3BE1H

Dual specific bh1 fab in complex with the extracellular domain of her2/erbb-2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
220
structure length
213
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-2
publication title Variants of the antibody herceptin that interact with HER2 and VEGF at the antigen binding site
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 213
sequence length 220
ec nomenclature
pdb deposition date 2007-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3be1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3be1H01
1YMMD 3EDDA 3RNQA 1RI8A 1NMBL 1RUPH 1T89A 3ARPA 5C6PB 3VFOA 3AB0B 4QXGH 3CFEA 4XNXL 3PWPB 5DS8B 1VKXB 1UCTA 1T0NA 2ZCLL 1F58H 4QRTB 2V5TA 2VLJD 2VLME 1A7PL 3DV4B 3I84A 3K0WA 4H20L 4LCUA 4X7TA 3GMQB 1D9KC 2NXYD 4FQQB 5DD5H 4LBEA 4Z8FL 4GXUM 3MRRB 2LQRA 3FZUD 1VFAA 2DQGL 5KAQG 2YMXH 2R0KL 5FYKE 1HYSD 5I71B 3MLSL 4XH2A 1JNHB 1SYSA 1E28B 2AXGB 1YUHB 2BFVL 2GY7B 1OW0A 1F2XK 2D3VA 3DX9B 2P24B 1I7TA 3EIFA 5GRUH 3NCYP 3WIFA 5MP6L 2Y5EA 5JPNA 1KPVB 4TVPE 3P0GB 1J0ZA 3QDAA 5EBLB 5F70A 4G5ZH 4QRPD 4U7SA 2IG2H 2E7LA 1B9ZA 4V1DA 1TZHB 3RKPA 1WBXB 2QJDA 3GMPA 2ITDA 2YD5A 3VXTB 1AHWC 1OAUH 4HFUH 5BZWB 4P2QE 5HHOA 2V2XB 4OFPA 2HN7B 3O81A 5F7EL 4DVRH 4GG6E 3DUSB 4L8CB 2X4PA 4HULB 5I74B 1U3JA 4HIHB 2QR0B 2R69H 5IMOA 2JELH 5D70H 1TNNA 2W0FB 5EH1A 1YNLL 4U6XB 4WV1A 4XBGA 4PG9A 2X4TA 3WFDL 1C16A 1FYTE 3VI3F 5I73B 3HZKA 3G6AB 1MCIA 1AXSA 2R4SH 4PJAA 1M7IB 2AEPL 4UQ3A 5T1MA 1OAXH 2HYMA 5DLMH 2VMFA 2L4OA 4PGEB 1LK3L 1MELA 2AV7A 1SEBA 4XXDB 4NUJA 3BP7B 4NCC1 2P5EB 2BOCA 1GAFH 3MO1B 3JZ7A 5CUSL 1JV5B 1TLKA 3H9ZA 5IF0A 1LE9B 3HFMH 1DEDA 3PP4L 1EBAA 5T5FH 1WTGT 1TZGH 5JORA 4WWKA 5E6ID 3T8XB 2AI0H 3FB8B 3AFLA 3IKKA 5DJ2A 3LVEA 4HJ0D 2LTQB 2NXZC 3FN0L 2AKRA 1ADQH 5DRZB 2VLMD 4QGTA 2UWEB 4LDEB 3DRQA 1DP0A 4DN4L 1I9JL 4I0PD 1OPGH 4F8TA 5TH2B 2V17L 3T77B 3NFNA 5D4QA 1MPAH 5CBAA 5K9KB 5FYKD 5L6YH 3MOBH 2NY4B 3EYFB 1M7XA 3EYQD 3WYRA 1S5IH 4JKKA 2R0ZH 1K6QL 4HKXA 5DEFA 2NY3C 2FECI 4XWGL 4K71C 2HVJA 1A7OL 5CILL 3TVMB 5TDPB 2ADJA 1KEGH 5L2KB 4LF3B 1KN2L 4OF6A 5FYJE 4MDIB 4TVPD 4DW2H 5F88A 3VFGH 5C0BE 4R2GD 3MODL 3BP4A 1INQA 3G6JB 3SDXE 1A3LL 2P5WB 4FQCL 5GRVK 5A40E 1RZIB 1A0QH 1MCQA 4G8FB 4OLZH 5IEHB 1VENA 4ZXBB 3EO9H 5DHYB 4ELME 1OARH 2NR6C 3UTTA 2ZCKH 4S2SA 2YD2A 3O6FB 4NM8L 1FIEA 5E2UH 5C6WH 5KVGH 4R8WL 3S5LG 2LU3A 1A6VL 1T0PB 3AMKA 2VB5A 3FQUB 1OVZA 5H35A 4PTUB 4EBQH 4OD1L 2Y5TB 5CCKL 1TJIL 1FYTD 4EDXA 3PGCB 3S7GA 4MWFB 4XBPB 4WW2F 3LHPL 5K9OB 3BPLB 3V4UL 2P48B 3UTPE 4UU9A 2VE6B 1AGEB 4N0CC 3GUTB 2VKWA 1G7PB 1V5JA 1EMTL 1IGFH 5HI3D 3U2SA 5IHBA 1KLGA 5AD0B 5D93C 5SWSA 4YPGA 4JM4H 4ODHH 1UB5A 3G6DL 1YNKH 2D03H 2H8PA 5I18H 1CDUA 4ZFGL 1MCEA 2BVPA 2E7MA 1XGUB 2H32A 3I2CL 1KUMA 1QSEE 1NC2D 4QO1A 3DBXA 4U1IB 5E4EB 3SOBH 2HWZH 3E6FA 4HPOL 4M3KB 5EU6A 5INCB 1E4KC 5EOTA 1RZKC 5CP7A 2RB8A 4Y5VA 5DJ6A 4KFZC 3D39E 4LKXB 1CGXA 1JGDB 1N59B 4MXWH 5C07B 1WUNT 4OZHE 2EDWA 4DKEL 2QHRL 4Z7WF 5E8OB 3DURB 3ARFB 1WBZB 4JG0L 5EUOA 3UMTA 5KSBA 3W0WE 4NOFA 1WLHA 4AEEA 4OF8A 1JZ8A 3M07A 4UUJA 4WY7H 2JF1A 5A43C 3HC0B 1K4CB 1CG9A 5FYJD 1S8DA 4U1HB 2UVFA 3DX6A 3EGSA 3ES6B 4WI6A 2OLDA 4NKOB 4H88L 1Z5LA 2YD3A 4LCUB 3ZKQD 2Z4QA 2FHBA 2DQEL 4XAWL 3BRGC 2YC1B 5IBTH 1J0IA 2HRPH 4PIRF 1ZVHA 2JIXD 4ZTPH 4XH2B 2VH5L 4IRSC 1RU9H 1PSKL 3PWVB 5IVZB 3EOBB 4N0UA 3WE6A 3DNKA 4OGXH 5ITBH 4FQ2L 1LDPH 1JNNL 3JV4A 3OKKA 4PJDA 1U8IA 1C5BL 5CS7A 1Y6KR 1XH3A 3C5ZD 2BSTA 4PRHB 4HF5L 3HMWH 3IXAB 3KYOA 3IVKA 3WHXB 2JCCA 3UTPD 3FONA 3RY4A 5CHNB 3EO1B 4J8RB 3DARA 2FJGB 2PXYB 3VRIB 3ZKXC 4P9MH 4XNYH 4PRDB 3NFSL 4MCZA 4ACPA 1YPZA 2X10A 3MBED 1FAIL 1W0YT 2A1WH 1AIFA 1CIUA 3ME0A 3S34H 1DE4A 4QOKA 3RWCA 1FNGB 4F3FA 1VACB 4Q58C 1I9RH 4RAUA 2VDLH 3V5KB 5CEZH 3WS6C 3KLDA 3OKDB 1NCWH 3HG1B 3A6CL 4MQXD 3MOQA 2C1OA 5I9QB 4LHUA 3STZA 5I8CA 4OBRA 5LCVH 5C92A 2ZJSL 4RGNE 5DQJA 3B4NA 4BZYA 1I7ZB 5HI4D 3U48A 3MUZ1 4M1GH 2VITB 5CSZB 5C8JA 5D7LE 2AV7B 5L8KB 3IDGA 4OCYH 4JRXA 3AU1A 3D39D 3PHQA 1HH6B 5BO1L 3H7LA 1PLGL 4ZQKA 4ZTOH 1C1EL 1WWWX 5T1KD 4BSVA 1WSST 1OAKL 5FHAL 4U0RB 3WXVH 1HN1A 5DZLA 5GZOC 2R2BB 4GAYA 5FF6A 3TO4B 3WXWH 5E2WH 1ZOXA 4HMDA 1WISA 4JFPB 5E94A 3ISWA 4M93B 1EX0A 1S9YB 5F71A 3DMMC 2VWEE 1DBAL 3QZWA 3SDDB 4LPTA 3C2AH 5KSVB 2MJWA 4H1LH 1AGBB 1M05A 4QCIA 3VGAC 3VXME 5JQHC 1IC5L 3M8OL 1BQLH 1J18A 2XZCL 2DLFH 2DJ4A 2W59A 2O93L 4BQCA 5I19L 2NQCA 4F57H 4X8JA 4HKXB 3TT3H 4BK5A 5LBSL 3KLHD 4NO2A 5MENE 1HEZB 4FS0A 3VG0H 2DI7A 1U8LA 4U2YA 5C0AD 3MNVB 4NRYA 1LNUB 3QXAB 4K07A 3CSYA 4N9OB 2GQHA 5CINH 1KPUA 1T7VA 4GFTB 1F6FB 4DZ8A 2EIZB 3LS4L 1INQB 4G6AD 2CGRL 4LHJB 5DR5L 5GRVL 3VD5A 3PWLA 4FQIL 1OCWL 3SE4C 3SJVB 4PRIE 4XCCL 3S9DB 2BP3A 5DMGC 2ZCLH 5D1QB 4ZFOB 3TO2A 3KVQA 1A7PH 2K7PA 4H20H 1LD9B 3IFPA 1N4XL 2Y36L 5C3LD 4Z8FH 4PTTB 2A6DB 2EDFA 1QA9A 3QPQD 1BGXH 4M5YL 2R0KH 3TA3D 1OP5H 3QA3B 2IPKB 3V6BR 4YGAB 4R97B 4NBYB 3CX5J 2D31B 1FLTX 3FFCE 4RGOH 3TIDA 3HI6L 2RFXA 2O61B 5E7BA 4C56B 3QDME 3HE7B 4YBLB 4RGND 4IMLB 3CZFA 4X5WB 5MP6H 4Z95L 5D7LD 3TT1H 4OGAC 4U1LB 6CGTA 1TQCC 