2DJ4A

Solution structure of the 13th filamin domain from human filamin-b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
108
structure length
108
Chain Sequence
GSSGSSGVVDPSKVKIAGPGLGSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Filamin-B
publication title Solution structure of the 13th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
total genus 10
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dj4A01
4JB9H 2DQUH 1TFHA 4Z95H 5DSCA 5HYSA 4NQEB 2Y25A 2IGFH 5GS2D 3ULVL 4RGNE 1A6AA 3MBEC 4MJ4A 2GJJA 3MRFB 3V6ZA 4GXUM 2PYFB 2HWZH 1MHCA 4G8FA 1I9RL 1R5VA 1T22A 5E5MA 5BS0B 5FHBH 2AK1H 4IMKC 1HWHB 2ZUQC 4M1DH 4QYOA 2A9NH 1WWBX 4H0HB 4A2LA 4YEFA 2JJUA 1U58B 4WO4B 3H9SB 2NLJA 1T1YB 5I1IL 1GXEA 1XH3B 2BMKA 4JFYA 2P8LA 4NWTH 3CUPB 4YHOL 1UM4H 3NPSB 2IBBA 1ODAA 3FN3A 2XIDA 1C08B 1CT8B 4JN1H 2FECL 4CVZA 2CUIA 3DX7B 3GMPB 4Q9BA 1N4XH 3ARFA 2PF6A 4Y5VB 4YDLB 3TV3H 3MLYL 2MQCA 2NX5B 1CDIA 4FRWA 3S8WA 4GMSH 4Z7VB 3H6JA 2WP3T 3GIZL 4LPVA 4JFQA 5D1ZD 3IKKA 5FAAA 3U7WH 2NR6D 4ZS6C 3TZVB 1NAKH 3PL6C 3QDMB 1MJ8H 3B6SB 1G6RL 3RGHA 5D5ME 3TPUB 2N56A 1IGTA 2CIKB 5ECJE 4N9OB 3DROA 5H94B 3WNMA 2W0LA 3L6FB 3IFPB 4MNQD 4I4WA 1JRHI 2NY6B 1OARL 4IM8A 4ZTPL 5IOPA 5DYOA 4N0UA 1BLNA 1VACB 3I6LE 1N64H 3OAZH 3OZ9H 4FNLL 2C26A 1QLFB 5DJCA 4RGMB 5F9OL 2P47B 3I9GH 3SDAC 2BJML 2W60A 3UPRB 2V5RA 2DWEA 2YS4A 4PRHA 4X6EA 2K1MA 1VFBA 4GT7A 1XR8A 2BVYA 5AZ2H 2ITDA 1X5AA 1FIGL 1KYOK 3DHJA 4PP1D 1IM9B 1EHAA 2A73B 2XKNA 1O5DT 3CD4A 4I0PC 3BGAA 4TTDD 3B8SA 3TCLB 2PW1A 3LEVL 3MRMA 3QIBA 1IAMA 4XVSL 4LSVL 4QHLA 4O02L 43CAB 3CSPA 4YBHA 5DRZB 3U4EB 1DFBH 1BJMA 3ALXA 5DMKB 4F37F 3UO1L 1JWSB 1CYGA 4KK9C 2NY5L 1MRFL 4QXTA 3VFSA 3NOIA 4EKXA 3PQYA 4HCRL 3QUXC 2D4FA 4JFZH 3EOTH 1QPPA 1NANI 4B50A 3MLPA 2PXYB 1P7KA 4PJHA 1TENA 4EDXA 3L7EB 2F19H 1MELA 3DMMC 5LCVL 3U83A 4PJFF 1IILE 4GRLD 4LSSL 5C08D 3HE6C 2OZ4H 5DLMH 2ZSVB 4ZUVB 4O00A 5EA0L 3IS0X 4K7PL 5D7LB 3CU1A 3WJJC 5FYLD 2DICA 1VFMA 1J0JA 4W6WB 5DHVH 4K7FB 3VRIB 4NQVA 3N1PC 1MFDL 4JKPH 1OF2A 4M5YH 4HJGB 1A7BA 2OMBA 3FRUA 4J3TA 4M43L 4PJXA 3VXMA 5JOEA 1ZHBB 5D2LF 1X5GA 5I76B 3WS6A 3G6AB 5GPRA 1NFDA 3BMVA 1CVSC 1C16B 3KJ6H 3DX9B 5FCSH 1ZLWK 1OTTD 1MF2L 1NAMB 3DTXA 4I2XE 3V6OC 4CUCA 2HH0H 1BOYA 1GHFL 3MR9B 1DBJH 3QIWA 4ZOEA 1LO3H 5I1DB 4PV9A 1PBYA 1MHPL 2YK1L 4S11A 4MAYD 4XNMB 3S3SA 4LLYB 4DQOH 1R0AL 1A4JB 5GZNC 5CILH 1MVFA 4RAVB 2R23A 2NXYC 3UJIL 4OI8A 2DM3A 3FFCB 3H9HB 1WWAX 3MGOA 4TOYL 4JZNA 3KPNB 2OJEB 4JRXE 3V4VL 2RB8A 3CDGB 4Z8FL 2F5BL 2J3SA 1OGTA 5CZKA 1XGYL 3IXTB 4JM2D 4LNVA 5CIPA 1XF2A 1LE9B 2AEPL 4P2OB 1KTLA 4Z5RB 2A6IA 2YSSB 2YKLH 3GI9L 5C86A 3OMZA 5T1DH 5DUMH 3ZSSA 1MFAH 3HRZA 3X3GH 1U8HB 3FO2B 3LHPH 3U48A 5BZDA 4J3SA 5HSFA 2DQFA 4R90H 1S5HB 3MRCB 1A3LH 2XZAH 2ZPKL 3E1F1 1LK3H 4NSKA 5ACLA 5J4MA 1OTUC 4L4TB 4PJIA 4DK3A 5IGXH 4O9HL 2FZ3A 1S7QA 5EB9A 4O5LH 3UEZA 2VERN 4GW1A 2GJ6A 1ZA3B 3BHBA 1LO0L 1ZT7A 3HE7C 3WLBA 1YEIL 4RA0C 5E95B 5ALBL 3TIEB 4KAQL 4YFLI 1T5XA 2JB6A 4HULB 4X99B 4KK6D 5C09E 2C1PB 2Z8RA 4ISVB 4IRZH 5DR5L 2GIYA 5I1AA 3ARZA 5EUKA 5L6YL 1FC1A 2VO5A 3ME0A 4FTVD 3LCYA 2GI7A 5IROA 1KFAL 3QUMH 5HBBA 3WDHA 3CFKB 3DETD 3PGCA 3U46B 2XWJB 1WTLA 3MFFB 4FQIH 4Q2ZB 4NWUH 1NCWL 1F4AA 2D7PA 1CDHA 3CXHK 3V6BR 5D2NC 2JJWA 5KVMC 1I3RB 4XP6H 5ACMA 5JW4R 2YA2A 2ICES 2J88H 3ROOB 3VMOA 4HS6A 5FGCB 3U7YL 4Y4FB 4PRPE 4HIXH 5D2NE 4X6DA 4XVJL 4KI5D 3RHWK 5HHXH 1TVBB 3LH2H 3C6LA 3A67H 3P77B 4FQ2L 4IDLA 5I15H 3TN0B 3K4ZA 3PP3H 3QJHB 4JM2F 1T1ZA 5C6TL 3KPOA 3QO1B 4XNQB 4JZJA 2FEEI 3MLRH 2J4WL 3QDGB 1A5FH 4NT6A 3DOSA 4HKBA 1Z9OA 4LMQE 1F11B 3ABZA 3TFKC 4CADA 4LARL 2X4UB 5F7FA 4YGAB 4N9GB 4RISL 2HTLC 5C0EB 4JY5L 1WIPA 1UEYA 4LOUD 3QWQB 4ZSOE 5F1NB 5TDPA 3VXSA 1TQBB 2ZCKL 4Z77A 2C7UA 4EUPB 1MH5B 2EH8H 1X5HA 3MV9D 2LU3A 1XGRA 3N9GL 3GSXB 1F97A 3VA6A 1ZANH 5I16B 3U9PL 1PY9A 2ADJB 3BYYA 1I3GL 4PLJC 1NC4D 1XCQB 2XICA 3KDMB 3WLWC 3O3AB 3RWHA 2Y7QB 2DJUA 1A2YA 3EW3B 4OI9A 5LGJB 1IM3B 4P23D 4RGOH 4YHMH 5L88H 4TUJB 1EFQA 5TFSL 1AHWC 3ARSA 4H8WC 1RZKH 3REWB 3UBXA 2F54B 1OQXA 4HC1A 4XT1C 3UP1A 3GSOB 5CLWA 4H20L 5DA4A 2H32B 1YEJH 3LS5L 3ZDZF 1AY1H 4Y16B 1LWRA 1SY6H 3RY6A 3CX5K 4KI5F 2X1PA 3LPWA 2XZCH 4S1RL 4PG2C 2YBRB 3O45B 1EO8H 4ODUB 2B1AH 1WJ3A 3GRWH 1FJ1B 1KNOA 4LEXL 3LS4L 4P2CG 1SYSB 4HIEA 1EEYA 1XIWC 4ALAH 4L8SB 2VLKB 2P5EA 2XN9D 3NAAL 5LGHL 1E4JA 2VLRA 4XNYL 1CF8L 4X5LA 4XNXL 4TUOB 3BH8B 3QUZB 3WNKA 4F15B 3LRSA 5IFJA 4IBLT 4OJFH 4JQXA 1E28B 2JELL 2BSTB 2E6PA 4WUUA 1EGJL 1IQWL 1H0DA 1X6NA 4N5ED 1V3JA 3WXWH 1RUQH 2YA0A 5E2TH 5C0CE 3IU4L 1E6JL 2HRLA 3M17B 3L3JA 3V0WH 1VADA 3ZLQC 1DLFH 2YHGA 3FN0L 4Y5XB 1QSFB 4BSJA 4YHNB 1MRDL 4PJFA 5C07D 5DK2B 4OGAD 1QHPA 1UA6L 4LEOB 4JQIH 1IAII 4Z7UE 2UZYB 3I50L 4U1MA 3C08L 4M03A 5KOMC 1XR9B 3MRLB 4PG9A 1LP9E 5FYKU 4HUXB 2W91A 3CFEA 5K9QG 1TCMA 1IQDB 5B8CC 5TQ0H 1HH6A 2Z91A 3VXNA 3LN5A 4JO3H 5CINH 2F8XC 1PKQA 3CPLB 4NHCL 5E1AB 4FQ1H 4FQLH 4RFOH 5IW3A 1T1XB 4MNQA 5D8JL 1T21B 1JNLL 1MJ7L 3OGOE 4WWID 5E2VH 3VG9C 3P0VL 4CVUA 4MDJA 1G7IA 4LKXB 1J1XH 5C0GA 1WV7T 5ELIA 4P5TB 1I7ZA 4PRNA 