2WNKA

Structure of sporosag from toxoplasma gondii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
235
structure length
223
Chain Sequence
TSCETEGSSISFTVEKAGHVVRFNCPSTLEEIKPAYEAGDSTKVCTTADCSNEAALKDVLKSASLAQAEGSGGNDFTLTVDALPEAETSVFFLCQRTGAAVPSDKCGVHILVKAAPQAPVCSAQDHTLELQITAANSDTSFVCGGTFNVIKPANAAKVLQGDSCETEVDLVSLVPHASRSALEQSGLIKLSVTDLPQQQQKLCYRCEDSSQKACKVLVTVSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPOROZOITE-SPECIFIC SAG PROTEIN
publication title Structural and Functional Characterization of Sporosag: A Sag2 Related Surface Antigen from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 50
structure length 223
sequence length 235
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04092 SAG SRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2wnkA01
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2wnkA02
2X28A 2JKSA 2WNKA 1KZQA 1YNTF
chains in the Genus database with same CATH superfamily
4A6YA 1T04A 4NQXB 4Q8BA 1EO7A 2J20A 3E2HB 3P77B 3K4DA 3C08L 4QOKB 3CFDA 2ZJSH 1NGXB 1SXNA 9PCYA 5DK2B 5FYLH 4POZC 2R23B 2OTPA 3MRQA 2CIKA 1UXLA 4BUQA 1P7KA 1EZSA 2VERA 1VGKB 3LS4H 3Q01A 4L0ZA 1TENA 3MFFA 2EIKB 4JJHA 4WDIA 3ZXAC 3TNNA 1A8ZA 1D2OA 2BCKA 3X1GA 2BY2A 4U3SB 4R2GB 5DC9B 5IMOA 1IARB 1XEUA 1A7OL 1S7SB 3IFNH 3FT3B 4HG4K 4HH8A 2WXOA 2K8MA 4UYPA 3T3ME 5PAZA 2NNAA 5FYLD 1XBRA 3WHXA 3NK4A 2C7UA 1KJ2L 5DRXA 2APTA 3ZT6A 2VLLB 3W11C 3WFEL 1UVQA 5EB9A 5J1AA 2OKMA 3H2QA 5F7LB 2YD2A 3KPSB 3DX9A 4OBRA 5EHFA 5EU4A 3UABA 4NC1E 2WXJA 2GBAA 3LN9A 2BOBA 3ARGD 2EEAA 3SE6A 2VDNB 2FATH 2CALA 2OK0L 1R3HB 2E86A 3FUJA 2SEBA 4O00A 5E8EB 4CN6A 3WTWA 1RK1B 1KEML 2BY3A 3AS3A 3HLKA 4KFMA 4AIOA 1K85A 4U1GC 5TF1H 1A9VA 3SGJA 4A63A 1MIML 1U95B 1DQLL 1RSYA 2NLJB 2VXUL 5JIMA 1DDHA 5BPPA 3Q8EA 2GUYA 4ZSOA 4HXBH 3CN2A 1N8ZB 4HXAH 4IDLA 1U8PB 1CT8B 3OKYA 4ZUTA 3QUXC 4KMTL 1GMEA 4NJ9H 5IHBA 2Y36L 3ULUL 1FGVH 3G5VA 5KVFL 5JXEC 1S4IA 5D7HA 3M88A 3X11A 1DQVA 4ABWA 1DVUA 1XGYH 2IWEA 5IG7B 2HT2D 1QKZH 3FUKA 1TVHB 4QXWA 2GJ6D 2VZSA 3BKJH 1LO4H 4M7JL 2BX5A 3ASWA 2CJUH 4L8BA 2EC8A 2GSMB 3UTTB 2YKKA 1SBBA 4PWKA 5BNXD 2X70A 3ZBMA 1M7UA 1ID5I 4X8JB 5EZLB 3G7TA 4OZIE 4CVZA 4Y9GA 3VXRD 2X4QB 2FB4L 4JW3A 5HI5C 2AF2A 5E6ZA 2AEQL 4FFWC 4UT6L 1PLGL 1SUHA 5HGBA 4L5FE 5D4HA 3ZMNA 3ARBC 4Z3EA 4UQ3B 4E9XA 2YMXL 4OM0H 1NMCB 3HUJF 2Q8BH 4QHLA 4PJEE 5F0LB 4HOZA 4LLUA 4N8CH 4P4KD 1D6VL 3UZEC 4I5BB 4UU9B 5EOCJ 4LLYB 2QVTA 4YK4B 1OALA 3P11L 1GAFL 2NTFA 3HG1E 3SIKA 1NLDL 4UNVA 1L9MA 3MVSA 4M1CC 5E99L 1JZ4A 2DS4A 3LTVA 1SM3H 3ZE0B 5D2NB 3KE0A 4DPCX 5BS0B 2P26A 4MS8D 1KXVC 4EOWH 5FM5M 3KBEA 1K9TA 1R19A 2ORBH 3HPLA 3L4WA 4WWKD 5F7DA 1OAZL 4JRYE 5FKAB 1XH1A 4YL9A 5GGRA 5AAWC 2FT7A 1UB6A 2I26N 3QWRA 3O2VL 4XXWA 1VKXA 3EUDA 2W07A 3D6GA 4LFHD 4N68A 4AENB 1ZVHA 1PY4A 1OAYH 3G9VA 4XO8A 2B2XL 5KSVA 5TGBB 1XWVA 4N1HB 5EO1A 3H2PA 4OKDA 1BVLA 3HCVA 5DJ6B 1KGIA 5KBNC 4EXPX 1KYOJ 2AXHA 2ITDA 3SYQA 2VQUA 4Z7WF 3WSQL 2NPLX 3BZFB 1PTZA 3HN8A 3DA0A 5E1IA 5I1JL 5E0FA 3RDTC 4UILL 1FYTE 2QDVA 3HAEB 5CJXC 1S9WA 5IJCC 4S1SL 1MJ8H 4P2RA 3X13A 3CVDA 4AG4H 4A7SA 4JY5H 4XB7A 1KBBA 3U9PL 3K72B 3ES6A 4BCXA 5CP7B 5LCVA 2B77A 3B9EA 4N9OB 5IFJB 5LKNA 4W4OC 5DZOA 1IGYA 3HAEG 4JFSA 3DNKA 4N0FB 5G4OA 5F21B 4XPBH 3V52L 4EI5B 2VAAA 4OQ1A 2IBZY 5AW9B 1VRSA 3OMNB 4APQA 2B9BA 2H9GB 1IB5A 3AFLA 1IIIA 3MRHB 3QEQB 3RWEA 3TZVB 3X12A 2UYLA 3BMVA 4LHJB 1ONQA 3CH1B 3DIDA 4HQQL 2HUHA 5JHLH 4DKAA 4MJ5A 1I8UA 2N0MA 3DV4A 3OX8B 4B9JA 1U8NB 5DC2A 2XN9A 3QAQA 5F9WC 5C0AD 1A02N 3BWZA 2QVKA 2YQGA 5I8OL 4D7PA 5I6MA 4G59C 2EC9U 3FU5A 1R4XA 5DVNA 4QRPE 4F20A 2R8SH 1ZGLM 2RCSH 4E42A 4Z1PA 2BVEA 4O02B 1QRNE 2IV8A 2Z31B 4I0CC 5CEYA 2YUXA 3DHMA 5JPMB 3LXBA 2FBOJ 1IJ9A 2F53A 4N2EA 1GW6A 1F4HA 5CIPH 3EOYG 3HBQA 5E4EC 4XVOA 4YBQD 5E95B 4BSWB 2B1HL 1T6VN 1M05B 5L4JA 1EAPB 4F8LA 3IJYB 2JLPA 2M1KA 3K8KA 1FNSH 3QEGH 3CFJA 4CMMB 5B3SB 1YY8B 2VC2H 4H0HB 3VH8A 1PAZA 3BHBA 4G80B 4KJWC 3VQLA 4BK4A 1A3RH 3D25A 2WLYA 3BKML 1AP2A 5FDYA 4NUPA 4ZZKA 1Q0EA 1QEXA 4TTGA 2VLKE 1JHKL 3K2UL 1XSKA 2WXRA 1T21A 1ZXKA 2IAAC 4Q9BA 3IS0X 4XPTL 3SHSA 1MRFH 4A6YL 2F5AH 4XMLH 5F8QC 1TUPA 5IBLC 2F7IA 5AVTB 5C70A 1TQCB 1I53A 3ZTNH 3GBLA 3DVGA 1JPGB 2VQ4A 1NSNH 3MMEA 2OXGB 2WBJB 3D7PA 3FB8B 4FLOA 4JFHE 2CRZA 1CG9B 4ADGA 1LM8V 5F6IC 3H42L 4QXUL 4HUWA 3GRWH 3SDXA 4W6YB 3U83A 4L18A 1LK2B 4LDCA 4AYFA 1SEBB 2DQGH 2VQ1B 3EYQD 5AZEL 2OMZB 4FQXB 3QPXL 3WFCL 2BP8A 4X8XA 2ARJQ 2Z1KA 3UTSB 2G2PA 2XIDA 4M48H 1YQ2A 4UT9H 1G7IB 5F70A 3QR0A 1TG8A 4FXKC 3QUXA 2VLJD 1BQHA 3MAWA 4HLEA 5D1ZB 3SYCA 5JXEA 3MRBA 5J06A 5C2BL 1YEIL 1FFNA 1EHLH 3MLZL 3ESUF 4IRJC 3MBWB 5I2IB 3KWVA 2KLTA 2VL5A 2OXHA 3D39A 1BFVH 4UI2A 5ITBL 1IAKA 3VMOA 1JV2A 4V33A 2WVUA 4OLEA 3SDCC 3MJ8B 5ES4B 1OGAE 3VJ6A 2J21A 2KLSA 2F08A 3S34H 3V0DA 3BQVA 4ZX4A 1G43A 1FHNA 4R26H 4U4BA 5AALA 4JREB 4MCZA 1X9UA 3G5ZB 1DVSA 2EE6A 3T8MA 1UB5B 4C55A 4BZYA 2Y7MA 3ZKMD 2R2CA 2C3HA 1PSKH 1AKJD 3BIBX 3PL6B 5DVKA 3IDXL 3SPIA 3ZJAA 3IDNB 1NINA 2F7OA 2Q3ZA 1VF5C 1J0HA 1ERNA 4FQ2H 3PJSA 4DKEL 4DKFL 3TA3D 1EHXA 2JKWA 3ARBA 3TASA 5ISZA 3MV9A 2DMCA 3NJGA 4J2QA 4WCYL 2YAQA 4BFRA 