2WNKA

Structure of sporosag from toxoplasma gondii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
235
structure length
223
Chain Sequence
TSCETEGSSISFTVEKAGHVVRFNCPSTLEEIKPAYEAGDSTKVCTTADCSNEAALKDVLKSASLAQAEGSGGNDFTLTVDALPEAETSVFFLCQRTGAAVPSDKCGVHILVKAAPQAPVCSAQDHTLELQITAANSDTSFVCGGTFNVIKPANAAKVLQGDSCETEVDLVSLVPHASRSALEQSGLIKLSVTDLPQQQQKLCYRCEDSSQKACKVLVTVSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords SPOROZOITE-SPECIFIC SAG PROTEIN
publication title Structural and Functional Characterization of Sporosag: A Sag2 Related Surface Antigen from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
total genus 50
structure length 223
sequence length 235
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04092 SAG SRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2wnkA01
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2wnkA02
2WNKA 2JKSA 1YNTF 1KZQA 2X28A
chains in the Genus database with same CATH superfamily
2PWDA 4KVNH 5AW0B 2H0EA 2JQZA 4IRZL 3IMWA 4KKCC 2R0LH 2WO4A 1MW2A 3VI4E 2BNQA 4JFEA 2CUIA 5E6RB 3TA4D 4YDLB 3H0TA 3QNXA 3LZFH 2EH7H 3CFNA 3MJ9H 5L8LB 2CCVA 1IB5A 5DVNA 1HTYA 4DTGH 3TIEA 4YDKL 2GC7C 1W15A 3P40A 1J8KA 5D2LF 4FQ1L 1MJUL 5D5MF 1A6AB 2W07A 5HYJB 4P2QA 5IJDC 4PH8A 2YPLE 5F9JA 4BQCA 1BVKA 1GOGA 4L8SA 3MRBA 2WOYA 4PV1C 4EI0A 5D6CA 2X2UA 1JF1B 1SXAA 2Y3NA 3D18B 4WDIB 3ROLB 3DRQA 1RJYA 1TQCC 2Q5BA 3AADB 2QSCL 4L9LA 3HB3D 4G7VH 4RISL 4YL4A 1N4XL 2ZICA 2AFNA 2PPFA 4K3JL 2NNCA 2ZXGA 5ANME 1BQLL 2KL6A 4FYSA 3RBSA 2CGRL 3BVTA 2JKTM 2WZ0A 2ERJC 4KKZA 3D2UA 4JB9H 3VI3E 3MJ9A 2MCG1 5I2IA 4BIKA 4Z1PA 4ZMQA 1CFVH 1X9LA 3FO2B 1VFBB 2ICWI 1SXZA 5IROA 5F7EH 1J8RA 1H15A 2AJ3B 4UNVA 5D2NB 3QUKB 1BQSA 4OZHE 3MU3A 4EMZA 2ZAIA 2X2IA 4LARL 3VXPB 5FCUH 3QNFA 4X6CA 1ZEAH 2Z35B 1J5DA 3GI8H 4F2EA 1NGPL 3NZ8B 3U30C 4ZBJA 2RB8A 1AAJA 2BIPA 3ME0B 4DPAX 3LRMA 1XF4A 5AB2A 1TQBC 4LLVA 1LTXA 4XPBL 2VR7A 2UZYA 5CEYB 2VXTH 3RZCB 3MLYH 5L0QC 4LNVA 1XL4A 1JCVA 2ZYSA 1T1WA 3TV8A 5EU7C 1T0MB 3D34A 1WIOA 4MXQC 4TVPH 4HLZH 4FQHB 2IG2L 3HE7D 5CU5A 1ADQL 1KPUA 1SXNA 2R29H 2A6DA 2IV8A 2YEZB 3NEXA 5H8DA 2HH0L 4XPTL 2DDQH 3OKKA 2UY7B 4UDTA 1DO6A 5FEBA 3CFQA 4FLSA 4LMQE 1H5BA 4ZUVA 3RDJA 4PWJA 1MUJA 5B21A 5DQJB 1MN4A 1NCAH 2ZWZA 4FG6D 4RFOH 2ZYIA 3F6IA 4ZUUB 3VD0A 3KBEA 3V5KB 3IFPA 4LDOB 5AZ2L 1A9BB 2CDFA 1F3DH 3ISWA 1P5UC 1QP1A 5F3HA 3UTOA 5GISH 3SPJA 3FCTA 1KIQB 3OHXC 4XMLL 2ODIA 4Y4FC 4Z7QE 1JDDA 5EZLA 2OMXA 1DVFA 3GXIA 5HDLA 1WZKA 3V2AR 2N7AA 2NXZC 1ECYA 5EEXA 2M2DA 1AHWC 5CHNB 4B50A 5IQ9B 1CE1H 1MCOL 2EICA 3EIFA 2C7UB 4Q4EA 4LSSL 5EDXA 1WS7A 3TA3A 2WBKA 3W0WA 4WY7H 2QVIA 2NX5B 1E67A 1U91B 5MENE 4D9RD 4OJEH 5CN1A 4UM8B 3B9KD 2PWEA 1BLIA 4OFYA 2A9DA 3WSQL 2AQRA 1HHHB 3EUDA 5GJSH 4W9IC 4YDIL 1IAOB 1ZDQA 4Q2ZB 1HOEA 1R3HB 3ULUD 4AKOA 3Q0HA 4YVUA 4RESB 1R33A 3U4KA 1FVDA 2Z65C 1MCIA 4N9GB 4JFHE 4A7TA 3B4NA 5EZJA 4PJFF 1OAZH 1TETH 3TC9A 3PE9A 3PGDB 4YX2L 2VT0A 4OI7A 4S1SL 5DHDA 2F54D 4ZUSB 2CCWA 4DVRL 1AO7B 4XC1H 5EU6E 4HLZG 2ARJQ 3COOA 1ILUA 2VDML 2IQAA 4WTZA 4AG4H 2RCSH 2VR9A 4WWKC 1DQDL 3L1GA 3NFSH 3WHE0 1IVTA 2Z31B 4TUJA 3BVVA 4P23C 4G1EA 3V5DB 3TNMA 4Z7NB 1SDAB 2PNDA 3LJ3A 2EYRB 4ZOEA 3V0DA 2WLHA 4XXWA 2P80A 2DB8A 4TPRL 3QARA 3T4AB 4CNIA 4AYGA 3WFZA 5FV1L 1OTSD 4UM9A 4YNYA 3EYOA 3BKMH 2BHFA 4KZEL 3EG9B 3Q3GA 4L8CA 3K2UL 3GHBL 4LHUD 5HYEA 4Y4HB 4G5ZH 2L8AA 4JFWA 4WWPA 3SQBA 4MJHA 4PJ5B 3LQAH 3LYRA 1RIHH 2OSLB 3SGKA 3FQWB 2GBVA 4BCYA 2APXA 1I8KA 3FFCB 4Y9CA 3LX9A 1OALA 2J1XA 3OKOA 4POZC 3FQ1A 5GGSY 1U4FA 1Y18B 4KJWD 4KJPC 3GMNA 1X4ZA 2CRZA 2Q7YA 2HX9A 2WN2A 5GGVL 3E6HB 1TQCB 4WTZG 5F7UA 1NEZB 1HXMB 3CHXA 3Q2NA 1ZDSA 2VRAA 4XN4A 5KWYC 4MNQA 4LLMB 1WBXB 5F3BB 4JW3A 2VO5A 3CX2A 2FGWH 5TE7L 2SODB 3FH5A 5IJBC 1ZLEA 4XC3H 4I3RH 2GK2A 1CICC 4JHWL 4UQDA 2WXQA 1MFEL 3EOBA 1KULA 3ZYJA 3FQRA 5K1JA 1K5WA 1YPZA 1E5CA 3UZVB 2AK4D 2NY2B 3F01A 1NCHA 1UGNA 3VFMB 4PHXA 2MNJB 3HKFA 4NQTA 3BZEA 4NKOA 1HHHA 3S36L 3N43F 4U3SA 4DK3A 2VZUA 2ZNXA 1J7VR 1J8SA 1QSEA 1R3HA 2VQ1A 2RR3A 1YMME 3E3QC 2RH0A 3OMIB 1JTTA 4PJBA 4K8RH 5G5DB 1QR1B 2UXVA 2EDQA 2Q1EA 4CSZA 5I1CH 3W9EB 2SEBA 1TQBB 2QQNH 3L4TA 4OM1H 3VGAC 1U3YA 3WS6A 4NO2A 4XOAA 5HJGA 5ECJE 4WI9A 4H25A 1QSZA 3ZYOA 4MDRA 5D1QB 2C9PA 2RBLA 4A55A 2YQBA 4Y2DD 4YPJA 3QUZA 5IMKB 3QDGA 1MLBB 1XH1A 3S35L 1T03L 4FG4A 4XMKL 5LCVL 3UTZB 1EZUA 3H7BB 5DWUL 4DQOH 2H3NA 3RGVB 4DGUA 8PAZA 2A7BA 2DWXA 4BM7A 2F7QA 4OBSA 4PMFA 3RTQC 1NSNH 3K1DA 3BDYH 4Z7OF 1OT2A 1JNJA 4TNGA 5AVZB 3KPMB 1IC5L 5AVYB 4JLRA 4XXDA 1YECH 2IEPA 3MJ8A 3GUTA 4HZ1A 2PXYB 1A14L 1EAOA 4IBQA 5ADPH 3PAZA 1PZBA 2OCJA 4L5FH 4PTUA 4N0RA 2VN3A 3OHXB 3MV9E 3Q8BA 2QLVB 1KTKE 3TN0A 3MRIB 3L7EA 3R8BB 3R7QA 3CPLB 1NINA 1E40A 3NCBB 2DYPD 3MRHB 3MGAA 4NKDA 5DHVA 1V3KA 3OZKA 1P4IL 4JG0H 1KNOA 3HMXL 4ZXBB 5CN2A 3CSPA 1T22A 3GD1C 4TULL 1U3HB 2WNGA 3FFCA 5CIPH 3KYMA 4YXKH 4IOSD 2X88A 5D1ZD 3OG6B 3HZVA 1J0IA 2PR4L 2EIKB 4H20L 1TYJA 3MRLB 1ET8A 2BZ7A 4UI2A 4U6YA 4G1MB 3H2WA 3MRJA 2EXWC 4GFTB 5ADOH 4Y16B 2XXCB 1UT1A 3RX7A 4NOBA 4QLWA 5HY9B 5SWZD 1HNYA 1YEJL 2VH5H 3BIBX 3OPZL 3UJIH 5LXGL 5E8PB 5IFHL 3EAKA 2H2PC 3IFLH 