL3L 2YZ1A 2XY1A 5F9WC 5CJXA 1G7JB 3B9AA 1A21A 1RIUH 1YEDB 3D87B 3D1MC 3QT2A 2W0LA 1RIHH 2VITB 1XH3A 4J3WA 3RWGA 3KPSA 5DDHB 4N8CL 4CVZB 1EIBA 2F19L 5SWQB 5I8OL 1M05B 3BI9X 2YD2A 4L8CA 1UM4H 3RX7A 3ET9F 5FHAL 5TDNB 1EH9A 3MUY1 4WFGD 3G5YB 5EZLB 1MHPL 3I6LD 1YNLL 3THML 2P49B 4QKXB 4BFIB 3QO0A 3RKPA 5BS0D 4JZNA 4XNUH 4PJ8B 2R15A 4KI1A 3RDTB 1PVHA 4PR5B 5TGBB 1KSRA 3HG1D 3LEXB 5J6HB 3S34H 3MBXL 1GGYA 5DTFA 2B39A 2X1XR 3RPKA 1BEYH 4HZAA 4WJ5A 5EORL 4PYGA 3TIEB 2F5AH 2OR8A 3NA9L 2NR6D 4X6CA 1XGQB 1YEJH 2WQRA 3D39E 3PWLB 4NRXB 3DVNB 1GXEA 5C0AD 1WZ1L 1BQUA 3RDTC 4WEBH 1CD8A 3GMQB 4G6AC 3TWCH 4MB5A 2H6PB 3VU2A 2XV6B 5D1XD 1R3LA 3UTTA 3IJSB 5D2LB 4A6YL 1R5VA 1T2JA 1P7KA 4K7PX 5DMKB 1KJ2L 3W0WA 5F88B 2UUDK 1HDMA 2AXHA 4LSVL 1U3HC 5BMFL 4POZC 3HCVA 4QRUA 3GMPA 2VDRH 3MRRA 1E4XH 2PW2A 1S5HB 1I1YA 1MQ8A 1OB1A 4Q9RL 2UWEE 1IE5A 1W0WA 5CBAB 2HT2D 1IC4H 2OP4L 1H3PH 3KNBA 2DWEB 5F9OL 1P4LB 3MO1A 2EEAA 3C5JB 4P2QA 5FYJH 3T4YA 5HPMB 3QIWA 4WUKL 2VZTA 2AQ2A 5CP3A 3ZDXE 4EUPA 3JXAA 1S78C 1S7XA 3WFBH 1B0GA 4ODSL 3G5XB 1NBVL 3LPWA 4Q0XH 1CDCA 4XHJC 4WW2A 4I1NB 2DTMH 3OPZH 5HYJA 3I6KA 5EN2B 2I5YL 5HHNB 3V4VL 4J7RA 1T6VN 4QY8B 4FZEL 4X6EA 3KLHC 5KN5A 5F9DC 1I8KA 1D9KB 2ICEA 3FN3A 5D7SH 5GGQH 3ZDYE 5DD5H 3RVTC 1U8LB 1UCTA 3U9UB 3VI4F 1E28A 1KPVB 4OJFH 3MBEB 1NGWA 3B2VH 5HHOD 4KQ4L 1JZ6A 3SKMB 5EPMA 3O11A 2EDXA 5JZ7D 1NAMB 5E8DH 4LVOB 1CLYL 2X4TA 5TQ0H 5GJTH 3T2PA 5JOFA 1KN4L 5L2JB 3ABZA 4Q6YA 3RHWF 2CUIA 2P24A 4Q9QH 2I26N 2WWMC 3EDJA 4YC2B 4XI5C 1T7XA 2BHUA 4QRRA 2GITB 25C8H 2HWZL 3CDGA 3VFSB 2KQNA 3ZSTA 1AGEA 2PO6A 2XRAH 4D0BA 3VXSD 2ZSVB 4HZLB 3G5VA 4P59L 1AD0B 1AGBA 5GS0D 4Z5RB 5EZIH 3PJSA 2JJTA 3BKML 1ZWIB 4DKEL 3NZHL 4OGXL 1LEKA 4YC2C 4HIIA 3EOAB 5CP3H 4FN0A 5T3XE 1IGIH 4EUPH 4PRIB 1NLBL 3SPVB 5AZEL 5MENE 3VE0B 4U33A 2EH8H 4F7CA 3C6SB 4X7FC 5E0QA 4Y5YB 1GOGA 3L3DB 5J57B 4IRJB 1CLZH 2GW5A 4F37K 1IZJA 3MV7D 1AKJD 5GJSL 4Q97A 1ZT7B 1NGPH 2DLHA 5DHVA 1CFQA 1D6EB 5CMAB 4YPGA 1SYSB 2R2HB 4QOKE 3HB3C 5E08H 1A2YA 1JGEB 4Y5YC 4UT6H 4IRJC 4AYFA 2XN9E 5T5FH 4AMKH 3LQMA 3P11H 5SX5H 4HXAL 4XVJH 2IH3B 3TBVA 4O5LH 3O2VH 1NGYB 5KSUA 3M1BA 4GXVL 5DUML 3UTSA 5HHVL 3N0PB 1JN6B 4QHMB 4HH9A 5BV7B 3QHTC 3TA3A 3ZHDA 4LCWB 4U3HA 7FABL 4X4XA 3D39B 5CEXB 1YUHB 4WUUA 5DJ0B 4UDUB 5DMJB 3SJVA 4QRPE 4I77L 3V0WH 3MGOB 1T03H 3NFNA 1RZFH 1BBJA 3LQZA 2KL6A 4XBEH 4WRLA 4YBLB 5E6IC 1KCRL 2VXUH 2LABA 1C8PA 1ZHLB 1ZAGA 2XOTA 4ZS6C 4JQVC 3MJ9L 2D0HA 3BWUC 2V2WB 2NXYC 3O3AB 5LXGH 2PN5A 5I18H 3MUGA 4GMSH 5HHOA 3C5ZD 1UM6H 2JJUA 2YUVA 3D5OF 4JFQA 1IGCH 4RRPA 5F44A 1CGUA 5ICXB 3HR5B 2J8UF 5HHME 2FH8A 3ESVF 4YBLC 3EO0B 1T6WA 4HK0B 4P4RB 2HKFH 1QBML 1T83A 2B2XH 2G75A 1KIPB 3SDCD 4DZBA 5DJXA 1P1ZB 3WO4B 3NCCB 5JA9A 4FXKB 2GY5A 4GW4B 4XGZA 5F6IB 2EDRA 4P3DB 4HIXH 1FZKA 2AJUL 3F7RA 3VRLF 5D6CA 3V8CA 3WIHA 3DJ9A 3BMVA 3MLPA 2D7QA 5DQJB 3F12B 5M95B 1I9RL 2ZUUA 3U4BH 3VI4E 2NY7H 3CPLB 4BKLA 2QSTA 4HGWB 4R2GD 5KG9A 2EDLA 3WO4C 4E9LA 4G8EB 2IPKA 4JGJA 1QFOA 1H9VA 3GIZH 5EBLA 3WBDA 5F6IC 3D0VB 2ADGA 3CU1A 4KJYA 3HC3L 2O5ZH 2X7LA 4KDTA 4KJQC 2FYYB 2PXYA 3SCMA 5J1TC 1QRND 1AE6H 3CVHB 4ONFL 4RAUA 1KB5B 3LEVL 5HVHB 4X5XB 1QR4A 3WDJA 1BOGA 3RZCC 2RB8A 4NUGH 1J05A 2GFBA 2WWKO 1UWEH 1BM3L 4MJIB 1TCRA 4BFGA 2KKQA 4HDIA 3ZL4L 1J8HE 4LSPL 2W0KA 3MUZ1 2A9MH 3UROR 2D4DA 3NCYS 5INDB 1KTDA 1TZIB 2R2BA 4YHIB 2VIRA 1FJ1A 2XZCL 3UJJL 1HQRB 4OZGE 4O2CB 5HVHC 3DX6A 1U8NA 4HKXA 1QSFE 5JA8B 1VFAB 2VRAA 4H88H 3G6AA 1HH9A 4NJAH 3VXPA 2GTWA 5IESH 4JLRA 1U8QA 2GCYA 3DXAE 2JB5H 2ZOKA 3IFOA 1JPFB 1H15B 1F3JA 2FGWH 1A1NB 3WIHH 1RZKL 4Z6AT 4K8RL 4LLVB 3S4SB 3EJJX 4D8PA 1JNJA 1LNUA 5D7KD 3J7HA 5EU7E 2HRPL 2A83B 1VSCA 4F33B 2C3HA 1MCWM 3RDTD 3HE6B 3KPMB 3MYZA 3OKLA 4RQQA 5DD1L 3V5KB 4G6AD 1M71A 2VDQL 3OKDB 1UCBH 5I15H 1KT2B 5KS9A 1KEGH 2A38A 2YBRA 3PWNA 2YA0A 3H9SE 4HUWA 4NKOA 3WFEH 2XN9B 3IAQA 4TULH 2AK4B 4Y4HD 3BOVA 3MRMB 1JPSL 2BSRB 4JG0H 2VDMH 4M1CC 1U3HD 3KHOA 2BFVH 1T5XB 2BVYA 2COQA 4ODVH 1NEZA 3HE6C 4MD4A 2VAAB 3SDCA 4RIRB 2GYSA 2A74A 5D7JA 1VGEL 4N8VA 3BRDA 3IJHB 4HEPG 1U8MB 1T22A 2YD9A 3NCFB 1G7MB 3QISA 4HS6A 5HGAB 3Q5YA 1FP5A 4O00A 1S78D 3RGVA 5E99H 4XHJD 1IM9B 3VRIB 1FNGB 1ZA3B 4NM4H 2IALB 4ODHH 3TO4A 3QNZA 2AI0H 4QXGL 3TJEH 5JORB 4DGVL 4AIZA 5ISZA 1OP3K 1KYOK 2J8UE 5JW4N 5K9KA 4U6YB 2CKBL 3B83A 3CFEB 1I1AD 1KCSL 4KK5C 1P7HL 1DN0A 5I1EL 2AV7B 4ZS7L 1MCBA 4C58B 5CD3B 2D7PA 2V5RA 3RVTD 4Y5XA 4UAOB 5D2NB 5IG7A 1X7QA 4P5KA 1HZHL 5F6HI 3B5HA 4UIMA 4JFYB 2K7PA 5KVEL 4N68A 3VRLE 5C2UB 3V2AR 4OLYL 2WV3A 3MR9B 3S36X 4CBPA 3VXNA 3U0PB 3VFMB 1A3RH 1N64H 5BRZD 3GI8H 1AFVL 1KLUB 2Z91B 4GLRI 2DQDL 4HV8B 2WWMD 4UAOC 4UV7H 1QSEA 3PABB 