2A9ML 5LVEA 3KPLB 3OPZL 4YUEH 2BVQB 5I8CB 3TBWA 2ZF8A 2AFNA 1HX0A 4HS3B 3UZEA 1O9ZA 4P9MH 1MF2L 1EWHA 2VMEA 4KFZC 1J1PH 2H1PH 3PXHA 3ZY7A 4LP5A 1MCCA 4PRHE 3PUCA 2DQUH 2YPVL 4TS6A 4Z95L 4TQHA 4D9RE 4F91B 3MODH 1R3KB 3EH5B 1T83A 1DVYA 2DWTA 4KTDL 3MREB 4U6TA 5I8EB 4HWUA 1MI5A 1KXVA 1S78D 2VIRA 4MD4A 5EU6D 1MRCL 2EDQA 5CUSH 6PAZA 2C9PA 4FZEL 1KTLA 4OLXL 4X4MA 3QUHA 5D71H 3ULSB 4BE6A 5AAWA 3BP6A 3OLIA 4NN6B 1WS8A 3G3LA 2WPGA 3FQTA 1Z9MA 3NQIA 3ABKB 4J28A 4MCYA 2GY5A 3LRMA 1MPAH 3CLEH 2E7MA 2RIKA 3QG6B 5T3XH 5I1EH 3JV4B 3SE4C 3FTXA 1RJLB 2XKNA 4R4BA 4H20L 3OJDB 4J6IA 5F89A 3ELAT 4GKSA 3NZHH 3OZ9L 4B3EA 5T33L 2ADYA 1BBDL 1N59A 1FH2A 3RDTA 5HHMB 2B1AH 3O6FC 5FYKL 4AGQA 2CLZA 1UOLA 3OR6A 5T3XD 2GI7A 2D8KA 3I9PA 4XWGL 3ROOB 3S3PA 1MJJA 4MJHA 1HNGA 4YNYA 3AWEA 1T66D 3GZQA 4W4OA 3DXAD 1FAKT 2OJEB 1WA2X 2CO3A 1FZMB 5ESVB 4ZW6A 5K9OA 1BZEA 1OY3B 4Z7UF 3C6EA 4G43B 2ZXAA 5IIEB 1MCQA 1BMWA 3I75A 4HH9A 4YHZH 3CVHH 3X3FH 4WNQA 4UINH 2WZAA 2WVVA 1R5VA 1GGTA 3I3EA 1X5LA 4LCIL 2RFXA 3ALXA 1AGCA 1JZ3A 3SY6A 1WH0A 3QZLA 3EDDA 5BJTB 1PZCA 1CZ8H 3GXFA 5LCVL 4YZFE 2BVPB 2PTTA 1UH3A 4KK6D 2ZD0A 3PF2A 4DOHE 2LHAA 1DQLH 3MA7A 4W81A 3FT1A 2Y24A 3OKOA 1N68A 3QFJE 1FVEB 1OARH 3UDWC 3BUYA 4Y5YB 3QR2A 5CJOL 5SWZB 4F27A 1FIGL 1OVZA 5IHZB 5CHNA 1NL0L 1PIGA 2QFRA 4JKPH 1E6OH 2YSSB 5T1DL 4NOBA 3VG0L 2XY2A 3VQ1C 2Y36H 3ZIYA 2JI3A 3TC9A 3S8GB 4JO4H 4CU6A 2EE9A 3CTTA 2EXTA 5M94B 3OKKB 3DYMA 4OAWA 4YFLF 5EOTA 3NN8A 1TJGL 4WTZG 2LOEA 4FMFA 2X38A 1NOFA 2ADJB 4NO0A 5KEZA 1Z9PA 4HGWA 3EYFB 3RUGF 1NFDA 2H2PC 3FN9A 4K9EH 4ELME 1UJTA 3IGUA 4C56A 4KI5E 2IVFC 1M6OB 1TKWB 3OKEB 1W0VB 4HPYL 4Q52A 2FX7L 1NICA 2NY3B 5GRVK 2AI0H 3U36A 3PABB 1LLAA 4J6RL 4KK8C 2X3AA 2AEQH 2CUMA 5L0QC 1BJ1H 1PLGH 3FPXA 1I9RL 3ELQA 4V1DB 5ITFB 4AJ0A 3MRPB 2UY6A 3UBXA 5CEZH 4TULL 3KXFA 4MMXA 4ODHL 2O1AA 1JGLH 3QXWA 2J1ZA 3UBHA 1DO5A 4KGLA 4F57H 2V2XA 1AO7A 3CFMA 3L4TA 2Y06H 3AITA 4GEJA 4X8GA 3ZE1B 1NLDH 4O4YH 5ERWB 2N56A 4QTFA 4LEXL 4PS4H 1I8MB 2NW2A 1U3JA 4FERA 5B3NA 5CEZD 3K1KC 1UD4A 2GT9A 3FB6A 4HDIA 4PG9B 1FP5A 3OQ3B 5I1LB 4EKJA 1ADQH 2AJXL 1XZ0B 4WJKB 3RZWA 4B41A 4NNXA 2IH1A 4NZFA 3BIAX 4IRJA 1S7UB 4YSEA 4NN5B 4BH8B 3FN0H 2YA2A 4N8VG 1SN5A 1AYRA 4R4FL 2XETA 3T9WA 4YH6A 3SDCA 2KBGA 3BH9B 2A77H 4HK3N 3F12B 4BSJA 3FW6A 4AGOA 1WZKA 2NUPB 3GIVB 3NP3A 1KN4H 4BELD 2P48B 3D1MC 4A55A 3VFSA 5DUML 3WSQH 1FG2B 2JI2A 5I1JH 2V33A 3WV0A 5DSCB 1VFUA 1LTXA 1TVBA 3BI9X 4UILH 1NMCC 5C6TL 4OJYA 1X3DA 4P49A 4P07A 4AYDC 1CDYA 1QLRB 1RIUL 4LLVB 2FYVA 4NBYB 5ACLA 4MDIA 1J8HB 1HEZA 4YK4C 5KTEH 1TZHB 3W2DH 3RPKA 2HVBA 4I0PD 3TNMB 3QQ3B 2QQNH 3T6ZA 3V52H 5D2NC 3O6LL 3FCTA 1KTKE 4AIXA 3MRDA 4Z0BL 2XZCH 2VLRB 1F11A 5KAQF 5H8DA 4G8IB 5CSGA 5JORB 1SF3A 3BN9C 3HE7D 5FCSH 1EXUB 1A6ZA 2HJKA 2Z4QB 4I7ZC 3SCMD 3LAFA 1YRKA 1XSJA 1T1YA 4L4TB 1WRFA 1DSFH 2PUQT 1GZHC 3HNSL 4ANWA 2I7SA 5A7BA 4Z78A 1VFOA 1BQUA 4KRPB 1YVLA 4LNRA 1QSED 3L9RA 2F54A 1ICTA 3IU4L 2FE0A 3BZEA 4YPGB 3IGAA 1XF4B 2EINB 2VDLL 3NGBB 3IJSB 4WSJA 5F0PB 4KXZI 1JZFA 4XOCA 2IAND 3SE4A 3RU8L 3VXPB 3FQYA 4XX1E 4GXUM 2MFNA 3TIDA 5IESL 1U8CB 2G75A 1QVOA 3VO0A 3I6KB 3P4NB 3RLSA 5L8KB 1RU9L 1BM3H 2NY5C 3RDJA 1YEFH 4OB5L 5H35B 3O6FA 1TEGA 1UOKA 1FL3A 1JV5B 3CC5B 4QTIH 2B5IB 5J57B 4RA0C 2W92A 2W9DL 4RA3A 4WI8A 1YPZA 4YDLB 2XZAH 3UAEA 3BKMH 2AW2A 3VA2C 1KXQA 1QUNA 1ZSDA 3AUVA 1UZ6F 3BH4A 1DQTA 4YQXL 5JO5A 4QXGH 3VRIA 3K2UH 2HVKA 2LAGB 5C0EA 3IM1A 1SFHA 3UZVB 1QZ1A 4TUKH 2ESVD 4JG1H 4MJIA 4XPTH 2BS71 2O61A 1NBZA 2NXZC 5I30L 4NNYA 3WNNA 4GAYB 1LO2L 4GI9A 1YC7A 4IBQA 1MZYA 3VSVA 1S7QB 4L37A 3G04B 4A7VA 4TUJB 2HFFB 3L3GA 5I1GH 1A7PH 1DTUA 2DQHL 4P0DA 4JFDD 2FIKA 3QPQC 2XVKA 4QXUH 1A6UL 3MBXL 5HDLA 1CDBA 3OSVA 1P4BL 5EO0B 1TTFA 5AZEH 2R1WB 1DQQB 4LSVL 5T1LD 2JCCA 5E51A 1QR1B 4NHUB 5FS5A 4BWTA 1NGXA 3BRFA 3ASOB 2V8LA 4BWWA 5AQ0A 2X4SA 2PETA 3GIZL 4HETA 1HYSC 3DX2A 3T77A 2EVFA 2H26B 3UDWA 3SBRA 3R0NA 3PGDB 4XVSL 4GSRA 4JZJB 4OCRL 2BHYA 2CCLA 4U3SA 5D1XC 4HIHB 1CFTB 1S7SA 3FT3A 4JMNA 2APXA 5FWQA 2QSVA 1S7XB 4PS7A 1P7QB 2VLLA 3U30B 4HLZG 4P5KA 4BHUA 5AB1A 3MV7B 3KPSA 2YGQA 1TQCC 2V17H 1BD2B 2VTFA 3BSZA 3PWPD 3BFQG 2F1AA 4RAUB 3DSFL 3T1FB 1JYWA 4M1DL 3S6CA 4X7DC 1JPST 3JV6A 5E8EA 2NW3A 3K2IA 5D7EA 3IDXH 1J1XL 4L8SB 3AT9A 1O0VA 3WIIH 5IW6A 4AY0A 5DJZB 2Z35B 4FQXC 2UX7A 4OLYL 2ISDA 4WCYH 2TSAA 3Q7JA 5AEAA 1F58L 3CVIL 5F6HJ 4TUOB 2PYEB 3GMNB 2E27H 2R69H 5GJSH 1PD6A 3EZ8A 3PNRB 4PJCB 1CT8A 3VAEA 3RJQB 2KC0A 2TAAA 3HG2A 1MAKA 1JGDB 4XP5L 5IFAL 3L54A 3TVMC 4KTDH 4OLUH 4Z3TA 1KNOA 5IG7A 4BKSC 5T5FA 1IAII 5C0BE 1TVHA 1MRCH 3UBGA 1ZJBA 5DZJA 3ROLB 1BAFL 2HVJB 2P5WA 3S36X 3WE6B 3DO4A 2VDOB 3FKUS 1ZHBA 1FPTL 2CR3A 4WO0A 1MRDH 3UTTA 3BAJA 3RGHA 3BPLC 5T3ZL 1HEHC 4JREC 1BYNA 4B6ZA 3CHSA 4IBSA 4OGAD 2XWDA 2CHZA 3PL6C 4D0DB 1U6AL 4H20H 2J5LB 4MA8H 1VADA 1U58A 3EJRA 3NTCL 1R9FA 4Y9BA 3SQRA 4ATTA 3DURB 4R96B 1J48A 5T33H 3DJSA 3MTXA 2WLJA 1FNGA 1HCFX 2X2UA 3AQYA 1H6EA 4OLVL 5FYKH 3BYYA 2Y5TB 3KL0A 1KCWA 1TXKA 4EI6B 3FT4A 2NZIA 4UU9A 4AT6B 4LLYA 1GJWA 4Z18A 1L0QA 2DBJA 4UUJB 3U2IA 1SXAA 5KVGE 2EDNA 1RUAL 5D2NA 4FA8A 5BS0A 4GQ9L 3MXWL 3KDPB 2R51A 