2DJ4A

Solution structure of the 13th filamin domain from human filamin-b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
108
structure length
108
Chain Sequence
GSSGSSGVVDPSKVKIAGPGLGSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filamin-B
publication title Solution structure of the 13th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 10
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dj4A01
1C08B 1NC2B 4OLYH 5F6HJ 5I1LB 3LS5L 4I1NB 3FB8A 3ZT7A 1XFPA 1FVEA 5DJXA 5I17B 3I50L 5L8KB 4XP1H 2BY3A 3P4MB 5EOTA 3TEUA 3TO4A 3L5XH 4K7PX 5JR1H 4PJIF 4MNHA 4P59H 4YO0B 1HKFA 1ZHBB 1BOGB 1VESA 4PGBB 3E6HA 1REIA 3KXFD 5FUZH 1I7TA 2IH1A 4PJ7B 5ANME 4RWHA 1ZVYA 4ACPA 4YWGL 2HTLC 3MLXH 5TDPA 1MFNA 4FS0A 4GKNA 2H6PB 5E8OB 5IW1A 2B1AL 3IAQA 5IVNA 2X6MA 4NBXB 4ZODA 3ULUL 3OXSB 5J6HB 2HLAA 3OV6A 5EBLB 3WFZA 4ODHH 4ODUB 3HR5A 4JLRB 1MHHB 5FDYA 1BD2D 1UB5B 2ZUUA 4KRNA 1VGKA 5I73C 1NEUA 5BV7C 1O7VA 4FNLH 1BQSA 3C6LB 4U1HA 2AJZB 1P5VA 1R3LB 3T09A 2AXJA 5I1GL 5EU4A 2BVYA 4BA8A 2QHRL 1CFNA 3EDDA 1U8PB 1F5WA 2FHBA 3WD5H 3U7WH 1SEQL 2I9TA 2V5YA 1UM5H 1BZ7B 5ICZA 1D5ZB 1I3GH 4F9LC 1U3HD 5D1QD 4P2OD 5T3ZE 3HPLB 4LFHG 5ID1A 4PJXA 3RA7H 1MAJA 4OKVA 4C56E 4NT6B 3QCUH 4NDMA 5D1XA 3DIFB 4DKEL 5IB3B 4PTTB 3RTQA 4HCRA 3FONA 1MREH 3GBLA 3GJFH 4K7PY 1MWAL 3O6FB 3UTSB 5F9WC 2XA3A 3TIDB 4UIKL 4J3XA 5DRXA 1DLHB 1LO4H 4R97B 1JRHI 3HS0B 2NY1D 3CFJA 4PRPB 5FYJL 5GHWH 1CK0H 1MQKH 5ICYA 4TNVF 3TO2B 3U0PA 2CJUL 1EAJA 5K9JH 4NM4L 1AI1L 1R24A 3VW3H 2VAJA 1J8HD 3TT3H 3DOSA 4N8CH 4MWFA 2YD3A 1QBML 2QSCL 3TVMC 3V4UL 5J11B 4GAJL 2QQKL 4DEPC 4YHZL 2IAMD 5DZLA 2SEBB 1EFXD 5GXBB 1CL7H 3QEGL 4HUMB 4TUOA 4LLYA 5E99H 3HI6H 4M7LT 1FN4B 1UM4L 3NAAL 1FBIH 1D5XB 1HWHB 4Q2ZB 4XXCC 1PKOA 5MHSD 4JFPB 2NNAB 3O9WA 3BW9B 2Z92B 4P9HC 2EEDA 4U1NA 2M2DA 3F6LA 5IOPA 5DMGD 4H1LB 4AZ8A 3IU3A 3KLHD 1KCUL 2CXGA 1I4FB 3T2NL 1QSED 1F3RB 2O5XH 1SY6H 4PJFB 4N0FB 2ICWJ 3RZCA 2PYFA 4LEOA 5H35B 2AQ1A 4G8EA 1JUFB 5DURD 1QFHA 3KYMB 4YQXL 1T7WA 1S7WB 5SX4H 5J4MA 5CEXA 3D0VB 4JPWH 2WMPA 1EMTL 1R3HA 1KXVC 4GMTH 4X6DF 3NZHL 1J0ZA 4BZ1H 1J05B 1EJOH 4G8IB 4XTRC 4K23H 4YBQC 3QUYB 4KJQD 5F9OL 4QRQA 3V5HB 1S7SB 2FR4A 1KN2H 3LPWA 2BJML 3L3IA 3DRTB 4OM1H 2MCPL 5J12B 1OD7A 2ICCA 1S7QA 1MCNA 2WINB 1KELL 2D2OA 3VXUB 4WW1A 4M6NL 3B9KB 2F53E 4G9FB 1NFDA 3Q6GL 5GS2D 1C5CL 2OTWB 5E00A 3K4AA 4LVOB 1K4CB 3L3GA 4KPHH 1UZ6E 2G2RA 4G9DA 2ED9A 3OJDA 5IJVA 3QRGH 5DGQA 1KFAL 2P5EB 1E4XH 1HHIA 2ARJA 2IPUG 3BP5A 3ZKXC 3D0LA 3S88H 3BPLB 4LRIA 3TJHC 5ISZA 3PHQA 4N8VG 1AGBB 1H3PL 4OD1L 4LOUC 4N5ED 3GMLB 4PY7B 3VXMB 3REVB 1LO2L 3MBED 4NJ9L 3WN5C 5I1IL 4J3OC 3D39E 1PBYA 4RWYH 5CMAA 1EEZA 3MJ9H 2ESVD 5GGUA 3IYLW 4M03A 3TA3D 4GKSA 4E9LA 1IMHC 1T1YA 4YGVA 2PCPA 4YDKL 4W68A 3S97C 1ZKAA 4KMQA 2KH2B 3STZA 3JV4A 2P4AB 5JHLL 2X4UA 2EC8A 4LLUB 4K9EC 3U6RA 3V79C 5TFSH 3BUYB 3KPQB 4GRWE 1DUZA 2X10A 1QZ1A 2RHEA 1FPTL 1UA6L 1WF5A 3A6BH 5J3HD 4NQSB 5D5MF 3VRIB 3DURA 1JHTA 2AV1A 1G0XA 3FO0H 3NZ8A 1IM9D 2WSKA 2H1PH 1HQ4A 5HDQH 3N06B 5LCVL 4KZDH 3ZE0E 4J1UA 4Z7WA 1H5BC 3GRWL 1I1RA 2W0FA 2XG4A 3UTTB 1A6ZA 2D7PA 4EQ3A 3CFBB 1RZIA 4Z78B 1G7HB 3RDTC 4LSUH 1JNLL 2P8PB 1A3LH 5DD6A 3QWOB 1CGVA 1KTKE 4HUUB 5JZ7D 3SE8L 4XXDA 5I6XB 1MI5E 4F7PA 5DQJA 1EGJL 2D4FA 3AGVA 4L9LA 5DO2C 15C8H 1FNSH 1NFDF 4OZFA 1ZA6A 3QEUA 4LRNH 1CXHA 5GIRA 3IXAB 1NDGA 1NKRA 3VE0A 1JV5A 4K3DL 4HKJB 4MA8L 1KCSH 3QNXA 3CX5K 1RZ8A 1WLHA 2VLJE 4O58H 1JZ7A 4WWKC 4OCYL 2ITCB 4CVXB 1I9JH 5HGAB 1NLBL 4RMUA 2FYYA 3A67H 3B2VH 2B4CL 3WO3B 4G5ZL 1A3RH 4PJBB 5EIVA 1OGTB 1RMFH 3Q3GA 2DQHL 5DUPH 5ID0A 3TLRA 3QXAB 4Y4FC 5MP6H 1A7NL 4X8JA 2FX7L 2VWEC 3UAJC 1CE1L 4KKBC 5GGTL 2VLRB 4G3YL 3RI5K 4AM0A 1LD9B 2CDFA 3EO1B 1N4XH 1U92A 2VKWA 4ISVB 2XKSA 5L9DL 5T3ZD 1BPVA 1OHQA 3QFJE 3CLFH 1URLA 1UWEL 3GSUB 4C56D 1S9XB 2ZUYA 2ADFH 4MXQD 1NFKA 6FABH 5C1MB 3GK8H 5KVFL 3IDNB 4NZJA 1TDQA 2WWMC 1IL1A 2COQA 2FH8A 4PBWD 4ELKA 1IVLA 2HTLD 1TVBB 1Q0YL 3NPSC 4JZJA 3IJYB 1HIMH 4PLKD 5DJCB 1OPGH 1J9CT 1PFCA 4JO1L 4ZAKD 3RU8H 1ETZB 2DLHA 2X41A 4LHUB 1WZ1H 2XN9E 3TT1L 5E5RB 5DJYA 1QKZH 3RWIB 1CDIA 4F7EA 2MKLC 5EOCJ 3VXNA 5CJQH 3WUWA 5D7SL 3JSSA 4D3CL 3E0GA 4Q7DA 3HCVB 4F7TA 2L7JA 4PRNA 4L8CB 3ES6A 3QO0B 3TJEL 2VDKH 1G7IA 3SJVA 3CPLA 4FZEL 3GUTA 4N8VA 3PWLB 5D9SB 5HTSA 4QCIA 4Z7QE 1C5BH 1CVRA 1FLRL 2QKIB 3EJYD 4NO2B 3OR6A 1AD0A 2EDBA 4PJIB 5DZNA 5ESQA 5FGBC 4YFDB 5T3XH 2Q8AL 2VR5A 1TCRA 5D71H 2J6EL 3B2UC 4POYA 5IVXE 5CD5C 3RFZC 2IG2H 4XZUA 5D8JH 4DFIA 4UTAL 1JN6A 4I0PA 4RA0C 2YMXH 4RX4D 1LEKB 1LO0L 1JRHH 4NQVB 3QUZB 4LGSB 5IHBA 3O6KH 9CGTA 3TWCL 2R8SL 3D5OF 4QRRA 2I07B 2EDYA 1VACB 1UCBH 3MLWH 4JZNB 3WXWL 5JQ6H 3Q48A 5HD8D 4GO6B 5EC1A 4JRXE 2QADD 4HMEA 4U1KB 2Q86A 4JFEE 4WU7B 2JE8A 4XNZB 2BCKA 4RFNB 1KNOA 4OAWA 5IM7B 2WUBL 3RVVC 3SDDA 4S0SD 5TGBB 5FA3B 3H9SE 3KWWB 1D5MB 2X09A 1I3VA 4LSRL 5FO9A 2WV3A 3HE6C 3VFRA 3TFKD 3AC0A 3HB3C 2YPVL 5HGDB 5HYFA 5E4IA 5DFWH 3I6KA 4PRIB 2R0ZH 4YK4B 4BJLA 2F53D 3QQ4A 3AROA 4Q6IA 4TSAL 3QIUC 5D7LA 4KQ4H 1IGMH 2APBA 3O8XA 5F96H 2RB8A 3PNWB 4AEHH 3HNSL 1YEGL 2A83A 25C8H 4NN5B 