4XI5D 5D2NC 4XCNA 5T1KB 1ORSA 4G6JH 5D4QA 1S9VA 1ZGLM 1KF9B 3GBLA 1TJIL 5LQBH 4OF8A 4X6BB 5BZDA 2E5EA 3REWB 3MX0A 1YEDA 2IH1B 5D5MB 4EI5B 4MWFB 4PRAB 1S7QB 4LF3B 4O58H 1RULL 4CVZA 4AQ1B 5SWQA 3V6OE 3LHPL 4FQ1H 3MLYL 4WEMB 1OAQL 4M61B 5TDNA 3V8OA 2GK0B 4NHUB 3G5YA 5EZLA 1LHZA 3O2WL 4BFIA 5ALBL 4P9HH 2L4OA 4PJ8A 3QRFM 1A6UL 4GQPH 3QCUL 4NOBA 4PR5A 1YJDL 2X40A 5TGBA 5KZCB 3K7UA 4P5MB 3KLAA 2QBWA 5HHXL 3U7WL 3LEXA 5J6HA 1TLKA 2F9BT 3QIBA 5IEHB 5CCKL 3QG7L 4L4VB 3ZTJH 2RJMA 3TIEA 2BY3A 2NY5L 1XGQA 3OAYH 4LVEA 4DUVA 2YD1A 5DVKA 4NRXA 3RJDA 4WHTB 3DVNA 4MAUL 1NUFA 2OQJA 1MWAL 4W4OC 2IFFH 3MRKB 1U3YA 3VMPA 5DD6B 1S9XB 2H6PA 4ENED 2DKUA 3IJSA 4F2MB 1YMHB 4XX1E 5D2LA 5TH2B 5DMKA 4WI4A 3LKQB 4XNZC 3OXSB 4X0KB 4Y4FD 4ZO6A 2JJWA 2FGZA 1AD9B 1QRKA 1A7RL 2I60L 3LSOB 1NAKH 1Q0XH 1QEWB 4QHUB 5CBAA 3OTTA 3CXDH 4OCRH 2IANB 4LDLB 1MHHA 2DWEA 3H9SB 4U6VH 5E6ID 1BFSA 3C5JA 1YMME 5E2JA 5JOPE 5HPMA 4ZS6D 4AY0A 1QPXA 4JFZL 2VXTH 3D39D 2IBZX 2NXYD 1A6WH 3UAJC 3C60A 1S8DA 3O2DL 5E6ZA 2GAZB 1HSBB 3BUYB 5EN2A 5HHNA 3BSZL 3P30L 3MROA 4QY8A 2Y7QB 2AJVL 3VXQB 1CD0A 2ZCHH 1PGRB 2X70B 5LVEA 1WF5A 3MRHB 1D9KA 4JJHA 4PRNB 5IK3B 1GYAA 1U8LA 3U9UA 1KPVA 1OAYH 4OZIB 5I1JH 2AK1L 1IGYB 3MBEA 2ORBL 2WP3O 3R0NA 4OCWL 3SKMA 3H2WA 4M6ML 4D3CL 3S9DB 5T3ZL 2IQ9H 3FO9B 1R24B 3MJ6A 1NAMA 4QXTB 2F58H 3OF6D 1FDLH 3LIZH 3QI9D 4EZMA 1BQLL 3NPSB 4K3JH 5CEZE 3O8XD 4X7TB 1DQMH 4ZUTA 2GITA 3PWPB 3BH9B 2OS7A 3S3SA 5FV2A 2ZSVA 4HFWA 2E9WA 1KIUA 1KIQB 4KJQD 5FUZL 1AD0A 4OFVA 5HXMA 5IFJB 4MA8H 2VKXA 4LPVA 4Z5RA 1ZWIA 4X7EC 3NPSC 5HI4C 4YDIH 3RZCD 1RUKH 4P3CL 3HI5L 3EOAA 5I2IB 4O4YL 5CSGA 4PRIA 3TYGL 4ZDHB 3SPVA 3VE0A 2I9LB 3NFSL 1SBSL 2FECL 3D0LB 2CKNA 3C6SA 4OQ1A 4PJ7E 3ZDZF 4Z95L 5DFTA 4TSBL 4Y5YA 2A73B 4AG4L 1XF3B 4IRJA 3WFZA 5CZXC 3F6IA 1NKOA 3BE1L 2JIXB 2Y07L 5K9JL 2UVFA 1XF2B 1WC7B 4BH7B 1U95B 1ZT7A 1T0PB 3KPRE 4M5YL 4MNGE 4NP4H 5GS2D 4Y89A 3VXRE 3GIVB 1DP0A 1NSNH 3BX7C 1D6EA 5CMAA 5ABDE 1SYSA 3SKJL 1BX2B 4Z7NF 4RFEA 4OZHE 4O2FA 1MNUL 3MCLL 1JGEA 4GKNB 1CIDA 1NAMH 3VGAB 1EFXB 1U6AH 4Q2ZB 5GXBB 3JWNC 4BK5A 3OAUH 3RGHA 4ZAKD 2IH3A 1NGYA 3MNZB 5I30L 3BRGC 1TZGH 5T3XD 5E5MB 1JN6A 4QHMA 3WFDH 2NTSP 4RA3A 5MEND 4Z7VE 5F1NA 2DBLL 4LCWA 1U8IB 4JQVA 5CEXA 1YUHA 1MSPA 2OTUB 5DJ0A 5AWNL 4QRTB 1OAZH 4UDUA 3MA9L 5DFVD 1DBBL 4BH8B 3ORJA 3MGOA 1OSZB 3C87A 4Y4KB 1J9CT 1KNOA 4MXVF 2X2YA 4J4PC 5ECJE 3ETBF 5JDJA 4M1CD 4M4RA 4HBCL 2WUCH 1RIVH 2V2WA 3O3AA 4HSQA 4QOKD 4R4BB 2Y4SA 4YEEA 4OB5H 2XN9D 5CJOL 2XG5A 5ICXA 3T8XA 1LD9B 4Y4KC 5LBSL 2J88L 3FTGB 3OF6A 1U8KA 3BUTA 5CLTA 4EJ1C 3EO0A 4HK0A 4P4RA 3QUZB 4F8QA 2R0ZH 1UACH 1KIPA 4JB9L 4NZUL 3DPBA 2DKMA 4R90H 4I0PA 1P1ZA 1FIGL 4ZSOE 1EEQA 1NMBH 4FXKA 3SKOB 1GRWA 4GW4A 3IDNB 2P8MB 4P3DA 4QRPD 3L5JA 2A6KB 3S96B 4ZTOL 3FOLB 5DQJA 3QUZC 4I3SH 1HNFA 3CPLA 4GRMB 1TQBC 5BV7H 4HGWA 1IM9D 1T7VA 3CH1B 5IUSA 4G8EA 1NFKA 1J1OH 1NDMB 1RSFA 1SY6A 5C0BB 1RZJL 3D0VA 3TPUB 1NUGA 5J06A 1BLNB 2FYYA 4KMTH 5HHMD 1CDHA 1QP1A 5IFAL 4Q6IA 1N0XL 3CVHA 4GAGL 1KB5A 4HULB 2X4SB 4X5XA 3GDBA 3HI1B 4UTBL 1UA6H 3V4PH 3BP7B 3N85H 5FM5O 1FZJB 1EZVX 3F5WB 4MJIA 2D0GA 3B5GA 1S9WB 4XP1H 3HFMH 2W0PA 3DUHA 3Q5OA 1F4AA 5JW3L 3ALPA 2DI7A 5INDA 1TZIA 4UT7H 1WGOA 4YHIA 2O61B 1WTLA 1HQRA 4NQTA 2K1MA 4O2CA 3UYRL 3L7EB 1V05A 1VFAA 4PJFF 4P2RB 4NZRL 5IQ9A 4EEEA 2P5EB 3UC0L 3BPLB 3MV11 2DQJL 5HDLA 1IAOB 1XGRB 1JPFA 5AZ2L 3QSKB 5JIKA 1H15A 3WE6B 1OTSC 1A1NA 1WIOA 3WMSA 3O3BB 4UZGA 4RGNE 4J2XA 4TNWK 4AEHH 1XGYH 3WKMH 1OW0A 4LLVA 1XR9B 2UUDH 4YPJA 4L8BA 3RWIB 1TJGH 4Z7NE 3QH3B 3BPLC 2A83A 4F33A 1A3LH 4PG9B 1SY6H 4EKXA 3HE6A 3KPMA 5IFHL 1J8HD 2CIKA 3OKDA 1TVBB 4F57L 4XNYH 1KT2A 1BFOB 1DLFH 3BP4B 5BW7C 2XN9A 3BESR 5CZKA 2AK4A 3CVHH 1KB5H 5EIIB 5T5NF 4I3RL 3MRMA 2BVEA 4E5XA 2BSRA 3QB7C 4PB9H 5TDPB 1E6JH 3TFKC 2IBGA 3WNMA 1T5XA 3MQIA 1R3HB 2LVCA 2VAAA 1UEMA 3DXAD 4RIRA 1DL7L 1IVLA 4WCYH 1B2WL 1WIUA 3IJHA 4MXVE 1U8MA 2QSQA 4L8DB 1JZ4A 1NLDL 3ECBB 1FQ9C 2MPAH 4KVNL 4U4BA 1W72B 5HGAA 4AL8H 1OM3H 4IBLT 5T3XH 4FFVC 4IJ3B 4NWTL 4DAGH 3VRIA 1RZGB 1FNGA 1ZA3A 2Z0BA 1KENH 5DRZB 2D03H 5JORA 4PBVC 3K8MA 3UXFA 4CW1B 5DC4B 3OJDA 3DI3B 4U6YA 4NPYB 3H9SD 4G7YL 4KK9C 3CFEA 2AV7A 3W81A 1C08B 3KYMB 3LKRB 4JY5H 5CD3A 1ZOXA 1CG9A 3BPCB 4PJDB 3CUPA 5D2NA 1Q8MA 2DTSA 4DQOL 2KBGA 15C8L 3P0VL 1IEHA 4ZUUB 1J1PH 4JFYA 3HKFA 4N0FB 1OCWH 4ONGH 1HCFX 3MR9A 1CDJA 4J3SA 3VFMA 3NH7L 1RVFH 1MAJA 4WFEE 4PLKC 1KLUA 2Z91A 1T0MB 1G1YA 1OP5K 3TESA 5TF1L 5DEFB 4HV8A 1CI5A 5T1KA 1HYRC 3PABA 4NBXB 1G1CA 2VTFA 1DQLL 4PIRF 1G6VK 5FEBA 1JRHI 5JW5B 4X6BA 1I8IA 2R1WA 4ZQKB 3REWA 3GHBL 5KW9L 5I17B 2ESVE 2IH1A 1OGAB 5D5MA 4EI5A 4MWFA 4PRAA 5JW4R 3MC0A 4LF3A 