1RZKC 5FKAA 1NMBL 5JHDA 5HDBB 3TJEH 4LGPB 3BCDA 4K07A 5FOJA 1Z3GH 4AV0A 3AUWB 3P54A 4WF7A 1I82A 1GZHA 2XWTB 1ASPA 3MKKA 3QHZL 2CO2A 4LCIH 4AENA 4NC1C 2YFNA 1YEHL 1YEJH 5TGBA 1D7BA 3RHWF 3BPNC 4MFHA 1E4JA 2OSXA 1J9QA 1BQRA 5CJ8A 2CU9A 3BZFA 3GKWH 5EFIB 5EEVA 3QR1A 3HAEA 1MHCB 1HDMA 4X6CB 3S0PA 2HXAA 4P2RD 1WLHA 4EQ3A 1NL0H 3IMUA 4GKNA 2AAAA 5CP7A 3Q8CA 4HKXB 4OD3L 4XCFL 5T1DH 3VG0H 2CO6B 1FLTX 3CH8A 3DRTA 1EQWA 2WYTA 2ZX7A 4N0FA 4QRRA 4N2CA 1NUNB 4UTCA 5EPMB 4HUXA 2VXTL 2MTAA 3DOHA 3NRQA 1TJGH 3P02A 4XPAH 1B4RA 3EAKA 3G6JE 4APQD 1PZ3A 3VG9C 3VXME 1OLLA 4HBCH 4ICWA 3FCSB 4QY8A 1CD1B 3KNBA 3OX8A 3C5SB 4WV1B 3BP4B 3MRMB 1FFPB 1WFJA 4LDLB 3BYTA 5HHVH 3US1A 2FX7H 2FHBA 1SYSB 2XN9D 2BY1A 2C1PB 2J73A 1OP4A 3ARFD 3P1VA 3V4UH 1A6PA 4J6RH 4LSQH 3GUTB 3S3CB 1HH9A 2BDNH 3V0AC 4AE0A 1H15B 4N6RB 3O4LA 4KKLC 4PJXF 4O02A 3EFFB 4XMPL 4TULH 5AL8A 4ODHH 2WWNA 1J8SA 1U8MA 3FQWB 2CBPA 3QUZB 2DIEA 4Y5YC 3LOWA 1WAEA 2OL3B 2F53D 5DVLA 2ZWLT 5TDPA 4BSWA 4POZD 3KGSA 3C5ZC 2F7RA 2CDGA 3AROA 1YY8A 3C09B 4PRPE 4I85A 2K7QA 2JJVA 5I74B 5D1XA 4P4RB 4JZOA 3FCUB 3D3VA 4TTDC 3PAYA 4BRJA 4X6DA 3WFHA 1M71B 4J8RA 3UYRH 3CVBA 4WEBH 4A2LA 2ZOKB 4NIKB 3W11D 1QEWB 2MOQA 3OHMB 2IFFL 3E8UL 5BCAA 4IBZA 3WLWC 1I7RB 4UTAH 3G6DL 4U6VL 4FQCH 5LLIC 3WNIA 2ARJA 5FKPA 2ADFL 4PW9A 4MAUL 1UD3A 3RA7L 1V5JA 5DUMH 4ZOEA 1R0AH 4N87A 3ESVF 1OSZB 1Q4NX 2IADB 2OSLA 2OYMA 5C6TH 5AKTA 1LK2A 2PF6A 3JT0A 4MKTA 1I9EA 2X87A 3BQUB 1R3IL 4M7LH 1SQMA 3IGFA 1FE8L 2EIMB 1DVQA 4H8PA 3IAPA 3UTSA 2EE0A 2DYRB 4JFFD 4PJFE 3T0EB 3HB3D 5IQLA 3IDJB 5D7LD 5G2NA 5CAYB 4H4NA 4PJAF 2XQBL 4BZ2A 4PBXA 3WDHA 3PJLA 3MLTB 4Z0BH 5FV2A 5I75C 3MQIA 2GUOB 2BZCA 3MU3A 3QUXD 4UIKH 1A4JB 5CLXA 2XNAB 4OGQC 3J7HA 3TVMA 2A2QT 2DOCA 5JXED 1YMMD 2XG5A 3PRZA 1DSYA 5C7ZA 2X6BA 3MBWA 4XBGA 5I2IA 5KBLA 2VDLB 3HNSH 4W9EC 4ETYA 1N26A 5F1OB 3MACH 3TN0B 1ID2A 3VYOA 3F7VB 4PBWD 1FAIL 5DA0B 2AK1H 1C8QA 1FL6B 2W59A 4LRIC 5EZPA 1UZ8A 5AOJA 1UB5A 4F7KA 3LQZA 4JRXA 3HC4H 4TQPA 1FO0B 3PL6A 5KBKA 3FQRA 4RFNB 3D4ZA 3IDNA 3RU8H 3FU7B 4FZ8L 5HI5D 5F3FA 4GG6B 2BERA 4WI2A 2F15A 2PABA 1XZWA 3P4MB 4FFWD 1A65A 4GEIA 1GPOH 5E6UB 5FO7A 1U8HA 1AMYA 1HZHH 1H8LA 1EANA 1RU9H 5CLYA 3BP7A 1A66A 1OB0A 2FEJA 1JAEA 3ARBD 3AG3B 5ISZD 4JZNB 4PGCA 3FFCE 1PG7W 3NVQA 2NX5E 4BFKA 2E7CA 1R1CA 4F2EA 4YDNA 1AGDB 3PWNB 4F37K 1CICC 1BSIA 1WWAX 2J1XA 5MENA 4HD9A 1R3JB 1MFDH 3KR3L 1AI1L 4HJSA 2C9VA 4M1CD 1R3KA 2R0WL 4WO4C 1FZOB 3MREA 2E7DA 2FX9L 1V3MA 2DMGA 1KXHA 3VFRA 1MI5D 1MVUB 4XP6H 2UY7A 4GG8B 2EDFA 1D5RA 2PMZA 4UM8B 4JGNA 5I30H 2BP5M 3ULSA 4YDKL 1HOCA 5BVJB 1F0LA 3QRGH 4EIBA 4NSKB 3P2TA 4NBZB 3ZDXE 4ZTPL 2EDLA 1V7ML 2KPWA 4WTXA 2GPZA 2XA8H 3NGBC 5JW4M 4ZFZA 2BNQE 3VQMA 4YHLH 1S5IL 4MNQE 3AWFA 3MBXH 5JOPD 3V5HB 1KIUA 3AY4C 3ZL1A 3OJDA 5FUOL 4GQRA 3NH7H 5A6LA 1IQWL 3R18A 3L4XA 5KS9A 1CJYA 1IM3B 1G7PB 1V54B 1VLXA 2ADGA 2JKSA 4RETB 4WFED 5DCCA 3RDTD 4JM2B 4RRPG 3PDDA 2YPLA 4PJHB 3BWAB 2B5IC 4PRID 3OGOE 5BZXA 4XVSH 3AZUA 4J23A 5CO1A 1LWHA 3H1ZA 4OCRH 1BVNT 1N3NB 2ZKHH 4XCYB 1ZTXE 4JQIA 5BRZB 5B8CC 1ZDQA 1NCTA 5CD3B 4PRNB 1EXHA 1HI6A 3I6GB 1R24B 1FZMA 1OOWA 4B0MM 3MGTA 4UOQA 5IVNA 3QA3A 4Y4HD 3L5HA 2YLKA 1XB3A 5BOPA 3GK8L 4TLUA 4ZX6A 1HH6B 4X80L 2YZ1A 2A4CA 2XUWA 1HWGB 3ASNB 2BIOA 5BJTA 1R75A 4CVXB 5DK3A 4OZIA 4HKJB 5FYJE 1V55B 2J2ZA 2N1KA 2VABA 3FPYA 3HG0A 1MFBL 2OLDA 4E9LA 4A38A 1QLEL 1Q9LB 4FFTA 4XC3L 12E8H 1RXLA 2B3IA 3S7GA 1LDPH 1NGPH 1BX2B 4OLYH 5A6IA 2L7UA 3KCWA 1F58H 2CDFB 3EGDB 3JXAA 1Z2KA 1RI8A 4QAMB 3CMOH 2V2TB 5IHZA 2ZWYA 4WTZA 4YSOA 2EDYA 4JZJC 1MY5A 1IL1B 2X89A 3C5ZA 1FFOA 3EJQA 3K0WA 3MGOB 3FFDB 4NIYE 2GITB 5AZ2H 4KJWD 2XWCA 3B37A 1ZT4A 43C9A 4AGPA 4LOVA 2PP7A 1C16A 2ADJA 3PHAA 1ZA6A 2PCPA 4GJTB 4NO0D 2FECI 3MRNA 3V6ZB 3FUHA 4N85A 5HI3C 1SJMA 1SUJA 1P1ZB 1CN4A 2BRRL 1RURH 3LEXB 3L08A 2VMJA 4C56D 2XDHA 3QDMB 3B2MA 1E50A 5KJ7E 1CGYA 3GB7A 2LTQC 3PABA 5IBLD 5D5MA 1U6AH 4L8SC 2AJYH 2OZNA 4Z3IA 3HIZA 3FO9A 4V1DA 4K71B 3MRPA 1U3HB 3NOIA 3S35L 5IQ7L 4AQ8C 5DJ8B 5AW5B 3VFUA 1A4BA 3NFSL 5C0GA 4ANKA 1NCDL 4FHKA 2P46B 4OLVH 4NB7A 1FLRL 1X5YA 3QEUB 2AJVH 3EDFA 1AO7D 3SKNB 3BKYL 2I60L 2CIIB 3QWOB 2XIIA 4A7GF 3I50H 3FSZA 5LWYL 4CSPA 2MTPA 1C5DA 4KJYB 1RUAH 1TMCB 5I18L 5KANG 2FLMA 2HFTA 4ODSL 4N8VA 2HPTA 3RB5A 3BGMB 4PG9A 3MV01 1ZS8B 4OGYL 2ZSWB 3WKQA 1YQVH 3N43B 1KBPA 1I8LC 3CDGA 4QCIB 1U92B 1T80A 2DWSA 3BZ4B 3WNLA 2EEXA 3VXSD 1S7UA 4AM0B 4Z3HA 3CGTA 2J55A 1N64L 4IRJD 5IMLB 1FRGL 2HRPH 3T6VA 3ATFA 2IGFH 3GBNH 3MRLB 3O2WL 1YEHH 3SDCD 4PJ8A 2EIBA 3HUJE 5B38G 2J5LC 1JF1A 4LQFL 3GBML 3S2CA 4CC4C 4LRIA 2C3XA 2OR7A 4Z77B 2NY0D 4R7NA 5IVOA 3UO1H 4BK5C 4L8CB 5DSCA 4XAWH 4PJDF 2ZUVA 3CAFA 1QRNA 1MEXL 4LLVA 3FTZA 3DVIA 4B60A 1OPGH 1M53A 5DJ2B 4D8PB 3FO0H 4HOXA 1TZHA 4YVNA 3IMRA 5E94B 3A67L 4XXDA 3TNMA 5BRPA 1LQSR 3HRPA 2QKIB 3L1GA 3VXUE 3K1DA 1CICA 4XMUA 3CXHK 3KD4A 1UASA 2VLRA 3VD3A 4GP4B 1SDDB 2X2JA 4OY9A 1IGFL 4WO4A 1EXUA 1JPFB 4Z7VB 1DJSA 1ACYH 1SHMA 4KITB 4YN3A 3VXQB 4L4TA 1BF5A 2O5YH 1RCYA 4H0IA 4IMKA 1BGXL 2ED6A 1E5UI 1KPVA 3GXDA 4Z7WE 2VLKA 4FQHB 3SDDB 2XHNA 5IQNA 2K6YA 3HE6C 4MB4A 2F54D 2WWOA 2DIAA 3AT8A 3IJSA 4YO0B 