4MQTB 4BH7B 2JCCE 5LQBL 1NLBL 5E2JA 4PLKC 4GKOA 5FGBA 2QQQA 1NBVH 4WUKH 3AREA 4PJ7B 4D9RD 3EO1A 3S34H 3IU3B 4TSAH 3P4OB 4TQEH 1Z2KA 4R8WH 5JORA 2W59A 4K3DH 1BZ9B 1F00I 1OAXH 4LCYB 1A64A 2OI9C 4U0RB 5IQ7L 3IETA 5F7DB 4EDWH 3T0EB 5D7JB 1E27A 1HH9A 2EDFA 1PLGH 2FR4B 5ANMB 3PNWB 1EHLL 3ARFC 3QJFB 1FZOA 5F96L 1OM3L 5CCKH 4ZDHB 3G5ZA 4NKDB 2XQBL 4PS4L 4N8VB 5ID1B 1F5WA 8CGTA 1U9KA 2HLAB 4ZFGH 3UTSA 15C8H 3I02B 1N8ZB 3MC0A 1IGMH 3CXDL 1MAML 4Q0XH 4X7EC 2N4IA 2X4NA 1RJYA 5IBLC 3FQTB 5DK0B 1MEXH 1F6AA 4XZUA 4JY4B 3CX2A 3LKPB 2SEBA 4MGXA 5I0DA 3CVHB 1NMAH 1QLRB 1A8JH 4MXQC 4JDVB 2EDJA 3PWJB 4KV5E 3E3QC 2CDFB 4S10A 4UINL 3ILPB 5IM7B 3TO4C 2LU7A 5DJ6A 1TMCB 4XBPB 3VA2C 3E3QE 3QRGH 3KYOA 3I84A 4H1LA 1ETZB 3NZHL 4EUPG 5CMAA 1Q94B 5BV7B 1UJ3A 3P4NA 5BW7A 4M00A 3SOBH 4H8WL 3WFDH 3DVGA 1PQZB 1YZZA 1OGAA 3HS0A 1KJ2H 2BFVH 1BAFL 4OLXL 1L6ZA 4DUXA 4N0YH 4YZFE 5JZ7C 4PRIE 1CXKA 1CD0A 4GO6B 3FB7B 2BNQA 2H41A 4IJ3C 3QWRD 2CLZA 4Q7DA 5ILTH 3S5LB 2H6PA 5SWZE 1IEAB 3BVNA 4LFHG 3WO3B 1H5BB 2APVA 4MSWA 4RQQB 4UB0L 5F89A 3JUYA 1A4KA 4QRTA 4FFVD 4JM2A 4JJ5A 4NUJB 4AQ1B 3U2SB 5JLZB 3MZGB 3PQYE 4PREA 3H3BC 5IK3A 1YYLL 4PJEE 4I77H 2DD8L 2A6DB 5T1KA 1OCWL 5L8KB 3B5HA 3UZEA 4MLSA 4PJHE 1T3FB 1TJHH 1Z3GL 2AEWA 3PIQA 4W4NA 1I85A 4BELD 1YEEH 1W72L 5C0FA 2HN7A 1FG2B 3O41A 2VH5H 4EOWL 4OCWH 1YECH 3JV6B 5DHXB 4XC1L 3EDDA 3V0AC 2VDLL 3RWIA 5JR1H 3IGAA 4DTGL 3V8CA 1G7LB 3IDXL 1FVEA 1C1EH 5JOPE 2OJZL 2BZDA 2H2PD 4Z6AT 4OSUH 4HH9B 1KTRL 4RGNB 3BYTA 2EDDA 3VXRE 3ARQA 3WS6C 5IEKA 1FGNL 1YNLH 3BXNA 5DGRA 1QKZH 3MRRB 4PJXE 1JZ6A 2UUDH 3QIWC 2CQVA 3SDXF 2ZSWB 1NFDE 5GJSH 3W2DL 4D8PB 1A0QL 1OTSC 4HWZA 3P9LA 4OTXL 4DGYH 2HJKB 5EFIB 5DQDL 2WWKT 1AD0A 5B39A 5F1IA 5IMKB 1J86A 1IEBB 4D0DB 2FL5B 1U3JA 5EZLB 3PGFH 3V0VB 5KSAC 4JFFD 1TZIB 5ACZA 3EO9H 2IAMD 3O2DH 3TH3T 1DBKL 4PJBB 2QQKH 3LQAH 4I5BA 3KPRE 3V6FA 3PDDA 3GIVA 3K8KA 1YPZE 5CUSL 3N85H 4AYFA 1NC2D 4FG6C 3WNOA 2NQCA 3GMMA 3WJLA 2DYPB 2L7UA 5J6GA 3DO7B 4PGDB 4BQ6A 3BWAA 3STZA 3SKMA 4XB7A 2IANE 3WE6A 5F7MC 3QDHA 1TZHB 2NY2B 3O8XA 3VFPB 4HWBH 1U8JA 1HKLH 4RWHA 1TZGH 3LKRA 3TWCL 2RFXA 1UXSA 3L95B 2MKWA 4N1HB 5I1LB 3KLDA 2X70B 3GSVB 5D5MB 2HRPL 2UWEA 3ALPA 4O58L 5JW4N 3OB0K 4PJIE 5CJXA 3PL6B 1AFVH 2V6HA 4F57H 1M6OA 4R4BB 1BVLA 1I8IA 3B3IB 5JPMA 5GGQL 1KB9K 2YPLA 2AQ3A 4WW1A 3IJYA 5GRWA 1QR4A 3BIKB 4NRXA 3ILQD 3LSOA 1ED3A 4LSPL 3CU7A 2Q6WB 5HHMB 3JTTA 3MV9A 3T4AB 3K81A 3MO1B 2WUCL 1HILB 4KVCL 2CMRH 1JCKA 1K6QL 4HGMA 4QKXB 5IROC 4XTRD 5HVWA 1WGOA 1SJEB 2EKSA 2Y9RT 5I1KL 5ERWB 4M3JA 3L1OL 1BIIA 2H32H 2R8SL 5JHDE 4JY6B 3SDYL 5I2IA 4DZ8B 5C0AD 2WM0A 3KPSD 4AZ8A 5DJ2B 2H9GA 4JFDE 4XPAH 5F9WC 5SWSA 3V5HA 1QVOA 3EOYG 1RK1B 3UTTB 3U1SL 5EC2B 2V17L 1U8MB 2BNUA 3C6LC 3PWNA 4WGWB 2P4AB 2IQAA 1UH4A 3BMWA 4JLRB 5T3XD 2DMCA 2DB8A 5C7XH 2XKSA 2DKSA 1RZ7L 3THMH 5JXED 5JW4Q 4TVPL 4X6DE 2R2HB 2ESVA 3IJHA 4JZJC 1RUMH 3QUXB 1OAQL 2ICWB 2IH3A 4GLRH 1W8OA 1MWAB 1S7XA 3RL1A 1QLEL 4UMGA 2ILLA 1SEBA 3DMMB 4P5MA 3RY5A 3HE6B 2BRRL 4L8CB 1C7SA 1NBZA 3VWJA 3MX0A 4Z7WF 4RRPA 1BEYL 4GKZA 3NPZB 1SJHA 4YXLH 1JGEB 4PR5B 3D85B 4LDEB 3OF6D 5KTEL 2HT2D 2YUXA 4C59B 4F7CA 4P5KB 2G75A 4HKXB 3HLAB 5ADOL 4Q58C 3VG0L 5LBSL 3ZYZA 1HHGA 2Q1EA 3VXSE 3S5LG 2E8YA 4I2XB 1ORQA 1OWWA 1IGCH 3HAEA 5F1SA 2EO9A 5JHLL 3LZFH 3MRBB 1I8LA 1KC5L 1ZSDA 5C07A 3C5ZA 2P5WD 4LRNL 5T1MB 3AM8A 3D87B 4F7MB 5D1XB 1EJOH 2QR0B 3TVMD 1C5BH 5T3ZD 4MQ7A 4CDGC 1BVKA 3V52L 4JRXB 3V9FA 5GS0D 1DQJB 4ZUTB 4JPIB 2NXYB 1GIGH 2X4RA 5TH2A 2AJSL 3EZJB 3LAFA 5HHVL 4KRPD 4M5ZL 4J3WA 4S0SD 3RY6C 1G7HB 2NW2A 3V7MA 2FX8H 4ONFH 3U0PB 4AT6A 5I8KH 2P7TB 2QHRL 5IG7A 5T33H 1RZJC 1QSED 5EU6D 3GIZH 3GKWL 4QHNB 4UTBL 4X7SH 3GZKA 5IKCA 1K85A 3V7AE 3DRQB 5I1HL 2RGSA 1NCAH 5EOCH 3PP4H 3H3PH 2GEEA 5DQJA 1NGQL 4ODWA 4GAYA 1W0WA 1D5BB 4JDTL 5KSBF 1T5WA 3S37L 4PJ5D 1HINH 1JPST 4JQXC 3HNVH 1CFNA 5J89A 2YD9A 4U7SA 1R3IL 3TJHD 5C09B 2DN7A 4ODXA 1TNMA 4JFEA 4P4KD 4ZFOA 4IRJB 1FNHA 3HE7B 3CFDB 1RUKL 1CIUA 1U6AH 1UCTA 4MNHA 4WV1C 4XPTL 5HI5C 4WUUE 4ZFZA 5LAXB 1A7OH 4OZFA 1BM3H 3SJVD 3CVHH 1RHFA 2M26A 3V4PH 3P0YL 1OAUL 1V7ML 2QJDA 2BSSA 4HBQA 4HDIA 4POZC 5D1ZC 4ETQA 5JMOC 3OTTA 4YXHL 1CCZA 4TPRL 1EXUB 4PJFE 3QULB 1IC1A 1N6VA 3TNNB 3G5YA 1AGCA 3MUGA 1IC5H 1PDKA 4WRLA 4XVSH 5D2NB 4MVBD 4LIQL 3OKLB 2FYYB 2X44D 4AENA 3SDDA 4C58B 1QFWM 2FJFA 1RJLA 1I4FB 5BV7H 1MRFH 2R2BB 4EIGB 3RNKA 4GW4A 3HR6A 5ICXB 1Q9WB 4AIZB 2ENSA 4HPOH 3F5WB 4HCRH 4KGLA 1MNUH 3HMWL 2VLJD 1ZTXL 3L5WB 4MNQE 5D2LE 3BZFB 3W11C 3ARDD 2V7NA 3AREC 4NNXA 4HPYL 1AO7B 1BQSA 4JEGB 4F3FB 4LSSH 2AGJL 3T2PA 1ZT1B 4HUUB 2R39A 3A6BL 5EU5B 1WITA 3AXLA 1B4JL 2Z31D 4PFEA 2FATL 2NZIA 2XWBA 4FQXD 4TTDC 4UT9H 1QFUH 1T4KB 4UILL 3KXFA 3DRTA 2GITA 3MROB 4KDVA 5GXBB 3HMXA 4I3RL 2QSCH 4WEUD 1YUHB 3M1BB 3VXOB 4P4RB 2HLFD 5AAWA 4OD2B 5C0IA 1S9KC 1KN4L 1D5MA 3CVIL 3MPCA 2R1YA 4PGZA 1KCKA 4MX7A 4O2FB 2OL3A 4YC2C 1RV6X 1FCCA 4GRLC 4J3OC 1ZWIB 2WBWB 3LKOB 2ED7A 3T1FB 4MQXD 2E27L 3MYJB 5AUMA 4YFEA 2CR6A 1KB5A 1Y6KR 1MHPH 3R06B 3UTSE 3FQNB 3D3VA 2H3NB 3RA7L 3S36L 3O4OB 1H3GA 1FDLH 4F33B 3UJIH 