2WNKA

Structure of sporosag from toxoplasma gondii
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
235
structure length
223
Chain Sequence
b'TSCETEGSSISFTVEKAGHVVRFNCPSTLEEIKPAYEAGDSTKVCTTADCSNEAALKDVLKSASLAQAEGSGGNDFTLTVDALPEAETSVFFLCQRTGAAVPSDKCGVHILVKAAPQAPVCSAQDHTLELQITAANSDTSFVCGGTFNVIKPANAAKVLQGDSCETEVDLVSLVPHASRSALEQSGLIKLSVTDLPQQQQKLCYRCEDSSQKACKVLVTVSAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPOROZOITE-SPECIFIC SAG PROTEIN
publication title Structural and Functional Characterization of Sporosag: A Sag2 Related Surface Antigen from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 50
structure length 223
sequence length 235
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04092 SAG SRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2wnkA01
2.60.40.1320 Mainly Beta Sandwich Immunoglobulin-like SRS domain 2wnkA02
1KZQA 2X28A 1YNTF 2JKSA 2WNKA
chains in the Genus database with same CATH superfamily
1UWXK 2V17L 4K23L 3UXFA 1OTTC 1T1YB 1VFBB 2AJ3A 5HD8C 1BXXA 5C8JB 3CHPA 1PLGH 3R1GL 5DFWH 5SX4I 4A68A 1F90L 3DIFA 5DHVH 3MRPA 2P52A 4Y2DD 2YD9A 3O45B 3FFCB 5D1ZI 1JCKA 4B3EA 1E2VA 2GI0A 4YEEA 1LQBC 3QNZB 5BQ7B 1QR1A 5DZAA 3BKCH 1OPGL 1NBYA 4EVNB 2B4CC 4DO5A 1JUFA 4YQXL 1CYWA 1JOIA 4HKXA 4ANXA 3E2HC 4Z23A 3FT4A 3GMPA 3OG6B 2CLZA 3LQMA 3ZZQA 2VLJD 2Z4QA 4QO1A 3V0IA 3RVVD 1R3HB 4POZC 4X0KA 4PLJC 2IADA 4QNPF 4PV9B 4HBQA 3IYLW 4RFOH 1JK8A 3ZE0B 3BMVA 4KK5D 4M7LL 3DO7B 3JV4B 3VXSB 2KZBA 3FU9A 1FC1A 5KYXB 4I1NB 5ELIA 2AABL 3LKSB 1E5YA 4K7PH 2EICA 1YN6B 3P73A 3ENEA 4WUUD 3GJFH 3TT3L 1R3KB 2WTOA 2P8LA 5DGRA 2NUTB 4MNGB 3I85A 5EN3A 1JGEA 5CGBA 4AQ1A 3P0VL 1PVHA 2MCG1 4ODVH 4JGMA 2BP3A 2VC2H 3QG6B 2FH6A 4DK5A 4R8WL 3P2DA 4I18C 4P5TD 2H26B 5B8CC 5C0FA 5AZUA 1ID5I 1BYOA 2BNRD 1YC8A 1OCWH 3HC4H 2UZYB 3RY6A 2YAEA 4PJ5E 2WQWA 4G8IB 2LVEA 1OAJA 1A14L 5FC9A 3U1PA 3C5ZB 1QRND 1OHZA 2ZCLH 1IM3B 4JDVA 4H8VA 2CRZA 3MKKA 1FFPB 4KKCD 3KD4A 2ALWA 4Q6IA 5GGRY 3FTVA 4HJGB 4WQOA 5ACLA 5F1NB 4J1UA 1ZLUK 3OJVC 1CGUA 2CKBB 3JV6A 1V10A 1A7OL 3LN9A 43CAB 2XKUA 2Z0BA 3LVEA 3CFJB 3ELAT 4UQBA 1OEZW 3DURA 1J0KA 4DZ8A 1DO5A 2ZX5A 4EI5B 2BS71 3MQIA 4IS6B 4RDBA 3SOBL 5JIPA 3CSGA 4NN7C 4GP4B 1AG0A 2HFGH 3CN2A 1EANA 1A1NB 3D39E 4PJXA 2PLTA 4WFED 3BPLB 1JV5A 4H8PA 2F7IA 5KYUB 3QUHA 1N5YL 3B9KB 4PJEE 4X9GA 4X7DC 3KWUA 4BRVA 1NDGA 4ZX5A 3ZYZA 4S10A 2H0EA 4HULB 3CHRA 4YX2L 3SODB 4MS6A 5K1JA 4U2ZA 3NSFA 3BN3B 4LKCA 4NQCA 4A7GF 4F57L 1J9QA 2UXTA 2EIZA 4XT1C 4NHCL 1OAKH 2FLRT 3NZ8A 1EAQA 1MLCB 4RRPA 3HTLX 4ZNEA 4OZIB 2Q3ZA 3FO2B 1QVOA 3DGGB 4NN5B 2E7CA 2HUHA 5FYKH 3RVXC 5F89A 3L4CA 1CFSB 1J05B 4PBVC 5L4JA 4WUKL 1JV2A 4P3CL 1W72H 2VJXA 3FQRA 3RZCD 2AI0H 5JHDB 4MVBD 2HJFA 1F2QA 2PO6D 1HCVA 1X5KA 3FTXA 5E1QA 3S36X 3Q7JA 4NXSA 4WHDA 4YHPA 3OVUB 3GS0A 3S35L 4UV4H 1G7QA 3D9AL 2HLAB 4OLZL 1AQ8A 2ZCKH 3GUFA 4LSRH 4Z7WE 4MXQD 3BZDA 3KJ4B 4FRWA 3IM1A 5D1ZB 2O1AA 2AJZA 1ADQL 1K4DA 3F6IA 3TLRA 3MODH 3TYFB 4XRCB 1PS3A 1CTOA 1TJIL 4OLWH 4DP0X 5FA4A 2NXZD 5DJ2A 4PJ9A 1RK1B 3O2DH 5DURD 5DQDH 3TVMD 4F3FA 4XCFH 3P11H 2JXMA 3RVTC 1ASPA 5MHSD 3FH8A 5K59F 2PYEA 3BH9A 4QOKE 1U8NB 3IJ9A 4UU9A 3SYPA 2R7EA 2X6UA 3TPUB 1GZQA 3ARRA 2E47A 4GKZB 1GYVA 3SB3A 4MCZA 4AYFA 5D2NA 4NOFA 3GI8L 4XHQA 5IROC 5AVXB 4L4TA 5CUSH 5GRUH 2OJZH 5T1LB 1P6WA 4BWTA 2BSCA 3PAVA 4M5TA 3MR9A 2XY1A 2CK0H 4J3SA 5INDA 4F24A 4CADA 2IFFH 3QJSB 4Y4FA 4EN3C 2WW8A 4NC1C 4U1LB 1OGTB 3WLWD 4JE0A 5BVJA 1G7JB 1IAIM 1IBDA 3IPEA 2W8CA 3KVPA 1S5HA 3KPMA 4O4YL 4HHAA 2P8PB 4G42A 1T89C 1BDYA 1ZSHA 4L1TA 5E8EB 4TUKL 3HZKB 3QPQD 1CF8H 4H8QA 3V4PL 1KULA 2VITA 1AXTH 1SOQA 1UJ3A 1VESA 3R0NA 4K7PX 4DESA 3L54A 4LSTL 4P23A 2WXIA 2YPLE 1T7VA 1SF3A 2WQUA 5DS8A 4M7JH 4FQHB 2J8UF 3T3PF 5KJRL 1XMEB 1Z9MA 3SO5A 5BJTA 4OUOA 4QI3A 3RYMA 1JBJA 3RGBA 2X4OA 1NAKL 3HHRB 2X87A 3MNDA 3TC9A 2WAHA 4UTCA 4BUHA 4QWWD 1M56B 2ZKYA 5SWQA 4N28A 1ETZB 4KNSA 4AM0A 4WWKA 3MOBL 3NBNA 2EDRA 5DZOA 2FX7L 3O6LL 1TENA 2Y1VA 3BLKA 4YS4A 2DQEL 4ZK8A 4C55A 4YWGL 4Z95L 2G4EA 3AT9A 5C0JA 3VSUA 2A83B 4KY2A 4EDXB 4ZMYA 2WXOA 2CNYA 3WFDL 4U0RB 1ODUA 1LLAA 2NUPB 4Y5XC 5C08B 4WFHE 4FA7B 3FU7B 1WZ1H 1S3KH 2XQBH 3EXJA 5I1DB 3QCUL 5F7HA 5I71B 3IDYB 4WI4A 5B1BB 4JZJB 3SPJA 5C1MB 1EBPA 2GUYA 2WO3B 4KKBD 4FG6D 2VLJA 4KPHL 4OUUB 4M7ZB 3ZHNA 2DLEA 2J88H 4PM1A 4Q97A 4G83A 1N5AA 3CC5A 4JKLA 5KVFL 2D4FA 4AOFA 2KQNA 2VR8A 2FWOA 3BKMH 3L3GA 3MRNB 3RJQB 3UC0H 2HUEA 5BV7H 4MXWL 2DQTH 3UJTL 1PKQA 2WLYA 4PFEA 4PGZA 4LBEB 3EBHA 5H8DA 2HH0H 4NNYA 4ENEC 5HYQB 2AFNA 4P2OD 1YMME 3PV6A 2WCGA 2XWJA 5HHME 3QRGH 4MDJB 3HHSA 2UZIH 1Q38A 5F96H 3SEPA 1Q8MA 1NAML 4CW1B 4PG2C 4BDVA 1LK3H 2PUQT 3MRQB 4NOBA 4OV5B 3DO3A 3K2KA 1UB6B 5D7IF 4XOBA 3B7TA 2V2WB 3VD5A 4DKEH 2CHZA 2ARJB 3W0WB 4AEHH 5IB5B 3O0RH 4LVEA 4E68A 1MCPL 3BQVA 2K6ZA 3O2VH 1UACL 1MWAB 2BNRA 5MEOA 4P99A 5I0VA 3L95B 4QRRB 1O6SA 3U36A 2YEQA 5C9KA 1BVLA 3QZPA 1S3RA 4AKOA 2YKLL 3TCTA 1QRNA 4PRAB 3EFFA 1HXMA 2X4SB 5F9WB 3FUMA 4B9CA 1JZGA 4YXHH 4RAVA 4LCYB 4X42A 5MI0B 2NY2B 3FTUA 3W38A 1MRDL 1QSVA 3F12A 2Y0SA 4NXKA 4N90E 4PU2A 2FTAA 1PZAA 1G7HA 3ZMEA 4OCYL 5IOKA 5IBUB 4N0UE 5FXCH 