3TCLB 3JWDH 4KQ3H 1WAAE 4EIGB 1KIQA 3RGVA 3FB8B 1I85C 4U1MA 1FVEB 4R4BA 5DJXB 4Y1AA 4UTBH 5EOTB 5KTEH 3TO4B 2QEJA 5IWLC 5EORL 5I0DA 5F89A 3MGAA 1J0HA 4JAMA 5D2LE 3OR7B 4MNHB 2FIRT 4U1GB 3VFTA 3D39D 4FTVE 3E6HB 1I7TB 1RUAL 2B2XL 4WV1C 5GGQH 2NW2A 4GKNB 3JTTA 1CE6A 3U4AA 4KTDH 3EIFA 1U91A 4OD3H 5DHVB 2HLAB 2XZCL 3S34L 4L5FL 1RIHL 3S96A 4YBQD 2Q87A 3HR5B 3QHFL 4R26H 4P5KA 5C09A 1SBSL 3KYNA 5SWSA 4J12A 4LDOB 1VGKB 3K8KA 2WBKA 2BOCA 2UV3A 5I74C 4H1LH 3EOAA 4ETQA 1QHPA 4OUUA 4UT7L 4L4VA 4P23A 4AENA 2UUDK 3QXUA 4PB0H 4KI1A 4JVPA 3CU1A 1BOYA 3EOTH 5EU4B 5FF6A 2JJTC 4M62L 4X4XA 1CFNB 3K8MA 2RGSA 4HWNA 5I71B 1RZGA 5I1JL 3CX5J 2Y07L 2E27L 1MI5D 3RX8A 4UV4L 4R90L 3LQAL 5ICZB 1WZKA 4FXGA 1KTRL 2Z9TA 3QIWC 1KBGL 1U8MB 3TJHD 3A6OA 3VFWA 5ID1B 4PJXB 1AR1D 4OKVB 2FX8L 4NDMB 5D1XB 2OLDA 4GKOA 5DS8A 1TQBC 3K74B 1JTPA 1DBMH 3QIBC 3DVIA 3RTQB 4QF1A 1VHPA 4HKZA 2VLJD 2QTEA 4DJMA 3HR6A 3MLZL 4CDGC 4ZPVA 5DRXB 3UMTA 1ITBB 1NSNL 1I8KA 3EUUA 3CFJB 2ZG2A 5D2NE 5F7YC 1Y6NR 5ICYB 3ULVE 3PDOB 5LG1A 4QXUL 3U0PB 1X6LA 5FUCE 3S5LG 2A0LD 4MWFB 1UZ8B 5BRZE 4Y4KC 5IQ9A 4HEME 4XNUH 4HJJL 2FX9L 5IBTH 4W6XB 1B2WL 1KIPA 4TUOB 1F4XL 5DJ6A 3KR3H 3MA9L 1A7PH 5GS0C 4LFHD 5DT1L 4L29A 3EAKA 3QFJD 5KSVA 1WISA 4PGDA 1HSBA 3LH2L 1RK0A 1II4E 2AEIT 1FAIH 3O9WB 1ZANH 3UPRA 2ZSWA 2VDML 5DF0A 4LASH 1FQ9C 2EXYC 2F5BL 2ZSVA 4U1NB 1J7VR 2NZ9D 1JPSH 4Y16A 2J1KA 4PJEE 2BVTA 4H20H 4RGOH 5IOPB 3OMZA 4JRWA 3T08A 3IU3B 1FL3B 1NL0L 1UEYA 3QHZL 3IFPA 1FZKA 1WC7A 5HYJE 3QDGA 1UADC 3CUPA 4HBCH 1ACYL 3RZCB 4ERSH 2PYFB 4N1HB 1CDUA 4D94A 1WFNA 2XN9D 5CEXB 2F9BT 2IFGA 3AM8A 4FFZL 4LPVA 3EJZD 4WWKD 5SWZE 1FGNH 3R0MA 1FYTE 4AT6A 3GHBH 4XHQA 3ZTNH 5MERB 4QRQB 1GGTA 4C54A 1BJ1J 2FR4B 2I60L 5T3ZL 4TSCH 2NY0D 3E8UH 4V2BA 1EHNA 5T1DH 2AJVH 1S7QB 4RFOL 5KSUA 3S35H 5L2JA 1TJGL 3SQBA 4KKBD 4G6MH 4WW1B 2A9ML 4OF0A 1FNHA 2OI9B 5HHOA 1YY8A 3QCVH 1NFDB 5DRNB 3HI1A 5IVOA 4ESKA 5E00B 5MI0B 5GGSY 3L3GB 2N7AA 4GSDH 5T1LD 4NUGL 3V95A 3LS4H 2W59A 3V4VH 2NX5E 1CGTA 4HWZA 1RUQL 1OP3K 5JXAL 5EULV 4F7CA 2BNUA 1HHIB 2ARJB 2LQRA 1J1PH 3D0LB 4IMKC 4HS8L 5ISZB 3NA9L 3PHQB 4WO4A 4JFDE 5CGMA 5LQBL 2ZUTA 3VFMA 4QYOB 3L1OL 2WWMD 3OB8A 5IBLD 4M1DL 3LEYL 1WEJH 4H5SB 4JRXD 4N0UE 1WUNT 3SKUD 4JFED 1X5GA 5CMAB 1CBVH 1EEZB 5GGUB 2CMRH 3OZ9H 3KXFA 4GKSB 2BVUA 4R7NA 1OAYL 4JQIL 3H9SD 4YGVB 2PCPB 2DQEL 1QPXA 3JV4B 4KROC 3STZB 2ICWA 2X4UB 3U6RB 3N50A 1DUZB 3FHAA 3G08A 3SCMA 4KHTH 5HDBF 1BGXL 4XVSH 1BIHA 3E2HC 3STLA 3HA0A 3WL9A 1EHXA 3INUH 3DURB 1HILA 2YZ8A 1JHTB 4XC3H 3UCRA 3NZ8B 2YR3A 5EO1A 1HQ4B 4OTXL 2VITA 4G7VH 3KYOA 1AKJD 4H88L 3BZFA 4JVWA 5C08A 4J1UB 4JFFA 2W0FB 1L6ZA 2UZXB 1A6ZB 1NBZA 2ATKA 4Z8FL 4LSPH 2NYYC 3L3KB 4U0RB 1NCNA 1RZIB 4WI4A 3NGBC 3VRJA 4AK1A 5DD6B 3L5HA 3KS0J 3B4NA 4XXDB 2IEPA 1PG7H 4F7PB 3KPRA 5DQJB 4FTVD 2R69L 4L9LB 2B1HL 4ZFOL 1DANU 12E8H 4OZFB 1ORSB 1T1XA 2J8HA 1U3HA 3QEUB 5D1QA 4K94C 5DEFA 5GIRB 5BQ7A 3VE0B 1DVFD 5F7NC 1L4IA 3GJEB 1JV5B 3FQUA 3QNXB 5FO8A 1RZ8B 2YA2A 2P1YA 2LTQB 3W82A 5JOEA 5B39B 4I2XA 3VFVA 5I1HH 2FYYB 5C2UB 1XGYL 4GW1A 2ADJB 3ZTJH 4XX1E 5E2VL 3DXAB 5ID0B 2FDBP 3NH7L 3ILPB 2V17L 4OIIH 1RIUH 1GZQB 4GW4A 5DVLA 5MEPB 4X8JB 5IMMA 3MV8A 1CWVA 2OZ4H 4AEIL 4BSJA 1J8HA 4FRWA 4YHOH 5DHXB 1I9EA 2J2ZA 3QBTB 4J6RH 5FUOL 5JQHC 2X4RA 4PRHA 4NO5A 4XWGL 2IAMA 4AM0B 2CDFB 4KKCC 1LDPH 3H0TA 5SX5H 3RIFF 3FB5A 3C5ZA 2ZOKA 1CQYA 3PL6B 3SQOL 4A2MA 4PV9A 1H8SA 1MCOH 3U1SL 2ZUSA 4YBLC 1IL1B 2FWOA 4CNIA 1DBJL 3CXDH 4ELKB 2NY3B 4EUPA 4OJFL 1NBVL 3QUXB 5DRWA 3CMOL 1L7IL 3T0BA 3GKZA 5C6TL 4DN3L 4UINH 3UJTH 4KHXH 2UWEA 1QPPA 1FRGH 4GBXB 4AG4H 4F7EB 1DTUA 4ZNEE 2HJLA 5D96C 2QV2A 3WUWB 2CGRL 3U9UA 1ODAA 4WI5A 3ES6B 5BRZD 1G7IB 3SJVB 5IVZA 2ZPKH 4RRPG 3RY4A 3OG6B 4UOJA 2O5ZH 1XIWD 1BAFH 4X6EA 1E4WL 1SYVA 1NKOA 3MNVA 5LKNA 1I1YA 3UJIL 3OR6B 4OGYH 4TQEL 5ESQB 1S9KC 3PIQA 5E70A 1FC1A 3CU7A 2Q3AA 3VDAA 2GK0A 3MMEA 3SDAC 1MCHA 4KZEH 3NCYS 3M1BA 2A9NL 5CBAA 1OVZA 2H26A 3DX9A 4MVBD 4LVNB 4XZUB 1JN6B 5CKGA 4I0PB 4EBQH 5EUOA 3ZE1E 2DD8L 3VFOA 5DHVH 3ZKMC 1CTOA 2MOVA 3DRQA 5FIEA 3BEWA 5M7QA 1HQRA 3V6ZB 5HYJD 4GUPA 3N0PB 4JPIA 4QRRB 2DLFL 4WHYH 4LSVH 1B3JA 1YEIL 1D9KD 2ENYA 4OZHE 1HINL 1YPZE 1K2DA 1OW0A 3OPZL 2ZCHL 3LEVL 5F7KC 4DVRL 5EC1B 4PGZA 2JCCA 5SWZD 5BS0E 1FYTD 4YXKH 2Q86B 4FQXD 3DTXA 5HGBB 2BCKB 5KVGL 1KNOB 1MPAL 4OAWB 5GRJH 3SDDB 5B38G 2ESVA 2BSSA 2EDFA 1ZLSL 3BRGC 5K9OA 2D7QA 3T0VA 2A74A 5FO9B 2H9GA 4KKLC 4OSUH 3VFRB 5E9DB 2YK1H 1AD9A 1UFUA 3I6KB 4Q6IB 5D7LB 3NTCH 4Z95H 5J6GA 4RGMB 5DD1H 2DLTA 3O8XB 2ENSA 1EV2E 4HCRH 1MWAB 2A83B 4JR9L 2X9YA 2FD6H 4FG6C 2NX5D 1KIQB 3RGVB 1TZGL 4U1MB 3TH4T 1QSFE 4OFIA 3PV6A 4Y1AB 4JFDD 4XRCA 2Y36H 3NCCB 2OL3A 4C55A 5F89B 4JAMB 1IT9L 5C92A 2XQYK 1EHLL 3GI8L 1XGRA 4BFIA 2HKHL 1EHAA 5IFHL 1JYVA 4KI5C 4H0GA 1NJ9A 5E8EB 3N9GH 2NW2B 1H9VA 3SDYH 4CRPA 5EUOF 3JTTB 4Y4HC 1CE6B 2UVFA 5F7DA 1BREA 1U91B 2Y5TA 4PS4H 4U3XA 2VQUA 1MCLA 3S96B 2XICA 3PJSA 4M7JH 2BNQE 4P5KB 5C09B 3OX8A 3SEPA 3KYNB 2AP2A 4O02H 1ZSDA 4WVRA 2H8PA 5E8PB 3KPSD 2JK5B 1QACA 2BNRE 1DP0A 4Y2DC 3EOAB 2JCCF 4NM8L 4ETQB 4OUUB 