1OSPH

Crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
218
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGEPITSGFWDWIRKFPGNKLEFMGYIRYGGGTYYNPSLKSPISITRDTSKNHYYLQLNSVVTEDTATYYCARSRDYYGSSGFAFWGEGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 184.1
publication title Crystal structure of Lyme disease antigen outer surface protein A complexed with an Fab.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Complex (immunoglobulin/lipoprotein)
total genus 35
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1996-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ospH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ospH02
3QRFM 1X5AA 3MGTA 1J86A 3TH4T 2FHBA 1J0KA 1JHLL 4XCYB 4AQ1B 4PLKC 5HGDA 5F9AC 3HHRB 1ZVSA 4ZPVA 2DQCH 3LQZB 2WM0A 4NKMB 3VXPA 4AY0A 4DOHB 4TULH 3KLSA 3ARBC 4U1MB 5GJTL 1U6AL 5D1QD 5I8EA 2YD2A 4QT5A 3UPRB 3V4UH 2QLVB 4HUWA 1UKSA 3VXRD 1OW0C 4GMTL 3M1BA 1I9IL 5IGXL 1DQJB 3X12B 1IQWL 1UZ8A 4GLRH 4CU8A 1RUML 1R3JA 3KJ4C 1D6VH 1MFAL 2VZSA 4AG4L 3VDAA 4QRRD 3AU1A 1LP9B 1N59B 3L3IA 3VFNB 4MQ7A 5B3JF 1WT5A 3ROLB 3ULSB 5C2BH 1IEAB 3IXTB 5F8QC 3NOIA 3QEQD 3QG6A 4JY6A 4YH6A 2BVTA 4Z0BH 4S0TD 1U2CA 5C08A 3ULUC 4L8BB 4LCCC 4PUBL 3ALXA 2P46B 3OF6A 4LLAA 2ZWLT 4IOIA 2WP3T 3RAJL 5CWSA 1F2XK 4PY7A 2CRMA 4NQEB 3H0TA 3MBEA 1I9EA 12E8H 3UAJD 3AM8A 4KTEH 5CJOL 1OT1A 3I6KA 4K71C 4PGDB 4I5BB 4GKNB 4XPFL 1KELH 5FUZL 1HSAA 1OL0A 1OP3H 3UX9B 4HZAA 1OAKH 3DRTB 5TE6H 1MFEL 1Q9OA 4KKNA 4EBQH 2BERA 1KIQB 4ELMF 1NFDB 1T21B 4O4YH 4RIRA 3FMGL 3K8KA 2IANA 3L3KA 4OAWA 4DGIH 2FECL 1CF8L 3MV8A 4Q7DA 1ETZB 1INQB 4PGJA 4KQ4L 2DQHH 4NC0B 2XKNA 4KHXL 3LEVL 3SGKC 5C0EB 1CIUA 2IWGA 1RZKH 5I18H 1CXIA 2R0KL 2D7TH 1H3PH 1CWVA 3T77A 4JB9L 2F8VA 4OGXL 4P48A 2V2XA 5DHVH 5IWLC 2GK2A 4RGND 3VG0L 4BKLB 3L7FA 5D7IB 2QSQA 5B8CB 3I3BA 4I0PD 4RNRB 4EDWH 1U2HA 2YD4A 4WJ5A 2FNBA 5JW5A 1YJDC 3DVGB 1V5JA 4HF5L 4PB0L 1IC7H 4JFPA 5E6ZA 5IW1B 4YDIH 5GGSA 1LEKA 4LHUB 4PJGF 5D4QA 4PRNA 3WUWB 3BWAB 1DQML 5E8DH 2YWYA 1T20B 4ISVA 3EHBD 4Y4HC 4JPVH 1H3TA 4JZJA 2D9CA 3OB0K 1IAIL 3HZMA 1JL8A 1FYTE 1LWRA 3U79A 4YZFE 5F3HA 1YYMH 3ZYOA 4PJGA 1I1YB 3ABZA 3G04B 2X09A 4EI5B 3LKQA 2QSCH 3MX0A 4HT1H 2FO4A 4LRIC 3RUGB 1PYWB 43CAA 3C5ZC 5CEZE 3RWEB 3NACH 5D70L 4MD5A 4OFDA 5A2LH 4JCMA 4LCUA 1F3RB 5B22A 1D5XA 4PJBE 5HD8C 4LSPH 4C56D 1WFNA 2DTSA 3I6GB 3UJIH 3BT2H 4HIHB 3O0RL 4KKBD 2BFVL 2NY1C 4KKAC 3MV9E 5EZLB 2XNAB 4HKJA 4CVXB 2AEQH 2AI0H 3QIUA 2I5YL 1R5IB 3QUZA 1ZT4A 2J4WH 2QQKL 4F7PB 4F15B 1I8LA 3SJVB 1CVSC 2ZUWA 4KC3B 5DZOA 4H5SB 2VUYA 2VR4A 4OCXH 5J6GB 4XP9L 2CK0L 5FYKD 3CSPA 3DGGA 1A4KA 2DS4A 3BUTA 1Q8MA 5D6DC 1MPAH 4XWOD 4P2OA 3WIIL 2XWBB 3QXWA 2ORBL 3BKCH 1Q9KA 5IR1B 2VN4A 5A1AA 4HGMA 2OSLA 1SEQH 4LAJH 4LNVA 1AO7D 2FJGA 3QQ3B 5DJ2A 4P4KC 3MRFB 4MDJA 1VSCA 2D7PA 1F4XH 4ZS7H 2BXYA 4JN1L 3QHZH 1ZLSH 3VH8A 1A9BB 3I50L 3OR6B 1XGYL 3B3IA 3QSKB 4JFFE 4RISH 5IG7B 5T33L 1IBGH 3A6BH 4ZDHB 3LEXB 2FBJH 4JFHE 4PS4L 1AD0A 5C0FB 2VWEE 2EXWC 4JM2A 5I0ZA 4WU7B 4NQVB 1A1MA 4LEXH 3P30L 4FXGA 5L9DL 1QNZL 3HI5L 1KJVB 5C0BD 1DSFH 3TZVC 2QSTA 1X9QA 5JXEC 4QHUA 4MQXC 4FOMA 4L4JA 3ARDB 4P5MA 4GQ9L 4RX4D 1CQKA 4F2MA 1KIPB 3GNMH 4RQQB 3GI9L 1ZHNB 3O8XD 4O5LL 5C0AB 4L3EB 5JQ6H 2ED9A 2XWJB 2FCBA 4K3EH 2F53D 2PO6C 2NTFB 1Y18B 1AGBB 3BSZL 3GO1H 3GIZL 1F6LL 5IJVA 2C26A 3BPLB 1NUFA 2C9AA 2XOTA 1KPVB 1BEYH 2BC4B 4I77H 5DXWA 1F11B 1U8NB 2ZUUA 3G6JB 5C70A 4G7VH 4PJ9A 4M1DL 5HYJA 3O6LL 3HG1E 2DQDH 2V17H 1YEHL 3FB6B 2CUHA 1CGXA 4NN6C 5DUML 2BX5A 4X4ME 5DJ0A 3REVA 3RGVB 2ZZUT 5ILTL 2R69H 3VFRB 3RPIB 1ZGLB 1UXSB 2ZSVB 5C0ND 5IMKA 3FFCD 5IIEA 3LB6C 4P99A 2A73B 4OV5B 2CKBL 4GAYA 2VZUA 5KAQF 2NY2C 3THMH 1S8DA 4K7PX 4KMTL 5EFIA 4WHYG 3BP4B 4M43L 2EKSA 2ZSWA 5DUBB 4PBXA 3HS0B 1XF5A 3AREB 2FD6H 3FOMB 4K23L 4JR9H 1MAKA 1NCDH 1D9KB 4BQBA 3TJHD 3T3MF 3QG7L 4HG4K 5EBWA 3CCHB 2J12B 1MWAB 3MLSH 3VFVA 1NCCL 4ZUSB 4FQLL 4AIXA 4ZSOE 4Z78A 4JLRB 3RJQB 2Y06L 4PYHA 5I9QC 3ZYZA 1KPRA 2NZ9C 3F7RA 2BOCA 3PWLB 1BD2E 3LS5L 1MCOL 1ZS8B 5DRZA 4XXDA 2BRRL 2LTQB 1WIPA 4Y5XB 2DI9A 3S4SG 4HAGA 5SWSE 5TDNB 3SY0B 2KQMA 5GXBB 2V5RA 4HK0B 4JVWA 3WLBA 2R8SL 4LCYB 1ROWA 5GS0D 3KJ6L 3R06B 3FT3A 2QL1A 1I3RA 3EFDH 1AIFA 2X4NA 3K3QA 2OK0H 1BFVL 4HV8A 4P9HC 2BNQE 3L9RA 3NCYP 1PY9A 3MLXL 2K9UA 4G6KL 4FFVD 5IQ7L 3IGAA 5EBLB 4PJHA 3FTGA 5IOPA 2QR0B 3LDBC 3QUYC 4TUKH 3W9EB 1JFQL 1PZ5B 3QEGH 1SBSH 1ZHBA 1GPOH 5ACMA 4EXPX 1LEGB 2HKHL 2WP3O 1BVLA 1UVQA 5EUKB 1U9KA 3H2WA 3BQUB 2Z93A 1E4JA 1T0NB 4DKAA 1B3JA 3P4NB 3ARZA 1RZ7L 2Q3AA 5I1DA 1FGVH 1T0MB 4LSQH 4KFZC 5E7BA 2OI9C 4Z7WB 5F7EL 1I1AB 1I85A 4CW1A 5D6CA 3WIHA 2M1KA 5FO7B 4WHTB 2VLJB 3BD4A 4UT9L 1BVZA 3PNWA 3RWFB 4JFDA 3Q5TA 4KDTC 4PP2B 3VI4F 4Z7QF 4UT7H 1JJUA 3HCVA 4O2EB 4F33B 4LU5H 3VCLB 3MOQA 1A6VL 1EUTA 3TO4C 3DIFB 2B1HH 1VESA 4MB5A 3PDOA 5ANMA 5BRZD 4QXTB 3TIEB 3KJ4B 3VFPA 3DV6A 2I26N 2VIRA 4YHOH 3KPSD 1HHGB 4HMDA 3RFZC 3O6FD 1H0DB 4GXUN 4HFUL 5J12B 1M71A 2JCCB 4WNQA 4IM8A 4UB0L 1JF6A 1QFWI 2P8LB 4Z77A 5BMFL 3FB8A 3MOBL 4HZLA 3T0VA 4KK5C 5DJ8A 4WW2F 1A7OL 4EDXA 3D9AH 4ORZC 2L7UA 1YEFH 3FB5A 5LCVL 