3B6SB 5I71B 2CJUL 4IMLB 4MA7L 2ITDB 1MJ8L 4YIQB 5F1IB 4YX2H 5J8OA 5KVMC 4M61A 4PV9B 5EB9A 2GK0A 4NHUA 2HFGH 5ETUB 2ADIB 4LNVA 5CFHA 3QQNA 3UPRB 1I9JL 5F8RC 3DO3A 2R56L 4BSWB 4FQIH 1Y0LB 1D5ZA 1FGVH 2W9DH 4P5MA 1SYVB 1E27B 5I71C 1VFOA 3KJ6H 1F13A 4FP8L 2EDJA 3N9GH 1LE5B 4XPFL 4L4VA 4PJFE 4XPGH 5E8NB 1JHLL 1E4XI 3L5WB 5LCVL 4DUWA 4HJ0D 1ETZB 5JQ6L 3RY4A 3MLRH 2QQQA 4CJ1A 4WHTA 3IKCB 2ZOLA 2DQEH 1I7UA 2C3VB 2CO7B 1KB9K 4ZNEA 5ANME 2E7LA 3MRKA 2A6JA 5DD6A 1S9XA 3HNSH 1GHFH 1K4CB 2E7HA 2JIXD 4UINH 2A77H 1UH3A 1ZS8B 2ZUQB 5I74B 4F9PA 4HF5H 4F2MA 1YMHA 1GPOH 1FPTH 1Y18A 5I0ZA 5TH2A 4UIKL 2DWDB 2MCPH 4PB0L 5AG8A 3LKQA 2PTVA 3QDGE 3OXSA 4X0KA 5L9DH 1RIUL 2ICWJ 2B7DT 1AD9A 4NDMB 1CR9L 3VXTB 3LSOA 1QEWA 2R1XA 1DFBL 4QHUA 3CXHJ 3PGDB 2QQLH 2XWBB 3IETA 2ZUQC 1UZ8B 4LMQE 2IANA 5I74C 8CGTA 1KJMB 5D1QB 2D0FA 3ZKMC 1MCRA 3Q0HA 1S7UB 4P57B 5A1AA 1YNKH 4HPYH 1KULA 1S5IL 1H5BB 5TF0A 1IEBB 3VD3A 3UO1L 1C16A 1Y6KR 2NCMA 3QP3A 2Y23A 1QFHA 5AYUH 2GAZA 1DSFL 3CGTA 4Y4KD 1VERA 3BUYA 2FX8H 1L7TH 4X8JB 1TITA 2Y7QA 5GGVH 4U1JB 3VXQA 2MQ3A 1NCDH 1A6AB 4E41B 2X70A 2YOCA 3MRHA 4IIQB 4H1LG 1H5BC 1X6LA 1YEJL 4PRNA 5IK3A 2J8OA 1Z9OA 3L1OL 3B9KB 4OZIA 4WEBL 5F7KC 1IGYA 5F7UA 4H25B 3TWCL 2VLLB 3UYOD 1ONQB 3WHXB 1R24A 4QXTA 5EOCH 2G9HB 4NQVB 2AJSH 4LIQE 3QUZD 3UTZB 1YMMD 5JOPD 4X7TA 4TSAL 4LLMB 3VRJB 2VDRL 5L7XL 4JDZA 3PWPA 3BH9A 3SDAB 4JRXE 5GRJH 5JW4M 5IFJA 3UBXI 4ZO7A 3E6FA 3VCLB 1ZVYA 2Z8RA 3EO1B 2KH2B 3MRPB 5DJ2B 3Q1SH 1CU4L 4F7TA 5FYJL 4X80L 3E8UH 4LP4A 5ACMA 4AEEA 2WBJC 1IKFH 5I2IA 4ZDHA 2VERN 4Q0XL 2I9LA 3SDAC 1XIWA 3UPAA 2DTML 1L4IA 4H1LB 3WJJA 5FYJU 2A73A 1XF3A 4XXCA 3RUGF 1B6UA 5FO8A 1OF2B 4KHXH 4X4ME 5GGQL 2CDFB 1BIIA 1XF2A 3MLWL 3Q3GB 1QSZA 4BH7A 1KLFA 1U95A 5CEZD 2FNBA 4WEUD 4KAQH 5T33H 3GIVA 2DLFH 4OJFL 2EH7L 4ZOBA 1XT5A 3TT1H 2YKLH 4NHCH 4GKNA 4M7LT 5TQ0L 5GJTL 4EVNB 1S7WB 2EO1A 1EFXA 4Q2ZA 5IMOB 1XCQB 1EGJA 3PGFH 5EZOH 1ZT1B 1ZMYA 3QXUA 4Q9QL 3BJLA 3MNZA 4J4PA 4TOYH 4KHTH 5E5MA 1KOAA 1Y6NR 1U8IA 4GKZB 3V5HB 4I4WB 3PP3K 4QHKJ 4JHAH 2OTUA 4QRTA 5GISH 1FRGH 5E94B 4BH8A 2H2SC 5ANMB 1UQSA 3HPLA 1OSZA 4Y4KA 2JK5B 5E2VH 4G43A 4MDIB 4HHAB 3L3GB 4Q74A 5ESVB 3VXRD 5C0RL 2EH8L 5D71H 1A5FH 5CWSB 3VXUE 3QDGB 1OP3H 2FJGB 1NMCB 4R4BA 2ARJQ 2Z92B 3M17B 2JE8A 3UCRA 3GMOB 1LD9A 4GBXB 3ULUH 4Y16B 1QSVA 32C2B 3FTGA 4ELMB 4Z7UB 4QTHB 1MCFA 3PNWB 4FFVD 3R1GH 2EECA 3GSQB 5F93C 2VZVA 1NMCC 2OL3B 5E08L 2RHEA 5DR5L 5MEQB 4UT6L 5DVOA 1YEEL 3SKOA 1WT5C 3N1PC 4L5FL 3IDNA 2LU3A 5T5FL 2P8MA 3U36B 5I1DB 3GO1H 4AMKL 3NCBB 4GBXC 4QT5B 2A6KA 1EGJH 4UUJB 4C55A 3E1F1 3S96A 3GI9H 2QLVB 4O5LL 5EZJB 2JB6B 3O2VL 3FOLA 4PD4J 4AT6B 1IT9H 1N8ZB 4TUOB 3RAJH 2QJDA 1J88A 2IPTH 2WIIB 4GRMA 1AIFB 4PREB 2DB8A 3CH1A 3G6DH 2FWOB 5I75B 2Z31D 1NDMA 3A6BL 4QXUH 5C0BA 2AABH 3DVIA 3V0WL 1T03L 3TLRA 4R4NC 1RZFL 2VDOH 3TPUA 1MJJB 3MYJB 4PLKD 1RZ7H 3K4ZA 2VLKB 1BLNA 3MLZL 4DUXA 1XF4B 1WWAX 4XBEL 1IAIH 4JQXC 1XGUB 3LH2H 4IS6B 4QGYA 3ARBB 1CL7I 2FZ3B 3U46B 3V5DB 3X11B 1IGFH 1FZJA 1JF6A 3F5WA 4RGOH 1S9WA 2ZCKH 4GMSL 1PX4A 3T09A 2BMKA 3UDWA 4CDGC 4G42B 2IWGA 1ORQB 2IG2H 3ARBC 2HKFL 2E27H 4M7LH 3R8QA 2QQNH 4B0MM 1QBLH 4C56B 1YEHH 4P2RA 1KJ2B 4G5ZH 3V4UH 2P5EA 1AJ7H 5C3LD 4GO6B 3BW9B 2PYEE 3LCYA 4OCYH 5TDOB 1IAOA 5I1KH 3FZUC 4PJXF 4HUMB 3WE6A 4YHMH 5L0QC 4OGZA 3O3BA 3O45B 3G9AB 5BW7A 3BP5B 3BKCH 3U4BL 4GUPB 1XR9A 4K71B 1ED3B 3FOMB 3O6LL 3WNLA 2LVEA 4OCXL 3QH3A 4KVCH 4PG9A 4LSTH 1TVBA 1KXTB 3PQYB 5E1AB 1BFOA 2VO5A 3ROOB 3QDJE 3BP4A 5KJRH 1AE6L 4LNRB 4RFNB 1DBAL 5EIIA 1MVUB 3V7MA 4FQ2H 2YPLB 2BXYA 1NC2B 5TDPA 4AJ0A 2VH5H 5MI0B 1R3HA 1S3KL 4JKLA 1CK0H 2X89A 4KRPB 2AXJA 3C09B 3UJIL 3BZ4B 1U58B 1WFTA 5E8PA 4RFNC 1IRAY 4L8DA 5HDQH 4RGND 3ZKMD 1IBGH 3ECBA 3UTPD 1W72A 4C59B 4NJAL 2RAMA 3QWRA 3X14B 5MI0C 1DBMH 4ZTPH 1RZGA 3ULSB 4KRPC 3C09C 5DRZA 1OL0A 2FGWL 4NQDE 3MNWB 3WIHL 3UPCA 2FLBT 4BQ8A 1TPXB 4XHQA 1RHHB 3CCHB 3KYMA 2CMRH 1NMAH 3BPCA 2AEPH 4PJDA 1LO3H 2BDNH 2AEIT 4H20L 1U91B 4KC3B 4ZUUA 2VDKH 1UCBL 2J5LC 4KKAC 4N0FA 4KTDH 4G8FB 4O2EB 2XIDA 3WFEL 2FATL 4TULL 3NN8B 1KXVC 1WTGT 1TPXC 2VE6A 1T0MA 4M93C 5L6YH 1OAUH 4ZFOL 3U1SH 5DEFA 3Q6FB 3QCVH 5ID0B 4U3XA 4ODVL 4LSQH 4AK1A 5JW5A 4ZQKA 5I17A 1FNAA 5DUPL 1OGAA 3S35X 3RWHB 2DQIH 3B6SA 2EDOA 4IMLA 3ZKXC 3RVVC 2JF1A 2ITDA 1W72H 4YIQA 5GZNC 3TGXA 2EDNA 2WBJD 1EHLH 1HIMH 4PV9A 5E99L 3WLBB 1GAFH 2ADIA 3OWEA 1CFVH 3DGCR 3UPRA 3C2AH 5K93A 2AI0L 5E2WH 5HGBA 2AVGA 4BSWA 2K7QA 5CGYD 1HQ4B 3AROA 1F4WH 1SYVA 5FA4A 1E27A 3HI6L 2YZ8A 4WFED 4XMPH 1M7XA 1LE5A 5F3BB 1BQHG 3F62A 2LFGA 4OM1L 5E8NA 3L5WA 2NXZD 3MOBL 3KPNA 1ETZA 4JFOB 4OT1L 1R3KB 4BUGA 4YHPB 3VFOB 2YXFA 4XPAH 1EO8L 5EIQA 2F8XC 