3CH1B 1QLRB 3RWGB 1WP6A 5C0DB 2FX8L 4LARH 1G9NH 2ED7A 3RTLA 1VGEL 4Z7QB 4PRIB 2WWKT 4GUOA 5AL0A 1BOGA 1K5NA 4IBSA 4YSTA 3U7YH 1U8IB 1RIVL 4O2CA 5FB8A 3VG9B 1U2HA 3MA9H 3VI3A 4AQ8C 4EF3A 1MVUA 2X2UA 4DO4A 4FAAB 2P24A 1NMAL 1QNIA 4QDGA 2QFPA 3FU0A 4O5LL 1U8KA 2DQIL 1KFGA 4A6YB 1PMYA 1BAFH 4P04A 4M1GL 2WQSA 2OQJB 5IFHL 3PNRB 1V3JA 4LEOA 3ROOA 5C3LD 1D5BA 1TQBC 5DD0H 3SYCA 3H9SE 4JPIB 4IBWA 1ET5A 1TQCB 4AV5A 5DJCB 1PAMA 1LDPH 1YAZA 2WZ5A 3V6ZB 1WHOA 2ERJC 2P28B 4AXWA 3BP6A 1SEBB 1G9EA 3ECUA 4JFVA 3VXPA 3AS0A 2J4WL 2CRMA 1YQVH 4O2FB 4D8PB 2ATPA 1NM4A 3FHAA 2X4NB 2VW4A 1UENA 4FG4A 3T4AB 4DT2A 3LRLA 1CC3A 2VUKA 3N50A 3F62A 3RZCA 3US0A 5LBSL 1SXSA 1M05A 2VDKH 2VDRL 1YEKH 3R4DA 5AWNL 1TETH 3EO9H 5DUMH 2ID5A 3E38A 1YYMH 4PWHA 4F7MA 1N19A 1IFRA 2G30A 1AKJA 1XF4A 4D0BB 2G5BA 5CMAA 4NN6C 1WAPA 5K1NA 1I7TA 4QRTA 2D9QB 3KLDA 3GSQB 1NC2B 5E2TH 2EIJB 4LCVA 3RX5A 1KB9J 5IJVA 1E9PB 4UOW0 4WK4B 1A4BA 3NJLA 1G9HA 2DZEA 3F2LA 5JO5B 5JYMA 3SE6A 2OS7A 3EYVB 4P59L 1BZEA 5FYLE 2A4EA 4ODWB 4R96A 5GJSH 1UXWA 2XA3A 1DEDA 3C8KB 1QFHA 4JFUA 4Q4IA 3KH4A 3VX1A 5BW7C 4TUUA 4N22A 3ZL4L 5F7UA 1G87A 2XN9D 4XVTL 4LP4A 2OBGA 3FQUA 1NCAH 4UIKH 3VFPB 3ZYIA 1KIRB 2JI2A 3DUSA 2F7OA 4WU7B 2P5WB 3F6LA 4WJG3 4L18A 2LVCA 1YEJH 4HIJA 1S7WB 4JO3L 1YDPA 1UH2A 4JPKH 3IE9A 4MTMA 4HPYL 4X6CA 1XEDA 1T2QL 1H3XA 1UUSA 4JFEE 3SBQA 4Z7NE 5B1KA 1BD2E 3HE6A 5H37H 4Z7VB 1T5KA 4XNQB 1QLEB 1RURL 1UADC 3EGDA 5D5MB 2Z7UA 1B9ZA 2N7BA 1UT1A 4F93B 2QMKA 2ZPKH 4M3KB 4TQEH 2IH8A 1L0QA 4IU2B 5EU5B 4G1MA 4P3WA 5INCB 3ESMA 1HL9A 4XB7A 1UOVA 3K5SA 1KV3A 4PJBE 3UBFA 4DVRL 5L9DH 3AJ7A 2PW1A 4FFZA 2GT9B 4S0HA 2Z64C 1IC5H 1KXVC 4PGDA 3B9VA 4Y2DC 5IHUL 1CLOH 3CHQA 2YZ1A 1GTNA 3GTVA 3WXWL 4OLXL 1UH3A 1WFOA 3FQWB 2NY5C 5E2UH 3REVA 1J18A 3V0HA 3W39A 2XJKA 4YSUA 4WEBH 1BVNP 1FFTB 3FFDB 2PCFB 2EVFA 3MCG1 3EJCA 4XO8A 2HB0A 1EO8H 4JN1H 4PWFA 4ZQKB 1FGVH 1EEQA 3CZKA 3OR6B 1RU9L 3ZIMA 3I2CH 3BUQA 1UZGA 3HOGA 4Q6KA 2D8KA 2P80A 4ELMB 1KCBA 1TKWA 3SDAC 4IBYA 5G5DB 2JCCF 1XBDA 3CFQA 1RP8A 3BP7A 4ZMOA 3M46A 4PLKC 2CLVB 4MRBA 4B7IA 4ZPVA 4WRLA 5IBLC 2ADFH 4KJPC 4FQIH 3HEIB 4M8RA 4KGLA 4J3WA 4MGXA 1OQXA 3D2UA 2J1ZA 3MCKB 3O3UN 3T2PA 1A1MB 2B4CH 5HYSG 3QEUB 1GGIH 4G82A 3BFWA 5FM8A 1UWEH 1R24A 1YEGL 1U8MA 1Z9SB 2EE3A 1EEZA 1J1OL 3ZK0A 2Z9TA 4M7KH 3T3ME 1HN1A 3N6YA 1L0PA 1I9EA 2LT9A 3QARA 3WYRA 1KGXA 1MEXH 1DQQA 5AAMC 2EDDA 2FT8A 4AUYA 4JM2F 4JFOA 4Z0XA 4XZ4A 5AG9A 2NNCA 2BY0A 1H9VA 4WWOA 1BVZA 4P2OA 2VDOL 4Y19B 2IOOA 4K8RL 2AJSH 4MCMA 3U46B 3U9UB 4A2DA 1LGVA 1CI3M 2WBXA 2VDMH 4WSKA 3AUVA 4AQOA 4WDIB 4P2QE 3B9AA 1D7DA 2EDBA 3W9EB 1G1YA 1U58B 1FE8L 1IARB 2WIMA 5DRWB 3IDNB 2F54E 1E4WL 1OT4A 4NYLB 3W2DL 1A4AA 2VW7A 4JGJA 3PP4L 4GRLB 3TV3L 3APNA 1S7TA 4CVUA 3A47A 1XZWA 2W59A 3T77B 5I6XC 4S1RH 4UOQA 4NSKB 4BFIA 3BX7C 5A40E 5IG7A 4OLVH 1T3FB 1ID2A 3KGSA 4YZFE 4M48L 1IAMA 3C5XA 1NL0L 4X6FA 4JUTA 2O6EA 2RBLA 1FL3A 1XCXA 4EBQL 4FKEA 3TZVB 4ICWA 4IU3B 2EUXA 4MBRA 1XX9C 3S48A 5EU3B 2EEAA 2B0SH 2X1XR 4YFEA 3FRPA 4HF5L 3RDTC 1XGQA 4UOZA 1KT2B 3L5XL 5IW6B 2XV6B 4NWUL 3ZHFA 5FYKD 1KNOA 2YN3A 5LN4A 4A37A 3UABA 3A4AA 4K3GA 5EBWA 3W5NA 3QUKA 3QORC 4F2MB 4EQ2A 1DBKL 3EJYC 1KJMB 4HKJA 2FLMA 1I3RB 5AVYB 3UIZA 5JIDA 5C0BE 1ZDSA 2C1OA 4DP2X 1ZANL 3EYQC 2Z35B 5AW2B 3RGVD 3IDGB 3WE6A 1NMCC 2ZOKB 3RNKB 1U93B 3QUZB 2VSCA 1IL1A 1UJTA 4MA8L 4HIXH 3T2LA 4H8WL 3UTSD 4AYID 5E0QA 2R4SH 3OC8A 3VGAB 3JVGA 4LRNH 3U4BH 1OARH 4KOCA 4N9GB 3IFNH 1BM3H 4H8UA 3I6GB 3ZKXB 2F53A 3ZQXA 1HHHB 2DKSA 1AE6L 3OJMB 5AOMA 3NOIA 5I0YA 5FHAH 2H9GA 2OX5B 3QHFH 2EC9T 3NCFB 4OCWL 5CD3B 1S8DB 1L0YA 1RMFL 4GSDL 5KG9A 3QDGD 2ZWZA 3VCLA 4MJ5A 4GAGL 3X3GH 2FO4A 1U9KA 1IKFL 1CFNA 3PQYD 3ZE1E 1LK2B 1BX2A 4D0DB 3UAEA 4JG5A 1DN2A 4XCNB 1A22B 1QUNB 2R2HA 5EOQH 3MGOB 3ZR5A 4FI6A 3ESOA 2BH0A 3QUXD 2Z31C 4JM4L 3U7WH 3QWNA 4Z7OB 2ENJA 2OSYA 2EDYA 1OD9A 2IV8A 2VJ0A 1E2WA 3HHMA 2MRYA 4RNRB 4HWUA 4C83B 5I1JL 2H41A 5HI3D 4OF5A 2ZE0A 3QFJE 1CF1A 3IJEB 3U1SH 5HYSA 1HL8A 1WCBA 1QX1A 3SY6A 2NY3B 3U9PH 1IQWL 4LSVH 1M71B 4JW3A 4QLRA 3CX5K 1VCAA 5GS1A 3BIBX 3H4FA 4OF7A 2PF6A 2ZAGA 3DRQA 4NFDA 3QI9C 2XN9A 1OWRM 3K72B 3O6KH 4LVOC 3I9IA 1KPVB 3RHWF 2H2PD 4I0PD 5I0XA 5FEBA 5I8KH 1QPPA 4FQCH 3U0TA 3N42F 3QIUB 4NNPL 4I0KA 1TFPA 3T0VA 4WV1A 5I1EL 2CMRL 4Q0XH 4Y9FA 3WNIA 5KZCD 3PWUA 4I1RA 8FABA 2QR0A 5J1TC 2YFNA 5GRVK 3RX8A 2MPVA 1YCSA 3B5TA 4WI0A 1WITA 3WKQA 3I3DA 4AEFA 2YS4A 2EO7A 4PGEA 3K2UH 1B2WH 3AQXA 4A7GA 2RA1A 2XRAL 4OI9A 1ONQA 3DX6B 2FBOJ 1EVUA 4JZOB 5C0IB 3VGFA 3O8XB 3QQ4A 3Q0HA 1SXZA 1E5AA 2QQLL 3QAZC 4ZX3A 1YJDL 4OLUL 4Y2OA 5F0PB 1OAQL 3D0VA 2RJMA 2FJHA 4KMTH 5DHVA 1NFDB 5HI4C 1R5VA 5F1IA 7PCYA 2WWNA 4FXKB 5E8OA 3HC0B 5AZ2L 5E94A 4PJHF 1X5YA 4PBWD 3OBAA 3BFQG 2WOYA 2X1OA 5E2JA 2OYKA 4OGYH 3RUGB 4QHNB 4BQBA 4EZKA 2VXVL 1F1DA 3SE8H 4AW7A 1G7PA 3WNKA 1ES0A 4Q9QL 1T1XB 4OF6A 1IBFA 4E9QA 1E7UA 2HKHL 4AG4L 1UB5B 3RL1B 4X6BA 3I6LD 4OTXH 3HCVA 4QHLA 2KUTA 3G5VA 5FKAB 2PKDA 3UO1H 1PAZA 3BGFB 2V2TB 3HB3D 2QPFA 2WXKA 3NFSH 3QXDB 3VXMB 4F37F 3P2TA 1RFDL 3PU7A 5C0NC 3MBWB 2JKSA 3FNKA 4PIBA 5HYJA 4NUPA 1XD1A 3TJEL 3WLBA 3BI9X 1TT6A 5I30L 1NCCL 1JJUA 