1OSPH

Crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
218
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGEPITSGFWDWIRKFPGNKLEFMGYIRYGGGTYYNPSLKSPISITRDTSKNHYYLQLNSVVTEDTATYYCARSRDYYGSSGFAFWGEGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (immunoglobulin/lipoprotein)
molecule keywords FAB 184.1
publication title Crystal structure of Lyme disease antigen outer surface protein A complexed with an Fab.
pubmed doi rcsb
source organism Borrelia burgdorferi
total genus 35
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1996-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ospH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ospH02
3RX8A 3GMOB 4G6MH 1MRFL 4PJEE 3GMPB 3S8WA 4HUWA 3RBSA 1XH3A 2NY6C 5DJYB 4NM8L 4DKEH 4U2YA 4HCRL 4P2RB 3PGFL 3CVHL 4NOFA 1M6OA 3ESUF 5T33L 2UY6A 1QBLL 1VGEH 4NNYA 2NCMA 3MYZA 4F3FB 4LEXH 4WFFE 4U1JA 1LDPL 1D5XB 4L8CA 4LSRL 5I66B 1FYTA 3MRFA 1A5FL 2CGRL 2P5EA 2DQUH 4NPYA 3ZE0F 1TZGL 3GJFA 3TT1L 5DTFA 4J1UA 5TQ0H 3KS0H 2YHGA 2DF3A 1H15B 4WUUE 4WHTB 4YDIL 1SMAA 5L8KB 3ZE2F 4FG6D 4JFED 4YQXH 5IK3B 5EOCH 4RISL 4BQBA 1NC4A 3CFKB 5K59F 4JPWL 4WEMB 1MVFA 2P5WD 1F11A 3GSNB 3TIDA 4WV1C 1XF2A 3G6DH 4PYGA 2D9QB 4XPTL 4NBYB 1DBMH 1UKQA 2XTJB 3RAJL 4W68A 4DK6A 2HYMA 3CZJA 5EB9A 5JHDE 3ZL4L 2CUHA 2ESVA 3BZDA 3JUZA 3P9LA 5SWZD 3BP7B 4QHMB 2X10A 4TNWF 4PGJA 3C5ZD 5DFWH 4XC3H 4KXZH 1RVFL 3DUSB 1LE9B 3T8XA 3QIBA 4WI4A 3KYMB 1SM3H 4ODWA 5EZIH 2OZ4A 1DUZA 3IXTB 4ODTL 3JVGC 1NGQH 4M43H 4D0CB 3EHBD 1T0PB 1H0DB 3DTXB 2CIKA 4ZUUA 5DUPL 5ELIA 3V4UH 2ATKA 2APFA 3RTQD 4KK5C 2EECA 2ZOLB 5E2UL 3O9WB 3DETC 3ROLA 4Z0BH 3WSQH 5GPRA 5DMJB 1NLDL 1U2CA 3HCVB 2KPNA 5DRNB 3PWJB 1ZMYA 3WJJA 4R7NB 4OZGE 2W9EH 5T1DL 1S7RA 3QXAB 1M71B 1TQCB 4AIZA 4P23D 1J1OH 2DQTH 3QI9C 1INEH 3VGDA 5ID0A 4UT7L 2JJWA 1I3UA 3B4NA 3BN3B 3PXHA 4ZO8A 4YHNA 3LS4L 5HPMA 3BQUB 1OARH 1PLGL 3GBML 1FNFA 2AJVH 2XI9A 2AEPL 3MLUH 3C09B 3MNWB 4YGAB 1JPTL 2XKSA 4U2ZA 3JV4A 4JFFE 4XMLL 4M8QB 4ZDHB 1XR8A 4XBEH 4JE4B 4KMQA 4C58B 3CUPA 4OFYA 4UNVA 2DLTA 4P5MA 4X4MA 2J3SA 3FTGB 4M7KL 1F58H 2F54B 3D9AL 2OBGA 2VZ3A 2PTTB 4JGMA 4XXDA 1D6EA 4X9IA 4OQTL 4CU8A 5HHVH 2AGJL 2AV7B 2F9BT 4L4TE 2VXQH 4FQLH 2Y6SC 3RNQB 5ICYB 1KB9K 2I9LB 3D6GA 5TGBB 3X13A 4S11A 4JKPH 5ID1B 4KKCD 5EN2A 3VXQA 1FFPB 1MH5A 4NRXB 1DDHA 3T0BA 3G04A 4JQVA 5FCUL 4WVRA 3S5LA 4LVOC 2ZWLT 2N1KA 4U1LA 4PP2B 1NAMH 1KB5H 2C1OA 2NY2D 3D2UB 5E1AA 5BVJB 3IKKA 3TVMB 2AQ1A 2XN9A 1NCUA 3ZKQD 5JIIA 4E5XB 4KTDH 2Q76B 1FGNH 1IC7H 5ESVB 3S9DB 5GGRB 3BT2H 3U7YL 3QDJA 3ZKXC 2Z35B 2CK2A 3KPQA 3MLVL 2CKBH 1J88A 4F2MA 3HFML 1ZEAL 5FM8A 1SJXA 2D7OA 1C12A 4AEHH 4U1MA 2MKLC 3GKWH 2VLKB 2RJMA 4PLJC 3G08B 4U1IB 3ZDYE 5FUZH 3AROA 1GAFL 2VXVH 4F9PA 5DDHB 4ORZC 1MHPH 3RZCA 1J05B 4KKNA 15C8L 1X5FA 1F42A 4LVHB 1PKOA 2XIDA 2AK4D 3NFSL 5F7KC 4OGZA 5C8JB 2DTML 1PW3A 1G6RL 4QF1A 4ELMA 5EBLB 4D9QD 5J8OA 4Z8FL 1JPGA 3NPSC 4IMLA 43C9A 5ACZB 2V2TB 3QUYA 4NKDA 3KXFA 5F6HJ 1MCOH 1JZ3A 2NY7L 4E42A 5CBEB 2BRRH 2KDGA 4JM2C 4JY5H 2CRIA 3QUZC 3RDTA 4HJ0D 2DLEA 4QRPE 3IETB 2ZUVA 3JWNC 1JZ5A 5GRYA 3D3VA 4X7CC 3PWNA 4HKZB 5CP7B 5GISL 5JQ6H 1HHIB 4V1DD 5SX5K 1Q1JH 3QHFH 1D9KD 4R2GB 4XCYA 5DJ2A 1YEJH 1N2RB 4YHLL 1JYXA 4X6DA 2R2HB 3FQXA 3HMWL 5TJWK 4N1EA 2E7LC 5DD0H 1N5YH 3M17B 2NTFB 2IQ9H 3DXAA 3K8MA 2ICEB 4QRRD 4UV7L 4TQEL 5J4MA 1CLCA 3Q48A 1H5BA 2FBOJ 3VFTA 1FE8H 4GAJH 4P2OB 3B83A 1XF5A 1YQVH 3ZSSA 1FBIH 4J3SA 5IGXH 1R5WA 2DQHH 2JJSA 4P4KD 1Z5LB 3DMMC 1CDUA 1RZFH 2ZZUT 1A7NH 1N8ZA 4X6CB 4OZHB 2BNQD 5JORB 3DLQR 1AKJA 3O6FA 5DJ0A 1P7KA 3QFDA 3GSWB 4XNMB 2GCYA 2QSCL 4JZJC 2X89D 2EE3A 3WD5H 4RMWA 5DMYA 5F1NA 3U9UB 4PRBA 4RAHA 1ITBB 1AGCA 5C0GB 1T7VA 4DOHE 4LBEB 5EBWA 3BH9A 2BP3A 1XF4A 4ETQB 1LGVA 3ARFD 4ZODA 3UAJD 3VFVB 4PRID 3I50H 4OV6F 4NCC1 1IAOB 3LRSA 3ES6A 4HZLB 1AD0B 2A73A 3HE6D 3AY4A 5J12B 2X1XR 1P4LB 2W0LA 3K2UH 3FRPG 