2DBLH 3ES6A 2EINB 2VLRE 1IEAB 1NBVH 2ADFL 3OXSB 4NQDD 1GS8A 4I18B 1SVCP 3F6LA 4MB5A 2VMCA 4PRDB 1A6TA 1YYLH 3HG5A 1T5WB 1BD2B 5CIPA 1Q9WB 4HKJB 3IDIA 1D7CA 4FX5A 1NLDH 4GI9A 4QRSA 1AOHA 2ZNWA 1XXDC 1KEGH 1SJHB 1N6VA 2XTSA 3N06B 3MBWA 2R0KH 4P23B 4FI7A 4PFEA 2DPKA 4O02A 4JFFA 3UROR 3TEZA 3IJSA 4ZSOE 4M1GH 4WKZB 5IB5A 2P47B 1AGEA 2E46A 3IWVA 4PMEA 3Q9QA 4PJ7A 3EYFA 5IUCA 4BZ1H 2HRHA 3S9DB 3QORC 3DHMA 1BEYL 5KBDA 2F58H 5D8JL 2I07B 3RAJL 3ZTEA 5CZVH 1G1YA 5D7KE 3QYMA 4ZMTA 2VKXA 2APWA 2N1TE 3FDWA 5HI4D 2ENPA 2BNRD 1P7BA 2P1YA 2DQEL 1ZA3A 4IIQB 4NC0B 4H0IA 2K8QA 3JQOB 1NANI 3FTXA 1F4YH 2D3VA 3C5ZC 5F2FA 2IDCA 5KBPA 3GZQA 4KKCD 1FYTE 3WKQA 4PGDA 4FFWC 1NUNB 4NJAL 1GVIA 1AQKL 2KS0A 4RAUA 4XN2A 2IIJA 5DRZA 1DFXA 4XVSH 4PWEA 4PJ5D 3BP6B 3VFUA 4RAVB 1NQBA 2MKLC 3G5ZA 1OAUH 4LKXB 4W4NA 3VXSD 2F1BA 5F6HJ 3GMLB 2WSKA 4Z7UF 1A6UL 1CICB 1Q94B 4JRXE 4ODBD 4GAYB 4F93B 1E7VA 1TJGL 2DIAA 4PRNB 3ZYZA 1YY8B 2XWZA 3DSFH 3UO1H 2L7QA 4P48A 1FORL 3LN5A 4PRPA 4BBWA 3CZNA 2QLYA 4GB9A 2FJFB 4X6FA 1R24A 5LKNA 1EEZB 4BFIA 1FFPA 1XAKA 2R4SH 3NN8A 1ZHNA 1ASPA 2JIXB 3ZX1A 4UQ3B 4WI7A 1N8OE 4HC1H 3WHXB 2O93L 3MMEA 1OGAB 3FU0A 3VXMA 3EF7A 3O0LA 4WI8A 3RQ3A 1OHQA 3BPNC 3UFIA 4JRYB 1GGYA 4FZ8L 2AI0H 2EDTA 2KZ1B 4I85A 5CSZB 2F74B 3U46B 4IIZA 5JPNC 1CGUA 2QPSA 3N44B 1X5HA 3N42B 4PJXE 2H47C 2OI9C 3CVHB 4JZNB 2WD0A 4LSUL 4X9HA 3TT1H 2QL1A 1R5VA 5J89A 4G9FB 1Z9MA 5K1NA 3IPFA 4GKSA 3IMVA 1OWWA 3NMEA 4TQEL 2BWQA 4JQVA 1SMOA 5C3LD 1S7UA 3CN4A 4B9CA 1K2DA 1NPUA 4XMXA 1D9KA 2I60L 5KSVB 4R90H 2B0SH 1RULL 2K78A 3QAZC 1UWEH 3P30L 4MXQD 4NUMA 5J6GA 4LLAA 2WB1A 4HC1A 3FT2A 1OE3A 4D0DA 5IG7B 2F19H 4JFXB 4GW1B 3NIDE 1S5IL 3WY2A 2DI9A 4QRTA 1JPEA 1EX0A 3CH1A 5IFJA 3SDCB 5E6SB 3AUVA 4HK0B 5EC1B 1UHVA 1YEFH 2IH3A 1RZGA 4NGHL 1I8AA 1UFUA 4DP9X 1MCSA 1XGQB 1JRHH 2IAAC 2VUKA 5E99L 5HHOD 4AY0A 3QP3A 2M8XA 1AIZA 3PP3K 1M7DA 4WUUB 4KGLA 4XN5A 1XF3A 5KS9B 3TF7C 2A77H 1O6VA 5KJ7E 2BJMH 4UDUA 5BRZE 4OB5H 4Y4FD 5JORB 5DK2B 3NBNA 3OZLA 4MDIA 2NXZD 3O6LH 1TTRA 3VFWA 4P5TA 4DKFL 5C3IA 4JFSA 3SHSA 4MCMA 4LVOB 2XI9A 3ZT7A 1XHHA 1ZIBA 2BP0B 2R51A 4HPYL 4NQQA 3CH8A 2ITEA 2A6IB 1F8TH 2ORBH 3D0LA 4DQAA 1DQJB 3FKUS 3HI6H 4Z76A 3H56A 1P6AB 5I0DA 4KO6A 5DZNA 2IANB 3VXRD 2E7LA 4EN2A 5ILTL 3CVHH 4LF3B 4PRIE 2OZ4A 5IHZA 3DIVA 3MRQA 1LO4L 2JB5H 2ADGB 2CR3A 4UCFA 4QXUL 5DD1H 3QEGL 4PUBL 4P5KA 3C5JA 1A25A 3V0WL 1IKOP 5FDWA 5ERWA 4LL9A 2DAVA 3N55A 1JERA 1IM3B 4BKSC 3WKYA 2EAEA 2WINA 1D5XB 2C1OB 5DGQA 1KUMA 3T2PA 5DZJA 4OLWH 1QTPA 3DX3A 5A3IC 2A73B 4MJID 4YQXL 4HBCL 1NKGA 4YXHH 3FTSA 5K9OB 2EYTA 4XAWH 2WXKA 5C0CA 5CM1A 1L7TH 5DJZB 1OB1B 5E6IA 1GW0A 2JMRA 1DN0A 4XCEA 2RA1A 3WO3B 1MZZA 3VDCA 4Y19A 4UQAA 3F7YB 4Y5YB 3K1KC 4JGUA 4MX7A 1EO8L 4WWKD 5MERA 4M5ZL 1U33A 2WWKT 1M7IA 4J28A 1B0GA 1IIIA 4X80L 1AQDA 4WO4D 1X7TA 1ZA6B 4EDXB 3F8UB 1CZ8L 2RFXB 4P4KB 3AT0A 2DLHA 1IEBB 2OMWB 4KNTA 2CXGA 4LO9A 2Q6WB 1JRHI 2P26A 4LLUB 4GIAA 3HE6C 3RVWD 3ABLB 4UOW1 1IAIM 1CK0H 1N0XL 1NDMB 4BE5A 4R4FH 4HOMA 1GJIA 2XQ0A 3QNYA 4O2FB 3T65A 3VXTA 1OAYL 2IPUG 4ONHB 4MXWL 3EHBB 2P5EE 3OKDA 4QKTA 4HG4J 3FSVA 3VFGH 1NBZA 3ABMB 4N2EA 1TQWA 4OY9A 5EOCJ 1LO5A 2OL3B 3HI1A 3IETA 5DI8A 4OT1H 5KVFH 1H3XA 3K6DA 4HJUA 4HIQA 3C9NA 3IGKA 3V0EA 5F21B 4KXBA 4OCWH 4XR8C 3QCTL 1F00I 3AXHA 4POZD 2XZQH 4KJPD 2DRUA 1M1XA 5GGRY 4OKDA 1MFCH 1CLOH 1YEGH 3H54A 3M1BA 4XNQA 3KGRA 1UURA 1TJHH 3OSVA 5GXBB 2FX7H 1NCWL 4F27A 5I6MA 5LJYH 2GT9A 3GRWA 5A2FA 4LAQL 1OEZW 4LIQH 1SPDA 1CICD 2VDRL 3HJEA 2QT6A 3O3BA 1ZK5A 4AV4A 4JG9A 4LEXL 4Q6IA 1V3JA 3Q6GL 3BPNB 4YIQB 2CO2A 5K39A 1IGTA 4KVCL 2IMNA 4NUGL 4LP4A 2EIDA 5CBEB 3T2QA 2R1YB 1N6QL 4GRMA 2FEJA 3KXFD 2FJHA 4F9PA 1ERNA 3SJVD 3PQYB 1E43A 1ZLVK 2VLMD 5KVEL 4KRMB 4IMLB 2OK0H 1MH5B 4Q14A 3JV4B 3F7RA 1E90A 5KUKA 3BSZL 3KJ4B 2DWDB 5E7BA 3RWFB 4FXKC 4PTTB 3PWUB 4LSPH 5FF6A 2XHNA 2VITA 4U4IA 1MWAA 4JRYD 3PUUA 2WLLB 4L29A 3SDYH 5JYLA 4BK4A 5AWNL 1DUYA 2YA2A 3B6SB 4ACTA 1UJTA 2OW7A 4C4KT 3HPLA 4DN3L 4ODVH 3QAZB 5IBTL 2FX9H 2ZX7A 1NCIA 5SWSA 1EK3A 4PRHA 3RWIB 3MR9A 2X3BA 5LWYL 2R69L 1OP3H 3U83A 4G6FD 5IMLA 1ANUA 1CLYL 2H0PA 3EXLA 1NCDL 2GSIB 3HBGA 3IJYB 3GLDA 5EO9B 1EAJA 1SYSA 4FFZH 2A5UA 4G59C 3UYOD 5AB0A 3QCUL 4KKAC 4CW1B 4U6HB 3RTQD 2JTYA 2GCYB 4AQZA 1XGYL 2GVYA 4K0OA 3T2LA 1LK2B 1SLUA 5A6MA 1R75A 1KFAL 4XMWA 2BP8A 1FIEA 4FQPA 1N2RA 3FPYA 5E4OA 2VZVA 1K4CB 4HWZA 3MV7E 4MWFA 2RGSA 3I9GH 4Z0BL 5EBMA 1VEOA 3V0VA 5BQ7A 4JPSA 3D0VA 2BS71 3ZDWA 4BFOA 4TRPL 5IQMA 3KLHC 3LHAA 1C08A 1QPKA 4QRRE 3LZNA 1VGEL 2AV7B 1PKOA 4XP6H 1L6PA 1MCNA 1JUFA 5T8IA 1UA6L 3GSUB 3ZE1F 4HHAB 4HUNB 5BVJA 1UWGH 2COQA 4HXBH 3LTVA 5D71H 1MCFA 4FFZA 3BPOC 3SO3C 4MLSA 1J9TA 3AITA 1YQVH 5IJKA 4KHTL 5FM4A 1AGDA 3UP6A 2OMVB 2WCGA 1TZIB 5IFAH 2E6JA 1QSFB 1H8NA 1NFDF 3RJOA 1MJ7H 5FW8A 1PQZB 1A7PL 3BOVA 4MAYC 4CVWA 1MFDL 4U6TA 2EXWD 3LEVH 3P9WB 3CFCH 4U1HB 3X14A 1XIWC 4AGNA 1KBKA 1TPXC 3QZPA 1BF2A 4IKIA 4ZQKB 5JHLH 3C6SB 4ES9A 2EXSA 3FRPB 2J1KA 3DX0A 1KIRB 4V1DE 1KGCE 4RGMC 3VE0A 5IWLC 2P45B 3EH4B 2L7UA 2QZ5A 3VU2A 3ATDA 3FONA 3Q05A 3BYYA 3BH9A 5KVGE 1XD1A 4HUCA 2V3FA 4PLJC 5CLWA 1DL7H 3FPXA 3ILPA 3QWOB 5E9DA 