5C08E 3G6JB 1KT2A 1A1MA 3OJMB 2XZQH 1E4WH 5FUOH 5KVGH 3LKNB 5J6HA 1HQRB 1JF6A 4R7NB 4LLMB 4ELKA 4XBEL 3WUWB 2CKBL 5FYLE 5T5NG 4YK4B 2F5BH 1DQQB 3P40A 1WK0A 3MNWA 5MEPB 3JV5A 2DDQL 4XMLL 3SGKA 2UY7A 1JWUB 3GI9H 1RZGB 1UJ3C 5BW7C 4XNUL 3U79A 5EZOL 4ENED 1S8DB 4NFDA 4OM1L 2X4SB 2UYLB 2OSLB 3MOAH 4GAGL 2WZPD 4LCUB 2C4XA 2ZPKH 1UB6B 2OK0L 3QCTL 3D18B 1AR1D 1R3JA 1UZ8A 4QRSA 1BPVA 1K5NB 1ONQB 2R2EB 4YO0A 4E41D 1FFOA 5FKAA 1EHXA 2FO4A 2R0LH 1QEWA 3MTRA 5EOQL 4BSVB 5TPWL 2NY0D 1WIUA 2X4TB 4X6CF 2FX7L 1MIMH 4RA3A 4L8DA 4KZEH 1NH6A 1LO0H 2P43B 4WNQA 3X14A 2ZOKA 4M7LH 4JM2C 5ALBH 1I7TB 3A6CH 5JDSB 1P7QD 2AP2A 1K4CB 1NC2A 1MREL 1BQHA 4X4ZA 2EKJA 4ODTL 2OCFD 4XWGL 1NL0L 2AJZB 1BOGB 4FZEL 1R3LB 2EDLA 2VRAA 1KJMB 4ZUUA 1LP9B 4QRQA 3RAJH 1I85C 2J8HA 5KVEH 1KG0B 1CDGA 5LWYH 1RIVH 3CFIC 4Z7WA 3KYMB 5FEBA 1WEJL 3O0RH 2J6EH 5DQ9B 3FT2B 4QXUL 3RHWF 3ZSTA 5IB1A 1CFVL 4KRLB 2XV6B 4U49A 1ZHKA 2HFEB 3QZWA 4E9LA 1EFXB 2AK4B 1HQ4B 5IIEB 1QRKA 1J9CT 2ICCA 3B9DA 2IH1A 1SMAA 4KK6C 4X9HA 1N3NA 5FV1L 4JANA 1GGIL 4BZ1L 1A6AB 4PJGF 2I9LA 1FFRA 5DRNA 2V2TB 3HC4L 4OLUH 1SEQL 5CP7B 2FHBA 2CGRL 2C5DC 3WN5B 3CH1B 1HIMH 4AH2A 3BE1H 4RISH 1Q9OA 2DMKA 3OJDB 4JY5H 4WHTA 2B20A 2R1XB 3MV7A 1YC7A 3ZMRA 1Z0NA 4P3CL 5BVJA 1PSKL 4KI5C 5DD3L 5KSVB 2FJGA 2A83A 4XB8A 1LMKA 1N5YH 3ZDZE 3PDOA 3UTQB 3HI5H 3VGGA 3WJLC 1X7QA 4WI9A 5JXEA 5MENB 3U9PH 2B0SH 4KI5E 3HUJB 2IQ9H 1WBYA 4NM4H 3C5SA 3O8XC 4YUEL 3QNZA 1A14L 3FZUD 5CJ8A 4LVEA 4NCC1 3VFTB 1FN4A 1C5CH 1LD9B 5FCUL 2ERJC 5KSBA 4X6FA 2P8PA 4U1KA 5CJXC 2BY2A 4NJ9H 4QTHA 3A6OA 4HG4K 3BEVB 4Q97A 5HHPB 1DUZB 3DBXA 1ES0B 3RJQB 3TO4B 5GISH 5FYKE 2XNAA 3U0TB 1BLNB 2GJZB 5EWIL 3MLSL 1BD2A 1INQB 3S35X 1FV1B 3T2NL 4ELMF 1I1YA 1PEWA 3CSYA 2AV1A 4KMTL 2O5YL 4F9LA 3MV9E 3JWDC 1QFOA 4YX2L 2F53D 1LO5A 3LEXA 2X05A 2E7BA 4PRIB 4PJCF 1U8PB 4YHPA 2D7OA 1RVFH 4PB0L 3TVMA 2AXGA 1QP1A 2P8MA 2QLVB 1RUAH 2V5MA 3OXSB 4LSQH 1HHKA 5SWZB 4I9WD 2A6KB 3OAZK 3DECA 3R4DA 4R2GD 2VDPL 2W9DL 4F2MA 3TYFA 4GFTB 2RCSL 3M8OH 3DNKA 1CGXA 5BQ7A 1ZS8B 4Q9QL 3VXUB 1U8NB 4ONHB 4WFFD 2XT1B 1MRCH 2E3VA 1IQWH 4LSRL 4FQCH 3RU8L 3MA7B 5DO2D 4D0CB 1TVDA 4HFWA 4YPGB 4PJEB 2OR9L 1IVLA 1E6JH 4EVNB 1KJVA 1NMCC 1Q72L 2EIEA 1ADQA 2IG2L 2EE2A 1KENH 1P7KB 3FT4A 4IMLA 2E8ZA 3KNBA 5MEQA 1Q0YH 1CFTA 5DZNA 1IGJA 1AKJA 3VWJC 5IQ9B 4ORZC 4NGHL 3ARGD 3D5OF 2Q8AL 5K9JL 3KLAA 3GMRA 3CLFL 4EN3D 5GGSY 2DWDA 1P84K 1OSPL 4JG1H 3VDAA 4QXWA 1N0XL 1FNAA 4U6YA 2MCPL 3VXRB 4MA8H 3KPQA 5IHUL 3QH3A 1WZ1L 4G8GA 1FPTH 5D8JH 4YXKL 4P4KA 1L6XA 4N5EC 3OAYH 1KYOJ 3O6KL 4X4YB 1A7PH 3P0VH 5DJZA 4V1DA 1NFDB 5I6XC 1CFQB 3C5ZC 2FJHA 3JTSB 4HGKC 4OGAC 3SJVA 1T20A 3AU1B 3NCMA 3AM8C 5C0DA 4L3ED 5GSVA 3WCYA 2PCPB 1S7TB 5EOTB 2CKNA 4OGXL 1DANT 3SKNA 3GB7B 4KQ3L 5C07E 1URLA 1WZLA 3H42L 3T1WA 2YUZA 2R23B 3UTPD 3MUZ1 1B2WH 2JKXA 4HX1A 3QUKA 3SGDI 1DR9A 4RX4D 1S7SB 4Z7VF 4XVTL 4JHWL 3KPRB 3MGOB 4JZNB 4BZ2L 1YPZB 3U4BL 5KSAB 1SMOA 3S7GA 3ROLB 1T04B 1WLHA 5HDLA 1PG7L 1DN0B 4AEIH 1FVCB 5F96H 3BPNB 3O2WH 2IANB 2XA3A 4K8RD 2KKQA 3BN9D 5BJTA 1DANU 3ARDA 1I1RA 4HSQA 3RDTB 1I8MB 4W70A 2ED8A 3DV6A 3WIFA 5GIRB 1JZ5A 1I1FA 3P30L 3TH4T 4D9RE 5HHQA 1KIUA 1JIBA 1A7QL 3KR3H 3OSKA 3RQ3A 4F8QA 5D72H 1U8LA 4KFZC 1YDPB 1JWMA 4YHLH 2FBJH 3WLBB 4N8CL 4ZODA 4HH8A 3V5DB 1Q1JL 4K3HA 1KN2H 1T5XB 5CSGA 3ZHKA 1C8PA 5I8CB 2BSRA 3WHE1 3N1MC 3C8KB 3UMTA 2UVFA 3BSZL 1YEDB 5EZIL 2X1OA 1J8HD 3NFNB 4NO0A 4DZBA 5JHDB 5D7SH 1FO0A 4P2OD 4G42B 4WENB 4X7FC 1JTOA 5H37H 4JFDB 2OQJA 5I66A 2VYRE 1GOGA 3QPQC 4C55A 4UI2A 3PWPB 5TF1L 4PD4K 1J1OL 3EOAB 1N6QH 3SDDC 1S7UB 2DL9A 1A6VL 4C83A 3DV4B 5HJ3B 5HVFB 5EIIA 2H1PL 5ADPL 1CR9H 3GSWA 4L4TD 3SE3A 1ZLSH 4R7DA 3LB6C 4NQCA 4BK5A 4GG8B 2JE8A 2WNGA 3JWDL 5IMLB 4O51A 3QO0A 4KHTH 3SCMB 2QEJA 3TT1L 4YNYB 3QG7H 3TESA 2EYRA 5KSUB 5L2JB 4NN5C 3EYFB 4DGVL 1LO4L 4OLWH 1RIHL 3IYLW 5FF6B 1GAFH 3RZCB 5FECB 3MNZB 3GJEA 3SDXE 4FN0A 5ISZB 5JXAL 4NC1C 2VXUL 3H0TA 3TBVB 4E41A 4ZNCD 2LV4A 3MREB 3AUVA 1NEZB 3TEUA 1BVZA 3VE0B 2GAZB 5TDPB 1RD6A 3Q5YA 4P2QD 3BKJL 1F90H 2BVQB 2D9QB 4JHAH 5K9KA 4Y1AA 2ZOLA 3C5JB 4QT5B 3QISA 5HHOD 3IFNH 3CXHJ 3O9WB 3PV6A 5CEZL 2MSPA 4OBRA 2K3TA 4ZUSB 4NQDD 2AXHA 5F21B 3FT3A 1KJ3L 1DQML 5L9DH 2GTZA 1L7TL 4CW1A 4Y19A 1XGQA 5JW4M 1CLCA 5A1AA 3IDIA 3QQ3B 1M71B 1Y6MR 4FQHA 4GUPA 5FOBA 4UNTA 1IFHH 1MI5D 5CD3A 5FO8A 5KAQG 3GSQA 1YY9D 4H26A 3TBTA 4NKOA 3QDGD 5DRXB 4XPFH 2V5YA 4W81A 3L3OB 4OIAA 5MP6L 1KLUB 2YC1A 3P73B 1DBKH 3DSFH 3I3DA 4KMLB 1C7TA 1H8OA 3BP7A 4E5XB 1KPVB 5J3HD 2VDOH 1YQVH 2YUWA 4WW2F 1BREA 2D03H 2DM4A 2ZKHL 3PWUA 4V2BA 2ORBL 4E42A 4YDJA 3PJSA 1IZJA 1GZPA 3PWLA 1YJDL 4UNVA 4PJCA 1AQDA 1BBJA 4OZIA 4ZG1A 1JNHB 2BVOA 5DWUL 2BVUA 2FH6A 4AK1A 3SE9H 3EYSL 5EBWB 3EFFA 4UDTB 3T65A 4OQTH 2YN3A 4AM0B 1BFVH 3H9YA 3TA3D 2VB5A 4LNRB 2OTWA 1NLDL 1X5IA 3K2MC 1HDMB 4Y2DD 2DIJA 1RMFL 4JFFE 4LFHD 5GJTH 4UQ3B 4MJID 4H0IA 4LBEB 1FVDA 4B53A 4WV1B 3MRGA 5DHYB 4GAJH 5C0RL 1DEEA 4WIQA 4XXDB 4ZXBD 1FZMA 2R0KL 3GI8H 3E6HB 4X9GA 3V5KA 2DIBA 3OQ3B 5D1ZB 1T1WA 4L8BB 3CX5J 2HKFL 4NQEA 4PG9B 4PTTB 4RFEB 4ZFOL 1Z9SA 5FYJD 3RVVD 1G6RB 