3VXRB 2O6DA 5KBKA 2NSQA 3WEXA 2HMID 3BGMB 3BUIA 1ET8A 4ZPTA 4CVZB 1YNTF 3GC3A 4MJJA 5HYEA 2WNWA 1DBBH 2K3TA 1JZDC 4IJ3B 3GJFA 1QO3A 3G7TA 5KTEL 2PPAA 1MCSA 4GW5A 4NCDA 5TH2A 2IWGA 3D48R 5AAWA 4L3ED 1OCOB 2NSMA 3JXAA 1S9XB 4GKLA 5FO8B 3CLWA 3BRFA 5EU4A 1KBGH 4M6OL 1ZT7A 5GGSA 2VLRE 3EOAA 1N7MH 4X80L 4M43L 1Q9WB 1T0NA 3CD4A 1TTFA 2FECI 3VXOB 5D9SA 2FJFA 3G6AB 5G55A 5EEVA 5H2BB 3N44F 5EA0L 5G2NA 1LO3L 3W3BA 2ZCZA 3U30C 1QACA 1OY3B 2EE9A 2J2ZB 4Q7DA 1TSHA 4OLYL 5AKSA 4GUPA 4ZFOL 1OM3L 3L45A 3FQNB 2VN7A 2YA2A 3RPKA 1FHNA 1G6RH 4M9PA 4XN9A 3VFRB 2WB1A 4S1DD 4AMKL 3BZFB 5KYWA 3SPVA 8CGTA 1AMYA 4KJQC 1P1VA 3SDDB 4NERA 4UDUB 1YUHA 4MB5A 3DI2B 5DMJB 2QKIB 4AYGA 5BO1L 3SE3C 4L1HA 4XBGA 4MMXC 4GLRH 4F9LA 1XL6A 3WKNA 4X5WA 1SYSA 2LFGA 1NGQL 7TAAA 3HG1E 5LNGA 1XIWB 3ARDB 5MEQA 2QBWA 5KJ7E 2WLKA 4U1JA 4IRJD 2XU9A 2XYCA 5GRVL 1JXDA 4LHJB 4ZW6A 1G7IB 2DJ4A 5CSBA 4ESKA 1T80A 1FNHA 5ECJE 5DD5L 5FV2A 1T21B 2VXQH 4KKLD 5C6WH 1WBYB 3D30A 3J7HA 1E0OB 3RWEA 3FUKA 2K45A 1GS8A 2UV3A 3GXTA 4RCAA 4GW1B 1J1XH 3CNKA 3Q8CA 3PG2A 4PGBB 4R84A 5TF0A 2X5PA 4CMMA 2ITEA 2R4RL 3WENA 1XFPA 1TO4A 5CNHA 4DPCX 2P7TB 3EOTL 5E0FA 1QASA 3H2QA 1DUYA 4DCQB 3IGKA 3WO4B 4XPBL 4ZW7A 5EUOF 1SHXA 4ZFGL 1U33A 3DPBA 4YHKL 1P69B 1W72A 1DP0A 2LV4A 2WCPA 4M6ML 1NCUA 1FLRH 3E0GA 4PGJA 1JF1A 5DRXB 2VW6A 2FH8A 1KENL 3CVHB 1IM9B 3TA3A 3RGVA 5D6DC 5FS5A 3TOPA 3CU7A 3LQAC 1UYWL 5CSZA 5HGAB 2XBZA 3PS6A 3UTSA 5C97A 2APXA 3FBQA 3WL9B 3MTXA 2RH0A 3ZTNL 4WNQA 1X6LA 5EC2B 3SKNB 4ELKB 1KIPB 1PD0A 2E75C 4FL4C 5C07D 2GJ6A 1CTMA 5C09A 2V7NB 3O2DA 4PG9B 3FUDA 4FJ6A 1QEWB 3PWPE 1WUZA 3FONB 2A6DB 4QHKI 1EV2E 2ADIA 2WQAA 2Y4SA 1YEEH 4QTHB 2VDLB 5DZNA 1FAIL 1UWYA 2J44A 2BY2A 2C4FT 2ZXAA 5KS9F 5EO1A 5L4FA 1JN6A 5DJZB 1QBLL 4G5AA 3QDGA 1RJLA 1OSZB 1AVAA 4OGQC 5IW1B 1U8OB 3BAWA 3PQYA 2G9HA 1QLFB 2QL1A 2C9XA 4R2GD 2VXUL 3DVIA 4ZFFB 5K9JL 3DHUA 1I1YB 4ONGL 4LLMB 2XPYA 3QUXA 4L37A 5KSAD 2BNUA 3QFGA 4G9DB 4BUGA 5I1HH 3WTSA 3OX8B 5DJ0A 3RBSA 3GM0A 5I1KL 1JPEA 3T6VA 2BSTB 4Q6YA 1WO2A 1IBGL 4KDVA 1S9YB 5GJTL 5I1AB 4DPAX 2NYKA 3IPFA 3ULSB 2YUZA 1A6TA 1PYWA 4HDIB 4DKAA 4W4NA 2VTFA 4FQJH 3K6SA 1UOLA 4UNIA 4AGLA 4I0PA 4UIMB 3VGBA 1BECA 4L29A 4ANUA 4E36A 1MJJB 1HTYA 3TEXA 1MJUH 3DTDA 4IRSC 2AV7A 1S46A 4HJUA 4EDWL 2EDQA 4HWZB 4N0FB 4HAFA 1ZGLP 1JNNL 2XPGA 5IUSA 4AENB 4LCWE 4G7SB 5HGGS 4QJ4B 4UUJA 2E7LC 2NNAA 4N5UA 1S7SB 3CDFA 3PXHA 1RK7A 4OW6A 4YMPA 4JQIH 1HHIB 3NIGF 4K3JH 4K9EC 5HJ3A 1OTTD 1MUJA 4PCYA 1OD7A 3NJNA 3IGFA 5JXEC 4NBXB 5HD8D 5KUMA 3UPRA 3MLPA 4K94C 4RETB 4BD4A 1DVTA 4OI7A 4U7KA 4HUWB 1A6UL 4S1SL 3VMNA 3ZUNC 1UZ6E 2X4TB 1UA6L 3GIVA 2CCWA 4EI0A 5IMMA 1Q0XL 4AEIL 3W82A 2R2BB 2EH7H 2NY5H 3SY0B 4AZ8A 2YAOA 5EORL 1CDCA 5LAPA 2I9LA 1LEKA 1HJCA 1KJ2B 3NJIA 5ACZB 2BIPA 3VQLA 2VO5A 4POZD 2FQDA 6FABL 3DX0A 4X6DB 3ULUE 3DMMA 3WFHA 1F58L 4PLJD 4KDWA 3LKQB 3ABLB 4LU5L 1NGZB 5ANMB 2XZAH 2EJ1A 3QJHB 4NAQA 4ZXBB 4HV8A 5IQ9A 1TUPA 4XP1L 2XI9A 1R3LB 3IVKB 4YC2C 5CP7B 1CU4L 2QGDA 1URIA 1NC4D 3AXIA 1R5WA 2B15A 1FV1B 3GSWA 4FXTA 3UEQA 4K0OA 3THMH 4J8QA 1Q72L 1D5ZA 2I5YL 3NYKA 3OGCA 3S7GA 1DFBL 2ZSVA 3A0OA 1XR8B 1WF5A 4AMXA 1F41A 4C56D 1T83C 4OFIA 1IO4C 3Q9PA 5CEXB 1CFQB 4E9SA 1OB1A 2I07B 1ZSDB 1ZT1A 4Y16A 2WLNA 4FHKA 4E9LA 1T6VN 3IRCA 1OAYH 4U1KA 4YBHA 5D70H 3RWDB 3CDZB 1SHSA 3H9HB 4C59B 4KTEL 1MI5D 4ISVA 2CKNA 5DMKB 2ZNWA 3FMGL 4XNZC 5EZIH 1NCDH 4XNMB 1P7QB 1PY4A 1TTUA 4NQEE 5JPNB 1W6LA 3MUUA 1VSCA 2H1XA 3T2NH 3ZT6A 4QHMB 3V52H 4DKFL 3OHXB 4DGYL 3NPSC 4FLOA 2W65B 4G6KL 4KHTL 3GYRA 1AJ7L 3LIUA 1HAUA 3MLXL 3GO1H 3KM1A 4LAJH 4FYQA 5F72S 1KCLA 2NPLX 3C6SB 2WZAA 2IGFH 2QPEB 5HY9B 1EZVY 2R9HD 1WJ3A 5JW5A 4J3OC 3L3DB 1KXTA 3EBAA 2KERA 2APWA 1V3LA 3L3OB 4DP8X 4IRJA 4ELDA 5ADOH 3D05A 3HUJE 4ACPA 4DN3L 4OGXH 2G3ZA 4KUZH 2IANB 3HRZB 5FUCE 1AZZC 4L5FE 4O2EA 1O9VA 3RIFK 3LTVA 3GLDA 4UTBH 4U3SA 1T4WA 5J6SA 4GFXA 4ATWA 4UT7H 1ANUA 1E8WA 1REIA 3WG7B 3CZLA 4IBTA 3OWRA 5J6HB 2JCCA 4GQRA 3KPSD 1YMHB 4BHUA 4K23H 4ODXA 3DARA 1QFWL 3AUWB 4JL1A 4B5EA 1CXKA 2HVJB 3R1GH 4FCAA 4G8GD 3RVXD 1UURA 4GG6B 4YR6A 3TURA 3A6CL 1DQDL 2E6PA 4R3SA 1WBXA 2GKIA 1A3LL 2NX5B 3P4OB 3ORJA 4HUNB 3NFNB 2CE6A 1HH9B 3ARFA 1HXYB 1OPGH 3HLAB 5HHXH 4BQ6A 4PRPD 1KTDA 1QEXA 3CFNA 4JPVL 1EFXD 5DDHA 5EZOL 1JNLH 1BM7A 4GKNA 4NQSB 4UINH 5JPMB 2Z92A 4QR7A 2CA3A 3DX7B 2FJSA 4JO4L 4ANVA 5IQ7L 2A1WH 5C07A 1PEZA 2AXGA 3W5MA 4P46D 4XVOA 3ARGC 2FUTA 3BP4B 3RVTD 1L5GB 4LLYB 1IGIL 3V5HA 1KZQA 5CSGA 3WY2A 5EN2B 1CD8A 1TYEB 2R29L 2D3JA 2NZIA 1HKLL 3U4AA 4U2YA 1BIHA 5JORA 1BVKA 4DVBA 4KZ0A 4HH9A 3SN6N 3QDMB 4KXCA 1A7NL 1N0LA 2B3RA 3NIDB 2XZQL 3RVUC 3PIQA 4HK3J 5IROD 1CBVH 4K7FB 4GIOA 1NCTA 3LV3A 3P0VH 4RFNB 3N55A 1OP5H 4HXAL 3X1FA 5JMRA 4OKDA 2MNJB 2V7HA 1KLGB 1EGJL 4B0MB 2IBBA 5KSAA 1BGXL 3GWJA 4Y4HB 1F11A 3ESPA 2JQMA 4EN3D 5H37A 1ZWIB 3MN8A 4M3JA 5IVXE 1A14H 1HILA 1KLUB 4MQXC 2ICEA 5HHNB 1U8LA 3H1ZA 4JFYB 4GXVH 3N85L 4ZI8A 2BSED 4R97B 1DJIA 1G7MA 1N68A 2J20A 1KXQA 5EF0A 3VD3A 2DWSA 3MUHL 3DTXB 2WUBH 3KXFD 2R2EA 6PAZA 5TQ2L 2V5SA 2X89A 2EAEA 3MRHA 3Q9QA 2QSTA 4XBPA 3IETB 3A5VA 3VGHA 1QR1B 2YD2A 4N1CA 1GXEA 2BVPA 4YIQA 4I48A 3V7MA 4GSQA 