2CR3A 4HS6A 5A2LH 3FB5B 3O0RL 3ZDYE 2FBJH 4OGYH 1TVHB 3B2UC 1HHIB 1MCKA 4HGWA 4DQOL 3QUYB 4R4FH 4I13B 5I2IB 5L88L 2H26B 3IDNB 3DIFB 2BNQA 5F7EH 4JHBA 5BCAA 4NWTH 2ZNWA 1IGYB 5CP3A 3JV5A 3DBXB 4HKJB 4RIRB 3UTOA 4QTIL 4HGKC 1YEFL 3QJHB 2BK8A 1YNLH 4XCFH 1MFAL 3QNXB 4PRNA 3I75B 4J1UA 3RA7L 1ZS8A 4A6YA 4KKLC 1SHMA 3BMVA 4JDTL 2YA0A 3OKLA 3SGKC 1UZ8B 3ARDD 4JPIA 5F7HA 3W11C 4EI6A 3QIWA 3T4YB 2AEPH 2F58H 1VDGA 2XZAL 3ELAT 5BW7A 4LVEA 5FGCE 3RWDB 4LCWA 1XGYL 2E6QA 5MEND 3RRQA 2B2XH 5HYSB 4GUPB 3C5SB 3AGVA 4NC0B 1JGLL 2DQTH 4MSWB 4WNQA 3LQZB 2CLRA 4M4PA 5HYEA 2PTTA 3LN4B 1BHGA 2R1XA 1K8IA 3EGSB 4NCC2 4N8PA 3SKJL 1A9BB 1T6WA 1LO5B 5DJAB 3PP4H 3VXUA 1ZLVH 3M1BA 4XVUD 3IJYA 2DF3A 5JIHA 5TPWL 1JRHH 1SJHB 4PRID 4K3JL 3FN0H 4P5KA 4JO3L 3MR9A 3F7VA 3LS5L 3SDXF 5IB5B 1X5HA 4XMPL 3HC3H 5IWLC 3ARBA 1EO5A 5SWQA 1JHLH 4PJ8D 1BD2A 1GOFA 2YN5A 2R0WL 2EE9A 4ELMF 1U92A 4R4NC 2EH8L 4EN3D 4PJIE 1K6QH 3FONB 3LEXA 3FFCD 5GRWA 4HC1L 3BIAX 1ZVYA 1FFNA 3ILPA 4XWGH 1A7OH 5CILH 4FFYL 4N8CL 3QDMD 5JXEA 2F74B 4K3EL 3DXAA 4M4RA 1XF2B 3HZVA 2F5AH 1GZQA 4FQPA 3OR6B 4NFCA 4OUOA 2AK4A 5J9PA 4TRPL 3O8XB 3MODH 5KANG 3JV6A 4E5XA 1A3LH 1L7IH 4TVSa 3VWKC 1IM9A 2EICA 4Z76A 4QYOA 4Z0XB 1RZGB 4FQCH 2CDFB 1BFVH 1VHPA 5FO8A 1DLHB 4KK8D 5GRJH 8FABA 3VA2C 1KACB 3ZE2E 5BRZB 1GCFA 3GSRB 1CICA 4OQTL 4FQ1L 2WWMC 4NM8H 1VCAA 4HH9B 3MYJA 5CBEA 43C9B 3FOMA 1A6VH 1AI1H 3WO4B 1R5VA 2A83A 3S36L 1QNZL 2WAHA 1AD0A 3UJTL 4NKMA 3MRJB 4OD1H 5CCKH 1S5HA 1QFWL 4WCYL 4C58B 1CE6B 3QDGB 3LHPH 4Y2DA 3V4UH 3SGEI 2OK0L 4MJIA 5EFIA 3BDBA 4GKSB 1M7DA 3KXFB 4JE4B 1BOGA 1MCJA 2V2WB 3ARED 1EMTH 1MREH 5D2NE 3B8SA 1A02N 4IRJD 3HZMA 3RY5A 1RK1B 5IFHL 4S0TD 5GGSY 4G9FB 1N64L 3G6DH 5ACLA 5C0CA 3EJZD 5F6HJ 2NZIA 1G7JB 4ZFGH 1TZIA 4X0KA 5GS3A 2JJUA 5IQ7L 1QVOB 2HAZA 4LRNL 3I2CH 4U1JA 4QEGA 4KI5C 1H3WM 4PJEA 2X40A 1SJXA 4HPOH 5BJTA 4DK3A 1FV1A 1R5IB 3VXRA 2HKFL 3VFVB 2OL3A 1TFHA 3ZSTA 4QRSB 4KHXL 4KQ4L 1EXUB 1OD7A 3OJ2C 4FOMA 3AM8C 2FRGP 4DKEH 3GSOB 2QHRH 1N5AA 3FTGA 5IESL 2XXCB 2YD6A 3SE9H 3MOAL 4JG0H 4UB0L 5IGXH 2QSQA 3H9SA 3REWA 4WHTA 1UXWA 4HUXB 3ARGB 1EZVY 1RUML 3CCHB 3HUJE 1MWAA 2H3NB 4LLMB 4H88H 5FA4B 4K55A 5TFSL 4KDTA 2DQEH 4XAWH 5DK2A 4JKPL 4M7ZC 3ZYOA 4RFOL 4WI7A 3IXTA 2CXKA 1AQDA 3HPJA 3DX8B 1PSKH 2BXYA 4GH7B 1ZHBA 4NQSB 4RMRA 5D1ZC 5DT1L 5E8NA 3CC5B 4FQ2H 1P6FA 1GVIA 3B83A 1JNNH 5E1AB 3QRFM 4K2UL 1C5BH 3CZFB 5HYJA 1NFIB 3QI9A 5I1KH 4L8SB 4CUCA 4U6HB 3LD8B 3FQWA 1P4LB 4X6DE 5IR1A 2I07A 3RI5K 1BWWA 1Y18A 3KWWA 3G5VB 2J4WL 5F1NA 5IVNA 4PB0L 2W65A 3OB8A 5LGJA 2DL2A 2BNUA 2CKBB 2FX8L 4LK4A 4OZGE 1KIQA 2ZPKL 5EC2A 2F54B 5FDYA 5C09B 1FAIH 2DMKA 4OTXL 1ETZA 4KGJA 1T20A 1N3NA 4GMSL 4MCYB 2O26U 1CR9L 2MPAL 4MYWB 1BAFL 2FHFA 1NFDA 3CMGA 3KG5A 4OCXL 1U8MA 1CFTA 5F89A 5I6XB 3CLFH 4F9LA 2ICCA 1IT9L 3EYUL 4ZS7L 3GJFA 5FYLE 3FRPA 3A6CH 1TETH 3K81A 1HHJA 4U1SA 1CK0L 1MI5A 5F6IB 4Y4KB 3C9NA 2VDQH 1NLBL 4J3OC 1P7HL 4P9HL 1OTUD 2BHZA 2L7UA 4QRQA 4MNQA 3NZ8A 4Y16C 2A9ML 5IVXE 2DWDB 3GSUA 4NQXB 2R23B 2V7NB 3U0TB 4QY8B 5BO1H 5I8KH 5JLZB 4ZO6A 1IAOA 5E8EB 3T0EC 4DAGL 1C1EH 4N8VA 2DB8A 2M26A 4ZG1A 5C9JA 1L0YA 1OAKH 2PW2B 5FHAH 5CD5C 2OMNA 3TH3T 1Z9SA 5DD1L 2Q8BH 5J6HB 1IZKA 1U6AL 2NY6B 3MRCA 4P5TC 3BZ4B 4P23A 3B5HA 4MA1C 1HKFA 1EZVX 4BZ2L 2VJXA 2IQ9H 3QEUA 4I9WD 3P4MA 5H2BA 1A22B 3LKSB 2SEBA 2I5YL 5KAQF 5JO5A 1IQWH 1QLRA 4LSVH 1S9VB 3FT3A 3KPPB 2JJSC 4PV9B 3IFOA 3U9UA 4ISVA 1VA9A 3M8OH 5GGTA 2XZCH 3V8CA 3C8KA 1AFVL 1EJOL 1Q8MA 4P5MB 5DUBB 2IH3A 5FM5O 3VWJD 5KSAA 1EFXD 3MRQB 5ESVB 2GTZB 4QHNB 4ZUVA 2X1XR 2OTPA 4NUGL 2I9TB 1XIWC 3QCVL 4L4VA 3RWEA 4PJCE 5HJ3A 1CDBA 3MNZB 2G5RA 4GAGL 1MNUH 3NCFB 2X7LB 1X4XA 2YUZA 1WAAE 2DTSA 1HKLL 2WLYA 1RJLB 5ESAA 4J4PD 3VMNA 5D5ME 1A6TA 2CGRH 2CIKA 4YHLL 3BMWA 4FQIH 2FIKB 2W91A 2YBRB 4XCCH 1ZAGA 2FEEI 1P4IL 1U91A 3SKNB 1GL4B 2AV1B 1HINL 4LP4A 3ZDYF 1N4XH 2Y36H 3QHTC 3PWJA 3RU8L 1YEEL 5FKPA 5H37H 1OM3L 4O2FB 3A67L 2FZ3A 5D7JC 5FYLD 2HFTA 3V95A 3MMEA 5GRXG 4LSPH 2QADD 4KK9C 4YK4C 1NKRA 5IBLC 5AG8A 1T89C 3HI6H 2X4OA 2HFFA 1UVQB 2QQKL 1RFDL 3V0WL 4C54A 4KJPC 4Z95H 1MHEA 1UYWL 3ZHKA 4D0BB 1ACZA 1WV7T 4M9OA 4MMXC 3JTSB 3O0RH 4ERSH 1A6PA 2E9IA 3V6FA 1Z9LA 1YMMB 1J1OL 3KPRE 3DSNA 4DQOH 3GNML 2C3HA 5L88H 3UAJC 2A74A 4LNVA 2HH0H 3PHOB 3B3IA 1OW0C 3U83A 3QDJA 5F6HI 3QJFA 1EVTC 1CL7L 1J0HA 1RHFA 3NA4A 3LAFA 2VLJB 4QTIH 4G6FD 1AKJD 1ZK9A 5BJTB 5HD8C 1G6RA 4XI5D 5LAXB 2YXMA 3PGFL 1Q0XL 3CZJA 1U8NA 4PRPE 1RZ8A 3BEWB 2DI9A 3RA7H 1ORSA 2ZUXA 4EQ3A 2QV2A 2E7LC 2AABL 5IUSA 2BCKA 1S78C 4G42B 1NKOA 2FJFA 2XZAH 5KW9H 1QFWM 4DGVL 1XGYH 3N1PC 1ZT1B 3ORJA 4GKZB 3REWB 1SQ2N 1S7QA 3NGBB 1OLZA 4NZDA 4DKDC 4GBXD 1K2DA 5E2JA 1R3HB 5E2TL 4QRPB 1XGTA 3RZWA 4NGHL 3CSGA 3MJ6A 4WV1C 4PJIF 3VJ6B 3CGTA 1IGJA 3SKJH 4XMLL 3BXNA 1KN4L 5TGBB 3ETBF 3OKNB 4GKOA 2OJZH 4TNWF 1S7VA 1IKNC 4PP2B 3U36A 3BKJL 1MLBB 3IXTB 3FQNB 3QWRA 5TPWH 5GGVY 3UJJL 4K3JH 3RWGB 4DGIL 1SM3L 3WIIL 1QBBA 3T0WA 5F3BB 3CDCA 3LS5H 3HB3C 1HCFX 3O2VL 4XMPH 5C9KA 4Y4FD 3Q6FB 2XA3A 1MH5A 3OR7A 3Q6GL 2FHCA 1XF3B 3QI9B 3T3PE 5DZNA 2R0WH 3ZE2F 5JUEL 3EO0A 1MSPA 3QNYA 1HSAB 