1TETH 2R1XB 4EJ1C 3MRDA 3AS0A 4U31A 5FXCH 3BE1H 1J87A 4NSKB 3RX8A 3EOAB 1EMTL 2C3VB 2XTJB 2X4TA 5T1LA 1M4KA 5FUCC 1G9MH 3KG5A 2HKFL 1U8IA 4K71B 5DJYB 1EXUB 1YDPA 1IAOA 1KG0B 3C8KB 2NY4D 5IFJA 5KSAB 2AJ3A 4M4RA 4MX7B 5T3XE 1EHAA 4FQJH 3HRZB 5K9JH 3L95B 1YEEH 5ICYB 4JG1H 3MYJB 4XHQA 5DK0A 3LN4A 5FO9A 1C7TA 3LKOA 1TVBB 2EDQA 5C0GB 4UQ2A 3LSOB 4GRWE 1UZ6F 1WK0A 3VWKA 3S88H 4RDQF 4S1RH 3EOTL 1IFHL 2WUBH 4WI9A 2OL3A 2W9EH 1QRND 5MEND 5DZNA 3X13A 1OP3K 4PJDA 1GIGH 2VLJE 4HWBA 1XIWC 4JO2H 4LOUD 1TDQA 1YNLH 1UKTA 4FN0A 5IFAH 3BH8A 4ZXBC 3M8OH 2VLRD 2Q20A 2VXSL 1UH2A 1K4CA 3TP4A 1Q72L 4AYFA 3ZE2E 4KV5F 3CK0H 3Q6FB 2VLKA 3UJJH 3QNZB 1JPGA 4YHLL 1RUQH 2FHCA 4RWYL 2R9HD 3S4SB 15C8H 3DWTA 3S96A 1XEDA 2ZOLA 3KPLA 5E2JA 4C55A 4HGWB 2BNUB 1LEIB 3WJJC 1PQZB 4PTUA 3UTTA 3DROB 2D03L 5EZIL 1EBAA 5KSUA 3VXSB 3CFBA 1HNFA 1MLCA 1RU9H 4M5ZH 3TBTA 1KB5A 2VXVL 7FABL 2C7UB 4FTVA 4K94H 1G1YA 5IB3B 4HSQA 1UENA 3C9NA 2GITA 3HE7B 3I3EA 2PTUA 2HLAB 4FHBD 3MFFA 3WFCL 5HVHB 1F4AA 3O2DA 2X9WA 3PGFL 4OZGB 1SJEB 1QR1A 3C2SA 3ALWA 5AUMA 3ULVD 4V1DD 3SGJA 5CUSH 3T0DA 1R3KA 3TA3D 4BH8B 1MNUL 5C07A 4G6JH 4MAYC 4U6XA 4YGVA 3ZE0E 1QOKA 3GMNA 5BXFA 2NY1B 2R4SH 2IH3B 3WUZA 3H9ZA 4F7EA 4P3DB 1JZ4A 1BWMA 4PJ8D 1KXTB 2VL5B 3LS4H 1W0VA 4OLYH 1R5VA 1FBIL 4UQ3A 3SDAD 1MWAH 3TNMA 2YR3A 3T0XA 1I8MA 2KZ1B 5D8JL 4H26A 3SCMA 3CZFA 3D3VE 2WQRA 1FJ1B 5KVDL 4CBPA 4XNZB 4LVHC 3KYOA 4TSBL 1ZA6B 2A0LC 1GC1C 3RDTA 3GI8L 1EO7A 1U8QA 1RZGB 3VXTA 4XZUA 1A6UH 4LQFL 5EU6A 3RRQA 4U6HA 1WGOA 3CVHL 4RGMC 4S2SA 4QF1B 1MIML 3RVWC 5CP7A 2BNRE 1FL6B 3RHWK 3DMMB 2D7NA 4HEPG 4OCRH 4OLZL 1G7HA 1E28B 1MJJB 4R7DA 2EDDA 4HDIA 4ZAKA 3HB3C 4OKVB 3GBML 4D8PA 3GSNA 4DW2L 4QEGA 2P5EB 1H3XA 1KT2B 3L5WB 4I3RL 3DXAB 2YK1L 2PCPB 2DQFB 4NNXB 5CEZL 3B6SB 5CIPH 2ZKHH 3MUY1 4PJIB 3TZVB 5FAAA 4YAQA 5ISZE 3RWHA 1LILA 1MCFA 1T1YA 4OZHF 3RTQA 2CUMA 2BMKB 1KYOK 3SKUD 5E4EB 4LLMB 1D5BA 4X6BB 2QADD 5CLTA 1HDMA 5DJAB 5I1GL 1U95B 2VAJA 4MXWL 3BW9B 5K9OB 4F58H 4X5XA 4UTAL 4ZD3L 2KH2B 4MA3B 2P47B 4HIXL 3B4NA 4OZHA 1T2XA 1TVHB 4PREA 1JGLH 5GGRY 1ED3A 3E6FA 3HPJB 5DYOB 3MNZB 4NKOA 4TVPE 1MUJA 3P4OB 4G9FA 4BFIB 3GKZA 4XI5C 3MV01 3TWCL 4XVJL 3GMQB 2ZCKL 2DICA 4IMKA 3RBSA 1DLHA 1IGJB 4NKIH 3EO0A 1CG9B 3V4VH 1FNFA 1FH5L 4NRZB 4AZ8A 3HMWL 1YNKL 3ULUH 5SV4A 3V6ZA 1YZZA 1BFTA 5ADOL 3H42H 4AIZA 2Y72A 3B43A 1EHLH 4NWTL 5F6IB 2VQ1A 3B9DA 2CDEB 2NY2B 4Y8AA 3KNBA 4NZRH 3DX9A 1DBJH 1INEH 1HZHL 4JKMA 4M61A 4ESKA 2BY3A 3T4AB 1HWHB 1NH6A 2AK4A 5FCUH 1BF8A 2WBJB 2MPAL 3V6OC 1X5ZA 4N0CC 1QFWL 3VFGH 3O4LB 1XF3A 2I9LA 2VXUL 3BUYB 3KWWA 4HBQA 1LO4H 4FABL 2ID5A 2APVA 1NEZG 1ZHLA 5DRNA 5C09B 4J23A 1A9EA 5HVFB 4DEPB 3EO9L 4YDJB 3EYQD 3V0WH 2HFFA 5TF1L 1JHTA 1T66D 1HHIA 4MDIB 4Z7UF 3OGCA 4H0HB 3O4OC 1F45A 2HFGL 3KPRA 4L8SA 5HSFA 1C5CL 3WSQH 4MXVF 5E1HB 1RJYA 2HA1A 1L9MA 3SDCA 5DDHA 4ZFOB 1VEPA 4MD4B 3PIQA 5JHLH 3ECBA 5B3NA 4AIOA 1MRDH 4LLDB 3ZT7A 4PFEA 4Z7UA 2HRPL 4PYGA 5DT1H 3D0VB 5HDBE 4Z76A 3UTZA 2YSSA 4RCAA 4Y19B 3QAZC 3PWNB 2RJMA 4QHKJ 2DLEA 5EU4A 4MSWB 1GJIA 4HKBA 3MRKA 4P2RD 1TCRA 3SKMA 4JRYA 5E9DE 1F8TL 4GG6F 2DD8L 2AQ3A 3U7YH 2X42A 1Q0YL 4I3SL 4O9HH 3V7MA 4NQDB 1KPUA 1YJDH 1HINH 1Y6KR 3U4EA 3LDBB 3MJGX 4MNQE 4E41D 3O45B 5DGRA 4ZFFB 3OKOA 1VFUA 5MP6L 4X7CC 1YEKH 4TUOB 4MAUH 5GJSH 4L8CA 5JW3H 3FO2B 4GG6A 3RKPA 3IF1A 4KVNL 3SDXE 3JV6B 2DIJA 2MWCA 4U49A 2DJUA 3QBTB 3O3BB 5H35B 2DM7A 2VDPH 4HWZB 5DUPL 2OI9B 3UTPD 4BQ8A 2XG5A 3CFCL 3L5XL 1IGCL 3BHBA 4EVNB 2MOVA 4GRMA 4NBZB 3IDXL 5T1DH 3HMXL 3WFBL 2YPKB 4OCNC 2MTPA 3L3DA 3C08L 4P5KB 1OAQH 1JUFB 3SGDI 2OR8A 4R8WH 1BAFH 1BMGA 2EH7H 3IETB 4OCWH 4N8PA 3B9AA 1N8ZA 1MCQA 1NSNH 4JRXB 4N0UB 3TCLB 4R90L 4ZOCA 3MODL 1T4KA 3QP3A 4MVBD 1F02I 3GKWL 4KI5D 4LNRB 3AY4A 4HLZG 5KS9A 4RWHA 3UC0L 5D1QB 3K4ZA 4IMLB 1A6ZB 4D0BA 5GZOC 1MCLA 1XGTB 1R3LB 3VXRB 4B0MM 1GVIA 2XRAH 4A6YL 3MMEA 1D5IH 1A7PL 1ORQA 4QRRB 1VFBA 1UH3A 5F1NB 4D0DB 5DJ6B 4HS3A 1OGAE 1RURL 3F58L 1ZSDB 4ONGL 2V6HA 3N9GL 3QNXB 3SE4A 3WIFB 3FQXA 3MRPA 3QEQB 3W2DL 4I2XA 4PJCE 1AGCB 1GGUA 1IM3B 1DCLA 4HHAB 4EI6A 3I84A 1JNJA 1T6WA 3U1SL 3BP7B 2OYPA 5IEHA 3BPNC 1T22B 2AXHA 2B1AH 4GKSA 5E24E 4PJ7E 3GK8H 1JGVH 3QFJE 1FO0A 1JWUA 4KZDL 2ZUVA 2Y5TB 1F6FB 3QJHB 3PJSB 1YEJL 5EO9B 4OIIL 4Z95H 5DGQA 4LPWA 2QSVA 4MCZA 3GJFH 4ETYA 4FP8L 1XGQB 1HQRA 4XP4H 4WCYH 1IT9L 1NEZB 3HE6C 4LPUA 2J3SA 1DDHB 4FQQB 4ZXBB 4WO4C 3BZ4A 5IESL 5KN5B 3G5XA 1HYSD 1EFXD 4NNPL 1JE6A 1BIIB 2ITCA 4Z5RA 4DN4L 3KXFA 3BRDA 3P9MB 4DCQA 4IS6A 1X5XA 3MRMB 4ZG1A 3S5LG 1JWMB 3G08B 3HNTL 2Z9TA 3UTQA 3VWJA 1PD6A 1ZT1A 5DHXB 1WIOA 2R1YA 3S7GA 3BIKB 1EJ6A 2DQEH 5DTFA 3I6LD 4P4RA 3T2PA 5IHZA 5IV2B 5E8NA 1BFOB 4OF5A 4WI5A 4N8CH 4P59L 1MRCH 5KVGH 5FF6A 2HJFB 1MF2L 2YPLE 5GS1B 2R39A 4H1LG 4I0PB 1YPZB 1KEML 4XB7A 5JW4Q 4XCYA 4X99B 3KS0H 2B39A 2BVOB 3LQZA 4NKMA 4DUVA 2ZP0T 4TRPH 2OJEB 1IGIH 3ZYJA 4R3SB 1LP9F 4CVZB 1A7NH 1B4JH 4U1MA 5FHBH 3LIZH 2HWZL 1UJ3C 5EUOB 3UPRA 4PBWD 1WBZB 1CXEA 4OCYH 1EAPB 1QO3A 1DQJA 3X12A 4MAYB 1ACYH 4AK1A 2J88H 3TF7C 3WD5L 1FNAA 1XGRA 4QHKI 1LP9A 1N59A 2R0ZH 3LQMA 1MREH 3VFNA 2A2QT 2GY5A 2G60L 1NCBH 