5MERB 1JUFB 1AQHA 1Z9PA 1NEZA 3GMPB 1WT5C 4UDTA 5LAXB 4HZLA 3R8QA 1NWOA 4FTDA 4QO1B 1EVTC 2VIRB 3UYRL 4NC2B 3FOLB 1CUOA 1RAMA 4DEPC 3MLSL 3CJJA 2BFVL 3C6LC 4L1DA 1YA5A 3L7EA 1TTBA 2VR4A 3BUTA 2FE0A 4WK0B 2IADB 4F7PA 1G6VK 2B2XL 1KGUA 4FLRA 2K1MA 4V1DD 5D93C 1JK8B 2WB7A 3HS9A 3NA9L 1FBIH 1UWXH 4L2YA 4F57H 2NY0C 4LB8A 3Q8FA 1JWUA 5IQLA 5B21A 4OLEA 2P44B 2JLPA 1KB9K 1LYQA 2XTJB 4LSQL 2YC1B 3CUPA 4UQ9A 2RAMA 5I2IA 2XWRA 2OYLA 1JSYA 3KPOB 3VFNB 4OCLC 1DJGA 5BOPA 4AQ1B 4WUKH 3MDJA 4J3UA 1DBAL 2VXTL 5B7MA 1DVYA 3DX9A 1YEDA 4P3CH 3HAEG 1QHPA 5DK0A 1I9JH 3TBYB 5EEYA 5C0FB 2BRQA 3GUTB 3WDHA 1F97A 1XO8A 1GIGL 4DWHA 4ENED 2KPNA 4NRZA 3F7QA 4NQXB 5A7BA 5C6TL 5I76A 1A6VL 2X1PA 3BRGC 2CUAA 1KIQA 4XWOC 5JQ6L 4JR9L 1AZVA 1ADQH 1FZJB 3ZY7A 1T04B 2Q7AA 3IU4L 4JFZL 1NC4A 4R5TA 4WW2B 4X7TB 1TJIH 4XCEB 1RIUH 4I77L 3RFZC 1PZUB 2FHFA 3BQUA 2XQYG 3NDZE 3FQXA 2J6EL 2Q87A 5CJXC 4AL8C 5JOFB 25C8L 5I15L 3MRLB 4KNQA 1YECL 4U49A 5AW5B 3RJDA 1A65A 3RTQC 5JYLA 3FN0L 4V33A 4L4VD 4MJIE 4C56A 1KB5B 1ODAA 4ONOA 4OIFA 4R0LC 4Y4KA 1PQZA 4I18A 3VXTA 2DQ6A 2V2XA 3G6JA 3LSOA 4I2XE 2O30A 3S4SA 5B8CA 3HVNA 2BIIA 3LRKA 3GI8H 3SO3C 1S78C 1BQLL 1NDGB 4BELD 5FLVA 1H5BC 4MB1A 1MI5A 3DDGA 4BINA 4OI8A 3ATFA 3F5WA 3LHAA 5IMOA 1OF2A 2G5UA 2IG2H 1EJOH 4EIBA 4A1RA 2GK0B 1HWGB 2DY2A 1EDQA 3ERXA 1J7VR 3CDYA 3J2PA 4HIEA 2YGOA 4FMVA 4J3XA 1BFTA 4U6YA 1NCHA 2BNQD 3SBWC 4JDTH 4XPFH 2XKNB 2AGJH 2DS4A 2B14A 2C3WA 2QVKA 4HJEA 1RUAL 3TO2A 3U0WL 4O4YH 1RK0A 4PJHA 4JJHA 5IB2A 4UQEA 3CZEA 1JPFA 4TUKH 4X9HA 4NDMB 3DIDA 3ILPA 3V4PH 1JV2B 1N2RB 2OMUB 4ETQA 5DYOA 2GCYB 4LSTH 2PP9A 2Y1AA 1KCSH 1F42A 5AB1A 2BP5M 2R1YB 1D7CA 3FO1A 1HOCB 5KJRH 2L7QA 3UAJC 1KJVA 3KL5A 1VFMA 3G3LA 4X4XB 3N41F 4FG0A 3TBSA 1R19A 2MPAH 3GBNH 3FFCE 2AJZB 5AYUL 1N6VA 1A0QL 3CX2A 3FW6A 3KPSA 3MOBH 5CGMA 3BZEA 2YPVH 1N70A 3MRGA 3O6LH 1D6VH 3ARBC 5FA4B 3WHE0 3ECBB 4XMXA 4PJ9B 1DQML 2DQEH 2QELA 5DJ2B 1RZGB 4FF9A 1YNTA 4GO9A 4G8GA 4OT1H 3D85A 4OIAA 4W81A 3FCSA 3VWJB 1GZQB 4FYRA 3RIAK 1JYWA 1ACXA 2A9BA 1O5PA 3AW5A 1CICC 3CLEH 1R5IB 4EAEA 3BDYH 3N1MC 3MCYA 3WJMB 3QGVA 4PS7A 2ESVA 3FUJA 2DI8A 3LQAH 3ZE0E 4PI2A 3VXSE 1R46A 5ANHA 1EFXA 1I1FA 5DU7A 4Y5YA 1ZGLM 3JWOL 2DN7A 1T6WA 5FKPB 5H4ZA 2VE6B 2V9TA 3GDBA 4GQQA 4M1DH 4OV6F 4B97A 1F4WH 3AWEA 3JQOB 4GKSA 1RZ7L 4MNGE 4P46A 1SOSA 4IHBA 3A4EA 4BFRA 1CL7I 1S5HB 1O6VA 2YMOA 3KPMB 3OR7A 4HHAB 1TQVA 4N2NA 1DQLL 4UANA 1U3HB 1IKOP 5FF6B 1FVCB 4KQ3H 5F71A 3L4VA 5DEGB 3EH4B 2F61A 1EUTA 2MWCA 3PAUA 5K5YA 4Q9RL 2X42A 3GMOB 4DEUA 4GAYB 3OAYK 5DS8B 4D9RE 3LZPA 2CO7A 4NZRH 4X0NA 4A2LA 1LM8V 3MJ8B 1CFMA 3IFLL 1XTMA 2X4OB 1MY5A 1KJ3L 2WINB 3TX4A 5FPIA 2H3KA 1UACH 5GSRB 1S6NA 1B0RA 3HPLA 5SWQB 2O6FA 1MF2L 2FEEI 1CLZH 2WXRA 4U1SB 4WWKB 2XQYA 1SMOA 1D6EA 3RNQB 2BSEA 3PWLB 4BFKA 3O11B 5HHPB 4Y1AA 5TQ0H 5IFJA 1PDKA 2E0PA 4MLSA 4XE5B 1E5BA 4KAQH 1YEFH 4C58B 5F0MB 4YPGA 3ARXA 4JL2A 2IGTA 1EDHA 3UL4A 2DTMH 1NBZA 3V4UL 4UZUA 1NGXA 2FBRA 4MYWB 5EUOA 2FT6A 4GB9A 5IB1A 1TMQA 4XP4H 1JPGA 2FX8H 4H5SB 5J5EA 4QUOA 4XVSL 5JIHA 1AACA 1MFNA 4Y5XB 2CBPA 3NUKA 3REWB 2ENQA 4JBSA 4FXLA 1N5AB 3CC5B 1Z9NA 4WLCA 4U1IB 2A0LC 3ISRA 1PKQB 4OZIE 1A4JB 1FFOA 2Y36H 5CILH 4V1DA 4NNYB 3D7PA 5FYLH 5AOKA 3SDAD 3QEQD 3B8SA 5IFHH 3S5LG 2F5BL 4HMCA 2BHYA 4PJCB 5TE7H 2ZKHL 3DBXB 2DYPA 3DA0A 1NFIA 5JHDE 3ZDZB 5IBLD 4WCYH 4QF1A 1DQIA 5LBGA 1NGWA 4JQVC 3TCLB 5ICYB 5FGCB 1VLXA 3LPFA 4JPWL 3ZXAC 4YO0A 5KS9A 2J4WH 3MRFA 5CJ8A 3JUYA 3S3BB 1IJ9A 5K9QG 2VR9A 4LPCA 3IDIA 5J9PB 1I8IA 4UM9A 3LMJH 3GTTA 4RVBA 5EULV 2Y07L 5I8EA 2IJ0C 2FL5B 3N1QC 1Y1DA 4U7MA 2PR9A 5JZ7D 3DGDA 3MZGB 1ZTXL 1IVLA 4XN7A 2GTWB 5AWNH 5EU6D 1TOXA 4ZW8A 4XCYB 5IMKA 3TNMA 3MO1B 2UY7B 4CVWA 1O6SB 2W81C 3E6HA 43C9A 1YPZF 4YGVB 1XZ0A 1Z7JA 2VKWA 1XGRA 3O2WH 3PL6D 4GBXA 4HGWA 1UTDA 3JWNE 4RAUB 5DJ6A 5AENA 1F3DH 2Y7SA 3MREB 2IMNA 2EDLA 3VI4F 3F12B 3EGXA 4PG2A 4RSVA 4GPVA 1NMBH 4RDQF 4W6XB 1G6RA 4R4FH 1YSOA 1RZPA 4P59H 5DEFB 2QSVA 3VFVB 4H2AA 4APQA 2R0LL 1BLNA 4AIOA 4B60A 3II2A 3MFFB 4HAKA 1F2XK 2Y5TA 1SVCP 1CXEA 4DP1X 4N8VG 2B5IB 1X9QA 3ABKB 3AU1B 2YUXA 4YHML 1FWXA 1HSBB 3OKLA 4NM8H 4O2CB 1N64L 3ZE2B 3ULUC 3VI3B 3TWCL 5E56A 1QFWM 3MLYL 3MFGB 5EBGA 3H3PL 2Q6WA 1YEWA 4HPYH 1OW0C 4PRDB 5L4IA 1D5BB 3RWCA 2VZUA 4Z5RA 1RUPH 2X4RA 2BNQA 4TF4A 2NYZA 1N59A 4FX5A 4F5CA 1TQBB 5E9DB 4HLZH 2X2JA 3BP6B 3RDTD 3ZTJH 3EDJA 5E5MB 2WGNB 1XSKA 1HHGB 3IJYA 3NMEA 5DF0A 3B4NA 2NY6B 5T33H 5D71L 4LPTA 1N10A 4FD0A 5K39A 5CZVL 3QORD 5AL8A 2EE0A 4JHAL 5EWIH 4GW4A 3GSNH 1M05B 4MNQA 5IHUH 4Z1PA 2GJPA 4MKMA 2LLNA 4PJ5D 3EYQD 3WXWH 3FH7A 3F7VA 4JFWA 3A4DA 3QFDA 2FO8A 3EH2A 1AKJB 1XF4B 3DJRA 5CMAB 1J5DA 1M6UA 1PG7L 2C7UA 1EHKB 2FO1A 4XCCH 1I7TB 3MRMA 3FKUS 4L8BB 5D4JA 1MH5A 1GOFA 1NGPH 5C08E 6PCYA 1ADWA 4ICXA 2XTSA 4OIIH 5CGTA 2GY5A 4N20A 5IJVB 2AKRA 3TEUA 1MHCB 1RU9H 2B59A 3B3IA 1V3KA 4N3TA 4UQ3B 1UWGL 4P07A 1HSAB 3R0MA 1VF5C 2H8PA 3QH3B 3SDXB 2VERA 3CSBA 4UBDD 3VMOA 1BP3B 1AIZA 1UXWB 3D39D 3TT1H 5IVNA 4YXKH 1FPTH 3BXNA 3UGUA 2GJZB 1T7XA 1YEHH 9CGTA 3TF7C 2OKMA 4LSSL 3MRJA 2W9EH 3DPDA 1NIBA 1VKXB 1UZ8B 4K3EL 4LQFL 2GSMB 5CIPB 1MCOL 4KOBA 3RWJA 1CD9B 1U8PB 1T7WA 