4OGYL 3MRFA 1FLRH 4WEBH 1G1YA 2PYFA 4P2YA 4Z7WE 4KGJA 4XP4L 1HYRC 2VN7A 2LABA 2D0HA 2NCMA 3BPLC 3W0WD 3BZDA 5M7QA 5MEOB 5BS0A 3OHXB 3BWUC 5D2LB 12E8H 1DQLH 2VWEE 3QUZD 1PZ5B 1U58A 4WO4A 2YPKB 3MSPA 3H9SA 4OV6F 4XTRC 4DGIL 1XH3A 2CPCA 1I7ZB 4YE4L 3CUPA 3AFLA 3LD8C 1C08A 1CT8A 1NJ9B 1FNEB 3NFSL 4J4PD 4LKCB 3DX7A 1PW3A 1VEMA 1K8DB 2VUOA 4Y5VA 1INDH 1VCAA 3MXVL 1QSFD 1VPOL 2NX5A 5ID0B 4EI6B 4Z7VA 5CLTA 1JGDB 2BCKB 4Y4HD 1QR1B 3BD4A 1IC7L 1PVHA 3UX9B 2FEDC 4JZOB 4ERSL 5C0AE 3MUJA 3KPSE 3T3PF 1GC1L 5JXEC 2FB4H 1FZOB 3QDMA 3B6SA 5CBAB 3RX5A 4HK3N 1D6VL 1MCKA 3TPUA 2CIKA 4LSDA 5H94A 5T3XE 4MS8D 2CXGA 3QNXB 3L6FA 2RHEA 3IFPA 3MODH 3X11B 3IAPA 2HKHH 4PP2B 1VACA 4GRLB 4HS8L 5C08B 5IJVB 1ZXQA 3NABH 5DD5H 1QLFA 1JUFB 4ZOCA 4P5TD 5CD5C 1X5ZA 3UPRA 3MLXH 1XF3B 1EAJA 2Y1VA 5IBTL 3VFOB 2HT2C 5KSBE 3IS1X 1AD9B 4YWGH 4WDIB 4P9MH 4M5ZH 2OL3L 1GVIA 1NGPH 2D0FA 1NEZG 1IM9A 2A73A 2N7BA 3Q2CA 3TCLA 2IFFL 4MMZC 5JOFB 3KYOB 3AS3A 3WIIL 4F9LC 43CAA 4I18B 5DRZA 3U4EA 5DMKA 1JWSA 4PUBL 4KXZI 4JO2L 1SVCP 4YAQB 3TVMC 3HS0B 4PBWD 5FYJU 1NGQH 1OPGL 4MAYB 4JDTH 7FABL 4OD3L 2PXYA 4XX1G 1A7RH 5T3ZE 1A6PA 4NKIH 4QGTA 3DHMA 3VJ6A 5GGVY 2ZSVA 4ZUVA 4R3SB 2VDML 2G9HB 4QRTB 5D7LA 5KVDL 1KPRB 3J7HA 1GOHA 4ODVL 2D3VA 4PJ8D 4XPTH 3G04B 2AVGA 3PE9A 4MD4B 4G8EB 4K7FA 3FB5B 2Y06H 5TGBB 3BKCL 4GSDH 4HJGA 4KZDL 4LDLB 5D6DA 3BPOC 4HJ0C 4BUHA 3BRDA 2IC2A 4TPRH 1ZHBA 5EU6E 1UH2A 5I76A 3G6AA 2I24N 1C16A 1JPTL 3DX9A 4XCCH 3C60D 3C09B 1NAMA 3P3YA 4LIQH 2DRUA 5ETUB 5I73C 3MR9A 1IAIM 5I1DA 3BP5B 2YZ8A 3DXAD 5C8JB 4P4KC 2HFGH 4XNMA 4LLYA 3RUGB 4F58L 1ITCA 4PJ5E 1A4JA 1I7UB 4RAVA 3OR6B 4JREB 4G8GE 4OIIH 3VD4A 3H9HA 3FFCA 4O4YL 4XPGL 2ARWA 2GQHA 2OJEA 4ZO6A 5DFWH 3CDGA 1FE8L 4V1DE 4FXGB 4G3YL 4FTVB 1J8HA 2ZUYA 1IC4L 3A6BH 1JTTA 3IXTA 5SX4H 1LE9A 3SJVE 4P2OA 1CLOH 3L5JA 3VDBA 4Z5RA 2AQ2A 2YSSA 3ULUD 1JBJA 5DD1H 3HR5B 2VC2H 3GHEL 3ULUL 1FRGL 3GNMH 3R0MA 5HYEA 4DJMA 3OGCB 1RZ8B 1U8HA 3T0WA 3FO2A 4UNUA 1Z0MA 1S5HA 3MRCA 2EXYD 1BX2B 2DI8A 3SQOH 3LY6A 5IMMB 4L4TA 5IESL 4M93C 2UUDK 1QTYT 3GIVB 3MBXH 3EIFA 1N0LA 3CVIH 1CICD 3BZEA 2Z8WC 4WVRA 4DKFL 4K71C 3ARDC 3ZYOA 1L7IL 1ZA3A 2XKUA 3MJ7B 5A16B 3WFEH 3KPPB 2XI9A 3IDNB 1QFPA 2VLJE 4QNPF 4X80L 1CU4L 3TIEA 4X99A 3C8DA 3VGEA 2C1PA 4ISVA 4OZGF 3V2AR 4HUNB 4P2RD 1HHIB 4L3AA 2R0ZL 1MVUB 4JO1L 5MHSD 3AS2A 3B9KD 3MOBH 5AAMA 4LHQB 3SE8H 1AJ7L 4DN3H 3CFKA 3U46A 5LXGH 1QBML 2HLFC 3PGDB 2XWJA 2C3WA 1VGEL 3MFFA 4KK5D 4Q2ZA 4XMLH 2X9XA 5F9DC 5FM5O 4BFIB 3HFML 3JTTB 4XWOD 1MCWM 3EUUA 4K9EC 3IVKB 3ROOA 1D5IL 1X5FA 2PTTB 2WMPA 4Y4FA 5GRUH 4NQDA 5I1CL 5DC0A 3RVWD 4HC1H 2N7AA 4MQXC 1NC4B 3MYZA 1JPSL 3P77A 2CD0A 1EVTC 5L2KD 3TN0A 1YEGH 5HY9B 4JB9L 2DQUL 4ODBD 4Z95L 3OBAA 2IGFL 4P23B 4R4ND 1CGUA 3QYCA 1JFQH 4XNQA 3ULUF 2NY2D 3AS0A 2HWZL 3QDGA 4BFBD 3SE3C 5GS2H 1F11A 5DEFB 1RZJH 4OQ1A 5FHBL 1SM3H 4N9GA 4MWFB 1I75A 2A9NL 5C0EA 3RWFB 4J12A 2RIKA 5E03A 4YFLF 5F1NA 4ENEC 1Z6JT 3VXPB 4XWGH 2G5BB 2VISA 2VMFA 1NMCB 4PJGE 1YMMD 3MXWH 4NWTL 2E7MA 1KB9J 1S7XB 3RL1B 5GSRB 4EUPA 1MH5A 4LSTH 5HHMD 1WFOA 1UEMA 4JN1L 5HVHC 4U6HA 3GSXA 4R0LA 5I16A 1N4XL 2XN9B 2ADJA 1KCVL 3TV3L 1BQLH 5CEXB 2NY0C 4GMSL 1XCQA 1AP2B 3KDMA 3O3AA 5FO7B 4R96B 3K46A 4E41E 1MLCB 5E5RB 3SO5A 3DX8B 2Y7QA 3W5MA 3I3EA 1TPXC 3U7WL 3ELAT 2IMMA 5LGJA 4HAFA 4HS3B 5T1LD 4TUJA 1NAKL 4KUZH 3REWA 4JVPA 2F54A 1MJ8L 4UZGA 4BZ1H 3UYRH 1CGSH 2AJXH 3GSOA 5DJYA 5C07B 4Y16A 1SEQH 4XI5C 4PJBF 4XCNB 2CO6B 5BO1H 1N64L 1F3DJ 5HD8D 4POUB 5I1GH 3B9EA 2W9LA 2YBRA 3I9GL 4Q74A 5KVFH 3O45A 1PKOA 4ODUA 1WWWX 4MAUH 4K2UH 4M7LT 1FJ1A 4C4KO 3MRHB 4G6JH 4LCIL 5GGUB 2ZG1A 5AZ2L 4L8SA 5BVPL 2VLKA 4HUMB 2RR3A 1FNSH 3Q6GH 3T8XB 1NDMB 2R56H 1NKRA 4TUOA 1U0QA 3JWNC 3BH8A 3QUZA 1FBIH 1HXYB 4ELME 3GJFB 4YUEH 1DZBA 2VLMD 1DFBL 1A14H 3BX7C 4S1SH 1E28A 4CMHC 1ZK9A 2BSTA 3BT2H 2NY3D 1TTGA 5GZOD 4KROC 3RBSA 4PJCE 3M17A 4JFZL 3EOTL 1W0WB 4G9FB 4Y5XA 1QSFA 4X5WA 4YHNA 4Z7OE 4HD9A 5DK2A 4JAMA 2F19L 2PYED 4LEOA 5L0QC 3MCG1 1JNNH 1I9IH 1KIPB 2FHCA 5D1XD 2AXJA 1DTUA 5DLML 1XR9A 5IV2B 3MRLA 3MFGB 4HBCH 4CN4A 4HUXA 2NW3B 4TSBH 1M7DB 4AEHL 1IQDA 4APQD 4WHYG 5E24E 2W1NA 3FZUC 4GAFB 3CPLA 4FFYH 5E1AA 5FYLH 4D9LH 5KN5B 1WCBB 5L7XH 4M5YL 1T1XA 3QDJD 4MA1B 2BSSB 3GSUB 2DQCH 3FONB 3R1GH 1V3KA 2WBKA 1EVUA 4LKXA 4P5TA 3KJ6L 1DBAH 2J8UF 3SGEH 4BH7A 4XH2B 5F9JB 4NPYB 4PJ7A 1AGFB 3CFJB 4H1LH 2AJYH 4ZUWB 3IFOB 3IU3A 1DBJL 2GK0B 1LO3L 3P4OA 1JYVA 4N90D 4DFHA 1TQCB 4DQOL 4LSRH 1BZ9A 4WO4C 5CILL 4NN6B 1U8IB 4ONOA 4LCYA 3RWJB 4UIKH 4M1CD 4FQJH 3MLTB 3QPXH 5F7DA 4AIXA 3CLEH 1MQKL 3ARBB 3SDXB 3NPSC 3DI3B 3T0EA 5D7JA 1U36A 2VTFA 3DUHA 4IRJD 2QADB 2FR4A 3QHZH 3U30B 5ANMA 3ESUF 3PNWA 4FFWD 3QJFA 1FFPB 2WIIB 4AEEA 2DL2A 1RZIB 4QGYA 4ZDHA 4NQXB 1HXMB 4NO5B 3TGXA 5B38G 4NKDA 4N8VA 4UV7H 2XWBB 2YKLL 3HKFA 4OLEA 5ID1A 4UTAH 5T1DL 5HGDA 5DUML 4OCSH 2HLAA 2A6JB 5I8EA 1MFAL 2QHLA 3I02A 3X3GL 3QEQD 1QQDB 1RHHB 2G5RA 3LHPL 3LPFA 3KLHC 1JPGB 1CE6B 3K0WA 4R90L 1WZ1H 4Z7VE 2XZAL 3FQTA 5DK0A 1LK3L 4I9WE 5H35B 4NRZB 4JG0H 3LKPA 4HZAA 5HHNB 4LPCA 3CDFA 5DO2C 4U1JB 4L4JA 1WWCA 5IGXL 