1IEAA 3IXTA 1MFDL 4GUPB 3ARTA 4L8BA 4YZFF 4C56B 1RD6A 3QDMD 4YXLL 5JIHA 3WKNA 5CEXA 4LVHB 4M8QB 5ENWB 3I9GH 3B2UD 4L9LC 1E0OB 3TPKA 4H8WC 4KXZI 4XC3H 4IRSD 4PJBF 3D87B 1F6AB 5CS7A 2BY0A 2PW1B 4PGDA 1NBZB 4GKNA 1ZA3A 2MSPA 3ZSTA 1W72B 1Y0LA 1X7QB 3C60A 5F1IA 3RVXC 3FO0H 3U2SA 3WS3B 1NGPH 4RGNE 4K3JL 4P9HH 4S1QH 1NFDA 3HC0B 4M1CD 4X4ZA 4ZUUB 1IAKB 2IAMC 1MFBH 2GJ6B 5DEZA 4YK4C 2CIKB 4MXQD 2AGJH 1IKNA 2A9NL 2XYCA 3RA7L 3O3UN 1INQA 2Q1EA 1QLRB 4QXUL 1H3WM 4PJAB 3RIFF 3H3BC 4KK8C 1RZFH 3H9SD 2GFBB 5C0EA 1AO7B 5BV7B 4YWGL 4TNVF 2R56L 1Z0NA 3HAEG 1N6UA 3B2VL 3LZFH 3PQYD 4GSDH 1L6XA 1S7SB 3RVTD 1KFAL 5F72S 4I8DA 4Z7VE 1JCKA 4ETQA 1A8JH 2ZNWA 2Y23A 3O2WH 4XCFH 1NUDA 5D7IA 4G8GD 5EC2A 1I1FB 2CH8A 1KULA 4RNRA 5IBTL 4QHMB 1ZEAH 4PRPE 4P5TD 3WYRA 5C0BB 1FIGH 1GGCL 4NUGH 2CPCA 4UV7H 1KYOJ 5C0IB 5IROA 4KHTL 5GHWL 3DVGA 2CLVB 1Z3GL 3SKOB 5IW1A 1G0DA 3ZKND 4LHUA 3O8XB 4CDGC 3S5LB 3BWAA 1CN4A 2F53B 2RQ8A 3P0YH 2DLIA 3LKPB 1T20A 4ZO8A 4FNLH 4IDJH 2EDBA 4JFFA 3HN3A 4U1IB 2AJXL 4XVTL 1WICA 3RZCD 4WI6A 2J8UE 2IQAB 3QDJB 4CL7A 3IKCB 4YBQD 4KJQD 4PRID 1HE7A 1ZGLP 4JZNA 5DRXB 5GGTH 4EIGB 5DRWA 3QNYB 3RUGA 1PYWA 1N64H 4H1LB 2VYRE 3RWEA 3AMLA 3U0TA 5ADPL 4Q9QH 2Y6SC 4FS0A 3LVEA 4Z9KB 3I6GA 4HIHA 3FFCB 4FQ2H 5EZLA 1PBYA 5I6XB 4PJAE 1JGUL 3F7VB 4LDEB 4KZEH 4CVXA 4NZJA 1R5IA 3WMSA 3TVMC 2QV2A 4F7PA 5H2BA 5J1AB 3HC3L 1UM4H 1YY9D 3BGFB 2X4SB 4HK3N 4W4OC 1BZ7B 3SJVA 2OM5A 3WNMA 4HCRL 1INDL 1T6VN 4KRLB 4U0QB 4Y2DC 3MJ9L 5F1SA 4M6OH 5J6GA 4X4MA 2HJKA 4NN5C 2C3GA 5I75C 1AFVL 1K8DB 4BFEA 3JWOL 2N7BA 2FSEA 2XWBA 1KTDA 1CDIA 4KVCH 4HC1H 4EN3D 4AEIH 5IR1A 5AYQA 3IDNB 4PV9B 2P4AB 5AD0B 5J9PB 1V7NH 4TVPL 1NLDH 3QQ3A 3OXSB 3MRFA 1E4XH 2IQ9H 3K4DA 1JPFB 1RI8A 3O6ML 3WEXB 5FGRA 3VD7A 2AJVH 3GSXB 3PHOB 1HHKB 1A9BA 3OR6A 5IG7A 2PNDA 4QRSB 4ZDHA 4WFFD 3LEXA 3IU4H 4WFHD 1CD1B 5C0FA 4C4KT 2MCPL 3ZMRA 4GAJH 1JPTH 1AP2B 4NQVA 3JUYA 1KJVA 2FX8L 4HWNA 5FYJU 1C16B 5BO1H 4R7NA 2VABB 3HMXA 5DQ9B 4GKZB 3ARDA 3R1GH 4M7LL 1S9WB 5GGQH 3KAAA 4PJFB 4RQQA 2MCG1 1ZHNA 5D7JC 1ZANL 5C0AA 2D4FA 2XWJA 4YFEA 5IFHH 3RY4A 3UROR 2NTFA 3LKNB 3T0EE 5L2KD 1AGBA 3FFCE 1BD2A 3KDMB 2UY6A 1CR9L 3HAEB 2ZUSA 3MRRB 1U3HC 4AENB 1NAKH 4WEBH 5MEOB 4LVOC 1KPVA 4UIMB 4M48H 5D93C 4F7TB 2BC4A 2FGWH 3SHSA 1E6OH 3QI9D 1U8NA 5F9OL 1F4YH 1S5IH 3QUXD 3H9HB 4XAKD 1AE6L 2VDNH 4JDTL 3FB6A 1YNTB 5D2NB 5DZLA 5EWIL 3RGVA 4BA8A 5AG8A 1QLEL 2BNQA 2CJUH 1UXSA 1DFBH 2ZSVA 4LRNL 4WI2A 4NYLB 4F80A 4XTRC 1HI6B 5DEGB 1PW3A 5JXAH 4L29B 2KQNA 4JQXA 4JY5L 4GH7B 1OD7A 4LSTL 3KYNA 1QFUL 2A77H 2X89A 1FCCA 3A67H 5B4MD 5BRZB 2F74B 4Z8FL 3KPSB 3O6FB 1WF5A 1FGNH 1XH3B 4JHWH 1NL0H 2EDWA 1LE5A 5EO1B 3OJDB 3BP4A 2APFA 1W72H 2YS4A 1FDLH 2XN9D 3FONB 4QHLB 4UIKH 2XZQL 3HS0A 3AREA 1N4XL 1WT5C 2W07A 3F5WB 3FOMA 1OAYH 2WWMD 3PP4L 2IGFH 2JJWA 1IZJA 3BPNB 2X2YA 4MNHB 1R5WB 3C87A 3RX5A 3CCHA 1QBLH 3OKKB 1MWAA 4QRUA 3ZL4H 4PJFE 4ZUSA 4D0CB 4OB5L 4JLRA 3VGAC 3DO7B 1CLOL 2VKWA 5GRWA 1V8HA 3GJEA 4NCC2 4NZUH 2P43B 4LIQH 3MBEC 3PWLA 1U36A 3AM8C 1ZS8A 3BZFB 4NCC1 3BX7C 1VFOA 2NY4B 4G7YH 4ZTPH 1JNNL 5ALBH 5TDNA 5KW9L 4WO4B 3SY0A 5DQDH 4GAFB 4HK0A 1U8MB 3W0WE 3WNNA 3ZKQD 4LCYA 3R06A 4PP1C 5ID0B 1FAIH 1CDCA 3DX7B 3V5HB 5IF0B 5I19L 3N1QC 5A43C 4S1SL 3VMPA 2R0LH 2RHEA 4FZEH 4XNYH 5MENB 5E8EA 4DUXA 2CGRH 3Q48A 2XY2A 4O2CA 1QPXA 5EBLA 5FIEA 3DHMA 1UQSA 2QR0A 4AMKH 3W9EA 1PZ5A 2VLRB 1AKJD 3QWQB 4KRNA 2VE6B 1LE9B 1JGEB 3ARSA 3B5HA 1P2CB 1IQDB 1QHPA 3KPNA 3BQUA 2R15A 4UBDD 4TULL 1T0NA 2Q8BH 3P4NA 2O5XH 3DO3A 2E7BA 2JIXD 3QUMB 3SQBA 1Q94A 1T0MA 3C6LA 3V6BR 4Z7WA 4HH9B 5D5ME 1I1AA 3TBSB 2VDKH 3ZE2F 5FO7A 5I15L 1YMMD 3OL2A 4WHTA 1FQ9C 4J6RL 3VFWB 2EC9T 5CJXA 4YE4H 2VLJA 1SHMA 3TPUB 3VD3A 4H25B 3RWFA 2OTWA 5L7XH 1QFPA 3IVKB 1KB9K 5I66B 1ULVA 3MLTB 5F88A 1S78C 4O2EA 2NY6D 5C2BL 3CH1B 3MOAH 3VCLA 2PW2B 2NX5B 4YHMH 5GSVB 3DIFA 2M2DA 4OM1H 4XCNB 3TIEA 4JZJC 3O81A 3FT2A 2AW2A 1HHGA 1NGXB 1OPGH 1G9NC 3H3KA 1EO8L 4J3SA 4HPOH 2JCCA 1OTSD 2P8LA 3MQIA 1J0JA 1RZ8A 4KTEL 4V1DB 3LHPL 1FZJB 1CGWA 3TA3B 1MCPH 4ODUB 1I7ZB 2PTVA 2R1XA 4MZ3A 5A16B 1QRNE 1OAKL 2EXYD 2V5TA 2X4PB 3EOAA 3BFOA 2HH0H 4PRDB 1G6RH 5GRUH 4EBQL 3PUCA 4PJ8B 3S36H 4U1LB 3QCUH 4O4YL 5HI4D 3SDAB 2VMFA 3G6DH 3ZE0F 3SPVB 1KG0A 3QIUC 3QUZC 3C8KA 2BOBB 4WRLA 5KSAA 4MX7A 2DQHL 1I8LC 2LU3A 3HRZA 4N5ED 3L95A 4X4YB 5ICYA 5GGUB 4NO0D 4QXGL 2OZ4A 5CZKA 3MYJA 5I18L 2IAMB 1TVBA 5C0GA 1H3PL 1GAFH 2VH5H 3FN3A 4R4NC 5INDB 4QRQB 5K9QI 1QKZH 4P2OC 5GPRA 1LD9B 3F62A 1IC5L 1BLNA 3L6FB 2EYSB 1JI2A 3DV4B 5EN2B 1NGYB 5HHOE 3PHQB 4L4VD 4NFBA 1QSFE 3STZB 4HUMB 4HWUA 3D3VA 3FO1B 5JZ7C 3Q6FA 4GW5B 3QNZA 4YQXH 3HAEH 1F3DH 1CQYA 3FN9A 4NC1C 1X6NA 1FV1B 2BP3A 3S4SA 2ARJQ 4JM2C 4JPVL 1NC4A 1UGNA 4WDIB 3OPZH 1PG7W 4NWUH 2ARWA 2BNUA 4DJMA 4V1DE 1PQZA 4I48B 1RIVH 3V0AC 1UJTA 3QFDB 4WWKA 1R3IH 1KN4L 5IP4A 2YN3A 5T3ZD 2QQLL 4X9GA 3VXSA 2QADB 3MXVH 1NDMB 4DAGH 2QSCL 4HT1L 2ZG1A 1H3UA 2C7UA 4ZOBA 5IB3A 4HWEH 3BPCA 1NFIB 3QQNA 1KLFA 4XMKL 1ZLWH 1CE6B 2H45A 3HE7A 1FIEA 2HLAA 4LSPL 3E1F1 5E5UB 3B9KA 3DTXB 4QYOB 3BT2L 3LRSA 1SJEA 1MCCA 3OKEB 1FFNA 5I8CB 4FFWC 4UINH 4PJ9C 3TJEL 