1YEGH 3LVTA 5FUCC 3BZ4B 1J1OH 4Z7NF 1DVFC 1HE8A 2IBZY 4HIJB 1FNFA 3EFDH 4XZUB 5D7SH 2Z31D 4X6CB 2E7DA 1ZCRA 1ZTMA 2R2CA 3HE6B 3EGDB 4RLDA 5EUKA 4BWUA 1JTPA 3LEXB 1UXSA 2XDHA 2VDOH 4PJBF 3W0WE 1BFSA 5HVHB 3UZQA 5BW7A 3QDHA 4G1MB 1UCBL 5FECA 4ZRGA 3VX0A 2BXZA 3FZUC 4BM7A 1JGVH 2VDQH 1WZLA 2NY1C 4K5OA 2B3IA 3WSQH 4QRRE 3EOBB 1T7YA 5TDOA 4PGDB 1VCBC 4X5PA 3SE9L 3DX8B 1Q1PA 4M8UA 3EBIA 4NUMA 3MLTA 5I23A 2YLHA 4LQ1A 2TAAA 3W2DH 1WS8A 1XD0A 3REVB 2ZIDA 3TV3H 5KVMC 3WMPA 1OHQA 1I8LC 2DTSA 4J28A 5FO9A 3K71B 3O6FC 1WDAA 2ENYA 2Q3XA 1M9SA 3O6MH 1NKRA 3WTUA 4Q9CA 2DD8L 1EBAA 3NCJH 3EF7A 2LR4A 5BZZA 4JY5H 3B2VL 4JQIA 5HI5C 2VWEC 4G7RB 2JB6A 4PV8A 1NL0H 2BW5A 3FSAA 4EBQH 5C6PB 1TKWB 4OFDA 4Z7QE 4F27A 1C5CL 4PRIE 4CMHC 4BSWB 4QOKD 5HI4D 3BO8B 5DC9B 4LPUA 2RMNA 3ZDWA 2EDFA 2WMPB 2AMUA 3V0JA 2AJVH 4N8VA 1MIEL 3QQDA 3UC2A 1A7RL 3WGUB 1LE5B 4HETA 1XH3B 3CDGA 1QW8A 3CFBB 2OR9H 4NHUA 5IVZA 3I3EA 3NZSA 3D2UB 1GVIA 3EJZC 4NWUH 1GZHC 1ZXQA 3DJZA 2JJSA 2WP3T 4H0GA 4YSPA 2O4EA 3NSCA 3OWEA 1EEZB 1DO6A 3VH8A 2AJUL 3VDAA 5I8CA 5E8NA 3KVQA 3VFMA 1BA9A 2WOBA 1ZANH 4OF0A 3VFUA 3BVVA 4JZNA 5AW4B 1E9OA 4GMTL 4JJ5A 5C0ND 2KLSA 1OCZB 1XGTB 3MLWL 4NO5A 1UFGA 2WYIA 4WI8A 2F74A 5BVPL 1U36A 1RZFL 2HX7A 4HH8A 3SDAA 3QEQA 2DQHH 5BZDB 4FFZL 3B6SA 1VIWA 3G5XA 5EEXA 3MRIB 3FBKA 1ZEAH 3U6RA 2BP0B 1MFEL 4ZMXA 4JFDA 1MN4A 2Y2WA 4HUUA 2KLRA 1TZIB 4RQQA 1QLEL 2AQNA 4IBVA 2E86A 2OMYA 5B22A 3WOVA 2YPLD 1UA3A 4U33A 3OAUL 3QPXL 4GOSA 1JYXA 3M1BA 5C0GB 2XVGA 1MFCH 1DBML 1G1OA 3P69A 4GSDH 3VTMA 5J1AB 3CZNA 4YZFF 5C3IA 3EYOB 5EU6A 3OF6A 5AAMA 4F7CA 1OPOA 1AS6A 4WEMB 1TZGL 5K9OA 5IFAL 1OM9A 3AS3A 3PL6A 2HN7A 3ZR6A 2OM5A 1DTUA 1P4BL 4JM4H 4UB0H 3CVIL 3GBLA 1DJWA 4PY8J 4EI6B 5B38G 1OP3K 3TNNA 2XQ0A 5CFHA 3KYNA 3IJSA 2YPKA 4WFHD 3TCXA 4AL8H 2I9TA 4F7EB 2EDJA 2WXJA 4JCLA 2P5WE 4PSPA 3CFKA 3I6KA 3EYSL 4JG1H 4KJQD 2CM6A 2H0FA 5ERWB 4IIQB 3FRPB 2OMBA 4FTVB 1LXMA 3BH4A 5D1QB 4XI5D 3WTWA 4LOFA 3TH2T 1WUNT 3O9WC 4BK5C 1DSFH 5TGBB 3QUKB 4RGMB 3GMLB 4Z7VE 3HE7C 5D5ME 3QIBC 4UM8A 2VRQA 1GOGA 1CD1B 4LESA 3RY5A 2EADA 3HZVA 2C1OB 3D52A 2R0WL 5EOTA 5C0CB 2CMRH 5D1XA 2E9BA 4JY6A 4HUVA 2VMJA 3QORB 3CPUA 5FM4A 4BZ2L 1YMMD 2W95A 5AFAA 4G71B 5D7KE 2LU4A 5HHMD 4UTBA 1IL1B 4F91B 3IMRA 3ME0B 3FULA 1GPOH 1UH4A 2RB8A 4TNVK 4I9WE 1BZ9B 1IIKA 3QWOA 2QZ5A 3STZB 2F53B 1CXIA 4R7DB 2VMDA 1JFQH 1YJDH 3RQ3A 1EZLA 2I32A 1MSPA 1ETJA 4JREB 3IXAA 1HIMH 2WJ7A 3GMNA 4F2EA 4KVNH 1GGCH 5LJYH 2IH3A 3TEZA 3MBEC 4KNTA 1MIML 2OMWA 3PF2A 4G8FA 2Z93A 4PJ5A 2VXVH 4MJ5B 3NP4A 3T0WA 1IVTA 2FO4B 1IU1A 2MSPA 4OD3L 4ELME 3SKOA 4QRPB 5IWLA 3GHEL 1BX2B 2YLKA 3IS1X 4PJEB 2VXSH 5IQNA 5T3ZE 3KGTA 5TPWL 3V6OC 2ZWLT 3L1EA 2PXYC 2NT0A 1IE4A 4Y9GA 1D9KC 3UTOA 4N90D 3KH3A 5JXAL 3BPOC 3S0PA 2Y72A 4FZEL 2A6IB 1JZIA 4J3TA 4PJ7F 4ZX4A 3E80A 1P4LB 3HNTH 4YDVB 5I30H 4M5ZL 1MCNA 3BT2H 3D0LA 3L1GA 5FWQA 2E4FA 3B7YA 3NAAH 4WENB 3TTSA 4ZG1A 4MD4B 5C9JA 3D39A 2A77H 3ML9A 4WFGE 4DETA 1ZAGA 2FX9L 4HAGA 3RP1A 1KB3A 1NLDL 3V8OA 5JNYA 4XBEL 2ATKB 2DV6A 3U0TB 2IIJA 1IX2A 1QQDB 5KTEH 3LNIA 4JHWL 4QXTA 3U4KA 2BIHA 4X4ME 4IBUA 3QI9B 4WV1B 4Y19E 5ITBH 3GSXB 4X8CA 1S4IA 3PWUB 4AGNA 2QR0B 3LS5H 4OJAA 2Z31A 3H9SD 3V9FA 4P9MH 4LHUB 4DP7X 4M43H 1KTLA 2LGNA 1J12A 2VLME 2VN4A 3FCTA 1E5UI 2JVUA 1UA7A 2DMKA 4NZDA 4PJDF 1KEGL 3O3DB 1DL7H 1TEYA 3GJFK 3QQ4B 3ULVE 4MQ7B 4L3AA 4P5KB 1JHLL 3H6AA 4JVUA 1NOLA 4Y2OB 2W91A 2MOQA 4W6YB 2FJHB 4HFUL 4QXWA 3UADA 1R5VB 5F1IB 1NKGA 4OJDH 4ZTEA 5E8OB 4DHLA 2WNKA 4JHBA 5E8DL 1KN4L 2WKLA 4IRSD 3DETC 4IK6A 4FLSA 1ZVSA 3KJ6H 3QO1A 4FZ8H 2WVUA 5IV2A 4MCYA 4XNUL 4P2RB 1ES0B 4X4YA 2HP4A 5DA4A 3K6NA 1TNNA 1TVDA 4X6BB 1WIPA 4Y1SA 4N25A 3VFSA 4FQ1L 5B38A 1SQ2N 1RIHH 1EAPB 1AD0A 2XACC 4OZGB 4FQXA 1V7NH 1QHOA 5JXED 3W1ZA 1LVEA 1S9VA 4N0CC 4MMYA 5DD5H 5LWYL 1MJ7H 3Q8EA 1EHNA 5FYLD 2DKUA 1NBVL 5HYJB 4H40A 4KMLB 4RMUA 5LKNA 1NLBH 4QOKA 1FSKB 4F2ME 3L3KA 2QHRL 2IXQA 1IB5A 3N04A 1LO0H 4XC3L 4G8EB 3S36L 4YSQA 4HOWA 3D3VB 3CPLA 4KVCH 5TDNA 1AD9B 3P0YL 12E8H 2WXGA 2R4RH 5SWZD 1QWHA 1OT1A 5GGVL 2EVGA 4EOWH 2DBLL 3D8MA 4GRMA 4LKXA 3EOTH 5TH2B 4JGNA 4B9KC 4X9BA 1RJCA 2HX9A 3AM8A 5DJ8B 4AQEA 1NCWL 4PY7A 1OOAA 4XXCC 1DQTA 4JFED 4AQZA 5EU4B 1BD2D 5TE6H 1ZT7B 5GGSB 3QO0B 3GK8L 4EI5C 1T0NB 3TH3T 4N1EA 4XNXH 4PBXA 4PP1C 1EX0A 2X70A 1G7LA 5DR5H 4GUCA 5FFGA 2FYVA 3NH7L 1X5FA 1ADQA 4GUPB 4PCSA 4LEEA 3LZRA 4PJGB 3B9KC 5KYYB 1F4HA 3APMA 3BEWB 3KYMA 3JZ7A 4YLQT 3U30B 3NSJA 2F68X 2CO1A 3RPIB 2EXYC 2YPLA 3KEDA 1ZV5A 3MUJA 3X3FH 2NTSP 1FAIH 4E5XG 1YUHB 1UQSA 4HUCA 2BC4A 4BKLA 3SPHA 4D9QE 4XBGB 4WW1B 2VDNB 1AIFA 1HS6A 3C2AH 4Z7OE 1ZE3C 2ORBH 3RA7H 4U6XA 1BVOA 2J8UB 3T3PB 3BC9A 1OGAB 2WQVA 3PY9A 4XN1A 5CEYB 3L9RA 2OYMA 2N1TE 5DWUH 2WUCH 2CJ3A 4ILDA 1AG6A 5BNXD 1VZGA 2BVQB 2D73A 2VZVA 5K9JH 3W56A 2WVVA 1K8IB 4K7PL 4HFWA 2EXTA 2G5RA 2EDHA 4G6FB 2O61A 3LEYH 2AEPH 3ZPDA 2E46A 3LN5A 5BUGA 3DVGB 1IBGH 5AW0B 5HHMB 4ODVL 4QYAA 1M2VA 2VC2L 5E6IB 1HI6A 4R83A 4GS7B 3SE3A 1PX4A 1GJIA 2AQ2A 2DWXA 3MUY1 5IT2H 3HZYB 1OCWL 3HC4L 3V4PA 3KJ4C 4J3OD 3VE0B 5D1ZC 5DTFA 2OK0H 1S2EA 4PTUB 1W72B 4ZO9A 2NCMA 2A74A 1USZA 3K8MA 4I3RH 1C12B 5B1JA 