4ZDHB 1MY7A 3BI9X 2MQ3A 5IFJA 3QEHB 3KWWB 4MB5A 4WWKC 5J1AB 3JUYA 25C8L 4HC1H 1S7RB 1UWXK 2ICWB 2W65B 1KTDA 2I9LB 3P9LA 4L9LB 4F7PA 4HJGA 3VD4A 4FFYH 1NANH 3BWUC 3IAPA 4M7LL 1GGIL 1F02I 1ZLSH 4U1MB 4ZOEA 2GUOA 2JJWA 1OT2A 3KPRD 4HUUB 4P2OD 2NTFB 1IBGH 1UZ6E 1FVCA 3DECA 4CVUA 3GJFK 3RL2B 1QR1B 1C7SA 3NPSB 5ALCL 5HYQB 4OQTH 3DO7B 4FQ1H 3BISA 4U1SB 1B88A 2WBKA 1IGIH 5CLTA 5FUOH 2VLKE 4TSAL 3FQXA 4I0PB 1QNZH 2G60L 1QFWH 4WCYH 3QIUA 4PRPD 5FCSH 2HT3D 2UV3A 4CU7A 5HVHC 5TQ2L 3IDYC 2OK0H 3G5XB 3D87B 3E3QC 5EBWA 5FECB 5A2KH 2X4NB 1IAIL 3BVNA 1JF1B 4UILL 4IRZL 1FVDB 1UEMA 4RWHA 3MRPA 5MEOA 4MS8D 1GIGL 5EBGA 4F9PA 3SO5A 5IFHH 3MUY1 4XGZB 4OQ1A 4R2GB 4KH2A 4UQ2A 4WTWA 2G9HB 4WI8A 1PKOA 2HG5A 3RPIA 4DCQB 4O00A 4YJZL 5DHVA 5IQ7H 3WBDA 3U9UB 3DX7B 4Y8AA 5IQ9A 4Z77A 3AAZB 4GKNB 1W8OA 4GG6B 4R7DA 4FABL 1DUZA 4PR5B 1KTRL 3QEQD 3HUJF 4BKLB 2OR9H 3D3VB 2HKFH 3BUYA 4RZCB 3RZCD 3MRIA 1UWEH 3QUZD 5A1AA 5JR1L 1FYTB 1HWGB 2P45B 1RK0A 1A1OA 4UT9L 4IOIB 5GS1A 1S7XB 4XNQB 1LEIB 4L3EE 3QO0B 5IVOA 1DN0A 4D0DA 5DEZA 5KSUA 3L3HB 4MA3A 3GSVA 3VD7A 3MOAH 3MV8D 4UB0H 4WHDA 4M5ZL 5EZLA 1VEMA 3N9GL 3N06B 5E9DE 2X4SB 4P4KD 5IIEB 2ERJC 5GGQL 2JB5L 3W2DH 1YEIL 1J10A 1RVFH 1RUMH 3HE6B 1FN4A 2EXWC 4Y5VC 4R90L 1F11A 3LKNB 3P4LA 4F7CB 2GT9A 5HDOA 3BEVA 2DM2A 5I1AA 4RFOH 2CPCA 3TCLB 4U1NA 2GFBB 3SGJA 1HHGB 3IDJA 1NC2B 4M6OL 5CMAB 3MTRA 5I15L 2CJUL 5I0ZA 3IETB 5EORH 1Q9LA 2VLKD 1LGVA 3QUMA 1TJGH 3Q0HA 3BKYL 1YN7B 1C5CL 1MCOL 5KZCD 2FJHB 1KJ2B 4FQJH 3K2UL 5ICZB 2D7NA 5F21B 5BXFB 5FO9A 2J4WH 4PB0H 5ITFA 4QHLB 3RWJB 2FX8H 3DYMA 5AWNL 5E5MB 5EZJA 1K5NB 5IVXF 3P11L 5EO0B 1D9KD 3JWOH 1P2CA 4NO0A 2GTWA 4O2CA 4OTXH 1CFSA 5D8JH 2Q7NA 1FZOB 4H8WC 1X9QA 4GMSH 1CR9H 1P4BH 2MPAH 1BAFH 3CDGB 1IGTA 2PO6A 2HJFA 5ELIA 2XN9A 2JIXB 3VDBA 1RZ8B 4JFQA 5AZ2H 2HJKB 4LASL 4ELMB 4RMWA 1JHTA 4K23L 2I27N 2WZPD 1BJMA 5BV7L 3UPRA 5I76B 4LKCB 1G84A 1CXHA 3BD4A 1NLBH 2KDGA 4HBCL 4P9HH 4GS7C 2Z91B 2LVCA 1NDGB 4XTRC 4XX1E 2XA8H 4JFYA 3C5ZB 2IAMA 4F15B 4HJJL 4E42A 2EE6A 2F19H 1G9ML 5T1DL 4DAGH 5TDOA 5HSFA 2EIEA 5LGHL 4L3ED 3B2VL 1NCAL 4YXLL 5J7CC 1R3LB 5D6CB 3ESVF 4XPHL 5DD1H 1T21B 1WZ1L 2O5YH 1H3GA 1U6AH 1IMHC 3PV7A 1LO3L 3L5XL 1YMHA 2IFGA 4PJCF 4Q0XL 5E9DD 3PHSA 1UXSA 2OP4L 4NQEA 3SKMA 5GS2D 1I8IB 1JVKA 5JIKA 1FFPA 1I1AA 1VB9A 3I6KB 4PRBA 5T3ZE 5D96B 1WAAF 4ZSOB 3V5DA 3K74B 2ZOKA 5DMIL 4JKWA 1PKQE 4X4ZA 5E08H 4J3SA 5HI5C 4YR6B 1RZJC 2NY2D 2UZIL 3WFZA 3OR7B 2OR8A 4JFDE 4OZFA 1MHPL 1AFVH 1EJOH 4Y0GA 2WBWB 2CIIB 3JWNC 1DDHB 1KOAA 2VABA 1DANT 4JFZL 4Z18A 4F7EB 1PVHA 5IFJB 5ETUB 2WQ8A 5DMKB 5JHDA 3GBNH 4YPJA 4G80B 1T5WA 5C0EA 4WEUD 4NUGH 1AY1H 2IH1A 1YEHL 5DURB 3PDOA 1DBJL 5IKCB 3D39B 3V0VA 4GAGH 1AGCA 3BSZL 4GQ9H 5T1KB 4RFNC 3CVHA 4OZHB 1HHKA 3PF2A 4FMKA 3R4DA 4LLYA 4ORGA 4OFYA 4PJGA 2NXZD 4YHLH 5F8RC 4GRLB 3PJSA 1RIHL 2V9RA 5AAMA 1U58A 1P4IH 1OTSC 3IDMB 5BS0D 1HINH 1T22B 4JREB 3RU8H 3DHMA 4Y8DC 3LKOA 1YEEH 1OM3H 4LPWA 3A67H 3LPWA 3BP5B 2GSGB 2NY3D 3EDFA 3Q5OA 4JZOB 5DQ9B 5TQ0H 4NZUL 1QYGL 4MAYA 1WFNA 4EUPH 4NNPL 4V2BA 2FO4A 5B8CA 2DQCL 5I8EA 4N0FA 5C0AB 4OZIA 2W9LA 5CJBA 5DXWA 3TNNB 4QGYA 4P46D 2VKXA 1TPXB 2EDNA 5CD3A 2BMKA 1JPGB 4PY7B 4OT1L 4EI5A 1J1OH 4JFEA 2OJEB 3CSPA 3RX7A 1ND0B 4MJ6A 3ZDXE 4KUCF 5EN2A 3GNMH 2NR6D 4NYLB 5BZDA 4G8GE 2JB6A 3O4LB 3H0TA 4JVUA 2GAZA 1IAKB 2N4IA 3MRLB 2C7UA 3L5JA 2EKJA 5JA9A 4LDOB 4C83A 3DO3A 5T3ZD 1J87A 3RNKB 1ES0B 3IKCA 2F8VA 4ONHA 1UENA 3PGFH 3D48R 3X3FL 3KPLA 4LQFL 2Y1VA 1KCKA 3EYOB 1NMCC 3TA3B 4FMFA 2X89A 1YDPA 4JFDD 2AABH 5HTSA 2AJSL 4Y19A 2ADGA 5JPMB 3MJGX 3C09C 3ULUH 3S96B 4BSWB 2OZ4A 3LKPB 5IHLB 5FK9B 2ZUTA 4RGNB 2NY5L 5HY9B 1RULL 1RHHB 5D7LB 3UYRH 3KPOA 1AP2B 3W81A 5E2TH 1A7NL 2ZSWA 4C59B 4YHIA 4Q9QL 1XMWA 3T3PF 1T1ZA 2VYRE 4X5XB 4NGHH 1X5IA 1KELH 1ORQB 1ZANH 2F53E 5A16A 2CD0A 32C2A 5GIRB 4CMHB 4LSTL 5I6XC 5IMLA 1FL5A 1OGTB 1YA5A 3VFNA 5IB3A 5E5RB 5T5NG 4PV8A 2VLLA 2AJUH 3QIWC 1N6UA 1DJSA 4GRMB 3UJJH 5BW7C 5DVOA 4R4BB 1SM3H 3WIIH 1A1MB 4R3SB 4HKZB 4Z7UA 3O2VH 1E4XL 4HWUA 3VE0B 5LQBL 4P57A 2NMSA 1KG0A 2J6EL 5ICYA 2C4FT 3Q6GH 1A9EA 4MZ2A 1AO7A 1UZ6F 3LRSB 3R0MA 2EIBA 4FFVC 3PNWB 3PGDA 4Y1AE 1AGFB 1HI6A 1QSFE 3ARDB 4QNPE 3L3DB 1YQVL 1MJ7H 4LPYA 4CDHA 2BVQA 25C8H 4U1KA 5D7IA 3L5HA 5MENB 3F12B 4P48A 4S11A 4UNVA 1X7QA 3BPCB 4M7LH 1T6VN 1INEL 4I5BB 4M61B 4NO3B 5ANME 2VZ1A 3ARBC 3G9VA 1RUQL 4JG1H 2DKUA 2F9BT 4EXPX 4IRSD 1NGXA 5JMOC 2YWZA 1GZPB 4G8GD 5DEGB 1MEXL 4K94C 1X5GA 5GJSL 1BVKA 1QLFB 3X14A 5EBMA 3QFDA 3WLBA 4OGZA 5EZOL 4A2MA 1P5UA 4X6CE 5F9JB 5JXEC 1XCQA 5E24E 1FBIH 2Q76B 1L6XA 1EAPA 1BZQK 4PJ8B 4Z7QE 1IEAB 4JFYB 3O3BB 1KJ3L 1KTLA 1Q9KB 4NKDA 2PF6A 4O2EB 3UBXI 1UB6A 4HD9A 4X4MA 5TDOB 3WSQL 4DVBA 2R56H 4JFXA 3FFCB 1IAIH 2ZSVA 3T65A 4L4TA 1X5LA 3MV7A 3QDMB 4UILH 5B39A 4G8IA 4PB9L 4P99A 5F9WC 4GLRH 3O41A 1CICC 3D1MC 4XNZB 3SKMB 1E0OB 4NQCA 4PRBB 2C4FU 3MLRL 1NGYB 3V5DB 4BJLA 5C7XH 5JW4R 3RWFB 3PWNA 4WTZG 4NQTA 5IB4A 1KIRB 4CVXB 5JOFB 3EYVB 1QUNA 4Y2DC 3D85D 4QXTB 1FL3A 5I1LB 2E8YA 4RX4D 3RVWC 4M1CC 4LAJH 4JFFE 3D18B 4DFIA 4TUOA 4FABH 4O4YL 4XVJL 3ZE1F 3V6OA 2VDML 4X7CC 