4LGSB 5ISZA 2Y4SA 1NMAH 1DBKH 2AI0L 3QIWD 3PV7A 4U1NB 5JO5B 2J4WL 5C6TH 2DMKA 3IDJB 2XWTB 4BH8A 5I30L 4XP1H 5TE4L 4C4KO 4N1CA 3QHFL 4K3DL 3ZT5A 1WBYB 1GH7A 3GSOA 5GRYA 3WJLA 4P3DA 5FFLA 2PXYA 3FB7A 1PSKH 3TVMB 4XMLL 1FNEB 1MPAL 5I1JH 3BISA 3VRJB 3FRPA 1T5WB 1FL5B 1XGUB 4M6MH 4TNWF 3BKCL 1N0XH 4Y2DB 1FJ1A 2C3HA 4DK3A 1FZKB 1SEQL 3BO8B 4NJAL 4JO4H 3DVNB 1ZA6A 1T7VA 1MCKA 1V3LA 5CHNB 1JZ6A 1F4XL 1ZLSL 3QHZL 4X98A 1NMBH 4R2GD 5HDQH 1NCAH 4KK9D 1IBGL 4FXKA 2K7PA 3QB7C 1B88A 4QF1A 1YQVH 1XGPB 1QTYT 1FL6A 4AEEA 5DD3L 3DMMA 5EOCH 4LEXL 2YD5A 1E28A 1MJJA 3CXDH 5F6HJ 1DSFL 5L2JB 3CLEL 4KJPD 2HN7B 3BEWA 4KKLC 1OP5H 4OKVA 2ATKB 5SWZD 2P5EA 4LFHD 3RY6A 3GNML 4KKCC 4YC2B 1I3UA 1KT2A 1PKQB 3BDBA 4IRZH 2PCPA 5DJCB 5JQ6L 2DQFA 4IIQB 4K3EL 4NNXA 3B6SA 5FDWB 4OZIE 4X83A 3TZVA 3RI5F 3GHEL 3BDYL 3WL9A 2NYYD 5EBMB 2D31B 4I77L 1MI5D 4V2BA 5HDBF 4FQ1H 3KLHD 4P3CH 4LLMA 4X6BA 3RL1B 4G7VL 5JR1H 2BVQB 1Y6NR 1QLFB 2DQDL 2AXGA 4XBEL 5DJAA 4E41B 5MHSD 1U95A 3SOBH 3UYRH 4HS8H 2BDNH 3SE9L 3BW9A 1LO5B 3GSVB 5K9OA 2KUTA 2V2TB 4QHNA 2R69L 5FV2A 1QBMH 2P8PB 4MA3A 2VXQH 4F57H 2Q86B 1TVHA 4D2NA 4DQOL 3CLFH 3S34H 3GHBH 3HPJA 5DYOA 3E3QC 4KJYB 4YXKH 35C8H 1JZ3A 3FZUD 3GSWA 3P4OA 4PRAA 4BFIA 5DFVC 3GMQA 5SV3A 3SO5A 3SDXF 1IGJA 4PB9L 3THML 1I85C 2OQJB 5TPWH 1A3RH 1CG9A 2B0SL 2EDJA 4NRZA 5EU7C 4DGVH 3MJ6A 3ULVH 4FQCH 3GFUA 1NANI 4MNQA 4HKXB 5C1MB 4XBPB 1Z9MA 3RKDD 4M1GL 2H6PB 5BJTA 1K9TA 5JIPA 1EERB 2FD6L 4QT5B 4HUWB 5BQ7B 4H8WH 1NCDL 4N0FB 4UAOB 3M1BB 3T4AA 3NCBB 3WDJA 4OLXL 4A2LA 3S37H 5EC1A 1J0ZA 1R3JB 5DD0H 1E4WH 2WBJA 3N1FC 1OF2B 5HTSA 1L7IH 4EOWH 3A0OA 3IJSB 5BZDB 4AEHL 3O4LA 1MCHA 1XF4B 4MQ7B 4YR6B 2EZ0D 1JPSH 3VDBA 4X8JA 1II4E 1SY6L 3T04D 2K7QA 4ODSH 2P1YA 2VC2H 4CNIB 4P2RE 3VGFA 1DVFD 3RQ3A 3K8LA 3V2AR 2EYTB 3MLYL 1KNOB 4MDIA 3ILQC 1VPOH 3LPGA 5K93A 4OLWH 3HNSH 4PY7B 1IKFL 5CILH 2RBLA 1ZMYA 2E6JA 3EFDL 4CADB 3VMNA 3I6KB 2OK0L 4ZFOA 1A21A 3RWCB 2EC9U 1U58B 4YNYB 4WW2C 1HXYB 1HSAB 4YDKL 4LLDA 4KU1A 3D0VA 4PPTA 2ZCLH 2JKXA 1Q9OB 1AQDB 4MA8H 4MMZC 1J8HE 2P7TB 1X4ZA 1BM3H 4TUKL 3DETC 4Y19A 4PRHE 3QEGL 4AEFA 3GSUB 4LBEB 3MV7E 4MSWA 4XHJD 2Z8VC 1KCRH 2IANB 3L3KB 5KVEH 4L4TD 3VWKC 4PJ7F 1RJZB 4OLEA 4M93C 1S9YA 5HHNB 1IAIM 1FGVL 4WTZA 5DMIH 4CJ1A 3O45A 4JPWH 4YDLC 4ZFFA 4ELMB 1EFXB 4MJ2A 1R0AH 5ESQB 4TUOA 5JA9A 5EU3B 2A6KB 5IB2A 1CL7H 1ADQH 2V2XB 3B8YA 1KCSH 3BEVB 3JV6A 3UMTA 5DVMA 4WFGE 5EZOH 1SYVA 3L7FB 1G7PB 3FRUB 2VDRH 5H35A 4KI5E 4UT7L 5FA4B 2XXCB 4HWZA 3QDGE 5FGBA 5CZXD 2B1HL 3UO1H 4YLQT 3H7LA 1NAMA 4KPHH 2UYLA 5J3HC 3IS1X 4P5KA 1JUFA 1IJ9A 4C83A 4ZFGH 1PFCA 5KSBB 1YN7B 5CSZA 3NPSB 3ELAT 2F9BT 3IETA 1KTKE 5DEFB 4HIJB 3VFOA 3BKYL 4JCLA 5JHDD 4N0UA 3TCLA 2KPNA 3HZMB 4OI7A 1P4BH 3D9AL 4NKQB 1Q9LA 1YEFL 4AT6B 1TETL 1UWGH 5F6HI 3BE1L 4LNRA 3MRJB 5AAWA 4QWWD 4DGYH 4PJGB 4XVUD 3KS0J 5D1QA 4EUPG 4K9EC 1MEXH 4IMLA 1A6ZA 2YEZA 2FO4B 1G9ML 1XGTA 1R3LA 43CAB 5KAQG 3VXRA 2EDLA 4LCUB 1S7VA 3NGBC 3NN8B 2P8MB 3SGJC 2XTLA 1VADB 3TNNA 4Q2ZB 4N0YL 3VXOB 4QRRA 2SEBB 4AJ0A 4FFZH 3WE6B 1FAKT 3INUH 4FQJL 5DJ6A 2N56A 4GOSA 4D0DA 1FFOB 5K9JL 1YEEL 1DBML 1ZSDA 3QNXA 3AAZB 3QEQA 3ARXA 3WXVH 3KPPB 4HKJB 5DJXB 4CU7A 4HHAA 3S88L 1FYTD 4S1RL 4K8RC 3RIAK 1CU4L 3IAGC 3IFLH 5DA0B 3ARQA 3QDMB 5GIRB 1T22A 2J6EL 2E5EA 4YJZL 3SCMC 1FSKC 4JO2L 3U9PH 4CN6A 1IILE 1UXWB 2Y07H 3PJSA 1CD8A 3M8OL 4IRSB 1W2KT 4POYA 3RDTC 3I6LE 1KJ3H 3VRLE 4C59B 1XGQA 3EYFB 1NEZA 1UT9A 3CK0L 3FJTA 1ZWIB 3UJJL 3MV9D 1RUQL 2G5BA 1DDHA 4FQQA 4NQCE 5EIVA 4ERSH 1DL7H 3QHTC 3SGEI 4RFEA 15C8L 5KN5A 3WDIA 5KSBE 5D7SH 3VFMB 3T65B 2UUDH 3P9MA 3T2QA 3MRMA 1A5FH 4ZAKC 2A9MH 4CJ0A 1JWMA 3G08A 3H9SB 4G6AD 4P23D 4MGXA 1SVZA 4R97C 2ESVD 4RMSA 5FYLH 3BIKA 1RU9L 4M5ZL 3MLZL 3DUHA 3PQYB 4LCWE 3G9VA 5AWNH 4A2MA 4MNGB 4K94L 2FATL 5DD5H 2OR9H 1KXQE 3QPQD 3UZVB 1BFOA 2W0FA 3D1MC 2HJFA 1MJ8L 4XC1L 5ERWA 4G8GB 4L1HA 5GS1A 4I0PA 3RTQC 4F37F 1YPZA 5KSVB 5ACZB 4ZUTA 4P5TB 3U36B 5HHPB 3MJ7A 1S7XB 1DBAL 4Z7VF 4X99A 3VA2C 4LGPB 1PVHA 5CUSL 3KGRA 5GGVH 2CRYA 1JGDB 2BVOA 3PHSA 4G6JL 3RNKB 4JFHD 3Q3GB 4TVSa 2OJEA 4K3GA 4NP4H 3ZHKA 3L5JA 2GJZA 4R3SA 4CVZA 1FC2D 2R4SL 2A6IB 1TJIL 4RMRA 3CDFA 1KGCD 4M4PA 1RULH 3RY5A 2G75A 5DJ0B 2DDQH 3RZCB 3SE8H 5I8OH 4GMSL 1FLRH 1JV5A 4IMKC 2CRZA 1A7RL 4X4XB 4L3CA 4PRIB 2NY3D 2G5RA 4KJWC 2AS5M 4IRJD 2D7OA 3OSKA 2NR6D 4HLJA 5C0RH 2J8UF 3V5KB 3WBDA 4GUPA 5HHMD 1TENA 4H20H 1U93B 4C56A 5J6HB 1Z6JT 3UYPA 2GCYA 2GUOB 3QJFB 4WEMB 5E03A 4LSDA 1S8DB 4M8QA 5ENWA 1FPTH 1QHOA 3HG1D 3ARUA 2EE9A 1DQDH 3EDFA 1BJ1H 5TE7H 1JYXA 4OCRL 1MHCB 2ZSWB 2J8UA 4ZUVB 1F6AA 4EUPB 1ZTXH 4ODHH 2PW1A 1XF5B 1NBZA 5E2TH 3TN0D 1W72A 5I76B 1XT5A 3D39E 1X7QA 2GSGB 2FR4B 3WS3A 4PJAF 2R2EA 4PLJD 3BPOC 3TLRA 4PTTA 5HDOA 2YD9A 3NMEA 1CXLA 5DC0A 4X6CE 3V5DA 3HC0A 3VG9C 4ZUUA 1IAKA 1LDPL 2ZKHL 4Z78B 1WITA 2CIKA 3U30C 4L8SC 4RDQG 4QOKE 1CFVL 1KPRB 4HXBH 5DI8B 4R2GC 1IC4H 4EN3B 1F00I 1QLRA 3SDCC 1CDHA 4PJAA 2YBRB 1GZQA 2VDQL 5AZ2L 2GFBA 1TZGH 5I74B 1AO7A 4WHCA 1RAMA 3OAUH 2OBGA 3ETBF 3FT3B 5IT2H 4FMKA 1OP5K 2C4XA 1QG3A 4HV8B 4X80H 5DMKA 3VXMD 1JGLL 1I1FA 2PYED 2NW2A 1RMFH 4QHMA 