3THMH 2W9DH 5JXAL 1IFHL 2YBRB 4OTXH 3PXHA 2P8LA 3MCG1 3WJJA 4M6OL 4P46B 4KDTC 3CZEA 2HJKA 4O51A 3APMA 1VRSA 3IF1B 4NZFA 2HJFB 3QZNA 2QPDB 2ZP0T 3EO0B 4XMZA 1WPCA 2WQSA 3IFNH 3T3MB 1U92B 1PG7L 1P4UA 3PYCA 1AOZA 2GEQA 3HE6B 4UAOB 4LGPB 2GJ6E 3LN9A 4DP8X 5GS1A 4EPSA 5JHLA 1QNZH 3QORD 4NJ9L 1CGWA 4X8CA 5EO9A 3SYCA 2KERA 4WFHD 3QXTA 3QYCA 1ZT1B 4N85A 2DYSB 4MB3A 2QHRH 1UB5A 5HGHB 2Y0SA 5EZOH 2AMUA 5BOPA 5FFOA 3GSWA 3UTSD 1U8NB 3QG6B 1OCZB 2A9ML 4MNGB 4ZFOL 3A6CH 3PHSA 2ZAGA 2VKWA 2F6AA 4OZGE 2OTUA 1UT9A 2HFGL 3SE4C 1S7WA 3C5ZD 1OT4A 3F12A 1NFIA 2IPTH 2A9BA 5IB4A 5D1XB 2E8ZA 4MVBC 2PLTA 3OAZK 4BK5C 3BUIA 4X99B 3IWUA 2VDNL 4M02A 3CHPA 1S9VA 1HWWA 2BIMA 2A83A 2DQTL 3LZPA 4HHAA 4Y7OC 1BM7A 4U2ZA 2KZKA 2AXWA 1JGLH 4QTHA 1XZ0A 3I9AA 1G7PA 3QFJD 4WCYL 4ZAKA 5F88A 1H3TA 4H5SA 3A0OA 5CEZH 3O4LD 1M6OB 2OMVA 1SBSH 1TZIA 1TEGA 2P9RA 2WN3A 3CXFA 2YUZA 3HNTH 3MLRL 3HVDA 4LVHB 4CSSA 3U0PA 4MGXA 5FW7A 3FULA 3SPHA 5F1IB 3VNZA 4BKLB 4PCYA 4DFIA 4X5PA 5DEJA 5KG9A 4IKKA 5TE6L 3KYKL 4PJDE 4UQ2A 3VJ6B 2XV3A 4HK3N 5ICXA 3B7YA 4FXKB 3S3SA 4X7SH 1G9MH 3DVNB 1THCA 4GQRA 1MCHA 4UUJA 3QH3A 4QOKD 2O5YH 3C60A 2X9XA 5FGSA 1D5MA 3K4DA 1HI6A 2YKKA 3PGCB 4HSAC 4TTDD 4XXCA 3VI4F 5C08B 4P3DA 2F7PA 5C0BE 3KR3L 4XN8A 5EO1A 3PQYD 1JNNL 4MJJA 4P4RA 2Y5EA 3QUML 5IVXB 1BAFL 4GIPD 2XZAL 1BOYA 1J8HE 2X1WL 3DGGA 5D70L 3R19A 2Y7QB 5DURD 5LUMA 3VQ1C 1T4KA 1M3IA 4LCUA 3R18A 1W0WA 2WBJA 2ED8A 2H7WA 4HCFA 4UILL 2CBQA 2E6QA 3FU6A 4WW1B 2J4WH 1MAJA 1K5NB 1G7JA 1G0XA 1RUPH 1U2HA 3VXNA 5EU4B 5CJXA 4KFMA 3HZYA 3EO0A 4L37B 4EI5D 3SKMA 3UTTA 1U92A 1BOGB 3D3VA 4L8SC 2NY7L 2XN9B 4J6IA 2FO8A 5DK0A 1A3ZA 1EZSA 5E9NA 5FOBA 2W8CA 5E6ZA 3GSVA 4L9LC 5EPMB 5EIVA 4CN4A 4QRBA 5B3SB 1YN7A 2DLIA 4JN1L 4GI8A 1BX2A 3HS0B 4Y88A 4IRSA 1FL5A 3IYLW 3RU8H 1QYGL 2WIMA 4QXVA 5I30L 4H26A 4PV9B 2ZSWA 5DMKA 5CMAB 4ALAH 1I85C 2YA0A 3V4LA 3VMOA 2EC9U 1QRNA 3LDBB 3CXHK 4QWWC 5IROC 2BIQA 3K5SA 2APTA 2P8MA 5HJBA 4BSVA 4K7PH 1A0QL 1XH3B 4WTWA 1RIVL 2KKQA 2V3EA 3T9WA 3SDXB 3BEWB 3N40P 1SBBA 3DBSA 1CURA 1CT8A 3TWYA 1DBAL 3AQXA 3AS0A 2QHLA 4Y9FA 3RWDA 4KVNL 1JGDA 1E5UI 3PL6C 1TQSA 2A9AA 2R0LL 3E1ZA 2JKXA 4ONGL 1SDDB 1YRKA 2QQLL 2K6WA 3LZFL 4RFNC 4QR7A 3D69B 3MJ9L 4JFDE 1BYNA 3UZQA 2Q8AL 3B2DC 4AW7A 5J1SC 4Y1AA 3BN9C 5DC2A 3T77A 4A7GF 5CJOH 3O2VL 4AZUA 3AROA 3IVKB 1DBJL 1DQQB 1NAKH 1IGYA 2B59B 3GJFB 1RK0B 3HAEH 1MFVA 2AEPH 1I3RB 1NCUA 1RUML 3ZRCC 1YNLH 3NIFE 4G7VL 4NZUH 3NABH 3N6YA 4LFHD 5A3ID 4G8GE 4OVUA 5DR5H 2K8MA 3B9AA 2C3VA 3L2NA 1TJMA 3TX4A 5IW3A 3MNDA 2UUDH 1JWUB 3RRQA 4X5QA 5ENWA 1QEWA 2V2XA 4F7MB 1UXSA 1DVFC 5DVLA 2R56H 4GP5B 4K5PA 4JB9L 2Z0BA 4JPKL 1OARL 4JANB 3W82A 4H7VA 1CFVL 1FNGB 5ID1A 4KK6C 2CO6A 4HIXL 5F7EL 4R7LA 2UXTA 4FGMA 1CI3M 1Z5LA 3P2DA 4E9TA 3D51A 5FCUL 2IADA 3HAEA 1ZEAL 1YNKH 3GI8L 4HIHB 3QWRD 1OP5H 4F8LA 4OI9A 1ZGLA 2BWIA 3ARDC 3HE6D 2Y69B 2CHDA 3KNBA 4I4WB 3EO1B 3WFEH 1UZ8B 4TVSa 2OCFD 1BMWA 1XR9A 3SGJC 2VXTL 3FJTA 4PGJA 4PLKC 2YARA 3MFFA 1COBA 1CDHA 3NEOA 3PV6B 2AABH 3HOGA 2XICA 3CN2A 1EFXD 4XP5H 3BAJA 1CFNA 2YXVA 3BQUD 1F02I 2CIIA 2BVYA 3QXUA 4DZBA 2DDQL 4BQ8A 4I9WE 1FBIL 2GEEA 4XPHL 5D4IA 1X9UA 5L2KA 1E30A 1M05B 5HDBF 1MI5E 1TTUA 4L18A 3OR7B 3AT9A 3DUUA 4RFOL 5CXPA 4DGYH 3PAVA 1CIUA 3C6LA 1BQKA 4ORZC 1GGTA 2ZWYA 3VRIA 3OR6A 1KB9J 3QUMB 4X9BA 3ZZLA 4UOW0 1P9MA 1ZHKA 1J18A 4RGNB 1F4WH 2ZUVA 1MNUH 2H3KA 3MV8E 3FCSA 1KGIA 4Y4KB 1RVFH 4GKNB 1N5AA 4L3EE 5GISL 5BXFB 3OGCB 3BLPX 4UBDC 1DQKA 5F0JB 3IU3B 4N87A 3OB0K 3HAEG 5ICZB 4CVXB 3T0EA 3FUIA 3B2XA 4H88H 1DSWA 2V9UA 3FN0H 1PYWB 4TSBL 1KCWA 1USQA 5FW6A 1MXDA 3WNJA 3VFOA 4HWEL 4OCXL 1OVZA 3WFBH 4MNHB 4AIEA 4AGOA 3FTUA 5C07E 4GW4B 4RGOL 2WAQA 5LGHH 3RKDC 2ICWB 4JY5H 5FGRA 5AW8B 1AP2B 1GZQA 4HWNA 4O2CA 1AY1L 2EEBA 2J8UF 2FH8A 5IUSA 4IEFB 1PJWA 3MUZ1 2OX5A 2FNBA 4A2EA 1XCTB 2VDQH 3SGKC 4ELMA 1PZ2A 5I1HH 3S5YA 1LP9B 3WUWB 4JM2A 3QQ4B 4K73A 4AQAB 5C08D 1HEZA 1I7ZB 3Q5OA 4PJFA 4TQIA 1CO1A 2J1WA 2QKIC 3U6RA 4NQUA 1JWMB 3T4YB 3GDBA 5BZDB 3Q8FA 1F3JA 4HEMA 5JW5A 2YR3A 1G7MB 5EA0L 3WY3A 25C8H 2IQ9L 4YZFE 1RK1B 5KYXB 3L3JA 3UTQA 2CD0A 5I5RA 1FO0H 5CO1A 1DBMH 1GIGH 3APFA 5JA8B 1FDLH 4K7FB 2A9NL 3ARFA 4KKAD 4F7CB 5T1LD 3QRLA 1DHKA 3G6JB 4ZNEA 1PD0A 4M43H 1N5YL 4XC1L 1E5ZA 4DP4X 3L3OA 4OR1A 2L04A 4R7NA 1FAIH 4RNRB 5LAXA 2NY0C 4EZJA 2V5TA 4RMWA 2Y7SA 3GO1H 4ZTOH 3NFSL 1RPKA 4OCMC 3LQAC 5J56B 1BZ7B 1MREH 2OTWA 4B5ZA 1EZVY 4IDJH 4WHYG 4TOYL 4PG9B 3KLHD 3NCXA 1MSPA 1I1CA 2DMKA 3PV6A 2PP9A 2Q87A 2WCSA 1V05A 3BKYL 5EEVA 4ZO7A 3MQIA 2C5DC 4FKEA 5EWIH 3PFUA 3QRGH 3HC3H 4F9LC 4UOZA 1AGBA 1FO0A 2OYKA 3PL6B 5KSUB 3WS6C 1SHMA 1ZE3H 4WGVB 2QTEA 4KTYA 3WN6A 2J72A 2P24B 4AYDC 4XOEA 3LXAA 1E9OB 3LQAL 1RIHL 3AQZA 3LRSA 12E8H 2Y24A 4R3SB 3QUZC 4ZFQA 1O6TA 1U8MA 3WTSA 3CLEH 2V9RA 4HPOL 4MAYD 2Z92B 4NP9A 5LVEA 5IT2H 3DX2A 2MH4A 3JVFC 2C1PB 2MQ3A 1XIWD 1AGCB 4ODXB 4G8EB 3NTCH 4JY4A 1IC7L 1TVBB 2A74A 5J5EA 2X5PA 1R3JB 4K8RC 4D0BB 1IBHA 4GUPA 1USZA 5DMIL 4AYID 1P2CB 1RIUH 4PLJD 4I3RL 1TFPA 1Z5YD 5ESAB 3TN0C 3MLWL 2FLRT 5LBGA 3RNKB 1E4WL 1UENA 1JYVA 4F7KA 5AUMB 2UZXA 3AS3A 3OX8B 2EE9A 4XWOC 1RPQA 2ARJB 4Y5VB 4IEFA 5D7LE 1M71A 1G9NH 