3CVHA 4P0DA 1QLRA 2MFNA 4JDVA 4O5LL 4PJ8A 4WFFE 3PWJA 1WISA 2CDFA 2NY6C 2WK2A 3FQXB 4HIHB 3WSQH 1IBGH 3QDME 3ILPA 5IM7A 3Q0HA 4UAOB 4L9DA 4HKJB 4OZGA 1KB5B 2DI7A 4XBPA 2L4OA 3GO1H 3O6LH 5F93C 3IDUA 5F3BB 1M4KA 4IRZL 2F58H 1ETZA 1Q94A 3DGCR 4WI8A 1OQOA 1KT2B 2QSTA 4JHWH 1FIEA 5E7FA 1PQZA 3QUML 4U1NA 4BZ2H 1VDGA 3G5XB 4LCWD 4X4ME 4FQIL 4Q6YA 4KKLC 4NWUL 1ULVA 2Q87A 3FB7A 4XP6L 3ZKND 2DQIL 2X09A 1SBBA 2J88L 3DUUB 3S5LA 1IEAA 3BGMA 1C5DA 1H5BA 4HIXL 3GHBH 4Y4KD 5HHXL 4U1GB 3NFPB 3A67L 5I17B 4NUJA 2GK2A 3MLVH 3U2SA 5JLZA 4L3EE 5CSZB 1QEWB 2O93L 3OB8A 4PTUB 2EE9A 3NCBB 2BC4B 2A6DA 3MLRL 5IB3B 5E4IA 4JFFB 1A5FL 1X5JA 1VGKB 2IAMB 3UTPE 1T3FA 5IVZA 1F42A 3CIQA 1FG2A 1FL5B 3JV6A 4K8RC 2APBA 3LEYH 1CICA 1U2CA 3BN9C 4NJAH 1MJJB 1G7LA 5A2IH 1YEHH 3L5XH 4QHUB 4X8JB 2J1KA 2E9BA 5EH1A 1MIEH 5EZIH 3NCYS 2YXFA 5EU4B 5T5FH 4HH9A 1J05B 4FMKA 3U82B 3VMNA 5FYKH 3EBAA 5D6CB 1P4BH 2EH8L 2NY4D 1E6OH 3IDJB 4Z7WB 4U6VH 5LVEA 4WHDA 1ZANL 1JE6A 3BRGC 3MRRA 1V3LA 3C9NB 2VKWA 4DKAA 4C57C 1F8TH 5DT1H 2D7QA 2ZSWA 3RRQA 1A6VH 4D8PA 5AG8A 3ZKMC 5ADPH 1O7SA 4HJJH 3PXJA 2HJKA 1JF1B 5EFIA 4RGOL 4YHML 2IH1B 5L88L 5HI4D 2X41A 1SJVA 2PR4H 5IMKA 4IMKA 1IEBA 4D0DA 2FL5A 1X3DA 3TT1H 3V0VA 1PY4A 3L7FB 1TZIA 1E4XH 2MTPA 4ZO7A 3TC9A 4KKCC 4G7YH 4OCXH 3RVXD 4PY7B 1ITBB 1QACA 1YEJL 4UQ2B 4DGVH 1MCNA 2WWMD 1AY1L 4PJBA 2GW5A 4P2OC 3VH8B 4O2EB 1I1AD 3QFJD 1U8KB 5EO1B 5JXAH 4M1GH 1J8HE 2XZCL 2DYPA 5JIHA 5C0AB 4YJZL 4ONGH 3DO7A 1EO8L 3KPSB 4PGDA 3DLQR 3MQIA 3MRDB 3HZVB 4G43B 2B1AL 4Q9CA 1TZHA 3H7BB 4L29B 2YD7A 4G8IB 5BVJB 3L95A 5K9OB 4ALAL 5F9AC 1OAYL 5I1LA 4K3JH 4DCQB 5D5MA 3AROA 3OKNB 4X7TB 5CEZH 3B9AA 4L4TE 3PL6A 4ZNEA 3G6JF 3NH7H 3AB0B 4R4BA 5HGAB 3TT3H 5FB8B 1F4WH 2BHYA 3S88L 2PN5A 3B3IA 2ZJSH 2D7NA 3QNZB 1DQMH 5DXWA 3BIKA 4QOKD 3RP1A 1R3HB 2HYMA 3SEPA 4LHUD 2J6EA 3QHTC 4P99A 2Q6WA 2AXFB 1CGWA 2VZTA 3KYKH 3ZHLA 3WXWL 1RUQL 1HSAB 3T4AA 3MO1A 3I75B 2VXSL 1HILA 2P8PB 4BM7A 3O3BA 3V0WL 4Z0XB 1DLFL 2B4CC 1SJEA 4CJ0A 1A9BB 3HAEH 2CR3A 5ERWA 1QFWI 4JQIL 1D3CA 4JGUA 5DVNA 4OAWB 4Y0GA 2HTKD 3FMGH 4JY6A 43C9B 4CAGA 4U4BA 4JPVH 4DZ8A 4CDHA 3L5IA 4HMEA 2DLHA 5DJ2A 1S9WB 1W2KT 3LV3B 5TQ0L 1NGZB 4Y4FC 2V7HB 1RK1A 5DZOA 3NACH 1VA9A 3UTTA 4JO3L 5CINL 5EC2A 4S1DC 2NZ9D 5IF0B 1U8MA 5HHOE 1NMBH 4FQ1L 4LLDB 5DWUH 2DLTA 1DQDH 2P5WB 3TN0C 3D0VB 4DKEH 2EEAA 4JLRA 2DTMH 1BJ8A 4NQDE 3F62A 3TVMB 2R2HA 3W9DB 3QIUD 1YY9C 1AXTL 1J1XL 4GS7B 3QUXA 1I9JH 4JFHE 3MJGX 3LKSB 3JWOH 5F71A 1ORSB 1MWAA 5EPMB 1NBVL 4WUKL 1JHTB 3GJFH 2GTWB 3S34L 4RFNB 5FK9A 3IRPX 2CK0H 4TSAL 4KRPB 3HE6A 4KRNA 4TQEL 5J3HC 4R8WL 3QDGE 5ALCH 5AD0B 4M62H 4K3DL 1BGXH 2GY5A 1OAXL 2RJMA 1EX0A 4J1UB 1JGEA 4PR5A 4TTGA 4NC0B 1TQBC 2YD8A 5BMFL 4I3SH 4EDWL 4BH8A 1QSEB 1J1PH 4HG4J 5EU6B 4P5KA 2PO6D 1EZVY 3HLAA 4HKXA 3QDAA 3QXUA 2MCG1 2P24A 1PLGL 3RI5K 4R0LC 3DX6B 5IMOB 3QXWA 4EXKA 2GT9B 4I2XA 4TULH 5EZJB 5CCKL 2EIZB 3L9RB 3MRBA 5CJOH 2GFBA 2AJUH 5J7CC 4ZFGL 5E94B 15C8L 4PJ5B 1IGML 5T1MA 1U92B 4Y2DC 4Q0XL 4UDUB 3MGTA 4LLVB 5D1XA 4F7MA 2QR0A 4NUGL 4HUVB 1UWEH 5HYSG 1MEXL 3T3PE 5D9SB 1JI2A 3P11H 5JQHC 1NMAL 3O3EA 2PKDA 3W82A 3I85A 1DQJA 3AY4A 5ESVB 4JPIA 4ZUTA 2DBLH 4ZXBC 4XCEA 4Y16C 4RMUA 3VXUD 3ARVA 4LP4A 1V05A 4PJ9D 3VGFA 5KW9H 1T20B 4GRWH 1G7HA 2OS7A 4OUUB 1NCTA 3V79C 4JO4H 4NNYB 2EDTA 1MCJA 3U0PA 1CN4A 4JVUA 4Y2OA 4CRPA 4GBXB 2P7TA 3RVVC 3QRGL 2I60H 3MRPA 4UU9B 4LAQH 1P6AB 3HUJF 1WAAF 3ES6B 5CS7A 4QHNA 5E7BA 3SOBL 1IC7H 1X5LA 5D96B 4L8SC 3WFDL 3O6MH 3DRQA 5FYJE 1G9NC 1KJ2L 2BFVL 4MB3A 1X4ZA 4N0YL 1YEFL 3F12B 3QUZC 1D5BA 4F15C 2EZ0D 1MCIA 3EOBB 3K2UH 4M93B 2VZVA 3W0WE 3U36B 1OW0C 1BF2A 2VLJB 4D94A 4OCLC 1P84J 4NZRH 5ILTL 1B3JA 1F4YH 5F72S 4AJ0A 2I07B 4K71B 2W92A 4BSWB 5C09A 3S4SB 5E0QA 4IRJA 3HMXH 3HE7A 1ZT4B 1R5IB 4KTEH 4Y7MA 3CFDA 3RVTD 1S3KH 4KTYA 4Y5XC 5CAYB 2CDEB 1D9KD 1EJ6A 2EDXA 2X5PA 5C0BD 1QG3A 5LAXA 2Z31B 4X6CB 4FQXB 4Y4HC 5EUOF 3RFZC 4BZYA 4A6YB 5CZXC 5J1TC 4I77L 1FG9C 1QSFE 2OL3H 1EXUA 3QULA 1NGWB 3NMEA 3TNNA 1U3HD 1YEEL 1T03H 2Q20A 1H3WM 2VH5L 5BOZG 1KB5H 3I6KB 5D2NA 1K2DB 3OKLA 2FYYA 5JR1L 4MS8C 1C1EL 1I4FA 2C3HA 1R3KA 4BFEA 4OSUL 4Z7QF 2QTEA 2B4CL 5ICXA 4AIZA 5E99H 3X17A 3F5WA 4P5TC 3U7AA 3L5WA 3X12B 4WHCA 1MCLA 3BZFA 2WSKA 3MCLH 4OD3H 1FSKB 2CIIB 2YR3A 2X1XR 1QOKA 1AO7A 3RDTD 3MUHL 1WZMA 4F3FA 5GJSL 1LK2B 1ZT1A 2YMXH 4HUUA 5IHBA 5KAQF 2B5IB 2VDMH 4DGYL 1KXVC 2ITCB 2VIRA 3BDYH 4R7DB 5EU5A 4PJ7E 5IBUG 3WMSA 2VE6B 2O61B 5DUBB 1T4KA 3MLZH 1QBAA 4PJGB 3MROA 3PGFL 5D7JC 1DCLA 4N5UA 2JJTA 2Z0BA 2FWOB 3EO9L 1YUHA 3O2DL 2EDQA 4KZDH 3M1BA 1T83A 3OJVC 3VXOA 4P4RA 1A6WH 2VXQH 4OD2A 5HDQH 2QQKL 1Q9KB 2LVEA 3LQAL 3H9ZA 1JGLH 4KJPC 3LMJH 3LRHA 3N85L 3OL2A 5ANME 5KJRL 3DVNB 4O2FA 1LO2H 3HC0B 5E6YA 1ZWIA 2NY0B 1CFBA 1P2CA 3LKOA 3DJ9A 3T1FA 4ODHH 1OWRM 3K4DA 3MYJA 1HKLL 5ENWB 1TZGL 3R06A 2BY0A 5IFAL 3FQNA 2H3NA 2Y6SC 2ATKB 3NZ8B 1TPXB 4PJ8C 4F33A 3T4YB 1YN6B 3G6JA 2KL6A 1H3UA 1P7QB 4PD4J 2Y07L 3LKNA 1HQRA 1AFVL 2XRAH 4R7NA 4IHOB 4LLMA 5GQBA 4F57L 1JZ3A 3P4LA 3WUWA 2FSEB 2NTFB 4Q6IB 5D70H 1QFHA 4CN1A 3B9VA 1DQQA 3GBLA 4GRMB 1KCUH 1ERNA 