4Y8DC 4XMPH 1LWJA 3AY4A 3SYPA 4EJ1C 4KHTH 3K6IA 1U8CA 1MN4A 1DJGA 5HGGS 4UIMA 5SWSA 2PW1B 4M7LT 4N3TA 2UV3A 3EJJX 1B3IA 1M4KA 3S5LG 5H35A 1FVDB 3O6FD 1WFTA 1T4KB 5IR1B 1INEH 5AYUH 2FTAA 2JKNA 1UH4A 2OSWA 2ZG1A 1TO5A 2CCWA 4MASA 3RZCB 5B8CA 2HFGL 2YLHA 4FKKA 4QKXB 3BEVA 2XN1A 1MSPA 3VD5A 1L9PA 4JEGB 3WFBL 5IOPB 4AQOA 3FCBA 1YO4A 1AS6A 1JI1A 4OFYD 5GISL 4RGOL 4WV1C 3SKUD 4ZS7H 25C8L 4MJID 3E8UH 1D5MB 2AGJL 4ZFGL 5FECA 1LEIB 4GP5B 4GAYA 4JGUA 1TYJA 3KMDA 1S7QA 4M6AA 4F7CA 4Y2NA 3KBHE 5C86A 1CXHA 3BN3B 3G04A 1T0OA 3OF6A 4WU7B 1LNUA 1K6QH 5ILTL 3WEBA 3LYRA 2VB5A 4M62L 3RTQB 4Z7NB 2QPSA 4P8QA 4Z5RA 4WEUD 5A7EA 3EYSL 5I17A 2A38A 1JUFB 1DDTA 3SE3C 2DQFB 2I07B 4ODBD 4F7MB 4WGVB 5EO0A 1DQQA 3QH3B 1I1FB 1XH0A 5F1NB 4F8NA 1E28B 1IBGH 4JY4B 1IKFL 1B0GB 1G7MB 4P3CL 4X0NA 2H26A 1LP9E 2D3VA 4N6QA 3O9WC 3PNWA 2JB6A 1Q9OA 2XQBH 1WT5C 4OFIA 3QDGB 3S5YA 4M5YH 1HKLH 4M6ML 3QXAA 3ZKXB 3PGDA 2FD6L 3C09C 3FU0A 5JDSB 2H0FA 2W95A 1DQJA 4EBQL 3BSZH 1AGEB 2ZYIA 5I74C 4CKQA 1CFTA 4R2GD 2VDNH 5DXWA 5TDNA 3WYRA 2Q2EB 1QG3A 3QO1A 1BG9A 1L9QA 4A67A 2J3SA 1XGTB 4OKVA 4I3SH 1J18A 1DR9A 1TJIL 3QP3A 1CF1A 4JG0H 4B7IA 2Z7UA 1OM9A 1ET5A 1TMQA 4Y2DB 3VX1A 5KSUA 2KUTA 2G0LA 3MV7A 2VT0A 4HUCA 4Q9QL 1EERB 2QPUA 3KPSD 1BD2A 2H2PD 3NT0A 2NQCA 4KKAC 4NZDA 5L2KE 3T1FA 4RAUA 4L5FL 4DEUA 5IVXB 1Z0MA 1KENH 1ZT1B 1DE4A 4OI8A 2HT4C 4Q9CA 1OP5K 1PY0A 1DQDL 1DBBL 4LOEA 4L8SA 3ZTEA 2NY4C 5ID0A 3LMJL 3OLGA 1EJOH 2AK4B 4FZ8H 4KK8D 5B7FA 3RWGA 4LP4A 3JWNG 4KQ0A 4AQ8A 1IX2A 1ZGLB 3IYLW 2W60A 2VQTA 1QRKA 5B1CA 3T0EC 3EADA 3KJ4C 5T5FH 2EUWA 2PYEA 3GMNA 3IJ9A 3FQUB 1QSFE 5GS0D 1J10A 1KIQB 4PJCA 2WLLA 4JFXA 3NA4A 2D31B 1LXMA 4MMYB 1IC1A 3S96B 1U2YA 5IP4A 5EOQH 3BPOC 2WINA 4PJ9B 4GUQA 3MNWB 3ZHLA 4HA1A 3UJIH 3MJWA 5D9SA 2ATKA 4K3GA 4NGHH 3ROLA 3VA6A 4IKLA 1TVDA 2R1YA 1I8LA 3GMQA 3FU9A 5TQ0L 2P5WD 3RWDA 3WE6A 2TRYA 1WBYA 3V0EA 2B7DT 3QEHA 1JP5A 1D5IH 1DEEA 5C0FA 2BXZA 1A4KB 3UTTD 3ZDZB 2BSCA 4Z3FA 3OKNB 4ZTPH 3IJEA 5IBTL 2NQ3A 4RFEA 2COVD 5CLWA 3BEWB 2J1YA 2DTSA 3FU6A 3KPOB 5GGUA 2VO8A 1XSIA 3NPSB 3RL2B 3VE0A 1IEBB 5IW1B 5EO9B 5DA4A 1FN4B 4F33B 1IQWH 1TJXA 5FFGA 4CC4A 4BQCA 1AGBA 1TIUA 3B1TA 2ICEB 1EEYB 4KH2A 4BFIA 4BK5A 1RZIA 4I77H 3P3UA 2DQJH 3GMLB 4E9VA 1W80A 1ZRUA 1ND0A 2FT6A 1BECA 4O58L 3DGGB 4AT6A 2GIYA 4JPWL 4MD0A 3H85A 3CV5A 4UUJA 3Q5OA 1XL6A 5J11B 3HG3A 1ZV9A 2BJML 5AW1B 4ODWB 2AXGB 5BS0D 3ILDA 4ERSL 4E9SA 1QOKA 2BVUA 4LASL 3IDYB 1JNJA 2WGNB 4ZBJA 3NJFA 5E56A 3BZ5A 1BREA 3Q6FB 4KXDA 3BN9D 4HT1H 3KVPA 1UWFA 3GK8H 3E8VA 3WL9A 2XWTA 4LAQH 5K9QI 3DVNB 2E6QA 4S0HA 1A1NA 5AKVA 5J1SC 2OMVA 3HAEH 4X80H 3FO2B 2XXGA 5CWSB 2J44A 5I1KL 1XCQB 2PKDA 1M1XA 3IMWA 3MCLL 3CN4A 4PJ5B 4Y7MA 2ZCLH 4DQOH 4Z7QF 4PCKA 5F9JB 1RUQL 3NABL 4OTXL 2IAMB 3HE6A 2DD8L 2PPAA 3CZLA 2NY5H 4IEFB 5KN5A 2VGLM 2Y9RT 4XE0A 5EZIH 5BXFB 1QLEH 2X4PB 4XC3H 3SO5A 1W0WB 4NWUH 3UP6A 5HY9A 1SLXA 1I9JL 2GJZB 4UQ2B 5D6CA 4X6CA 3L95A 5EIIG 1YEKL 1KJ3L 4AGMA 1QACA 1AXSB 4JM4L 2VZOA 2WP3O 4PEEA 1SY6A 2PYFA 4XNAA 3W39B 1GGYA 4LRNH 4M7ZB 4ODXB 4AYBA 4CL7A 2CO6A 5B1JC 1GKOA 1IVLA 4C4KO 3BKCL 2R9HC 3EW3B 4KK5C 2OPCA 3B56A 1ZEAL 3PUUA 2RTTA 2XFGB 3VD9A 2MHAB 3BW9A 2AKRA 3TZVD 4KGJA 5DO2C 1OZTG 3FHQA 4O02H 5DEFA 2RA1A 3UAFA 2UWEB 3P73A 1WBZA 1ETJA 3LNFA 3C5SA 5FYKU 3MRMA 2JSFA 4FP8L 5I5JA 4Y5XB 2NXZD 1RP9A 2FBJL 5JXAH 1U8LA 1WK0A 2OYPA 3LD8C 2EKJA 2QQLH 5K33A 4LHQB 5IQ7H 5DJYA 1WAAA 3ESPA 3VSUA 3EFFA 1EHAA 1WFMA 1GGIH 2WLHA 3BAIA 3QPQD 4GXUN 1JN6B 4QYOB 4HCIA 3FQWA 4YHYB 4XP1L 5BW7C 1FLRH 2DLHA 4GOSA 4UWQB 3T09A 1XIWB 4NQDE 1PIFA 2I60H 5LGHH 1HYSD 3O9WA 3F7QA 5CXPA 1VFBB 1WT5A 5IFHH 3BH8B 5I18H 1OCOB 2CE6A 3B8SA 4OF6A 3RUGE 2IDQA 5JOFB 4QJ3B 5I1IL 1T89C 4FULA 2WNKA 3NZ8A 4NNPL 5DS8B 4XT1C 1JIBA 4GUPB 1QFWH 3PGFL 1WZ1L 4WGKA 4X6FB 4ALAC 1GS7A 4OUOA 4TLSA 5HGDB 1N64H 1H3PH 4ZO6A 1FRGH 1GYWA 2CR0A 1QEWA 3ILQD 4NENB 1KT2B 5DJ0B 4M4PA 1I7RA 4OFPA 4NAQA 1DBJL 3C6LB 4LBEA 3S88H 3D9AL 1JZDC 5ALCL 1QABA 2Y6TE 4OFQA 3C6SB 8FABA 1S5HA 1AE6H 1IVTA 3MBEA 1AD0B 3E6HB 4K71C 3GHBL 1KBGL 2OR9H 1IAIL 4BZ2H 1ZHKB 3HNTH 4JHWH 1OSZA 4ADIA 3WCYA 5IEHB 3HC0A 2EDDA 3P3RA 3E3QE 1OAXL 2AV1B 2ATPA 4L4VE 5CMAB 3WELA 5ICXB 2CPUA 1SHWA 4AEHL 2NNFA 1A7RL 3CFTA 4FQXD 3K91A 5F88B 5T1JA 3RWJA 2ZOUA 3T0EA 2AV7A 3UTSD 4CGUB 3BD5A 4M61B 2FZ3B 3V0WH 1PKQE 1HJCA 5JIKA 4BZ1A 1Q94A 2GUOA 3CUPA 1TT6A 3D50A 4K7FB 1JXJA 1ROCA 1L6PA 2GIMA 3JWOC 3I2CH 3IRZA 3IN2A 5D1ZD 2QMJA 3T8VA 2G5BA 5C0DB 4G2AA 2XWBA 1CF8H 4JDTH 4Q58C 1YN6B 4GW1B 3KWTA 1N6VA 3N91A 1CLCA 1BGXH 3APMA 4ZZFA 4F93B 4WI9A 3AXHA 4W70A 2YAMA 2VZ3A 5IHHA 2X6UA 2F58L 1I3RB 2HKAA 3F7VA 2BH0A 2A9NL 5FYLE 5DJCB 3CZNA 3BAYA 1FL6A 4ZQTA 4DVBB 4WJ5B 3BDYL 5IJKC 2P47B 3PL6D 4W6WB 2YEZA 4A1RA 1O75A 3T3MB 1KBWA 3HZVA 3IEAA 4N2LA 5E4OA 5C0RH 1PD1A 1X7QA 5KYYB 2B4CL 2ZWNA 4MZ2A 5HVFB 2IALA 4BWUA 2YQBA 3M07A 1W72B 5C0IB 4WI5A 3O3BA 2Z0BA 3BPCA 1RZKH 3KYOB 2E7LC 3ZE2F 3ZVVA 1NFDF 4LHUB 1DANT 2Y72A 2A9AA 2QKIC 3HZ3A 1MCOL 3ME0B 4DP5X 4QJ5B 2ETWA 1I3GH 4Z9KB 5DYOB 4N0UB 1V10A 2YAHA 1CLYL 3L7FA 1TQBC 5MEND 4ZW7A 3EOAB 1FZOA 1NZRA 4OCXH 3GJEB 3RX9A 2EP6A 2OBGA 3LRLA 5CKGA 5I6KA 