3U0WL 3K46A 3GHBL 3IU3B 5BQ7A 1W0WB 3DI3B 3BGMB 3SDAA 5F93C 5EU5A 1FNHA 5JOEA 5JR1H 1CFQB 4M1DL 3TEUA 5GJTL 4UT9H 1P53A 5GZOD 1NEZA 1QSFD 5SWZA 4EDWL 4HIXL 3AREB 2H9GB 4AJ0A 3GSNB 5E99L 4M5ZH 4XVSH 4IRJB 1AJ7L 3C8HA 3N9GH 3KJ4C 4JRWA 4NOBA 3RBSA 4QTHA 4HZAA 3GKWL 5GGQH 3T2OA 2JB5H 5CIPB 1YEIH 4N90D 1M71A 5GQBA 3O3EB 2D4FA 2XWBA 1VGEL 3LN5B 1NPUA 4O58L 4S1RH 1YC8A 1DBBL 1MCFA 5JW4N 4W68A 4FP8L 5KS9A 1X5ZA 3IGAA 4M6OH 1TCMA 1WCQA 2IADA 3QCTL 1H5BA 3J8F7 3J7HA 4YHYB 1X6NA 1HHHA 3NPZB 3DV6A 3HAEA 1CFVL 3AS2A 3BKYH 4NT6A 1KGCE 4KXZH 1A1NB 2BNRA 4R0LB 1MHCB 1JWMB 4KDTC 3H3PL 5DYOB 4WDIA 4PJIB 1I8KA 1J88A 4JFEB 4JZJB 1J11A 4IJ3C 5DMGD 2BERA 5AWNH 5DA0B 2IF7A 2GAZB 5IMKB 5DZOA 5T33L 1U8JA 5HHNA 5I17B 2WIIB 3QI9C 1A21A 5I1CH 3IJSB 1CU4L 1CE1L 2XQBL 2PNDA 4HBQA 3TYGL 1J05A 4WW2A 1YY8B 1B0RB 1MCDA 4JFFD 4P3WA 3MRKB 5BV7H 2NX5E 3H9HA 1F4HA 2X1QA 4JPWL 5DSCA 2W9DL 4OGAD 1KLUB 4UT6H 1LEGA 4GW4B 3KJ6H 3O6KH 4QXWA 3B2UD 5ERWA 4PJHE 3N1GC 1G9MH 1FCGA 5LGHH 4BH7B 2B20A 3B2VH 4C57C 5JDSB 4F9LC 4XPHH 2VXVH 5D2NB 1WZ1H 1BECA 1RJYA 4AIZB 1MFBH 1NCUA 3T4AA 1LO3H 2NY0C 3L5XH 5DJCA 5HGHB 3D0LB 2OP4H 1EEYB 4J3WA 4I3RH 4NM4H 2KZWA 3LDBB 2HFEB 2XZZA 1NANI 5DQDH 3NOIA 5DMIH 5GGRB 4KKLD 1CXFA 5FV2A 5C0JA 3RFZC 4R26L 2AW2A 3CFBB 2XNAA 5IB2B 4OCSL 2MHAA 4M7JL 3QG6B 2OCFD 2R2HB 5DJZA 3W9DA 1XF1A 4PREA 1AO7B 3HNTL 4UV4L 5CGTA 1TTFA 4FQHB 2EDRA 4JFZH 4Z7WA 3QHZL 1EEZA 4ONGL 1UWXH 5D1XA 5DD6B 2GHWB 4P23C 2R1WA 1EUUA 1VFBA 5ALBL 2QKIB 1KGCD 3BDXA 4BK4A 1I9EA 1I3RB 2BRRL 1QFWI 2J5LC 4TPRL 4I77L 1REIA 4AEIH 4NRXB 4JKLA 1LP9E 2GK2A 4Z7OE 5KSAC 1RIHH 4HZLB 4MLIA 3ILQC 4TNVF 5GGUA 4UIMB 4WTXA 2BSRA 1FGVL 3LRHA 1E27A 1BVKB 5CJ5A 4ZPTA 2EYSB 3O4OB 2XOTA 5EO1A 3BZEB 5FKAB 1MLCA 4JGJA 3QHFL 3BX7C 5GRZA 3ZDXF 5B3JE 1JNLL 4R4ND 1ITCA 1ED3A 3MUGA 3SY0B 2UYLB 1MCRA 3VWJB 5C1MB 4NZUH 1QYGH 4YAQA 3DGGB 2IQAA 4NNPH 2DQCH 4YEEA 3FHQA 3OF6A 4JFXB 4HCRA 2VAJA 4Q6IA 9CGTA 1YN6B 1J8HA 5I1DA 5INDA 4WFFE 1XZ0B 1D5MA 1JNJA 3O6LL 3T1FB 3VWKD 5B22A 3H42L 3MFFA 3WNLA 3MACH 2GI7A 4X6DB 2VL4A 2WW8A 4ZFOL 1NJ9B 1BF8A 1FNAA 1IFHL 1FPTH 1CFNB 1OQOA 1JBJA 3I50H 1L7TL 5IB4B 2WWMD 2BOBA 4PBXA 4XC1L 1NAMB 3KLAB 4X98B 3HNVH 4OZGB 4PJ7A 2CLVB 4E0RB 3TBSB 3RX5A 2P5EE 2BRQA 3MV01 1CXLA 3SO3C 1AGDA 2ZNXA 3ZKNC 1DBKL 3HCVA 3U7YL 4IS6A 1WBYA 4PJ9A 1AR2A 4LQFH 1IEBB 1PX4A 5EU5B 3T0DA 2FX7L 1A6AA 2XXMB 4Y5YB 5FEBA 1IE5A 1B4RA 5HYSG 2VZTA 1A6ZA 2UWEE 4MD0A 3TPUA 5ID1B 1U3YA 1ZWIB 2NY5H 3X11B 4IIQA 1RULH 2YD4A 5IVXB 1SBSH 3BZFB 4CU6A 3UTSD 1A7NH 2A73B 4Q9QH 3FHAA 5IOPB 4X6FB 3WIHH 1MHHB 1QEWA 4QNPF 1HQ4B 1DCLA 3SKOB 1NBYB 1S7WA 2NW2B 4LSTH 5KVEL 4KI5D 1UA6L 3PABA 1MUJB 4KAQL 3CAFA 2AK1H 3ZT6A 5IW6A 5F1KC 3HPLA 5L2KE 4KTEH 1JE6A 3NAAL 4BH8A 3MUJA 4P0DA 1HK6A 2WQRA 4G6FB 5FUCC 1VADB 3ARXA 2GITB 3G6JE 35C8L 1E4XH 4L8BA 5GS0C 1BZ9B 2P5WE 3T0EE 1U8OA 4WGWB 1T1WB 2V7HB 2VXUL 4L1HA 5L0QB 4KDVA 2XTJC 1SYVA 3QULA 3SKUD 4Q6YA 1DQTA 4F7TA 2H1PL 3ZE0E 1GSMA 4ZFFA 1FP5A 4GMTH 4G8EB 3OXRB 4Z7VA 3DVGA 4TSBL 1YQVH 1FFRA 1WJ3A 4R7NA 4WFEE 1I8KB 4HWBL 1T1YB 1JP5A 4JRYA 5EWIL 3SPVA 1UH2A 4ZOAA 3W9EA 2HLAB 4WVRA 4MQTB 4PJCB 5DJYB 4WFFD 4GBXB 4Z7QF 1F90L 5DJDA 1G6RH 3MRDB 3LSOB 1YNTA 4FXKB 4NWUL 4LLWA 1ADQA 4LMQI 4JPVH 5D5MB 2CRIA 4NN6B 2CLZB 2WNGA 5D1ZD 1I8LA 1ZVSB 1MEXH 2XZQL 1KT2A 4LHUG 5DJ8A 4P2QA 2YEZA 3K80A 5GJSH 3NN8B 3T2PA 1T0MA 4EEEA 2P5ED 5HPOA 1GGTA 4HIEA 1Q0YH 3P4OB 2MCPL 2B39A 5ENWB 4HXAL 4Y4FB 4D0CA 1SJEA 5GS0H 1CDIA 3I9GH 4HHAB 1KJ3H 1A2YA 1OGAD 1T1XA 1R6VA 1I3UA 1BQSA 5D9SB 3WSQH 3HI1B 3OKOA 1YEJL 1R3IH 5M95B 4X6BA 4KK5C 4NJAH 4OLUL 5DRWA 2ZUQB 4LARL 2AXFA 2WP3T 3UPAA 2Y06L 5ISZA 4DN3H 2Z31A 4ZNEE 4OJFH 1IL1A 3QZWG 1AR1C 2EECA 4I3SL 5FO7B 4X7DC 1D6VL 1T3FA 2AJYL 4IDLA 3QCUL 4BQ8A 3LQMA 3QIUC 4Z78A 1C8PA 3PIQB 3O3AA 3GIVB 4E41B 1WFOA 3TVMD 2RGSA 2D2OA 1JUFB 4AQ1B 1HQRB 5L2KD 1FL6A 2DLIA 3L3OB 4KKBC 2DRUA 5C0FB 1C5DA 1F4XL 2QLVB 1NBQA 2VDMH 5LG1A 2VL5A 4X99B 2P5WD 3T0ED 4F9PC 3ALXA 1FNLA 2DM7A 4JR9L 1KNOA 4M1DH 4PRPB 4YO0B 5GJTH 5GXBB 2E5EA 2APVA 3BDYL 3UROR 5CD5D 4WFHE 3FB6B 2B0SL 5FOJA 3MCKB 5GRYA 4EDWH 2OYPA 3FT4A 1G9NC 4HIXH 4P5TD 1KIUA 2PN5A 3INUH 1Q38A 3QXVA 7FABL 4X4XA 5A3IC 3QYCA 3V6ZB 4MJ5B 3GKWH 3G04A 3MA7B 2BSRB 4YHKH 4HLZH 4ZPTB 3O6ML 1EUTA 4XPAL 1JPFA 3TBYB 5TE6L 5C0BA 4V1DE 3GGWA 4O58H 3SQOH 3SDXA 3C6LA 1XAUA 3GMMB 5GS1C 3VFSB 1HSBB 4FP8H 1E6JL 4KKNA 1F45A 2V6HA 1L0XA 3P30L 1CDHA 5GSRB 1DVFA 3LV3A 2Q7YB 3QEQB 2IGFH 2AQ3A 1CL7I 4YC2C 3RZCB 3KPQB 3KHOA 1UJ3B 1CFVH 2MQCA 3QUZB 1AE6L 3JVGA 4L3CA 4ZS6C 1OAZL 4UDUA 2E27L 2Z92A 1H15B 3C8DA 5J6GB 3IDIB 1RUKL 2G75B 3MV8B 4MQSB 3RAJL 3O3UN 3GBLA 5L2JB 3SGJC 4F2MB 2Z35A 5F7KC 4WW1B 5ICXA 4OM1H 4P4KB 1MCHA 2APFA 3QIBA 3E2HC 3MRHA 1VEPA 4PJHF 4G6KH 4HK3N 4KVCH 3UEZA 3MBEA 1FZKB 2ILLA 4YDVB 3BO8A 3UTZB 5D7JD 2FL5A 3VFPB 1F4WH 1U8QA 4P2YA 3GI9L 4PJ9B 1CU4H 1NCBH 2J8UF 2NYYC 4KK9D 1B2WL 5IJKA 1CE1H 1N0XH 1TITA 5IBLD 2XQBH 2CO6B 3BPOC 3TYGH 3GM8A 3EZ8A 43CAA 3VFUA 1N7MH 4WUUA 1QSEA 1PYWB 4KJPD 1T4KB 1LWRA 4JPWH 2VLKB 1G0DA 3K1DA 2P47B 5HGAA 2VIRB 5JNYB 2CKBL 5KZCB 4BZ1L 