4Q74A 1HL5A 3TA3B 4R7XA 4URKA 5GGRB 2CGZA 3D09A 2V5RA 3VSQA 1ERNA 4W9DC 1JNNH 4RFEA 2BOCB 3IDXL 1YMMA 5FHBH 5AYTA 2ZX6A 4E9XA 3JWNC 4XC1H 4CU7A 1GHFH 2A9NH 1NFDE 5LGYA 3WY4A 5D2LB 3F83A 1A4KA 2GI7A 3FUHA 4YSOA 3APCA 1OL0A 1W2KT 3VU2A 1UGNA 4P2QD 1C08B 3BW9A 4PRNA 5AVUB 2YPVA 3Q1SH 1ZHNA 2F7PA 3RUGE 5EEWA 2GJ6B 5C09B 4HU2A 1A2YA 1GAFL 3L3IB 3T6WA 1JWMB 2F54D 4PRBA 5F44A 4DOHB 2H3NA 5I66A 3DOIA 5D7IB 4FL4B 3HBZA 2A6KA 5L88H 4N87A 2PETA 3TBWA 5EO1B 4OD1L 4WNJA 1MW2A 3VXME 5B3JF 4KRPB 3ARWA 5CD5C 3N9GH 4AEIH 4BFFA 3GZPA 5D6DA 4OIBA 4G43B 5EORH 5I1IH 2CLRB 1FQ9C 1S7XB 4G1EA 5CN3A 2G9HB 1DLHB 3VXRE 2VQUA 1FFNB 4JO5A 1A6WL 3QRFM 4L37B 4LCCC 2BNUB 5I19H 2EUVA 3WKML 2KH2B 1F58H 3ARUA 3X14B 3QUMH 1LO5A 1YN7A 5FAAA 5FYKL 3ARGD 3WJLC 4N0UA 1AQDA 5BS0B 4U1GB 4ZOAA 4WTZG 3RB5A 1CU4H 4H25A 4QJ3B 3EYUH 3K4AA 1IQDB 3MJ9H 5DHEA 1J0JA 3NRFA 3IDJA 3PHOB 1HQRA 4NQDB 1C7SA 1ZA3A 5FOBA 3RVUD 5C0BD 3K80A 4UV4L 3M17A 4HLZG 2DBJA 4PJFB 1CDUA 3ZTJG 2AV7B 2R56H 5KVDE 1SDDB 1OGPA 2OMVA 3BZ5A 3B9DA 4L5FH 4M03A 5LGJB 1F6LL 3X12B 1ZIBA 2JE8A 4NZJA 5DI8A 3MODL 4N6QA 1A3RL 4J3OG 4KFMA 5T8IA 5IHLB 4OLWL 4HS3A 3ULSA 1CXFA 1MHHB 3EW3B 1CQKA 4GT7A 4OFYA 4U0RC 1N12A 3O2DL 5DQDL 3JBG7 5I75B 3BUDA 2AK1H 4HKZB 4MQXD 2MEJB 4XCFL 3F8UB 3P11L 2GTZA 5DC2A 3FMGH 1XR9B 4YJZL 2OTWB 4TMPA 5D7JD 1JYVA 5I71C 1MCEA 3S3CB 1IBBA 2DLFL 2FQGA 2COQA 3MRRB 4WGVB 4E5XA 2ZYRA 1UUNA 3IJHB 1P5VB 1IFGA 2YQBA 4CC1A 4DKFH 4H2CA 4M7ZC 3KPLA 3MRCA 4H0IA 2DB8A 3FF7A 5CUSL 5GRUL 1KTKE 2OJZL 3H42L 1E42A 3LKPA 2C9QA 3OXRB 3TP4A 4AZ8B 2CK0L 5MEPB 4H1LB 3GMRA 2E3VA 3IB4A 2DQDH 2I9LB 2IFFL 2QDVA 1IAOA 3DUHA 4N85A 2E7BA 4O9HH 1JCVA 5SWZB 3C6LD 5E4AA 3N1GC 5E1AB 3L5HA 1A1OB 2CR0A 4DN3H 1NANI 1TCRA 3DMMB 1J5OL 3GSVA 4JVPA 5BV7B 4XMLH 1SOXA 2I25N 5JXEA 3QFJD 1HNYA 1I7UA 4XPAH 2EYRA 4G3YH 4HS6A 3SDCB 4OZ4A 2NY0D 1AXTL 2ATAA 5CJOL 3VFTA 4X5LA 2CXGA 4JN2A 1E27A 1FH5H 1M1XB 2BY3A 2PMZA 4M7JL 3BVNB 1H0DA 1OOWA 4TVPE 3CFDA 4XN8A 1F0LA 2ICWI 5EB9A 1XV8A 5F9WC 3CU1A 2DM4A 2ZYHA 3VM5A 2XICA 3A6CH 4AYEC 1KCWA 4ODSH 2NY2C 1A3LH 2CHNA 3CK0H 1GKOA 1DANT 1OB1B 4A7TA 4Y16B 3VRIA 1BD2A 1XB8A 5CR1A 3P4LA 5E00A 4QGYA 4LGPB 2EYSA 4ISVB 4CNIA 1RY7B 1CLYH 3CXDH 5LHDA 4XWOD 3IK2A 3ML8A 3C5SB 4LNRA 2EYTA 1ZLSL 3L3HB 4KI5F 1WZ1L 1S3KL 2XQBL 4PJBA 5A3IC 1JZ7A 4JO4H 3BKJH 3VFWA 2H6PB 1UXLA 1KCRL 3VG9C 1FI8C 2YD5A 4P0DA 3B2DC 3BVXA 5F7WC 3V6BR 3L13A 1EO5A 1GR7A 5KBPA 3RTQD 2D2CC 2OL3H 3GHPA 2YJLA 1VFOA 1T83A 2J88L 4ZDHB 1HKLH 3WNLA 1I85C 3CN3A 2F7QA 3OTTA 1JGLL 3BKML 3UC0L 2EO9A 3DROB 2DQTL 1TQCC 4I5BA 1ROWA 5JW4M 3PUUA 1KXTB 1VZIA 1D5XA 2Q1EA 2ZJSH 2XZQH 1S78D 1WA0X 2KDYA 3ZO9A 4GI6A 4N8UA 2XBDA 3P9MA 2UZIL 4O2EB 5H94B 3UBXA 4JRLA 5F96L 3CN4A 1J48A 1FZKA 1EGJH 4WTZA 1SJVA 1FZOA 1LK3L 1BGXH 3T4AC 4U3SB 5I18H 5MENA 1DN0A 5TDPB 5IF0B 3JTTA 2ZICA 4PB0H 3WUWA 1WBZA 2JCCB 5JTWA 3KZ8A 5HP5A 1PZDA 4UWQB 4MAUH 5J3HC 4AEHL 4ODXB 2H3XC 3BH8B 4AMWA 1A8ZA 4WJ5A 3DXAB 4YR6B 2XN1A 4AQAA 1AHMA 3EXLA 1CYGA 3GSNA 1AZBA 4I88A 5T1KD 2VLRD 3ETBJ 3CBKB 5AVQB 4ABQA 1WE5A 3ARFB 5EO0B 4ATTA 1A9EA 3CIAA 3UAJD 1AGDA 1VGKA 5D7LB 4UZGA 5EC1A 4QT5A 2Y25A 5FWRA 5DDHB 4P48A 1UG9A 3WEMA 4JLRB 1C9SA 4JM2B 2WSKA 2GC4C 4L9DA 3LKRA 3K81A 5HDBB 1RZKC 4BA0A 3RRQA 1A47A 4CVXA 5CFAA 2EKJA 3GT6A 2DLHA 4BZYA 3ARBD 4LIQL 3H55A 4PWKA 4PJIF 1G9NL 2C8NA 3D25A 4LGRB 4ZYKB 2F54A 4X8JA 4QRQA 2QV2A 2OTUA 4HHGA 4OY9A 3MA9L 3HG1D 3HMWH 3LKOA 4X6DE 3BWUF 2AVGA 4DVBB 4EZJA 5L4MA 2QQKL 3QXWA 4QMEA 1CICD 1HZKA 4FHJA 2ILLA 3FTGB 3ARSA 4IBLT 5ANME 1BAFL 1NOFA 2CDFA 5DD0L 3UYPA 2I7OA 1NM9A 1KEMH 2V7HB 1LDPL 2K6WA 1C5DB 3W57A 2MCPH 2R51A 3R06A 5JLZA 1F11B 3P54A 1KYOK 1WFTA 1L9RA 3GZQA 3V95A 1Z0NA 1HILB 3L9YA 3FDWA 3IMVA 3EO1B 4ZZKA 1OE1A 4ZUTA 3ARGA 3IDMB 1SVZA 1ZJAA 1EZSA 2D7OA 4LCUA 2J56A 1IBYA 1RZ8A 3CSYA 5HTSA 2VDKL 3IU4H 1YEKL 4G7YL 1TETL 5DUML 1YYML 4TQ8A 3KMDA 3MRHB 1Y6KR 4AUUA 2J6EH 3KHQA 3ZUCA 1I4FA 1T1WA 3T65A 1WPCA 4OJFL 2AQSA 4U6VH 2BVPB 3IPBA 2ZF8A 4I48B 4PGCB 3A23A 5A2JH 1ET7A 2IH9A 3BWAB 3RWHA 5E2TL 2Q7YB 1NEZB 2IQ9H 1TLKA 4UDTB 4MA1B 4KUCF 4EO5A 1JVKA 1FZMA 4HZLB 4HCGA 2Q10A 3GPEA 4Z3GA 1BQLH 4KV5E 1RD6A 3EGSA 1EUUA 4E9TA 3EJPA 5GJSL 3T2OA 1IEAB 1U8CB 3ZVVA 1J9TA 1JWSA 2MHAB 3HBPA 4F7PB 5D7JA 3PWPD 2JI3A 2F19L 4KNUA 4N5ED 4H26A 4TUOA 2ZXBA 1NCAL 4UIKL 1SOKA 3BSHA 2WWMC 1RLBA 3T0EC 2DMHA 4YDMA 1RUAH 4Y9EA 1J0IA 1QRKA 2IANE 3BSGA 4OJYA 4RMRA 4JPKL 1WAAE 5I6NA 1FJ1A 1AY1H 1T5WB 1Y0LB 3EIFA 1B4LA 2Q0ZX 3GF8A 3RWIB 4KXZI 3FPXA 3CZGA 2QSCH 1JGDB 5CHNA 5DK0B 1VACA 2FIKA 1GYCA 3C6LA 5DD3H 3HKFA 4KO7A 4BCYA 4R4BA 1CZ8H 3QDAA 2ZPKL 4RMWA 2CSPA 4TQEL 3T0XA 1JPST 5ABDE 3L4YA 2BS9A 3QFJA 4AITA 4NRZB 4UNTA 3RIFF 2FYYB 4GG6E 3WEOA 5L9DL 5CP3H 4BQCA 5KSUA 5JOPE 3ULVC 4BH7B 5FYJE 4PJ7A 5DMIH 1T0MA 2NX5E 2R0KL 4IK7A 1A0QH 2J5LB 3WN5A 2BSBA 2YD7A 3K0WA 3U2SB 4M1CD 4MSWB 3BQUB 5E2UL 1DQMH 3FQXB 4KK8C 1HDMA 1ZT4A 4PJAF 1KACB 4RMVA 2QFRA 4WEBL 1E4XI 5FDWA 5F1SA 1PSKL 3C60A 3N42B 5L0QB 1EO8L 3TZVC 2CKBH 4Y4KB 1OQOA 4K71B 4JN1L 4LCWD 5BUPA 3BT0A 3IN0A 1F4YH 3S4SB 1KYUA 2L0DA 3I2CL 2AEOA 4BFEA 2JKIS 3GSRA 1AGFB 5J6GA 3OC5A 1CXHA 3ZTEA 3SQOH 