2WYIA 1L6XA 4ZMPA 5EU3B 3KYOA 4JDZA 3RJQB 5I8KH 3PJSA 2O6FA 2R7EB 4A39A 5B38B 3ABGA 4K8RL 5IJVA 3ARDB 5BZDA 2J88H 3V6ZB 3O2WH 4U6XA 5I1CL 3W39A 1DJZA 1CBJA 2ESVB 1WG3A 3IAPA 4OM1L 4NIYE 2APFA 4DNLA 5CAYB 4HUWA 1U21A 2AVGA 4J3UA 2X44D 3UGXA 1C5CH 4JPWH 4BFEA 1T6WA 3ZDZE 2XTJE 3DHJA 3QDJA 4PS3A 4OD2A 3BIKB 3GSQB 3O6KL 1Q0XH 4JR9H 1JI2A 5GS0C 1F45A 3CD4A 3IRPX 1BFSA 3CZFB 5KSBF 3BZFB 4DQOL 4Q0XH 1NSNL 3GXTA 3BDYL 1KACB 1NKOA 3ULUE 1OANA 4K3EH 4JFYA 3L3DB 3TJHC 1D5ZB 4MVBD 3GTVA 4PJ6A 1RURH 1OGTA 2XN1A 2GTQA 5DJ0B 2X6VA 2W92A 4IRJC 2AKRA 2R2HB 5ADPL 1T7XA 2LU7A 5ABZA 4WI5A 1NLBL 1C5BH 4PJCA 3V4PB 1CXHA 2J8HA 4N0UA 2H1LM 4NN5C 3ULSA 4CU6A 1PEWA 1NCCH 3LPOA 4GRLA 1JNHB 2H6OA 5GS0L 4TLKA 4ZD3H 3UZEA 1WAEA 5BCAA 1MPAL 2X9YA 4QMEA 2GFBB 1J5OH 5GRYA 1TIUA 3W9DA 3QO1B 1WO2A 1YEKH 3UC2A 1AE6H 1P7KA 4NN7C 4A2FA 1ZMYA 2GUOA 4GT0A 4R3SA 3LD8C 2L0DA 4PEEA 5ABAA 4YBLC 3FFDB 5BS0A 4EQ2A 4NRZA 2R2CA 5L4JA 3UBXB 1GHFL 3NGBC 4H1LB 1UVQA 5J12C 3GMMB 1UH4A 4F8OA 1I7RB 1LNUB 2WKOF 5CILH 5ECGA 4ZMAT 1F2XK 4K3HA 1KCRH 2ZUYA 4MZIA 3GIZL 5JLZB 4YC2C 2ID5A 1T3FA 1A1MA 2GBTA 3ASNB 4O02L 3UG3A 5KUMA 1WGOA 5EN2A 2QKIB 4UMSA 2AJSL 3AM8A 3HZMA 2IWEA 1DLHB 1JF6A 1Z9SA 2VH5L 3S37L 1MWOA 5GRVK 2BNQD 4ONOA 3D39B 4MZRA 4QRAA 1A7QH 3VXQB 4PR5B 4ZOBA 2WWMC 2ZZUT 4ESKA 4NZDA 2F9BT 4B6ZA 1B4JL 1NBVL 3QI9B 4IBZA 1JE6A 4KRPC 4LP8A 4GP4B 4HS8L 2XSKA 1VEPA 3E2HB 5E8EB 1GAFL 2AJXH 4X5XB 5M94B 1AH1A 1F3RB 4KY1H 4P2QD 5HHMB 3T6VA 1EVUA 2VABA 4AVHA 5HYQA 1IARB 1CE6A 3OJDA 5BV7B 2H6PA 1SJEB 2NY0B 3LH9A 4I0CC 3O81A 2K4WA 2N01B 5AVXB 1NGYB 3VXUB 4AYFB 1PKQB 3MRKB 3RBGA 3WNOA 3TVMB 2VDLL 3V4PH 2WV3A 2PW1A 1SUJA 4C4BA 1FFNA 3ARZA 5HYJE 1YUHB 4FRWA 3D8MA 5EN3A 4UV4H 1Z2KA 4YDNA 3TO4B 3VSQA 3QPXL 3FN9A 3GI9H 5KSAB 3T8XB 2CMRH 2QGEA 3RKPA 5IVNA 1NUFA 2AQTA 5DD5H 2F58L 3IT8D 1A7NH 1F13A 3I50H 3MODH 4QWWD 1TNMA 1OSZB 1CFTA 4GI6A 1TSHA 5CZVL 5IROD 4PJXF 3DVIA 4B97A 1P4LB 4J39A 4GIOA 5BRQA 3H2PA 5E2TH 1U41A 1ZOXA 2CUAA 2Q2LA 5IZ7A 3AACA 1OCRB 5B3NA 5IQOA 1F4YL 3JBG7 3VX0A 1KPRB 4R96B 4CSTA 4MQTB 5CEXA 1VERA 4JQVC 4QXWA 3P2TA 3PL6D 1D2OA 3D06A 3IJEB 4LOUC 5D2NE 3POCA 2WLIB 4HHGA 1JP5A 1TDQA 1XCQA 4Z7UA 2J25A 5I8CB 5I1IH 3G6DL 3BN9D 1OAUL 4Z0XA 2CXKA 5LNGA 4OLVL 4QHMA 3SE3A 2EJ1A 3D08A 1N70A 5I1JL 2FDBP 4NHUB 1I7TB 2VDPH 2P5WB 3GSOA 4E41D 3UO1L 5BV7H 2X42A 5B1JA 3FW6A 2XNAB 2K6YA 1RI8A 1GRWA 1FNLA 3MRCA 1NIBA 1EQWA 4YR6A 2G60H 4KXZH 5H35B 2VL5B 2AEQL 4HFUL 4HT1L 4PJ8A 1JZIA 4BDVA 1BVZA 4YWGH 3WFHB 4HC1L 1DVFD 2X3AA 2UX6A 3DRTA 2VGLM 4P5TC 3NJMA 3KBHE 4E5XB 2A0LC 3FCBA 4XNUH 4XH2A 1KB5L 2I69A 1NMAH 3HJ0A 3TA3D 1FQ9C 3W0WD 3CE1A 5I19L 2YRBA 1OTUC 3FQNB 3HC4H 2RACA 1AYOA 1KDIA 4FLQA 4HFWA 2HT3C 1MVUA 2G9HA 2ZUXA 2WLKA 4LAJH 3TT1L 3FQXB 1S3RA 1XGPB 3FQYA 4GFXA 2UXGA 3FB5A 4G8FB 3P9MA 2GSMB 1EJOL 1EWHA 1NEPA 1YSOA 4PYHA 5DJDB 4OFYD 3CZGA 3KWWA 7FABH 4PLKD 1N8ZB 1DFBH 2G2NA 3MNZB 4R90L 1PY4A 2NX5E 1FVEB 3N9GH 5FM5O 4YFLI 1PLAA 2VSMB 5LHDA 3BJ91 1IGJB 2BRRL 3HZKA 2JE8A 4FNUA 4IRJB 5EC2A 3NFNA 5GZNA 4ATTA 1QKZH 4N0FA 2AANA 3SBWA 5CCGE 1WAPA 3BT2L 4AQEB 3ARPA 4U1GC 1VADB 5CINL 1NC4D 4D7PA 4TNVK 3HMWL 4PVMA 4JHBA 4A2MA 4YHKH 4YBHA 5IW6A 3WTXA 3M17B 1KCUH 5E6IC 2OZ4L 1Q72H 1JRHL 4PJAF 4U1SB 3Q5TA 3QK0A 4C4UA 2C7FA 2EVIA 1WCQA 5IK3B 4AQ1C 4YBLB 2A77L 3BWAA 2G4EA 5T1MA 4DGIH 4PLOB 4LCWA 5CZXC 2CALA 3QWQB 4UBDD 3V8OA 5JO5B 4RBPK 3TT3L 2R2EA 4ELDA 4PJHB 3IKKA 5FO7B 5I26A 3QBTB 4HH8A 1G0YR 1CMOA 2X1OA 4G6ML 1AO7E 5AVVB 4NM8L 4A7UA 2WY3B 3U6XS 3M7FB 1QMUA 4MMZB 2P80D 4XO3A 3DARA 4WO0A 4KXZI 4K23H 1X7QB 4UM9D 2I9LA 5IM7B 1Z7JA 2ORBL 1Q1JH 3HI6L 5EOTA 2VDLB 3QJUB 4Z7NE 1JWSA 4HMDA 2IV9A 3NPSC 1P0SE 4N8CH 4A2GA 1KG0A 2EDMA 3MRMB 5FK9B 5DD1L 4G6KH 4YHYB 1INQA 5IF0B 4KX8A 1MHHB 2AZUA 4UOQA 2V7HB 4H8HA 3CVDA 1Y1UA 3NJHA 1QLRA 2OQJA 4B9IA 2XA8H 5F89B 1D7DA 1WT5A 3GEWB 2ENQA 1IIKA 1AKJB 5B22A 3HW7A 4R8WL 4LSVH 1PVHA 4D2NA 3MCKA 5CGTA 2JKNA 1ML0A 3LCYA 4PJ5E 3HC0B 3QHZH 4L05A 2IF7A 4OLWL 3KG5A 4Y2NA 3U4EA 2LLLA 1RUKL 4MNQD 4NQEB 2LOEA 4YXHL 1NAMH 3MNWA 4XAWL 1YJDH 5FB8B 2UWEB 1WBZB 3RNQB 1ACZA 2M83A 2XC8A 3LNFA 1I8UA 1TSRA 1TQTA 3MJWA 5FA4B 3ZHDA 4ISVA 2GHWB 3RTLA 4YSOA 3IBOA 2GTWA 1XTMA 3OKMB 4HDIA 1ODUA 3HCVA 3IKCA 4Q6IC 5AOKA 1KT2A 4ADIA 1G5AA 1FHNA 1VEMA 3QJSB 4MQ7B 4LLQA 1TEFA 2EXYC 4XMPL 4FNTA 4F9PC 5BNXD 1QSED 2ENSA 3T5WA 5IHWA 4OD3L 1JN6A 2EDOA 3BCFA 4RMBA 4X6DB 1KB9K 4WEEA 1V10A 1N3NA 3O8XC 1S7RB 3PP3H 3B3IB 4XP9L 2LABA 3GRWL 2Q9OA 4R4FL 5KVDL 3MJ7B 4XX1E 3BO8B 1NAMA 3RPIB 2C9VA 3T2OA 3IJ9A 1W8OA 4ODTH 3Q1SH 3VFGL 2P44B 2EDJA 1EXGA 4Z7VB 2VIRB 4OT1L 1EXUB 4YDVA 1WBYA 2QTVA 2AAAA 4DF9A 3QUZD 3MSPA 3QDGD 5MI0C 2FRGP 2QVKA 4NYLA 4OCWL 3DI2B 4ELKA 1N67A 3QEUA 4EOWH 2DLTA 1KB5B 5JUEL 3O3AA 1P4BL 4J8RA 1TCRB 4N5EC 3BISA 5D1QE 4OJYA 4JDTH 3CQPA 1MFCL 1MWAL 1YEGL 3ECBB 1UWXK 4K8RD 4M3JA 3O45A 1TJHL 4M6MH 4P3CL 1I53A 2FX7L 5AOLA 1Z1WA 4IHBA 4AYEC 1CLVA 4LIQL 1UADC 3IB4A 2Y25A 4N1CA 1WFOA 3TN0D 5CJ5A 3HR5B 5DJ8B 3BP7A 5T3XH 4PCTA 3STZB 1MHCA 1ZT4B 1HSAA 1LGVA 2V3DA 2YC1A 4M61A 1EIBA 1VGKA 1X7SA 1E6OL 3FU7B 3PWPA 4XWOD 3DPBB 5J11B 4CMMA 5IV2A 2JELH 3NT0A 