1A5FL 5ACMA 1WIPA 4WI4A 4MD4B 1BVLB 4WFHD 3VRJA 3S6CA 2MKLC 4RRPA 2BVOA 1LE5A 2PO6C 3RIAF 3EFFB 5CEYA 3H6JA 3TJHC 3W0WA 1HILB 4MMZC 5HD8D 3WDHA 1D9KB 4RMTA 4NIKB 4KPHL 5I1IL 3LEYH 1I1YB 5A2IH 3REVA 4OAWA 5DC9B 2DKSA 4V1DD 4F7MB 3G5YB 3WDJA 1IEHA 3BYTA 3QFJA 2IAMC 4OCSH 1S78D 4KGLA 3UP1A 1UGNA 4Z7OF 4UV4H 1CD9B 3SJVE 3S37L 3BGFC 3KDMB 3CVIL 4Z7VB 3F62A 3UTTE 4UNTA 1TVBA 3QHZH 2CSPA 5CJQL 4IDJH 4HKBA 4JY4A 2KUTA 2XG5A 4OZ4B 5B3JF 5IJVA 1I1AC 4KHTH 2YHGA 3ZYIA 3GJEB 3VXNA 3OMZA 4ZO7A 1AHWB 4U33A 2HMIC 3L7EA 2BRRH 4L3EB 2APWA 2BY3A 3U6RA 4I77H 2PYFA 3ARVA 2ITCB 4HUMB 4YDJB 1A14L 4UTAH 1U8HB 1ZT4B 3WUWA 1RAMA 1IAII 4H1LA 3TBVB 2DQHH 5E9DB 3FO9B 3HB3D 4XNMA 1FGVH 3EFDH 2YUWA 1JZ2A 2WSKA 4I18A 1N2RB 1WIOA 3ROLA 1F3JA 4PGBB 1DEEB 2X1PA 3SCMA 3O9WA 3QHFH 1JNLH 1SJEB 2ZUSA 3E1F1 4WWKD 4X80L 4F37F 4XP5L 2GW5A 3TBWA 3VCLB 1T1XB 3DTXA 1GGYA 2VUYA 5AEAA 4P3CL 5C0GA 3ABZA 2R4RL 1C12B 2Y7QB 3CUPA 3L3IA 5J12C 5H94B 1C08A 3KHQA 3SDDD 2YD1A 5JQ6L 5DRWB 3GMRB 1X5FA 1T7WA 3IF1A 2EC9U 3K4DA 3MLWL 3VG9C 4XCEB 1JPSL 2FO1A 5B4MC 3DVIA 4NC2B 3FRUA 2CH8A 3KYNA 1VPOL 5T5NF 3LOWA 1IFHH 3WJLA 3VD9A 2VQ1B 1L7TH 2UWEF 4FZ8L 2NXZB 3BQUA 4HIJA 5C08A 1MCWW 1LEKB 4XC1H 2EEAA 4MAYC 5B8CC 4RDQG 4OLVH 5BS0B 4K9EC 4CVZA 4HIIB 3H9YA 4JY6B 5CZVH 3RVVC 2W0PA 3QH3A 3U7YH 1S7SA 3L6FA 4TTDD 4L29B 1VFUA 5F7DB 3TP4A 3CFJB 3VXMA 5E8PB 2NY3B 3BUTA 4EI5C 1HZHL 4K71B 1Z9MA 2W07A 1MJJB 5D1QD 3UTTD 4N0UE 4ODWB 1D5ZB 3WFHA 4NQVB 4B41A 3G6JF 3TIEB 4LNRB 4RA3A 5EU3B 2ATKB 2DQIL 4PJDE 1SMOA 1FNEA 1HXMA 1C7TA 1M1SA 4M43L 3G08B 1I4FB 3ZE0F 1R24A 4KXZI 1V3KA 3MLZL 4JHAL 3X13B 2JCCE 2WINA 5HGDA 4GSDL 5KVEH 3TGXA 1QPXA 2PW1A 3VFMA 4KAQH 3WNPA 3N85L 2ZZUT 2EXYC 4PJBA 4QRRA 5F7FA 3NAAH 3NIFE 3IRZA 4RAVB 1FZJA 1YPZE 1DVFB 1KCLA 3VMPA 4U4BA 1I1FA 3KPMA 3D0VA 35C8H 4K9EH 3LIZH 1W0VA 2C1PB 2GCYB 2VXUH 2GK0B 5DD3L 2YN3A 4HX1A 4JFDB 4D8PA 2H1PH 15C8L 1E4WL 1F8TL 2QSTA 3WFEH 5D93B 3PQYA 4NPYB 3FQTA 5TE7L 1BM3L 3PWUB 4HWBH 4ODUA 5EWIH 3FQRB 5DVMA 1OB1B 2HVKB 3U4BL 4I2XA 3GEWB 2EXWD 4NSKB 2P8PB 2UZXB 2DTMH 1F90H 1BIIA 4LSSL 1K8DA 4HEPG 3RBGA 5EZIL 1F00I 1SY6L 3BO8B 4NWUH 1KB5B 2EH7L 3L95A 3PV6A 1NCDL 5CSGA 2EDTA 3FRPG 5HVFB 2XZQH 5IMMA 1FNSH 1XF4B 2UVEA 3ZKMC 5SX5K 3F7YA 2D0GA 4HXAH 3RKDC 5IG7A 2ESVA 4LGRB 3QR2A 2P49B 1FG2A 2P42B 4JO4L 3MCLL 3IFLL 2XTLA 4QHUA 1AD9B 4N8VG 2DDQH 4GG8B 2Q86A 2CUMA 3QO1B 3HI5L 2OTWA 5C2UB 2AJ3A 1K4DB 1DQDL 1YEJH 3L9RB 2VQUA 4LFHG 1JK8B 3FO0L 4NNYA 1CQYA 3F5WA 4OLUH 4YHML 1JPTH 5KN5A 4LLUB 1NAKL 2X6MA 4ZYKB 4I3SH 1M6OB 1HH9B 2OTUB 1LO0L 1UM6L 4PJFB 5FDWB 3QCUH 4IRSB 3JUZA 3QXTA 4UT7L 1F5WA 1Z3GL 4QF1B 3OPZL 4RA0C 5FYKL 2VXTL 3VW3L 4N5EC 3NZHL 4QKXB 3KNBB 5EU4B 4QT5A 1MFCL 4XTRD 1NGQH 3QWOB 4PJ5A 3SDYL 2UUDK 2P7TB 4LSDA 1F4XH 5D71L 5EA0H 3MJ8B 4WI3A 2X09A 1MFEL 4DKAA 4X4YB 1FC1A 2LAGB 4JR9H 1QO3B 4L3AA 3BDYH 3FFDA 4UDTA 2IPUK 4MB3A 3ZKXB 4RMQA 4TVPL 1P7QA 1QRKA 2B0SH 3WLWC 4F33B 2C3VB 1B0GB 2VDPH 1ITBB 4LHUD 5TDNA 5F3HA 1SJVA 5ILTL 4I48B 3MRNB 7FABH 3H2WA 5DUML 2WBJA 3HN3A 4H5SA 4KMQA 5GGTL 1P7KB 2D7PA 3S5LA 3V6OC 5BVPH 1HXYA 3L3KB 4JRXD 5HI5D 1TDQA 3O6MH 1P69B 5GGRY 1RZ7L 4XPAH 4YNYB 5TE6H 3SDAC 1F3JB 2FSEB 1DQQA 1YJDC 5HGBA 5HHPA 4UZGA 5F96L 5H8DA 2CDEA 1W2KT 3MZGB 2DLHA 1E6JH 3D85B 5D2LB 1ZHLA 2WM0A 4AEHH 1Y6MR 3V9FA 3P30H 1PQZA 2G5BA 4POZC 2OQJB 4PUBL 4AENB 3BT2L 3ULSA 3MLVL 1CD1B 1TENA 1WFTA 2NW3B 4MJ4A 1DQLL 1CF8H 4JY5L 2FIRT 3BYYA 1AE6H 1U42A 2EYTA 4OUUB 3U0PA 4ODTL 5IW1A 1OAZH 3MZTA 3RWHA 2XRAL 4ZPVA 3K8KA 2E27H 1QSFB 3MGTB 4ODVH 3F7RA 4P2RA 3RAJH 3GBML 4HXBL 4KMTH 4HG4K 1PG7W 2N7AA 1RIUL 3LQAC 1OTSD 4LCWE 1ZGLB 3DMMB 4YHZH 4ZUTA 5C08B 3FOLA 3MXVL 1ZT7B 4LLQA 1H5BC 2HT2C 3E6HB 1RY7B 4M03A 3VGAB 2IMMA 5CWSA 5ANMB 3WS3A 4MQ7B 3WMSA 3ULVC 4JAMA 2JTDA 1T5XB 2X44D 3GI9H 1QRNB 3VXUE 2B5IC 5F7WC 1CVRA 1KJ2L 3D2UA 3RL1A 2DBJA 1I7RA 5CZXC 3BWAA 3OKEA 2VXSL 1PJ9A 3V4PL 4X6CB 3PL6A 4HDIA 1U3HB 4JFOB 1SVCP 2CKBH 1HWHB 1E4XI 3I6GA 1A5FH 1BD2E 4WO4A 3RJDA 2RHEA 2Q3ZA 1ONQA 3OAYK 5E00B 2VAAB 4RFEB 1PG7L 2WINB 2X70A 5IK3A 5J4MA 1LO4L 4GW5B 2XQYG 3LMJL 1IM3B 3JWDL 2JKXA 1IKFL 3MYZA 4WW2C 5BOPA 3MV9A 1M4KA 3OAZK 4F80A 1XR8A 1DZBA 1GHFH 4JZNA 3UYPA 4NBXB 5ACZB 1HOCA 3FB7B 2AK4E 3S3JA 4RNRA 4LVOC 3OKMA 3U9PH 3KPMB 4K8RC 2X2YA 3HAEH 5CEXB 2V5SA 3L3GA 1EERB 3CU7A 3S35L 4RISH 3VFRB 3K3QA 3C2SA 4JFFB 2BNQD 1EFXA 3CVIH 3P9WB 3PQYB 1FO0B 1ZA6B 1I7UB 4PGCA 2W60B 4K3GA 1KF9B 1TQCB 5EU7C 2Y6SC 4YDIL 2FD6H 5KG9A 5ADPL 4MNHB 4Q9RL 1U0QA 1HDMB 2Q8AH 1MRDL 2D4DA 4OV5B 1K8DB 4MJIE 5DVKA 5AAWA 1U3ZA 3QQ3B 4G9DB 2QEJA 3QIWD 1A14H 3L95B 3CPLA 1GC1C 3P77B 4UNUA 4LCWD 1CGVA 3OGCA 3UBXA 1P1ZA 2BC4B 5D1XC 4JKMA 5I30L 1EVUA 5C0CE 1MCWM 4JM2A 1A3RH 1YMME 4LHQB 3EJJX 4FFVD 5IG7B 1F6AA 3VFTB 3WD5H 4V2CB 2XPGA 5T3XL 3VXUD 1MRCL 4WJ5A 4X80H 4XP5H 1WWAX 2ADFH 4PGDA 4FG6C 5B38A 3B6SB 4PJEE 3MRFA 3GRWL 5C0DB 2R4RH 3V5HB 3NFPB 3VXRE 4IHOA 1GGUA 3F5WB 4M9PA 5JQ6H 4HUWB 3ARBD 2EKSA 5AUMA 3MLWH 4I8DA 3QRGH 4DUWA 4CRPA 5DJXB 1KENL 1BD2D 3WO3B 4R96B 3V0AC 3VXQA 1BX2A 2NXYC 5CGYC 5GZNC 5MEQA 2X4RA 4Q9BA 4BELD 1BZ7A 2AEIT 3OXSB 