3MLWH 2EEBA 3FTGB 3NCEB 4W4NA 5C0BA 4NKDB 3TIDB 5IOPB 4DKDC 5C0IA 2IPKA 1ZHBB 5IQ9B 4NOBA 2CLVA 3ARFD 3SKOA 4RX4A 3V4VL 1ZXQA 1UVQB 4Q9RL 1RZKC 3O8XA 3QO1B 5HDLA 5SWSD 1XMWA 2APBA 4X6DE 3ULUL 4JANB 4WGWB 2F53A 1MCSA 1P69B 3LKPA 5C3TA 1EHLL 3MCKB 1G9NH 1H3GA 4U1IA 4MHHG 1AR1D 5MI0C 2EYRB 4NZRL 1INEL 1UM5H 1Z9OA 4CW1B 2IQAA 8CGTA 5C2UB 2YKLH 2I9TB 3Q0HA 4F7CA 3QI9B 5FCUL 1WLHA 5DRXA 4UILH 2WIMA 4NT6B 4TSCL 3QNYA 4TSAH 3EOBB 1PEWA 4H1LA 2PN5A 1JN6B 3I2CH 1CYGA 2VKXA 3RVVC 2E7LA 4OF8A 4DKFH 4QRPE 4WUUE 4N8VG 5TGBB 5HYQA 4LVNB 2DM2A 3MR9B 4GO6B 3V0WL 1P4LB 2VIRB 2WINB 25C8H 2BSSB 5D1XD 3FFCA 4D9QE 3C2AH 4H0IA 5IVXE 3V52H 3AY4C 3MA9L 5A3IC 1ZLVK 4LSVH 4WNQB 3WSQL 5EOQH 4Z77B 2UWEE 2WBWB 4Y16D 3ZDZE 2RFXB 5J1AA 4C58B 2X4SA 1BZ7A 5F70A 3LY6A 4HW6A 1YQ2A 2IPTH 5JHLL 2H3NB 3MRLB 1F5WA 4WFHE 5FGCB 4HGKC 2DWDB 3MRDB 2ILLA 3QCTH 2GEEA 3QA3B 4LAQH 4YBHA 4P2CG 4TTDD 2XN9B 5DT1L 1F4WL 3W39B 5T1LB 2AAVA 1K8DA 2EE6A 3L3HA 3EKCA 3SE4C 4ODWB 1LK3H 2DKUA 3C6SB 3S35H 1IAOB 4D9RD 4WW2B 4G6ML 4UT6H 3TM6A 1A14H 3U7YL 3MUJA 1MFCH 3MNVB 5EORL 3IDNA 4PV9A 4G3YL 3S6CA 1RHHB 5J9PA 4KMQA 1YJDL 3HI6H 2DTMH 4X7DC 3BN3B 3VD4A 3OXSA 5DO2C 1JPFA 5FO9B 5L2KE 5CKAA 3LKOB 4QTIH 3PHOA 1HHKA 1YEKL 2Y36H 4Y4FD 4MAUL 5GJSL 5JW3L 5IB1B 2OL3B 4PJFF 1CD1A 4IOSD 1T80A 4PBVC 3C09B 4G9DB 4WW1A 2DMBA 1AP2A 1FORH 2VDPL 1OAUH 4HJ0D 1PG7H 3BH8B 4BZ1H 1C16A 4MJ6B 1T2QH 5DURD 1SMAA 2VABA 3FL7A 5DQ9A 4MWFA 4GKZA 5C9JA 1S9WA 3WKML 4M7KH 5C6WH 3KYAA 4U0RC 1GXEA 4PJFA 5CGYD 1K4DA 1A7QH 3K74B 5EZJB 4R8WL 1BAFL 1VHPA 3VWJC 4JKWA 3KDMA 4I3GA 4OCWL 1AKJB 5SX4I 1NSNL 2ZOLB 4UOJA 4D9LH 4LLWB 4UIMA 4OZFG 2ICCA 4F7TA 1K2DA 3UTTB 1A2YB 3BN9C 2JIXB 3NH7L 1EHXA 2DLGA 2MFNA 3JWDL 3JTTB 5D2NA 1BWWA 3TBTB 1CE1H 4OF0A 1A3QA 3U7WH 3WLWD 3OAZH 2XN9E 4LVEA 4OQTH 3DX6B 2FZ3B 3GDBA 2DLHA 3M17B 4NYLA 1HEZB 3UTSD 3JVGC 2O26U 1D5IL 5DQJB 5J1SC 2LVCA 5DEGA 4YPGB 5B39G 4NC2B 4KY1H 3TH3T 4ZFZB 2BVEA 5CINH 4GAGL 2M8XA 4L29A 5D5MF 5FKAB 3MC0A 2NTSP 3G5VB 3TYGH 1WCBB 3ARGD 3LV3A 5E99L 2DLFH 1YC8A 3VFUB 5AUMB 5BRZA 2F74A 2APXA 1R3KB 4J4PD 4ENEC 3KPSA 2EIBA 3TESA 3O6FA 4PJ5D 5HGAB 2OCFD 3BYYA 1XH3A 4DKEL 5EO1A 1JGVL 1AJ7L 1HYRC 3FONA 4QHLA 5L6YH 4KROD 4F7EB 2WZPD 3VXUD 3F5WA 1EPFA 4Z95L 1W0VB 1BZ9A 4UZGA 1JRHH 1ND0B 3V6OE 3T8XB 1R5VB 4K7FA 3QXTA 3OR7A 4HUVB 3LN9A 32C2B 4N8VB 1I8MB 4FQXD 1QFOA 4H26B 4HJJH 3SDYH 3SCMB 4W6XB 1MIEH 4BK4A 2XI9A 1BHGA 4O02L 5IM7B 4M3JA 1CFNB 1CFQB 1A6WH 1KEGH 1FL3B 4X9FA 4BUHA 1H15B 4BZ2L 1U8QB 4LFHG 3BZFA 3HUJE 5JA8B 2OLDA 4ALAL 2DIBA 3F7YB 2VITA 4JDZB 2X70B 3C60C 5D1ZD 1U8MA 4NO0B 3MACH 2PTTB 2Q7YB 2DQEL 4R26H 1JZ2A 3ZSSA 3IKKA 3ISWA 3V79C 1OB1B 3DX7A 3V5HA 5IF0A 1M7IA 4R7DB 1LO2H 5JIIA 4N9GA 1QRNA 5C92A 4N8CL 1HCVA 1IKNC 1MRCL 3GSNB 5MENA 1YMME 4KUZH 2Z31D 2YMXH 3F12B 3E8UL 5F44A 3LKRB 4J12A 4CN1A 2VQUA 5M95B 2VLRA 4TYUA 3STLB 1LE9A 2UUDK 4NCDA 4XRCB 5ID1B 1JGEA 1P2CA 1IQDA 3PGCA 4PG2A 1J12A 1Z9LA 3RWHB 1YY8B 4YXHH 1P4IH 1IGIL 1MHEB 4LKXB 4GMTH 1A7NL 1B4JL 1I9IH 2BNRD 3QUMA 5DSCB 3MRGB 1JIBA 3LIZL 3QH3B 2YD8A 4Y1AD 3QEHB 3WIHH 1RUMH 2JJSA 4HUUB 4J3UA 4QO1A 4HH9A 3RWJB 4AG4H 3TBSA 4URTB 1L7TL 2E7HA 1BBDH 1F3DJ 4KGJA 3VFWA 2J88L 3KR3L 3O11B 5IROC 5KVMC 2HT2C 3TPUA 4WY7H 4H25A 3IVKA 4OZHB 5I66A 4N1EA 1DN0B 4PREB 3MLTA 1MREL 1U8LB 4YX2H 2O5ZL 5IHUH 3MREA 3W5NA 1WFUA 1JMXA 2CKBB 3MBXL 4NKOB 4Y8DC 3OJMB 4HFWB 4G9FB 4P2QE 2VXTL 3P9WB 1BQUA 1N2RB 1NGXA 4F7MB 4OZFB 3I9GL 4B5EA 1FFRA 2HT4C 3OKMA 1EGJA 2YXMA 4XC3L 3QIWB 4V1DA 2E7MA 3P0VL 1FZJA 1P7QD 5EIQA 3TA3A 1XR8B 2DQIH 4X7SH 1MFEH 1NUGA 2E27L 3KNBB 3DX9B 3MTRA 4ODUA 1I7ZA 5A16A 3W11C 1NGPL 1FNLA 5JNYA 2V5YA 2X4PA 4P9HL 5D9SB 2A6JB 2J7LA 5BS0E 4PJ8A 5B39B 4U1LA 3S3PA 4L4VE 5JOPD 1MFBL 2I9LB 2EDKA 1MOEA 3SDAA 1FLTX 4NNYB 2AGJL 3SPVA 4IEFB 2BOBA 2VDLH 1A6TB 2Y1VA 1IGTB 3MLVH 3CDYA 3IU3B 4F15C 4HPYH 4S1DD 2L4OA 2NXYD 3BPOB 4B7IA 1RZFL 3LH2H 5GGUA 4F8QA 5CAYB 4U7MA 2Q76B 2OL3H 4XPGH 3EJYD 3LZFL 3KPRB 3U30B 2M26A 3VRIB 3VG0H 5IEKB 5INDA 1I4FB 2QQNH 4QRQA 4R2GB 4HWBH 1UYWH 4N9OB 1M1SA 1ZV5A 1LD9A 2EDHA 4JFEE 4UU9A 3PIQB 3L6FA 3O2WL 2EYSA 4XCFL 3DARA 2E8YA 3DV4A 1YMHB 1NGYA 2DLTA 5T3ZE 5GISH 5IB4B 4Z7UB 3CUPB 4NZTH 2Y5EA 1FIGL 1KIUA 4K2UH 4NUGL 3FAWA 1QVOA 4JHBA 2OTUB 1T04B 5SWZB 4JKLA 1VFMA 4XNXL 4GW5A 1LQSR 5KZCD 3UP1A 1FV1A 3P0YL 4MJID 1DN2A 5DHYB 3ZTJG 5E4IA 2QHLA 3OKOB 1ORSA 1VGKB 4I48A 4OFYD 4L8CB 3QFDA 1QSEE 1MI5B 3ARDC 4GG6B 3WCYA 1RUAH 1OM3L 1IGYA 1FVCA 2X1OA 3H8NA 2CLZA 5HY9A 4OZIF 1XCQB 2YD3A 5FA3B 5CCKH 3U0WL 1MLBB 5MI0B 3HI1B 1VFAB 4FMFA 4OI8A 3O2DH 3O0RH 3K7UA 1CE6A 5E9DD 4EQ3A 4K9EH 2IFFL 1IAII 1U3JA 3BPLC 4QYOA 1KCLA 3CD4A 2VQTA 4DN3H 1LDSA 5TQ0L 4OZIA 3NCJH 5I8CA 1T0PB 4PR5A 4U7KA 4EZMA 1OLZA 4KZEL 5DLML 2XWTA 2IMMA 2MHAB 4XP9H 3RGVC 3ZO0A 1J1OH 4OSUL 1WBYA 3DJ9A 4LSSL 3GMMB 4K8RH 1XAUA 4M6OL 3RL2A 4OCLC 4B50A 2ORBH 1XFPA 3ZKMD 1FNEA 4JQXC 3S98A 3VRJA 5LJYH 1IRAY 1BOGA 1T5WA 3H6JA 3BXNB 3MRIB 1FL5A 1XGUA 2H26B 4M8VA 5D2LE 2E6QA 4APQD 4KVCL 1CFTB 4HC1L 4MHHI 4AEIL 3RVUD 4GKOA 2IF7A 4RGOL 3MMEB 4HUXB 4QNPF 5DMGD 2CO6B 1FZKA 3AGVA 3BO8A 4JN1H 