3ARDC 4YFEA 5I8CA 1JGUH 3WUZA 1ETZA 1OGAB 2BVYA 1EHNA 4BH8B 3R4DA 2VDNH 4HJJH 4MA8H 2OTWB 2ERJC 5AZ2L 2J1KA 5EU6E 4HMCA 3JWDL 3GUTA 4NRYA 4KRPD 2DS4A 4QHKJ 5KS9B 2X7LB 2ZG1A 1I1AB 2UVFA 4U1NA 1EXUB 1MIML 4ZD3L 3D39D 4MJ2A 4NKIL 4F80A 3PNWB 1ADQA 4OD1H 4XCFH 3RWFB 2Q3ZA 3FFCE 2AKRB 1H3GA 4U33A 5F7EL 1OSPL 1GZQA 4PREB 5E8DL 3HE7A 5J1AB 4M9OA 1T20A 4JREB 1V3LA 2AEQH 4XCEA 3TF7C 4WW1A 3NFNB 3WFBL 5IHZA 5L0QB 1NCDH 2EKSA 3JV5A 4G5ZL 1CLOL 4BSWB 4QXUH 5I1IH 4UOJA 2CK0H 1QKZH 3UDWA 3MRHA 5EDXA 1Z9SA 2C3XA 3MV9B 1NGPL 3G5XA 4YNYB 1QP1A 2PYEB 2ZSVB 3PL6A 4EBQH 3HZYB 3W0WE 2FWOB 1O5DT 2A74B 1MHHA 2NY4B 3PIQB 5A16A 1KIQA 2NZ9C 4JZOA 3C8KA 3L3GB 3BH8A 1VKXB 4NP4L 1XGQB 1OM3L 1IEHA 1HHHA 4Z78B 1JV5A 2BHUA 3W2DH 1EHLL 5MEPA 3MRDB 1CT8A 4KI5F 2VLJA 1LNUB 3GHEH 1YEEH 4O9HH 3T0DA 4F58L 1PQZA 3F7RA 4GAYB 4NNXA 4WGWB 4L9LA 3VXSE 5SX5H 1A6TB 1TJIL 1J1PH 4KUZH 1A2YB 4S10A 5FV2A 4GW1B 1DQTA 1T1ZB 2HT3C 4M62L 1K5NB 1FH5H 4XMKL 1FYTE 2FGWL 2P5EE 3R06A 5DO2C 1K2DA 1KT2A 4PJDB 3BW9B 5ISZB 4QNPE 1SY6H 4UT9L 3V0VB 3EJJX 3S3SA 2ATPB 3L3HB 4GG8B 4JM4H 1RZGB 5B21A 1QHPA 3P30L 1ORSA 4M7JH 4OKVB 3AS1A 5KW9H 2D4FA 1ZLSL 4O58H 4ZPVA 3VWJB 4F8TA 5J6HA 4W6XB 4YHYB 3PGDB 3VH8A 3MLSH 3OKKA 4XNXL 5BRZA 3KLDA 2OS7A 4RX4A 2E6QA 3KR3H 5KSAB 3CSYA 5ECJE 4I3RH 4LF3B 2ESVE 4MQXD 1NGXB 4XGZB 2W9DL 4GUPB 5LG1A 5BV7H 4WV1A 4Y5XB 5MI0C 2EXWD 4YDVA 2MQ0A 5FHBL 1CFSA 1MY5A 2ZG2A 3O6MH 5C0FB 4Q2ZB 3HLAB 1SYSA 2AJ3B 4LOUD 3QDAA 4TULH 3QHTC 4PJHA 3KPRD 1FC2D 1IAII 2F74B 3MA9L 3TO2A 4AJ0A 1ZSDB 4RAVB 1A1MB 4WFGD 3GSVB 4NN6B 1MFEL 3VFWA 3BEWB 4P99A 4XH2A 1AHWB 2CLVA 1DN0A 5DK2A 5DVKA 1QBMH 5DEGA 4NKMB 2XXMB 3GM0A 4ZSOB 3JVGA 3WHE1 1YUHA 5HDBE 2IBBA 3G5YA 3BPLB 4MJIA 1NGWB 4ZUSA 3INUL 4JFPA 3MLPA 4J3UA 3QFJA 5IT2H 4IRJA 3SCMD 2H8PA 3MX0A 4XP9H 4U6YA 5IB1B 5GRZA 4IIQB 4L4VA 4WWKD 1IAIL 3V4VH 3VWKC 1AR2A 1R3IL 2J2ZA 1YYLL 1U93B 2A9MH 4R90L 2X05A 5JW3L 2R9HC 4MDIB 3QCUL 4HPYH 4NN5B 4K3JH 4K7PY 3G5ZB 3QI9A 4JHBA 4LLQB 5CSZB 2OK0H 4PRAB 4WGVB 4NQEA 2VWEC 4F7MA 4KHTL 4X4ME 4TUJB 2FR4B 4HS3A 1NGZB 1JN6B 4UIKH 4WY7L 4ZPTA 2A6IB 3V6OC 1NSNH 4JO4L 1JNNL 4P2QB 2CR3A 1F4AA 3TA3C 2VDKH 1NC4D 1X5LA 4LASH 3QDMB 4PJ9A 3SDYH 4D9LL 1J18A 1OP3H 4PJGF 4LAQL 2W0KA 4HMEA 5TDNB 4Y16D 3JBG7 4YXLH 5IBUB 4QHNB 1RZIA 3RIAK 1RZKH 2F5AL 3KYOA 4ERSL 2IFGA 5AEAA 1NLBL 2YPLE 3MLYL 5CSBA 3GBLA 2XN9E 3T3MF 2BMKB 4JDVA 4BSVB 5I1JH 1P1ZB 4FQIL 3MRQB 4ALAL 2X09A 3MLRH 1LO5A 1SJVA 2B1HH 4MYWB 5JXEA 4RGOH 4OLXH 3UTTA 1CZ8H 3H9HB 4NQTA 2B1AL 4NOBA 2FECL 1G0YR 1MREH 1KOAA 3B5GA 5L9DL 4XRCB 4PY8J 3S96A 1CL7I 3EOTH 1MFBH 1OPGL 1C5BL 1NCCH 2BX5A 5I1KL 4NUJA 2UZYB 4Z95H 4M3JA 4PUBL 2H32H 3AREB 3S37X 4OZFB 1SEQL 4OCXL 3TZVB 4G3YL 4JRYE 5D7JB 4JFYA 2QADD 4FS0A 4Z5RB 1C5CH 3OB0K 4N8CL 5DHVA 4KKLC 1RZ7L 2FJFA 4XVJL 3U79A 1FZOA 4EOWH 4H88H 3VXRB 5BJTB 3KXFE 5CFHA 2XY1A 3TBWA 3SJVB 4O4YH 5ILTL 3PWVB 25C8H 1CL7L 5KANG 5JIPA 3GO1L 3GRWA 4M6OL 3TGXA 3D3VE 4L8SB 1BD2D 1Z9OA 4I9WD 2HKFH 1UM4L 4QO1A 4LSUH 5JPMB 1F3DH 3DROB 4OCNC 3EZ8A 4JM2A 4N5ED 3QUZA 4X6DE 1KACB 4ZOAA 1ZT4B 1BVKA 4WTZG 2AJSL 1YPZA 5HGAB 4WI6A 1BOYA 1U3HC 4Y4HC 1ZANH 5IKCA 3O3DA 3CZFA 6FABH 4PJIF 3B5TA 1KLGB 4V2BA 3FB7B 3GEWB 1VEMA 4LSVL 3IFLL 2DJUA 1FLRL 3ZSTA 1EBAA 2E7LA 1EO5A 2YXFA 2HVKB 4PB0L 5C0CE 3MRPA 4PJ5D 3P0YH 3GMLB 3VI3E 1LEIB 5HHQB 4R8WH 4Y5YA 4XPGL 3IXAA 2FJHA 5CJQH 2CIIA 5KBNC 2PN5A 3RY5A 1G7QA 3RIFF 5JQHC 3IDNB 4WHDA 4CU6A 2YPVH 1DQJB 3DMMA 4G80B 1N0XH 3HRPA 3L7EA 3SE8H 3GBNL 1L7TL 1FDLL 2YXMA 1F4XL 4LCCA 2W0FB 5KSBA 1IC4H 3CJJA 4JN1L 3UYPA 1NUDA 2OJZL 5MEQB 4PTUB 3OKDB 4JZJA 3G9AB 5FDWA 2VERN 3FOMA 4EDWH 1NBZA 3L3IB 1S78C 4DN3L 1ND0B 5ESAB 1FNGA 3RZCD 2VDOL 2JJVA 3I2CL 4XVSL 4OB5H 2BXZA 4OFKA 1V7MH 4LGPB 4DZ8B 3DBXB 2FX9L 2KZ1B 4JCLA 1DFBH 1RZ8B 3ECBA 5TH2A 3MCG1 4OLVL 3MGAA 3ARDA 5HHMD 4H5SB 2VLKE 1J0ZA 4N8VA 5BS0A 4ODSH 3MXVL 3DPBA 5F9DC 4RDQG 