4FZ8H 2IBZX 3HS0A 4ZFZA 2NLJA 5DRXA 4P59L 4PJDF 1GC1H 3D6GA 3OJDA 3DXAD 4QRPE 4Q6IC 4G3YL 1D5BB 1UQSA 3ZHDA 1AKJA 2AK4D 2JCCF 4I4WA 4JO1L 2Y72A 2K7QA 3BHBB 4EVNA 4LCCA 3WUZA 1IM9D 1JJUA 1JYXA 3BH9B 2Q6WB 5TE4L 4PS4L 1ZGLP 1HZHH 2ZUYA 4M6NL 4MLSA 3NIFF 4AZ8A 1YPZF 4B7IA 2Z93A 1CICD 4JLRA 5JHLL 2A6KA 1FJ1B 1XGQA 4NRZB 3MLYL 4TNWK 1G9NL 3NH7L 5HYJE 3VWKB 1TCRA 1DQJB 3O11B 3QQ4A 3SDCA 3MLZH 3W39A 4XVTL 4JHAH 4Y2DD 4PJ9C 4MJID 4GSDH 1EJ6A 3BGAA 3RVWD 2D0HA 3G5ZA 1DQQB 4M1CD 5IB1A 4LOUC 2DL9A 3AXLA 3N85H 2P44B 5KJRL 3RWIB 1TXKA 5JW5B 2CUHA 4CMMB 3TJEL 1N8ZB 3VD3A 5C0CD 3T1WA 4HCRH 4YHNB 2FATL 4IIQC 1MCNA 5TF1L 2C3XA 2CXGA 4MD5B 1NFDE 2OXGA 5F8QC 2VR5A 5DD3H 3VH8A 2ATPB 4LEOA 4OLWL 1MVUA 1BBJA 4LPXA 5F1IA 3R06A 4FTVA 3RGVA 4BFIB 5DJ0B 3TFKC 1D5XA 4XC3L 1BM3H 3KYMB 1MI5E 5I1EL 2O5XL 1ZSDB 3LKRA 4L4JA 3V2AR 5E7FA 4K7FA 3VXRD 2KL6A 4MNQE 4NNXA 2P1YA 1ZHNA 3UTSB 3BP6A 2EYRA 1WFUA 4L8DA 1AQKH 4XXCA 4JN1H 1YEDA 4LSSH 1XGRB 2YZ8A 1T04B 5EZIH 1SY6H 4RMVA 4M6ML 1CLZH 2Z9TA 2EH7H 1VGKA 1LP9B 3WNNA 3KPRA 2X4QA 3QUML 2YPKB 1FYHB 4HWNA 2QTEA 2XWJA 4P2OA 3OSKA 3GMOB 4FN0A 3QPXH 5I1JH 4LLDB 3X12A 3EYQC 3HZYA 1J7VR 2JK5B 2BVYA 3DROB 3RL1B 5DK0A 4G7YH 1S7TB 4XB7A 4KZEH 1HNGA 2PCPA 4H25A 2DQUH 3L5WA 4JANB 1KCRL 1BLNA 4WI2A 4HC1A 4JO4H 3MCLH 3IFLH 4AT6B 4YQXH 3NMEA 2H2PC 1MF2H 4JQIL 4MNGB 4XRCA 4JB9L 3HI5H 3P73A 2P8MB 1NEUA 2ARJA 5EPMA 4XP4H 5DFVC 5FGRA 2R2CA 4ZUUA 3D3VE 3FO0H 3OZ9L 1I8LC 2YPLA 4G7VL 1WCBA 3IU4L 4LCYB 1NAKH 3GSXB 3RTQA 1O5DT 5HYJD 3BE1H 3QI9D 3U4EB 4M7KL 4M7ZB 4JN2B 4I3GA 1LO0H 3K4ZA 3NTCL 1UM6H 1BQHA 1CGSL 1FDLL 4OQTA 5EUKA 2NZ9C 1BJ1H 2QSVA 4YFEA 4OZFG 4UT7H 1FVEA 2B1HL 1JF6A 1Z3GH 3STLA 3OPZH 4F58H 1A64A 3C6SB 5D1ZB 2AJZA 1U8PB 5FYKH 2VXTH 4W4NA 3NZHH 4HMEA 4HK0B 3BAEH 1CDCA 1LK2A 5D71H 4LQ1A 4PGCB 4GXVL 1MFEH 5BMFL 2XWTB 3HRZA 3EW3B 2DQFA 2Z31C 1GYAA 3E8UL 2O5ZL 4D3CH 1UM5L 1N6QL 5EOQL 5KG9B 1G7QA 1OGAB 4TVPH 1UH3A 2IALA 2XKNB 2BSED 1Q94A 2NY0D 2GJZB 2BSSB 1MI5D 4CBPA 3GSWB 3GMNB 1MIEL 1RZFL 4MNQD 2VLRA 5IHZA 2FR4A 3P3YA 2AQ2A 4CW1A 4QHMA 3TN0A 2A6JB 1NGZA 4ONFL 4OKVA 5MEPB 1CLOH 4PPTA 1NCTA 1BFOA 1FG9C 2FGWL 3A0OA 4XCYA 3S36X 4HQQH 5F96H 4Y5XA 2WUCL 1OP9A 2XPGB 3AVEA 4NHCH 2H6PA 4LFHD 5DTFA 4OD2B 4ZUSA 1BMGA 2B1AL 4Y16B 3QDJE 4P23D 4XPTL 4PUBH 4P4RB 4CNIB 3BT2H 3MRFB 3MLVH 3GSNL 1JWSA 4CJ0A 1G7LB 3VXOA 1DQLH 3T0EB 1G7MA 3HKFA 4LLVB 4JDZA 4ODTH 2P8LB 1VESA 4N0YL 2VR9A 1GRWA 5I66A 4RBPH 3EOAB 3LKQA 1N6VA 1KIPA 2ICEA 2RJMA 3PE9A 3C6LC 5KSAD 3TV3L 5J3HD 3ILQD 4P5TB 4MA1B 3GBMH 4HXBH 4W6YB 1IQDA 5IW3A 1RIUH 1A6UL 3D3VD 5T1LA 5FUCE 3DUUB 4TSCL 3MXVH 3NCMA 1DVFC 3FCTA 4L4VD 2XFXB 4I1NB 3GMLB 2YD9A 5DI8A 2HTLC 4ZUWA 2XTJE 3CFDA 3MJ9L 5BVJA 1DUYA 3JVGC 4TUJA 3MREB 2PR4H 5HPMA 1KJ2H 3IT8D 1U8KB 1JIBA 1Q9OB 4U2ZA 1XIWB 4EQ2A 1ZA3A 1OAQL 2CDGB 2VXSH 4LVHC 4S1DC 4UOW0 1P84K 4ZSOE 2ADIB 3P0YL 3HE6D 1R3JA 5FCUL 2FWOB 3WFBH 4O9HH 3QIBC 4MAUL 1A8JH 2VDRH 3TESA 3MBEC 2DIJA 1MQ8A 3O3DB 5FYJH 2R2EB 4LPVA 1YYLL 1W72B 4J6RL 3OHXB 5E4IA 3L3JA 5ESQA 5IJKC 1WC7B 1KJVA 4ODXA 3JWDH 3B43A 4TQEL 5T3XE 3VXPA 5DDHA 4JGMA 4X9IA 3ZKND 4XPBL 1KJMA 4APQA 2YUXA 1H0DA 3D69B 1OT1A 2KH2B 3S4SA 3BIKA 2YK1L 5D7JB 2OZ4L 2A9NL 4FFWC 4YK4B 5ADOH 3RNQB 2OMBA 3IFNH 3S35H 3RUGA 4HFWA 3VFOB 4LU5L 5K9JL 3LH2H 2DICA 3C08L 3CFEB 3RGVB 1NDMA 4OBSA 1D5XB 3QDJD 3QQ9C 4MX7A 1T0NB 4X7FC 3U7WL 3MNWA 2B4CC 4X7TB 4LBEB 4NFDA 4WHCA 3TLRA 1MJ8H 5ADPH 3V4VH 4LIQL 4Q9RH 1VFAB 4OCLC 3HMXL 1KEML 1S9KC 3KAAA 1SYSB 4PJEF 4NP4L 1JN6A 4RDQF 4D9LH 1I7TB 5C0AE 3U30B 3WIFB 3MV11 1RIVH 4U6VL 3SN6N 5JPNB 2I26N 4QHKJ 4G6ML 3LPGA 1DQML 4R9HA 5KOVC 5I30H 1NGWA 4QXUL 4AMKL 5SX4H 2XTJD 3O2WL 5HDBE 5SX5H 2DD8H 1KFAL 1UH4A 4V1DB 2EO1A 3GMPB 2ITDB 1KBGH 1QKZH 3O45A 1MRCH 4FNLH 2WUBH 3FO1A 3B9KA 3R0NA 3O4LE 5HHOB 5DFWH 3OB0K 5L8LB 3RDTA 4W6XB 2X4PB 1X3DA 3OAUH 3IDXH 3ZT7A 5IMOB 4AM0A 1WT5A 4WV1B 4XBGB 2X5PA 4PG9B 2X4TB 4LGSB 2B4CH 2FCBA 1C16B 1OL0A 4I18C 4P46A 2V9TA 3SCMC 3O9WC 3HZKB 2DLGA 1AXSB 1EGJL 4PJAB 4UQ3B 3QQNA 1JGUL 5T1MB 4UINH 5LWYL 1J1PH 4I0CC 4P59H 3R1GL 2NY7H 5DURD 5T3XD 1CGTA 1SEBB 4NUJB 3NCJH 2BOCB 2UUDH 4UAOC 4JO1H 4EUPA 5IF0B 1ZTXL 2V9QA 1OY3B 4Q97A 3VDCA 1RMFH 1R3KA 5TE4H 5JORB 1NEZG 4WWKB 4GRLD 5F97E 1D6EA 4O51A 4HPYH 4FQLL 3WJLC 3MJ7A 3MROA 5DJ2B 3TYFA 3I02A 3BQUC 1EHLL 4OCNC 3GB7A 2AKRB 4MJ2A 4QLRA 3DRQB 1AR1D 3CNKA 3L5IA 3MLYH 3VXSA 1NFDF 3S3PA 3JXAA 3NH7H 1NAML 3ARUA 2GJ6A 3MRMA 3NFNB 3QIUD 1ZLUK 1JWUA 5CBAB 4QHMB 2VWEC 4U6YA 4XVTH 3ROOA 1K9TA 4ELKA 4OKVB 3C5JA 4OB5L 2VZVA 5DEFB 4KKBD 2HVJB 5KJRH 1BVZA 2ADJB 5JXAL 5FYLL 2HJLA 2XY1A 3HR5A 5DTFB 2FYYA 1FLRL 4XP1L 1U3HC 5F88B 3MRBA 2FATH 5HVHB 1U2CA 3BP4B 3IDYB 5TF1H 2EO9A 5F9OL 3V79C 4KWUA 1NMBH 1IGCL 2XN9E 2GIYA 4XNXH 2JJTA 5L9DL 2ICWJ 3O4LD 1KCUL 5AYQA 5K9QI 1KIPB 3UTTB 4S2SB 5A3ID 5I1EH 1FGNL 1JTPA 4J3XA 3EOTL 3DRTA 2W9EL 5H35B 4NC1E 2DQGH 5CJ8A 1DBML 2E7HA 4EDXB 3MLSH 1G7HA 1URLA 4GG6F 4FQXA 2V5YA 4BFBD 2BFVH 4KJYA 4UU9B 5JW4M 5SV3A 1UC6A 2Y07L 3U2SB 1TIUA 1OSZA 1KLGB 3WN5A 4G8GA 1A7RL 3BN9C 4YPGB 5SWSB 1BJ1J 1ODAA 4LVNB 4N9GA 2DM4A 4NQEE 