1V7NL 1VFBB 3DVNA 3I50H 5T33H 4KK6D 1E4XL 2IQ9L 5CHNA 4PS4H 2VERN 3FQXB 3MRPB 4RFOH 3AREC 4IJ3C 3VGGA 4XCEB 1VKXA 5SWQB 3DI3B 3IU4L 3HI5H 4ODXB 5IEHB 2HLFC 1DBBH 4GKSB 3HZYB 4GAJL 1JPTL 1U91B 2XA3A 1WCQA 3GSNH 5DK3A 3ZTNL 4UOW0 5L2JA 3GI9H 1TQCB 4PJEE 3O3EA 2HN7A 2ATKA 3R1GL 2HTLC 2LTQC 1OTUD 2VAAB 3GIZH 1OGAD 5DJCA 4IIQA 3NZHL 3NFNB 5IFHL 1P84J 5FDWA 2FJFA 4M7JL 3G5XB 4P2RA 1NAKL 3O6LH 2DQUH 2QQQA 4M48L 4QKXB 5EBMA 4DCQB 2E9WA 2IBGA 2FGWL 2XPGB 4NO2B 1E6OL 3QFJD 1F4YL 2BVQA 2FJHB 2VDNL 1K6QL 3UTQB 3VWJB 4E41A 1ZT1B 1J05B 3EDJA 5JUEH 1LO5A 3GSVA 2B8OT 3TFKD 2V2TA 4ZOEA 2NY0D 2CJUL 2P8PA 4QLRA 3JV5A 2DI8A 2CIIB 3EUUA 3BQUC 1Z5LA 5IBLC 5JXAL 3RZWA 2DQGH 3HC4L 5CJQH 4KJYA 1IZKA 4DVBB 5FDYA 3BKJH 3ZKXB 3C6LC 1TIUA 1WZ1L 4OZFH 2ENSA 4XAWH 1I1AC 4JAMB 2OQJA 5FECB 1GC1L 1MHPL 2DWEB 3RWGB 5CJXC 4KI5F 4JHWL 1BX2B 1U8HB 4HKXA 4XBPA 2BZDA 1IGFH 1EJOH 2DYPD 1FDLL 2H6PA 4OGZA 4UIKL 5FYJE 1BP3B 3QG7H 5IVOA 3OAZK 5FUOH 5JHDB 5BQ7A 1NCCH 4N0FA 1KJ2L 4DVRH 1QO3B 1YUHB 2WUCH 4FQLH 2IGFL 4BQCA 5TFSH 3ZZ1A 2F5AL 2YPLD 3C8DA 4PV8B 1OF2A 3NCMA 1XGRB 3ZL4L 4RA3A 1MJUH 3LS5H 3IJSA 4WHDA 3IDIB 5BZDA 5J12C 1ACZA 1XF4A 43C9B 3MJ8B 4YR6A 4NZUL 4DUWA 5IMMB 2AEIT 2MKWA 3DVFA 2B4CC 1T7ZA 4P49A 4KRPD 2HT3C 2R8SH 4HIEB 4CNIA 3TO2B 4ZTPL 3MRHB 4L4TE 2NNAB 3ARYA 2EYTA 1KNOA 3QQ9D 5CEXB 3L3GB 1X44A 2XZCH 5DQDL 3V7AE 1BFVH 3GRWA 5GGVY 4CRPA 1GGTA 3CXHJ 5F97E 1FAIL 2XTJC 5CZVL 3V0VA 2ZOKA 4MQTB 3T1FB 4CADA 5C86A 4NM4L 1FYTB 3BYTA 4G6KH 2R2BA 5IQ7H 3RWCA 1U58A 1ZA3B 4YNYA 4XNYL 4FZEL 5KJRH 1HXYA 1Y0LB 1JFQH 3C60B 5F1IB 3WFHA 1BQHG 2VL4A 5KSAC 3U2SB 2CGRL 2HKHH 2WV3A 1FFQA 3DECA 5C6PB 1TLKA 1AQDA 2P7TA 3QPXH 3GSUA 1LGVA 4LBEA 1FN4B 3NIDE 4PJBB 2H2SD 3PL6D 1DE4B 1ZLUH 1RZ7H 4C57C 1RJZA 4RAHA 1E4KA 3VGHA 5HHNA 3IDGA 5FKPB 2Q8BL 3MV9B 4I9WE 4R0LB 2O5XL 1OQXA 3JUZA 4OF7A 4ELMA 1EFXA 5HBBA 5ESQA 3VRLF 2X4UA 5EU3A 2A6KA 1G7IB 1NCWH 5JHDE 1FNHA 4YE4L 3BEVA 5L7XL 1WAAE 4ETQB 3UPAA 5CGMA 1G1CA 1G7PA 4G6FD 3FRUA 4K55A 4P23B 5CMAA 5EC2B 5KSBF 2ESVB 5FA4A 2HTKD 1HN1A 3MOAL 3VJ6B 3OQ3B 1ZAGA 5F7MC 4YHML 4HFUH 2IPUG 3AS1A 4OM1L 3L7EB 2RGSA 5F1OB 4XBGB 4LKCB 4UB0H 1OPGL 3SDDD 1RQ5A 5FK9A 1I7RB 4WWKC 5D7LE 5KSBA 2BSED 1YN7A 3TC9A 5FYLE 5J7CC 1BJMA 3EBAA 4LARL 5DEFA 4HIJA 4PGEB 1BPVA 4JFFB 1CDGA 4WEUD 2VRAA 4AT6A 3HE7C 3BIBX 1S9VB 3MRJA 3B9KC 1MJ7H 4IOFD 5HVHC 4YHPB 4PRPD 3OGOE 5GRUL 1G6RL 4D94A 4JZNB 1UWEH 1ZVYA 3S36L 5DRWB 3ZE1E 2EDOA 3K1DA 4RFNB 3G6DL 3NN8A 2P8MA 4X7TB 1VADA 5K33A 4Q2ZA 3U0TB 4B41A 4GBXD 3VXOA 2GAZA 1PEZA 2SEBA 3BMWA 3WE6A 1FFOA 2X4RB 4JFZH 4POZD 3EOTH 3WJLC 5GGSY 5BOPA 3AAZA 1NMCB 1FG9C 2OMNA 3KPPA 5DJXA 1MCDA 4OTXH 1GAFL 2PXYC 2VH5L 5H2BB 1QKZL 1FO0H 5GIRA 3QDMA 5E6ID 3KHQA 1YN6A 3K81A 2XFXB 3HG1B 1UC6A 1JNLL 5F7LB 1UXWA 4XNZC 1Q72H 4BUGA 4IRSA 5C08E 2ESVE 1GGBH 2HJKB 2YPVL 2VLME 1XZ0A 2EDFA 5HHXL 3TN0B 4RWYH 2VZOA 2FSEB 3EYFA 1KTDB 4BSWB 1ZWIA 4YQXL 5J89A 1K8IB 1T3FA 4W68A 5CJ8A 1SJHA 4S11A 4XH2A 4LLYA 3HFML 3OJ2C 3PDGA 4JGMA 3VFMA 3DMMC 3OPZL 3UXFA 4FG6D 4NWUL 5DS8B 3T65A 5GS3A 2R0WL 1U8KA 4Z7NE 4ZS6C 1HSBB 1OTTD 7FABH 1R3IL 4X6CF 4PGBA 3IFPB 3V4PL 1NCTA 1FNGA 3H9SA 3GIVB 1UB6B 3RY6C 3MXVL 2GQHA 4DAGL 1BQHB 2UZXB 3PQYA 3SO3C 3MV8E 4MNGA 3WFCH 1P53A 1CT8B 3PWJB 1MCJA 4R7NB 1KGCE 1MVUB 1AI1L 5GZNC 1C5BL 4NQED 2JJTA 4NHCH 4G8GA 4JEGB 4ZSOB 1FZMB 2A1WH 4U3XA 5ACZA 5E4EC 5KSVA 4P5TA 3U36A 4UINL 3CU1A 5HHPA 1NKOA 1S7XA 5HGHA 1MH5B 1BD2B 3D69B 2ADJB 4XP1L 5IW6B 1JGDA 4LF3B 5HHME 1NEUA 3RNKA 1G7LB 2W0LA 3Q3GA 2JE8A 5SWSB 2H2PC 1FBIH 2A6IA 3GMOB 4OLUH 4U2ZA 2W60B 5D8JH 1PSKL 1KCUH 1R24B 1AD9B 5KVDH 3RZCA 5CEYB 4TSBH 4NQUA 4M6ML 2BNQB 2UZYB 4PGZA 4A6YB 1UEYA 4X4XA 4OQTA 4PRIA 3VI3E 5T3ZL 2P44B 3HZKA 3T0ED 5LWYH 4JO4L 4HIIB 4LQFH 2NMSA 3V5KA 2E6PA 3KYNB 1MIMH 5F6IC 4CGTA 1U93A 1NMBL 1NCAL 2W1NA 5J6HA 2QKIA 2GUOA 3QJFA 2XV6B 4OLZH 4M00A 5IHBA 1YQVL 4F9LA 2WBJC 1LE5B 1I9RL 3GBMH 5D72H 4DW2H 1MHCA 3K46A 4ZUVA 4UDTA 3CXDL 2RCSL 4EUPA 4Y16B 2NZIA 4I3RH 5HYFA 4IJ3B 2YK1H 5KVFH 4JFYB 5I76A 2GSGA 5CEZH 2FR4A 2X9XA 4DEPC 4IRZL 5IVXF 4GW1B 3VXME 4QRUB 4F9PA 2PYEE 2EDEA 2UWEF 3ZDZF 4P46D 4BM7A 2Z4QB 5EO0B 4XP6L 3GJEB 4LK4A 1S7QA 2NLJB 5DI8A 2JTDA 4EI5D 1OAZH 4EN3A 1I3VA 5HI3C 4MXWH 2YBRA 4ZUWB 2FIKB 1NBVH 3EYSH 4FQ1L 4P3CL 5IVXA 3MLUH 1BGXH 1HCFX 5JR1L 1J7VR 4OM0H 2HMID 2OR7A 5H94B 3SOBL 3UYRL 4HS8L 2BDNL 5I73C 5F3BB 4Y4FB 5DVNA 2EDTA 1QBML 3DSFL 2VXQL 1GZPB 1QPPA 3U48A 3CLFL 5E8EB 4XVJH 3S34L 3GHBL 1WC7B 4X7FC 2ZCKH 2DQTL 2ICEB 2AVGA 3AUVA 3EYUH 4O2CB 1QEWA 4ONHB 4Y4KD 4NKDA 4YXKL 35C8L 1UQSB 3TIDA 3U0PA 3HZVB 4GRLD 5CBAB 3HMWH 1F42A 4NJ9L 5IQ9A 1DQTA 3SKNB 5ADOH 4NC1E 5TPWL 3EFFB 2AJZA 1A3RL 1OLLA 4K07A 2FEDC 4OGAD 3U46B 3KPNB 4DGVL 3QO1A 1G7QB 4FQCL 2H8PB 4JANA 4OV6F 4YHIB 5F7HA 3W0WD 3F6IA 5L2KA 4LLUB 1KLGB 1Q94B 3C6LB 3JTSB 3MCKA 3C5SA 4GRWB 5D71L 2HVJB 2VZVA 3TFKC 2EYRA 1KJ2A 5FGBC 1MVFA 3PXHA 4H8WL 4OJFH 2AJSL 3OZ9L 1QFWH 1AXTL 1G7MA 2I9TA 1Z9SA 4U4BA 2VXUH 3QI9A 5DD0L 1E4WL 1I8KB 3QUXA 4LMQE 3TYFB 1TJGH 1L7IL 2OTWB 3EJZC 4NT6A 4EOWL 5E8PB 5F88B 3EO9H 1KXVC 3EOBA 4XNUL 1JN6A 3OKDB 