5DJAA 3TJEL 3QWOB 3G6JF 4EQ2A 2WBKA 2OTUB 1NJ9A 4UDTA 2B7DT 2B5IB 4X9FA 2W60A 1AP2B 3UC0L 1QEWA 5IB2B 1A3RL 3NIDE 3SKMA 2R1WB 4CRPA 4MA3A 3GJFK 1UYWH 5IV2A 4F7EB 4IOIA 4U0QB 1IARB 1QRNE 4J3TA 2WIMA 1A4JA 5EC1A 1OB1B 4TNVF 3VGFA 4M6MH 2JJTC 1TCRB 1IMHC 2XICA 1JGDA 2JKXA 2Q86A 3VXPA 1FORH 3QCVH 1IRAY 2F58L 3L3JA 5IVZB 1BQHG 4FQXD 3DXAD 3MSPA 2VRAA 4UI2A 1VEPA 4NHCL 5E99L 1AFVH 4HUVB 3WFEL 3U48A 2R8SL 5FGCE 3RU8L 3RNKA 1P69B 5HHOA 3O4LB 4FABL 1HILA 4W81A 1ZVHA 2R56H 3LEXB 1L9NA 5IMOA 4XX1E 4ZXBC 1NGYB 1YMMA 1EVTC 1AGEA 3F8UB 4DKEL 5A40E 3QA3B 3OV6A 1I7UA 1PG7W 1YMHB 2VLJE 3UTPE 3QIUB 3WE6B 3MRRB 4NT6B 3BIKA 1A4KB 4LEXL 2D3VA 5DI8B 3QRFM 3RBGA 5DD6A 3GSXA 5EO0B 1MUJA 2MKWA 1SEBB 1P2CB 5C0NC 2GJZA 4OM0L 3IDMA 5F44A 4PRHD 4E41E 4KXZI 4XNYH 1CE1H 2G75B 4NRZA 1T0MA 2VAJA 4J12A 1CBVH 3M07A 4YQXL 5EOCL 4XNQB 3R1GL 3LV3A 2GTWB 1KIUA 4GG6E 1AO7A 3AB0B 3G6DL 3I6KB 2DM4A 5I6XB 3VRJB 1Q9OB 3QR2A 3B9VA 1DBML 1NANH 1MCWW 2BVQA 2LVCA 2XOTA 2RCSH 2RQ8A 3UTQB 1R3JB 2WBJB 4X99A 4LRIC 3TN0C 1S9YB 3UYRL 4XC3L 4NBZB 3V9FA 5KAQF 4URTB 1M05B 4Z0XA 3VXUA 3K3QA 2VLLB 3K0WA 2XTJC 5D93B 4OCWH 1SM3L 1BVLA 5EZIL 2EDLA 1K3IA 4RGNC 5JA8B 4PGZA 4S1QH 1B0GA 1NGQL 4M43L 2JB6A 5EU4A 5FKPA 2Z0BA 5E8NA 3MOBH 1BFOB 4AH2B 3BP5A 4OGYH 2VSCA 1ORQB 5LBSH 1T03H 1JF1A 3V4UL 1DUYA 1U8KA 1W8OA 4K8RD 1Q9WB 4NJ9H 2P4AB 1IL1B 3WSQL 1JCKA 3BE1H 3KPMB 5F21B 3PWUB 5T1LA 4ZG1A 4DVBA 3HC4H 2R2BA 4Z7WA 5D7KD 2VDLH 3V7AE 5MENB 3THMH 1Z0NA 1M7IB 2W9EL 3IJSA 5JW4M 2ZNXA 2VISB 5GS3A 3SDCA 3O9WC 4GBXB 3RKDD 2DQTL 5E00A 2HLFC 1INEL 1I7RB 4O51B 5SV3A 3B3IA 4LLUA 4L3CA 4HHAA 3GIVA 3VFMA 5SWSB 4Q97A 2JLLA 1OF2A 5L2JB 4L4VE 1R24B 1VENA 4MB5A 1OARL 2AJVL 1IM9A 2PYEE 1E4WH 1N3NA 2HTKC 4XBEL 1TQCC 1G7IB 1XCQA 4KV5E 4PB9H 1P84J 4Y2OA 5GS2H 3LKSA 4GRWF 1T3FA 4Q6IC 1BGXH 3L5WB 1JNJA 3GJFH 5D6DC 4OTXH 3HAEB 3VWKA 1F58L 1U8JB 3DARA 1FV1A 4ZOCA 2LV4A 3BQUC 1OD7A 2QBWA 4NQEE 2IANE 5IW6A 3C09C 5HHVL 2CR6A 1HIMH 2OCFD 2VMFA 32C2B 3MLTB 1L7IH 2VXQL 4FQLL 2X6MA 3O6KH 4PD4J 4JKPL 3PHSA 5FYLD 3QJHB 5CD3A 4BJLA 1BZQK 1S3KH 4PJGB 3CVHB 4BH7A 3QH3B 3DSNA 1KB5L 3PGCA 1QSZA 1C08B 3QPQC 2DJSA 2DYPA 4KTDL 1FGNL 4PJDE 1IC7L 2OL3H 1U8PA 3OXRA 3DVNB 3OTTA 4XXCC 1H3PH 3BT2L 4HS8H 1YN7A 2J8OA 2Y25A 3VXTB 4D9RD 2E27H 5DSCA 3IAQA 3OL2A 3WBDA 1Y18B 4M1GH 5AAMA 1ZHBB 2CKBL 3VFUB 4ENEC 3MR9B 3WUWG 3TVMC 4FQCL 2OZ4H 4KQ4H 4ZO9A 4AEHL 1BIHA 4Q9BA 4X83A 2BVOA 1KBGH 4UNTA 3GKWL 2C3VB 3NFPB 1NKRA 3C5SA 5FUZL 4MB4A 1HCVA 3KPLA 5CZXC 1MHPL 4L3ED 3RPIA 4IEFB 3ALWA 3LQZA 3B9KD 1HI6A 3ETBF 4FZEH 4NQDD 4GLRH 3PJSA 1L4IA 4U6XA 3OKOA 1S9VA 1LEGB 2WMPA 3F7YA 2N4IA 4FQQB 2M1KA 4I18B 2IWGA 1MCOL 2XG4A 4MJID 5I9QB 1YEDB 2BRRL 4BFBD 3QFJD 2I25N 4NKOB 4LVHC 2ZPKH 5TFSH 2V5MA 5C70A 3IFOB 1RY7B 5IJKC 1BF8A 4JFHD 5T3ZE 1M7DB 3AS0A 1RJZB 1I8MB 4I48B 4ESKA 1NDGA 1JHLH 1GYAA 4CVZB 3NN8B 4G6JL 4XVUC 1KLFA 3O8XD 2AJZB 4O2EB 2XFXB 3TBVB 1UVQB 4XPBH 1Q1JL 3QHFL 2Q8BL 3B6SA 4ZSOE 4POYA 1YEJL 3RKPA 4EZMA 4IHOB 4NWUH 5I1DA 1A02N 3WIHA 3RWIA 1JGEA 4J6RH 5HSFA 1OQXA 4XCNA 5DD0L 5HI3D 2X44D 3G6AB 2IQ9L 1YEKL 2P24B 2X4QA 5F9JA 1I9IH 1FE8L 4GAJL 4KTEL 1KJ2H 1YPZE 2NW3B 3G5VB 4R2GC 1E4JA 4PJIB 2NZIA 4ZUWB 4HXBH 1GOFA 1YQVL 3IGAB 3MRMB 1FBIL 5IGXL 3OJ2C 1ZA3B 2ADJB 2BC4B 2X9XA 1RZFL 1U8NA 1A7NL 4RFNC 1GC1C 5IR1A 2P5WB 3DX9B 1T1XA 3RL1B 3K4AA 3EW3B 1I9RH 1U3HA 4P2OC 5GRVK 5JR1H 4MQ7B 2QKIB 4Y4HA 4CW1B 1UJ3A 3Q2CA 4LVNB 2F53D 3WD5L 3RWCA 2Y6SD 1FNLA 4OAWA 5DMGD 2W9LA 4WHYG 5FUCE 4M5ZH 3E3QC 3M45A 2V7HA 2A83A 3UEZA 5FOJA 4P0DA 5FGBC 2YPKB 3C6SA 3PDOB 2FIKA 4M4PA 1JVKA 1AC6A 4OQ1A 3I50L 2BSTB 2VL4A 3UTTD 4JO3H 5I1LA 1FIEA 5IMLB 5KSBE 3PABA 5KOMC 5FCSH 1D3CA 2Z8RA 1JGUL 1DE4B 2KQMA 3EDKA 3JWOH 4DTGL 4RFEA 2KUTA 1YEFL 1U8OB 2QR0A 4GW4B 1C7TA 2VDNL 4HJJL 4D0BB 4MA8L 3TYFB 2V5TA 5J12C 3I6LD 1WBXA 4X6BB 1XGRA 1BIIB 1XGPA 5A2FA 4HWBH 5AWNH 2VN4A 4QTHB 5DVNA 4MAYA 