3BH9A 4L4VB 4P23B 4TRPL 1IAII 1T89C 1CT8A 4JM4H 1EZVX 1MY5A 2WQRA 5FF6B 1BLNA 1J12A 4OCXL 4ELME 4NQDE 4JO4H 4X8XA 2CPCA 5JW4N 1IQDA 2C4XA 1CGXA 2XI9A 4JFOA 5I1EL 2DM3A 5TPWL 3C08H 2IMMA 1KF9B 4FXGB 2VXQH 5A2FA 3ALXA 3HPJA 1OAKH 3HAEG 3V0WH 4R4NC 2VSDA 1OTTC 4QF1B 3HC0B 3GSNA 2R56L 4HUKB 2A6IA 3VWJC 4HKZB 3C09B 3H3BC 4OQTL 4B5EA 5CZVL 1FSKC 4UILL 1T04A 4OLXL 5SWQA 4ZPVB 1I8KB 4JFQB 2FH6A 2JB5H 1JPTL 3QPXH 3SDCD 5E95B 3Q5YA 3HMWH 3WDHA 5DJ8A 4I3GA 3MO1A 2BFVL 5KZCD 3IU4L 1M7IA 4XP4H 3RWGA 1KIPB 5DJ6B 5GZOD 1MFBL 2Y23A 2AV7A 1NCDL 4KRMB 1IGIL 1YN6A 1UM6H 2FATH 3DROA 1HSBB 1AIFA 4LARL 1RK0B 1EZVY 4WNQA 3U82B 2D9CA 4M1GH 1IQWH 2Z8VC 2ZSWB 3V6BR 1QFUH 2ZSVB 3RVXD 4U6HA 1I1AC 2EYTA 1LNUA 1CICB 4DK3A 4WENB 1FZKB 2PW1A 1WC7B 4RX4A 4F9LA 5BW7C 3QDGB 3BKMH 1H3TA 4I8DA 4UT9L 2XA8L 2XTJE 2CUHA 5F3BB 1K85A 4ZO9A 2LVCA 2NY4C 2VUOA 4HLJA 4P57A 2W0LA 3U9PH 5T1MB 4HF5H 1XF4A 4S2SA 5CSZA 4AT6B 1EH9A 3MOBH 2JJSC 1DFBL 4HS6A 1CU4H 5EC2B 1JVKA 4Y8AA 1HKLH 3MUZ1 4IIQA 3TZVC 3KYKH 1IAIL 3TGXA 3GO1L 3QCTH 5L2JB 5KSUB 4FQLL 1QBBA 4OZFH 4MJ2A 2IPKA 5C0CE 2MPAL 5HHOB 3TVMA 1YY8B 4Z7VE 1Z9MA 1F90L 2F53A 2DQJH 5GGVL 4PR5A 1MFDH 1BBJA 4BSWA 4PJHE 1PD6A 5HHXL 4MA3A 1W0VA 2A1WH 4F58L 5HVGB 3VG0H 1IFHL 4HWZB 2E9WA 5FHBH 5M94B 1RUML 5JMRA 4F7CB 1KXTB 2BNUB 1DQLH 2MJWA 1T83C 4XXCA 3ULVL 1S78D 2MWCA 2W9DL 3ZKNC 3LRHA 1UWGH 3VFMB 3IS1X 5HI4C 3V0VA 2VH5L 4U4BA 4GAYA 4L3CA 4LCWA 5LXGL 5BS0D 1Y18B 3MRNA 3MCKA 4WUUD 1JNNL 3BSZL 3F5WA 4KGJA 4DAGH 4PJAA 1ULVA 3KXFB 3V6OC 3L3HA 4PG2A 4DOHE 1MJ7H 4R7NB 3CFCH 1E6JH 1YECH 2BRRL 2NMSA 2LVEA 3I2CL 2ICWB 4HWBA 4CJ0A 2Y7QA 3H42L 4N0YH 3HG1E 1HOCA 1Z2KA 3G08B 3SCMB 1CR9L 1EPFA 2FSEB 3STLB 1T2XA 5I18H 3BMVA 3WL9B 1HILB 1WITA 3VGAB 3HAEA 4S1SH 4FFYH 1BD2B 3VD5A 1F3DJ 1FFPB 1T5XA 1WVZA 5EO1B 4M3JA 3MOQA 2VLKE 3TIEB 1ZVHA 2VITB 4UDUA 3KYOB 3BD4A 5FKAA 1T4KA 3DHMA 4YHKH 5TF1H 3G9AB 4XNXL 2ATKB 3VH8A 1FVCA 1AJ7H 3ZE2E 3VRJB 3BKCH 3FO1A 2E9BA 4HEPG 2YEZA 1WV7T 4IMLA 3I50H 5DMIL 3PXJA 1Y6KR 3FQNA 3F8UB 1QLEL 1P53A 1T1XB 2ZNXA 1U3HB 5D1QB 2HG5B 4QOKE 2NQCA 5DEFB 2IPTH 1H15A 2IGFH 4NFDA 4OLEA 1LK2A 2O5YH 1S9WA 4UV7H 4XCFL 2J12B 5I15L 4DZBA 3FQUB 2OYPA 1X4YA 1UZ6F 5FO8B 1Q94B 5E5MA 4H0HB 4R97C 1QNZH 5BXFA 2ICWI 4JG1L 1UWXH 4AEEA 3VFVB 2FGWH 2D0GA 3SPVB 4GW1B 3K8LA 4X80L 5DFVD 3G5XA 2ZWLT 2C1PA 4HFWA 4HV8A 4RMVA 3QHTC 4ZTOL 2NY1B 2GITA 3MLYL 3FFCA 1K6QL 4GW4B 1MFEL 5IMMB 4PJAF 3MV8B 1Q9LA 2E6JA 1P7HL 4IHOA 1J8HB 4NQDD 4WJ5A 1F00I 1FZMA 3LIZL 2HMID 5I75B 1GPOH 2Z0BA 2X4RB 5I1CH 1C5DA 4PRHB 4AL8H 4NO5B 1WK0A 4Q9RH 2IAMB 3DSFL 5JLZA 4R96B 4JZOA 1VADA 3H0TB 4K8RH 4GRWF 4UIMB 2BSTA 1H5BA 4D0BA 4BQCA 3FB5B 4ZOCA 4H8WC 5CJXC 3C5ZB 3BT2L 3RVUC 2P7TA 1WIOA 3RDTA 3RY5A 1GGCL 4PV9B 5T1KA 4XHJC 2GSIA 2GT9A 3TN0D 4HKXA 4LAJH 1JNHB 1EUUA 1D5IH 3FKUS 2FWOB 2BMKA 2XZAL 4CNIB 1BVLA 1MCRA 4V1DA 3ZE0F 2CKBA 4EUPB 4RSVA 2R2CA 5BCAA 4TTDD 5DUBA 5D4QA 5EU7C 2HKFH 1IARB 1GIGH 1Q1JL 4DKEH 1GZPB 4DVBA 4PB9H 1YZZA 2X4PA 1ZV5A 2VDRH 1MWAH 2UWEB 3UO1L 3U9UB 5HHNA 2NY2D 4BH7A 4ZXBD 2WWKO 4WWKA 5AD0A 5IVZB 4PJGE 5FYJH 1G84A 5J12C 4P9MH 1MRDH 2P47B 5I1DA 3FZUC 3ILQC 5DJDA 2CJUH 3C8DA 2DQIL 4X6EB 3DUSA 4TUKL 1SYVB 1VGEH 3MNVB 4Z7OE 2CLZA 1I1YB 1GAFH 1QBMH 4EIZC 1YC8A 3VGFA 3GIZL 3PIQB 3T4AA 3X13B 4Y4FA 1JPGA 3BAEL 4YHZH 5FV2A 2GK0B 3CLEL 3MMEB 1FV1A 3VD9A 4HFUL 3BHBA 3MFGB 3QEGH 4PTUA 4IRJD 3M1BB 4M1CD 5CBAB 3MSPA 3DX9B 4PJDE 2ATPA 3NAAH 5EUOB 3VFOB 3DRQB 1HQRB 3CX2A 1Q9WB 1KPUB 4WEBH 1FVDA 5FK9A 4Z76A 5T1LA 1AQDA 4MA1C 4GUPB 4JPIB 3KPOB 3QO1A 1FE8L 4KY1L 4EDXA 2XTJD 3VMOA 4G42A 3U46A 2EDEA 4JRYE 3O0RL 4KK5C 1K2DB 1RAMA 1OM3L 4OM0L 3GZKA 1FFQA 1FORL 2M1KA 1I8IA 3WSQH 4S0TD 2EDXA 4V2CB 5IQ7L 2JCCB 1UXSA 3BE1L 1F4HA 1A7RL 1J87A 1C12A 1QFWM 2ED7A 3TYGL 1XR8A 4XP9H 1IBGH 2BY2A 2P24A 3T2PA 3M8OH 1EMTH 2ESVB 2BSSB 1WBYA 5EFIA 2LU3A 2DKSA 3IF1A 3TA3B 4ZUUA 5K9OB 4LLWA 3GMQA 5ESVA 2A74B 1JF6A 2QR0A 2H9GB 4X7FC 2R9HD 1RK1A 2J8UA 2Z93A 3THML 1AD9B 2LV4A 4GAFB 4MD0A 5I30H 5C0CD 5FDWA 4ODWA 5J6GB 2AGJL 3EFFA 3QDAA 4J3SA 5CZXC 4NC0B 5A2LH 1TNMA 3MXWL 1SEBA 1NCAL 2JELL 3SKNB 4M6NH 1IM9B 2VMFA 5FGBA 3GKWL 1QEWA 3Q6GH 3KPNA 4J4PD 4URTB 4KH2A 1OT2A 1AKJA 3ZL4L 5K9KB 3PV6B 4JO2L 3EHBD 4XRCB 2E9IA 2OL3B 3JV5A 3DI2B 3C5SA 2D7NA 1D3CA 2E7HA 5DA4A 2ZCKL 4DGIH 1EVTC 4Z7QF 5DVOA 1XGRB 4BFIB 5IUSA 1ORQA 1DZBA 1SJEA 4NZRH 5F44A 1NJ9B 4S1RL 2EDKA 5IT2H 1ADQA 1A6VL 3U2SB 1GJIA 5F7DB 3HI5L 2FLRT 2FHFA 2P49B 1CIUA 5IW3A 4AMKL 2DBLL 1KCRL 4Y0GA 5CINH 3PJSB 1GSMA 4YPGA 3I02A 3OX8B 3RQ3A 5M95B 1RZ7L 3DUUA 3VFSA 5F7FA 3F58L 3TZVD 1XCQA 4CBPA 4AIZA 4KAQL 4OT1L 5AZEL 3QA3A 3BH9B 1N5YH 3HE6A 5JIIA 2KBGA 1CT8B 4MNGE 3VXRD 1QVOA 5MENA 4XVUD 5D70L 3QIUA 1V7NH 4HIXL 1W2KT 1IQDB 1NCBL 43CAA 3H3KA 1DQML 4JFOB 2QJDA 2DMKA 4Y7MA 2VZOA 4XP6L 3S3JA 1I85A 1RZFH 5H37H 4YUEL 4JO3H 3HPJB 4X0KA 4QOKD 3SE8H 3VFUA 2VDNL 2ZKHL 2DM4A 1RV6X 4OKDA 1RVFH 4C56B 5GGVY 3PWPA 5IWLA 3GSNB 4R2GD 5DUML 4MAUL 4DTGL 3AY4C 1WAAF 4ZO6A 2WK2A 3BGMA 1T04B 3QP3A 5FYKE 1G7LB 4WV1A 5SWQB 3WNKA 1JPST 3WFHA 3H7BA 3T04D 5D72L 5D2LF 