1UVQA 4PJXE 2C3VA 2ESVD 3S97C 1MFCH 2YN3A 5DA0B 5JOEA 4U1KB 1B4JH 1UADC 1A3RL 3RUGB 3FB7B 1VFBA 1K4CA 2JJSC 2Z93B 4DFHA 4PJIA 5DMYA 1T66C 1ZS8A 5GZOC 3I50L 4G6JL 2V7HA 4BZ2H 5KAQF 3CDYA 4ORGB 2DWDA 3G6JA 3H3BC 1KFAH 2OTPA 4HMCA 2O5YH 5FYKH 4Q58C 5A43C 4NDMA 5CJQL 4Z0BH 5I1AB 3WXVL 4LU5H 4E0RB 4W68A 1G7IA 3PGDA 2XWBA 4UOW0 5MP6H 1UZ8A 3RY6A 1EPFA 5D1QA 4PJBA 1CDYA 1S7UA 4JKMA 4P57A 4U2ZA 4U1NB 5CGTA 1H5BA 1IEBA 2DMKA 4P9HL 4WGVB 5FOBB 4XWOC 5I1GH 1BQHB 4MAYC 3SGEH 1JBJA 4ZXBD 4AM0B 1HHJB 1ZSDB 5IW6B 4X8JA 3LMJH 4G6MH 5GRUH 3ES6B 4U1JA 43C9B 5KSAB 4E41A 2UZYB 2MHAB 4IIQA 4ZYKB 2FSEB 1HXMA 3QDGD 5CSBA 2VR4A 3B9KA 1IZKA 2IFFL 3E3QE 4H25A 2VLLA 2R69L 2VDLH 2FJFB 1GC1L 1F6AB 1ONQA 3NCMA 4K3DL 3WHXA 3QFDB 4NQDB 4OBRA 4R97B 1FZMB 4ONHA 1MJ7H 4GXUN 4N8PA 3UTZA 1IAKB 4LLMA 3VRJA 5IV2B 3B9DA 4YXHL 3SDAA 3ALWA 1Q0XL 4IHOB 4O9HL 4HUNB 1XZ0B 4M5ZL 2PCPB 3V79C 4R4ND 5B3JE 5IKCA 1I75A 3RA7H 4OCRL 3D85B 1QVOB 4DOHE 2Y72A 2GT9B 4R97C 3VCLA 1C1EL 1KV3A 4U6VL 4G6KH 1OARH 4XVUD 3EO1A 2CUMA 3MRPA 5DJ2A 1NFDF 1TVDA 2MKWA 1I8LC 2VXTL 3STBA 3F58H 4DKFL 5D72H 5E2TL 2BK8A 2ZWLT 1T5WB 1A6PA 4HCRA 2MCG1 3SQOH 1CS6A 1H3UA 4XP9H 3Q48A 4H1LA 2V7NA 1KJVB 2W65B 1OF2A 4R8WH 2ZCHL 1RZKC 3ARBD 2DIJA 1RJYA 1VENA 1GJIA 2CDEB 2AV1B 2CDFA 4K8RC 4CNIB 1B90A 3Q3GA 3RTQD 4N1HB 3W5MA 1FAIH 4JFEB 1OAYL 4X9IA 5I1JL 3RRQA 4YDKH 2CLRB 3O4OB 3IU3B 4CU8A 4JRXD 1UEYA 4LPUA 2CQVA 2IQ9L 3FZUD 1HHKB 2F58L 3KXFB 1FDLL 4EVNA 1S7WA 4CMMB 2CDGB 1XCQA 3ARFB 3F7QA 4G8GE 5ILTH 4K3JL 5C0CE 1ZT1A 1MRCL 4UTAL 1X5JA 3HMXA 5IIEB 5DT1L 5JPMB 1BD2B 5C92A 3O4OC 1RUQL 4GKZA 2YRZA 3V5HA 4I4WA 3WHE1 2X10A 2APWA 4FXGB 3SDDB 2X6MA 5T3ZE 5E94A 4JRYE 4KU1A 1MREH 4MA8L 5I73B 2XACC 3VDBA 3ZYOA 3ARFC 2QHRL 2CKBB 2JK5A 1RUKL 4MDIA 4HHAA 5ERWB 4OUOA 1ODAA 4J3TA 5ESVA 3WIIL 4OUUA 4HCRH 2DD8H 5CWSA 1HCVA 3WD5H 2FJGA 4Y2OA 4H1LH 3SDDC 2Z92A 3M17A 1WT5A 5I73C 4YWGH 3GMOA 3WL9B 1UYWL 4WGWB 4GBXA 3OB0K 3SDXF 4JM2F 4Y16A 1RAMA 4NSKB 32C2A 1IFHH 5EUOA 5FYLL 4ELMA 4Z7UA 1NBZB 1YZZA 3PNWA 4CU6A 1GIGH 1QFWL 1CCZA 1OTTC 2GJZB 1K6QH 5MEQA 1M7DB 3EGSB 1NAML 3U36A 1YC8A 5I1DA 1MQKL 1T21B 3OAUL 2BRQA 1WZMA 3R4DA 4M8VA 5EZJA 2JB6A 2A9NH 4AT6A 3HMXH 4TUOA 1TZGL 3P77B 3WFDL 1T3FB 2HVJB 2WIIA 4PREA 2B1AH 1QKZH 2FWOA 2F5BH 4XPBH 3BGFB 4KKAD 1A9BB 3O9WB 1EMTL 1X5YA 1MJJA 3JWDL 3MYJA 4GS7C 1G9MH 2VLKA 5K9QG 1XF4A 1WWBX 1XGUA 4IS6A 1KEML 3ARBA 2FZ3A 3U46A 3V5DA 2WUCL 3VFVB 1RIVL 3X11A 4HGMA 4JFDE 4NFBA 4BA8A 3PL6B 2UZIH 3O9WC 4TYUA 1A0QH 3EYSH 3MLVH 5D1ZB 1MFEH 1MWAB 1P5VA 1JZ5A 4G42A 1YJDC 4M1DH 1NFDE 3RVVD 12E8H 1ORQA 5GZND 3S36H 4FQJL 1BBDH 2APFA 2R0ZL 1QA9B 4C56A 5TE6H 1KJ2A 3PL6C 3DVGA 2OL3H 4PGCA 3BN9C 3CNKA 5B22A 1EDQA 1GOFA 3BW9A 5D1ZC 1UKQA 5FECB 2VYRE 4R96B 1NJ9A 4Y0GA 5FIEA 1Z6JT 4N8CH 3O45A 4HIEB 3BP5A 4NN6B 5I8OH 4I48B 4I3GA 3UZEA 4I3SL 4GUPA 5BV7L 3GNMH 1ED3A 3T04D 4LPXA 1MHPH 3D6GA 3THMH 4LPWA 4U1GC 3RU8L 4EQ2A 1R3IH 3ZHLA 4H5SB 3IDGB 4WI8A 2GKIA 3QUXB 3TZVD 2EKJA 5CZVL 1HSAB 2VZUA 3PQYA 1U36A 4X4ZA 5E1AA 3ROOA 4KMTL 3TVMB 3PWVB 3GEWB 1LMKA 1T66D 4LNRA 5GZOD 3MBXH 4U1MA 3LS4H 1MVUA 4LHUG 5EORH 1UA6L 2APTA 3IFPB 3V4PL 2YPLA 2WMPA 1NC2A 4XP1L 3NA9H 5IMLB 3NOIA 4OV5B 1Q38A 4TUKL 4L3EE 2P46B 3QUXC 3T0DA 1IEAB 3BPNB 1AY1H 1EHXA 4LGPB 1G7HB 5FB8A 4MDJB 4DKDC 4UT7L 3BD4A 3BZ4A 3TVMC 1U58A 1VFUA 5ENWB 5L8LB 1ZKAA 2HJKB 1A7OL 3FFCB 4JKPL 5TE7L 1KJ2H 3X14A 4OM0L 4V2CB 2DKSA 4XWOD 4LSVH 4MAYD 1CXLA 2AXGB 3BPNC 1EO7A 3ULSA 1EAJA 4UBDC 2ERJB 4LVHB 3SDXE 3JVGC 3MNWA 3QDJD 1GGUA 2EYTB 3QUMB 1KCLA 4JO1H 4AEHL 4OI9A 1XGYL 3WKML 5D96B 5F9OH 1RHHA 3CCHA 3SGJC 4CUCA 5D8JH 4L4JA 5GGUB 5JPNB 1LO4L 1A3LL 2ZNXA 4LRNH 5IHBA 4ODSH 1U91A 1S7SA 2ERJC 1NBVH 2GJJA 4JFFE 5JIHA 5FK9B 4XNYL 3JTSB 1I1FB 4LVHC 4OIIL 5LGJB 4G8FA 3AREC 3MCG1 2DBJA 4NQEB 3CVHL 2ICCA 3V4VH 3NN8A 4ZOEA 4LHQB 3MLSH 5D96C 5JDSB 3ZLQC 4PB9L 1HN1A 4KY1H 3MMEB 4UI2A 1NCAH 1H8OA 4TTDC 3OGCB 3LQAL 3IF1B 3WEXA 1BWMA 4L1HA 4IOSD 4WTXA 1ITCA 3NAAH 2QTEA 4NQDD 1AGDB 4RX4A 3RWHA 4LCCA 3AB0B 1I3UA 5CUSH 1CLYH 2MPAL 2WUBL 4AL8L 1KN4H 5I1LB 3WNOA 5E5RB 3HA0A 4RNRB 3WLBA 1BAFL 2DJ4A 2D03L 2VQTA 1BMGA 2NX5B 3D85D 4KK8C 5EBWB 5J6GB 1HQ4A 3T0EB 4MSWB 4P59H 5BOPA 3BKMH 4DKEH 5F3BA 1NGQL 2E6PA 2X1PA 3HNTH 1OT2A 1OPGL 4OGXH 1PX3A 5KVFH 2OSLB 3S7GA 4WWKD 1NLBH 4JFOA 3PP3H 2DQUH 2P42B 3VFOA 5JLZB 4LL9A 2HKHH 4ONGL 3FO1B 1LDPH 3T0EC 4U1KA 2VLME 4OCNC 3RUGA 2OM5A 3FB7A 1RVFL 4K9EH 5C07B 4LSSL 2Z93A 2C7UB 1TENA 4G9FE 3MREB 1OAXH 5GJSH 1NUDA 4U0RB 1C7SA 4J3UA 4ORGA 5MEOB 2FHCA 5T1MB 1NDGB 4AIXA 4P5TB 5CJ8A 5C6TL 2ZKHH 5I1AA 3GKWH 4E0RA 4P23B 2OJEA 2EXWC 4JFPB 1BGXL 3ARFD 3AAZB 2EKSB 1F45A 4S1SL 2CRYA 