5BXFB 1NPJA 4W9EC 1S7QB 2YBGA 5D7HA 3SGKC 5F3FA 3QXTA 4LPYA 1FUNA 4ODBD 3V5DA 2ODIA 4FQIL 4LDCA 1A25A 4M5SA 1NICA 2XFXB 3CV5A 3RFZA 3QDME 1CFTA 1T5XB 2B4CL 3NIDE 1GGIL 3B37A 4FA8A 3WFEL 2EEFA 1XGPA 5CJXA 2CPUA 3QPKA 1TZHA 1QG3A 4KFZC 1I3UA 4PVLA 2CO6B 3RTQA 3TO2B 4A2EA 4A2FA 4M7KL 1DQLH 5C92A 3QUZC 3IFOA 4PJHB 3E8UL 3OLGA 3LQZB 4PUBH 4R9HA 1P7HL 4R0LA 5HXMA 1ZE3H 2VDPB 1NJ9B 3WD5L 1MEXL 1DZBA 2ED8A 2YR3A 3J27A 5DYOB 2W94A 2ZXQA 4HU8A 3VXUB 3ULUD 4Q9RH 5IHHA 3OQ3B 1FCGA 3ZKXC 1H5BA 4G59C 1Y18A 2YWZA 3OAZH 2NR6C 5IEHA 3QZWG 1KJVB 1NSNH 2VDML 3SCMC 1HNGA 1P9MA 2J8OA 3UGXA 1Q9LA 3ZT7A 2ITDB 3QR2A 3CN0A 1EEYA 3SBWA 1MF2H 4X9YA 1HU8A 4KH2A 1FNSH 5JHBA 3BD3A 3FRUB 5LBVA 3VDCA 3I74A 4QKXB 5KWYC 1EJFA 1MLBA 1XF3B 5SX4H 3ARTA 2LLLA 4ERSH 5EIIB 3EFOA 3ATEA 4D0CA 3D69B 1BWWA 4Z18A 1OGSA 5IB4B 4NO0D 3D85B 3CQQA 4S1RL 3I02B 2LU3A 5KVGL 4I8DA 1U3JA 1H6UA 2DF3A 1M7IA 3V4UH 4OLVL 2VLRA 4K73A 2ZUQC 1RHFA 4PW9A 2L7EA 3MRDB 1UKTA 2YAPA 1T20A 1R34A 5E4EB 1BFOA 2ESVB 2X12A 3ZYJA 3OLEA 2IVFC 2XQYK 5CINL 2NY3C 2XXGA 3JWNH 2E7MA 4NQED 1S9WA 2V37A 4Y5YB 2VISB 3BCFA 3N44B 3AQZA 2XTJE 3DYMA 2B0SL 5JIMA 4PMFA 4R7NA 1BZQK 4PYGA 2X9ZA 5F88A 4IMKA 3B43A 3QIUC 4XP9H 4AVIA 3K2MC 2Q8BH 2XG4B 3OKKB 5KOVC 2AC0A 1P7KA 5KW9L 2ADYA 1J8HB 5EZJA 5IQMA 3NN8B 1AOZA 5DSCB 4PJXF 1X4ZA 2BP8B 3HG1A 3KNBB 3VYOA 4LL9A 3V0GA 2CIKA 5D72L 5HGBB 3ZW3A 1KN2H 4HIXL 2YD4A 3O8XC 2CO7B 2R4SL 1DVFD 4LRNL 2ZP8A 3U4BL 3WO3B 2A4CA 1AR1B 4IGBB 5T1JA 3U0PB 1BM3L 2RFXB 4FXKC 2EILB 3ZOAA 3C09B 1ITCA 4PD4J 1OE2A 4YDJA 4BWWA 4RMTA 3QHFL 2YAQA 2R69H 1D6EB 1BMWA 4N8CH 2ZONA 4NQVB 3DVNA 1I7ZB 1IAII 2DOCA 2OSWA 3SZKC 4Y1AB 4BSVA 2D03L 1IGJB 1U6AH 1X5AA 1C16B 4ZFOA 2XNAA 2BW4A 4TLSA 4TNEA 2NY1D 1TTAA 2H2SC 3X3GL 4PCKA 5E99H 1FL6B 1F56A 3BGFC 3TO4A 3VSTA 1JNJA 1INQB 1NGXB 5GZOC 3GLZA 1JPGB 2R0LH 4LGSB 5EOQL 4BV1A 3K8KA 2FBJH 4U31A 2E8YA 3M1CA 3OAYH 1PLCA 3S35X 1MHPH 2AHIA 1JAEA 5EFIA 3O6FD 4HCFA 4OZIF 1I8KB 3SE4C 4IHOA 4WKZA 1WSST 1UVQB 4IJ3C 4ZUVB 2V33A 3K4ZA 5HI5D 5KBMA 3U9PL 3LH9A 2XA8L 3CAFA 1JNHA 4LSVL 3QDJD 3H3PH 4QY8A 4ZNEE 4L8SB 3PWPA 4UQIM 1OZUA 4QYOA 4FABL 2Y1YA 2R0ZH 3U4EA 3KLAB 3O6KL 1O6TA 3VMPA 5DJAB 4B96A 2DYPB 4FQCL 1AO7A 1F4XH 4QF1B 4JFQB 1DQJA 2JI1A 2EIEA 2VAAA 2YMTA 3KYOA 4Q0XL 5AALA 1YY9C 5KS9B 4KQ4H 4HXBH 2QTVA 4U1NB 2K8QA 5F9JB 1FN4B 5BOJA 2OMXB 2WJ5A 2X6CA 3ATAA 3MLUL 3NESA 3QZWA 5D71H 4UM9B 5CZVH 1H3TA 3QNYB 2AQ1A 2NOYA 3KVDD 4JHAH 4ZODA 3K2UL 1B2WL 2G2RA 4P4KA 3HNSL 4YDIH 3X13A 3C5JA 4G9FB 2VZ3A 1ACYL 3TNMB 2EIBA 4MAYB 2VLKA 4ZD3H 3E6HB 2WBJB 3SDDC 2PP8A 4KMTL 4GBXB 2QKIC 1JPTH 3QJFA 3KPRA 3EYFB 3RVWC 3TBBA 5IM7B 2BZDA 2ICWJ 2X7LA 2VZ1A 1XIWC 1E5ZA 3ARDC 4C47A 1MWAH 4OGYL 4LDOB 3F04A 4JQVA 4AWJC 1F45A 4EUPG 4LE8A 1L9TA 2NXYD 4UTAH 3NTCH 3V5KB 1KELH 3HR5A 2YA1A 3US1A 1IGTB 3ETSA 4OTXL 4WI7A 5EO9A 1BLNB 2BVYA 4F20A 1ACZA 2UX6A 3UO1L 5CR8A 4LCWA 3ZKND 3NFSL 1IUZA 4UQ2A 4LSSH 1WD8A 2YOAA 3MNVB 4DPRA 4P9HC 3A67H 1Q0YH 5DJYA 4K3EH 4L1BA 5LO7A 3MNWA 4Z7IA 4MXVE 5DGQA 4XB8A 2FSEA 1N8OE 1D5IH 2YHGA 3B2UC 2YEZB 4F15B 1RJYA 3CQPA 2Q6WB 5CCKH 3B56A 2LAGB 3CZFA 4NO3B 3WO4C 3NIGB 4CA4A 1DBBL 5E7FA 2FR4B 5CAYB 4Z5RB 1HXKA 2X4RB 4BYHA 1NUNB 5ID0B 2OA9A 2W9DL 2NTFA 3VWKB 2XC8A 2TRYA 3U6XA 4A6YH 3B5GA 4WU5A 2CHWA 2X9WA 3IJYB 3PDOA 1UCBH 4DZBA 3O9WD 1ZGLA 1KBGL 1CI5A 1PZ2A 1IGCH 1N7ML 2OZ4H 5KOMC 1DDHA 3WDJA 4BUQA 3HE7D 4HJ0C 5CZXC 5C7XH 3QIBD 3MROA 4MNQB 1GYAA 1JZJA 4QCIA 4B41A 1F6AA 1UGKA 4U1MB 4HMEA 2HKFH 4YAQA 4F7TA 3NCEB 4PJ8C 1F3RB 2ZOUA 5A43C 3MJ7B 3QQ3A 1E40A 3FPYA 2C7UB 5JW4R 1G6RL 1FIGH 5GGUA 3DSFH 1W8OA 1IC1A 2DD8H 2FUQA 3BISA 1ICTA 2B59B 2YAFA 1ZV9A 3B2VH 1CR9H 4KVPA 4WFFE 3U2IA 1GYUA 1HH6A 2VZTA 3QIWD 2H8PB 3OD3A 2WXLA 4TS6A 4MZRA 1I1AA 4MJID 2Y69B 1U95B 2C3VB 3UZVB 1A7RH 3MBED 5JIKA 3X2QB 3AITA 3STLA 1PKQE 3VQMA 2WGXA 3LH2H 4ZUWA 4M8QB 2DM3A 1VEOA 2VXQL 4G11A 4PWGA 3RWJB 3NABH 3FQTB 2CIIB 3CSPA 2I7SA 4PJCE 1ESOA 5FO7A 2AJUH 3SBPA 3ZDZE 3NACH 2PXYD 3AT8A 2XETA 4KDTC 5ESQA 1RZKH 1D9KD 3MRKA 5FGCE 3S88H 3HNVH 3B7SA 4GMTH 3QUMA 5BVPH 4JDZB 4ONHB 5EUKB 2GSIB 3MV7B 1WICA 1RZFH 5FLUA 4NBYB 1UXSB 3P1VA 3QHTC 1MFDL 3NCYP 5FK9A 1DQKA 1IKNA 1T03H 1FLRL 1QFPA 3UZQB 1FF5A 1PFCA 1ZA6B 4J6IA 1VDGA 4L9LA 1CT8A 3MJ9A 2Y7OA 1G84A 1QLEH 2D31B 2DMCA 1ZPLA 1JRHL 5IK3A 1L3NA 4NFCA 1A9BA 4LLQA 3HUJA 3LZNA 3K3QA 1FDLH 1QSEA 1SN0A 3M86A 4XGZA 3CFCL 1DBMH 2FIRT 1DVFA 4MJHA 1BQHB 1G43A 4GXUN 3FT2B 5FO9B 3FFCD 3V6FA 2Q86A 3WS6A 5KBNC 1MCIA 4Y88A 4HHWA 1YEEL 4AH2B 4Z7QF 2Z6FA 2EEBA 1A4CA 1KTRL 3T8VA 4WI2A 4PV8B 2BWQA 2AXJA 1KFAL 3CVIH 2C1PA 5B39A 3UAAA 5K9KB 1CE6A 5HHVH 4ZTPH 3ZO0A 1QOKA 3QXAA 2EC8A 3VGEA 3QDJB 3ZE2E 4HUMB 4GO6B 4FC3E 3VI3E 1WS7A 3IF1B 2O5XH 3CDGB 3EYSH 5HGDB 3DETD 1W80A 3IKCA 5CN1A 5HVGB 3DO4A 5FOJA 1JZ4A 4ZXBC 2JK5A 4XPTH 3LD8C 15C8L 1PZBA 7FABL 1MPAH 4HALA 3VXSD 4E0RB 5ABZA 3R8BB 2XPZA 3FCGA 5BZWB 5IQOA 5T3ZH 3GXFA 5IJDC 5BRPA 4IDJH 4TTGA 2MJWA 5KN5B 1B4TA 3VH8B 3O6FA 5DRNA 5ID1A 4FCHA 3N43F 1JXJA 3KBEA 2X9XA 4GI8A 2ETWA 3VFMB 4QRUA 2DI9A 5EBLB 2DEYX 2H1PH 4FNPA 4IOSD 4JM0A 5DZPA 5E9DE 2JB5L 4N0CD 4BZ2H 3I75B 1KGYE 1XCTA 3EBGA 