3RNQB 4XPHL 2YRZA 5D7KE 4NRXA 4JDTL 4LCCB 5AUMB 4U1JA 2B4CH 5CJ8A 5DJ8B 5IK3A 3D3VD 1YNKL 4TSBH 1M7IB 3GNML 4JGJA 3ARQA 1X5XA 1BZQK 1VSCA 3VFNA 2ZP0T 3EOYG 3W11C 1F6AA 5F9JA 1IC4H 1RY7B 4KK8C 2YUVA 2AV7B 35C8H 5E7BA 4F9PC 1YN6B 3PP4H 5FYKU 1IC7H 4HJGB 4NQEA 3ZDYE 1ITCA 1AIFB 3DROB 2JJTA 5E6ID 4WNQB 5BMFL 2L7UA 2UZIL 4K3JL 4HW6A 5JPNB 3GBML 4U6HB 2V7HA 2EYTB 4HX1A 1Q72L 1LNUB 5DJ2A 3JTSA 4M8QA 2PW1B 3BKJL 3OKNA 3RAJH 4WTXA 3QIWA 4GRLD 4G8FA 4JHZA 4DN4L 5DC4B 3B5GA 3U30B 1DDHB 1JK8A 3U0TA 3MLSL 3MACL 3MJ6A 3QIBA 4XNZC 2OJZL 4YX2L 3T65A 4P57B 5MEQA 4M5YL 1XF4B 3GGWA 4LU5H 5CSZB 2XQYG 4Z0BL 5F9WB 5I2IB 5KS9E 4XB8A 2DN7A 4HS6B 1YNTB 2EIBA 2V2WA 4IIQB 4M43L 1MEXH 5EZOL 1F13A 3RHWK 4Y4KA 3TVMB 2VDQL 1YQVH 4DEPB 3QEQE 2F53B 5C0BA 4PR5B 2W9EH 3FRPA 4BSWB 2PNDA 4JFXA 5KBNC 3IJSB 3DV6A 4MA3B 2YBRA 3SKOA 1W0VB 3CD4A 1QHOA 3OAZH 1X9QA 3DSNA 5C0JA 5JW4M 3TO4C 4P46C 4JRYD 1LO0H 1B6DA 5I19L 3CDYA 1G9ML 4GAYB 4EZMA 4LCWB 1ZLVH 4XBEL 2AJUL 3TWCH 3MRNB 2ERJC 3MCKB 4ONHA 3F5WB 2CK0H 3G5VB 4PJAB 3L3HB 3IKKA 3HN3A 5HHME 1XF1A 5KAQF 5DK3A 2Y7QB 4GJTB 4PJEF 5EBMA 3FFDA 2WBJD 4PJCA 3RL1A 2A77L 4GRWB 2HT2D 3HAEB 5F7MC 1OP9A 1FYHB 1IGCL 4NWUL 2B20A 4QRUA 1T5XB 2YSSB 2YPVH 3L5WA 1VEPA 2OX5A 2CH8A 3KPSA 4UDUB 4F37F 3D2UA 4UB0L 4IRSD 5FKAB 4EUPH 4PP1D 2AJYL 2OQJB 4FQJH 3VH8B 3MCLL 4IDLA 3HNSH 1FVCB 1IAOA 1NH6A 5EA0H 4ALAH 3MBXH 4DFHA 3MV9E 4ZDHA 3FO1B 1IKFH 4XH2A 4FZ8L 1T20A 1PY9A 4Y5VC 5L8LB 1A4JA 4IMLB 4JREB 5H94A 3BO8A 5IESH 4QXGL 4HMCA 4EXPX 3FQNB 3ZKXB 2P8MB 4IMKA 4D0DA 1TZIA 1H15B 2GK2A 5IFAL 3MLRH 1BMGA 1NC4A 3WNOA 1S9WB 2EH8H 4DZBB 1PLGH 4E5XA 1WWBX 1X5YA 1RUAH 2B2XH 1JYXA 5E5MB 3LPGA 1YJDC 4W4NA 4X9BA 5BXFB 1V8HA 4B0MM 5ETUA 3G6AA 5FHAL 5I1KH 1SQ2N 3O6LL 5IBUG 5E8NA 3RUGA 4YEFA 3G5XB 1D5BA 2C1PB 4HFWB 4HV8B 4UQ2B 2R0LL 1INDL 2GITB 2FJHA 3K4DA 5KSBE 5C7XH 1KG0A 5ICXA 4IHOB 5CZXD 4WJ5B 1QRNE 1GGIH 3WNMA 3G6DL 1HHGA 5B8CC 2NTFA 5DEZA 1C5DB 3QQ9C 5EN2A 2FB4L 1UT9A 4N1EA 1Z3GL 1NANI 4JZOB 1K8DA 1IC5H 1VADB 3MJ7A 4Y2OA 2OMBA 3LSOA 2AK4E 2Y06L 4NP4H 2BSTB 1H5BB 2G75A 4G6KL 2G60L 4D0BB 2P7TB 3RDTB 5T1KB 4UV4H 2GT9B 4R90H 3F65A 4HKXB 4ORZC 4GT7A 5TF0A 1N7ML 4WI8A 1GRWA 1KBGH 2BMKB 4LPCA 1JHLH 4V1DB 2F5AH 3MXVL 2CKBB 5A2JH 5FYKD 5DUBB 1RIVL 3X12A 4DVBB 1YMMA 2X4PB 4JHWL 4PLJD 5JUEH 4J8RB 4APQC 2GQHA 1N2RA 3TPUB 5CGYC 4YE4L 3FN0L 1B4JL 1DBBL 4NCC1 2XN9B 1JPFA 3BJLA 2CO7B 5HHNB 5C07E 4BH7B 4I0CC 3U4BL 4WWKB 5AD0B 1CTNA 4BH8A 4LDLB 2D7TL 4NZUH 5HVHC 2OL3H 2XY1A 5L7XH 4G7YH 1WFUA 4LP4A 5DJDB 4HUVA 2IQ9L 3DUSB 2EDOA 2Q8BH 2GJ6A 2CLZB 5IP4A 3CVHL 2I25N 2OI9C 2NY0B 3IT8D 3PHOA 4Y4FB 3IDXL 1J1OL 1JPGB 2BVPA 5MI0C 4KRPC 3RUGF 3BHBB 4PTUB 3OG4B 5CAYB 3BPOB 1F42A 2R1XA 4J3WA 5CEZH 2AQ2A 5DT1H 5HPMA 4GG8A 2CQVA 5FK9B 1FVDB 4Z76B 5T1LB 1AQDB 4G8GE 1PW3A 2VDMH 1A7QH 2ZOLA 3QO1B 2F5BH 2RR3A 5IF0A 3WFBH 3GDBA 3CIQA 4EDXB 5GSVA 3U46B 3IDMA 4JEGB 3EDJA 1BQLL 1I8IB 3T3PF 2F54E 2Q6WA 1ACYH 1UXSB 1WBZA 2P44B 4KJWC 5EU5A 1C12B 1U9KA 5EO0A 3NPSB 4JANA 1KJMA 4WUUA 4X7DC 3TNNB 2P24B 4TNVK 1N6QL 3O6ML 4YHLL 1WBYB 4R9HA 4M7LH 5EFIB 4R8WL 3RZWA 3IF1B 5EZIL 4ZUUB 1EDQA 2N4IA 3GMQB 2QR0B 3H9SB 2R0WL 1RK1B 2J8UB 5D7IE 5EDXA 5I9QB 3U0WH 2FBJL 5T33L 4MD0B 2DQFA 3PWUA 4HPYL 2DQUL 4HAGA 5FDWB 5T3ZH 3HNTL 4ODWB 1ZT1A 3UPAA 3EFFB 3UTZA 1PG7W 3QEQD 2OR9H 1V3KA 1IEAA 2WM0A 1WFOA 3IKCA 5DA0B 3GSNH 1NCTA 1SEBB 1A2YA 4WGWB 4Y88A 1LEIA 4MAYD 2VE6B 3MRIA 5GRZA 2AXGB 2VL5A 3QI9D 5E7FA 3KPNB 4TOYH 1AKJB 1AO7E 3SDAA 1RHFA 2ZUQB 3O2DL 3W2DL 3MQIA 3QDMA 3C5SB 2DWEA 4L9LC 4KV5F 1BZ9A 4P2RA 2HYMA 2XQBL 1AE6H 5LGHH 1JWSB 2AEPL 4JKPL 1ORQB 3DBXA 3I6LE 4YFLI 1SJEB 4FTVB 5H8DA 4PYHA 3VXSA 4YDLC 1JGVH 5CILL 3K2MC 5HHMD 3HFML 2ZCLL 4HDIA 1MJ8H 4W6WB 3ZE1F 4BK4A 1J8KA 5DR5L 4DQOH 1P6AB 4ZS6D 2HLFC 2Y1VA 4YPGB 1KGCE 3I02B 4RMQA 2X4SA 2DQEH 3BESR 3DUUB 3MLUL 3VFSB 4JGUA 1XCQB 1YPZF 1A7OH 5C0AA 3QA3B 5KW9L 4PLNC 4LPWA 4RFEA 2DDQH 1OAXL 1PSKL 1RULL 1QVOB 2Y4SA 4Z0XA 5MENB 1HH6A 1U93A 2ADIB 4CMMA 3MV9D 2W1NA 4OTXH 1LK3H 4F57L 5D1ZC 2IANE 4NQDA 3OQ3B 1I7RA 1KLUA 4NSKA 43CAB 4JJ5A 1OTUD 1OY3B 1OT1A 1RPQA 2WUCH 4OV6F 4X9IA 2D0FA 5DQ9B 2NXYD 3VRLE 3PL6C 1JCKA 4XVTH 5HJ3A 4X0KB 3VFUB 3D9AL 1EEYB 1OSZB 4CVUA 5DJZB 1A7BA 3PWPB 4AYFA 5K59F 1BM3L 4HH9A 2HH0H 3MRMA 3QUXC 4MQ7A 1MCJA 3BGMB 2ARWA 4OF8A 4MDJB 3ARBD 4WV1B 3AB0C 4JY5L 3GHEL 3QNYA 5BVJA 4GBXC 2W0KA 7FABL 4OZIA 1NGPH 4MNQE 4HLZH 4Y4HA 2XOTA 4MD5A 3WFHB 3H7BB 4LCUA 3SKJL 5D2NB 3L9RB 4HWEL 4NRXB 4OQ1A 4P5TC 1XGYH 3LN9A 2NR6D 1W8NA 5IK3B 4L1DA 3P0YL 4GG6E 4QHKI 4LQFH 1BFVH 4P9HH 3ZHLA 4NNYB 1GYAA 3VFNB 2V17H 3CXHK 4IBLT 5DVKA 1F6AB 3D1MC 4Y2DA 5F9JB 2DTMH 4ZOBA 5ITFA 2YD6A 3DGCR 4CW1A 1T89A 4ZFGH 2AK4D 2PYEE 4OLUL 4KMLB 4MA7L 4PFEA 3ULUC 5F97E 4NQEB 3T8XB 3V4PL 4BZ2H 5KJRL 3QXDA 2EDJA 1P7KA 2CIKA 4HWBH 1VEOA 4LKXA 1VFAA 4Q0XL 4BK5A 1IKNC 4HX1B 3S3PA 3ARUA 4GAGH 2R2HA 1V5JA 2LU4A 3JTSB 4M8QB 3OKNB 4Q6YA 3GSXA 4GRWH 4G8FB 3KLAA 1MHEA 3P9MB 2FEEI 2LAGB 3KPTA 4OF7A 3X17A 4Q97A 5HYJB 3O3BA 4HUWA 2F58H 3HAEH 3VG9C 4ELMF 1JK8B 1JWMA 4QWWD 1JGUH 3KPMA 1TQBB 2W38A 