4LZKA 4RDQF 4BH8B 1FVCA 3MBEA 5BZWB 2B2XH 4PQXA 5I76A 5FYKL 1ET5A 4A63A 3EO9H 2Y7MA 3NA9H 3EGXB 3U4BH 3QUYB 3K6OA 1RZKC 1PW3A 2I85A 5EUOF 1EJ6A 3LKNB 3VGFA 3L4VA 3VFTA 4Q58C 3BP4B 4P49A 4G9DB 3SDYL 2VISA 1VCAA 4GEJA 1GZPA 3RUGB 3LMJL 2BVPB 2WBWB 5JW4N 1CG9B 3NP3A 3F7KA 2FX9L 3VGEA 1ACCA 1HH6B 4MMYB 3Q2VA 2FEDC 5D7IA 3B9DA 4GPVA 2BSRA 5GS0D 1CCZA 3F6JA 1M6UA 1W0YT 4U1GB 4Z78A 2XIDA 3CK0H 4FFZL 2FSEA 1DDHA 4A2LA 2Y7NA 4JO5A 3LH2H 2YGPA 4NZTL 1RZKL 3TJHD 2WQRA 4JPQA 3BUYB 3D30A 1FAKT 1K8IA 4AMKH 4NFBA 2JJTA 4O58L 3WIFA 3WJJC 4QKXB 4FQQB 4IU3A 5B8CA 4M4PA 4N2HA 1E28A 3WG7B 1WTGT 2J1ZA 3Q8CA 4BKTC 4HIPA 1W80A 3TTYA 1PCXA 2NDGA 2WXHA 3AU1B 1TOXA 4EZMA 1WWWX 1HDMB 1BD2E 4XP6L 2GI7A 3K6SA 5L4IA 2AXHA 3U0WH 2X41A 5GS1C 1AXTL 4NFDA 2VXQA 4H44C 5JPMC 5K9KB 2W65A 1UWGL 5D71L 5IBLC 3K72B 5HVHC 2WK2A 2E6PA 3LPPA 5CR8A 1NOLA 3LS4H 2R59A 2J20A 1ZWIB 2LAGB 5C0FB 5GGTA 4CILA 5IFAL 1S8DB 2XXMB 2YLHA 4OZGF 1V27A 3FUMA 4OCYL 1UGKA 5L6YL 1MJ7L 1EFQA 3TWCH 3U2SA 4BWUA 4K7PY 2AJVL 4XAKE 2GITA 3K2IA 4K5MA 2BOBB 4ICXA 2C9SA 4C56A 5T3ZH 3L08A 3VDBA 1XMWA 4QUOA 2D7NA 1PX3A 1ZLVH 5JHLL 2QVFB 4JEGB 4NERA 3JXAA 2GKIA 2B4CH 1TKWB 2WWMD 5C09B 4K4KA 32C2B 1VA9A 1VSCA 2KBGA 4KRPD 5AOZA 5ANHA 3WN5A 2V9TA 3RWJA 3TPUB 2YFOA 1UM5H 4X4KA 1MRCH 5AD0B 1WJ3A 5IKCB 2J1YA 1U8IA 2W9DL 5I9QC 1UKSA 3MRNB 4ZAKC 3ZMEA 4JJOA 2BXZA 2HKFH 3AS1A 4M7ZC 5I0XA 4WI0A 3W5MA 1C7TA 4PJDF 4WU5A 2CJUH 5FLVA 3W3BA 4YHOH 4NQED 5I8OH 3MREA 4HUVA 4OAWA 4LPTA 2VDKH 4NUPA 4NP4H 5JHMA 3QNZA 1CG9A 1WD8A 1ZJAA 4M9PA 4P59H 3TBTB 3G04B 2J5LC 4UT9H 3WJMA 4XO8A 2G5RA 3O8XB 1NBYA 3VXMD 1LE5A 3KPOB 2OMTA 3GXNA 2X4RA 3CDCA 3SBRA 3PU7A 3C60C 4K94H 4XXCC 4TQPA 2QHRL 5FHBH 2AZAA 2DTSA 3IDNB 5AOIA 2CNYA 2VLME 5EZOL 3HG1A 5G2NA 1IZKA 1XH0A 5INDA 1OAKL 1AMYA 2D3JA 4LASL 1MEXH 3L9EA 3P4OB 2A4CA 2NLJB 2ZCHH 1KJVA 1OGAE 3A6CL 3VFVB 1I1AB 4JFZH 5AKSA 5BJTA 1F5WA 1KV7A 1DJWA 1UA7A 3DX7A 3LQMA 4JRYE 3VGHA 1S7VA 2WBJC 3VFRB 2IPTL 5L88H 2NT0A 5DRXB 5I0YA 4NO0A 3H9HB 1D9KD 4LOUD 1CGYA 2FQGA 5CJXC 1ZCRA 1ACYH 5F7YC 5HHNA 5KW9H 1FGNH 3UMTA 3VRJB 3BH4A 1NFAA 4D9LL 4UT9A 2DQHH 5ACLA 2HVKA 4BA0A 4FXGB 4G9FE 5F9WC 1TENA 1WITA 2AV1B 4XCFL 1G7QB 2DV6A 2W59A 4OIFA 3VFPB 4XI5D 4AXWB 4WLCA 1G7HB 1YAIA 1JGLL 1BECA 3LNDA 2NW2A 4J6RH 2XWTB 2HRPH 1P7QB 4IRSC 3UDWA 1MCKA 5FM8A 4X6BA 1RJZB 3MUGA 1SBSL 3HNTL 1D6EB 3AB0C 2Y5TB 5DFVC 5IB1A 3MGTB 3PGFL 4UNTA 3CDGA 3EYSH 4N2MA 1FL6A 5GHWL 1FRGL 5JMRA 3VI4A 3ZHKA 1HE8A 3WDIA 2K3HA 1KFGA 4X7SL 4PB0H 2ZKYA 5IP4A 4NAMA 3TIDA 1NMCC 4LDEB 4P5TD 2A0LD 3HFMH 3BRFA 2NTFB 5DK3A 3NZHL 3IM1A 4WUUE 1U8HB 1AD9B 5KS9E 4LE8A 2X4NA 4ZDHA 3QPKA 3VWKB 4OVVA 1QUNA 4GMTH 1OTUD 2BXYA 2YPLA 1UQSA 3H8NA 4WHTB 5F9DC 2HT3D 1URIA 4ECNA 4HGWA 1XGUB 3ARGA 2NCEA 1UB6A 2YSSA 2G3ZA 1JTOA 1WWBX 4HKXA 4I89A 4E42B 2LU5A 2IBGA 4Y8DC 4ALAC 1LO3H 1KGJA 1SRDA 4UINH 2J4WL 5ANMA 1B0IA 1RUPL 1EA9C 1XGTA 3NA4A 1CFBA 1XDTT 4OCSH 4HKZB 4N2FA 1IGIH 2IANE 3TBTA 2UXFA 2AGJH 5KVFE 1UD6A 4FS0A 3VI3A 3PNWA 2V4LA 1DVQA 1PBYA 1LE9B 4FQIL 1EAPB 5CLXA 4OZFB 3ZO0A 4ANXA 4ONFL 2ZCKH 3FHQA 5DUJA 1JJUA 2FBOJ 4NHCL 4OZHA 1OSPH 4PD4K 5DEFB 2FL5A 5E6ID 4AL8C 1AXSA 4Y19D 1O7DE 3VXOA 3K4AA 3RWHB 4ALAL 5JPMB 1MELA 4CN6A 2OW6A 5DQ9A 2CKBH 3PLYA 3FQ2A 4ORGA 4WEBH 5AW5B 2XG4B 3BSGA 1TMQA 3EYUL 3LPWA 1XR8B 3QZWA 5CZXD 3ZHLA 5JQ6H 4BSWA 1TYEB 1OSYA 1JVLA 2AXFA 4K7PL 3R4RA 4X4YB 1KY7A 3PWLB 2CO4A 1U2YA 3GMOB 4TVUA 2IWKA 3DC0A 3LN4B 4EI6A 5C71A 5I23A 3FT3A 3KPPA 2M1KA 1CD8A 1DQMH 5JMOC 2DL2A 3MOAH 3MYJB 2V8LA 2NNAA 2VMDA 4PI0A 5TDNA 3QSKB 3MLSH 4GG6F 4JZOB 4BXVA 5DJ6B 4AL8L 1IBBA 2X4UB 4A7GA 3O3EB 4G7RB 4GMSL 4HX1B 4ETQA 1RHHA 1KJMB 1QTSA 2Z93B 2GW5A 1BG1A 5B1KA 3OKEA 3BGMA 3RE0A 4AQ8C 4L8BA 4OLYH 3TV3H 3T0BA 2G5BA 1UYWH 3WTVA 2CKBA 4PRBA 3AWEA 2ZWSA 3DX9B 4LCCB 3DHPA 1A9VA 3L95B 1RZ7H 2C3GA 3M07A 5I9QB 5LDSA 1R5WB 1MQKL 4LRNL 3W37A 1EH9A 2X2JA 3H9SB 3HLAA 5EOCL 4JDEA 3KPQB 2NTSP 3C6LC 4M7ZB 3FB6B 1YNLL 3LKQA 2NR6C 5FO9A 1ONQA 4NZUL 1P9MC 4WU7A 5DS1A 4NKMA 4HGMA 2J6EH 1AHMA 1U8HA 3QZOA 3QZWG 2P7TA 5T1KA 2ZOLB 2F7RA 3OBAA 3Q5YA 2BVQA 5MENA 1QNIA 1WWCA 2QQKL 2J5LB 3CFBA 3M46A 4PWKA 2G75B 4QGTA 1CFSB 3VYNA 3T0EC 3O4LE 5FA3B 3L9RB 1IQDB 3SCMC 3UYPB 1U8KA 3M6DA 4LMQI 5CP7A 5I5MA 1ZGLM 2VW6A 2EXYD 1PY9A 2XZZA 1XD0A 3I02B 3TZVA 3KPRB 5E1AA 1YNKL 3LSOA 2K7PA 1KWKA 4QD2E 3IRZA 3UEZA 1SY6H 4U7MA 3O8XD 1KIPA 4LSQH 1BVOA 1U58A 3EFDL 2EUVA 3BH8B 1SOXA 1T4WA 2IDQA 2J6EA 1EAPA 2AABL 3FAWA 4CVUA 5E8OA 5E8DH 3PQYE 3EOAA 1KXVA 3H6AA 4KJYB 1VFAA 1OW0C 2YAHA 5SWSD 4PRHD 4MBOA 4S0HA 4ZW8A 5EU6A 3AWGA 1QBLH 5MHSD 3D25B 4AT6B 2D8KA 1UA3A 2DQUH 1ETZB 3ILEA 4WVRA 3ZRSA 3PDOB 2FECI 3ARFC 4N5ED 3NG5A 2OP4L 1YDPB 1UCBL 3HRZA 5FYKD 3TH4T 2VWEE 1QO3A 3L3OC 2Z8VC 5DUMH 4IGBA 1FWXA 1F4WL 4GP8B 1MNUL 4D7BA 3QXAB 1MW3A 1SY6A 1JHLH 4AIZB 1J5IA 4AGQA 1RVFL 4K3DH 4JCLA 3TBCA 3DUSB 3JTTB 4JL1A 3UAJA 2V5RA 4ODSL 5FDYA 4F7PA 1KJ2B 3I6LD 4YHZH 3I75B 2VE6B 5TE4L 4JREB 2B5IC 3L4CA 5CCKL 1FL3A 4ZPVB 3C5SA 3U9PL 4OFQA 3OWEA 1WFJA 3MACH 3WFBL 3ZGIA 5SWQB 3DV6A 1FFOB 3WNPA 5D72H 2H32B 4YHNB 1BAWA 5LGHL 3Q6FA 3ZRFC 2ZKHL 2HLFC 3GSNH 4ZX3A 1AANA 3L95A 