1EA9C 4YX2L 5HGGS 4NZTL 3SQBA 3DNKA 4HXAH 4U0RC 4UOJA 1BD2D 4OFDA 5HHVH 4U1NA 2X4PB 4ODUA 3GUTB 5FOBA 1BQHA 3SDDD 3AY4C 1VKXB 5IOPB 4P23C 5SWZB 4OGAC 4AM0A 1HHJA 1ZSDA 4IRZL 4ORZC 4BZ1L 5IW6A 2H41A 3KJ6L 4I77H 2ZG1A 3N9GL 1AI1H 4IOFC 4XPGL 3ES6A 1YEIL 43C9A 4HJGB 5FGBC 1EO5A 5KSAA 5GQBA 3QHZH 1DEEB 4D0DB 3EW3B 3X13B 3MLRL 1INQB 2FSEA 4RMUA 1OTTD 4KKCC 2W60B 1EZVY 3TJHC 5D7LB 1T7ZA 3I2CL 1EV2E 1GHFL 1RZJC 2FJFA 1JPST 1F6AA 4YR6B 4JM2B 3MOAH 4HF5L 5HYQB 5EIVA 1FZMA 4P2OD 5HY9A 1GZQA 1A9EB 4B7IA 5C0JB 2ZUXA 5L9DL 4UB0H 2P5WB 4ZOAA 5ESQB 4PJ5E 1LO0L 3HC4H 4M7ZC 3UTQB 1CICD 2PCPA 4FQCH 2QQLL 1CLOL 1QVOA 4JM2C 4YDJB 2AJUH 4GAFB 3BP6B 2XICA 4NFCA 4HPOH 5ALCH 1T2XA 1YNKL 2R4SH 5E8OB 2CK2A 3MRIB 2GTZB 1T5WA 3W82A 3O9WD 5AYUL 2VUYA 3T0VA 4WW2F 1P2CB 5DJAB 3GM8A 2P48B 3CMGA 1KJVA 2W65A 3KPPB 3AGVA 3O81A 4G7VH 1A6VH 3CZJA 4GW5B 4K2UH 2CDEA 4PLOB 1FL5A 4MQ7B 4CNIA 3DGGB 4XNQB 5C09E 4JFEA 3PL6D 1HWGB 4M02A 1BM3H 2CLRA 4WO4C 4ZUVB 5HVWA 1KPRB 5IVXB 3ZL4H 4DEPB 2SEBB 5TE4L 3REVB 2ILLA 5BZWB 5IVNA 2P44B 5EOCL 3KXFA 3VGFA 4CVWA 1JNLH 2V2TA 3B5TA 2CDGA 3MTRA 2R2EB 5DO2C 3H8NA 1GCFA 1Z0NA 3VFNB 1QR1B 4DZ8B 5IIEA 3JWOL 3MLTA 5JPMA 3L3OA 1BD2A 5GRJL 3OAZH 4L4TE 5E95B 2MFNA 5KSVB 4DEPC 4GSDL 4FXGA 5A16B 1LO5A 1NCCH 4CADB 3Q1SL 3E8UL 1F5WA 4K8RH 5ERWA 1M4KA 2EDDA 3O3EB 4Y2DD 3BQUD 4XCCL 3MSPA 2NY4B 1U93B 4RSVA 3QYCA 2AKRB 2WINB 4XMKL 5H8DA 3KPSE 4N1CA 5D70H 5DD1H 3TVMD 4OTXL 1NBQA 4GMTL 4YAQB 1UM5H 3WL9A 4G8GD 4NSKA 1MI5A 1UH4A 5FYJE 1CGXA 4MQXC 1NBZA 2H3NB 1T1WB 3OXRA 1JPSH 2ICWI 2NY4C 4MZ3A 2DLTA 1MAML 5B39G 3FAWA 2AJZB 4QTIH 4JVWA 4U1SA 4QWWD 1M7DA 3EGSA 1F3DJ 1DVFA 4CJ0A 2HLAA 5T3ZD 4JRYD 1MPAL 3X17A 1T21A 4B5EA 4OD1L 5DK0B 5EZOL 2DM3A 4X6CE 4TRPH 2G60L 4KHTL 1T3FA 3DVFA 4Z7QE 2HVJA 2Y36L 2VC2L 3X3FL 3CFIC 2PW1B 4JHAL 3ARED 1A9BA 4QXGH 4DGVH 4KTEL 3UTTE 2AW2A 3AVEA 5GGTL 5E2VL 5I1EH 3W0WE 5MERA 4MVBC 3VJ6B 4GQ9L 1DANU 4OD3H 3VFVA 3VW3L 5D71L 1A5FL 4TTDD 3GJFK 1FC1A 3ZSSA 1HZHH 4JPIB 2BNUB 4PJ5B 3DRTB 5KVEH 4NJ9H 5D1ZA 3RIAK 1JE6A 5C0NC 1MCQA 3ULUL 1D5XB 4OLYH 5B39B 4HWNA 4BQCA 4F7MB 4P2QE 5K59F 5J89A 3OG6B 4GXUM 3RIFF 3I75B 2DQDH 3OKMB 1QA9A 3OHXB 3CFJB 1VGKB 4PPTA 1FL6B 5J1SC 5C9JB 3WHE0 4YE4H 2DJSA 4BZYA 3FB8A 4XNXH 5HYJE 3MV9B 4KK8D 2L7UA 4M7KL 5E9DB 1EGJL 2F15A 4R96A 2DQCH 3FQWB 1RULH 4HIEA 1H3TA 1IT9L 3G9VA 5EA0H 3WDHA 4I48A 3RAJL 5HDBF 3VI3F 2IPTL 1RJZB 4YGAB 3VMOA 5DJCB 3BT2H 1IMHC 4JFDD 4PJAB 1G7PB 3O2WH 4YO0B 5C09B 4W81A 4A2LA 5I6XB 2FEEL 3IDGA 5ALBH 4PJGB 4YHYB 4OCSL 1PY9A 3QUXA 3ULVH 3UX9B 3SY0A 3QCUH 3O2DA 1HSAA 4XNMB 3PWVA 5HHXH 3EJYD 3SO3C 2P43B 3LH2L 4D0CA 4MA1B 2ZJSL 1F3RB 4QRRE 3IFPA 3I6LE 1MFAL 1IGFL 4OV5A 5IMLA 3FQXB 5E4EB 5GS1B 3MRDB 4MAUH 4X4YB 1LP9F 1IEAA 2EXWD 5C07D 1G7HA 5DYOB 4L4TB 1U3JA 1A47A 3D25B 1F8TH 3JVGA 5ENWA 1PZUB 4MA1C 4YHZL 2HJKA 2E27L 5C08B 4NQSB 3IRPX 1QBLL 1SEBB 3FFCA 3CVIH 1AJ7L 4QHKI 1ZLSH 5E4EC 5GS1C 4V1DB 2AXGA 1FSKB 4OCYL 4P23D 2P7TB 1EBAA 1J8KA 5A2IH 4OFYD 1A7RH 4YHML 1A1MB 2ZUYA 2EYTA 3QUMA 3T2NH 1CDBA 4LFHG 3L5XL 3OR7B 5KBNC 4KKCD 2DL2A 4MD5B 5JPNA 4F9LC 3TJHD 4L3ED 5LWYH 3VA6A 4LSTL 4J3VA 5SWZD 5F7FA 4W6XB 5FK9A 4LHUA 4ODTH 3JTSA 3O2DH 1I1FA 5LGJA 2PKDA 4FFWC 2IBBA 2AXFB 4KDVA 1MIEL 4NQEA 4YK4C 3BSZH 3P30H 3FAXA 3AFLA 4KKNA 3UTSE 5JDSA 4FQ2L 3RX5A 2Q86B 3T0BA 1A6TA 2VH5L 3HE7D 2EDYA 3MMEA 4WUUE 5LAXB 1MFNA 2ZP0T 2D2OA 3OGCA 3SJVE 3IF1A 1MLBB 2PUQT 4OCWH 3V0AC 1AGDA 1UWXH 2W1NA 4JM2D 4NO0B 1S9YB 2WM0A 3MXWL 3UTTB 3IFNH 5I8EB 4WU5B 4CU7A 1U2CA 4OF5A 5I1LA 2OMBA 3K0WA 4HUUB 2H26B 2NY1B 4Z18A 1HDMB 5DEGB 4ZMAT 3DSNA 1DBML 3VD7A 3W9EB 4ZTPL 3TBTB 2QR0B 5DVMA 1EUUA 3O0RH 1I1YB 2HTLD 5J0BA 3OJMB 2VSDA 1CXEA 2NX5A 5F7EL 3QUMH 5TPWL 5K59E 3BDBA 4MSWA 3HZVB 1WEJH 5FUZH 3T0EA 1MHCB 1UC6A 2CMRL 3RVUC 4NN7B 2AEPL 3BXNB 1LO3L 2NY1C 2OXHA 2BDNL 3HI5H 1DJSA 4UMGA 5GIRB 2OSLA 4M6OL 4O4YH 4WO4D 2VDKL 3DX7B 3PP4H 1WCBA 1F4YL 5JLZA 1JL8A 4WW2B 1SBSH 5DRWB 3FO1A 4Z95H 2FBJH 5SX4I 4TSBH 3F7PC 4LRIA 1TTUA 3KYAA 5C07A 5HDBE 4QHNB 3VI3E 5DO2D 3ZMRA 2C7UA 4NN7C 3U1SL 2H2PD 4PTTB 3QCVL 2Y07H 3QIWC 5K9JH 3MREA 2DS4A 3V7AE 3PF2A 4N0UB 3WCYA 4M5YH 3E0GA 2XYCA 3GJFB 5MEOA 5T1MA 1NDGA 3JV0A 4L3AA 4P5TA 4WW2C 3T0XA 5F96L 4P99A 4P2CG 3AY4A 1JGVH 1MNUH 1X4YA 4JFPA 3RBSA 2DQIL 3AAZA 3OB0H 4OFYA 2EKSA 2X4TB 5IVZB 2ZZUT 1W72L 3FT3B 2P24B 1OLLA 4PGEB 1V8HA 5F7YC 5FGBA 3D18A 4RMTA 1BFVH 4FHBD 4K23H 3MRGB 1CFVL 2X4PA 4HWZB 5E2WL 2AS5M 3GUTA 3CDGB 1NANH 1CL7L 2AP2A 2RGSA 2ADJB 5IOPA 5SWZA 4HLZG 1CQYA 5AWNH 1F4WL 2VLMD 3MA9H 4CKVX 4OFPA 4XMPL 5GS0L 3VWJA 4HQQH 3L3KB 1Q0YH 4ZUSA 4MQXD 4HJGA 2W91A 1JYXA 2NY4D 4GAJH 5DJZA 1DEEA 3WNKA 3ZYIA 1ADQA 