4LVHC 5JW3H 4MZ3A 4QNPE 4I0CC 1T2XA 3SO3B 1JWUA 3SCMD 3DUSB 1K8IB 1NCUA 4K7PY 5DK3A 5E6ID 2Z9TA 2DAVA 1RZGA 2FRGP 2VDQH 4OZGE 3QUYD 5A2KH 2CMRL 5E08H 1S8DA 1UXWB 1G84A 2X4SA 2UYLA 2OSLA 1NSNL 1X9QA 4UOW1 1IE5A 4LCUA 2NTSP 1CQKA 1WBXB 5ISZD 1UB6A 4QLRA 3D18A 4K94C 4YR6B 1CL7H 1K5NA 1ONQA 2R2EA 3LDBB 4ELMB 5I30L 4BSVA 3KJ4B 1YMHB 2X4TA 4XPAL 3IF1B 2G2RB 1GPOH 3NA9H 3PWUB 4NO2B 2COQA 1I8KB 3OX8B 1W0VB 4XP1H 3REVB 1FZJB 4YDJB 1ZGLP 1O0VA 2NY1D 4X80H 2F74B 3K7UA 1I7TA 3BDXA 5JDSA 1G7PB 1I1AA 2MQ3A 2ADFH 3THML 1K4CA 5C7XL 3ZTJH 1G9NL 2A0LD 4NBYB 1RUML 2AJZA 5T3XH 1BOGA 4WI3A 4OLVH 3C6SB 1R3LA 1KJMA 1LP9A 2EXYC 4JN2B 4DN4H 5L0QB 4ZAKD 1YEKH 2W0PA 2PTUA 2DQEH 3KYMA 1GGYA 3JV0A 1CICC 2Z93B 5DQ9A 1MCWW 4DEPC 2GUOB 4KQ4H 4YXLL 1UWXK 2R4RH 3B43A 4LRIA 4U7MA 4PJDB 2HFEA 3BIAX 1OLZA 5IFHH 1EFXA 2M1KA 1NEUA 2AK4A 1HQ4A 5IIEA 3NA4A 3ULVD 2I25N 5J0BA 1UZ6E 2UVEA 3S4SG 1IGCL 1G9MC 4RMRA 3LZFL 1ZKAA 5GRJH 3B9KC 1LNUB 4FXKB 5BCAA 2V2TA 1QUNA 3X3FL 1CZ8H 1QPXA 5CP7A 5ESAB 3WN5A 3L5HA 5MHSE 1EJOL 4HAGA 1C5BL 5FM4A 3CH1A 4HF5H 5GGRY 2EDNA 1S7WA 2EO1A 1HEZB 3OJDA 4XWOC 5T3ZH 3VD3A 2R1XA 1JYNA 1GIGL 3RVWC 5KSVA 2XWTB 5GS0H 4K3EH 1YYML 1U8OB 1CXEA 2F53B 4OQTA 3UTQA 2FX8L 3W39B 4ONFL 1KTKE 5I8KL 3QA3B 5MENA 1BFOB 4PJBE 4R4NC 1KCVH 3D39D 3GMLB 3HPJB 3HUJA 1WAAA 5T33L 3UZQA 2NY2C 5F70A 1KCSH 4QF1B 4U0QB 1X4XA 3UCRA 1ZAGA 4OV5B 5CGYD 5L2KE 3S9DB 3VFTA 4X7SL 4R2GB 5I19L 1MHHB 1ADQH 3ISWA 2F8VA 2R0WH 1XF4B 1LD9A 1NCAL 5EOCL 3PP4L 3HI6H 3GM0A 3H3PL 4LLUB 4RBPH 3VWKD 3RKDC 2EXWD 1BZQK 5TDNA 2YRLA 5C0JB 4B7IA 4X6BB 2ZG2A 1HINL 5IR1B 3BEVA 5HHPA 1ZV5A 3MLUH 1DUZA 3HNVL 1X5XA 4GQPH 4NZTH 3O4LD 2PO6A 4ZNEE 1ES0A 3TO4A 1QZ1A 3U0TA 5MERB 2GJZA 5HDBF 1U6AL 1ZLWH 1INQA 1FV1A 1O7VA 2JJVA 1FYTD 3ULVF 3ARGB 1A7OL 4BJLA 1BM3L 5HHME 3CVHL 4NHUB 1CTOA 3ARWA 3V4PL 4OF3A 4EN3B 1BQUA 4PRIA 4P46D 4LCIH 4BQCA 1EK3A 1U8PA 1CVRA 5BVPH 4KKAD 4I0KA 4NQTA 3T0BA 3RTQD 1MCDA 3OXSA 1CD9B 4PPTA 5SWZA 4QXGH 1AXSB 4JFPB 1IC5L 5IJKA 2A6KA 2Z8VC 5INCA 1K3ZA 2R9HD 2XA8H 2EDWA 4IIQC 5AG9A 3VW3H 2ZNXA 2OR7A 5FA3B 1IGFH 1ZS8A 2UZXB 4W4OA 5BV7L 3VXUA 1U8NA 4ONHA 1U2HA 5CKGA 1MCFA 1VEPA 5C1MB 1JPFB 4L3EB 3UTTE 3MJ9A 1CDBA 5HD8C 2ZCLH 5JA8B 3MA7A 3BQUB 4D0CA 1B90A 4XGZB 5AWNL 4GW5B 4HPOL 3RY4A 2AEQH 4YPGA 1GYAA 4PJEA 1MNUL 1YA5A 3C2AH 4EVNA 2HT3D 3PF2A 4JJHA 5CBEB 2ICEB 4CVXB 2Z8SA 1ZLVH 2JK5B 3JVGA 3RZWA 2J8UE 5C9JB 1IMHC 2E7CA 3VJ6B 3NCJH 3WL9B 1X4YA 1OP9A 5TDOB 1JK8B 5IQ9A 2XG4A 5SWQB 1KLGB 4XMPH 3BESR 4XXCC 4AEHH 4UT9L 2R69H 1QFUL 2LTQC 3P9MB 1XCTB 5EN2B 3P9WB 3VFRB 3MRNB 3QXTA 3VXRA 2QSCL 2IBZY 4HFUH 4MXWH 3GSNB 4A6YH 4KKBD 5F7EH 3N06B 4JKMA 5GZOC 4NIKB 4LSUH 3T2OA 4X4YA 2VLME 3FB6A 3FCTB 3HG1D 3ZDYF 4HT1H 1CFQA 2WINB 2BOBB 5DF0A 4WTZA 3JTSA 3AU1A 4NN7B 5D1XC 4HZLB 2PCPA 4UIMB 2GSGB 5KG9B 1S7TA 5EOTA 4K9EH 4GH7B 5KS9F 4OZHF 3GB7A 3AY4C 1FO0H 1PX3A 1FDLL 1JF5A 2XZQL 1E4WL 5FUOL 1S7SA 5KVGL 1MQKH 3KPRA 3O11B 3MBED 2DM2A 2DJ4A 1YPZA 5KSAA 3VFGH 3ROLA 1T04A 4OLYH 5INDB 4XVUC 1J8HB 1DN0A 1FVCA 3O81A 4HXBH 2IANA 3RGVD 4EEEA 5HYQB 1MCCA 1LEKB 5F7KC 2LAAA 1KELH 3RDTA 3AGVA 3MOAL 1I8MA 2APWA 4KPHH 2MHAA 2XACC 5GIRA 1JTPA 1J0ZA 32C2B 4X8XA 2DIAA 2HG5B 3NIGF 4JCMA 4WW2B 2O5XH 3B5TA 2R0LL 1ZE3C 1LE5A 3BZEB 4FABH 1JP5A 4N90E 1YDPA 1MIML 4L1HA 2D4DA 4KZEL 1GCFA 4Y8DC 4IRJC 3V5DA 4FFWC 5I1EH 4M7LL 2HA1A 1B0RB 3A6CL 2ARJB 2VL5B 1H3TA 5I8CA 3ZE2E 2OP4H 4ZS6D 5HGGS 1RAMA 3C8KA 1WCQA 4OZ4B 2WWKO 4G6KH 1YEDA 3QCUH 5JHDA 3NFNA 3HCVB 4YDIH 2ZZUT 5C2BH 3RAJL 4G42A 4P2QB 1VENA 4JFDA 5KVEL 5LWYL 1RIVL 1JJUA 5B3JF 3PWPA 3EYUH 3O0RL 2J6EL 3EOAA 2JB5H 3HNTH 5HHOB 5DVOA 4F7TB 1S7UA 4OLZH 1HHJB 2DQIH 4R4FH 1B4RA 2V9TA 1CGVA 2BX5A 3KPMB 3SDAD 1V8HA 3DV4A 5HJ3A 4NQDB 1DDHB 3FFDB 1MCSA 3WKML 4UOJA 4GG8A 2EC8A 1NFIA 5IMLA 1J0IA 2CXKA 4MA7H 1QO3A 4U2ZA 4KJWD 3SCMA 4YNYA 2WAHA 2J2ZA 1MI5B 2VABA 4NYLB 3CGTA 3LRGA 1AGDB 5GS1B 5KSUA 5L2JA 1JN6B 4FOMA 5E8DH 3EYFA 2VDRH 2NMSA 4OLUL 5FF6A 3FRPG 5FECA 4X7DC 1GGBH 3RZCA 3MNZA 1RJZB 3B2UC 1E4KC 2V5TA 4XCFH 4KY1L 5ISZA 1AO7E 3B8YA 1HIML 3MNVB 1FZKB 3TBVA 3BE1L 1Z9MA 2O5ZH 5GGSB 3MREA 2JJTC 1NEZA 4LCWE 5E4EB 4BA8A 3VE0A 1T83C 2GAZA 2VISB 5DFTA 2BVQA 4Y4KC 4TN9A 3BJLA 4Q9RH 3C5JA 4QT5A 1MWAL 1N5YL 2JF1A 3HI5L 4L5FL 3RUGF 3O9WA 2BVPB 4U6HB 4R0LB 1DBBH 2M8XA 1F4XH 2B0SL 1DL7L 2Q3AA 2IQ9L 4ZUSA 4NM4L 3OJ2C 3NCCB 4XRCB 2VNCA 3TA3B 2ATPB 5DI8B 1OY3B 4U05A 5CEYB 2FX9H 3O4OC 1C5CL 3QQ3A 1M71A 3IJSB 4Y2DB 5B4MD 1QFWH 3ECBB 4F37K 3B2VH 3NCYP 2APFA 3V4UH 4M6ML 5IB2B 4NJ9L 4MJIB 5DRXA 4AL8H 3SKOB 3L3OA 4YK4C 1KLUA 5I9QC 5J57B 4LLAA 3LIZH 3P73A 5DJYB 3EJJX 3G6JE 4ZXBB 4LPWA 1FQ9C 4E5XA 3K8LA 1KPVA 5JQ6H 4MJ5B 5K9JH 5GISL 1CXIA 5B39G 2NY4C 1PZUB 3QXDB 2P45B 4KC3B 1UH3A 3EJZD 1AR2A 5D71H 5DD6A 1A1OB 4MMXC 5GZND 2AJVH 2ADIA 1II4E 1JNHA 3DO3A 4S1QH 5HTSA 3VXTB 2BDNH 2AV7B 5EULV 4PRDB 1H8SA 4YGVB 5EBWA 1IAKB 1OAYH 3W0WB 1GJIA 4UDTA 3T04D 1RVFL 3KPTA 3HC3H 1RUAL 5HI4C 5EG6C 4LLWB 4LSQL 4AM0A 5IW6B 1JGVH 4MCZB 1KBGH 4LNRA 4JVWA 3S88H 4KJQC 4HK3J 3M8OL 1HDMA 5A2LH 1MRCL 1I1AC 3BPCA 5F88B 1W0YT 