4JY5L 2XIBA 4B41A 3EH1A 1U3JA 1IZJA 3HBQA 5DT1H 5EBGA 3MZGB 2ZKXA 5D2LB 3G5YA 2FCBA 5D5MB 3U36B 4J3BA 2VDQL 4PJ9A 5I1HL 3K6FA 4CMHC 5GIRB 4ERSH 1XF5A 2NY5H 3PWNA 2XWBA 4PSRA 3HUJB 4ZMNA 3D85B 3S88H 3KEDA 3NFPB 1KTDB 4G42A 5EIIB 3HFFA 1QFUL 4NWTH 5E24E 3T0WA 4PJIB 25C8L 2FEDD 1CC3A 2CDEB 3IDGB 1JZ7A 2C8NA 3N0PB 1IKFH 2A74C 4RWHA 3T1FB 4L4VB 3L5XH 4OQTL 1FO0L 1QSFE 3TNNA 1YN6A 2CLVA 4J3WA 2XVBA 1R0AH 1DBML 3TESA 1HHKB 3TBVA 1K3IA 2WLZA 3FUKA 1T1XB 4EDWL 2GSGB 4N6RB 2IFFH 2PO6A 1NZRA 1CS6A 1NGWA 4M43L 2A4ZA 4YE4H 3GSNA 5E08H 4S2SB 1A4JA 5HPMA 1YMMA 3QFDB 4W9GC 5E9DD 4AI7A 1IMHC 3L7FA 5IEKB 4JHAL 1FAIL 1I9JH 4XHQA 1Z32X 1B88A 2X09A 4MJ6A 3GO1L 4ZTOL 3H4FA 5IOPA 1G6RB 4N0CC 3Q2CA 2Z1PA 2FR4A 1ZV2A 3ZDXB 1KJ2H 5GS2D 4GRWF 2D3LA 5HJDA 3BAKA 1EVTC 3BAWA 3Q9PA 5F96H 5C0DB 3OKYA 5JNYA 4DP7X 5LO7A 3BPLC 1BYOA 4PIRF 4LCYB 1XCWA 2AEOA 3VD9A 5H37H 2EE2A 3HC3L 3ZL4H 5TDOA 4KFZC 4XRCA 3DX4A 2PTTA 4YHPB 3ZDZF 3DNKA 5IBLD 2FIRT 2IGFH 2IXQB 3IDXH 2CO7B 4MYWB 1H3WM 1ZANL 3T3ME 3ZKMC 4AIXA 1LK3H 2LLNA 1ZIAA 4UF7C 5C0EA 3OB0H 3QR1A 1T89A 2KLRA 3GBMH 1KYAA 3SOBH 4PN6A 3BP5A 3ZE0F 3ILQC 4HYTB 1ZY9A 3QXAA 2I27N 5IHLB 3MV9A 4OJAA 3VD4A 1YYMH 3D05A 3BFQG 4W70A 2HX7A 4JDVA 1AZVA 2QKSA 2RIKA 2Z7UA 3GK8L 3TBYB 2PW2A 1PIGA 4MNGE 1UKQA 5A7EA 1BXVA 2Y9RT 2BPBA 1HKFA 3QIBA 5E03A 3S5LA 4F8PA 2ALWA 1QTYT 4DKTA 5IR1B 1H3PL 2EVJA 5L8KB 3H1ZA 3ESNA 3AXLB 4E9YA 4GRLC 1JL8A 2FIKA 2YOCA 2RJMA 5D1XE 4R7DA 4ZAKD 3SCMB 5C0GB 3WS3A 3ZTJG 3CSYB 3ERXA 5LN4A 5F6IC 3WFDH 1VESA 1A1OB 1A1NA 4ZYKA 1G6RH 3SE8L 3GSXA 5E0QA 1LO0L 2EDLA 1DUZB 3IRCA 5KEZA 4AENA 1W9XA 1P7HL 4L4TB 3WGVB 4DSYA 2MEJB 4OIBA 4XPAH 2WZPA 1PFOA 1CFMA 5G4MA 2VLRA 4HIJA 2O26U 3C60D 2IH9A 5FUZL 2IAMA 5ETUB 3RL2B 4NO3A 3AM8C 5DDHA 3PWVA 5J13C 4QRPB 2PYFA 2P52A 3TS8A 4LPVA 4ZTPH 1BPVA 2ZXAA 3R0MA 2HPOA 3KPTA 4G3YL 1DVZA 3S5LG 3QXWA 2WBJD 4YK4C 5MEQA 3IS0X 4N2IA 5C08E 1K85A 4NRYA 4LQFL 4ZSOA 3IGUA 2V37A 3GNMH 4ZFFB 1JXFA 2D7MA 4XGZB 1H3VA 1RURL 5ES4B 1HHIA 2BNUA 3CG8A 4JGJA 4XN7A 1JK9A 5IVXE 3UTTD 2DQJH 3D3VD 1T0NB 1E8WA 2TRHA 3UIZA 3DUHA 3KGUA 2B39A 3VH8A 1C5BL 2XWRA 1N6UA 4GOSA 2KLSA 1CDIA 1X5AA 2DLGA 4IRSD 2EH8H 2ZCLL 5D93C 3QXVA 1CL7H 4PGEB 1PGRB 1UM6H 2OMUB 2XN9E 4QY8A 1J5OL 2R2BA 1FV1B 1AE6L 3ARRA 3SDAA 4H0GA 4FFYH 5HYSA 3UJTH 5T5FH 4XNXH 2VSKB 4XB8A 4CADA 3GJEB 1J1OH 1FYTA 1JHTB 1M56B 2FYYB 1DDTA 4MA3B 3G6AB 3H2QA 4W9LC 5HHPA 1KCRL 5FKAB 1RZFH 1FN4B 3NQIA 4FOMA 3GKWH 2QADB 2FTAA 4O9HL 2MHAA 5D7HA 2QDVA 5D7SH 1KOAA 5LNEA 3PXLA 4JRXA 1VZHA 5L2JB 4NENA 5D7JA 5I17A 2NYKA 5GGUB 4AKQA 3BKJH 1A7QL 4B9PA 1JD9A 2ATKB 4H2CA 1KBVA 4PJGB 1JVOA 4X8GA 3RDTA 1CGSH 4Y1AD 4DCQA 3SDXE 3VH8G 1GSMA 1T2QL 4D8OA 4XCNA 3DGCR 4FFYA 4OU3A 5AVRB 3RP1A 3N1PC 4OIIH 3VDAA 3D85D 4KY1L 5T5FA 3D48R 3SE3C 5JR1H 3SGEH 4F37K 1C16A 3SKUD 1E4KA 1QQDB 1M7XA 2E75C 4OLXL 1D5BB 2VSCA 4QRUA 4RRPA 1HC1A 5B1JC 1I8IA 1UOKA 1R5IB 3QQDB 1L9SA 3L3IA 5I66B 4MA1C 3V0GA 5IMOB 5HYSG 1HILB 2VTFA 4QEGA 1SXSA 3KDMA 5D4QA 5EG6C 1OAQL 3N1FC 2COVD 5J1AB 4PJ8C 1G7LB 3PABB 2BVOB 3NCWA 5IBUB 4IMKA 1K8DA 2V2WA 3BPLB 2CU9A 4PJXA 3GI9L 1QFWM 3JWOH 3H3KA 3OJMB 4J3OF 2IDFA 3NSCA 3NSFA 2CMRL 3HHSA 5DD5L 3LEXA 5LGJA 2XQBH 3I50L 5H94B 4YHLH 4PJEB 3GBNH 2YN3A 3FS9A 4PVNA 1CL7I 1RZIB 5E2TL 3O6FB 4ODWA 1SHXA 3FQTA 1X5LA 3N0AA 1QLEL 4WK0B 3ROOA 4UIKH 4Z7OB 3WAJA 3DBXA 4XN1A 2EC9T 2BC4B 1AC6A 2NY1B 4BCXA 4G6JH 3VFNB 1YPZF 4MMXA 3ZKXC 4D0CB 3P3UA 4FTVB 1S9WA 5B1BB 2AAVA 4PB9L 3TJEL 4V11A 3N1GC 1AQHA 5I1IL 1IL1A 2D0GA 5IB3A 2BFGA 1XH2A 1EXHA 2O6EA 1FZOB 3SBWC 3CN0A 3EF4A 4P2RB 2P3YA 4PJBF 1U8CA 4BJLA 1MHPH 5GZOA 1KLUB 2KI6A 5BRZA 5L2KD 5E4EC 3JZ7A 3CV5A 2Z7YA 2VDPL 5DS8A 3BC9A 3C6LD 3QZMA 4AGPA 2CHZA 3WO4C 2OMZA 4AH2B 4NQCB 1VKXB 1OK8A 5M7QA 2G60L 1FZMA 3MA7A 2JCWA 1ZD6A 4FEMA 3GM0A 4JAMA 4YWGL 4R9HA 1UACH 1IGCH 4JQIH 4NQXA 3O4OC 3T0ED 3J07A 3SCMD 1JPSH 2FO4B 4PRIA 1FE8H 5KYYA 3BKCL 4H0LC 1CDBA 3QAQA 4LLYA 3DV4B 1JV2A 4XNUL 2BY1A 4RGNE 1FG2A 1NMAL 4YO0A 2MKWA 4IKJA 3ZDYB 3S0PA 3WMSA 1UUNA 3HC4L 2VAAB 5A16B 5J13B 4X98B 5ID0B 4OJCA 1RQ5A 3R06B 1ED3A 3QJFA 2R0WH 4PGCA 4L4TD 3CUPB 3TURA 2WVTA 1RXLA 1HH9B 4IBSA 1CGVA 1N7ML 1MRFH 1CD1B 3LNGA 4ES8A 5EZIL 5KANI 1ND0B 2GJJA 4R5TA 5AG8A 1CWVA 1DFBL 5FO8B 4GBXB 1DANU 5I1LA 1NC2A 1J1XH 4QJ3B 3QRFM 2JJSA 5KANG 1MY5A 4HUXB 3MUJA 4GSDH 4IW4C 4JQIA 4X7DC 4HJJH 1DLFL 1KYOK 2R1XB 3KHOA 4JCMA 4RMSA 2EDEA 3WIIL 3MLUH 4RZKA 3ARVA 3PNRB 4OCNC 4U1MB 2V17H 1GGCH 1VPOH 3LB6C 3M8OH 1LP9E 1OAXH 3ARFD 4XCYB 3TEWA 1PNCA 1N26A 2NYYC 4X7CC 4YHKL 4BHUI 1KCUL 5CBAB 2ITDA 1Q72L 1UJ3C 5D93B 4JMNA 3JTSA 1NGQH 2VUOA 2XZCH 1GJUA 4YSSA 3O9WA 3KE0A 2VR8A 1L0XA 1CF8H 5F1NA 1AS6A 5INCA 1B0WA 4S10A 1E2WA 4B3EA 1WAAE 1MXGA 2XG5B 1EV2E 1LMKA 3GB7B 2DN7A 5AFAA 1OM3H 2Y4SA 4MCZA 2ICEA 2XQYK 3MNVB 2CLZB 2F8XC 1ZSDB 4C54A 2LVCA 4NRXB 2P5EA 3VSTA 3G6JE 4X5LA 1U93A 1Y0LA 1GMIA 3W5NA 5B7MA 4MDJB 1JMZA 4PP2B 3QO0B 1GC1H 4AYSA 1ZRUA 4K23L 4CC4A 4IU2A 5HGAB 5ACZA 2YXMA 1A3RL 3VD7A 1KYDA 4AITA 1Q1JL 2WZAA 3O3DB 1LEIA 3BQVA 4L3CB 4MCYA 4ZOAA 1WICA 1PFCA 2LT9A 5F7HA 1NGZA 3MPCA 4N8CL 1QABA 2OLDA 4G6KL 2VCOA 2ZE0A 3HG0A 2E5EA 3GMPB 