5E1AB 3QDJA 3QIBB 2IBZX 2ID5A 2VDLH 1T0PB 3T65B 3VWJA 5MEQB 5C07D 1NGZA 1S7TB 3GGWB 1L7IH 3D87B 1SVZA 1J0YA 3QZWA 4JVUA 2FECL 1BJ8A 1CFTA 4FQXB 2I9LA 1AGFA 4OLVL 2R2BB 2V2WB 1CLOL 1JZ3A 4HHAB 5F7LB 3DVNA 2AJSH 2C5DC 4KVCH 4HT1L 3V6FA 4XI5C 3GMMA 4XBGB 1FO0L 4RGMC 4JPVH 3HNVL 2IFFL 4Y4KB 1LO5A 5L88L 1JGLH 5C0BB 3M17A 2DWDB 5FYKL 3RGVC 5I8EA 4JFXB 1TJHL 1A9BA 3DV6B 2YBRB 1DBAL 3T0EC 5K93A 1W0WA 3ULUE 4G8GD 3OJ2C 3EO9H 5E2UL 5C0JB 2BSRA 5ALBL 4I48B 2VR4A 4GXVH 4WTWA 3BIAX 5HI5D 3O45A 1FNGA 1N64H 1NUNB 1INQA 4JFDB 3S9DB 2F54D 2NXZC 5IB2B 1KCVL 1I1AA 4K9EH 5HHVL 1PX3A 3NABL 3V7MA 2Z35A 2MKWA 1YEIH 4ONHB 5DK0A 2HFGH 1T6VN 4M5ZL 1K4DA 5BW7A 3CJJA 4WGVB 4XPTL 1YYML 2V5RA 5DMKA 1I7UB 5CGYD 2JF1A 3OXRA 4JQVA 3DI3B 5EBMB 5D6DC 3QEHA 3FFDB 5DWUL 3DGGB 1CF8H 5KVGH 5DRZA 1U2HA 2IBZY 4NN6C 1MPAH 5I8OH 4PJCB 3EYOB 3IGAA 2R23A 3HC3H 1MHPH 1AR2A 2FRGP 2BC4A 4H1LG 3FQXA 4QRUB 4Q9QH 3L5WB 1KPRA 5BO1L 3KPSB 3TZVA 1QLRA 3D2UB 1CZ8L 3TBYA 2AK1H 2CKBH 2YXMA 4NWTL 3LQZA 3KS0H 1AO7D 3S36X 1FAKT 4X99A 2C3XA 4S1DC 3VXRA 3V52H 4ZDHB 1U8KB 5B3NA 1T20B 2APFA 2Z31D 5KVEH 1JL8A 1A4JB 5TE7H 3S6CA 5H94B 2LAAA 2WWKT 4KDWA 4JM2D 3I6LD 3Q1SH 1RURL 2HT3C 1SM3H 2UUDH 4QRPE 1DN0A 2VXUH 1TZIB 4D0DB 4HPOL 3MRFA 3VWKD 3C09C 4MQXD 4WU5A 1NC4B 1ZHBA 4FQCL 1A6AA 1BWMA 1VCAA 1XGUA 4NUJA 4E5XB 4KJWD 3BKYH 1KJ2A 1GXEA 3P4OA 4NKQB 5ETUB 4X6BA 4OCRL 3DMMC 1KGCD 5E8OA 2H6PA 4EI6B 4LLDA 3FO2A 2AABH 5E8NB 4LIQH 3RUGB 3V6OA 4JHAL 3I6GA 3UC0L 1TPXC 2FO4A 5IEHB 2FJHB 3P30L 1T66C 2GAZA 5DMJB 1N5AA 2DLEA 4L3AA 3A6CL 2CLRA 4XPBL 4YZFE 1KG0B 3SDCB 4NIKB 5ICXB 1J0IA 1YNLL 3TBWA 5L2KA 3SY0A 2NTFB 3D3VA 5C8JB 2IAND 1KJ3L 1S3KL 5KZCB 1D6VL 2AJZA 4L3EA 4OCSH 4R4FH 3LZFH 1FNFA 3MJ7B 4KK9C 2HVJA 3LSOB 4OLWL 1U8PA 1P4BH 1HE7A 5GRUH 2G75B 2HWZL 1GVIA 1T2QH 2XWBB 2I5YL 1CICC 5TPWH 5E4EC 2AEQH 1MOEA 3WFDL 1UWXK 1PYWA 3BD5A 4IRZH 1KUMA 4QHLA 1ZA3A 1FNLA 3WYRA 4Y89A 4I5BB 1ZLWK 3X12B 1S5IH 2ZUXA 4YHML 1OOAA 3CXHJ 3MRRA 4X7EC 4P2QA 3ZE2F 3ARED 2R56H 4Y19D 4MNQD 3BPNC 1N2RB 2FEDC 1VFBB 2PTVA 3UTSA 1HDMB 1O0VA 4OLXH 3O3UN 3ARDC 3OKOA 3PGFH 1YEJL 3R4DA 2P45B 3EW3B 4G6FD 4XMLL 4XPAH 4BH8B 4PRPA 2H2PD 5T5NF 4W81A 4CU8A 5T3XE 4OCNC 3TO2A 4HUVB 5KSAC 1FIGL 1CLZL 3MNZA 2XPGA 2GJ6B 5F1KC 1QBLH 1J10A 3PHOB 2HRPL 4HGMA 4JKLA 2BVPB 2PYED 5EIQA 4N8PA 4KVNH 4K3HA 4HIJB 5D1ZD 1ADQH 3VMPA 4HXAL 1GH7A 2R1XB 4FQ1L 3QH3A 3T1WA 1NCDH 2X7LA 1YYLH 1KPVB 5HPMB 4GG8B 2B4CC 1K9TA 4LARH 2OK0H 4EOWH 3C60C 3IFOA 4LP5A 1MRCH 2ZOLB 2Z92A 5IF0B 4XCYA 1MJUH 4AY0A 5GSVB 2PO6D 3T0DA 5CJXA 1A4KA 4H1LA 3IDMB 3SGEI 5LWYL 1MIEH 4ZO8A 2OCFD 4NFBA 1DL7L 2Q6WB 1WBZB 4YBLB 3VI3E 2XA8H 3F7RA 5EU5B 3CH8A 1KB5L 1ZVSA 5EO0B 3KYMA 4JANB 1KJMB 4WUUB 1OP3H 4ODVH 5CJOH 1T7XA 1ZT4A 4XPGH 1BF2A 1MH5A 4QNPF 1HK6A 5F21B 1J05A 4P5TD 5D96B 3W0WA 4GMSH 2AEWA 3PWUB 4LLVB 4HC1L 3WKML 1MF2H 1S7SA 3HKFA 3JWNC 1ZT1B 3QNZA 3UTZB 3WKNA 4CUCA 4K55A 1B90A 3IKCB 1MIML 1A2YB 1SJXA 1LEIB 3UTQA 1OARL 4NN7B 4UAOC 3MRIB 3ULUD 2VL5B 4HSQA 2DOCA 5EOQH 1YN7A 1OSPH 3PDDA 4ZPTA 5JORA 5ELIA 5JW4R 4LHUG 2X89A 4PJGF 4JFYA 2B8OT 1WTLA 4PJ8D 3BX7C 3QDMB 2V7NB 4K7PL 4F58H 2DWEB 2J7LA 1BZ9B 4P2RB 1C1EL 4Z7OF 2VKXA 3HC4H 2EH7H 4P2OC 4YGAB 1QFWL 3DBXB 1T0MA 2QQLH 1PQZB 5JHDE 5F3HA 5TE4H 3SE4C 4ZD3H 2K7PA 5LXGH 1GGBL 5GISH 2DAVA 5F6IC 4MSWA 1FIEA 3AMKA 1M7DA 1RFDH 4IDJH 5J0BA 4MS8D 3ZTJG 4R0LB 5DTFA 2X4SB 3P73A 2NY1C 3VD4A 4PJFE 1EO8L 2XTLA 3KPQA 1GOHA 3BYYA 4LAQL 1XF2B 5C0AB 4U3HA 1CR9H 4RFEB 4MXVE 4PLOB 4BFGA 3D69B 4N5UA 5I75C 4LLAA 1T03H 3BGFB 3TNMA 1H3WM 1CDYA 2VZTA 4Z0XB 1U93B 2IAMC 5E08H 4CMMB 1GHFL 5JMOC 4ELMB 4NQDB 1I7RB 1KLUB 4NSKB 4X5WA 3T0ED 4F15C 3ZYJA 1A6UL 3BDYH 4NJAH 4XNXH 1RZJL 1E6OH 1SMAA 4I4WA 5F1IA 1SVCP 3CSBA 3K1KC 1TMCB 1AXTH 4E42A 4Z78A 4ONFL 4FA8A 4E0RB 2C4FT 4PG9A 3QWOA 4QRPD 1B0RA 5HJ3B 2E7LC 3RGHA 1JP5A 4JFHE 2GCYA 4KJYA 3QPQD 3VXUE 1KENH 5DMGC 5DMIH 1CL7I 4G9FE 3KLHC 1N8ZB 1W72L 1IGFL 1V3JA 2E7BA 4HH9B 2YA1A 3MRMB 3S37H 3P9LA 5ILTH 1YEDB 4HZAA 4MQ7B 5E8DL 5TQ2H 1HYSC 1NAMA 3RVWD 1F3JA 3QNYB 2Z8WC 4XP1L 4HKJA 1H8OA 4G6JH 2A73A 2P5EE 2FCBA 4PJ9D 4Y4HB 3RP1A 3L5XL 4MD5B 2GKIA 1KJVA 4P59L 4KDVA 5GS0H 4CVXA 4KMTH 1LO3H 1A21A 3P3YA 4A2LA 3VXME 5C0ND 2XKUA 2XYCA 2NY2B 4KJQC 1KTDA 3MLXL 4ZTOH 3EYSH 5FM8A 1WWWX 1C7SA 3QXAA 3QDHA 5SX4I 4J2XA 5ITFB 4CW1B 1I3RB 4ODHL 3F7YA 3FL7A 3UROR 4FFWD 4PBXA 1F11A 3RHWF 5GRVL 3QXDB 1P7KB 3QXTA 2CIKB 4ISVA 4LKXB 1VFAB 4NKOA 2HJFB 4MCZA 2EDRA 4FNLL 2R2HB 3K0WA 1ZHNA 5DJAB 4WHYG 1M71A 1U8HA 1S9XA 1A6WH 3GSXB 8FABA 1GGCH 3KLAB 1MHEB 1EVUA 1OW0C 1NC2D 3O3BB 1E27A 5JO5A 1RHHA 5IG7B 3NMEA 4LK4A 3KPMB 1MCIA 7CGTA 4N5EC 3UTTE 4L4TA 3WD5L 2XTJB 2XZAH 3U7WL 3QDJB 3MBEC 4WI9A 1PKQE 3L5IA 4JY6A 3VWJB 1TVBA 1UM5L 5DJ0A 4P5MA 3AY4A 5JNYA 1CXFA 3MRGA 2XFXA 4CADA 1ETZA 3QZWB 4HQQH 4HGWB 1E4XI 3TA3C 1CFTB 5DVNA 3QCUL 5T3XD 4XC1L 2I9LB 1M1SA 4OBSA 2ITDA 3HCVA 2DQDH 3DVNB 1MREL 4WW2F 3V6FB 3GMMB 4OD2A 3DVFA 5J3HC 3MZTA 2Y5EA 3PWLA 1WTGT 1ZHKA 5CP7A 2C3HA 1V7MH 4FXKA 1LO4L 1NAKH 2FBOJ 4PJIA 3B43A 3M17B 4HAFA 3GIZH 5I8EB 3QEQA 3RIFK 1CK0L 