3F6JA 5ESVA 1JZ6A 2Y7QA 1IMHC 1MAJA 1WZAA 3HI1A 1OV8A 4MMZB 5A16B 3L3JA 1MJUL 5ALBL 2PWDA 3GMQA 4JFDB 1R3JB 1FORH 4YSDA 3C5ZD 4O02L 2F1BA 2OMYB 1IM3D 4PN6A 3MHZA 1LEIB 4D9RD 1H15B 2P5PA 4LASH 5LNDA 5JPNC 4XXDA 1SY6L 1BWMA 4QHUB 3JV0A 5IJKA 3OHXC 4JQIL 2X09A 3CTTA 4K3JL 4F8LA 3NSYA 2DWEB 3PHAA 5HDQL 4EI5D 2P46B 3I9GH 4UAOC 3MV9B 4N6RA 3SBRA 4OD3H 2QDWA 3SDXE 2FGWH 4AJ0A 3OKEA 2GFBB 4Y5VA 4B9ZA 4IEFA 4PP1D 1E9QB 1JDDA 3QC6X 3CHOA 4HCRL 2QT6A 4MWFA 2XT1B 2H0JA 2H7WA 2AQTA 2JIXA 3IKKA 3B9KD 4HX1A 3ARPA 3TNNB 3KL3A 2PPDA 4K3DH 1WGVA 2JSFA 2ARWA 2NY5L 1FO0B 1TJHH 3PUCA 4LRIC 3RX9A 3IJSB 4ZSOB 1KGJA 2AJYL 5H4YA 2OL3A 1R9FA 2GABA 3H53A 4NZUH 4Z7VF 5E6UB 3OKNA 2XZCH 1R33A 4X6CE 2FX9H 1B0WA 3PHSA 2YD0A 1NLDH 2VABA 4ZUSA 4W4OC 4XBEH 2XZAL 1HINH 3MA7A 5I17B 1E6OH 4FFWD 3VUAA 2C3GA 2AERT 2L3BA 4RZCB 5DEZA 3ZX1A 5HGHB 4L8CA 1YY8B 4W1TA 4A39A 1B4RA 1B0GA 5D1XB 1IC0A 1MW1A 4PIRF 3FOMA 3HE7B 3QJUB 4HIHA 5F7YC 3RDJA 5ICZB 5ILTH 1EGJA 3ABZA 3QUYB 1NUFA 2F58H 5DVKA 1JI1A 4N86A 4DP5X 2WXQA 1X4XA 5JHDD 1BQ5A 4YGAB 4RIRB 2Z34A 4G6AC 1KSRA 1IJNA 4CSZA 5DHYA 1BYPA 1YYLH 5F9OL 4J8RB 1WRFA 2VRKA 1UXMA 4HT1H 4RA3A 3Q2VA 1W0YT 4MB4A 1JHLH 4KBPA 1SPDA 3O9WA 4XAWH 4TUJB 3IRZA 5D1ZD 1OAYL 5JPMC 5D70L 3F00A 2YD6A 4H88H 2NQ3A 3BAKA 3QIBA 2A9MH 4MJ6A 4JK0D 2OMWB 4GG8A 4QEGA 1NCDL 2J12B 5H35B 4RGOH 2JMRA 5HHQA 3FSWA 3V52L 3VXQB 4TNWK 2NYYC 3D12B 1WV7T 2J21A 1GGBH 1HT6A 3LNGA 1W9XA 2OSLB 4NI6A 1EXUB 2N59A 2NCEA 3Q43A 7CGTA 4E42A 4WWPA 1CJYA 4WSJA 5A2IH 1NZRA 2BZCA 1A66A 2IDSA 2JELL 3QIWA 5T1LD 3B2XA 4X7EC 3FB6B 4RFNC 5T1MA 5KBLA 4QRAA 4MA3B 4MJIA 4FMFA 5F93C 5C9JB 4E41B 1E4KC 2QHRH 1NDTA 5ADOL 1FVEA 4K7PY 4Y4HC 4NNXA 3TBTA 4I2XA 1Z5LA 4XC3H 3KEHA 3S36H 4JAMB 4KUZL 4OGXL 4QLWA 1C1EH 3V55A 1FNGA 1TPXC 4UV7L 2BMKB 4R97C 2XLLA 4UTBL 4QXTB 2MQGA 2C9VA 3LRGA 1X5GA 4M62H 5GGTH 4NQQA 4UT7L 4V2BA 1NCWH 4FN0A 5IP4A 3TL5A 5JHLH 5ISZA 2PXYA 5GGSY 3UTTA 4AY0A 1D9KA 2F8OA 1HCYA 3GK8H 1S5IH 1OSPH 1LNUA 3K6DA 1WTGT 2KI6A 2P47B 2ZUVA 2YSTA 3NH7H 3OXSA 3Q3GB 2IBZX 2CO2A 1SM3L 1KPUA 1MJ8H 1TVBA 2VZOA 5HHXL 1UD2A 1E43A 1B2YA 1E28A 1N67A 2J6EA 3ARYA 2QADB 1HQ4B 2KLTA 5IIEB 1ZVSB 3ARZA 1JNLL 1VFBA 2I27N 4NKOA 1KGCE 3S2AA 4UINL 5C8JA 3IAQA 1QD0A 5I6OA 5IV2B 2ZKMX 3NCBB 5BPPA 2ZXEB 4JFPB 3KGUA 3VFSB 1HE7A 2A1WL 3O45A 4YNYB 5C08D 5F3BA 2XTJC 2VL4A 3FFCA 4D3CL 1ZVYA 1K8DB 4KX8A 4MASA 2IPKA 3QNZA 3PJSA 4FQXB 5BQ7A 5D4HA 4EVNA 5JHAA 3FO0L 4FTVE 3L1FA 2KYIA 5DUJA 1S9VB 5D1QE 4AGQA 4BH8A 5E08L 3JWNG 1AGCB 4AQ1C 1TVHB 4HK0A 4TULH 3Q1EA 4FGMA 1BHGA 2N01B 4PB9H 1CBVL 1R3HA 3QG7H 32C2B 4FKKA 3S97C 1HYSC 5L8JB 4TNGA 5FUZL 3RY6C 4XH2B 5C0CE 5I1CL 3HLKA 3V79C 4WY7H 4NUJA 1X9UA 4YSEA 3DO7A 2Z91B 2NRDA 4LKXB 2AEWA 3JV4A 3VXSA 2BSSA 1ZHKB 3ATBA 2EH8L 4W9IC 1RUKH 4AIXA 4QNPE 5EF3A 3UDWA 4PY7B 5IGXH 4WW2C 5DFTA 5EZPA 1Z66A 4GXVL 1YN6A 2XWBB 4XP6H 3UTPE 4YSSA 1OAXH 3Q6FA 2YAMA 1R3KA 4IOSA 2F53E 2NZ9C 2DWDB 1M4KA 2NUTA 1KBPA 4MNGA 5IOPA 3IDXH 2IO5A 4OFPA 5HHOB 5SWSB 2WUBL 2PPFA 3W0WD 3QG6A 2X70B 5CP3A 4WO4B 5C0AB 1G7LB 1ZLEA 2YGVA 2AV1A 4C57C 3KWWB 2H26A 4PSRA 4TNVF 3VJ6B 2F9BT 1CGTA 2OCJA 2UZYA 4QRRD 2XG5A 3SGDI 3MTRA 3EH3B 3BFOA 4G8IA 3TIDB 3C5ZA 5I5JA 4R4NC 4QRPE 1GAFH 1SJMA 3U79A 1PNDA 3IT8D 5KVDH 1FFPA 4L1LA 4WHTB 1Q4NX 5HDOA 2NY7H 4HJGA 4PS4L 3U25A 1WEJH 2BC4B 3E1F1 3G04B 5F1NA 3S3SA 3W81A 2NY2D 1AIFB 2FAUA 2CKBA 5DQ9B 1R1CA 3IGUA 2APTA 1MW3A 1VFAA 3CFJA 5CJ5A 1WISA 4CDHA 2MMXA 1FBIL 1UKQA 2DYSB 2PWHA 4RSYA 5LXVA 1H6FA 3V4VL 3ASOB 1BYNA 1A6WH 5KYUA 4PRID 2WLLB 2EDWA 3WKMH 4LLDB 4CILA 3NT0A 1MG3C 2QJDA 2XWDA 5DK2A 1OVZA 3F7LA 5AKVA 2C9SA 4L8DA 3D18B 4DGUA 2QSQA 3VAEA 4HZ1A 1S7RB 1I9JL 3NJHA 1R3IH 2EECA 5DO8A 3NJXA 1JG9A 3V4PB 1G4RA 3SSGA 4JMNA 2HRPH 5DTFB 5K1VA 5ETUB 2AK4B 2WIIB 4P9HH 5IEKA 2A74B 4XP5H 1MLCA 4C4KT 3UG4A 1JTOA 4N2FA 4PJ9C 4QJ5B 2G3XA 4OZIA 2A6JA 5DK3A 4RMBA 3INUL 4N24A 1A3RH 4HWNA 1J05A 1CFSA 1PKOA 3TN0B 1RIUL 3VWJC 2WANA 5ES4B 4NENA 3F84A 5JHDA 4AIZB 4Y8AA 5KSBB 3UGEA 3BPNB 3HW7A 5DA0B 3BW9B 3CVHH 4PRNB 5BMFH 5J3HD 2FRGP 1C8QA 4TVPH 3WS3B 3N0AA 2DLFH 1JZ2A 4P2RE 4OD2A 2SEBB 5E6YA 4EIZC 4DGIH 4GXFA 3RGHA 2HLAA 5GQBA 4PRBB 4JQXA 1JD9A 3BLBA 1NC2D 2L7JA 3LY6A 1U8QA 5DFAA 3TYFA 3H42H 1WH0A 3L4TA 1KTBA 4OZGE 4Y4FC 3V0WH 2EDOA 5F6HI 1P5UB 1UC6A 1WYJA 1XB3A 2IG2L 3BD4A 1XGZA 1EJOL 1AXIB 2X28A 1T7ZA 2GITB 5HYJE 2VDLH 5D96B 1AZNA 1PNCA 1HJBC 1K4CB 1U8NA 3LHPH 1YPZB 4I89A 3N06B 1DVXA 2CXKA 4JDTL 1U3HC 4XPFL 2AGJL 1NPUA 5B4MC 1CK0H 1MCQA 2R8SH 5K59E 1J5OH 3QXUA 1M1SA 3D3VE 3QB7C 2J57A 2P5EB 4JFFB 4KKQA 5IBUG 3ZT5A 1YN7B 4P05A 5ICXB 2P5WD 3VI4B 3L5JA 5T1LA 4PYHA 4MNHB 4GRWB 4LCCB 2GSGA 4WHCA 4KO6A 5CJOH 4N2AA 2HRLA 5T5NG 3UBXI 3UP1A 1NAMB 2J43A 1H3GA 3ZBMA 1KCSL 5CKAA 1E50A 5FIEA 2MKLC 1N6QH 1HQRB 3GXPA 4U1LA 1ZA3B 3ZGIA 4NM4H 2QTEA 4WWKC 1G7JA 4BZ1L 1B6DA 2EO1A 1KCVH 2OMVB 3BE1H 4X99A 3V7AE 2MPAL 4LL4A 2FEDC 3GBNL 4RWYH 2V3EA 4NFBA 4P06A 1BQKA 2RR3A 5D7KD 3SD5A 3NG5A 5E8EA 3HZKA 4PJGE 3FYIB 2YPVL 2OAAA 1D6VL 3N5AA 1GOHA 3AROA 2Y6TE 3SPGA 4I9WD 3CXHJ 5SV4A 3WJLA 2R69A 2O5NA 4FQHA 4HBCH 4OT1L 2EE2A 4XVUC 4Y2DA 5A2LH 3B7UX 5I16A 3QISA 4MAZA