4PPTA 1IBZA 4OI8A 3A6OA 1DSFH 5GQBA 4IS6B 3VSVA 2XA8L 5CD3A 2NUTB 5T33H 1G9HA 2OJEB 3EW3B 5FHAL 4XZUB 1DJIA 1NJ9A 5BMFH 3AY4A 4LSVL 2Z1KA 4R4BA 3MLVH 5ISZB 1IGFH 1LQSR 4LEOA 4MRBA 2HMIC 1PSKH 4GAJH 4YEFA 2VRQA 1QLEB 4LBAA 1PS3A 2DLFH 5TQ2H 1NAML 3EOTL 3UTPD 2RD0A 4UTBH 5LAPA 2C4FT 2EEAA 1AS8A 1SQ2N 2QJDA 4G80A 5H2BA 3V9EA 3RY6A 3QG7H 2VAAA 4R5VA 3DXAB 4X8JA 3H3PH 3WY4A 4XMVA 5FR3A 4N0CD 5FECB 1CD1A 5LNDA 1PX8A 2GQHA 1XBRA 3MBEC 4OM0L 3CQQA 3SE9L 1SLVA 2VLLA 2R1XA 4NQVB 5C7XH 5HP5A 4PI2A 2YJLA 1DCEA 1YCSA 3MGOA 1GKOA 1MDTA 4DKAA 4LSTH 5CGMA 3MVSA 4JG5A 3IJHA 4UTBA 3VD2A 5D6DA 3JVGA 5DFTA 3ZKMD 4RBPH 2WTPA 1AFVL 1HCYA 1XGRA 3NACH 3P1VA 5DTFB 1KY6A 3ILQD 2ESVE 2CDGB 2DTMH 2FWOB 3MV7A 5I74C 3MXVL 5DUBA 1YUKB 5D9SA 1S7QB 4EOWL 1T04A 3E38A 4WNQA 5BO1H 3BZ4B 2UY6B 4FE9A 4NPYA 1KIUA 5KJ4A 4AVKA 2IBZX 4QRRA 5TH2B 2YAQA 1CLZL 1I3GH 3WO4B 1DVUA 1LDPH 3C8HA 4EXKA 1YYCA 2JJTC 2ZXQA 3DX6B 4YSAA 4M6ML 3LXUX 2CR0A 1OCCB 3MA9L 4UT6H 4QJ5B 5KVGH 5B8CC 3LKSB 2X4PA 3DX8B 5I16A 2O4EA 5DD0L 4M4RB 1KEMH 1IGML 3B5GA 4F57H 5T3XL 2H1XA 3FO9B 5F8QC 4YSEA 1XF2B 4GRLD 2Y07L 1BZQK 5IREA 3FT4A 4LBEA 2PPDA 4MKTA 2WQUA 4OJDH 1BVLA 1O7SA 1TVHB 2DQFB 3QIWB 4LKCB 4N2NA 3WEBA 3HI5H 3K80A 2P49B 1FA4A 2VLKB 1FNHA 1CQYA 4MD0B 3ETSA 2X2HA 2G5UA 1VFMA 4UQCA 5HBBA 4I2XB 2Q7NA 2B2XL 5BS0D 5EBLB 4ZUWA 1RZ8B 1WEJL 1E3ZA 3RWGB 3NA9L 3AJ7A 1EMTH 4TLSA 4XBGA 1M7UA 4UB0L 2VW7A 3VYPA 4V1DA 1HXYB 1Z9NA 2BIOA 2ZX9A 2VXSH 2XBDA 3MLZH 2YUXA 4Y5XA 2ZSVB 4GS7C 4LESA 2GUYA 4UT6A 1MFAH 1S7TA 4XPFH 1HHJB 2W38A 4F33A 2WXJA 1NDGB 1SEQL 3MKKA 5DC0A 2VXQL 1S9XA 4JO1H 2P8PB 1FIGH 3CK0L 5TGBA 3T2NH 3PFQA 5FYJL 2MOGA 2PWFA 4B27A 1V8HA 1AACA 5J0BA 3WN5C 1HIMH 1I1FB 4NT6A 1PG7W 4UU9B 4WQOA 5GGTL 4F7EA 1UJ3B 2XTLA 4HUKB 1CIDA 3O6MH 4X6EA 5JIHA 4AMKL 4XBPB 3N1MC 2GJ6A 3D39E 4PGBA 3P73A 4U1KA 3GZPA 3RL1B 2QR0A 1BQHA 1A6VH 4YH6A 5I24A 3O0RL 3QA3A 1KELL 1AR1C 3ZGHA 1X5JA 3OF6A 1GCYA 1PZ3A 3TJPA 2WIIB 5HHME 4EKXA 2B9BA 3M88A 3IU4L 4N3TA 1B4RA 3U0WL 3ALWA 1B4TA 3HNSH 5E6YA 2W80C 5IEHB 1UWXH 1B0RB 4OZGA 3FQUB 4QYAA 3VXUE 1PKQE 3UPRB 3LS4L 2X4SB 3EZ8A 3GMQA 4C83B 1G7IB 1SVBA 1KJ3H 2QFPA 3ARBB 2VOTA 4JNXA 5CR1A 5KN5A 1PLCA 2CJSA 3GSRB 4O2EB 3ATFA 1JGEB 2Y36L 1TZHB 1KCKA 4W9EC 1S46A 1R3KA 2AXJA 4AK1A 2GTZB 3IDMB 4CJ1A 2HN7A 1LEGB 1LXMA 3H55A 1U6AH 1T83A 2IH8A 1N0LB 2FX8L 2XWJA 3N44F 3VRLE 1QSVA 3DX8A 4GLRH 2RAMA 3L5WB 5FIEA 1O6SB 5DQDH 1X5YA 4W6YB 4OZ4B 5AAMA 3L3HB 3C8KB 2ZX5A 4M00A 1BQHG 1IM9A 3VO0A 2IALA 3CZLA 5AW2B 4RMQA 1PLBA 1WZLA 4HJEA 4PBWD 5EV7A 5I73C 1UM5L 4HJGB 2HRGA 4DW2H 1IVLA 4M62H 1M1SA 3FOMA 4PJDA 4TNFA 4APQB 4AZ8B 4D8PA 3LNIA 1ZXKA 3UEQA 3JWDH 3PY9A 2VAJA 4Z7WB 3UDWC 4AM0Q 2I25N 4IBYA 4NKQB 1ES0A 2CJUL 4QF1A 4GSUA 3EFOB 2VDKL 5C0BA 3LS5H 4PJ8D 2Y22A 5C6TL 3QEHA 4KUZL 1AGFA 4HJ0C 1T66C 2P5WE 1J8HA 5KS9F 1KPVA 4M1DH 3BXNA 3MTRA 5E1IA 3OKLB 4AV0A 1E9QB 4RZCB 2RALA 4LT7A 1AIFA 5KJRH 1D5IH 2ZONA 5C0IA 1GTNA 3U2JA 5FHBL 4QHKI 3R0NA 4DN4H 4KI5D 4AC4A 3GM8A 4MZ3A 3ZU8A 3U1SH 4B7IA 4HU2A 1GH7A 3LPFA 5BVPH 1I4FA 4JFZL 4FNSA 4L1HA 1T21B 1DJSA 3ARGC 4OGZA 4X7TA 5LQBL 4TM9A 1WF5A 5DA4A 2O6DA 1W0VB 1NUDA 2DICA 1EHLH 1IAII 1JPST 5L88L 5BW7A 3DKHA 4JY6B 5C70A 4XVJH 1IE5A 4RFEB 1LD9A 3LEYH 4L0YA 4B60A 1ZVSB 4X4XB 2E7BA 5GZND 5HHVH 1L5GB 1HSBA 1O5PA 2GJPA 2KHAA 4M93C 1QFPA 4AK2A 2IDUA 2JK5B 2QPEB 2UYLA 3GUFA 3VWJA 2HVBA 2H9GA 4CVZA 1XSKA 3ZE1B 3BZ5A 4PBXA 3G5WA 2YQ2A 2OXGB 5DJXB 5IIEB 4NZJA 3DIFB 2AQSA 15C8L 5EOQL 4WRLA 4KO9A 4FLRA 4NUJB 5E2UL 3DYPA 3AG1B 4WK2B 1F3DJ 3ZQXA 2OSXA 3AREA 2TSBA 4D3CH 5DFAA 2D7OA 3BVNB 1NFDB 4LCWD 4YOKA 2IO5A 4K2UL 3V10A 1LEKB 3T8VA 2JNZA 4HVBA 4OV5A 4PB0L 2K70A 5C6WH 3QQ3A 4JFDA 2FHFA 2V8MA 1JK8A 1TG8A 5KBMA 2B1OA 5HGBA 3HFML 3D9AH 1KN2H 4YSUA 4GS7B 3V52H 1OF0A 2ATPA 5DJ2A 2BIHA 5TF1L 2ADJB 2W60B 6PAZA 4MLIA 3FN3A 4ODHL 1E8XA 4U6VH 3X3FH 1DEEB 2HFEA 3BE1H 4PJHE 2NNXA 1W72H 3V4VA 3IS1X 1XL6A 3MN8A 1ETB1 3PS6A 5GRWA 1RZJC 1DQLH 1Z0MA 1QACA 3CTTA 1C12B 3FMGL 1SEBA 3P77B 2ZP8A 4AW4A 4G8GA 5DF0A 3VVWA 4BH7B 3MBXH 1HOCA 1YQ2A 3PWJA 2AEIT 4EN3A 1ASQA 1IGIL 1OE2A 2ZOOA 3NCJH 3PPSA 3VMPA 1KC5L 2AGJL 3BAYA 4QXGH 2Z91A 4NO5A 1LM8V 3KCPA 3K7UA 1YEHH 1FCCA 1BDYA 3VYOA 4PLNC 2X4TB 3A67H 4JPIA 1EGJH 1CPUA 3LB6D 5CP3H 1G0DA 2JB6A 4R84A 2FNWA 1F6FB 3SKJH 4F2MB 2NYYD 1NCNA 1OSPL 2PETA 1HQRA 3K0YA 3IFOA 1M2VA 2FB4H 3ZE2B 4CDGC 1RZJL 3BAEH 4R4NC 5FS5A 1F1GA 1CD9B 2PMZA 3EGSB 1W72A 4HK3J 3HB3B 1E5AA 4HLEA 1MCEA 2CKBL 3OKNA 3KPSB 4WEBL 3RZWA 3ML9A 4KKLC 5JDSA 5JQ6L 2BSTB 4NQEE 2UWEE 3UIYA 1F0LA 2V7NA 3ARXA 3KAAA 3TZVC 1YAZA 4I0PA 2BSSA 2V9QA 3U7YL 3VFSB 3DROA 3WE1A 2MOQA 2WZ5A 3G5XA 1DQML 1MFMA 3MOAL 2Y72A 1MY7A 3QR2A 2CLRB 5F72S 3SBQA 4XWGH 3FSWA 2XU9A 3CVIH 4GSXA 2PABA 1THAA 3O11B 4ZMOA 3FUFA 4UV7H 5CP3A 1JZ6A 3F58L 1U95A 2FECL 3V0FA 3SYQA 2F7IA 3CDZB 1V7MH 4RQQB 2BCKA 3I6SA 1KXVC 3UO8B 1I8MA 2BIIA 4QCIB 4MYPA 5GSRA 4X6DE 4OLYL 1TU2A 2YMXH 5E8NA 3WENA 1PDKB 2FJGA 3P69A 3MV8A 1UYWL 5I73B 5K69A 4L3EA 2X4OA 5E4IA 2YQGA 3MO1B 3FB7A 4KMTH 3G08B 3RVTC 2E4TA 3NJJA 5C9JA 3HE7B 4Z7VE 2G3MA 2V2TB 5CLZA 2HMID 3NH7L 2UX7A 4YHMH 1KCSH 3HRZC 5L7XH 