1UB5B 3X17A 4NHUA 3G9AB 4HUNB 5HYFA 3BZDA 4ZS6D 2VC2L 1KCRH 3QNZA 4WRLA 2H8PB 5SV4A 5J1SC 2H45A 5FOBA 3IJHA 2BVPB 1KXTB 2H32B 4WHYG 1CT8A 4XP6L 3N50A 4JB9H 1X5YA 2R8SL 1XCTA 3OAYH 4Y4HA 3UJIL 5AYUL 3ARTA 4YGVA 3E6FB 4KK8C 2ERJB 5EU6B 3OZ9H 5EOTB 4HV8A 5JHDE 4G7VH 3TZVA 5D7KE 1XR9A 5CP7B 3IU4H 3OX8A 1X5AA 3WFDH 4Y5VB 3IAGC 5DJ6B 1PGRB 3OAZH 2Z8RA 1KJMB 4M7KH 3U46A 2Z0BA 3NTCH 2DYPA 1CGSH 1FDLH 2F53A 2QQLL 2B1HH 3F7PC 5EUOB 5KSBB 4PJGE 1LK3H 3QWQB 4K8RL 2OI9C 1NBZA 4UUJB 2X4UA 4XBEL 1NC4A 1MIML 1CG9B 5CUSH 4NO0D 2E9JA 2P4AB 3HHRB 4WI5A 1S8DB 4GXVH 3DX6B 4MA8L 4NKIL 5IV2A 3EYSL 5BMFH 1FIGL 1Z5LB 2X9XA 1QLEL 2A77L 2Z4QB 3T3ME 2PO6D 1N6QH 1NGPL 5EOQH 5CKGA 2XN9D 4JJ5A 3MLUL 1IAMA 1YECL 5FUZL 3TJHD 4Y1AA 1UKQA 4YHOL 1FH5L 4N0UB 3WE6B 4DN4H 1I9JH 4M8QA 1MIEH 2C26A 3JV4B 3OKKB 4PJDB 4OZIE 1FHGA 1QTYT 2V17H 1U8IB 3D5OF 4HS8L 1XH3B 2BSTB 1JTTA 4OI8A 2IAMD 1U93A 4K7PY 3KYOB 4ONFH 3IVKB 3QUKA 2JCCB 4C4KT 4JFEE 4XCNA 5CZKA 3F6IA 3O45B 4Y88A 4QHKI 1G6VK 4GS7B 4MCZB 1KN2H 2B1AH 4NQED 4OCRL 3D25A 1R0AL 1YPZB 1I1AD 1FZMA 1ZXQA 1AIFB 4O02L 3WEXA 1DE4B 4LSRL 2WBJC 4QOKB 2HMID 3RWCB 4F3FB 4RQQA 1A4KA 4RAUB 2IEPA 3ECBA 7CGTA 4N0YH 4U1GC 1EEUA 4LCIL 1PZ5A 4PLJD 2AP2A 2IANA 4QRUA 5K59E 3TV3H 1S7UA 2C1OB 4YIQA 4LHUB 3STZB 4OF5A 4R8WH 5I8CB 1A6UH 5JHDD 1L0QA 5D7KD 4TSCH 5DQJB 5C6TL 5DMYA 4E9LA 3HNSL 3RJQB 2IC2A 4BUGA 5C8JB 1TJIH 3TNMA 3IDGB 3MGOA 2A6IA 4JRXB 3AU1B 3PHQB 4KTDL 3TM6A 4ZQKB 1S9WA 3MJ9H 3P9MA 1EHNA 5IM7A 3DVNA 4BSVB 4NO5A 1HYRC 1BOYA 2D7TL 1QQDA 4OFYD 5DA4A 1MY5A 3VFWA 5EDXA 4GAYB 3H7BA 2ORBL 2ZOLA 5FF6B 4X9GA 4LIQE 5E94B 1OAQH 1J12A 2DWEA 1T2XA 4YX2L 3CH1A 5DGRA 4OZHF 4Z5RA 4DGYL 3ZTJG 4Z7UE 5B4MD 3QZWB 3LY6A 4RFNB 4MAUH 1M05B 3RVTC 4QCIB 1XF5A 4MDJA 1AO7E 4GRWE 3QB7C 4DZBA 3CH8A 4YDLC 1JWUB 4PFEA 1YYLH 3ARYA 4J6RH 4NDMA 4ZOCA 2GSIA 3UTQA 3KYAA 4MAYD 4DOHE 4X8JB 5D7IE 5IHUL 4NO2B 1X6LA 2VISA 4TQEH 1QD0A 1U8LB 3RVVD 4M48L 4NRYB 4XPBH 5MHSE 2RCSL 4OLXL 3CSYB 4JQXA 4KK6C 4XT1C 4Z7NE 3PL6C 4PRAA 2J1KA 5ABDE 1KPUB 1OTUC 1XGPA 4XZUA 4DZ8B 3QSKB 4EI5D 2A9NH 3QUXA 4NQDA 4JFED 4WO4C 3KPSA 1V8HA 3FAXA 3PWLB 5K9JH 3C08H 1KPRA 4I9WE 3C60A 5GGSA 3TO2B 1JGEA 3A6BL 5HDBF 1KXQE 5F7NC 5EC1A 3IFPB 2R69L 5D70L 1EHXA 2ICWI 1QA9B 2VNCA 2M2DA 4TNVK 4WUKL 4GW1A 3HMXH 1KEMH 2X89D 2VH5H 2NPLX 5ID0A 6FABL 4X4ME 4Y19D 5EIIA 2EXYD 1Q9WA 3TBTA 3TIDB 4L4TE 2RFXB 3B9VA 3MV7E 3MLTA 5DLML 5C86A 4Q2ZA 5GHWL 4U6VH 4CADA 4HF5H 5IP4A 2LVEA 1DQMH 3O2DL 4HS6B 4NQCE 4AMKH 4YHPA 1NMCB 3O2WH 1GAFL 3OV6A 3NCCB 4TN9A 2EDLA 3L7FA 3I3EA 4HGWB 2VSDA 2NY1C 4RAHA 3IJHB 3C09B 1A7BA 4FXGA 5J11B 3NFSH 3QG7L 3BW9A 1TZGL 1WZMA 4KROC 1L9NA 2QQNL 3CFIC 2AI0L 2BNQB 3VI3E 3Q2CA 4UOJA 2D0FA 4CAGA 2NX5A 3PXJA 4YGVB 5E1HB 3STBA 3T0BA 2YSSA 4XHJC 2VZOA 3K2MC 4B7LA 4PRNB 4J1UB 2VTFA 1OPGL 4JM2C 8CGTA 1ZS8B 3CFKA 4A6YB 1AO7D 4PJHA 3MUHL 5I16A 1ZHKA 1I1CA 3OKLB 2DYPB 4JPIB 5EB9A 4EI6B 3QIWB 3JTTA 2R0ZL 4AQOA 2ZJSH 2A2QT 4LCWB 5F1SA 4J12A 2J8UA 1QACA 2PYEA 3NCEB 3ZKMD 4LDLB 5GSVA 5MHSD 1NC4B 2R0LL 4WNQB 1PLGH 2CLRB 4M62L 4ZAKA 2PTTB 4KRNA 2R1XB 2QL1A 1K8IB 3VFGL 5HHME 1S9XA 3VXUB 3M1BB 5KS9E 1RD6A 3TH2T 1A0QL 4OLZL 3ARQA 3PDDA 3IJYB 3PWPA 3EO9L 2ARJQ 2D7MA 1OARL 4P5KB 5DS8A 1VKXA 4QRTA 1DBAH 3MR9B 3DV4A 3F7VB 3B5GA 3GMQA 4FQQA 1QPPA 3ARBB 4HGMA 3ULVE 3MRRA 5SWQB 1IC5H 1MAKA 2Z8VC 1BD2B 4EBQL 4HG4J 4CGTA 1U92B 3CXHK 1JNHA 1E28A 4LCCC 4BA8A 5I19H 2AXGA 1YUHA 3LEVL 3LEXB 5LBSH 1KLFA 2J12B 3DX9A 2P24A 1FFNB 3ILPB 4L4TD 3MV7D 2F15A 4JJHA 3THML 5FYLH 3DXAB 3HZVB 1KPVA 1GZQB 4XP1H 4OFKA 3B9AA 2FGZA 5EBLA 2AK4B 3H3BC 4NQCD 1BEYL 5CLWA 5J9PB 1FZMB 4M3JA 3LS4H 3JV6B 2D03L 4E5XB 1TZHA 5F9OH 1WBXA 1IM9B 3WLWD 4Z76B 4QYOB 5DR5H 2MSPA 3VXTA 1QFUL 5FO8B 3SDCC 8FABB 4Q7DA 1OCWH 5BZWA 5DVLA 2V2XA 1CVSC 4PLKC 2HN7A 1YY9C 5L8JB 1H3TA 3DUSA 5F9WB 4L8CA 1CICB 4J3VA 3WIHA 4HIHA 3DUHA 3MYJB 3SOBL 5CBEB 2QR0A 1UKSA 3FOMB 2W0FA 4U6XA 1R5VB 2A83B 2W9EH 3VU2A 1AD0B 3SDAD 4NKMB 4M5YH 1DBMH 4N5UA 1CLYL 1S5HB 3GFUA 5HYIA 2ZUUA 3MFGB 5T3ZL 4Y2DB 1J86A 4K3HA 4MJIB 5EFIB 3G6AA 5DWUL 1CCZA 1M7DB 1BOGB 4POYA 2Y07H 3RGVC 3HLAA 1QQDB 2J6EA 1A7RH 4PGEA 2FDBP 5EU7E 2XKSA 3HZMB 4XXDA 3BP7A 1CWVA 5C0CB 2VC2H 3MO1A 1JV5A 1LE9A 1UEYA 5HHMD 1TZIB 4X0KB 4E41E 4XXCC 4PJGF 4RRPG 2HRPL 2H2SC 2APBA 4U3CA 4XP6H 5K33A 3T8XA 2AEQL 4U1JB 3FB8A 3HA0A 2DAVA 3KJ4B 4PJEB 1YQ2A 5AYUH 1RU9L 3U30C 1YEFH 4P2OC 1FV1B 1NUFA 1KB5L 2HT2D 5DRZA 3VXRB 2UWEA 5ITBL 4ZMAT 1CIDA 2OL3B 3M45A 1MFAH 2VISB 3ULVD 2NNAA 3T3MF 1RZKL 5TH2A 1I3GL 2XT1B 3AUVA 3BJLA 3T77A 5K9KA 5MI0C 3AMLA 4JDTH 5M94B 3EYFA 2QQLH 1N5AB 1RV6X 3FTGB 4WU5A 2X1WL 2X42A 5FYKU 4X83A 3TVMA 3H9SB 2FEDC 4XNYL 2GYSA 4OZIF 4WHTB 5TDPA 1JGLH 4LF3A 1UXWB 1OLLA 1MIMH 4MDIA 1UCBL 4NKIH 1MWAB 1FIGH 2CUIA 3G6JA 4M6AA 1QLEH 2A77H 5SX4I 3RTQC 2P5WA 5DK2B 1I9RL 1RZIA 1NGPH 1VERA 2VDLL 4G8FA 4ZXBA 4IJ3B 3MLUH 3I85A 1AQDB 3HPJB 3LB6C 3N1MC 5DHYA 2CK2A 5FUZH 4JO3H 5IFAL 1NCWL 1ZHBB 3QEQE 4YHOH 3O6FA 5E8NB 1KB9J 1J8HE 4BSJA 1JYWA 3FQUA 4HS8H 4PTUA 5HYJB 4K8RD 2Y5TA 1FAKT 2DQJL 3DWTA 3PGCA 2WP3O 4OCYL 4XBPA 1I9IL 2EH8H 4PD4K 