1AXIB 4YZFF 1OP5H 2R0KH 2XG5A 4FFZL 5BS0E 2EEDA 4OD1L 3G6JB 3V0WL 5DD3L 4XCFL 2R23B 1HZHL 4LEOA 5CZVH 5C6WH 3LKNB 1OTUD 2WUBL 4HUXA 1CG9B 2DM7A 3ZKMC 3HUJF 1OD9A 1MNUH 4PRNB 4LAJH 4HFUH 4AK1A 1G6RB 1XIWB 2COQA 3BO8A 1NCDL 1E28B 1FHGA 5I1IL 4JM2D 3WLWD 2RAMA 2CDFB 2VLRA 3SJVE 1FL3A 1GRWA 1RULH 1U8LB 3U30C 3QZWA 4CKVX 5B39B 4XAWH 1J11A 4JKLA 3T2NH 4WEUD 3GMRB 4W6YB 4G9FB 4EBQL 1QNZH 1FFNB 1MI5B 4HULB 5L0QC 1W0VB 4WI7A 5F3BA 1OSZA 4ZFOB 2JJTA 1KNOB 2V6HA 1I1FB 2BY1A 2H6PA 4IDJL 4ACPA 3MRBB 5JW5B 4TVPD 4QHUA 4J3VA 1R3LB 3ULUC 4QRTA 4U1KB 4NQVA 1HEZB 5E8OA 2Z8SA 3GHEL 1YEEL 2WV3A 3MRGA 4O9HL 2AVGA 5L2KB 3QYCA 1PZ5B 3MRNA 2QTEA 3FQWB 2BSRA 4ZXBA 5CEXB 3TIEA 4KUZL 2IMMA 5E8PA 1UG9A 4ZUTA 3STZB 4FTVB 3WL9A 3RX5A 4RNRA 1MHEB 4HFWB 2PTVA 1ZHNB 5FA4A 4KK6D 1SY6L 3EO0A 2HRLA 4O2CA 2KQNA 3T1FA 1CXFA 1VACB 1X4YA 3UROR 1KIRB 4K7PH 1T6VN 1HQ4B 4M7JL 5ERWA 5KW9L 5DJYA 2FSEB 4Q74A 3QNZB 4LDEB 1TENA 3MJ8B 4H25B 4P2RA 1MFCH 4K23L 1AO7E 3MLSL 3N0PB 4E9LA 1IGCL 3QQNA 2BY2A 1WCQA 1HSBB 3UMTA 4F3FA 4JKMA 5C09E 1S7TA 2NY3C 4JLRA 3KR3L 1X5XA 3AMLA 1ADQH 2BERA 3ARDD 4XI5C 1B88A 3ARBC 1U8QB 2GT9B 3L5HA 2H3NA 4PJ8C 1CE6A 5BV7L 3VWJC 5HHXH 4P57A 5MEOA 2JB5H 4ONFH 5F9OH 4G6KH 1H15A 3FAWA 4CVUA 3DX8B 3RVWD 4KKAC 5IK3A 5KSAC 4TULL 3IVKB 4LRIA 3TN0A 4BM7A 2HRPH 1NQBA 3GSNA 1PG7X 5HGBB 1HQRA 5LXGL 4Y5XC 5H8DA 2ITCB 3MGOB 3L3OB 4KVCH 3MXWH 1YJDH 4EEEA 1T21B 1MRDH 1Q72H 3PDDA 3QPXH 2R2EA 5IOPA 3OKMA 5AYQA 2BK8A 5E4IA 1QQDA 1T66C 3ZDXE 2R4SH 4TSCL 3LVEA 5E0QA 5IT2L 1QLFB 2R0LL 4NN6C 1MWAB 4YHKH 1QO3A 4M7ZB 4L8BB 1FFRA 1VA9A 4R0LB 3KYMA 3CFEB 2AXHA 3V4VL 4HBQA 5F1SA 3IXTA 3LQAC 4JJHA 4M93B 3DNKA 4HV8B 5I19H 2A9ML 3DX6B 1KELL 4HIEB 3P11H 3KPSB 5DUBB 3DGGA 5DYOB 2ZOLA 3O9WA 4HPYL 4LARH 4GRWB 3BX7C 1MPAH 4IIQC 2NZ9D 3P9MA 2FJGB 4EUPB 3PWJA 3K80A 3PP4H 1TZIA 5GRJH 4Y19B 3BP6B 4HQQH 5GHWH 4UIKL 2NTSP 1CLYH 5DFVC 2EE6A 4H26A 3DYOA 2BCKB 1NSNL 5HYQA 4NN5C 2RHEA 4QOKD 4MCZB 1G7JB 2VDKL 4Q6IA 4LASL 3QEQD 5D2NA 2DQFB 4R4ND 3SDYL 1TMCB 1U2HA 4JANB 5D6DA 5AZEL 4GO6B 5H94A 3BQUA 4YXLL 3IJHB 3TCXA 1RZKL 1C1EL 3MNWA 1EMTH 2IAMA 4F57H 1HSAB 5CILH 5DO2D 2J88H 4UAOC 2I5YH 1QUNA 5IBLC 1JK8B 3ARUA 1UWXK 1FNSL 1AD9B 5I1JL 3T0AA 3WN5C 3FAXA 1HXMB 2F54A 5H37H 1I9JH 2J5LB 4KH2A 4MNGB 1EIBA 4JG0L 3OAZH 2DQEH 4AL8H 1S7WA 1S9KC 3VXUD 4RGOL 4OLXL 2AV7A 1CZ8L 2BVTA 3RNQA 4MJ6A 5ICYA 2I9LA 3RWEB 5TGBA 3QXWA 3WFHA 1MREL 3RVXC 2I9TA 4AIXA 4YH6A 4Z7NE 2WBWB 3QHZL 2IBZX 4XXCA 2JE8A 3EOTL 3LZFL 1FL6B 1NCCL 5IEHB 1DANU 1MCPH 5BVJA 1WJ3A 5BW7C 4DZBB 4MHHI 2Q76A 1CICB 4YUEH 3U2SA 3OAUH 1JHKH 5T1LD 1IGYB 2GW5A 1C5CL 2BSED 5GGRA 4AM0B 4GMSH 2H41A 4Y5VA 2FATH 1PKQE 4HS6B 4PJ7F 3T0XA 1NEZB 3U1SH 4JCMA 4EOWL 4H88L 4J8RA 3AREC 5KVGH 4O4YL 5HI5D 3OR6A 1UZ8A 25C8L 3PWPD 2J7LA 4FXKA 5D7JC 3QDGB 2EO9A 3UTSB 4AEEA 3G08A 5EU3A 3FO1A 2FEDC 5HYIA 3MROA 2YSSB 2JCCA 1A7RH 2R4RH 4LSUL 4PGBA 4DCQB 4G43B 2VLMD 1CF8L 4QRPD 4ZAKD 5GGVY 5IJKA 3V7AG 4BELD 4XNUH 2EDTA 3BGFB 4M00A 1U6AH 2XACC 4NO0D 5DJXA 2HAZA 4L8SC 4Y2DD 1ZANL 3X17A 1MEXL 6FABL 4MSWB 2YS4A 5CBEA 1BZ9B 1EO8H 3EYUH 3MA7B 4HEME 3ME0A 1K4DB 3IETA 3VU2A 1LD9A 5DRXB 3WIFA 1J8HB 4HKZA 2J8UF 3P0YL 5CP7A 1ULVA 3DO7B 1HHIA 4R8WL 3RHWK 4OLZH 4MAUH 1GXEA 3SKOB 1KXQE 3QJFA 3C8DA 1AQKL 2R2HA 3E6HB 4PP1D 2YPVL 1FFOB 1WT5C 4KJQC 1FL5A 3MYJB 3SE8L 3TA3D 1A7PL 1ED3B 4P59H 2DKUA 1UA6L 3VXMB 3OKYA 3HRZB 5HVFB 1GZPB 1IC4L 4I1NB 2DIAA 4CVXA 1TTGA 4PGEB 2NQCA 4S1DC 2W1NA 3MQIA 2D7PA 5FO7B 3TCLA 4I3GA 4Y1AE 2Q8AH 5FIEA 4EDWL 4KI1A 1Z5LA 4PG9A 1YDPB 5FGBA 2PR4L 4YGVB 2APVA 5FYJD 5C0AB 5D1ZC 2DQIH 3GSWA 3FONB 1S7QB 1QSFB 4KGJA 3IT8D 1KLUA 1V7ML 1NFDB 2NPLX 2VL5B 5D5MF 1A9BA 1DFBL 3B2VH 2EYTB 1LWRA 1LP9A 5DHVH 4OFIA 2EIEA 4YBQC 3X3GH 5C0GA 1MIEH 1T22A 4F15B 4ODSL 5F7DB 4ZFGH 3AXLB 5IVXA 4B7LA 2V9RA 3H3KA 3QNXA 1XT5A 5TDPB 3GRWH 2CLZB 5B3JF 3CH8A 1AD0A 4HZLA 2FX8H 1VFAB 