4D0DA 1T1YB 1INQA 4JN2B 4PP2B 2W60A 4F7CB 2PO6C 2BOBB 5D7LA 1MFCL 1P84K 1OGTB 4ACPA 2JJTC 1VHPA 4JM2A 5HYQA 5LBSH 5ADPH 4P49A 4XP6L 1A9EA 1JGLH 5C0JA 2O5YL 5DHVB 2J8HA 4S1RL 1PAMA 2P5WA 2VLJB 1CE6B 4NZUH 5B21A 4XCEB 4Z0BL 4LU5L 1RJCA 5KS9E 1FIGH 4IOIB 1HKFA 5AD0B 2P8PA 5IEKB 4KRLB 3EFDL 2GQHA 2R0LH 4IM8A 4YDJA 2X9XA 5FYKU 3T1WA 3BP6A 4WIQA 4KUZH 5E8OA 1ACYL 3MRIA 1AH1A 2GTZA 4M48H 1UWGH 3CMOH 4FQHB 5I1GL 1LEIB 4N0CC 3I84A 1JP5A 1P2CA 3SJVB 4HG4K 2YD3A 3KPPA 4G6ML 5GRUL 2DM2A 3U4AA 4XC1L 5IHLB 3VXMB 4GW5A 3QO1B 3GK8L 4PJEA 3M8OL 1N0XH 4GAGH 3W39B 1ADQH 1TZHA 3DGGA 4XNQA 2W07A 1KCKA 4PRHB 5ISZE 2B8OT 3IDXL 4PJ5D 5FO9B 4ZUVA 1KGCE 1KPRA 3PGCB 2F54B 2FX7L 5IVXA 3PE9A 5JW3H 3K4AA 4ZPVB 1Q9WB 3DUUA 1MJ7L 2R2EA 1OLZA 1CGWA 1KTKE 3GKZA 3VFNA 1QR1A 4XTRC 3UYRH 4ZPTB 4DZBB 3D9AL 5EBGA 2IMNA 3IS1X 4NZRH 4JQIH 1KXQE 1FFQA 4QO1A 4I5BB 5SV4A 4XGZB 3T77B 1REIA 5KSVA 2QQKH 3O3UN 3SE8H 5MEPB 1U9KA 3FO0H 1AC0A 1FORH 1FZKB 2ZG2A 5A16A 2XA8H 5A2FA 4APQB 1QSEE 2W0FB 4CADA 2NY0B 1FVDB 5I1IH 1DLHB 2G5RA 3F58L 4KQ3L 5KANI 5C09D 1G0YR 5DGRA 1Q72H 5DI8B 2AKRA 2WINA 1Q9KB 3SQOL 3VDAA 4XP9L 2ADGB 5IFHH 5F71A 4APQC 4YAQA 3PWUB 4R0LB 3SCMB 2X4RB 2D7TL 2WK2A 1AO7B 4L9DA 1YQVH 1ZXQA 1IL1A 2H3NA 1T1WA 4ZFOB 5KVDH 4KTYA 2GFBB 4YDKL 1MELA 4HDIB 1LP9B 4L4TD 1KBGL 4P4KB 1UZ6E 3BO8A 4R6UA 5E2UH 5CKGA 2UZXB 1KTDB 4NKIL 4TQEL 1FJ1B 4R0LC 3SCMC 5DK0A 5ILTL 4HKXB 4WV1B 1NLDH 5JMOC 2R2CA 4KKLD 4IEFB 3VXPB 5M94B 5IMMB 2PW1A 3MNVA 2VDPH 3KPSD 2ZOKB 4FFWD 1PG7X 3Q2CA 1SJXA 3BVNB 4LMQI 2WLZA 5D2LE 4G7YH 3U83A 4LCIH 1C12A 4MLIA 1OHQA 5FYJD 4J3OC 4WI5A 2ZG3A 1LNUB 2VXVL 4NGHL 5AAWA 3WUZA 2LAAA 5KVGL 2ATKB 3N50A 2MQCA 3PXJA 4JPIA 4YZFF 5L8JB 1TMCB 4YWGL 3DRTA 3BIBX 1D5XA 5B39A 5I19L 4F7MA 1FL3B 3ARPA 1FVEB 4AEFA 2PYFA 5TF1H 1GIGL 3OHXA 3CFJA 1VGKA 1IKNA 4NQCB 5ITFB 2L7JA 5C9JA 4NNXB 2NY3C 1DQLH 1CE1H 1K6QL 4MNQB 5IB4B 4M1GH 3MV9A 2WWKT 4NO0D 1GVIA 2A74B 5D7JB 5IBLC 3BZDA 4YHKL 3UTTD 5E9DA 4LSRH 3FQWA 2A9NL 3RVUD 3HMXL 1ZV5A 3S35H 3W0WD 4FQPA 1X5HA 4MA7H 4XH2B 1RJZA 1A4KA 3H3PH 5EO0B 2F5BL 4PJAA 1G7PA 4YO0A 4XPBL 3EDFA 1QLEH 3QNZB 1I9JH 5IB1B 1V3JA 4PJGA 5D7JC 2HT4C 2N1KA 1G9ML 3OBAA 1OTUC 4P2QD 4PJCB 3QIWD 4D9RD 4YUEH 4Y5XB 5LCVH 1H0DB 1X7QB 3DARA 3FQXA 4P9HC 4UT9H 5GS1A 3LN4A 5HYJD 1WBYB 3EYSL 3MLVL 3NIDE 4X4YA 4O51A 2EICA 5DYOA 4F8TA 5DA4A 1RFDH 1BOYA 3D25A 12E8L 4O02L 2VAJA 1BBDL 5C08A 5IMKB 4MJ4A 4Y5XC 4NQSA 4PRIE 1QSEB 5SWSB 1SEBA 4YH6A 3OMZA 4RAVA 4UIKH 1RMFL 4PB0H 3QFJB 2O26U 1YA5A 5BZDB 4V1DA 4F9LA 2ZSWB 1IC7H 4JO3H 4HWEH 2P7TA 3D3VB 4XRCB 1DQQB 1CR9H 3B9VA 4N5EC 1DFBH 4DW2H 3BGMB 1A1MA 1GC1C 3HAEG 4WDIB 3ZKQD 1DUYB 3QZWG 1RUPH 4X7SL 5F9JB 4WI2A 3GNML 4QRRD 2NYYD 3OR7A 3DETC 5IBUB 1MCHA 4MD5A 3P4OB 1R3IL 1S5IH 3SBWC 3L5HA 2PO6D 1BECA 3UO1H 4RWYL 1ZHNB 2X9WA 3QXVA 4G3YL 3FJTA 3KLAB 1DSFH 2AXFA 4FNLL 3QIBB 5I8CB 4OSUH 3NVQA 3LS4L 1ZLWK 1CYGA 1GGBH 2Q86A 4J12A 1ZEAL 1JGDA 4JPVL 4LCWE 5JNYB 1INDH 2FL5B 2HN7B 4PJ8C 5LAXA 4MA3B 1AY1L 1HH6B 2OQJB 3RWEB 1J0YA 3L1OH 5KOMC 1PKQA 1MLBA 1FN4B 1PG7W 3ARGB 3NCJL 4NO0A 4YXKH 4F37F 3FQUB 3QIBC 1S9YA 5I8EA 5DJDA 4WU5A 1IC5L 1BJ1H 4HUUA 2H26A 5EULV 5DEGA 2YUWA 3W9EA 3HAEB 3I9GH 4P46B 4TSAH 3TBTA 2QR0A 3OKNB 4N0CD 4Q9CA 3QZWB 5L7XH 3ARGC 2G2RB 3KWWB 1BVKB 4JO1L 1YYML 3HZVA 3BPOB 3DECA 1MHHB 1MHCA 1PEZA 4R4FL 3UTSD 4LCYB 5D8JL 2HTKC 3BXNA 1CU4H 3LN5B 3TA3D 1HYSC 4X80H 2C1OB 4U31A 5GIRA 4LRNL 4WUUD 5M7QA 3C60B 3SJVD 3DX7A 1S8DB 4HBQA 1NFIA 5HPOA 3P4LA 4G80B 1K4DB 4HKBB 5DRWA 3MROB 5BQ7B 5JUEL 3MLSL 4QHNA 1N6UA 3STLB 4XWGL 3CZFA 5GRVK 1A3QA 4PTTA 4KY1L 4NNPH 3MLWH 2X5PA 4N0UA 1NCAL 5BVPH 1PBYA 3R06B 3GJFA 3C60C 2EH7H 4Y88A 1L7IL 1CXIA 4LGSB 3NAAL 5D5MF 5DQDH 5JIIA 5CUSL 5IBTL 5IVZA 4F15B 3FT3A 1D9KC 3PHOB 4MMZC 4PGEA 4MJIE 5J3HC 4FQXA 3MRGA 4ZUTB 4HWZA 3MBEC 4LHJB 3IVKB 2W9EL 2IJ0C 2X42A 1YC7A 2ADJA 4HFWB 1PYWB 4LVOC 1PW3A 5EU5B 2EIEA 1ZLUK 3HNTL 3V0VB 3L3KA 1L6XA 4M6NH 1ZANL 5KVFL 3FN0H 1T1YA 2NW2B 4JN2A 2DQUL 5C0RH 4URTB 4PP2A 1UXSB 2HKHL 2BOBA 1LDPL 4K9EL 2PXYD 2ZPKL 1B0RB 1OGTA 3SCMD 3L5IA 5ADOL 4IRSA 1GL4B 3JWDC 4K3EL 3EYQD 5CS7A 1OAXL 3ZT6A 4HMEA 3GJFH 2AQ3A 4NZJA 5FGCE 2VLJA 1FNHA 2A6IB 1CE6A 4RFEB 1JV5B 2ZKHL 4XCEA 5FHBL 3GKWL 1J0ZA 1GSMA 3EIFA 4O2FB 3QUKB 1JIBA 4IOIA 5DR5H 5AD0A 1YEEH 4L5FH 5IEKA 5HBBA 2AK4E 3P2TA 3RKDC 3W5NA 1MCWW 5DK3A 2K9UA 1ZVHA 5F1NB 5IJVB 4FQHA 1LEIA 1D6VL 3V9FA 1C5DB 2DQFB 2DI9A 1IILE 3RL1B 1QG3A 3GRWA 2MNUA 5J56B 3A6BH 4DGYH 4H26B 1M6OB 1CDUA 1HXYB 3HS0B 1AI1L 1KNOB 1G7LB 3VXMA 3MLZH 3QHZL 3QO1A 4RDQG 3A67H 3I3EA 1BF8A 3W39A 5BV7C 3MZGB 4BSVB 2NY3D 4PRHA 1O5DT 4OZIF 5FO9A 3IDJB 4HLJA 1DBJL 4LASH 1OOAA 3PGCA 