2D3LA 2FWLB 2WXFA 1J0JA 3CZFA 3Q9QA 4XC1H 3SDDC 3AJ7A 3FOLA 2EAEA 3W1ZA 3LPPA 5CCKL 2VNCA 1HVXA 1F3DJ 4MNHA 3KGUA 3PDOB 5E5RB 2GJ6E 5EEZA 4IKNA 4LVHC 4RRPA 2CUAA 3WGVB 4EZJA 2A1WH 3S9DB 4RMQA 4JQIH 2WYZA 5IEKB 2D7NA 3WS3B 3VXTB 1IM3A 3MFGB 3VXRE 2X3CA 3Q5TA 4PCSA 4ONOA 4CJ0A 5HHMD 1VSCA 4MYPA 3VXOB 3NAAH 4EVNA 2FSEB 3DSNA 2CBMA 3BWAA 3L1OL 1YYML 2YPLD 3EO1B 3WU1A 5I23A 4M3JA 1CVRA 2FD6H 2OP4L 3QNXA 4C59B 3LN4A 1FC1A 3UMTA 1HTYA 4R0LC 2PPDA 5B1JA 3HBZA 5J9PB 3RZCC 2OW7A 2RAMA 5F7NC 1S9YA 4KY1L 4C54A 4PRNA 3I6GA 1R24A 5I15L 4BFBD 1MWOA 2H8PA 3QHFH 3DO7A 4LLMA 1W15A 4BXVA 4H5SB 4LARL 3WY2A 5J6GB 2H32A 4NHCH 2X1WL 1P9MC 4FA7B 2XCMC 4U2ZA 3QXTA 2B20A 1HH6A 3N50A 4L5FH 5KYWB 4Y9EA 2EIZB 3MA9L 1KB3A 3RTQC 3FF7A 3QUKB 2MRYA 5GSVB 1DBBH 5SX5H 2EDWA 3QQDB 4FNLL 4HKJA 3V5KA 5JW3L 3GO1L 4IU3B 4LSPH 1QASA 1CD9B 2ZX9A 4JRYB 5GHWL 1KBVA 3ARVA 4KKLD 5F9DC 5BZDB 3K6DA 1NC2B 2CDFA 5DK0B 3Q1EA 3H56A 2H1LM 4J3OG 4QWWC 5IOKA 3S36L 4QIRA 3CXDL 4HOWA 1KIRB 3EYVA 4GMTL 3QXUA 2X89D 3DHJA 4JFOA 3C5ZD 4NQCB 3SY0A 4ZG1A 5I1CL 3UYPB 1UGNA 3BFWA 1HHHB 3ALPA 2BWQA 4LL4A 3FFDA 1T89A 2BSEA 2GITA 3P0GB 1HHJB 2AQSA 2IPTL 3GYRA 1A21A 4H26B 1GMIA 1THCA 4HWBA 1Z7JA 4GSQA 1FYTB 4NP4L 4Y2DC 5IT2L 3ZSSA 3V6ZA 5CCHE 1CFVL 4GSXA 4TTDD 3JWNC 4BJLA 2OCCB 1PLCA 5D4QA 3ECBB 3QDMA 4KXAA 4WHTB 2WTRB 1FNFA 5BRQA 1LEKB 2OMBA 2O5XL 5E8DL 5MEQA 5IESH 3V6OE 1NUFA 4GAFB 1X4YA 4JL1A 3C8HA 4V1DD 1YPZF 3OGCB 4GLRI 1QYGH 3WUWG 2EVHA 5FW8A 3GF8A 5C0AE 3L5WA 4ETQB 3DK0A 3OWEA 1QAWA 1T22A 2DQIH 3ZQXA 4U1IB 1GS6X 3SKNA 2XQ0A 4JPWH 2HJFB 3N06B 4Z6AT 5F3BA 2J88H 3QZBA 1IUZA 1CXEA 2J57A 5DRNA 2C34A 4AE1A 1KCRL 4KJYA 2NY2B 5CSBA 2D03L 4Q2ZA 3S3BB 2JF1A 4QRPB 4PJ9C 4ERSH 2FJFB 1FNLA 3F7RA 3FUDA 2BM3A 2BNRB 3HG4A 4UNUA 5AG9A 4QCIA 1M3JA 1U92A 4G7QB 2J8UA 4NBXB 3BZ4A 3G6JA 5TE6H 5TE7L 3ZW3A 2OI9B 3LZRA 1XGUB 2JCCF 2RACA 3NIGE 5IMLA 4JG9A 4UF7C 1INQB 5I1KH 4CC1A 2WO3B 2DEYX 5LUMA 3MCLH 1U8IA 5JNYA 5DVOA 1UC6A 3NPSC 1RJYA 4BA8A 1MHPL 1LEGA 3II1A 1RKRA 4Z77A 5IJKA 3L45A 4HX1B 2C3GA 1J5HA 3TV8A 2QQQA 1YEKH 2ZNWA 3OKLA 4JM4H 4PY8I 2DDQL 1G6RB 3ZDWA 3GXMA 1R5IB 3R1GL 4D8PA 3FAWA 5E94A 3SZ6A 2WQUA 2E7LA 1IC0A 5J11C 3I9GH 2MQ3A 3WS6C 3QT2A 2QKIA 2HRLA 4Z0XA 1KJMB 2PN5A 3N9GH 2AQRA 1NUGA 3IDYC 3Q3GA 2CG9X 2VLRD 4LGRB 2VE6A 4HU2A 2NDGA 4QHUA 1JPFA 4FJZA 4ZFOL 2C1OB 1CFNB 2DQMA 4P2OB 4WO4D 4P9HL 4WLCA 2FT8A 1CK0L 4L4TD 5E00A 3CX2A 3NDZE 4GRWB 2VLJE 1CDGA 3HMXA 3L3HA 3SDDA 2NZ1A 4KRPD 5C08B 4EPSA 2FBJH 4A68A 2IAMC 4P23B 4FQLL 2C4XA 1DBKL 2CSPA 3HLAB 4HV8A 4YO0A 3S5LA 3TWCL 5J12B 4DAGH 1TZOA 3C9NA 4GYBA 4KHXL 4PJBB 4XP1H 3HR6A 1EFQA 4ECNA 1E5AA 1EBPA 4NFBA 5AUMA 5FM8A 1B88A 3FQNB 5SWSD 1X5ZA 3T0XA 2OYLA 2YOAA 3BXNA 1OGAB 3DUSB 1JZJA 1TTGA 2VWEC 4YXKH 4FNUA 4B95C 2EDHA 4X6BB 5LQBL 2Z4TA 3CDYA 1OL0A 5IB3B 3N0AA 4R0LA 1GRWA 1VA9A 4KQ3L 1UATA 1HK6A 3V4PA 3SQOL 3RZCA 2R4SH 1P69B 2HKHH 1ZHLB 1KLFB 2Y3AA 1ZVNA 3QJUB 1WF5A 1H3UA 3KS0H 4H88H 4YFLI 5CILH 1CFBA 4JPIB 5E2WH 1IILE 1P7HL 3W82A 1URIA 2GTZB 35C8L 4NKDA 3APNA 4PJXE 1WBXB 5GS3A 1KB9J 2DY2A 2QPEB 2VO5A 4Q7DA 1JZEA 2ED7A 2F1EA 5ALCH 2DWYA 1P9MA 2JJWA 4U3CA 4AUYA 2GAZA 5EU6E 5F7AA 1PU0A 2ICWB 2YGVA 3OF6D 3GHBH 3P0YL 4PRHB 4XBPB 3RTQA 3WAJA 5I8KH 3ZE0F 4L1HA 5BUPA 2I07A 1BLNA 4HLZH 2YD8A 1G7JA 4NQVB 5K9JL 1XBDA 4WKZB 4AIZB 2FECL 2W65A 4FI6A 3TF7C 1E28A 3FB5B 1XIWC 4NDMB 2DBLH 4LAJH 5AOKA 1UXWA 3NFPB 4JY4A 4AEHH 1B0GA 2Q5BA 1G7MA 3LN5A 1U0QA 2W88A 4NQSB 1JZ2A 1NPJA 1V27A 2MJWA 4MQSB 1CI5A 4BFEA 3WTUA 5HYFA 1W8OA 3FFCA 1T7VA 5JDSA 3S4SB 4PYHA 1BM7A 1AZRA 1AGEA 3D08A 1Q1JH 2C5DC 4AVJA 1IEHA 5DGRA 3Q8BA 1BZ7B 1XGTA 2OTUB 3KWUA 5T3XE 5KAQG 1W6WA 3CX5J 3R7QA 1E43A 3ZMEA 1E30A 2A83B 4I18B 4MNGE 3T6QC 2BIQA 4Y2DA 1DVZA 1SDAB 4HW6A 4ZMQA 1OP5H 2AJSL 1LO0L 3DXAE 5IB1B 1CDJA 3MV7D 3C6LC 3OAUL 4ORGB 5EIQA 5EORL 5HI3D 2B08A 2A9NH 1BD2D 4X9BA 2OZ4A 4FCHA 4RGMB 5CJQL 5SX4I 5IVXA 1UWXH 1LMKA 1JCKA 3TV3L 4AC2A 2X4UB 3D05A 5J3HD 1NM9A 3IVKB 4HZLB 2I9TB 1CD8A 5J6HA 5EA0L 1E9OA 4JCLA 4PJAE 3ATAA 2ZQKA 5KYXB 3A23A 3KH3A 4OIIL 1A0QH 4P5TB 3RFZB 1ZGLA 4DP7X 5AKRA 5I0YA 2WANA 2PYED 1F6LL 3MO1B 4LSTL 1P5UB 2DM4A 1MCOH 1KC5H 2VDOH 4ZQKB 3BWSA 1NKOA 3NQKA 5I5IA 4JLRB 3AGVA 3KYKL 4RDQF 2DZEA 1MNUH 4JKMA 5FGCE 3HHSB 4PJ9A 2DKSA 5AVXB 1FFTB 2CKBA 2KZBA 3VVWA 4DOHB 1RHHA 3QCVL 4X99A 1RSFA 2DM7A 4JY6B 4YHKL 4BKLA 4OQTA 1X9QA 2ZWKA 4JDVB 4H2CA 4HS8L 1G7HA 2WJ7A 2QFPA 3MUJA 5FUCE 4UM9A 2KZ1B 1GTFA 1AOZA 3V0JA 1T20A 5IB2B 3VMPA 1DVFB 1CQKA 4JR9H 1IEBA 3SPCA 3S48A 4UOJA 4FMVA 1JCVA 3TPKA 2CO7B 3VCLB 4KUZH 5IW1A 3GJFB 2OMNA 3GNML 3MLUH 3AWGA 1EEYA 3PY9A 3V0FA 2WSDA 4N1EA 1ZLEA 4DN3H 2VUKA 4HJ1A 5K9KB 1YYLL 5FCUH 5ESAB 1C5CH 3A21A 1F90L 3GHPA 4X6DF 4XP9H 2AP2A 1B2WH 4H1LB 3VFNA 1P2CB 5DHVB 3H9SB 1AANA 4YC2B 4ZODA 2ZOOA 2R1XA 4XO9A 3WS6A 1I4FA 3OXRB 2O30A 4FNQA 4J1UB 4LFHG 3MRCA 1DQML 4G11A 4BH7B 1XTMA 2ZKXA 3ECWA 2FWOA 3W3BA 1A47A 1WS7A 2V5TA 4HWZA 2NR6A 1U41A 2ZZUT 3IKKA 4LARH 4WWOA 5EBLA 5TQ2L 3TBSB 1RZFL 3HPJA 1Z32X 5CEZE 4XOAA 2FHCA 1X5KA 2DQEL 5CWSA 3HHMA 2LGNA 1XCQA 1MDAA 1YUHA 3HMWH 3N42B 3LZOA 3NPZB 5AW3B 5EEUA 2ZF9A 2ZX8A 3C5JB 