1MQKL 1A9BB 2EEBA 4U1SA 3VGEA 4WUKH 2L4OA 3CLEH 1A5FH 4PJBE 5K9JL 3TT3L 5FV1L 3TBSA 5FM5O 3KPLA 4N8CL 4F9PA 2V6HA 2BSRB 2YPLA 1TJIL 5CCKH 3WHE0 5C0DA 3O45B 5JZ7C 1FNGB 1CL7L 2V5MA 5E99L 4RAVA 1INQB 3RKDD 1I1AB 3HI6L 2VLRE 4KK6D 2Z35B 3H6JA 5DK0B 4E41A 4RZCA 1K4DB 1FBIL 4FABL 2NY7H 3O0RH 4B50A 1T1ZA 3ZDYF 1FORH 3SE9H 5DMKB 5DC0A 3OXRB 1B9ZA 4F2MA 1N0XH 3QEHB 5GRWA 4NKDA 5DRZB 2EEAA 2O5XL 1SY6L 1F3DH 3HZYA 3NCJL 1N3NA 4FFVD 3IGAB 5TGBA 1PZUB 1U42A 4RBPK 3O6FD 3FQXB 1F2XK 5JW5B 1PEZA 4JPWL 3TM6A 3TZVB 1QLRB 4GMTL 2P8LB 5EB9A 3TBYB 1I8MA 2AGJH 4GLRH 1ACZA 2FGZA 3LQZB 4RNRA 4BZ1L 5FAAA 5AAWA 4K23L 4HXBL 4XT1C 2CK2A 2CXKA 4X99B 5DC9B 3ARXA 1YA5A 4K94H 3VXRB 5I66A 1NEZA 4NQCE 1KN2L 4XP5H 1NLDL 5L8JB 4GOSA 4OM1L 3TBTA 1TZHB 3C60D 1K3ZA 2VDOL 4YDIH 3L95A 1AFVH 2VLME 5GGRY 2IADA 1MY7A 1WZLA 4MXQC 3MCG1 1DN0B 5JHDD 3LV3A 2NY5L 4P46A 1XGTA 3OR7A 4OV5A 3MRFB 4WU5B 4LSQL 1A6AB 1XGUB 4LCYA 4NUJB 3RY6C 3T0WA 4KPHL 1M4KA 3L3OB 1KJ2B 3P4OB 2WBWB 1G6RA 2GIYA 3S8WA 4XBPB 3QRGL 5I1AA 4S1RH 2LU7A 3EYQD 1E4XL 1MCPH 5F9AC 2C7UA 4X6BB 4PLKC 2BY0A 4LLDB 3FO2B 2X4QA 4ZAKC 3ROOA 1UXWB 3WIHL 3DWTA 4CGTA 5F71A 5DHVA 3W81A 4ZSOA 4LSSH 3I6GB 4LCCC 1KCRH 1UKQA 2FO4B 3LMJH 2GAZB 4H0IA 1N5AB 3NA4A 1RZ7H 4OGAD 1X5IA 1S8DA 2CLRB 5CUSL 1IEHA 3MJ9L 1CDJA 3TBWB 3RX5A 5L2KB 3SY0B 1LWRA 3D3VB 1F58H 3RNKA 5B21A 4L3EB 3EJYC 3QUYD 5TFSL 2F19H 2HVJB 5D70H 4A6YA 1UACH 3VI4F 1PY4A 3A6BL 1NMAH 3WO4C 4JFHD 3UP1A 5DDHB 4M7KL 3BH8A 3FO0L 3VXUD 1FG9C 2J88H 5E6IB 1R3IL 3KNBA 4XCEA 1A14H 2H1PL 3B9KD 1PYWB 3H8NA 3IFLH 4G9FD 4Y5VA 4QHLB 3WHXA 4M9OA 4X6DA 1U8MA 5HDQL 1ZA3B 4S1QL 3U30C 3ARZA 3R8QA 2VDNH 1ED3A 4LCIL 4WCYL 3B8YA 3MRRB 4P2QB 1A3LL 2P5ED 4MAUH 1I9IL 5HD8C 1X5AA 5B4MD 2QADC 2D03H 2RCSH 3OKOB 4P4KD 15C8L 2L0DA 1FP5A 1FNSL 1FFOA 1ND0B 1DN2A 4LRNL 4IIQC 3I3EA 1FHGA 3PDOA 4IOIB 2EZ0D 1X5HA 1MVUA 3MNZB 2XPGB 1NGQH 2VDPH 1Y0LA 3TFKC 1UZ8A 1KCSL 4OZFG 5K33A 3RWHB 4O58L 1MHCA 3NIGF 1A1OB 1DSFH 2Z91B 2E8YA 3HMXA 1I9JL 3A67L 4MJIA 2CRZA 4RISH 3K2UH 1A3RL 2EDWA 1IAIM 3QH3B 5B8CA 1RMFL 4YIQA 2X7LB 5DUPL 3H9YA 5F9DC 1LEGA 5B39G 5MP6L 4QRSB 2UZIH 3IFOB 5KSBF 4K3JH 4XCYB 4UU9A 3B5TA 3OTTA 1ZWIB 4L4JA 3ZZ1A 1A4KB 2OR7A 1FL3A 3UTTD 3EDKA 4BUHA 1YC7A 1HYSD 3GIVA 3QAZC 4NRZA 1T5WA 1IILE 4PG2C 1ZVSB 3CLFL 5D5MA 1ONQB 2ADFL 3F6IA 1ZT4B 2OJZH 5CSBA 4F3FB 4APQA 6FABL 1MH5B 1LGVA 4PJXE 2YD1A 3IDGA 2MMXA 3W0WB 4JDZA 4HJ0D 4OIAA 5HBBA 3OGCB 3BUTA 5MERA 2WBJB 4BUGA 2FHCA 5TDOA 2G5BA 1OPGL 3QNZB 4DUXA 1WGOA 1R5VB 3RU8L 1WZ1L 1J0KA 1NFIA 1QKZL 1NBYA 1UKTA 3UTQB 5CJQL 2Z4QB 3SO3C 4DZ8A 4ENEC 2DI7A 5DRNA 1YN7B 2YHGA 4ZPTB 4IRSB 5JORB 2VDKL 1Z9LA 4JGMA 5F8QC 5FYLH 3KAAA 4JFYB 1MFCH 5TE6H 2JJVA 4JREC 5JA9A 3DO7A 3WUWG 5J1AA 2DI9A 1C5BL 2VLRD 3WFCH 1U8IA 3BRFA 5T3XL 4EKXA 3SGDH 1OQXA 1T0MB 3WS6C 4MA1B 4Z5RA 1AR1C 4P3WA 2D31A 1AXIB 4MZ2A 4QYOA 2XRAH 4N1CA 4KU1A 5F3HB 4H5SA 3ZHKA 5IFJB 2IG2L 3GMPA 4Z7UA 3PDGA 2EDQA 2YMXL 4FXLA 1JRHL 4MSWB 1M7DB 2V9QA 4HK3J 2VQ1A 4K2UH 3O6KL 5DI8A 3QUMA 3P4LA 1A47A 2EDTA 5DTFB 3MLPA 3M45A 2X9XA 3P73B 3BISA 4WFHE 5GJTL 1YEHH 5JQ6L 1KEMH 4HIHB 1T3FA 4LKCB 1FFNA 4LHUD 2A0LC 3IVKA 1RU9H 1NGXA 4U1LA 2EKJA 3TNMB 5C0IA 1F4YH 4NWUH 4MNGB 3BN9D 5E5UB 4WFED 1PVHA 2AJXL 4NQCD 3QB7C 4X5WB 5FGCE 4M7ZB 3LKOA 4LLMA 4P3CL 4I4WB 4UT6H 5F1IB 3N85L 4CKVX 3L3KA 3ZKQD 2QQNH 4NCDA 5D7IF 4E42B 1AC0A 4ZNCD 4PG9B 1B0RB 4KQ4L 1IGML 1KN4H 1PX4A 2GCYB 2OSLA 4KJYB 4M6OH 2NZ9C 5F96L 1MJJA 1RD6A 4AEHL 5IGXH 2BY1A 25C8L 1OAQL 4M02A 3JWDL 3QG7H 1ORSA 3P9LB 4I77L 4KQ3L 3RWCA 1UJ3C 4WW2B 5FM5M 5J06A 4YHYC 1NAMB 4OFYD 5IFAH 2OJEA 1QRKA 4NPYA 1F3JB 4O4YL 3GJEA 3MRHA 4X7SH 4UTBL 3TV3H 2EE2A 2R39A 2A73B 3MV7A 5KTEL 1G9EA 2I27N 3AREA 3NIDE 2P42B 1KJVB 4Y19A 4PGCA 3EJZC 1ZGLP 5ISZE 4PPTA 5B39A 3O6LH 4NNPH 4I18B 1HHHA 2C9AA 4MJ4A 2ADJA 4JM2F 3GFUA 2Y72A 4U3CA 1LHZA 5ENWA 1RUPH 1KTDB 3DXAA 5GS1C 5FKPA 3W5NA 4Z7UF 5GGQL 1INDH 3BQUD 4NCC2 2NY0C 3ILPA 2E3VA 3QWQB 1GZQA 3FRUA 5MEPA 1I1CA 5LGKA 2DQCL 6CGTA 3EYUH 4U2ZA 4HK0A 4CN4A 5FOBB 3BPOC 4WRLA 3MGOA 1JZ6A 2ED8A 3F7YB 4R26L 1F11B 2AXFB 3PQYA 2FB4H 4R3SA 3B3IA 3ZYZA 1R3KA 1MRFH 4BFBD 1I9RH 5D1ZA 4NKOB 4MCZB 2WAHA 3WIFA 2ZG3A 1ZHNB 4QTIH 1M71B 1U8HB 2XNAA 3NCEB 2R29H 1L0XA 4PB0L 8FABB 5CLWA 4R7DA 3PL6A 3EOTL 1E27B 3KG5A 5JO5B 1RHHB 1MLCB 3PWVA 4CVZB 4Z7WE 3MJGX 4JY4A 5IBLC 4L4TB 3WXVH 3EO0B 3MXVH 4JY6B 1BQHA 1UVQA 2CUMA 5DJ0B 1RIVH 1MELA 4P5MB 3QUXA 2WLYA 4KDTC 5JNYB 3U7YH 2FL5A 3MRGB 2XFXB 4CADB 1TETH 4HULB 4NZTH 1KV3A 1NCCL 4GBXA 1B4JH 1AY1L 2CUIA 1DBML 5I9QC 3MROA 3O4LA 2ITDB 4C83A 3U4BH 2W60B 4OD2B 2D7TH 4H25A 4P5TA 3L7EA 3CGTA 5I76A 1ZHKB 5CP7B 3BDBA 4X83A 5H2BB 3UTOA 4FXKB 2RAMA 1A3QA 5LGJB 4LPUA 4XCCH 3QEQB 3IDXH 1KJ2H 4U1SB 5A3ID 5F93C 2ZUQC 5IHZA 3TBSB 4LSTL 3KPLB 3PXHA 4MAYB 5JIKA 4YXHH 2DIAA 1RUKL 3EFDH 4XNUL 2YPLB 5A43C 5IBTL 4JKKA 5C0DB 4U6VH 5D7JC 2MSPA 4RAVB 3V6ZA 4XAWL 1QA9A 4WEUD 1QFOA 3KR3L 1IKNA 1CFSA 1A7PL 5DMYA 1QD0A 1U8JB 4E41B 4RZCB 5EIIA 2DYPA 4U7MA 1T1ZB 5DQDH 3P11H 4NRYA 1FAIL 1ZANL 5EU6A 1DVFC 4DK6A 5JDJA 2X42A 4DW2L 4HMDA 4H20L 