2F54A 3NIGF 4JKKA 2WIMA 1ITBB 3QCTH 1CFSB 4ZPVA 4OI8A 4Z78B 3MOAL 3MXVH 1Q9WA 4BFBD 3KPTA 1U8KB 5D2NE 3HZMB 3QUYB 3JUZA 5FCUL 3U0TB 3OQ3B 4UB0L 5DHVH 1P7QB 2X9YA 1QTYT 5DWUH 4ZPTA 1NL0H 3ROLA 4I0PB 3HC4L 4KZDL 5D7JD 2H1PL 2M8XA 5DURD 4I5BA 3LVEA 2HT4D 4FQCL 4I18B 3T77A 2Z8WC 5MEPA 3GBNL 3A6OA 4Y8AA 1OTUD 1K8DB 4HPOL 5ALCL 4APQA 2W0FA 3QUYC 2R4SL 4HLZH 4YQXL 5F70A 1FVDA 4RMVA 1DLHA 5DJ8A 3RGVD 3TO4D 1QYGH 4I0PC 1QBBA 2ED8A 3O6LH 4OCXH 5ISZD 1CF8H 2Q8AL 5D5ME 5DI8A 1Q9KA 3SE3C 1KGCD 4ONOA 5A3IC 3TNNB 5DFWH 5FDWB 1JNNL 4POYA 4KKBC 4G7VL 1A6VL 3PWUA 3EZ8A 4K2UL 4Q6IB 4R0LA 3ULUF 2X4RA 5E56A 1AO7A 1DBAH 4YHOL 3CX5K 5IW1B 2Y06L 4WHDA 4I0KA 1NEUA 4ZFOA 1TFHA 5F1OB 2OYPA 4RWHA 5FGSA 1S3KH 4I8DA 1LP9A 2DM4A 4P4KA 2DLGA 1BVLB 2IGFH 4OCMC 1JNLL 3UJIH 4L4VE 4Q6IC 1X5GA 2EZ0C 2VR5A 35C8H 1QSED 2Q8BH 4G8IA 3CK0L 4WV1A 1T0NA 2A0LC 1PFCA 4JHZA 5IQ9B 1JGUH 3QXAB 5IMMA 1VACB 4ZNEE 5JIPA 1URLA 3LQAC 3HUJB 3BVNA 1NCCL 4PJHF 1UB5B 3CFBB 1SM3L 2GK2A 3BD3A 3H7LA 3Q6GL 1LEGA 3OZ9H 4L8BB 3WN5B 4PJ8D 3JV5A 5E24E 2ATKA 3IYLW 3BZEB 1UGNA 4H20H 3ALXA 5D70L 3DSFL 5FGCB 2CIKB 3ARTA 1WZLA 1SMOA 2IANE 3QIBD 1UM5L 5CKAA 1AXIB 1F6FB 5FOJA 2FATH 5DZLA 3FONB 1OW0C 1FL3A 1WQVT 1FVEA 3MRJB 4UQ3B 3ZKNC 4E5XB 3WN5C 4NQXB 1TNMA 4NQCA 4POZD 5ITFA 4QTIL 3IAGC 4NNXA 4MNQA 2X4OB 5IB4A 4I13B 4HXBL 2IFGA 3TBSB 4JG1H 2VLRA 5DUPH 1SJHB 4DN3H 2XQYK 3AS2A 2BZDA 1MFBL 2HTKD 4TRPL 1HYSD 4XH2A 2ICES 5I66B 2HRLA 1I3GL 4OZIE 5EO0A 2XKNB 5CGMA 1IQWL 4PV8B 3NIGE 3QRGL 2YN5A 5KSBB 1M7IB 5IB1A 2NW3B 4DK6A 1FFNB 5E00B 3OJDB 4DVRL 3FKUS 3KLHD 4NN5B 3HI6H 4U6TA 1YEKL 4PJCA 1JTOA 2EEBA 2FX9H 1CG9B 3CUPB 4OD3L 4OM1H 5AG9A 3PWPE 3C60D 1H0DA 3MOBH 3RFZC 4OT1H 1WBYA 4OGYH 2AJ3B 1EO8H 4NJ9L 1XGPB 4WWID 1UB6B 1X9QA 4PGDB 4GG6F 1FIEA 1I9IH 4L3CB 4FTVB 4P0DA 1D9KD 2YHGA 1QUNA 5IMKA 1EEYB 4K07A 3I50H 4HGKC 5SWSA 3FL7A 3J8F7 2V5MA 4HKZB 2H32A 1F2XK 3MBED 4YE4L 2WNGA 4XNXL 3QFJA 1I8IB 3SBWA 2R1WB 2ZSWA 3DROB 4DCQB 1G84A 1UFUA 3D3VA 5E7FA 4XRCA 1DQQA 2IAMB 5CJQH 4ZNCD 3WXVH 2CUHA 4BJLA 2DQCL 3ULUE 3BGMA 1N0LA 5EA0L 4WDIA 4HUXB 1LK2B 5K33A 3P4MB 1DUYA 4X9BA 5F9JA 1RZ8B 4LQFL 3BT2L 4OLUH 4WI6A 2L0DA 3P4OA 3ULVL 2OZ4A 2XKSA 2EC8A 2IAMC 2D9QB 3WSQL 1ZHNA 4EI5C 1D5ZB 2XZQH 3L3IB 4JO4L 3VMNA 5JHDA 4PS4H 1FYTA 4EBQL 3BEVB 2XTJB 2C4FU 1CFTB 1WK0A 2GSIB 5I8CA 3T3MF 4PRID 1YNTB 3CD4A 5JNYA 2FL5A 2QSCL 2HN7A 4R26H 5T1DH 3A6CH 3MCKA 4MA3A 2JCCB 2ZOLB 3HB3D 1HH6A 3RWEA 1I7UB 1CWVA 4IRJD 4M7JH 1ZHBB 1FN4A 3LKOB 4JPKL 3ARGA 2A6JB 1F8TL 3HRPA 2XTJC 2BRRH 2R69H 3FQUA 1GC1H 4K3DH 5FKPB 4KWUA 3DI2B 4H0IA 1Y18B 2DYPA 1ZT4A 2APVA 2DI8A 2H32H 3CVIL 5F21B 1ZLSL 2XFXA 3P9LA 3HAEA 4P46A 3OKNA 3NIFF 3QZWA 1A1OB 3KR3L 2E7LC 2GJ6B 5HI3C 3DMMA 4X6DB 4YXHH 2R1XB 2G2RA 3KWWA 4O9HH 3T2OA 4YXLL 1BVKA 4M5ZH 4X9GA 3RNKB 2MTPA 3ARXA 3IETB 3ZYJA 4F9PC 3T2NL 4MJ2A 1C1EH 4LCYA 3O4LB 1MCNA 2XA3A 1JZ8A 1KJ3L 2UY7A 3QWOB 3LN5A 4PJDF 2C1OA 4LCWD 2I27N 3JWOC 4DKFH 5LWYL 5DHXB 4PRPA 4LLAA 1C16B 2OZ4H 2XQYG 3QEUB 5E2TH 4ODTL 5LJYH 4QF1B 2P4AB 5FKAB 4G80A 1K4DA 4HKBA 4UU9B 2WLYA 2J1KA 4YGVB 5BQ7A 1QLFB 5DSCA 1HKLL 1AR1C 4D9QE 5BO1H 1AHWB 3STLA 5L2KA 1DZBA 3GSNA 3EHBC 2F53B 5DGQA 3R06A 3U4EA 5AEAA 3MV8A 5C0BE 4KH2A 3MV01 4JDTH 5C0FB 3GZKA 1T89A 2D3VA 1NCWL 4XPHL 3IFNL 3D2UB 4OLWH 1VEOA 3NABH 1AHWC 2D4FA 2BP3A 3PHOA 4ESKA 2NZIA 1MRCH 4UTAH 4I0PD 5CSZB 3HAEH 4X9FA 4Y1AB 4JDZB 5DT1H 2ED9A 1I7TA 3O0RL 4PJ9B 3RZWA 3IVKA 1U0QA 1FV1B 1RUQH 1N3NB 4XMLH 1PYWA 2ED7A 4B7LA 3QUML 4KKBD 4NBYB 3TNMB 1WEJL 4HJJH 1X5FA 3BHBB 3E6FB 4HIJB 5EU5A 1RUML 2QHRH 4WI7A 4F7TB 4PG2A 3V0VA 5EBMB 4P2RE 1ACZA 2P5EE 1AC6A 1CGTA 1WSST 4PJ9C 2NW2A 3PP4L 1B0WA 1UXSA 1XIWB 1WAAA 3WIIH 1N2RB 2CO6B 3BKYL 1H3WM 2FBJL 1BJ8A 1B0RA 5FO8B 2EZ0D 4PJIF 4EUPG 1UYWH 1DQJB 1BIIB 1VFMA 3GSOB 3TT3H 2A0LD 3GSNH 3MJGX 4MJID 5FYLH 3MFGB 1QFPA 3G6JF 1L6ZA 5C71A 1XIWC 1QFWH 1JWMB 2A6IA 1JV5A 4LLUB 2CH8A 1JGVL 2YRPA 3WJJC 3QUKA 1VDGA 1QHPA 4DVBB 4XXCC 3T3ME 3IDIB 3UBXG 1MQKH 3ULUC 3FQRB 4CGTA 2DICA 4F3FB 4PJBF 3BKJH 2N4IA 3EDKA 2EE2A 1BFVL 4K23L 4KROB 4W6YB 3F8UB 1LK3L 2EDWA 5IJVA 3C6LB 2JLLA 3S88L 1J0IA 1C5DA 2DQFA 3QEQB 3RL1A 3VGBA 3GSWB 4JHBA 4ODBD 3VGAC 4H26A 1M6OA 3IB4A 1NPUA 1HXYA 4HS8L 3HS0A 1UQSB 4JR9L 4PJHB 3HPLB 4HQQL 1EMTH 2VISB 1WFUA 3CDFA 4Y19B 3U30B 1Q0YL 3JWDH 4G43B 4TNWF 3WV0A 3ZKND 5IWLC 1G7LA 5DUBB 4KROC 4GAJL 1JHKL 1QNZH 1KEMH 3NIFE 2BSED 1XF1A 4BSVA 5ID1B 3HE6D 2VUOA 2ATPB 3C6LC 3RQ3A 3FHAA 1HWHB 4J6RH 5ICYA 3IDJA 4GAYB 1TQCB 3DURA 4NC1E 2JELL 4N9GB 1CFSA 2AK4D 2ITCB 3WDIA 4Z78A 4S0TD 5ADPL 1F58L 3RI5K 2DDQH 4PJDE 3P0YL 3HZMA 2C26A 3QUYA 1JGLL 3LKPA 3U0TA 1Z3GH 1TIUA 4FQJH 4LLDA 1P7QA 