5EIIA 1SY6H 2IAMA 1ZA3B 2JELL 2P8PA 1PS3A 3QULB 3Q1SH 2KLRA 3HE6D 3H3PL 4IEFA 5FIEA 1JZ7A 1MXDA 5GHWH 5F7FA 1JGVH 2C9AA 4XNXL 1W0WA 2H7WA 3M1OA 1HJBC 3UGXA 2GJZA 2G9HA 2DLIA 4S1RH 2FVNA 4K8RD 3TO4A 4HALA 1AXSA 3MOBL 5EEXA 5I9QB 2BSDA 1YNLH 1ZT7B 3CXDH 4G42A 3UAJA 2R2BA 1KTRL 3CLFL 5F9OL 1MFEL 4QGTA 1KCVH 4AKPA 3HMXL 1CMOA 4H8UA 1MJ7H 3G5WA 1SF5A 2WNWA 3QISA 2IPTH 3VTAA 5E8NA 3SDAB 1DBAL 1FZKA 1KPRB 4RSYA 1NCBH 2D2OA 4L0PB 1QFHA 1PVHA 3MTRA 3O0RL 2CPCA 4Y5VB 3RNKB 1BXUA 5I6NA 4LPYA 3ARPA 2WLMA 4DUXA 3DRQA 3O3UN 2GI0A 4HFWA 1P4LB 5T1KA 3TBVB 1RZ8B 3TBCA 5FDWB 4J3OC 1K4DB 3RJOA 1FUNA 2Y7NA 4OU3A 2IOIA 4W93A 3FL7A 4G5ZH 1UZGA 3EJTA 2OMUB 4LL1A 1JN6A 4F37F 2LQRA 1A6VL 1QSEE 4KRMB 1H3GA 4KY2A 4N8UA 4AVIA 3E38A 1KIPB 4LEEA 3V4PL 3QUZD 1SLVA 1XIWA 5EUOB 1F6AB 4OIAA 1XCTA 2IANE 4B9CA 5EG6C 1E9PB 1KCRH 2QGDA 3O9WD 1PX3A 2YEQA 3BH8A 2DLFH 2NT1A 3L3OB 4JCMA 3PHSA 5JOFA 1WVZA 1CTOA 4O9HH 2QZ5A 3PHQA 4NN7B 4X83A 4J3VA 2DJSA 3JV0A 1OHQA 5F7BA 3NIFE 3QJHB 2JJSC 4L8DB 4X6FA 4PWGA 3PGCA 2W5PA 3SPVB 4EMZA 3NCYP 3N41B 3P3YA 2G3MA 5KS9F 3H0TA 3OB0K 2OV0A 3WDIA 1NAML 1J5OL 3V4VA 5BQ7A 4CU7A 5C9KA 3PWVB 3EJYD 5CINL 4N2IA 3H9HA 2A6KA 3C6LA 3L2LA 2HLFC 1SJEB 1THAA 4TMPA 2UXVA 3HG5A 1MHPH 3C6SA 4KKAD 2EZ0C 4CADB 4X5XB 1X5IA 2GVYA 1AD0A 4M00A 2ESVE 2HT4D 3SGKC 3ULVC 2NY4D 3BVVA 1GHFH 4BZ1H 5IEHA 4RISL 2AV1A 2ZXGA 5CMAA 5F7EL 3BVNB 3T65B 4IIZA 5E4IA 1FL5A 5F88A 1H6UA 2I32A 2N3JA 4JFDE 4F24A 4LSSH 4N4YB 5I16B 4ZFOB 3T0ED 1DVTA 4PJGA 2ODHA 4M61A 4Y1AB 2FZ3A 1KELL 3MRIB 4FHBD 4F1SA 5DZPA 1U8KB 3OLEA 4ZNEA 1K8IB 4LMQI 5CBAA 1CPUA 2OZ4L 1QFUL 3PFQA 5C0DA 2YGNA 4N90D 5CFAA 5HPMB 3VFPB 4E0RA 1YN6A 3CN1A 3ARTA 4KO5A 2OI9C 3CBJB 2WLKA 5AVVB 4B5EA 5K1NA 4RGNC 3DV6B 3VMNA 1JWSB 4PJDE 3TN0D 2BFVL 5IVZB 1SXCA 2MKWA 3D69A 1AIFB 2D2CC 3BAEL 3S97C 2CUHA 1Y18A 2WQXA 3MR9A 3PQYB 5B7EA 3ZZQA 1ACZA 2M2DA 1KB5A 3PWJA 4LCUB 3PWPE 5GZND 2DWDB 4CU8A 3MNZB 4LVNB 2XWRA 1S9XB 1WC7B 5HPOA 1AXIB 3CMGA 1A2YA 3ZGIA 4KO6A 1ZTXL 3DX6A 2IH3B 1MUJB 2CKBL 3DYPA 1MWAB 4WUKH 2G9KA 5I6XB 1Y6NR 4DP4X 2JVUA 3O3EA 1XDTT 1LP9A 1PQZA 2NUTB 4OQTL 2A4ZA 5DYOA 3MRFB 5CGBA 3H8NA 3B4NA 3SQOH 1WA0X 5D5MF 3CIAA 3UTZB 4P2OC 5FOBB 4XNYL 3F65A 1N4XL 4ZSOE 4GNKB 2D3JA 3GGWA 4EDXB 3X14A 4XVTL 3B2UD 4ELKB 4L2YA 3K6SB 4O2FA 4AV4A 4KVPA 2WGXA 35C8H 5ACMA 4LPXA 3ABZA 4N2GA 4F9LC 3O11B 5FYJL 2DI8A 1H6TA 3PIQA 1E5ZA 4OT1H 1LE9B 2EEFA 3P0YH 2YD6A 3SSGA 4NZUL 5E5MB 3G08B 2ZXQA 4KKQA 1C08B 4KQ4H 1MLBB 1E2VA 1XQ4A 2CGYA 3GUFA 1HHKB 3D4GA 4U1HB 5DUBA 3WXWH 5FAAA 5C0BB 5CJ5A 4LSUL 3UTOA 5IEKA 3LPWA 4WSKA 5TH2B 3VGAB 1PCSA 4ONFH 4G9DA 1IM3D 1LYQA 2CKNA 4N86A 4CNIB 2FSEA 4JM2D 4KVNL 3OC8A 5A2JH 1NEZG 3CDCA 3EO1A 4NO3A 2X9WA 5IHUH 1NBQA 2R0ZH 4KDWA 4WSGA 5F8RC 4QHNA 3OXSA 4XO5A 2H32H 1J1OH 5J9PA 5DR5L 3V7AG 5IY5B 2HFEA 4M6OL 4NPJA 5CN1A 5ANHA 4YIQA 2VERN 1KPUB 2YD7A 4JFZH 4KK5D 5KVGL 3OBAA 2YQ2A 2V3EA 2BMKB 1KOAA 4K5OA 3P0VL 3FSVA 4H5SA 1LO0H 5DO2D 4PLJC 2HG5B 3OAUH 4LSRL 3LH2H 4MAYB 4HUNB 5GZOD 4MBOA 4ZUWB 2GJPA 5KYWA 5ETUB 3TFKD 1RH8A 3VFWB 3QUKA 1JZ5A 5EA0H 2GEQA 4FI8A 5ABAA 4HKZB 4HVBA 5GS1B 3NJMA 1G9NC 3PHOB 2LVCA 5BZDA 3DX1A 2E9GA 3B7TA 4F7TB 2C4FU 5H4YA 4HSCX 4LSTH 5CU9A 3VTTA 1E0OB 2ZG3A 4HWBH 2QEJA 5CCJA 1OEZW 3UEZA 1FIEA 5I71C 1KZQA 3DOIA 1I75A 1KGWA 3O6KH 32C2A 4ALAH 2UVEA 1WD9A 5AZUA 3STLB 4NQCA 2CM6A 5DD1L 4JKWA 4OSUL 4P2RE 5D93C 4TL5A 2X7LB 5H4ZA 4HS6A 2PR4H 1IAMA 2A73B 3M7OA 2DH3A 4HYTB 4I18C 4K3DL 4NRZB 5G5DB 4YHKH 3NK3A 2UZIH 2JJSA 4YLBA 3ARDB 3MRRA 1HCVA 4HS8H 2YPKB 3FC8A 4X6EA 4MB1A 5E24E 3FQXB 3WUWA 1PYWB 3ECBA 5D7JA 2WTRA 4IKIA 3QDMD 15C8L 2VM3A 2D7OA 4ZD3L 2EXSA 1INDL 3QQNA 4DZBB 2WKOA 5CZXC 1TYRA 3ML9A 4P5TC 5F96L 4FA6A 4RWHA 3SGKA 3RFZC 2XN9E 3VXMB 5HGHB 4GXVH 2QV4A 3ECVA 3PE9A 1BXAA 5DWUL 3C75A 4FABH 3KPQA 2EUZA 1L7IH 2ZXCA 4GI8A 2NNRA 3JWOH 4FDWA 4U1IA 3HS9A 2F6AA 4E41B 1GYAA 4WEEA 2JJUA 1KV7A 3TGXA 2IGTA 1JD9A 4QEGA 3V4VL 4P57B 2XWEA 4HJ0D 1B4JL 1DQMH 2YD3A 2F53E 4KTEH 3B2PA 5E4AA 5E1AB 1WICA 1F1AA 1S7TB 2BNRA 3EHBB 4N1CA 4QRTA 5D72L 4ZS6C 4QNPF 3T2NH 2OYKA 3OJMB 4GAJH 5B21A 5C0CA 3NSCA 2R2EB 1Q9KA 4MS8C 3NJHA 5GGSY 3K7UA 4G83A 4Y19B 1DVFC 1HESA 1BEXA 5E6RB 3VNZA 1JNNH 5I19H 1BVNP 1N67A 1C5BL 3H3PH 3PXJA 1S7VA 2FJSA 4YE4L 1RUKL 3QNYA 1HINL 1ZAGA 3KPMB 4XVJL 3FO1A 4JHAH 3ZYOA 3PP3K 1W9XA 4ZUVB 2Y7QB 3ILPA 1TEYA 2DN7A 1Z5LB 1N19A 3FT2B 1JNHA 1SLWA 4JDEB 1S7RB 1JGUL 1G6RA 1SLUA 4BDVA 4ZTOL 2BVOB 2JFCA 2DMBA 4EE2A 5BQDA 3UC0L 2LV4A 4R7LA 4NQDA 3SEPA 2XV0A 4M1GH 1PZSA 1UKTA 4WEMB 4O5LH 4LDOB 4CA4A 5CGYC 1KJMA 1QUPA 5AW8B 1NGQL 4TRPH 4PUBH 1C12B 4I9XA 1WFNA 4N20A 4LO9A 4D0CA 4N2FA 1VEMA 1TQSA 5D7LE 2C1OA 4P2OA 5JMOC 3ZIMA 4Z7QE 5M95B 5LAPA 1DFBL 1ZLWK 1X6LA 3GMRA 3O0RH 4YBLB 2A5UA 1GY2A 4XMZA 4HUVB 4PJFB 3DKHA 3SDDD 5H37G 3I02B 4BQ8A 4OJCA 1D7CA 1YYCA 2ALWA 2WY3B 3DWTA 4XHJC 4F9LA 4M6NH 4AYMC 4NX0A 4PS3A 1KCSL 4HIEB 1AZZC 2WKGA 1DLHB 4PJCF 1FGNH 1MJUL 2MWCA 4XNQA 3HLAA 1T1WB 3WN5C 1WIPA 4HCFA 1NCAL 1LO3L 4PJBA 4WWID 2VXSH 3V4PH 2JXMB 3Q2LA 3W0WA 1IC7H 1T1XB 1F4AA 1IAOB 2LVEA 4GS7B 5E1QA 2ZP0T 4L4VA 2DJMA 4FTVB 3DK2A 1KLGA 3D07A 4K5NA 4PD4J 