4FQCL 4UQ3A 3BISA 1S5IH 2VXTH 4LBEA 1T89A 4WV1A 2VXSH 4R97B 3O2VH 5DHYA 4XXDA 4X5WB 3QFJE 1KENL 3IDMA 2OX5A 5ITFB 4JAMB 2YRPA 3VFUB 4Y4HB 3E6HA 4LVOC 1Q0YL 4WTXA 1QRND 5J11B 5D1ZA 1KF9B 4L8BA 1J0KA 4RFEA 1MJUH 4PTTA 2HJFB 3VRJB 1J8KA 3LN4B 1G6RA 4WY7H 1Z5LB 1ZA6B 4LRIC 1QNZH 4JG1L 4U3HA 3SDCD 1FORH 3WFHB 4D3CH 4MA8L 5MEOA 4HEPG 4OF0A 3OHXA 3QXAB 1FPTL 5D2LA 4H5SB 4B7LA 2XXMB 4XAWH 1PZ5A 5DD0H 1CK0H 1A7PL 3W9EB 5E9DD 1AXTH 2YPKA 2AK4E 4QOKE 5DDHB 1RI8A 4PRPD 4HUKB 4OFIA 3WN5C 2CH8A 1MSPA 3OAUH 1MFNA 4QRRD 3RWCB 1IT9H 4H88H 1NJ9A 2VN4A 1FNEA 4LKCA 5DVLA 1K8DA 2ARJQ 1A3QA 4G9FD 1UM6H 2Q7NA 5ID0A 4EI6A 1EPFA 3O3UN 1JGDA 4K07A 1B2WL 4KI1A 2BCKA 1QR1A 5BMFH 2P49B 4JZOA 2NZ9C 2MJWA 3K3QA 4OFYD 1OOAA 1SVZA 1BF8A 5CHNB 2FLBT 2Y36H 4EI5B 4AEIL 2IBGA 4RRPG 1U93B 2X9WA 3V95A 3QIUC 3TFKD 2CDGB 5EORL 5CBAA 3O2WL 2Z92B 1TXKA 1XF5B 3QEHB 5HGDB 1HZHH 3TBSB 5I8EB 3QNXA 1NCCH 2HTLD 3UAJC 5MENE 3X11A 3HUJE 1WAAE 4PP2A 4K8RH 4GRLA 5C08A 1UYWH 5IJVA 4NUGH 1JUFA 2JJSA 4NCDA 3KR3L 1XF3A 5HYJD 2VOTA 5D72L 4PJ8B 3UJTL 3VFOA 3ZYJA 1AD9A 4Z78B 4WDIA 2PO6C 4QRPB 4YHLL 4YHYB 1NAMH 1U3YA 2KPNA 2DQTL 2FBJL 3INUH 3BKYH 4C56D 3WLWD 1KN2L 4OZGB 4D9QD 4LVHB 4F8TA 5JOFA 1P1ZB 1DE4A 1GGTA 5I1JH 3ARBD 5C0ND 4I18A 4HLZG 5BRZB 3C60B 3SKJH 3MV8D 2QADD 4U3CA 1P4LA 5EUOE 4YAQA 4U1NB 5D7SL 1PGRB 2V9QA 3DARA 3DXAB 4M7ZB 4Z7NF 1YEFH 2HVJB 4MAYA 3X13B 4OCYH 5IJKC 3EFDH 4AMKH 3VI3E 5ESQB 1N6QL 1BJ1J 5DC9B 4W4OC 5F7NC 2OXHA 4GQ9H 1HI6B 3BGMB 1C5DB 1CR9L 2Q3ZA 2D7TH 4R3SA 1ZLSL 2G9HA 3RL2B 4WTWA 1KPRA 2B7DT 3VXUE 4Z7QE 4KHXH 3G04A 4KHTL 4MD4A 4G8EA 3FB5A 3QG7L 4X9IA 3JVGC 5TGBA 3QI9D 5JIKA 4OLWL 1GAFL 1WFUA 3BN3B 4M8VA 3BAEH 3S37X 3L3KB 5IVZB 4ZOBA 2EZ0C 5B21A 1S9XB 4OZFG 2KUTA 1CICB 1JGUH 4QHMB 5ETUA 4DEPB 3BP5A 3KAAA 3LQZB 1VB9A 5C8JA 5LG1A 1EERB 1F90L 1S7RB 4JHAL 5HXMA 5CGTA 4ZO8A 3RUGA 2B4CH 3RVTC 1I7UA 3OR6A 3IFNL 4S2SB 3GDBA 3MACL 4LASH 4P2RB 1A1NB 1MCPH 3TF7C 4FXGA 4FTVA 3B9KB 5L9DL 1R24B 3S35H 1TJGL 1VEOA 2DJSA 1U3HC 2YPVH 1IFHL 3HR5A 4DWHA 3UTZB 3QG6B 3OGCA 4ODSH 1RZ8A 4XPFL 5A2FA 3IFLH 2FHFA 1P7HL 1BX2A 5C6PB 3DSFL 3FO0H 3VFMB 5IMMA 3NTCH 3BPNC 4U1IB 2VDOL 1DUYB 1YQVL 4L4VD 4G6AC 1P9MA 2DMBA 3U9UB 2XFXB 5L2KB 5KJRH 2D03L 3TBYB 1WC7B 3MJ7A 3Q3GB 3MJ6A 3G08B 3ZT5A 5A16A 5F1OB 3RDTC 3KPPA 2CUMA 4PLNC 3IDNA 4IOFC 3ARTA 2C4FT 4JGJA 1CTNA 3SE9L 4RMWA 5IFAH 1JI1A 5IUSA 1HHIA 4JKKA 4EUPH 1MVUA 4OQTL 1VSCA 3ARFD 1BFVL 2J8OA 2Y07H 2X4PB 1AC6A 2DS4A 3VMPA 3GBMH 25C8H 3EZ8A 5K59E 3PGDA 2EYTB 1YMMB 4UV4L 3OG6B 4WJ5B 4DAGH 2FIKB 5GJTL 5CWSB 4BFIA 5CKAA 3ALWA 1NUFA 5I0ZA 2VQ1B 2YEZB 2C4FU 3IVKA 4L3CB 1CD1B 2H26B 3O3BB 3PWVB 4GAJL 4GXVH 2PTTA 3ZE1F 5FHAH 4Z76B 3QBTB 1NSNH 3GI8L 1NC4A 2IADB 2Y4SA 3T0XA 2HVKB 2BRQA 5HY9A 4AIOA 5D7IF 5F6HJ 4P23A 5I30H 5T1LB 4IOIB 1FLRL 4WEBL 2PW2B 3PWPE 4PRHD 4IIQB 5FYJH 5TJWK 5DEFA 4HMCA 2LVCA 2I5YH 4TVPD 12E8L 4MWFA 3SCMC 1DQLL 2DQJH 1ZVSB 5DZLA 2W0FB 3RWFA 4M6OH 2J8UB 1G9NH 3QUYC 2C1OB 2LAGB 5JZ7D 3VXPA 4QWWC 1I3VA 3QIBD 2G5BA 3RZCC 4NCC2 4XPBH 5GSRA 4BYHA 3UJJH 2BNRB 5FK9B 4ZOAA 5DMGD 2YD3A 1BQHG 3MJ8B 1INDL 2XN9A 3QAZB 3PQYD 5CEXA 1XZ0B 1FNFA 5ISZE 1AP2A 1BWWA 5FO7A 4HMDA 4HWEH 4R96A 2LTQB 3LPGA 4BH8B 1MLCA 4M61B 3DX8A 1CLYH 2P24B 3UZVB 1EGJA 4HS3A 3O9WC 4HQQH 4NFBA 5KZCD 2NY3B 2FB4L 4JKWA 4BKLB 1JRHH 2A0LC 1JHKH 4J7RA 1EA9C 2GFBB 4CL7A 4LPTA 2VAAB 4NRYB 4ZYKB 2OYPA 3X3FH 2AABL 3MODL 2PYEB 2HKHL 4XC3H 1ZHNA 4XCNA 3MGTB 4PGEB 2GCYB 2VDKH 2D9CA 5DD5L 3NABL 3KS0J 4U33A 3VXMD 4LL9A 3QHFH 4XX1E 4MD5B 3O3EB 1JHLL 3MLXL 5DHVB 3PABB 3R8BB 4APQB 3L3IB 1TNNA 3MRHA 4YWGL 4KK8C 4XCEB 5HDOA 4P9ML 5GGUA 2A1WH 2NPLX 1YYMH 1NGPL 3D25B 1Q0XH 3QDJB 3T8XA 1NDMA 3ULVC 2P44B 1OTSD 3EYVB 2IALB 5HDBE 4RZCB 3QSKB 1HXYA 3GJFA 3VGAC 3MRPB 3ZL4H 3EGSA 3ULVE 5I19H 1UADC 4JE4B 4HKZB 1NANH 2UY6A 1Z9LA 4UUJB 4G9FA 3BD3A 1A7RL 1FGVL 4FG6D 3S3PA 2K7PA 3MRJB 1NFKA 5F6IC 1KIPA 4NKIL 2I9TB 5SV3A 4QTIH 4PJHF 5IV2A 1P4IH 5EU3B 1UG9A 2NW3A 1M7DA 5AZEH 4AEFA 1T89C 2C3GA 4N0CD 4GG6B 2AJ3B 2Y06L 5I74B 5CGYC 3MRIB 1WCBA 2GJ6D 4GSDL 5KN5A 1M05B 3GSUA 3QEQB 3D39E 1HCFX 2NR6C 4GBXD 1VESA 2LE9A 2X89D 3FONA 3AAZB 1EUTA 3IRZA 5CP3H 5DJ0B 4ZPVB 2DOCA 2PETA 3CCHA 2EXWC 1JNJA 2V2WB 4XCCL 1A02N 3MMEB 4PJXF 1BZ7B 1JZ2A 4XH2A 4EJ1C 5F9JA 4NPYA 1AGFA 1AGEA 2LQRA 3CFJA 4ZUWA 3IFOA 2GK0A 5IHZB 1R3KB 5LJYH 1MUJB 2HFGL 4KVNH 4C56A 2VUYA 1KXTB 2XG5A 5AWNH 1U8IA 4CBPA 2XZZA 3RWJA 4OIIL 3MLTA 1FAIH 3O4LE 4JR9L 4V2CB 4OKVB 4M6NH 2XY2A 3ARBA 3SDXA 4K94H 1GGUA 4RDQG 5IB5B 3RPKA 3ZDYE 3RIAK 4MJ6B 4P46C 4X9BA 4P57B 4P48A 1CGTA 5D7KD 2YWZA 4J2XA 4KKAC 3STLA 1FFPA 2WIIA 1B6DA 2FD6H 1CLOL 1RZIA 4PP1C 2VIRB 4MZ2A 1HXMA 3C6LD 3MUY1 4NO5A 4LCWB 4NQXA 3RTQC 5DD1L 5KS9E 4OZHE 1MCRA 2VC2L 3FQUB 4IDJL 3OKKB 2A6JA 3T0VA 1GOFA 3GNML 3QWRA 1OD7A 1QQDA 1RHHA 1JPGA 2X6MA 1CE6A 3TIDB 1EV2E 3SQOL 4I1NB 5H35A 1JMXA 4NRZA 4XP5H 5HHNA 3HTLX 4Y4KB 4U1JA 1KTDB 1R5WB 2E7LC 3MBXL 3SKUD 2HT3C 4LQFL 4JPWH 3FQXA 4HIHA 5EIVA 3VFWB 3WFEL 1P2CB 3GUTB 5DJDB 4YDKH 4HKJA 4MHHI 1F02I 1N59B 1NGYB 1NPUA 2JJSC 5F3BA 4G6FB 1PYWB 2W9EL 