4F2MB 2EYRB 4BYHA 5HGBA 4X5XB 4NKDB 4POUB 4XNMA 5A1AA 3HZYB 1N3NB 1JWUA 1N6QH 4HBCL 3O6MH 4ERSL 1ROWA 3FTGA 3DVGB 1VKXA 3ARVA 2YD2A 5JW4Q 4DGYH 1OGAE 5E9DA 5A2KH 1VFUA 4F7MA 4HPYH 1FGNL 1I8MB 3IDIA 4RNRB 3GHBL 1BFSA 2GTWA 4XPFL 3ZT6A 5ADOH 1MWAA 4U0QB 4MD4B 5I66B 5J1TC 1NEZB 4YR6A 4TSCL 2P43B 5C2BL 3MV9B 3E8UL 1I75A 3TBTB 2AJVL 1CXEA 5H37G 3S35L 3T0EA 5JW3L 4U6XA 4M9PA 4UDTA 3L95B 4G6ML 1VENA 5EZJA 3UX9B 1J1XH 2IADB 2J4WH 4ETYA 3QCVL 2NXYB 3LV3B 4P46B 1XGTB 4OV5B 2XQBH 3DYOA 2NY6D 4QRPA 4LCYB 1G7QA 2AJ3A 4FQIH 3O9WD 3LS4L 1G6RB 1NGYB 3ARYA 3V4VL 5I1AB 2DIBA 1ZE3C 2ERJB 1A9EA 5E8EA 3ULUF 2C7UB 3CFKA 4LHQB 1CGUA 2X4QB 1P7QA 3ROOB 3QQNA 5TQ0H 2C3WA 5D2NC 4WFHD 5DD0H 5DR5H 43C9A 4ZSOB 4OI9A 3RZCD 3ULVC 2QL1A 3BVNA 4QRRE 5FUCC 1WEJL 1JF1A 4O9HH 2RIKA 5D6DA 1S8DB 3DUHA 4TVPE 5J1SC 4K3EH 5E8PA 2CMRL 2JK5A 3OZ9L 4H8WH 1CDBA 1U3YA 4GQ9H 1MCFA 1XIWC 4Q58C 1KEGH 3RNKB 3K1DA 2QLVB 1A6PA 4D9LH 1OAZH 4ENED 4Z7NE 1RULH 3NPZB 2ZUVA 4UBDC 3WCYA 3WLBA 4A6YB 4K7FA 4G80A 4KHTL 4XVSL 2AK4B 3INUL 3BH8B 4MVBC 3LKNA 4GS7C 1BF8A 1WT5C 3T3MF 3KNBB 4XCEB 4Y5VB 5CD3A 2BP3A 4X7CC 5D7LE 3WHXB 4X6DB 5J9PB 1U95A 4G7VL 3MRKA 3MPCA 1ED3B 5FCSH 3G6JA 4KKNA 1OTSD 3LAFA 1D9KC 3R8BB 1HZHL 2C3GA 3HC0A 4W6YB 1OF2A 4KUZL 3X11A 5CIPB 1PG7L 5ISZD 4Y1AE 1FCGA 2P48B 4JY5H 1VPOL 4FQXC 3MZGB 1FFOB 12E8L 4JFQA 4G6AD 3DMMA 1JGDA 1CGSH 4X4MA 4JFZH 4EI5C 4P2YA 1MVUB 2MTPA 1Y0LB 4YHNA 1S5HB 3P0YH 1MHCB 3MJ8A 2GUOA 1HN1A 4WFFE 1FZJB 3BWUC 5I1HL 3CH1A 3O2VL 4MJIB 1CFVH 3U79A 1P5UA 5B8CB 3FQTA 4YIQB 3BEVA 4AJ0A 1IEBA 5C09E 1LEGB 2ZNWA 5SWSE 4MA7H 3IXTA 4OIIL 1RIUL 2XY2A 3V4PH 3QQ3A 3P9WB 2C1OA 3F7VA 5KJRH 4M93B 4UU9B 2OZ4L 3D85A 2D4DA 4G8GB 4Y5YC 4YHOL 4J6RL 1CICA 2IPUK 3ZDXF 3GIVB 2CDGA 4NRZB 1T5WB 1LDPL 2F54B 3QWRD 2ADGA 5SV3A 3OSKA 5D5MB 4ODSH 4LL9A 1LMKA 4CVWA 5F3BA 1AQKH 4POZD 1VEMA 3GRWA 1VFMA 4APQB 5T1MA 1MCOL 2VSCA 2P5WA 1QBAA 3IDGB 32C2A 3Q5TA 3O3AA 4JDZB 3G6JF 3ARDA 5CP3H 3CXDL 5EC2A 5D7IB 4I3SH 4P3DA 5TDOB 2G5BB 3ETBF 5HVHB 1EGJA 1YMHA 4UINL 1W72B 3UJTL 3QULA 4KHXL 3RVTD 5KSAA 1JFQH 1VDGA 1NFIB 1NBYB 4EUPG 2X05A 5J8OA 2YOCA 3HNVH 3OB0K 4U6TA 5C6WH 4DZ8B 4XMKH 1NAMH 5L88H 1XCTA 4KRPB 5FYKH 1KIUA 2OM5A 4NO0A 5DGRA 1AO7B 4WI7A 3DO7B 2JKXA 3ELAT 1IM3B 5J1AB 5HYQA 5E2UH 1DQJA 2QQQA 1U8IB 2EDLA 5ALBH 3SGJC 3HE7C 3BP6A 3EGSA 3C60A 2JIXD 4Z5RB 2APXA 2D31B 4KZEL 1T22B 3GMPB 4Z7UB 3V9FA 1FL6B 4EBQL 4XMPH 1ZTXH 1Y18A 3MUY1 4HIEA 5GGTA 3GI9H 1RQ5A 2VQ1B 4XPTH 5DI8B 3EKCA 3QUMB 4LSVL 4JJHA 2VO5A 2NY3D 1OGAD 4UZGA 5HDBE 3SDCC 4BM7A 1T3FB 2FSEA 4FMKA 1FFNB 4M6MH 1DLFL 4YXKL 1NGXB 3VI3F 4U1LB 3IVKB 3REWA 1BD2A 2JTDA 5C0IB 2VXTL 1FFPA 2BDNH 1UQSA 1DUYA 3C2SA 5GRJL 5LBSH 5BO1H 1IGTA 3TIEA 5GZOC 1DR9A 2AVGA 1A02N 1G9NL 3LKOB 4LLMB 4OF3A 3W9EA 5D6CA 3BJ91 5D7JD 3NTCL 3ROLA 2YD5A 3WHE1 2OSLB 3MLTA 3RVXC 3SN6N 5DD1L 1MJJB 2YPKA 4HCRL 3S35X 5HHOE 1RURH 3RWCB 2HG5A 4P2OA 4I0PD 2OJEB 3B5HA 4NPYB 1LE5A 1T21A 4HUXA 3FHQA 3H2WA 1FDLH 3MRHB 4YDLB 2Y36L 2PR4H 4RGNE 3MV7B 3SE4A 5DD3H 1Q94A 2CIIA 4D9QE 5I8KH 3AREB 4ZFZA 3B9DA 2J6EA 4Y19B 4PGCB 4NHCH 5LJYH 1HHHB 2DQGH 3SPVA 2LFGA 4TVPD 8CGTA 1ZLUK 3B6SA 1DANT 3O11A 5ENWB 4ODTH 5FKPB 1UCTA 3N1FC 3N9GL 1LP9E 4F37K 4G6FB 3SDYL 3HUJA 4K8RD 3BP4A 3FRUB 5BZWA 5C0RH 4PS4L 3SDDD 2H2SC 4YDVB 3RPKA 4HK0B 1A64A 1YNLH 4PD4K 3MGOB 5JTWA 3I9GH 1KJ3H 4M7JL 3RBSA 3PQYB 4QHNA 2CDEA 1EFXA 4R3SB 3B3IB 1R3KB 4R96A 1QO3A 5D1ZB 4PJFF 1H3VA 5L6YL 5D7LD 4PREA 1DCLA 4UIMA 3WIFB 2HWZH 1HXMA 2I24N 4JM4L 3RIAF 2XNAB 4MXVF 2I5YH 4NGHH 4R7DB 2V9TA 1S78C 5C3TA 1IGYA 2E7LA 4O2CB 3WFDH 4JO4L 2X2YA 3PWVB 1JNHA 5AYUH 5C08E 4JFFE 3LKPA 4JY4B 5DVMA 4B7IA 2X1PA 3NACH 2VOTA 4Y1AD 1BQHB 3UJJL 1UVQB 1QSEA 3C08L 3I3BA 1GC1L 1GZPA 2PXYC 2VXQL 2DTSA 2FL5B 1L6XA 3AB0B 3UPCA 3K3QA 3KPRE 1OAKL 3ULVD 3V0WL 1W0YT 1PG7X 1OP5K 2B39A 3HRPA 1CN4A 2R15A 1IGJB 3MROB 3O4LB 3L7FA 4C83B 2ICES 1JI1A 4XMLH 1TIUA 3TBVB 3NFSH 4H25B 4TULH 4P5TB 3L7EB 5FECB 5I76B 5EZLA 1T80A 4DKFH 4X6CA 4O00A 4NN7C 4PJ5E 2BVOA 2ICEA 2YKLH 2JB5L 4I2XE 3X13A 5MEOA 4UBDD 5SWSD 3WJJC 1G6RH 3IDUA 2R4SH 5IHZB 3HMWL 1S9VB 3OKYA 4N90E 3HUJF 4P23D 1A6TB 2R1YB 4XP4L 3C2AH 1Q9WA 3ARFD 1AHWB 3MV8E 1KPUA 1QA9B 2AW2A 5BVPH 3WDIA 4KWUA 1J8HE 2AI0H 1CFSB 3KPOA 1CDGA 3LB6C 4Q74A 2PW2A 2EC9U 1NUDA 4PRHE 2DYPB 5EIIB 3ZKSD 1UM6L 2ZJSH 2FATL 1HHJA 1DBKH 5LWYH 4NRYB 3VG9B 5EU6B 5T5FH 1L7TH 5AZ2H 3MBEA 3VCLB 5GRXG 4R0LC 4A6YH 1WZMA 5IKCA 1OL0A 4XNMB 3R0NA 1JWUB 3ZDZE 3BKML 3OKLA 1YEFH 3C8KB 3FTGB 4EI5D 1VKXB 3TA3A 3CAFA 2PF6A 5DFVC 4AEFA 3MRJA 3ARPA 4F7MB 3BGFC 3IFNH 4JDVB 5K9QI 3U9PL 3MODH 4HF5L 3X3FH 2O61A 2ORBH 3IDIB 4JCLA 1ZEAH 2UWEE 1DQTA 3SDXE 2GTWB 1U3ZA 3BZDA 2HMIC 4KXZH 3UYRH 1JMZA 1CU4L 5FCUH 3SKNA 4DGVH 2H45A 2HT4D 4YR6B 1IM9A 1HKLL 5CIPH 3AMLA 1MFAH 4NQCA 1IE5A 4BQ6A 3F7PC 1KLGA 3T0EB 1YJDH 2KQMA 4U6XB 1YEKH 5K9KA 4UDTB 1TITA 5EZJB 4X6CF 4K7PH 5HDOA 1C1EH 1CIDA 1E4KC 3TN0C 4QRPB 2DQJL 3N1PC 1ZAGA 4OZ4B 1MFDL 1U8NA 1KB9K 3H3PH 1G7QB 1QFWH 2AJ3B 4OF5A 2NXZB 3MRPA 4YXLH 3VG0L 3KJ4C 5FHBL 4TTDC 1A9EB 4Y16D 1UH4A 2BERA 3CFKB 3HMXH 5ANMA 