4RIRA 1IBGH 3TT3L 5EC2B 1P4LA 4PJXA 4JY4B 3R0MA 1JRHI 3HUJB 2GY5A 1BP3B 1JTPA 2NX5A 4XZUB 4KKLD 3SDAC 2W91A 2OTWA 3FFCD 4I3SL 4N1CA 1FORL 3QCVL 5T5NG 3BOVA 4N0CC 2HVJB 3SGKC 3OJDB 3VMPA 4QTIH 5KS9A 2X7LA 1AFVL 2X1QA 5DJ6A 2V2XA 1EXUA 2O5XL 1FZMA 3PNWA 3LPGA 4TVPH 3TO4D 1CU4H 3OF6A 4AT6B 4Z77B 4X4ZA 5DZNA 1V8HA 4HG4K 1RV6X 1WAAE 5DURD 2XXCB 4H0IA 3U4EB 1XGUB 4Y4HD 3W9EB 2VQ1A 3ILQC 1X3DA 3UJTL 1F90L 3NMEA 1NANI 3QB7C 2XKUA 3D5OF 4MD5A 5D2LF 4R7DB 5EOQH 3MV9A 3HTLX 5HYFA 1FP5A 3H0TA 3OQ3B 5GGRY 5IW3A 2HFFA 4OCYH 4XNYL 2FWOA 2Y06H 3KYAA 3QIUC 3RUGA 4RA0C 5C0BA 1CBVL 3VXSD 3L3GA 2EICA 3NIGF 3PHOA 4KPHH 4Z78A 3LKPA 1IGFL 3MRDA 1RJYA 3OBAA 1EFXB 2EDOA 3IF1B 1LNUA 2J4WH 1T80A 5DRZA 3T0EE 1KXTB 5EORH 4ODXB 4YWGL 2RCSL 1NBVH 3VG0L 1WVZA 3VXNB 4B41A 5D7LB 4KQ3L 4DUWA 3HNTH 5A1AA 2FX7H 3QCTH 4CDHA 2VN7A 5IBUG 1IQDB 4I0PD 1T1ZA 3AB0C 3QUXC 3EDDA 4MS8C 3U0WH 1HINH 5E9DE 1IC5H 3H9SA 1EEZA 4WO4A 1BWMA 1X9QA 2WBJC 2XQBL 1OT2A 4JKKA 1T7WA 3MOBL 5FB8B 4EI6B 3L3HA 4GG8A 4JFXA 4OGYL 5LBSL 3C6LD 1T03L 5D70H 3ARBA 4PJ8A 3GSOB 3VWJA 1WEJH 4HJGB 3BE1L 4R96B 3N9GH 4EIZC 4JQXC 2VLRD 2Y5TB 5ANMA 3T4AA 4N0UE 2DQCH 5KSAA 2ZOKA 3THML 5C07A 2VE6B 4RGNE 4X9HA 3UJIH 2IPKB 1LQSR 4M7LH 1IFHL 4XGZA 4GUPA 3S36X 4OZFG 4Y5XA 4JFQB 1NAKH 1T4KB 1N5AB 3LD8B 3M8OH 4G8EA 2GAZB 4OBSA 4PJ5B 3VE0B 2CKNA 4JAMB 4KJPC 5J11C 1OGTB 2K7PA 3H9ZA 4UZGA 2E6PA 5F89B 1E4WL 1U8MA 1XGTB 3VGGA 4QGYA 2ZUUA 1ZLVK 4KVNH 1ZSDA 2Z31B 4XBPA 4G8IB 4PB9L 5TE7H 1BQUA 2LVEA 2YKLH 4NQCB 3BEWA 1BGXL 4G8GB 3VMOA 1T2QH 5FA3B 4NKMA 3L95A 1OAYH 1GGCH 1HIML 4ISVB 4UIMB 5FUOH 3S3JA 5IIEA 3O3EA 2IH3A 2VZUA 3O6KL 5AD0B 2AQ3A 3HMXA 4IIQA 2C3GA 4N90D 1S3KL 1HXYA 3I9GH 5D2NE 3RY4A 1EAJA 5K33A 3B9AA 5C0ND 1D7FA 3BD5A 4P2RD 5D7IE 4MDIA 1GCFA 1ROWA 5JLZB 4M61B 1H9VA 1DSFL 1V7NH 3ARGD 1CDYA 1NKOA 1QSVA 5CSZA 4W6WB 1H3PL 2AAVA 4GLRI 2E27L 4QXGL 4M1GL 1ZWIA 3C5JA 5T1MB 5B8CC 3GK8L 2OZ4L 1NGZA 1U91A 1K3ZA 4JFDE 3K8KA 4P2QA 4UBDC 5IWLC 2VXUH 2A6DB 5D71H 3WKMH 4X7FC 3MCLH 3WN5A 5INDB 2X1PA 1DLHB 3OGCB 5TDNA 3FB8B 1YNTB 5TE4H 1F4HA 4FZEL 4NHUA 2XTJD 3LN4A 1MJ8H 4FOMA 1D5MA 4HPOL 4Q9CA 3LH2H 3HR5A 4BSVA 3BZEB 2GIYA 4PJ7B 5IW1A 3DRTB 3SGDH 3B8SA 4DAGL 1U95A 3D85A 2C7UA 4NN7B 5DHYB 5TFSL 5FGSA 3JV6B 4OCMC 4MQTB 4GRMB 1S8DB 3GMMB 5BW7A 5FF6B 4JRYD 1F2XK 5A2KH 3TFKD 4FXGB 1BOGB 1JHLL 4GKZB 1DQQB 2JF1A 1IGTB 3N1PC 2V9TA 4XRCA 5HYSG 5FK9B 2EIZA 3NZ8B 4C59B 4RMUA 3V8CA 3WDJA 4I18C 4LL9A 3RRQA 5CLWA 5I9QC 4NWUL 2JCCE 1J0YA 4J6RL 3VFOB 3FQNA 3AREA 4HGKC 2BOBB 2HLFD 1CD0A 3ARZA 4PJEF 5D7JA 4BFIB 5EBMA 1I9IL 2DQGH 3JUYA 4CMMA 3ZDZE 5CEZH 3FRUB 3EUUA 4PRHB 1T0NA 3UTOA 3RWGB 4HXBL 2PYFB 5DQ9B 4U1SB 3KPSE 5EOCJ 3HS0B 2J8UB 5EZLB 1FNEB 2NW2B 3QEGL 5D7SH 1MFDH 3BD4A 1I9RL 4TUOB 4Y4KB 1NCNA 5F7YC 3BQUD 5JR1L 3O2WH 1MLBB 2AEWA 4L8SA 1XR9A 3QO0B 1Q9KA 1S9XA 4X80H 5DT1H 4PJFA 4UMGA 5I74C 4M5ZL 1MF2H 5C0CD 1ZT4A 2H26B 2Q3AA 5HGAA 1HH6A 4MB3A 1BWWA 5EZOH 3BRDA 2PCPB 1T5WB 1ZLVH 4IMKC 3UTZB 3DWTA 1KPRA 4R9HA 1CFQB 3N1GC 1P4BH 1S5IH 4I5BA 5I16A 4KAQH 2IH1B 4JY6B 3QPQD 4S1SH 3ZHDA 3FB7A 3ALXA 5FYJH 1NCBH 4QRSB 5I8OH 1WT5A 1KB5B 3UO1H 3V5KB 3JWOL 3C5ZC 4HBCH 1HNFA 1Y6KR 3GMLA 5HHQA 2SEBA 1KV3A 2BNRB 4JFOB 1CD1A 5HYEA 3E0GA 1BEYH 3D2UD 3TVMD 5D5MB 3FO0H 3LRHA 2DWEB 4HKJA 5ICZB 2CKBB 2EIDA 3O4OB 2YUZA 4BZ1H 1DQJA 4ZUVB 3EHBC 1LP9E 5AWNL 3ULVD 4JVWA 1QG3A 2GK0B 2R0KL 3RTQC 3BPCA 1V3KA 5CZXD 1MJ7L 3BISA 5D1ZA 5GGUB 1RD6A 1W2KT 3U7WH 1CXHA 4NO5A 4PTUA 5CZVL 1AGDB 3CGTA 3CXHK 2BVEA 4KGLA 4LSQL 1TQBB 2VLKD 1MNUL 2X4TA 3L3IA 4PJXE 3WIHH 2D2OA 4OZGF 4NYLB 1DZBA 2OR9H 2NX5E 2DICA 3M1BA 4P23C 2PXYA 4KFZC 2AABL 4OJFH 4DZ8A 3DBXA 1RULL 2DMCA 1IC1A 3FB6B 5I1CH 4XAWL 3MV7B 3CLFH 2MPAH 2B0SH 3T2NL 3VD7A 2O5ZH 1VFUA 2FNBA 3RJQB 1XIWC 3LEVH 2OTUA 3SDAA 1IE5A 3DV6A 3UYOD 3CPLA 5IB2A 2NLJB 2NNAB 4PG2C 3SGKA 2AJXH 5IJVA 2BSSB 1ONQB 4AQOA 3W5NA 1CGYA 5IG7B 