4TSAH 4QTIH 4MJ5B 1URLA 3HA0A 4IGBC 2NSXA 1T20A 2J6EL 3VA6A 1SXBA 4S1RL 5ESVA 3EJQA 5C2UB 1X3DA 5I75C 4NDMA 3HNVL 5DJYA 5C07A 3UAJC 2CRYA 2UV3A 2WLMA 5ALCL 3G5VA 3Q44A 4IOFC 2FT7A 1IFRA 5AENA 2B1HH 3DTXB 3SKNB 5I0ZA 1ORSB 1JZ3A 4OZIB 4IHOB 3L6FB 43CAA 3K6NA 2A6JB 2MCMA 3GMRA 3PWPD 4U1NB 3HIZA 1C8PA 4C59B 3CC1A 4NQSB 4WFFD 1BP3B 4JFPB 3MBED 5DHYB 4A6YH 5I5IA 3CMGA 4HS3A 3V5HB 3BFWA 1QA9B 4KHXH 2JVUA 2PTUA 1SY6L 3IXAA 3TH3T 2CPUA 4LSQL 1CU4H 2NW3A 3C09C 5SV4A 2EIBA 2XN0A 4R7VA 1F1DA 5I1DB 4CRPA 3P11H 5K59E 2EE0A 1INDH 5E8DL 1YO4A 4Q9CA 1FNSL 5AOMA 3QHFH 1XWVA 3WLWC 2P28B 4ZFZA 3CCHA 2QFRA 4QHUB 4TUKL 3B9KB 4YDJB 3VGGA 2Q20A 5T3XD 4POYA 5I18L 4I8DA 4X5WB 2CBMA 5CFHA 4M93B 4ENEC 2EC8A 4FD0A 3QULB 3WKNA 1OP9A 4I77L 5IMMB 4LNRA 3QJHA 2BWDA 5D96B 4OCLC 1JVKA 3RUGE 4I48B 1R3IH 1OK0A 2EABA 2PO6C 5I6OA 3D4ZA 1PAZA 4EIUA 4A6YA 3D52A 4RX4A 2OPCA 3IK2A 3P4MB 5DUML 1QHQA 3CC5A 4RDBA 1I8LA 1VF5C 1JHLL 4L8DA 4PAZA 1X6NA 2LV4A 3LKOB 1JFQH 1YC7A 4K3DL 1MCBA 5F7MC 3N85L 4FERA 3U2IA 2QPFA 4X50A 2F54B 3QS2A 4FI8A 4YHZL 2H0JA 2G30A 2D31A 3BHBA 3AG2B 4GH7B 1KN4H 4L9DA 4NM4H 2CK0L 2IPKB 4TNWF 3P0YH 3LKRB 3ZZ1A 5D72L 3VQ2C 1PNDA 5FGBA 4EBQH 2C9AA 5K9JL 3B37A 3GSNL 5FYJD 1EDYA 1L9RA 1AG0A 4QDGA 5CF3A 2W0FB 1CYXA 3K8LA 1U4EA 4R0LA 1I9EA 5F0MB 2CZNA 1DQIA 1HT6A 2X0VA 3IJ7A 2XPGA 3FUDA 3OTTA 5E9AA 1C8QA 4JN2A 4ERSL 2NYZA 4JMXA 3L5JA 3QZLA 4QHLB 5DEGA 4LHUB 4OSUH 3RA7H 3S88L 1QPXA 2H5UA 2PCPA 5DJCB 2UZIL 1PTZA 4GINA 4EUPG 3L4UA 3M7OA 2KYIA 3PHQB 4NWTL 3ZUCA 4GG8A 3SDDA 1A7RL 1IKFL 1GSKA 5D4HA 3TBBA 5DRNB 4DP1X 5J9PA 1R0AL 4WSGA 2W9EH 4N90D 5D7LA 1EEUA 3QIBC 4TUOB 1WLHA 1WV7T 3GJFK 3QIUA 2P46B 2IFFL 4XNYL 5C0JA 3ULUH 4EKJA 5E08L 4XPGH 4AUYA 3ILDA 3CLFH 2ED9A 3OV6A 3QUXA 3BLKA 4G7YL 1E8YA 3FTGA 3RFZC 1I9JL 2VO8A 4FQ2H 1DVSA 2BFVH 3CIQA 3UJJH 1CVSC 5C09E 2HLAB 2XYCA 1S9YB 3V6FB 4UQBA 3I6GB 2XWEA 3KBPA 1AR1D 5SV3A 4PWIA 1SM3L 3DOSB 3CFEA 3APDA 4IBTA 5ALBH 4WJ5B 1PPIA 1UXWB 1S7SA 5KVDE 5F96L 2C34A 1Z9LA 3LQZA 2BOCB 1OM9A 2EEXA 3IXTB 3JT0A 4P5RA 1GY2A 2VDOL 5JOFB 2AK4B 3DSNB 2GBAA 4JUSA 2BLFA 4JHVA 3QZBA 4P2CG 4MAZA 4XMTA 3ZL4L 4Z5RA 2OJZH 5GRZA 3PV7A 4N2BA 5E00A 4DJMA 1E8ZA 5SX5K 3KPSD 3OXRA 1OF2B 4MFHA 2IGFL 3IDXL 3C5XA 3QC5X 2IGTA 4BFJA 2A9CA 1LK3L 1E27B 2DM2A 2DM7A 3HG1D 4GNKB 5C2BL 5HDBB 3GBML 1KYUA 2MTPA 4OKVA 2BSDA 3SOBL 5IVZA 2N4IA 5CWSA 3H7LA 3ZJAA 1IKNA 3MOBH 4X4ME 1TQUA 1R3LB 2DD8H 3JZYA 1BBJB 4ACPA 3ECUA 2X89D 5GRXG 3WJLA 2F5BH 4JL2A 3ARYA 1YYML 4Z8FH 3VSUA 1MNNA 4KV5E 4ODUB 4NO0D 2ZXEB 3GGWA 3JV6B 4UIMB 4Y2DB 3QXDA 4YL9A 4KGJA 4PY7B 5I1EH 4HW6A 1A6WH 3OC5A 4O4YH 2WVSA 1UH3A 4JKPH 2CIKB 5I75B 3I6KA 1IUZA 3AC0A 1HFUA 3WLBB 3WEXB 2AVFA 1O9VA 3V6OC 2OXHB 4NCC2 2ZOWA 5EBWB 2JF1A 3Q43A 4JUTA 1KLFA 5EO0A 5FYKE 5C86A 1K6QH 2P4AB 3ABKB 3FT9A 5IESL 3NP4A 3QEQB 4HKBB 3N04A 1U8JB 4KK8C 1J05B 1G1CA 2J8UB 3SDAC 3AQDA 5EUKB 2X12A 3GRBA 1MW1A 4K9EC 4MAUL 5HJ3B 5FWQA 5F71A 4HJ0D 1T66D 2DYPB 1KTLA 1SZNA 3EJZC 3HLKA 4XPAL 2ALAA 2PYEB 1N59A 4M5YL 3VMNA 1JPFB 4LK4A 3TCLA 3REVB 4EVNA 3E7JA 4KTDL 3SB3A 3MCLH 3NSYA 1XQ4A 4N4YB 5D7JC 3EBIA 4NLHA 5D1ZB 3SDXF 5DD6B 3ARGD 2IH1B 2JQMA 2R29A 2BHZA 2EKSB 4FJYA 5KYUB 3H9ZA 4EAEA 1HAWA 4K9EL 5MEPB 3L5IA 3RDTC 4OLEA 3WFCL 4HIEB 4PWFA 1REIA 2E27L 1A6AA 5HYJA 1G43A 5SWZB 3W2DL 1V7NH 3ZLQC 3F7VB 4AEIH 1E4KC 3AVEA 3KS0H 4J1UB 1QWHA 1X5XA 2CR6A 2ILLA 1JF1A 4OF0A 4WDIA 3D18A 3ROLA 4NQDB 1CBVL 1OO2A 1KSRA 1UD2A 1H0DB 4NNXB 1JXGA 3QCVH 1CXFA 1VJSA 1GZHC 3SY0B 1F4XH 1RD6A 4HS6B 3OAYK 1XSOA 3S34H 2EH8L 4APXB 5KZCD 4ELMF 1CL7L 1CR9H 5DVOA 4IMKC 1UM6L 4JM2F 2VC2B 5GJTH 1R9FA 1SUHA 1PG7X 4FFYL 2PCFB 2KMWA 2QDWA 2LTQB 3FO2A 1VFBA 4XNMB 4YBQC 4YGVB 1GYVA 1J1OL 1QVOB 1YMHB 2KUTA 3FCGA 2AJ3A 4HCRH 2DIBA 5D2NA 5J57B 3QUKA 4ODUA 3VXPA 3RLSA 2Z4QB 2XFXB 1UEYA 4O5LL 2Z35A 4WW2B 3VG9C 4BZYA 3GKWL 2DQ6A 3MDJA 1ESOA 3NZ8A 4GQ9L 3ME0A 1FPTH 4J3OH 5AZEL 4WO4C 4Y2OB 5IQNA 1MIEH 4GXVL 4HXAH 5CEYA 3T3PF 3RZCA 2D9QB 4MMXC 3WLBA 1E65A 1T0MA 2BNRB 2J55A 2WMPB 1MJ8L 5DUPH 4FQHA 5GRUL 1U8QB 1U9KA 3DX1A 3RVWC 3F7PC 43C9B 1VCBC 1CGSL 3P02A 3JWOC 2YEZA 1BWWA 4LCIH 4Z3IA 3TBSB 1NIAA 5EHFA 1I9IH 4RRPM 4J3XA 2UY7A 1KYFA 5BO0D 5JR1L 3RFZB 4HCRA 3EBHA 1AKPA 2DMBA 5DQJA 5E6UB 2AJUH 2JKIS 4ZUUA 3I84A 3BPCB 1ACXA 1TXKA 5FYLE 3V5KA 3RPKA 3U4AA 2N7SA 2ROYA 3KMDA 4HF5L 3VXSB 4JQXC 1A9BA 1DQVA 5IW1B 3FO1B 4JG1H 4JFTA 5LG6A 3OAUL 2ZX6A 5T1KD 1KIQA 5MEND 4N2LA 1FP5A 5PCYA 5AVSB 3H9SE 3JWOL 4P5MB 4R4ND 4CSPA 3SYOA 2Z9TA 4F7TB 4OFKA 1FC2D 2D7TH 5CHNA 4M48L 5IQ9A 2R15A 2XQBL 2C7UA 4U0RC 4KKLD 1KZQA 4YHLL 3UG5A 5AYUH 3P9LB 1OGSA 2NX5A 5KSBB 1U91A 1MCDA 5A2JH 3TZVD 1V3MA 4BRVA 1JZ4A 2ERJB 1BAGA 4UM8A 3IDUA 3TTSA 4UIKL 3HZ3A 4JFHD 3Q13A 1MF2H 1MHEB 3S3BB 2XY1A 3KVDD 4ZW5A 4G6JL 3II1A 1PEZA 4PRAB 4YDKH 3RYMA 1IAOA 4Q2ZA 2H26B 4RMRA 1MJUH 3GZOA 1KDJA 4L2LA 3WEAA 3SZKC 3F7LA 3KPRE 3U30B 1EAQA 5EU6D 2FQDA 3CPUA 2BVUA 1LP9F 4N9GA 2XBZA 1K4DB 9CGTA 3D5OF 5FFGA 5GSVB 1BF8A 1TZGL 2Z4TA 3S4SB 5L0QB 3QE5A 4I88A 2NUPB 2QSCH 4J3OG 1WFIA 4RISH 1N4XH 1BJ8A 3PGDA 4K3JH 3RVTD 4LXFA 1YMHA 2APVA 4ZUSA 1WAAF 4HJSA 1UXMA 3A24A 5GRVL 4JGMA 4OBRA 3B7SA