5EUOE 1DQLL 2VJXA 4J3VA 3U2SA 1P7QB 1FL5A 4HLZG 2XZQL 4OFYA 4U49A 1OWWA 5D93B 3CNKA 1SJHA 1UWGL 43C9B 3BVNB 3QG6A 2D9QB 1JF1B 1KCKA 2NY2C 2EDDA 4ZXBC 3V5KA 4NN6B 1G9MC 1Z6JT 4OLZL 3WNLA 1EO8H 4UI2A 2X5PA 3V2AR 4KTEH 1MJ7L 3CFCL 1E6JL 1YECL 4QRTA 3BQUA 3WLBB 4K7FB 4G80B 4ODBD 5FOJA 4IRJC 4M1CC 1VB9A 4KUCD 3LKNB 4J3TA 4FFYL 4IOFD 1RZJH 5TJWK 3KLDA 5HHOD 5CD3B 3UYPA 4BZYA 4ONFH 4M48H 1U95B 4O2FB 3HE7D 4TPRH 3MRKB 3E1F1 4PY8I 5ADPH 1XR9A 4YHKL 5TF1L 3G6JB 5FEBA 4X4YA 1E0OB 3VFGH 5ERWA 5ACZB 4C56A 2XTJC 1AJ7L 1WFTA 4HKBA 4RGND 1BBDL 1W72H 1IGFH 1OF2B 3BKCL 1CI5A 1A1NA 4D9QD 3OHXA 4ONGL 4PD4J 5E8DH 3RY6A 3X11B 3H7LA 4JPKH 3KLSA 1C16A 4WO4D 1G7LA 3OAYK 3T2QA 3VH8G 4I9WE 3NBNA 5E2WH 4GQPH 3DMMB 1JGDB 1IAMA 2BHUA 4ZAKA 5CBEA 3LKQA 4PUBH 2IPTL 5HYIA 1ZT7A 2IGFL 3C6SA 4MQTB 3RNQA 1Q9KB 2O5YL 4QT5A 4UV7L 4JN1H 2R9HC 4LCCA 5AG9A 5AUMA 2BX5A 1TPXB 4RAUB 4YHNB 1L9NA 4O5LH 4RQQA 1QNZL 2APTA 3OF6D 3MJ8B 5DSCA 2GUOB 5CEZE 2FGWL 3CH1B 3WDJA 1DQDL 2VXSL 4LSDA 5JXEC 3FQTB 4QLRA 3SCMD 3BEVB 1IEBB 3BZ4A 4QTHA 1ZXQA 4JG0H 2DQTL 3IXTB 4HJGA 5EBWA 4J4PC 4ZUTA 4LBEA 4ZS7H 3QUMH 3QQ3B 2C1OB 3F7VB 3FQRB 3KJ6H 1PZ5B 4FQ2H 3D85B 5JPNA 3EHBC 1WICA 3UBXG 5C08D 4JFFD 1GPOL 4ZG1A 5F6HI 5I1CL 4Q9RL 4OFVA 4AL8L 4TVPL 5E4EB 1U58A 2X1WL 4XNYH 5IMLA 1Q9OB 2CDGB 4KTYA 4UUJB 4RDQF 4K8RL 2ADGB 1DDHA 1H3XA 1SBBA 4PRAA 1UH3A 4JQVC 3S4SA 3KPRD 3LQMA 1G7JB 2CLVB 3BPNB 1EA9C 2P5WB 5I2IA 3EYVB 1D5IL 32C2B 1RJYA 3O3AB 3ARDB 1RJLA 3RPIA 1YNTA 4XC1H 2HKFL 3LRSB 2XZZA 3FT3A 4L8SC 4P3DB 1GIGL 4GH7B 1LE9A 4PB9L 1YMHB 1L0QA 2VDRL 3IDYC 4PJ5D 1MSPA 2EICA 4ZFOA 1CDCA 3QULB 2BK8A 5KSAB 2H2SD 4ZUVA 2OBGA 4MJ6A 2VXVH 5J13B 2VAAB 3CFEA 3CVIH 3VXPA 3FOMA 1JHKH 1JGEA 5IW6A 1XCTB 3OGOE 4XVUC 4N90D 1A0QH 1XT5A 2KQNA 1OD9A 4LNVA 4NO0B 3D25A 4P9ML 1MRDL 2PETA 3IJSA 2IALB 3MV8D 1E28A 5HYQB 1VGEL 1DQJB 1XGPA 1GAFL 5GGSB 2YRLA 3OKMA 3VXTA 2PTUA 1ES0A 4OCWH 4WI3A 1M05A 4PRHD 1TJIH 3BP6B 1TQCC 3EGSB 3C60B 1BFTA 5L0QC 1F2QA 1NMBH 3FMGH 5JHDB 2VQTA 4R2GC 1Q8MA 4HIEB 1ZHLB 3C5ZD 4FABH 2PXYD 3D39A 3T77A 3G5VA 4WEBL 2R1WA 2OP4H 2W92A 5GJSH 1FJ1B 3WFEH 3WIIH 5F7EH 2VZUA 1JMXA 4NKIH 3OWEA 2LABA 3OAUH 2AERT 3NCJH 1F4WL 3QJFA 3WSQL 3UEZA 4M4PA 1Q0XH 3IETA 2A6KA 3REWB 2EECA 5IV2B 4XP9L 1UQSB 5DLML 5LAXA 1DUYB 1JZ4A 1KB9J 1IBGL 2YSSA 2MFNA 3M8OL 1IGTB 2VC2H 3KGRA 4XWOD 3MRBA 2GYSA 3BGAA 4PJXF 2OQJA 4UAOB 1QSFD 4HXBH 4LEXL 1R0AL 2J5LC 3W9EB 2WP3O 2YN3A 3WLWD 2DBJA 5D6CB 5I30L 5E6IC 4EVNA 3PGCA 3B9EA 1NLDH 3LS5H 3ROLB 5KOMC 3ULSA 3MLTB 2YPKB 4LGRB 2VDOH 3LB6D 1MI5A 1TFHA 2IH3A 5ABDE 4EN3D 2P8MA 4QXTA 2NY5H 4GRLC 4P2OB 2VN7A 3WS6A 5ITBL 4LSQH 4CU7A 1LE5B 1T21B 4HUXB 2XWTA 2CIIB 4DGIL 4YWGH 4ZFZB 1R5IB 3TP4A 2VLJA 2BNQD 3GB7B 5F6IB 2B1AH 5CS7A 3DLQR 3WIHH 3ULUH 4NZRL 3B6SB 1BFOA 4P4KB 2B0SL 3O11B 1INEL 2BNRD 4LCWE 4ONOA 4P4RA 3G5ZA 1ZLWH 4UQ2A 3UBXA 5IT2L 1I7ZB 3HUJB 2GJJA 3BP4B 4F8QA 3ZSTA 4NYLA 3PG2A 5DHYA 4PJAE 1DE4A 1AP2A 5CUSH 4U31A 5BZWB 3RWFA 1T0NA 5IJKA 5CFHA 3TESA 2VIRA 5J7CC 2MHAA 2JJUA 5CINL 4BKLA 1JZ2A 3GMRA 4QHNB 4WTZG 2CDEB 5CJ5A 1EFXB 4KKAD 5I1GH 1X5LA 1QO3B 1SYSA 2QHRH 2A38A 5KVDL 4F15B 2YD9A 4PREB 3JV6A 5C0GA 1N5YL 2A6JB 5I8CB 1HXMB 3QFJA 3L6FA 1SEQH 4M7KH 4YBHA 1IGYB 1R3IH 3MX0A 4U6YA 1V7NL 3JWOL 3LKPB 1U8LA 5F1NA 4MXWL 1FZOA 4S1QH 1Z5LA 2BVEA 4N0CD 4OF6A 3EYFA 2CRMA 4LCIH 3OJMB 4I9WD 1QSEB 4TTGA 4WCYH 1PKQB 3TH3T 1UJ3A 1EERB 3CCHA 1RZFL 4J8RA 3QWRA 1I9IH 4JO3L 3TPUA 5B3JE 2JB6A 5DURB 3MRCA 3Q0HA 4YH6A 3PUCA 1KTLB 2XN9A 1RVFL 4UIKH 3L5JA 3L7FB 2WBJC 4KJPD 3DARA 5EZLB 5CEZD 2HT2C 2YXFA 4GW5A 4X6CB 1NDMA 5GS1A 4NM4H 1AI1H 2X9WA 3DYMA 2ARJQ 2ZG1A 2QSCH 3V4UH 2BVOB 2ICEB 1CXLA 3I85A 5MEOB 4GAJH 2QQKH 3O4OC 3NIDF 4IRSC 3U7AA 4PP1C 5IMOA 2IWGA 1ZS8A 4YHPA 5KN5A 1MLBA 4TSBL 1UM4H 2XKNB 5IVXA 3FFCE 3UDWC 1EBAA 2DMBA 3MYZA 3U48A 1IC4L 35C8L 2PW2B 4QHMA 2GFBB 4OCLC 3GSWB 2HTKD 3PP4L 4WI6A 1IC7L 1H8NA 4OCMC 1KCUH 1HHJB 1F6FB 3T2NH 1ZGLM 2JIXA 1K3IA 2V2TA 4D2NA 3HZMA 5HYSB 2NLJA 1UKSA 3MBEB 4JRXA 2GI7A 3T1FA 4YQXH 5IKCB 4JFEA 3PF2A 3TNNA 3RAJL 4XGZA 2K9UA 4KDTA 3L3DB 1HYRC 3OKLB 1RZKL 3NZHH 4V1DE 3H9SA 2IBBA 5KAQG 4Z7WF 3MRJB 1BEYL 4FP8L 5IB1A 5F9OH 1OGAA 3DETC 2XXMB 4LVHB 4PBVC 2O61B 4TUJA 1HEZB 4LU5L 1QQDA 1J11A 2BJMH 2MCPH 3RWJA 1OCWL 2HFFA 2W0PA 5JXED 1KELH 1K5NB 4OQTA 4M7ZC 2VE6A 1X5FA 3K46A 2GW5A 2AXGA 5DK2A 5FA4A 1C5CH 1S7UB 4NQCB 2GTZA 2VR9A 1MEXL 5HXMA 1J5OL 1WAAA 1JE6A 1KLGB 2X1QA 1U8QA 3MFFB 1TCMA 2X44D 4GKZA 2YN5A 2EE9A 1KFAH 1YQVL 1TLKA 5D7JA 3VXOA 1JWSA 4S11A 2W9EL 5D2LA 1U8NB 4WW2C 2VWEE 3MRPB 2E5EA 4FTVA 4OD1H 1H3PH 4QO1A 4LIQE 2D7MA 5EO9B 3H9ZA 5ANMB 1LO2H 4NJ9H 5IVXF 5I1IH 3F62A 3FRPG 4WTZA 1FL5B 4PLJC 4G43A 1SJHB 1DVFA 3HG1D 4I18C 1X4XA 3QG6B 3BYTA 5CJBA 1HI6B 3V5KB 4YDKH 4HD9A 5JHLH 2VLLA 2CK0L 3QJHA 5GJTH 1S7XA 1QR1B 3CC5A 2VLKD 1FPTH 1UA6H 3RWEB 2DMCA 1JNJA 3ZYOA 1TVHB 1GL4B 4QRTB 3BQUB 2FZ3A 4M4RA 3ESUF 2ADIA 2BHZA 5E03A 1F97A 2AJXH 5LCVH 3P77A 3T4YB 2J8UE 4UOW0 3ZYIA 4J3UA 4Q9CA 3GRWH 1KIRA 4P3CH 3N85H 5DQ9A 3W39A 3TVMD 3LDBC 3AFLA 2X70A 2V2XA 3RWDA 1JNLH 4ZUSA 1XR9B