5IQ9B 1A6UH 4F7EA 4P5KB 4HD9A 1RAMA 2FYYA 4NDMB 3C2AH 1TCRA 5D2LB 2JELH 1K8DB 1J1XL 5DJDB 4RRPG 1J8HE 2PW2B 1GGBH 1AJ7L 4MDJB 3O41B 4IOFC 1JWSB 5L8JB 4MCYA 2NY2C 1TNNA 4P2OD 4HUVA 5K9KA 1DL7H 5KG9B 2ADGB 1ZS8A 3O4LA 3UTPD 5EFIA 4PJAE 3T4YA 1CIDA 4XBGA 1IJ9A 3KPOB 3D25A 5GIRB 4PBVC 4APQB 3HAEG 3LEXA 4RWHA 3RUGE 5DD1H 1NGYA 4K7PL 4QYOA 3ARTA 2WUCH 2AI0H 1DTUA 2Z91B 4QRQB 4E41D 4L3EB 5HYJA 4K2UH 4BQ6A 2O26U 2WQRA 4MNHA 2H45A 5DS8A 4TVSa 2AJYL 4B53A 3QIUA 3WE6A 3MRRA 4NT6A 5F71A 5IB5A 1NAMA 5GRVL 5GS0L 3ZDYF 1ADQL 1FAIL 1S7SB 4XAKD 3WV0A 3ZT5A 4N0RA 3GMQB 4X7TB 3L5IA 5HHXL 2JB5L 4ONFL 5F9OL 5C0AE 3JXAA 2G75A 4G6KL 4HX1B 4MGXA 1NFDE 2AW2A 2GTZB 3H9SE 4RWYH 3O6LH 2G5BB 3WNKA 1D5BA 4XNQA 1YNKH 1RUKL 3S37H 5BVPL 1ZHKB 1OGAD 3QUXA 1UT9A 4P4RA 2WP3T 2MFNA 3I6KA 4ORGB 3VRJA 2VZ1A 4FP8H 5GRUH 1EEYA 1FVCB 1YEHH 3MXWL 1YJDL 4KVCL 3BZFB 4LLVA 4KWUA 4HJ0C 4YHOL 2APBA 1Q72L 3RIAF 2CD0A 1FVDA 4N9GA 3QPXL 1B6DA 4RFOL 2EC9U 3X14B 2WBJA 1R3JA 3KWWB 3GSUB 1S9YA 1JHTB 2R4SL 4X5XB 1I1AD 1M05A 4N8PA 5C07E 2Q6WB 4WI2A 4YHKL 3OXSB 1PY9A 4JQXA 2H2PC 4GQ9L 2PNDA 3GSRB 3MFGB 1BFOA 5L88L 3X12A 1OCWH 3BZ4A 3DV4B 1ORQA 4KJWD 4LNVA 3P11L 2YUWA 4LRNH 2WLZA 5FHAH 3GMNB 4LARL 4PBWD 1SJEB 1RUAH 4R0LC 1QLEH 4PYHA 3KPMA 4KRLB 5IB4A 4YR6B 4YE4H 1RIUH 3BSZH 3PP4L 3V5DA 1F97A 3MV8E 3MV9D 1CQYA 5MENA 3LCYA 2PYED 5GHWL 3L9RB 1CLYL 1G7LA 2GI7A 4PGDA 1EJOH 3CU1A 2NY4D 1A6PA 4WEBH 3VA6A 1FG2A 2GHWB 4MJ5B 5BZDA 4LPWA 4O51A 5SWSA 5GGVH 3WO3B 2G60H 1KB9J 1EO7A 3PP3K 2IAND 2IBZY 1FN4B 2YD4A 3UAJC 4UB0H 1EMTL 4FZ8H 4F57L 2DI9A 1BLNB 5CILL 2J88L 5EUKA 3IDYB 2I5YL 2V5YA 3HE6C 3QEHB 1G7IA 3MLZH 4ZS6C 4DVRH 4NC1C 3DYPA 1J5OL 1VGKB 3K46A 5JOPD 4HIXH 1IQWL 1OAQL 5L7XH 1U8JA 4JPVH 4MNQB 3G9VA 5IQ7H 4PRPB 5FFLA 2DBLH 4WFEE 3MLTA 4QY8B 3H42L 1WFNA 1JPFB 4L4JA 5ISZD 1WIPA 3GIZH 1X5YA 3FCTB 2YMXH 3GSNH 2GFBA 1MHCA 3CMGA 3IU4H 5I30H 3P0VH 1F00I 2J5LC 4XI5D 4P5TD 1T5XA 4QCIB 1MCPL 5I15H 5B8CA 2A1WL 5J06A 3VWJD 5B38B 2DMBA 1BHGA 2CRZA 2FO1A 2HTLD 2D03L 2EDQA 4YUEL 1JHKL 3OAUL 1KTLB 5BV7B 3GGWA 5IWLA 4GMSL 4C56B 1GOGA 1QVOB 2FATL 4LPYA 3L3KB 1Y18A 3IDUA 3VFUA 2UYLB 2V2WB 5DQDH 5KVGL 2P8PB 3WNOA 2WP3O 2ZJSL 1ZE3C 4FA8A 1T66D 2EC9T 5AG8A 3HG1A 5FO8A 4MA7H 2XA8H 1A9EA 1QSEB 1CXIA 5T3ZD 3DYMA 5IROC 2AXFA 2NMSA 4ZO6A 3MCKB 1EHXA 4PJEB 1FCCA 4XNUL 5M7QA 4RSVA 1U6AL 2YRPA 1NC2B 4OF6A 3TYGH 3FO2B 1BQSA 4I18A 1DVFB 4GFTB 1A6WL 1YEDA 3EYUL 1EO8L 3EFDL 1UCBH 4NKOA 3IFOA 1ACZA 5T3XD 4J3WA 4OFPA 1EEQA 1QFOA 1RJZA 2D7TH 3FO9B 1I8MA 3BGFC 3NN8A 5K9OB 1HHJB 4XVTH 5J7CC 3UPRB 4O2EA 5HGDA 2EEBA 1FAKT 4MAUL 1UVQA 4K94H 4E0RB 1TNMA 1N6QL 4WUUB 1R5IB 3LKRA 4QNPF 2ZSWA 3QQ3B 1QFWL 4PJFE 3QG7H 3DX7B 4P59L 2JIXB 2P24A 2EH7H 4EXKA 2R29H 1E6JL 2E7MA 4LLYB 3A0OA 2NW3A 3C8HA 1AR1C 4NZDA 5FYKD 4ZUWA 1KC5H 3HPJA 4Z7QE 2Q8AL 2WZPD 5JHDB 5JNYB 3U0PB 2ADJA 2BC4A 4NJAH 2Z93A 4JFEA 1I3RA 3OKNA 3VCLA 5IBLD 2PETA 4WTXA 3QDMD 1BF2A 5ETUB 2P5WA 3SDDB 4AEFA 5LGJA 3S6CA 1S5HB 4HMDA 2BJMH 3HNSH 3TBYB 2VUYA 2P7TA 4KJYB 3B2VL 2K1MA 3X3GL 3PP3H 3SKNB 2KL6A 4HF5H 3TBTB 5EWIH 3RVXD 5HHPA 4ONHB 3OKEB 5SWZA 4UQ2B 3TNNA 4ZFGL 4WU7B 3C5ZA 4ELKB 3S88H 4PIRF 4UT6H 5CUSH 3DUUA 2NY5C 2BSTA 2X4PA 4EN3B 3LHPL 3GRWL 4K3EH 5I17B 2FX8L 1IBGL 1T1YB 4CBPA 5KN5A 1EJ6A 1YNLH 2GJ6B 4J2XA 2VITA 3VG9B 5JDSB 1DE4A 4F15C 5JHLH 2CLRB 5HDBF 4OZGB 1U8OA 4KROB 1MCLA 4HK0A 1VERA 4YC2B 4D0BA 3SCMC 3RTQA 3H3PH 5E2VL 2FBJH 3DO3A 3TYFA 1AGBB 3ARED 1F5WA 4WWKC 4LU5H 3VXOB 3OWEA 3TZVD 1JZ6A 3L1OH 4QTIL 1DBKL 3MREB 3BKJL 2CO7B 3EYOB 4QTHA 4LLWB 4WFHD 4PY7B 2FEDD 5E95B 5IHBA 3KPNB 4JFFB 3F7VA 3RQ3A 3G6JA 5H35A 5HD8D 2R23A 3OGOE 4OIIL 3VXRD 4P23A 1KN4L 3SJVD 3DHMA 3UBXI 4M3KB 3P4LA 4ODUB 2ICWB 1CG9A 4PR5A 3ROOB 1NEUA 2EH8H 1IZKA 3BDYH 4PRNA 4GRLD 5CEYA 2D9CA 3BAEL 5EO9B 5T1KB 3IFNH 4L4TB 1IKFH 1G6RA 1UEMA 1TVBB 4GOSA 2X4UA 1GC1H 4X4YA 1RJLA 5I1HH 2CJUL 1S9WA 2CUMA 