1UACH 3NIGE 2BXYA 2EDOA 4ZO9A 3MOBL 3SE8L 1VERA 2DI9A 5B3NA 2OTUB 2HT4D 4DN3L 5LXGL 1G9MH 3G5XA 1B88A 3P2TA 4KKBC 4WFGD 5I9QB 3ZKXC 3O6FB 1B9ZA 2Q7YB 4I18C 2VXVH 1JVKA 2NY4B 4JDZB 3CMOH 3MLWH 2BVEA 1OTTC 2GHWB 5D1QB 3DUUA 2R2CA 4WWKB 1QYGH 5GRUL 3HPLB 2A77H 3DURB 4HC1L 5F8RC 3NFPA 4MAYC 3QWOB 5I17A 1LVEA 1ZEAH 2VQUA 1U95B 1YEGL 3VXQB 3JUZA 5CSZA 1IRAY 2ZCHH 1JFQL 2YOCA 3BUYB 4PTUA 5IEHB 5B3JE 3WFCH 1H8NA 2BC4A 3JV4B 5IB3A 1PG7X 1D7FA 4JFFA 5GRXG 2VR9A 4N1CA 1VGKA 4P3WA 2IAMA 1RZJL 5HPOA 4KDWA 3F65A 3TYGH 1FL5A 1SM3L 3OWEA 2P5ED 1I1AB 3N1FC 2VLRD 3QFJB 4L4VA 3RGVC 5ITBH 4ZD3H 4FFZH 4L9LB 1MJJA 3WIHH 2WLYA 4QHUA 4X8JA 1J10A 3G6DH 2B2XH 3WXVH 5EU4A 3MXWL 1N26A 1J05A 5J12C 3RVUD 5GHWH 3CFBB 1DVFB 3DGGB 5D6CA 1C12B 4LSTL 5E8NB 4CN6A 2CRIA 4FS0A 4LVOB 3IDJA 1IKNA 3OPZH 4LCCA 4WUUD 3C09C 4KDTA 4OB5H 3C9NA 1BQLL 4GLRI 4MNGE 2MKLC 3JZ7A 4H25B 3UROR 5DUPH 5HI5D 1QBLH 3TJEH 4MD0B 3WKMH 3GK8H 1JF1A 4OCRH 5MI0C 3NN8B 2VL4A 4JREC 4POZD 4QOKB 4P59H 5M95B 3QQ9D 2DLFH 4LHUB 5A43C 4KUZL 1D5XB 2AAVA 4M7JL 4G7VL 5I18H 1BBDL 3L7FA 4P3DB 3RUGE 3UYRL 1CGSL 2AJXL 4K23H 4TYUA 4PY7A 2OR8A 4UQ2A 4BQBA 3DETC 3CZFB 3VH8A 3F7YB 4O2EA 5GGVH 3KYNB 4KY1H 5EDXA 3K74B 5IVOA 1U8KA 4IRSD 5EO1A 5BO1L 5L8JB 5I1GL 3SBWC 4FTVE 1S7WB 5DFVD 1F58H 5C0AA 5GRVK 5KVFL 3KPSA 4G43A 3MRDA 1YQ2A 3HZVA 3KVQA 3G5VB 2YN5A 3H7BA 4HXAH 4MAUL 4K2UL 4L29A 4G8IA 4MB4A 3TLRA 4G6JL 3W11D 3BH9B 3ARED 5K9OA 4DCQA 1MWAH 1P9MC 1FNSL 3Q6GL 4L5FH 4RWYH 4BQ9A 4RAUB 3OKNA 1WIOA 2R56L 4X7TA 4KJWC 1MPAH 1K4DB 1DL7H 3QIUB 1FBIL 5HGAA 5FB8A 1WSST 1KEGH 4S1SL 4DUVA 3P4MB 2FECI 4KRMB 1R3HA 1IL1B 3UYOD 3BT2L 1HOCB 2AXFA 3GSRB 1HSAA 5M94B 5JNYB 4HUWB 3I75A 4NP4H 1IAIH 4Z0XA 4M6MH 4LOUC 5TDNB 2VITB 1A9BA 3GBNH 3ZE0F 1A7NL 3WUZA 3OF6A 3UTSD 1JNNL 4OAWA 1I9IL 4JFOB 4XCYA 2HAZA 4GMTH 43C9A 2PO6B 5ICYB 5BXFB 1T7ZA 1ND0B 4HBCL 4TSBL 1FFQA 1WBZB 1S9WA 3LV3A 1W8NA 1NGZA 4X4XB 2V7HA 1TJIH 1RK0B 5EUOB 1U8QA 1L0QA 5DTFB 5FXCH 5IF0A 4FFYL 1WTGT 5FYLL 1ZLUH 4LLDA 4D9LL 5L7XL 1OAZH 2IPKB 4RBPK 2P5WA 3PUCA 3D0VA 4OFDA 2DQCL 2MWCA 4P23C 3R1GL 3W9DA 5B4MC 4TNWK 2VZOA 5SX5H 5FA4B 5AYUH 4PLOB 4TSCH 1DBAL 3LKSA 1X44A 5INCB 1ORSA 1UWGH 5EPMA 3FTGB 1G7QB 1JHTA 5IVXB 2AJYL 1YNKH 3FOMB 2GTWA 5TQ2H 3LVEA 5DEGB 5JO5B 1TCRA 4PJ9B 5IVNA 1OGAD 5AD0A 1L4IA 3NGBB 3QEGH 4U6XB 3PV7A 3EJZC 4J1UA 4UIKL 2F9BT 4FQJL 3V6OE 4P9HH 3QPXL 4GKSB 2BNQD 1QSEA 1RFDH 3CLEL 5EU6A 3CK0H 3WDIA 4XAKD 1P69B 3PHOB 3WV0A 2Z4QB 1PFCA 3QHZL 4PJDF 3OKDB 4NKMB 3VGBA 4HGWB 5HGHB 1KJ2B 3DX6A 1NBYB 3BUTA 5IMOA 2GT9A 5EZJA 1QSVA 1I1CA 2EIZA 6CGTA 2ZWLT 3L9RA 3IT8D 1A47A 4UV7L 4W6XB 4UTAL 1NCDL 4DUWA 4KH2A 4OCSL 3WHXB 5TE4H 1RU9H 2X4QA 5E94A 5JDJA 1EEQA 2XOTA 2XN9E 4R26H 4PJ5A 1U92A 4UDUA 4LLVA 5T1KD 4HUVA 1G7MB 4JG0L 1HN1A 5D9SA 3ARPA 2VAJA 1ZLVK 2X1WL 3SQBA 6FABH 3FB6B 5ESVA 1RULH 2V9RA 2VLLB 1D9KB 3FO1B 1Q9LB 5C0BB 3OR7B 3WSQL 1IBGL 5EC1A 4OUUA 4NNYA 3BQUD 2FGWH 2F5AH 4GBXA 3GO1L 3O6LL 2X89A 1QSZA 4YHZH 2F58L 2HFFB 4HW6A 1U3HB 4UU9A 1QRNE 5CJ5A 3ES6A 3SDCC 2Q8BH 1RUPH 3ULSA 1WZKA 4YHKH 3RIFK 1KPUB 4WI5A 5FDWB 2BOCB 1VKXB 3JWOC 3F12A 2OXGA 3EOBA 4UT6H 2DLGA 5ICZB 4WCYH 1B0GB 5EORH 4XHQA 3U36A 3OXRB 2VLJA 1V7NH 2EH7H 4CJ1A 2I07A 1T2QH 4LHUG 1Q8MA 4BSWA 1DEDA 1Y0LB 1NUGA 3L3DA 3S4SA 1CBVH 5E9DE 1ZT4A 1R5IA 4FZ8H 3GHBL 1KEMH 1J0HA 4OKDA 2MHAB 1MFEH 5AYQA 2APTA 3ETBF 2CDEA 4NZUH 3MLVL 4Z7NE 2Z31A 4NBZB 4X6CA 4FQXA 4QRRE 5I71C 4AG4H 1LE5B 3UJTH 3HZMB 4A6YA 2CLVB 4RIRB 4XNZC 2AI0H 4G9FE 2DQTH 2XY1A 3O8XD 1NGWA 4G80B 3D69A 4PJAB 4OF5A 5F97E 4NNPH 4KTDH 2KBGA 3I6KA 1K2DA 3LEYL 4NJAL 4DVRL 4G5ZH 4KJYB 3UPAA 3WFBL 1YEHL 3L5XL 4MA1C 4PRBB 2XTLA 1MIEL 2DBJA 1T7XA 5FYKD 3EDJA 4JPKH 2EC9T 5T5FL 1PD6A 2YPLD 4NM8H 5FYKL 5C92A 1KUMA 1P4BL 1E6OL 2BXZA 3QP3A 3X12A 4U6VL 1IZKA 1INEH 2CIIA 4N0FB 1U3ZA 4B0MM 1F8TL 5DT1L 3D2UB 1LK2A 4J6RH 4YDVB 2CKBA 4WU7A 1TQCC 2JIXB 4HJJL 5HYJE 2ITCA 4NN6C 2IF7A 5DC4B 1N5AB 2VE6A 3F7RA 2O61A 5DUBA 3F7PC 1NFIB 1MFBH 2PR4L 2KH2B 4EIZC 4PJGA 3JBG7 2EC9U 1QO3B 2Q76A 3ARBC 4PY8I 5F6HI 5C0NC 3ET9F 2VABB 5E6IB 4C56E 1YNTB 1E4XL 2WLZA 2QADC 4PGCB 4G7YL 5SWSD 3U30C 2FWOA 3QUYB 1DJSA 3QCVH 4D9QE 1KACB 4OCXL 3BZ4B 4Z0BL 3IXAA 1Q9KA 1J7VR 2R29H 1WVZA 3MV8E 4M1GL 4PBXA 1OL0A 2EIDA 2AKRB 2UV3A 3DVNA 3FO9B 2ESVD 4ONGL 4ESKA 2R1WB 3HC0A 5E8OB 4I13B 3PP3K 5ENWA 5IHLB 3U0WH 4FFVC 2NY1B 2ATKA 4K3JL 1Y18B 3NZ8A 5CEZD 3T4YA 1YN6A 2NXZB 3RKPA 3KHQA 1P7QA 1OB1A 3VWJD 3LOWA 2DQDH 3MACH 4GKNB 1QA9B 3NH7L 4IHOA 3QI9C 2ICWI 3TT3L 1F4WL 2UWEF 1UJTA 2FSEA 2NTFA 4Q6IA 1DLHB 2ZJSL 4UAOC 4GRMA 3BKML 2ZNWA 1KSRA 3UXFA 2GSIB 1TJGH 2X42A 3DUSA 1K8IA 3KYKL 4ZAKB 3CFCH 3CC5B 3QEUB 3RPIB 1T0NB 4Z18A 1M7IB 3HRPA 2R4SH 3WS3B 2EYSA 2VKXA 1UXWA 4O2CB 5FKPB 5D93B 4LLQB 3H7LA 2OLDA 5E2UH 2H2PC 1WBXA 3C5ZD 3FMGL 2QQLH 4YR6A 2V2XB 4F9PA 1XGPB 4JPVL 4ELMA 1T0MB 4M48L 1V5JA 4ZTOH 3FAXA 3C2SA 5I75B 1YMHA 4YBQD 3IF1A 2G2RA 4NO2A 2W07A 5IP4A 1I8KA 5DD6B 3NACL 3OX8A 1W0VA 3REVA 1FZJA 4U1GC 1CG9B 2D7MA 2ADIB 4UT7H 1CLZH 3VGAB 1NMBL 1I3UA 2F74A 3ZE1E 4S0TD 1DQDL 2A9MH 2XPGB 4DKEL 1AI1H 1G7PA