3FRPG 5FM5O 5TGBA 1WUNT 2YRPA 4RBPK 3MR9A 1AHWB 4XNQB 2VC2L 3UTSB 5E5MA 2BY1A 3FT2B 1P4LA 4D9RE 5HYJE 1OWRM 2WINA 2BSSA 1VPOL 4YEFA 3MRBB 2DRUA 1T89A 1EZVX 3ARGB 5D1QC 1AXSB 3STBA 1RZ8B 2RFXA 4L3ED 4XVSH 2P48B 2FO1A 4NO5B 2H3NA 3MRLA 5E2WL 4L5FH 3KYKH 1CDBA 2WMPA 2DWDA 4MZ2A 1XF1A 3QA3A 2XN9A 2ZCLL 2CKNA 2DD8H 3W39A 1TTUA 1BM3L 4JN2B 4ODWA 3BH9B 1KCRL 3C6SA 5KVEL 3ZLQC 4WW2A 2FIRT 4YHKL 4FQXB 3MNVA 4KWUA 4Y5VA 1RHHA 3O41B 5MP6H 3WV0A 5DMIL 4FZ8L 4LPVA 3EGSB 4JPWL 4F3FB 1G9EA 3UAJC 1PLGH 4HKZA 2ICWJ 4B7LA 5MERA 5HI5D 1OD9A 2ZUQB 5IB1A 4L8DA 2NPLX 1ADQL 2X1PA 3FT4A 1KCSL 1NDGB 5ITFB 4G9DA 2D0FA 3WO4B 2YD6A 5EZOL 3IDXH 1BLNB 3D48R 4U6VL 3P9LA 3HMXH 5FYJL 2YUWA 3WFBH 5ETUB 4MJ6A 4N1HB 3DOSA 3HUJF 4U1GB 3C08H 4U6YB 5F9WB 1ZLUK 3FQUB 2ZG2A 2B7DT 3QEUB 3D3VB 4FQIL 3MXWH 2K3TA 4HUNB 2Z31B 3UTSE 2NW3B 5MEPB 4ZFGL 5EZJA 4R90H 1D9KD 3DYOA 3BRFA 3IDYB 1AKJA 2FEEL 3SQOH 3FQWA 1NC4B 3HUJA 1CICD 2E9BA 4JHAH 4M3KB 4LLWA 3UC0H 2CO7B 5FM4A 2W38A 1JTTA 3Q6GH 1A2YA 1UWGL 4JREB 4PJHE 4M62L 4MQSB 4WWKB 5HHOD 2JIXA 4RGNC 2BNRB 4PJ5E 5A2IH 1J10A 1QSFD 4DFHA 3JTTA 1CLZL 5GS1C 4I0PC 2ZUTA 2D0HA 5K9KB 3VXUE 3WHXB 3DX6A 3BPCB 4E5XB 2FZ3A 5CD5D 1YMMA 4O00A 1RURH 3F58H 4OCSH 3N9GH 3M17A 5FHAH 1HEZA 1HNGA 5DQJA 3B9KB 5LXGL 2H32A 5FB8B 4FFZL 4YPGA 4JY4A 4FQPA 4ZFZA 3LRSB 5DA4A 3O9WD 1FFNB 2BHYA 5FKAA 5HVGB 3G5VA 1WCBA 1WWWX 4Q9CA 4L9DA 3VFUA 2IG2L 3EHBC 4MS8D 5ISZB 3AB0C 1N26A 3V8CA 3IFLL 4JFDE 2W0PA 5GRZA 4JFXB 4ZNEA 1CGTA 5HGAA 3QIBD 3Q5YA 1YEJH 2YD7A 3GSOB 2V9RA 4I18B 5C0CD 3U9PL 4FP8H 1X6LA 4TPRH 5ANME 4BFGA 1IT9H 2PXYB 1ZK9A 3FB7B 1ND0A 1P7QB 2L0DA 3T8XA 1KJ3L 5JIKA 4CMHB 2B5IB 4HUVA 32C2A 4N8VA 1AQKH 4NNPH 3P77B 1D5ZA 4PLKD 5IM7A 4ERSL 5I1CL 4KKBC 4X0KB 1P1ZA 4U3HA 2RIKA 1CFNA 5LGHH 1CFQA 5D7SL 1FL3A 1H15A 3ARBD 1OARH 1WBXB 4X98B 1A5FL 1P9MA 2A9ML 3F7YA 4FXKB 4JG0H 2NXYB 4JDZA 1A0QL 2X70A 3CDGA 4LMQI 2X41A 4WTZG 4NO0A 5FYLL 2PTTA 2Q7YA 3ARWA 1UWXH 5JMOC 4ODTL 4P59H 5AWNL 4Y1AE 2AABL 1OB1A 1MF2H 1YECL 4JFOA 5DD5L 4PJXB 2OR9L 4XWOC 5LVEA 2Q7NA 3BEWB 3RWDB 2Z8RA 1KEMH 2AXFB 4NZDA 4XCCH 2UVFA 5ICXA 3F12A 3ULUD 1CI5A 4PG9A 4L4VA 3D85D 3LKRA 5T3XH 3SO3B 5HXMA 3BP5A 2O93L 5BV7C 2KBGA 3STLA 3CVIL 4XRCA 5ID1A 2F8XC 3WL9B 1MELA 2HWZH 4PJDE 3P73B 1YY8A 4NP4L 1WWBX 4KGLA 5KZCB 1MHEA 4G80B 4LKXA 1T7WA 5C3LD 2YRZA 3TBWB 5DSCA 3MRGA 3QH3A 4UOW1 3QEHA 4HUUA 4NQTA 5GSRB 2AXGB 3WD5H 3RWJA 3EZJB 3VFSA 4NHUB 2DDQL 2J1KA 3SE8L 5I8OL 1LO3L 1U42A 3C5JB 4QHNB 3O11A 4OZ4B 4MD0B 1CGSH 2ZG3A 1MFDH 2DQJL 4KAQH 5T1KD 1DN0A 5C0DA 1I9JH 1U8LA 3O8XC 2GY7B 5HHQB 2CKBA 5C0RL 5EU5B 4HFWA 3GSWB 4PRAB 1H8NA 3J8F7 3RGHA 5JOPE 4H20L 5E9DB 3FKUS 4FQHA 4G43B 1N2RA 4JHZA 5I16B 2IALB 3CH8A 4F7MA 4OZFA 4NUJB 2B4CH 2NY7H 1FPTL 2ICWI 4FTVE 4MNQB 1CD9B 3WFDH 1DQDL 5EDXA 1JYNA 3BJLA 3QIWA 5BJTB 4ODHL 1XR8A 5IMLB 4CVWA 5E2TL 3CNKA 2E7LC 2AXJA 3SDXB 4PJXE 4PY8J 3RU8H 2MKLC 4LLVA 4X5WA 5EC1B 1BBJA 5A2JH 3N85L 1PZUB 5C0NC 2R2HA 5FCSH 5D9SA 2XZAH 2A6JA 5B39A 2D7QA 4OF3A 1DEDA 5TDPB 5I6XC 5C07E 5LAXB 3IYLW 4NNYA 5F9JB 2V9QA 4X8JB 1WISA 1U3ZA 4HXBL 4JPIB 1A6TA 3D2UD 1IGTA 3IU3A 2OZ4H 1IC4L 2BJMH 4Y4HD 4TQEL 3B2VH 3BGFC 1EH9A 4YBLC 4WHYH 1TZGL 5HGBB 2PR4H 5T5FL 2Q76A 5I1LB 3OAUL 3VRIA 3KPOB 3LPFA 5IEKA 3W5MA 2OXGA 4MJIE 1I4FA 4HG4J 4OBSA 2Z92B 4X80L 3C5ZD 3UDWA 5J13C 4UV4L 3TJHC 1GGCH 1D5MB 1DQQB 1EA9C 4LSRH 1UB5B 1YMHA 4J3WA 5HD8D 1VACB 1RMFL 1T1WB 1Z0MA 3F7QA 1C7SA 5IB4A 3CUPA 2ADIB 3UEZA 4CKVX 3ZDXE 3B5GA 3MLWL 5I73B 1MY5A 1N5YL 5EU6E 2NY1D 2UY7A 2IMNA 4KKAD 2OTUA 1F58H 1T04A 5SWZA 3JXAA 4BQ9A 1JPST 4G8FB 3IXAB 3R8QA 5E70A 1KCVH 2DJ4A 4Y5YB 1OGAB 1S9YB 4XVTH 5ELIA 1OSZA 3FFDB 1LO0L 4PJEF 5JPNB 3LRHA 5DHYA 3QUKB 4PJCB 1G9NL 3DLQR 5GS0C 3SGDH 3BWUC 3PGDB 1VGKA 3RIFK 5IB2B 3LQAL 2YKLL 3T08A 1K5NA 1MI5A 3GMLB 4PJ7B 4TNVK 3QFJB 1CBVH 3TT3H 1OY3B 1XCQA 4UILL 5FA3A 1SYVB 1J8HD 5ADPH 4PJEA 4GG8B 4FFVC 4MB3A 4PRHD 3NBNA 1MLBA 3MV7D 1M7DB 1VFAA 3HI1A 3I2CL 5IB5B 2NY0B 4HMEA 4PRBB 4DKFL 1EAJA 3DURB 3BI9X 1JGUH 3DSNA 1NAMB 4P4KD 1YEIH 2UYLB 1FVEA 25C8L 3C2AL 3HC3H 1CTOA 5JOEA 4C83B 5I1AB 3V52L 2BSRB 2F5BH 2Z8WC 5CSZB 1CVRA 5EOQL 1RUPH 5D2NC 2EXWD 3H3PH 3DXAD 2MHAA 3VFOB 2IBZY 3WXWL 2IPTL 4BYHA 4WFGD 1Q9LB 1AFVH 5IKCB 3GMMA 5JXED 4MQXD 3MRQB 1N3NB 3QCTL 2E7CA 2VN7A 3QDGD 1YYLL 2YEZB 2KZWA 3IB4A 4M6AA 5CSBA 1OQOA 1CZ8H 1LK3L 3BXNA 2PO6D 3MRIA 2H26A 4TVPH 3S35L 1S7VB 3CIQA 3SKJH 4WIQA 5J4MA 4UT6L 3D0LB 1CFTA 2WWKT 2YPLB 3BP6B 3GGWA 2Q8AH 3TNNB 3O6MH 4HUXA 3O6FC 1EEUA 4G5ZH 3HI6L 2DTML 5HVWA 3DX8A 4NO3A 2FBOJ 5KBNC 4P57A 4OUUB 1ZGLM 2Y36L 3WNKA 5TH2A 4MCYB 4XCEA 2AK4E 1T03H 5SWQA 3BD5A 1G0XA 1MCWM 1EEQA 1KJMB 1YEGH 4ODXA 5DHVB 1DVFA 3T2NH 2APWA 3HZYA 3MRNA 1A47A 1U91A 1S5HB 3DUUB 1DQLH 1FORL 1AY1H 4QXWA 4M7LH 4KQ3H 1PG7L 1I8IA 4BZ1L 1T2QL 1ZANH 3BKML 4YPJA 3LB6D 1OSPL 1A3LH 4M7KL 3QT2A 1W8NA 3KPMA 2NY4C 2VAAA 4OD3H 2NY2D 1A7QL 1MCWW 3NFNA 5JPMB 2G5BB 5CKGA 3MV11 5DD6B 3MCLH 4BQ6A 4RFEB 5F89B 1XF2A 3D18B 1F90H 3PL6B 3PWVA 4D9LL 4L4TA 1AE6H 5GS2H 2XPGA 4NO2A 3OB8A 3B83A 2ADFH 4CU6A 1SMOA 2FJHA 1QLEH 5I1EL 4LRNH 1J05A 5I17B 3NIDF 5C09D 