5K9OA 3FQWB 5K59F 4ZTOL 5IR1B 2I07B 1AGEA 1Y18B 3MV8E 3GUTA 5F1NB 1G7PA 5LGJB 3WXVL 2BNUB 4N8CH 4YBHA 1GGBL 4K3EH 3OB0H 5E2WL 4AEFA 1KIQB 2Y6SD 4OCRH 4ODSL 4PJ7E 4TOYL 5EC2B 1R0AH 2E9WA 4TRPH 1ETZB 5C0NC 1T20B 1N3NB 5F7UA 3MA9L 1N26A 1NFDB 1CXKA 2D9QB 2BHUA 1U8MB 1XGUA 4E41D 1CFTB 3TN0C 5F89B 1P6AB 3GJFB 5CAYB 2NY0B 4Y5XC 3JSSA 1HHJB 4MGXA 4U1IA 2YWYA 4WIQA 1MI5B 3C9NB 5INCA 3KR3L 3OBAA 4F57L 4Z7UF 4XWOC 4QRQB 2ED7A 1PEZA 3S36H 4MNQB 3NZ8B 1K3IA 3GDBA 3UJTH 5C70A 3HNSH 4ENED 3GSUB 1I8MA 4CN6A 5JTWA 4LKXA 4ZNEA 4KTDH 1JGDA 1N59A 1IAOB 5C07A 2IPTL 4N8VB 1R5WA 5CINL 5E8OA 5C9JB 3OL2A 4FG6D 3DURA 5D7IF 2D7TH 3ARFA 1WBZA 2Z8SA 2ORBH 3MRCB 4P23B 1IVLA 2ZG3A 2OS7A 4Z7NF 3GI8L 1N64H 3HC0A 4YX2H 1K4CA 3RIAK 3QEUB 4DGYH 3P4MB 5H2BB 4U1HA 2SEBB 3ES6A 4NKOA 3K8MA 5JO5B 2RAMA 1QLRB 2ENYA 2J5LB 2EE2A 3FT3B 5CGYD 3TWCL 5FYJU 5GZND 1RUAL 2YC1A 1UACL 3IFOB 4LEXL 4ISVB 4LRNH 4YUEL 1ZLUH 1BGXL 3C8KB 2IH3B 4Z7VE 5KSAB 3FN9A 3PWVA 5IVZA 3EOBA 2DS4A 3OF6D 4RGOL 5IHUH 4JRYE 4LVNC 4ZUVB 1J8HD 4L4VB 4KHXH 4M48H 4KQ4H 3RWEB 2RCSH 3N1FC 2KZ1B 4OLXH 5HJ3B 4PRHA 3TT1L 1B0WA 1T2JA 5DO2D 3IXAA 4Y2OA 1RJCA 4PLOB 3WHXA 1T66C 5IESH 5ESAB 5CHNA 3EO1A 4J8RA 1GPOL 2FBJL 4OGYL 1A6TB 2FJGA 2PXYA 3RIFF 3VRIA 2CIKB 4CU8A 1INDL 2VO5A 3ZTJH 3JWOC 2X9WA 4X9BA 4PRDA 4R4FL 5J13B 2YRLA 4B0MM 4AK1A 5E6YA 4S1SL 1A4JA 1U91B 4NWTL 3HR6A 3BD3A 4X6DF 3A6BH 3UDWA 5TFSH 1FNGA 4APQC 1VACA 3PWJB 4JKPH 4RSVA 4PJ9D 4XCFL 3V5KA 4WUKH 1LQSR 5FKPB 4YBQC 4LOUD 2FZ3B 4OZGF 5DMJB 3NACL 3OKDA 1IKNA 3MMEB 6FABH 3HG1A 4P9HC 3VI4E 4K7PL 2NY2C 5DT1H 2X4OB 4XHQA 2HFFB 2F58L 3HLAB 3SO3B 4K2UH 1DN2A 1I7ZA 1QFHA 2VITA 5GHWH 5CSZA 4F37K 1OTTC 2B2XL 1IC7L 1MHEB 2CRZA 5ISZE 2DIBA 3O2DH 2DQTL 1HH6A 4QWWC 1FO0L 2HTKC 5E8DL 3V6FB 3PXHA 3AROA 3TFKD 3EKCA 2W92A 3QG7H 2R2BA 2A74B 2QQNH 3TO4A 1HIML 2ZPKH 4JFPA 3B3IB 3QDJB 5BS0E 2F5BL 3OJVC 3QJFB 1JRHL 1S9YA 1RJZA 2VZUA 1G6RB 3SDDA 5KVFL 5KSVA 4OCXH 1JHKL 1AGBA 3EDKA 4KRMB 3HC3L 1U8NB 4ZS7H 1IT9H 2NNAB 3EYUH 5GS2H 5KS9F 1JHLL 1ORSB 3GHEL 2R39A 1UFUA 4KC3B 2BCKB 2ZG2A 1CK0H 1JGVL 1LHZA 2FJFB 4WU5B 1O0VA 3B9KC 1HEZA 2A9MH 4JRYD 3ULVF 2D7OA 3RDTC 1S7QB 3MNVA 1LNUA 1QBML 3QXAA 2Y9RT 3BPNC 2HKHL 1K2DB 2R0LH 2F5AL 2EEDA 4M62H 1XGTB 1SVZA 2XTJB 4UOW1 5KTEL 1WT5C 2H2PD 4UMGA 1IGJB 2EIZA 4BYHA 3BXNB 4P46C 1L7IL 4HAFA 1DFBL 1S7VB 1H3UA 5DFVD 3AC0A 3U36B 1BFVL 1NSNL 5GRJL 3T08A 2ZKHL 1J8KA 3SJVA 4P2QD 5B21A 4BZ2H 4X9FA 2XI9A 4ZODA 5D1QA 2L7JA 4ZFOA 2BVEA 2I5YH 1LD9A 3DETC 2J8OA 2ED9A 5D5MF 4PTTA 1AI1L 2A6DA 4FXLA 1MH5B 1XT5A 2NZ9D 3VGDA 3QA3A 2IPKA 3EO0B 3QNYB 3B5TA 1TTGA 2D31A 3LEVH 1EIBA 2VN7A 2O61A 1KTDB 3P9LB 4C56A 4F7PB 1MREL 3QCVH 4HJGB 3HE7A 4IMLA 3THMH 4X5WA 5LKNA 1A6WL 1KULA 2K9UA 4U1LA 5ISZD 4MHHG 2Z31D 1HKLH 4YFDB 1BEYH 3FB5A 2GUOB 1TVHA 1HHIA 1QFUH 4YFLF 3QUYA 5C0IA 2A0LC 1P84J 2ZUVA 5I2IA 3IRPX 3QXDA 4AG4L 1FVCB 2AQ1A 2H26A 3IDNA 4AIXA 1NFKA 3DIFA 2YRPA 4D94A 1IGYA 4WUUE 1WF5A 4RIRA 4HKJA 3RX8A 1PZUB 3QJHA 5J1TC 3FQXB 3GIZL 3QNXA 1CLYH 3I75A 3QIUB 3S98A 1I8MB 1T83A 5T3ZH 4KQ3L 3ULUC 3B8YA 2EDDA 5DWUH 5EBWB 1UZ8A 1R5WB 1T7XA 2JJVA 4X7EC 1QSZA 1TQBC 3T4YA 2DQDL 3RWDA 2JJTC 2QQKH 3BVNB 3SE9L 1RFDH 3IYLW 3V0WH 5IGXL 3SBWA 5HYSA 2NCMA 4GUPA 3MRPB 5MEOB 2VERN 1ZEAL 3C5SA 4L1DA 1UYWH 1VFOA 4PJXA 5CEZE 4DKFL 4DEPC 4MSWA 2WWKT 3LQZA 2BZDA 4UQ2B 4PJFE 4L5FL 3LN4A 4HWBA 2GKIA 2HG5B 1A9BA 5C0BD 3RPIB 5DHVB 1LO5A 5DJAA 3QFJE 3C6LD 4FQXC 2AEQH 4Z77B 5IQ9B 1SJHA 1CL7H 4KRPC 4JEGB 4R7DB 5GISL 1DVFD 4HSQA 1DUZB 3KGRA 1KB5H 3WN5C 2HTLD 3BUYB 5IB5A 1Q0XH 3MRIB 1RZKH 4N0CD 1I3GH 1RK0B 1V3JA 1DLFL 2XYCA 1A1OB 5GS1B 4LLAA 5I1KL 2UZYB 2DI8A 1DN0B 4D0DB 1OP3K 5J11C 5KSUB 4MA3B 1PW3A 3GSVB 4DGVH 5KVMC 5A2JH 5EZLB 4S1DD 4Y4HC 2F74A 4RCAA 4YC2B 4KZDL 1XF2A 1E6OL 3QIBD 1IAIM 3IAQA 3OR6A 2BDNL 1A4JB 3TZVC 1UCBH 2W0KA 3O8XA 1FN4B 4XMLH 2L0DA 1F11B 1KN4H 4MVBC 1CFBA 4Z0XA 1RZGA 1X4ZA 2CDFA 2GT9B 3BEVB 3BKJH 1DLHA 5D2LE 5I1AB 4U1NB 3CLFL 1F4AA 1WWCA 3IDJB 4PJ7F 4DGIH 4ETYA 3DSFL 5IFAH 5BRZA 3WCYA 1ZGLM 1TETL 3GSRA 4WUUD 3E2HB 1QSED 4HH9A 3UBXG 1Q9LB 2VDKL 3F6LA 43C9A 2VDQL 2MWCA 4HK3J 3QUMB 4KV5E 3BFOA 1I85A 4I0KA 3MRJA 2DQJH 4FFWD 5JUEH 1CE6A 1I9IH 3QDGA 4ETQA 3CX2A 5I8KL 2YD8A 3BPOB 4GKSA 3KXFA 5FO9B 1DTUA 1FORL 2V2WA 4KVNL 1H8NA 5ITFB 3UXFA 5IT2L 3QQ9D 5C0RL 5B38G 4YH6A 5C08E 2Q8BL 1GGBH 5EZJB 1GGIH 3W0WD 4ODSH 1RK1A 4N90E 4TOYH 5CEZD 4G9FA 1P2CB 1TTUA 4NO0B 2GTWB 4O2CB 1CFSB 3HC4L 4J2XA 2IQ9L 5HHQA 3DPBA 4XMKL 1RJZB 1G7JA 3MA9H 4RGMC 1QRNE 1IGTB 1IQWL 2AAVA 4LSVL 2PO6B 3QFJD 4NN7C 2HJFB 1QVOA 4MB4A 2XN9B 2PTUA 4JFQB 5DC4B 5HVGB 5ALCH 4KMLB 1JHTB 2RBLA 2CK0L 3UPRB 3KR3H 4TSAH 3TPKA 1R5IA 3TF7C 5H37G 3FKUS 3VFVA 2G60H 4QRSA 4IOFC 2MFNA 5EIQA 5DRNA 3KPTA 1EXUA 5TQ2H 2IAMB 4E42B 5JMRA 2BHYA 4GOSA 1MNUL 2IPTH 4Z7VF 2UY7A 3GSOA 3BGFB 4WU7A 1ZLWK 4IRZH 4HUVA 5FIEA 1GIGH 1YMHB 4PJBE 4QRRE 1UXSB 4NQEB 3GI8H 2ZUWA 3GO1L 1FFPB 1I1AB 4HUXA 3ARGA 2EC8A 4UTBL 2KBGA 1FC2D 2ZOKB 3CCHA 2H3NA 4LLMA 5FA4A 4OSUL 3TWCH 3SCMD 3O9WD 1RUAH 3TCXA 1UACH 4LEXH 4YUEH 2CRMA 4OZFB 4DUVA 3RVXC 2VDOL 3DX8A 3PQYE 1A3QA