1ZT1A 1CXKA 1U8LA 5B39A 4O5LH 4GKSB 1RK0B 4PG2A 3P3YA 1IM3B 5F97E 1J8KA 4JG1L 2ZKHH 4OCYL 5E6YA 2DLGA 2Y06L 3W9DB 2IFFH 5I76B 3BDXA 5ADOL 2MWCA 4ZFOA 2XZCH 1QTYT 4J23A 4OD2B 4RAUA 1KNOA 4EUPG 2DB8A 5JOEA 1ZGLM 4TNWK 3MRBA 4KJQD 3JSSA 1TITA 4HLZG 4YHMH 3FB5A 1IAKA 4UDUA 1MJUH 3LEYL 4O02H 3VRLE 4HKXB 2J4WL 4X4XA 3EOBA 3NPZB 2P8MB 5HYJE 5L2KA 4S1DD 1PZ5A 3OX8A 3LQMA 1NBVL 2LFGA 3ZE1E 3WLBA 4QRUB 3HNTL 2HLAB 5KANI 2FZ3A 1XGYH 3QCTL 3VJ6B 4FTVA 3O3UN 1HINL 1IC5L 1SJHA 3QT2A 1MCJA 5DD5H 4G8FA 4GW5A 5GS1A 2EDNA 4RCAA 2QADC 5JO5A 4KZDH 2BZDA 1I7TA 1TCMA 4LNRA 4YBQD 2ITDA 3KYNA 3DURA 2ICWJ 1F3DJ 3PQYE 3QO1B 3T09A 3OR7B 5D70L 4K3HA 2IPUK 4M5YH 2FSEA 3MODH 3AU1A 5GZNC 4H25A 1WEJL 1FO0A 2EYRA 4HT1L 4QRPB 2AK4A 1TJHH 4CUCA 3N9GL 2N56A 3ZLQC 1HSBA 5CZKA 5DC4B 1AI1H 2DQCL 3ARPA 2H32A 2WWMD 3MUGB 1Y6NR 1KCUH 3UJIL 3S4SB 1U8QA 2GT9A 4M7LL 3STLB 3KLHC 1NAKL 4Q9RH 3CSGA 2X4NA 5JUEL 4X6DF 3M8OL 4H1LB 1DJSA 3BEVA 5FYJU 3FQRB 5IMMB 3EJZC 1QPXA 4EVNA 4N0CD 1G7HA 1A47A 1NEZG 4IDLA 3IVKA 4V1DA 4JPIB 4LHUB 3O11A 4R3SB 1IVLA 4KVNL 3RVVC 1W72B 4X5WA 3BXNB 5TE7L 3L3OA 3LD8C 2YKLL 2GITA 3ILPB 3MJ7B 3ULUH 5D1QB 2DLIA 3NCJH 1T2QL 1FZKA 3VI3F 2XZZA 4QRRA 1OAYL 5HY9B 5DR5L 2O5YH 1KJVA 1GGCL 3SBWA 3VDBA 2YRLA 3CFJB 5JOFB 1RMFH 2Z31C 2XWJB 3O4LD 3MPCA 1QLFA 4IS6B 1MWAA 2FO4B 5F93C 3ILQD 3H7BA 2N7AA 3EAKA 4R0LA 4Y7MA 3REWA 5E5UB 4DOHB 3I9GL 1A21A 1F6LL 2BNQA 4HV8A 1UQSB 4KI5D 3B9EA 3CXDH 3DX6A 3HB3C 1AGFA 4HIEA 4LKCB 4PPTA 5GGSA 1R3HA 1V7NL 2AJUH 1UFUA 3KLAB 1CGVA 3QUMA 1MQ8A 4YK4C 5KSUB 1E6OH 5F96L 2AV1B 3ARFA 2KH2B 2C5DC 1E27A 1HDMB 1CFVL 5EU6B 2BCKA 1EHAA 3X11B 3HE6A 4K3DH 3WS3B 1CGUA 2VXUL 5D71L 3WKML 4MCZA 3MCLL 1A6AB 4XPHL 2DQFA 4JANA 4NQSA 4UU9B 3OHXB 4LIQH 1RSFA 2EDDA 3U6RB 3U0TB 3EFFA 4R4FH 5TE4L 3FFCB 3DUHA 4G6FB 4JRXE 2MHAB 1MJ8L 3RGVB 1AXSB 3NIDF 4OI9A 2UZXB 3LH2L 5JDJA 3SKUD 1HXMA 4OGXH 5E1HB 3NTCL 3D39A 3I75A 1AQDB 2ORBL 3WEXB 1FQ9C 4CADA 4ZFFA 2X4OB 4F9LC 4FQXC 1B2WH 1I7ZB 1NMAH 5CJBA 4I8DA 4RGMB 4ODHH 1U8IA 3W0WB 3HPLA 5IEHA 4NN7C 3TWCL 1LK2A 2YA1A 1GSMA 2YC1A 4FMFA 3HG1E 3LQAH 3MO1A 1T1WB 1U36A 1BBJA 4TOYH 2VABB 3WO4B 2DQGL 4BZYA 5CEZL 4HUWB 4KJPD 1XH3B 4U6TA 4TRPH 5T3XH 2DD8H 3HMXH 4DGYH 3BPOC 5C0RH 4DUXA 4GBXD 3VFRB 1M6OB 5E4EC 3VXSB 5ADPH 4GMTH 5IROA 4A6YB 1BZ7B 3B8YA 4YHIB 3UTSA 5D7SL 1MFDL 1TIUA 2E7CA 4L8CB 1R5VA 5IESH 1FYTB 2EDKA 3O2WL 2P5EB 2FD6H 1CN4A 4X80L 2O93L 1CYGA 5DT1L 5DTFB 4J1UB 3GI9H 3MUJA 2P43B 5HXMA 1MF2L 1LO2H 5I71B 4JB9H 5EZOL 5FYKH 4Y4KC 4GG6F 1I9EA 4I0PB 2F8OA 4Z7VA 5A3IC 4WUKL 1P4BL 1QFUH 1S5IL 3TIDB 1FZJA 4QXTA 4MSWA 1XF2B 4U1GC 1BZ9A 1GGIH 1VCAA 3O3BB 4S1SL 3VDCA 2HG5A 1NCBL 1W8NA 3CCHB 4C54A 5I8OL 3UO1L 3K1KC 4RMVA 4LSSH 2ESVB 3OJMB 2ENYA 3P9LB 2VZSA 4FQHB 4HK3N 3C6LB 2AERT 3NGBB 3SOBH 4ZMAT 2R1XB 9CGTA 3F5WA 1BEYL 5DMIL 3SKOA 3T8XB 3MUHL 3FO0L 3QIBB 1UC6A 1F4WL 1FFOA 1WV7T 4BZ1L 2F15A 4HH9B 4UBDD 3MYJA 5ICXB 4IOSD 1PYWB 2ZCHL 3HRZA 4K8RC 5F7WC 1ZGLB 4UILH 2HA1A 1SQ2N 5E03A 3U7WL 4PGEA 1X7QA 3IJYA 4JHWH 5FO7A 1PG7H 2G9HA 2YWYA 2C26A 5GGQL 3WIHL 3KPRA 3TLRA 5IP4A 4PJCA 3NIFE 1CTOA 3BD3A 4YGVA 2YBRA 2EYSB 4PLKC 2BVPB 4CNIA 3FONA 1S7QA 1S7RB 2WQ8A 1X6LA 3CFBA 3L3DA 3RA7H 2HJLA 4AIZB 1WC7B 4XC1H 3ZYJA 2EYTA 5I1CL 4NCC2 2W0PA 5ID0B 1TQBC 3CLFL 2FCBA 2B0SL 2MPAL 3BIAX 4YHNB 2C9AA 4MWFB 3MUZ1 3BRGC 4L8DA 2ZUYA 4WDIA 3SCMA 4KV5F 2W65A 3QQ9C 3JV4B 5J3HC 5TDPA 1NBYB 3MRLA 4JRWA 1A6ZB 4KMTH 5EC2A 3VRIA 4J3XA 4WWKA 4P5MB 2AJXL 1K9TA 4P3DB 3L5XH 5D8JH 1HYRC 2HWZH 1E4KA 1T89C 1D6EB 2VDMH 3P4MB 4G9DA 4PGCA 5EU7C 1ZVSB 2YEZB 3X13B 2P48B 2JELL 3ARGB 5I75B 2HVJA 4PV8A 3KDMA 1WK0A 1GGBL 1HWHB 5EN2B 4K7FA 3VXQB 1MH5B 1DDHB 3JTTA 4ZTPL 2GEEA 3S5LB 1DL7L 2C1OB 5E1AB 2YPLB 4Z77A 4P3WA 2I26N 2XN9B 4PJDF 4GAGL 3TBSA 5I73B 3MNZA 1L6ZA 5GSRA 1OWWA 1SYVB 2AI0L 5GJSL 3BKMH 1X44A 1PFCA 3QDJB 4K2UL 4Y16A 1XGUA 4LCWE 2NYYD 3KPQB 4UOW0 