1S6NA 4HIIB 3DIVA 5IB3A 5H94A 2X4TB 4PGDA 1IBFA 2CK2A 5ISZE 3CHQA 1PKQA 3SDAC 3RZCD 3QCUL 4ONHA 2XX0A 4Y8AA 3RY5A 4K5MA 4PLOB 5DZVA 3OQRA 3FDWA 4XR8C 1RZGB 1USZA 4AOFA 4QHMA 5CINH 1WBXA 1G7LB 1AH1A 1E40A 2ED9A 3MXVL 2BPBA 4ZAKC 4ZPTB 2Y07H 4DF9A 3U7WH 1JWMB 1ORSB 1RULL 3MRJB 1MI5E 2ICWA 4RMWA 4XBPA 6FABL 2E76C 4FXTA 5AOZA 2IPKB 5LNEA 3RTQD 4X4ME 4BEIA 3LNHA 3LEYL 1JOIA 4FQ1L 4NQVA 2HT3D 2FGWL 4AIZA 1WITA 5FHBL 1LJMA 3NBNA 1JTPA 1NIDA 2YJLA 4G6FB 5F1IB 4NQSA 1AHWC 3SKOB 1PZBA 1UACH 4GW4B 4MCMA 5JOPE 2GHWB 1YZZA 4XOBA 2H3NB 4QWWD 1E6JH 2FL5A 3QDGD 2IG2L 3TJHC 1MH5A 4YDMA 4NN7C 4KI5F 4MNQB 4XRCA 4WFEE 4R8WL 3JWNH 2OZ4H 1ET8A 4PB9L 5E5UB 3RNQB 3ZR5A 3ZT7A 5KJRH 4YSUA 1BZ7A 4N2KA 3T71A 3B9KC 4PRIE 3HZKB 1CLZL 3MJ7A 4I18A 1CBVH 2Q8AH 2ZSVB 3VUAA 4N28A 5CF3A 4Y2DD 1MFVA 3COOA 2EUXA 4JANB 4X6CF 4ZMOA 3CSTA 1T2XA 3SGDH 1GIGH 4JJOA 2NDFA 1DUZB 4IQHA 5ANMA 3BAEH 1P0SE 2X4UA 2Z0UA 5CU5A 3GSWB 1SGKA 3MROB 5E08H 2GJ6A 4U1JA 1JFQH 1SVZA 3NZUA 2JKJA 1GJIA 5DQDL 3OMAB 3U6XS 5D2LB 2R0LH 3QXDB 4RAHA 4P5TA 1OE2A 4HIJB 3CHRA 3UG3A 3X1NA 1DUYB 3MO1A 3VXRA 1CGXA 4OQTH 4IMLB 1O9WA 4UOZA 2Z6FA 4P46C 3QSKB 1BQLL 3LZPA 4XNYH 3VTMA 5I76B 3JVFC 3T4AB 4C4UA 4TOYH 1R46A 4PJ9D 4FG6D 3WMQA 3V9EA 1CDUA 2IBGA 1WAAF 2O5ZL 2QQKL 2UZYB 4JY6A 5F44A 3HNVH 4TV3A 3HC3L 1IBHA 3CSYA 4JDVA 1EZVX 1MY7A 2VMFA 1YAIA 4GMSL 3T8XA 3G6AB 4GKLA 5IHLB 3LRKA 1E3FA 3K3QA 3ULVL 4U6HB 5JPNC 4NZUH 2O6EA 4GRLC 1A6TB 4XPHL 5DDHA 5E1HB 4AZ8B 5IB2A 3L7EB 3B1UA 2F5BL 3ZE2E 1NFDE 2XVLA 4OJAA 5A2KH 3DTDA 4PP2B 4LVNC 4C56E 4AVHA 1V05A 4KNTA 3S3JA 4XVUD 3R4RA 4D3CH 4ENZA 4PTTB 1GZQB 1I8KB 1PCXA 5ESAA 5KBPA 3BUPA 3O3AA 4NT6A 2HAZA 1HQ4A 4G8FB 5AFAA 2NMSA 1HSAB 2WZ5A 5DHVA 4G6JL 5A2LH 3H9SA 1OGPA 1URZA 5DR5H 3WXVL 2WTOA 2FO4B 3HN3A 4J1UA 3D8MA 3P3TA 4BH7A 1AO7E 3VI3A 1IFRA 1VACA 2FX8L 3MOQA 4Y4KC 2YRZA 1NJ9A 3P0VH 1K4CA 2JLLA 5FW7A 4YAQA 1NGWA 1N2RA 3IRPX 4GIAA 4ZOAA 5DHYA 1ETZB 3Q2NA 3UJJL 1IC5L 4ZX5A 1IGJB 5ALBH 5FUZH 4QR7A 1Z3RA 1MFNA 1HILB 2Y7LA 1WEJL 4L1SA 1BWMA 3ATBA 4XZ4A 1F00I 3WEAA 5CZKA 3D09A 4PJ5D 3BP5A 3C5JA 1M9SA 5BQ7B 1ZA3A 2IAMD 3VXSE 1TSHA 4MDJA 1XH3A 4QHKI 1XGPB 1UJ3B 4YHPA 1FBIL 2XJKA 3MV8A 1AVAA 4NO5A 3WN5A 5D4JA 2V3FA 3KJ6H 2QSCL 5L8JB 3IDGA 2HN7A 2ZWSA 2ILLA 3CIQA 1XVSA 5A2IH 2H5UA 3RE0A 1BZQK 2CK0L 1AFVH 3AREB 3DOSA 3EGXB 2UZXB 1ZT7A 4O2EA 1KBKA 1N0XL 3C12A 5IK3B 3GSVA 1GSMA 1KG0B 1KF9B 2AXFA 3L3KB 2VN7A 2NNCA 5DD1H 3UPRB 2FK9A 2HJLB 3EYUH 3DTXB 3LPFA 1IT9L 2BCMA 2YA0A 1BHGA 4XE5B 3SDAA 3L4YA 4GG6F 2Q86B 2V9RA 4RMTA 4XN7A 2BSTB 3RWIA 4QTHA 4X5WA 5D70L 4UV7H 4HEPG 4JM0A 2V9TA 2YHGA 2V2WB 4U3XA 2AABL 1P4LA 4NZRL 4F9PC 2HX9A 4ZAKA 5GRXG 5T1KD 5E2UL 2HWZL 3DDFA 4IU2B 5CIPA 3UIZA 4YLCA 5GS1C 1X5MA 3QDJB 5F96H 2WUCH 5LBGA 5K69A 2VDMB 4MWFB 3II2A 4OZHB 4FN0A 5DWUH 1KIPA 1LD9B 3SKMB 1JXDA 2F54E 5EDSA 3LNEA 1P53A 4FCAA 5HVHB 2L0DA 4JX0A 1EMTL 1F6AA 2KKQA 5EUOA 1XIWD 3DPDA 1X4ZA 4FXLA 4Z7WB 1AHWA 3FB7A 1BEYL 1E9PA 1ZANH 3D34A 1A7QL 3S5ZA 3V4VH 1HCZA 2E74C 3FUMA 4E5XG 1MKFA 2BSBA 3OB0H 3EH2A 3K6NA 5FO8A 1K2DB 1HFUA 3ARDC 2ZJSL 4JFVA 3CG8A 4TNVK 1T0NB 2H0PA 3SPVA 4UYQA 3B9KA 5FYLL 1K72A 4A2EA 1AHMA 2IWFA 1YPZE 3PWVA 1B4TA 3LS4L 3GRWA 4KK9C 2J1KA 3OZKA 3IS1X 3C6LD 1P1VA 2EXYC 2NYKA 4CADA 2X6AA 2PNDA 4JFYA 4PRBB 3NRFA 4RDBA 1JXGA 1S7WB 4JO3H 5IJVB 1HINH 3IFNL 4XVJH 5BV7B 4JFTA 1JJUA 4MJIE 1FF5A 4YFDB 5BZWA 4FTDA 3TPUB 4XH2B 2VR6A 4RIRA 3AS1A 1JGUH 1QBLH 4R84A 1RLBA 3C5XA 3QRBA 2A0LC 5DJDB 3UC0H 1KV3A 5I16A 1HZLA 3THML 4NI6A 2P24B 2BW4A 1ACCA 4UZSA 1KDIA 2W0FB 1NGQH 2JCCE 4LIQH 1WG3A 2NCEA 4X4KA 2F61A 1DN0B 3EHBC 4PAZA 1JS4A 4HSAC 4GH7B 4P46A 1D5ZA 3L8QA 2VDRL 3WNOA 3H7BA 4MXVF 1VB9A 2WLNA 4ICXA 1U93B 1KB5H 4Y89A 2PO6B 4HXBL 2R2HB 3QZOA 3PS6A 2QLVB 3KLSA 1KCSH 3DPBB 5IVZA 3QJFA 3RGVB 1MNNA 3D2UB 4NJ9L 4G8GA 2VITA 3HE7C 1F4XL 1MJUH 4NKIH 1FGVL 4LLDA 5HGAB 5HYSB 5JPNA 1RPQA 3F62A 4GRLA 4OZFG 1JZ6A 1EZVY 4D9QD 1QKZL 3PQYA 5EU6A 4G6AC 1O6SB 1LO3H 3KPSE 3PWLA 4OCSH 2CJUL 5A16B 4ZW8A 2ZAHA 3W5MA 2IH3A 1Q0YH 4YDJB 2HLAB 2QR0B 3ET9F 1O9VA 4KZ0A 1M3IA 5AVZB 4YPJA 3GSOA 4F2FA 4LHUD 1XEDA 2EQDA 2K6ZA 4U1NA 5FXCH 5L2KB 3GSNB 4K5PA 4OF5A 3HFFA 1DQIA 1MCPH 2HPOA 2DM3A 4GKZB 5AL0A 1A64A 3WJLA 1XX9C 2QT6A 1J7VR 2OTWA 4WK0B 3UTZA 1E4WH 1BVZA 3IPBA 3SD5A 1OE3A 2ZICA 4Y4KA 4Y9CA 4YBLC 2Q8BL 3O2DA 3SQBB 4N8CL 3U1SH 2Z93B 3QUYB 3G5XA 2E59A 2HSIA 1H8SA 2GBTA 4LPWA 1IEAB 1QX1A 4MNGA 3B2VL 3O11A 1OGTB 4X7SL 4CN1A 4K94C 2CLRA 4ZXBB 2K0RA 5DJXB 1QLFB 1IM9A 1SM3L 1TQTA 3G08A 1C08A 2WN3A 2P5WE 4MMZA 2OR8A 2J25A 3D85B 3UTTE 4NO2B 4P2QB 4P5MB 5KYUB 1SEQH 5AW6B 4M4RA 2HUEA 5HDQH 3N43F 1DVXA 2NYYC 3L3IB 4OGXL 5BZZA 1BOYA 2LU5A 5TH2A 3VFGL 4A37A 2ZTBA 3FSWA 3DUUB 4XPFL 2J8UF 4EKXA 3G6JF 4U0RC 1OAYL 5GGQL 1KTJA 5LBSA 2E8YA 3QJTB 4E68A 5CP3H 1WDAA 2VRQA 3GMMB 5FA3B 1AGFB 5JZ7C 4PY7B 4PB9H 5GGSA 2DRUA 2VZVA 4Q0XH 3O8XB 3Q48A 2F8IA 4JFEA 3VB8A 4DVRH 2J5WA 1QO3B 2JCWA 3D33A 4KXCA 3P4OB 4PQXA 1EHNA 4IBUA 3X1FA 4A2HA 5AENA 5K1VA 1ILSA 2BMKA 4J3OH 4K23H 2AERT 1RZPA 4JY5L 3ZE0E 2EILB 3ENEA 2GYSA 1J9TA 1YEGH 3D87B 5D2NE 5BS0E 5ETUA 2Q3AA 3FK3A 5ICYA 3W9EB 2WMPB 4E9RA 3VFWA 