4HULB 4LOUC 1CE1L 1F3JB 3T1WA 3U7WL 4JRYE 4J7RA 4JY5H 4WV1B 4I13B 2LAGB 2CIIA 2NZ9D 2W0FB 2VDML 4RGNB 4PG2C 4NQCD 5ERWB 5CINL 4DVBA 3S36X 4JGUA 1OWWA 3WNPA 2R9HC 4ZUTB 3TYGL 2FX7H 1J0IA 2DLFL 3K0WA 2JJSC 3MJ7B 1UACL 4JAMA 5FECA 1WAAF 3JVGA 2DWEA 1N5AB 5EOTA 3RWGA 4KTDL 1N4XH 1A22B 1BX2A 1U8HA 2HYMA 2F58H 2GJZB 1U0QA 4YGAB 4LCWD 2IPUK 2ZPKL 1HIMH 1NKRA 3AB0B 1DUYB 5JHDA 4Z7VB 3TEUA 4NQDD 2G75B 1YUHA 4HQQH 3CFKA 2V7HA 4KXZH 1I3GH 3PABA 3QUYD 4PV8A 1HH9B 2IH1B 1JV5B 3SDYL 1MIEL 4AM0B 1S7RB 1NJ9B 4L3CB 4PRPB 3IDIA 3IRPX 2QHRH 43C9A 3MJ8A 5K9QG 5IMMA 1A6WL 4YEEA 1KEGL 3Q1SH 1W0WB 3EAKA 3ULVC 5KW9H 4HIEA 3TA3C 4BSVB 3C8HA 3TO2A 4GBXB 3MRHA 3CVHA 2GCYB 4DK6A 5KS9E 2NNAA 1LNUA 3L3GA 3ZE1F 3ME0A 3MACL 1Q38A 4ZTOL 5JW4R 2JLLA 1IVLA 4R26L 3T1FA 1BECA 2OJZH 4PJ8C 1KLUB 2J8UB 1FYTA 2GT9B 3FN0H 3SDAC 1JTOA 1J9CT 5E6IB 1MCNA 3TO4D 4KUZL 1MCBA 2YMXL 2R2EB 1MRFH 4JRXD 4I2XE 4PTTB 3V5DB 5DR5H 2ADGB 1FN4A 3GB7B 4PJBA 1EBPA 1DE4A 3X14B 6CGTA 4GXVH 2P5WD 4R96A 4YXHL 1P4IL 1UM6L 5FKPA 3MV9A 4KK5D 4OD2B 4R0LA 5CP3H 3CSYB 4PGCA 1GZQB 4LPTA 4NM8L 3FCTB 5I15H 2AEPL 1UWXK 4J6RH 5E5RB 3WIHL 5JORB 4JO3L 1HILB 1G7IA 1BBDL 3D39D 1B0GB 4TOYL 2XQYG 4TUJB 1TZIB 4WY7L 1DUZA 4M6NL 4X6FA 2BRQA 2KDGA 5DMKB 4P23A 3NTCL 1N0LA 2ESVA 4YX2L 2F8OA 2NW2B 5IHUL 1NAMH 2JJVA 3VJ6A 3QDHA 3KXFE 3ILPB 3VE0A 4QOKD 4Z7NF 4LPYA 4XB8A 1EO8H 3L7EA 1DEEB 2IPKB 4XBGA 5I1HL 3L5IA 4LKCA 4OLVH 1WFOA 3AC0A 3ZDYE 4GLRI 1RIHH 2X44D 1B2WL 1I7RA 1OCWH 3LHPH 2LVEA 1U92A 3MROA 1V3MA 2QADC 2CDFB 1QA9A 3AXLB 4G8EA 4PGEA 1AGFB 1XIWD 1WWCA 2DQIL 5HPOA 4X7SL 5JTWA 1FNSH 3CC5B 4ZXBD 3DRQB 1S9VA 4ORGB 2JELL 3NCFB 4F7CB 3DYMA 3QXDB 4YHPA 1T5XB 4J3OC 2C3XA 4ZPTB 1C12B 2W59A 4LL9A 5CBEB 1JVKA 4DOHE 3U6RB 4X7TA 4QXGH 2VDLL 3MLVL 5HYQB 4HPYL 4Q6YA 2X4RA 3LH2L 4IRJA 3T0EB 1NLBH 1KSRA 5CJ5A 2OL3L 4XPGL 4NRYA 1CFBA 5T1MB 1IC5H 3RWIB 2A38A 4YHNB 4P2YA 2QQNL 4H88H 3K2UH 4FFYH 4HWBL 4LHJB 1UYWL 5GRJL 3VI3F 1LP9E 4YBLB 3KHOA 2E8ZA 2XFXA 4XGZA 3HG1A 1HXMB 5GISL 2UZIL 1AGDB 4NZTL 2H1PL 2BXZA 3WFZA 1KUMA 4K2UL 4QRPD 1BVKB 4WUUD 5L0QB 3TN0A 3L3HB 5I8KH 1XR9B 5J13B 4BSWA 1X5JA 2ZJSH 3UBXG 4NQEE 4D9QD 3EYQC 1K8IA 2O5YL 5LQBL 1VERA 3RNQB 1T66C 4MAYD 5F7DB 1OAXL 4P46B 1H3VA 3NFPB 1KN4H 2W9LA 5DS8A 3HLAA 2QQLH 1FE8L 3A6CH 3P11H 4XPAL 4LHQB 2CLRB 4O51B 4FXLA 1NUNB 1HSBA 4LDOB 2DBLL 4XXCA 4POUB 1KB5L 1RUAL 3IFPA 1DJSA 1NFDE 3GIVA 1UB6A 1FG2A 4XMKH 4WW1B 4YC2C 1RIUH 2EEDA 1BQHA 3NABL 5CCKL 4IIQC 5ITBL 1WTGT 1U8OB 1MCEA 3UZEA 4X8XA 1CT8A 2WWKO 4HX1B 1JHKH 1J1PL 3PWJA 1MSPA 3O2DL 4J8RB 1MVUA 3BJ91 4MWFB 2ATPA 4NGHH 4OI9A 4K9EL 2A0LD 3S37X 5E2UH 5C9JB 3TJEH 2FWOB 1FRGL 3VXMA 4DN3L 2PYEA 3FOLB 2EDXA 4ZSOA 5TQ2H 1FZMA 4CUCA 5I30H 3NCJL 5TE4H 1K4DB 3QHFH 4ONFH 4K3DH 4Y4KB 1C8PA 3JWDC 4GRLB 1MH5A 3D69A 4U6TA 3RVWD 2ADJA 5IW6A 1IGMH 3ARFA 4LF3A 1XCTB 1G7LA 5D7IE 1J1OL 1C08B 2LFGA 1HHHB 2I60H 4XMLH 1T2JA 3D6GA 5SWSA 2GJ6D 1K2DB 4OBRA 4K8RL 4JFQB 3W0WB 3HB3D 3W82A 3GMOA 4U1HA 4JZOA 2B2XL 2W60A 2AERT 1QYGH 1R24A 1NGWB 1AD9A 2AJUL 3TV3L 4JM2F 4NJAH 5CEYA 3WDHA 3I75B 4OFKA 4M5YL 4A6YA 3P4MA 4G42B 3ZT6A 4HIIA 5JLZB 1L6ZA 3CZJA 2BSTA 1PGRB 4JM4H 4OGYH 5ABDE 2WAHA 4RAUA 4RFOL 2VLLB 3LV3B 1ZT7B 5DD3H 2AKRA 4HMCA 4UAOC 1MAMH 3PWPD 4HLZH 2GSIA 5D1XA 1DBBL 1X5KA 2MQCA 4EKXA 3CLEH 4MVBC 3RUGE 4KI5C 4LLQB 5J56B 5D5MB 5J11B 1GGIH 3GSNL 4XPBH 2VOTA 3GMRB 4Y16A 1HWGB 5EB9A 4JFYA 1BZ9B 5KTEH 3GM0A 2C1PB 4K7FB 4JQIH 5FYKH 3GHEH 3OR7B 4XI5D 3FHAA 3BDYH 3X3GH 4GW1A 4I1NB 5HJ3B 3K1KC 3QDJD 2Z4QA 1P7HL 2CMRH 5EO0A 4TNWK 3SJVE 5F7WC 4BK5A 2NLJA 4YHZH 5T5NF 3DYPA 2XICA 5F7YC 3MUGB 2DQUL 4XBEH 5BV7H 4P9ML 1R3HA 1J11A 4ZYKA 4UNVA 1KN2H 2AK1H 4HH8A 4ZUWA 3SE9H 2FIKA 5AZEH 2DBJA 2VITB 2XQBH 4MA7H 4MJ5A 2VNCA 1CDJA 5JUEL 5H94A 4DQOH 5F3BA 5CD3A 4Y4FA 1S7TA 4WU5A 4N0CD 1M7IB 4JPKH 1GZPA 4N9GB 1QRNB 2N1KA 5FM5M 4BZYA 1WC7A 3QR2A 1E4KC 1Q0XH 3ZYIA 1CGVA 2ICEA 2DQGL 5CJQL 3UBXB 4PB9H 2B0SH 4ONHA 4HJGB 3BKJL 3EYVB 4GRWF 4E42B 3HZVA 5CBAA 3NIGE 1HYSC 4XAWL 3SKNA 2X9YA 1FYHB 5J57B 3EFFA 2XA8H 4M1GH 3U46A 1EVUA 2GI7A 3PGCB 5BVJB 2DQCL 4R4BA 4AQOA 2Y9RT 1G7QA 3T0BA 2H8PA 2PETA 3IJHA 3MA7B 4YHIA 3RI5K 4R4FH 4LLUA 1IGFL 1EJOL 1KLGA 3GSQA 2BVYA 2EIEA 2R4RH 3JTSA 4OLXH 4MA1C 2HVJA 4X9HA 2GW5A 1KIRB 4DFIA 1DR9A 3V4UL 1CICB 5FUOL 2C3WA 4LDLB 3OHXB 4DVRL 2WUCL 2ERJB 5TFSL 4AEHH 5C0AE 4L3EE 4RMWA 2FHFA 2ICWA 1D6VL 1I8KA 3F6LA 4H1LH 1SY6H 3TYFA 5HHOB 2BY2A 4JKPH 3MGAA 1MJUL 1QSFB 2HP4A 5E8PA 3VDCA 1M7XA 3QRGH 3VD5A 1SJXA 1S9XB 3MREB 1P7KB 3OKDA 4QCIB 5I2IA 3NPSC 5KG9B 3MLYH 4Z0BL 2VO5A 1AHWA 3QWRD 4XNQA 4PJHF 4YFDB 3G6JE 5H37G 3BIAX 3V95A 3UTSA 2YWZA 2NY5C 1IKFH 2AEWA 1B6DA 1TFHA 2L7JA 5BW7A 3MRBA 2XZCL 5HHVH 3O9WB 5EA0H 5D7KE 1AC0A 5I1IH 3OKMB 3ARGA 3NA4A 1PKOA 12E8L 3KLAB 1AXSA 4YDKH 4YHYC 4QY8B 5INCA 3LD8B 4J4PA 4NO5A 4QTHB 1QQDB 5K59E 1KELL 4PJ5A 2A74A 5KJRL 3QIBB 4Z0XA 5C0CB 2FH8A 5JNYB 5KANI 5TE6L 5CIPB 3QPXL 3VXUA 4NBYB 4JN2A 2WIIB 4NQSB 4XMPH 4OD1H 4P2QD 3BH9A 3EYOB 3GBNH 4DGIL 3TGXA 1K85A 3REWB 4FQXA 2PYFB 2QBWA 1T83A 3O41A 1FFPB 1I1CA 5JW4M 2R23B 4AL8H 3B2UC 3EGSA 1RZKL 1S9KC