2HFEA 4TNVK 4ALAH 5AAMA 5JW4Q 1TQCC 4C83A 3SE3A 4QEGA 4RFOL 1Y6MR 4I18A 2YPKA 2Q3ZA 2R0LL 4KK5D 4Z7OF 2IADB 6CGTA 1K8DA 1QHOA 2GEEA 5GSVB 3KLSA 4KUZL 5EC1B 3QNXA 3VG9B 3MRCB 3QJFB 5GRYA 4HD9A 3T0WA 4EXKA 3QXDB 4M48L 5FYKE 1UWGL 3CMOL 5DC0A 4N0YL 4MGXA 3C8KB 2B4CL 1OGAE 3RU8H 4GRWF 5BS0B 3TNNA 4PY8J 5EH1A 5FDWA 2RIKA 1KIRB 1C7TA 5GGSY 5DJYB 5CZVH 3QXWA 4OQTA 5GGSA 3VG9C 1ADQL 5IW1A 4NRYB 4HT1L 5J7CC 4H8WL 5FUOL 4TUKH 1QFWM 5D7IB 2E7MA 5C0AB 2BMKB 1BVLA 2W38A 2UYLB 4G9DB 4GG6B 1ZLWH 3FB5B 2VL5B 4HFUH 5T1KD 2ENSA 5D1XB 2NY2B 1A7OH 4JKPH 5TE7H 3R8BB 4JQIL 3ZDZE 4LPYA 4F58H 2EDBA 3QXAA 4OM0H 1I7RB 1VACA 3BISA 3QPXH 4EI5D 1MEXL 2QQKL 3UDWC 3SE8L 2CRMA 1FORL 3FO0L 3HUJA 4PJIE 5JXEC 4JN1L 2XA8L 2AEQL 1UB5A 3CFBA 5I1IL 5D1XC 3UTPE 2NY2C 3G6JE 3CLFL 1H8NA 3MLXH 1WWWX 3WN5A 3MJ7B 4JFXB 4DN4H 1Q72L 1Q9OB 2G5BB 1CN4A 1LO4H 3FCTA 3OAYK 3BZEA 3L7FB 3RP1A 5KZCD 5EOCJ 3B4NA 4OIIH 3HZKB 4PJBE 2J12B 4L4VD 4OQTH 2EYSA 3FONA 3ME0A 2M1KA 2HT2C 1YQVL 3EUUA 3MRJA 4UQ3A 5EUOF 4RMQA 4ELMF 4Z7UF 5KVDL 5EU3B 4NQXA 1E4WL 1X6NA 4JCLA 4XT1C 5HI3D 5E2UL 1MRFL 3LQAH 2X4OA 3WUWG 1SJVA 3TBSA 5DF0A 1SJHA 5E8PB 5DZNA 2EXYC 1Z2KA 4E41E 1CQKA 1T4KA 2AAVA 2WUBH 2VB5A 1YYLL 2OTWB 2N56A 5I66A 4KMLB 1ZGLB 3CJJA 4U6XB 4M4PA 2XKNA 3UAJD 3CSGA 1P53A 4PV8A 1BAFH 1PDKA 1MCPL 2VDPL 5KSBA 1M7IA 4MHHI 2NW3A 5IF0B 1K2DB 5HHQA 1FFNA 1FFOA 5E00A 1G0XA 2IAND 3VXSB 4LCIL 1AR1D 1RK0B 2X41A 4UNVA 2VDNH 4YFEA 2BHYA 5JZ7C 4UOW1 1CT8B 3BJ91 1NGQH 3EHBD 1N6QL 1OPGH 4IJ3C 4XPTL 2ZCLL 3N06B 4Z7OE 2AJ3A 1AGCB 1XGPA 2VMFA 1UB6A 5DRXA 1ZLUH 4NC1C 3BFOA 1FLTX 4PGDA 1D7FA 4L3CA 5F89A 1JK8A 4LSSH 2VE6B 4FTVA 5GS0C 2WQ8A 3WUWB 1FO0L 2DIAA 1EEYA 2FR4B 2O5XL 3MV7B 1FG2B 4HKZA 3WFCH 1CE1L 4ODXB 4WFFD 3JTTB 8FABB 4M1GL 4DCQA 3DROA 2W59A 3QG6B 4WW1B 5C6TH 2IAMA 1UH2A 4LSRL 5D93B 1RY7B 5F7LB 1R0AH 1BGXH 3MODH 5ACZB 3S35L 5EU6A 4PRBB 4HUXA 1LK2A 2YC1B 4S1SH 5HI4D 2R39A 3P4MA 4YBHA 2ZUVA 1MRDH 4NZTH 1RZ8A 1MY7A 3H3PL 4Y5VB 4L29B 4JANA 4OF6A 3PWPD 3ILPB 5IB3A 1KYOJ 1QLEL 3ZO0A 1YN7B 3SOBH 5I8KH 3S5LG 5HGBB 5CJBA 2E6JA 4ETQA 5LKNA 3V6BR 3L3IA 1VEMA 5CZXD 3NA4A 3PHQB 5HYEA 4IRZH 4BZ1H 3BEVA 5FA4B 1CFTA 2GSIA 4YUEL 3RL2B 4Y5VC 1YEIH 1MCJA 1YNTA 2Q3AA 1ROWA 4Y8DC 1X5AA 3KPNB 1XIWD 4PUBH 4UT9L 3MRBA 2JCCA 1UVQB 2AQ1A 1ZHBA 3LKOA 4HH8A 5B4MC 1RFDL 5CD5C 3QDMA 3ULUD 3I2CH 1VFBB 3H9HA 3LDBB 4PJIB 2VJXA 4ZO9A 5FKPA 3C5ZB 2V7HB 3JV6A 3O3DB 2E6QA 4M6AA 4NBZB 3G6JB 5EC2B 4HWEL 1IC7L 4JO3L 1A1OA 3SE4A 2GJ6A 3QDHA 2BNRA 1LO0H 4X6DA 4DGIL 1EFXD 4B41A 4JFHE 4DW2L 1YPZA 1G7IB 3LDBC 4Q9BA 4XCFH 4HWUA 4U2YA 3RNKA 3FO2B 5EUOE 1CLOH 1RUPL 3S5LB 4ELME 4Z7UE 4PJBB 2I24N 4J4PD 3AMKA 3O4LA 3QWOA 4YJZL 1CDGA 4K94L 3TYFB 4Z9KB 3OKEB 1DANT 3K3QA 4LDEB 3QEUA 1OD9A 3DV4A 4QF1A 2J6EA 5FKAA 3BDYH 3LB6C 1N6VA 1DBKL 3QXTA 1Z5LB 4UU9A 4OLZH 1YY8A 4YGVA 1RD6A 4OSUL 3RY6C 1R6VA 1QLFA 5D1QC 1GGBL 1AHWA 1INDL 5ESAB 4CMHB 1HXMB 2F53A 5C0EB 3ARDB 2B0SH 4KV5F 2R1YB 4YXKL 5C0FA 2Z9TA 2VLKE 3L9RB 4GW1A 5TE4H 4KRNA 3D2UA 4ONHB 4IIQC 3EYOB 4CMHC 3B8YA 5F72S 1PD6A 3I9GL 5CSZA 3RNQB 1RJLA 3JWOH 4UQ2B 3STZB 3B9KC 3ARDC 4Y1AA 2EIBA 4PJ9A 1UJTA 1FV1A 1N3NA 4HUKB 4GSDH 5IKCB 2BVPB 2R0WH 3TNMA 5C0DB 4Z8FL 3BHBA 1N4XH 4HIJA 1CGSH 4D9QD 3FHQA 5GGTA 4Z76B 4C56E 4XP4L 2XZZA 5EBMA 1LQSR 3RVWC 2C3XA 2RR3A 5IB2B 1G9EA 1FH5L 4XCCH 2HG5B 3NMEA 2BVTA 2E9IA 2YMXH 5C0BD 4GRWB 2J6EH 1N2RA 4XMKH 2HJFB 1ZVSB 4X83A 2XXMB 4W70A 1C5CH 2V7NB 4OTXH 1JRHH 4GMTH 1RJYB 1DQJA 4NNPL 1Z0MA 4LIQL 1LWRA 4XC3L 3GSOA 1EAPA 4Y4HB 3KGRA 5BVPL 1L0XA 1MY5A 4BYHA 3P73A 1JWMA 1MAMH 1PQZB 1U3HB 3PQYE 4LLUA 4LARH 1PSKH 5JXED 1OTSD 5DQDL 4DVBA 1Q9LA 4ZFFB 1Q1JL 4EOWH 1MPAH 3M07A 3IDIA 4P9ML 3FQRA 4OD1H 1MCKA 3B3IB 2NY2D 1KACB 1HI6B 2YPLE 2H9GB 5E03A 4F3FA 5IWLA 2C1PB 4Y4HC 4P2RD 3IT8D 1NCBH 2EE9A 1H3VA 4QHLB 3AU1A 2HYMA 2G60H 2P5ED 2BNQA 2Y36H 3C6LA 2VC2H 3X3FH 1MH5B 5IT2H 3QEQA 3GSWA 3OJVC 3BZFA 4KTEH 4PJHA 2OK0H 2VISA 1CZ8L 3QHFL 1PG7H 4BQ9A 4Y19A 2CXKA 5GGTH 5C3TA 4M6NL 1I1AB 3FN0L 4QCIB 5DUBA 3TFKD 4GQ9H 4UILH 4XB8A 5ID1A 4OUUB 4JDVB 2ATPA 3VW3H 3VFPB 2R4RH 4GAYA 3O6FB 2CK0H 4OF3A 4JO2H 4WI3A 2KPNA 1NCTA 4N9GA 2EXYD 1J1XH 2ITCA 5HSFA 1U8HB 1G9MC 1U3ZA 5IHUL 2Y1VA 1I1AC 5EUOB 1OQXA 5BRZB 2V5SA 2FEDC 3UBXA 5EO1A 4IMKC 1LE9B 2X89D 2R8SH 1X5XA 3O6FC 2YSSB 2X4QB 4KK9D 1P4BL 4M7KH 5JO5A 5E70A 4Y16C 2IADA 3BWAB 3ZTNL 4RBPK 2EDKA 5IP4A 2EO9A 5GSVA 4IDJH 5EC1A 1OD7A 3QWRD 4Z0XB 4J1UA 5DJ6B 3MRCA 3QJFA 4M9PA 3QXDA 1PZ5B 4KV5E 3C8KA 4C54A 2HH0H 3V52H 3U79A 4P2YA 4DGYL 1QLRB 4OCSH 5BS0A 5L88L 1S9KC 1KIRA 5DJYA 1H3GA 4EDWH 2P8LB 3A67L 3HG1A 1A7NL 4NRYA 4I2XB 2ZJSH 4OZGF 1MFAH 5I75C 4XXDA 3S37H 4JEGB 4LASL