4QMEA 1Z5HA 5J7CC 1GGCH 4N2AA 5TK2A 4F3FB 4F9PA 4PJIA 1JF6A 1EJ8A 4J3OD 1YECH 4N26A 2GCYA 1SOSA 4PB0H 1TTBA 5AG8A 4G7VH 4C47A 4JRYD 3P9MB 5JHLL 2EH7H 1G0XA 2GC4C 4E9YA 2K4AA 1NC2D 1NGZB 4U1LB 3SPHA 3Q2WA 5JLZA 2EABA 3J2PA 3LRHA 3NYKA 2WN2A 2EYRB 3T0VA 2XN2A 5HBBA 1EFXB 5K59F 4U1SA 1WYJA 2RCSL 3QS3A 4NQCD 3AABA 4GO9A 5E1GA 1CR9H 1PPIA 2X7LA 2IWKA 5JUEH 2Y69B 2O5ZH 3FS9A 4LCYB 3VFMB 1B90A 2QQKH 5G5DA 4DGVH 4FFVD 3ARDA 4HMCA 4UMSA 1RL1A 4IYKA 1Z9SB 4G72B 5I26A 3E80A 1TETH 1CTNA 4JQXC 4FLHA 2EIEA 3ULVH 1AQ8A 4Z7UB 4OZGA 1FNSL 5AOLA 3DJ9A 2W9LA 4Y16B 2HLFD 2F5BH 1A3RL 2ZE0A 1CB4A 5A1AA 2EZ0D 3O6MH 5HHNA 4DZBA 1OAUH 1KLUB 3B7YA 1CIUA 1SOKA 3F6LA 3NCEB 1TZIA 2O93L 1K8DB 4HUMB 2QJDA 1F1GA 5I82A 3MNMA 3LDBC 4OGAC 2F5AL 4ABQA 4B7LA 1ES0B 3CFBA 4E41A 1YMHA 1P4IH 2EO9A 4M5TA 3ZTNL 2I5YL 4FG2A 4IHOB 1NSNL 1ITBB 2CLVA 3LNDA 4FQPA 1CL7H 3WXVH 4P57A 3N44B 4HZAA 4W9JC 4ZRGA 3F64A 3T4AC 4Z7OB 1TCRB 3GRWL 4PVBA 5DS2A 3OAYK 5E1AA 5EZOH 4Q97A 4JL2A 2QV2A 1KGCD 1NEPA 2BNRD 2DQGL 2Q3XA 4NRXB 2NY7H 1JZIA 3ZTDC 4V2CB 3DJTA 3NZSA 4U31A 1CFQA 3FONB 3AC0A 1IC5H 5HI4C 3T4YB 1SYVB 4I3RL 5C0CD 5I73C 4MD5A 1MHHA 4M48L 3X2QB 2RD0A 3P9WB 4RGND 4Y19A 2MQGA 1G6RH 3PP3H 5D1QB 5DS1A 5ENWB 1JHLH 4HMDA 4KWUA 5SWQB 4IRSB 3R06B 3HE7A 4DZ8B 4QXTA 3V6FB 4JQVC 1I31A 5DFVC 3M8OL 1FBIH 4WY7H 5IB5B 3WFDL 1H3XA 4LCCB 4PH8A 4BCZA 1MCKA 4XN9A 4EIGB 1BFVL 1B9ZA 3FT2A 1IO4C 1OKEA 2YRBA 4FKEA 1NGYB 1S7RA 4L3EB 2CK0H 3OKMB 4L0YA 2CXGA 3RKDC 2BVOA 3S34L 2APVA 4FS0A 1BYPA 3VRJB 3E0GA 1AR1B 1MFAL 2QGCA 1XT5A 4GRWH 3MZGB 1A6AA 4LOUC 3HI1A 4TVPD 4L1BA 1EEUA 3EH4B 5IVXF 5AKSA 1ZLWH 4MA3B 2PP9A 5H37A 4FQ2L 3ZDXF 2VR7A 1ZVYA 3IN0A 3OM3B 3UTSE 2FWUA 3QIWB 5DI8A 3RP1A 1JYXA 3ORJA 3MLRH 4P2OD 4MSWB 2IBZX 2CBQA 3MYJB 2J7LA 4YUEL 1UYWH 4AL8C 4WU5B 4JKLA 4KUCD 4ZOCA 4FLRA 3I02A 4P9ML 2AABH 4FEMA 1NFAA 1J1PL 2H1PL 5C08D 3ZL2A 1FNEA 4HIEA 4OZ4B 4OM1H 1NCNA 1PNDA 2DQUL 1RIVH 3OLDA 2C3WA 2CO4A 3MODL 1UJ3C 3ABLB 3L1FA 1T1WA 4J27A 5C07A 5EUKB 1EK3A 5CUSL 5DWPA 4N0YH 1H0DB 2ZKMX 1OF2B 5D71L 3ARFC 1J12A 3AREC 3BIKB 1T1XA 3MC0A 4WKXA 1MAMH 3W0WD 1IAOA 1XGQB 4UNIA 4OLZH 4FFZA 4UT7H 1JMZA 1OGAD 1JPSL 5I66B 3HTLX 4NUQA 5E6IB 3ZDZF 1Y07A 1JK8A 1MPAL 4JFDA 1GC1C 4ZFFA 5I1EL 2AJ3A 4HIIA 1CBJA 2PXYB 4L1TA 4AK2A 3FYIB 5T1LA 1HNYA 3NZHL 4HGKC 1KTDB 4CMHB 2ENYA 3G9AB 3ARGB 4MA7H 3S3SA 1NLBH 2B1AL 4KH9A 1T5XB 3UERA 1T0MB 1MCRA 3LKRA 5MENE 3ZN6A 3LSOB 3IDIB 4PWHA 5KG9B 3VSTA 1JK9B 1G9NH 2CGRH 4ZPTA 4PLJD 5FEBA 3MRGA 4WI7A 4MKMA 1JWMA 3MZTA 1Q0XH 4HPOL 2MQCA 2A6DB 4PJDA 2H6OA 1S3KH 1IRAY 2ITFA 4F92B 2FUQA 4IBVA 3D0VB 4PJ7A 3GSQB 4XN2A 5LBSL 3U7YL 1L4IA 3R8QA 1AZCA 3BSHA 5EBMA 1MG3C 3GSXB 5DC4B 5JQIB 4YHZL 3CVHL 3C87A 3X3FL 4FADA 4JKKA 3PWPA 4UINL 5F1IA 3IWVA 4C8XA 2EICA 2VDQB 4GW4A 3THMH 2ZT9C 2QGEA 4CILA 3O4OB 4KROB 4BBWA 1MFMA 1DO6A 3UGEA 3FMGH 5KS9E 2MH4A 1FZJB 1JBJA 1CZ8L 3PAVA 4L9LB 2EDRA 1RVFL 4KMLB 2ZKWA 1MAJA 4OFDA 4ES8A 3F00A 3A6OA 5F71A 2VDKL 2YPLE 1CE1H 2ERJB 2VDRH 1IZKA 1NANI 3VD4A 2ZCZA 1P84J 3HB3C 2DMKA 2JTDA 3VXNA 1OARL 2V7NB 4HIPA 1CCZA 4ISVB 4WFGD 4X7FC 4Q6IB 4Q9RL 5A40E 2WSPA 1Y0LA 4JANA 1U8OB 4JKPL 3NJXA 5I1AA 1E6OL 4JQXA 2DJ4A 3ETBF 2VR9A 5CD5C 3U82B 1F4XH 5IB4A 3EF4A 1EEZB 2GTWA 4JO4L 1F45A 5FGRA 5BV7C 5KVEE 1TSRA 2R69A 3CCHA 3OJVC 1FDLH 4LESA 5L2JB 3HRZA 1ZVSB 2VL4A 3QXDA 2YRLA 3QGVA 1X9LA 2A9BA 2NOYA 3KLAB 5CZXD 3SKJH 4P5TD 1KTCA 1ZY9A 2O72A 3E1F1 4K9EL 4XPGH 1GS8A 2Z7ZA 2K9FB 4AXWA 2DMHA 2V37A 4FNTA 4IS6A 2AI0L 4WWKB 4TLTA 4I87A 4BHUI 1L3NA 3I9IA 4I1RA 4A39A 3REVB 3TXAA 2WK2A 1YEDB 5CGMA 2OQJB 5CEZL 3T4AA 3TEXA 4DSYA 3VWKB 3DX7B 4ZUSB 4PCTA 2R7EB 1JGLL 2F2HA 4U05A 4LCWB 4JFUA 4ZS6D 3ZHFA 4F57L 5IKCB 3FBKA 3QJRB 2PO6C 1OTTC 1UT9A 2H3KA 1M6UA 4X7SH 4XX5A 1KXTA 2OCFD 2Y06L 3B2VH 3G6AA 4O4YL 4AEEA 2A74B 4RAVB 3MUGA 4PS4L 5I0XA 1WO2A 3S35X 1ZHNB 4GINA 4OF8A 5DFTA 4AZ8A 2E9IA 4EN3B 3II3A 4KTYA 4H1LH 1DVFD 4PV9B 1ADQL 4XN4A 2EH8L 4AQAB 3EDKA 4JQVA 4PP2A 5DHVH 1FYHB 3T0WA 4HGMA 1I7UA 4OGXH 1NIBA 4OGZA 3GRGA 3VFGH 1WP6A 3FN0L 3IMTA 4XPFH 4YR6B 5MHSD 5D5ME 4NEHB 4NUGH 4KKNA 4LP8A 4BFGA 3I3BA 3GMPB 5GGQH 4FYRA 4ODUB 4V1DE 1KJVA 2A77L 4YHMH 1OGSA 4DK5A 3EOBB 1HSAA 4PW4A 1NC4A 3OPUA 2AZAA 1KN4L 3MX0A 3DX0A 3H9SD 3GT6A 4WW2B 2Q20A 2VJ0A 2FO4A 5J8OA 5CGYD 1BZ9A 4QF1A 3E6FA 2FH6A 2QADB 4X5LA 2Y1YA 3GZOA 3ZE1E 4TVSa 2P5EB 3QUYC 4OLWH 3F3HA 4POYA 2LFEA 1MQKH 1V3KA 3MJ9A 5EWIH 1ETZA 1EBAA 2OX5A 5KTEL 4NQEB 3VGBA 3RJDA 3W2DL 3MRKB 3QDHA 2E5EA 2QQNL 2VISA 5A2AA 1D5BA 4LB8A 4M8UA 3GHEH 4QT5B 1FVCB 2X4NB 2XZCL 4XHJD 2V0AA 2XTSA 2MCPH 3CE1A 1HE8A 4PJGF 4HAGA 4NWTH 4Y4HC 2VCOA 4ZMYA 4G1MA 2GABA 1ETB1 4G6KL 1UJ3A 2XV6B 4Y1SA 3TF4A 4MB3A 2OMYB 3MV8D 1DSFL 4F5CA 4MYWB 3MUUA 4H40A 2I25N 2CRYA 1U91A 2VLMD 2ARWA 1AJ7H 3CXFA 4ZMXA 5MEOA 3K81A 3T3PB 2W81C 3ARFA 3KYNA 3D0LA 3EGXA 5FYJU 2UZXA 1BQKA 5GRUH 4HJJH 5IK3A 4NZTH 1AD9B 4OF0A 3BC9A 3PAUA 2WOBA 5CZRA 4APXA 1QWNA 3O8XC 5DD0H 3QNZB 3IU3A 1MCEA 4HEPA 2FQGA 4NYLB 3UPRA 1J8KA 4AIEA 1AZBA 5DLMH 4TPRH 4GIOA 1N7MH 4K94L 3ZRSA 1AQDB 4RDQG 5AVSB 2VC2B 1YNTA 3GXNA 3KWWA 3SDAD 4Z23A 3OG4B 2Q86A 1BM3L 1AS7A 1I1CA 1UXMA