4F2MB 4JJ5A 1UXWA 1B4JL 4APQC 1C12B 4U1MB 3AGVA 3BESR 4CMHB 4X6FA 3QNYA 4FQ1H 3MLWH 2APXA 4C57C 4OF8A 5CBAB 1B90A 2OL3A 3D69B 2B2XL 2LAAA 1XZ0A 3EDFA 1LEKB 3B9KC 2HKHL 3RGHA 4BQ9A 4JRYB 3O6LL 2RBLA 1YNKL 2V7NA 2A6JA 5I18H 2QQQA 5T5NF 3T65B 1HNGA 1JPGB 3IAPA 43C9B 5E9DD 3IF1A 3DJ9A 4NKDB 3KXFB 4FP8L 5GRUL 1YEHL 5IFAL 4ODXA 5C08E 1WGOA 5F88A 3ARRA 3RDTB 4GAFB 2AK4E 3D3VB 3O8XC 2GJ6E 4D9QE 1SVCP 1IQDA 1UXSA 4D8PA 3U4BH 4NFCA 4PV9A 5DJ2B 4XCYB 4X6DB 2EEAA 3FQXB 5CJXC 5HI3C 1MSPA 1CGXA 4DQOH 4EI6A 5FB8A 4X8JB 1YPZF 1BD2A 1YY9C 3DVFA 1H5BB 4LRNL 3C9NB 4V1DE 5FHAL 1XIWD 3GSOA 1RUAL 1XF5B 4NZUL 1QLEL 4WWID 2YOCA 2XV6B 4YE4L 1R5WB 5D6CB 1RIUL 2GJJA 3BSZL 4LHJB 5C0CB 1N8ZB 1CDCA 1CDJA 3KYKH 4ZNEA 4QWWD 4G9FD 1EJOL 1P7KB 2NXYB 3BFOA 3QFDB 4XP4L 1MI5D 4WEBL 1I8IA 4MD4A 5DMGC 1T4KA 1KJ2A 1N5AA 5INCA 5HTSA 1HOCA 1A7QL 2OXHA 2HFGL 1P53A 2GYSA 4L3AA 4U3HA 4EXPX 2G60L 4NUGH 1AGCB 4PJ5A 2WLYA 1B9ZA 5EBWB 4PJBA 3BH9B 1XF4B 4UB0L 1YC7A 4IOFD 4FZ8L 5F3HA 3P77A 3RY6C 2Z31A 5KSBF 4JEGB 3LRSB 3MLZL 5L2KD 4DVRL 4PLNC 4NQCA 4BA8A 2UUDH 5CD5C 4NQXA 4HIXL 5EU5A 5EULV 3HI1B 2WSKA 5L7XL 5I8CB 4JPVL 5IQ7L 4EI5D 1ETZB 3IS1X 4FTVD 2DBLL 2O61A 5KVEH 2Y4SA 3IDYC 4LSPH 3V5HB 3IAGC 4PRIE 5AD0A 3SQBA 3GIZL 2YD7A 3GSNL 1NDMA 2CMRH 3IU4L 4CAGA 5HJ3B 4DEPB 5I30L 3GUTB 1INDH 1UZ6E 3D0VA 3P0VL 2RGSA 1OTSD 1NCWH 3VFSA 5EUOA 3RHWF 2GY7B 5T5FH 1U8HB 4Z7UA 1OTUC 5JLZA 5C0IA 4RMTA 4X7DC 1GZQB 5CGTA 4RZCB 1X4XA 4B50A 1P5VA 3DVGB 3HE7B 1L0QA 1QRNB 3IDXH 1T20B 5T1MA 2OXGA 1TXKA 2ZUSA 4HWBA 5IHZB 3D39E 3WLWC 1G7PA 1LDSA 2EKSB 3VGEA 1YZZA 4KDTA 4DGVH 1NMCB 3MRJA 2A6DA 5IFJB 1VHPA 3MRHB 4YHZH 2QJDA 2ZUTA 3BIBX 5FGCB 4OF3A 3VGAB 3OGCA 2IGFH 4MA7L 3QXDB 3DI2B 3R8BB 1B0RA 3GB7A 5CWSA 1MHHB 3I85A 5A16B 1TFHA 1KIQB 4OBRA 3C8KB 1UGNA 2XWTA 4TPRH 3BH8B 2XKNB 4ZTOH 4F9LA 2Z8VC 3TYGL 2H2PD 4FQXA 1HHHB 1JV5B 3IKCB 4FQ2H 5MEPB 3V95A 3BZEA 1QR4A 4PJ7A 3DRTA 1K4CA 4OZIE 3D1MC 2VLJB 3L7FA 1UCBL 1BX2A 1RIVH 3TPUA 3JV6A 1EZVX 1S8DA 1OAKL 1PVHA 1RK1B 5E24E 1PQZB 2D7TL 5FF6A 4NNXB 4DK3A 4GKZA 3ZYZA 4XVTL 1PX4A 1GGYA 2DN7A 4E41B 2VKXA 4K94L 1C5DB 3V6FB 1DVFC 5KTEH 3SE3C 4Q9QL 4KK6C 2UWEA 3KPSD 4LK4A 3R06B 4LDLB 1KT2B 3DRQB 1YYMH 2D7MA 3A6CH 4K3GA 3QG7L 2L7UA 4I0CC 3P4NA 4GG6B 1F6FB 1MRFH 3IDIB 4KDWA 1WWBX 4Y19D 4PRHA 3WCYA 2PF6A 3ZKSD 4GKNA 4NM8H 1KC5L 4Z7VE 2OMBA 3NCCB 5E8EB 5J6HB 1ZTXH 4U1SA 4DW2L 4X6EA 3OKKB 4ZS6D 2CRMA 4N9OB 2Q7YA 3HS0A 5GXBB 5KSVA 1I1YA 1FNEA 4NZTH 1NL0H 3CSYB 4Y4KA 4TUOA 1AY1H 3QDHA 2D4DA 1MLBA 3S7GA 3HNSL 3E2HB 4FQJH 5E7FA 4YDVB 5IB3A 3VGHA 3RVWC 1A1OB 3HZKA 2PO6D 4YDIH 1MCWM 4HF5L 1EX0A 1I1CA 5EWIL 1MJJA 3E6FB 1X5IA 3GNMH 3SDDC 1YEGH 3S88L 5J1TC 2P42B 3UTZA 4JPWH 1JGVH 4UT6L 5CUSL 4X7EC 4X0KA 3TO2B 1CFQA 1I4FA 4UTAH 1XEDA 4K3EL 4MXVE 1OWRM 4JY6A 4XPTH 1G9NC 3VFWB 4XH2B 1A1NB 1SHMA 4QRSA 5E94B 5DK2B 2X41A 3V5KA 5JHLL 3ZDXF 2XRAL 1YUHB 3KPRE 3G5YB 4JFOA 2FBJL 4ZQKA 1M7XA 4PJCE 4JFPB 3SHSA 1GIGL 4IRJB 5D5MA 1Z9LA 4QHKI 5KVFH 4LU5L 3O45B 4U6YB 1QACA 4WFGE 2XZQH 2DWEA 2M8XA 3SO3C 3S36H 1CICD 4BZ2H 3L1OL 4L4VB 5JZ7C 3VG9C 4M1DL 3CIQA 3WYRA 5I1AB 4YC2C 2GK0A 4H0HB 1OP3K 5E5MB 1J10A 2KZWA 5H2BA 3QQ4A 4HGMA 3AS3A 4ODBD 3QI9B 3QDGD 3W11C 4D94A 2EH8L 3UTSD 3BDYL 3AAZB 4NQEB 2IANB 2AS5M 5GJTH 2VR9A 3EOAB 3IFNL 3GHBH 1IKFL 1SBSH 4NFBA 4HS3B 5DC0A 5CP3H 4LFHG 5I1HL 4Q0XH 1HE7A 4R4NC 4IRSD 5J1SC 3FB6A 1UENA 4UT7H 4O5LL 4PJ9B 2NR6C 3HNVH 1CGSH 2ZKHL 3IU3A 4XTRC 2HJFB 2IFFL 1RZIB 2AEPH 2EDFA 3KYOB 2XZCL 1RHFA 1P7HL 2GSGA 3AUVA 4JDVB 1J8HD 4YHML 1HKLH 5F6IB 1JGLL 5KJRH 1MJUL 4P5TB 1ONQA 5B3NA 4UV4H 4OKDA 4P5KA 1L0XA 1KXVC 3ZTJH 1LO5B 1AR1D 4OQTH 4M6NH 3U83A 1I3VA 4ZOBA 8CGTA 5IBTH 4Z7NF 1XGYL 3GJEB 2PW2A 3FRPA 1RURH 2Q1EA 3HI5H 4WU5A 1G0DA 2PTUA 3S96B 3VXMD 2MSPA 4R26H 1PY4A 1KENH 4NUJB 1JNLH 2EXYD 5DD5L 2ADGA 3QIWD 5GIRA 1MCIA 1CDGA 1X5HA 2I27N 1VFBB 1CFBA 1R6VA 4XHQA 2Z91A 4S1RL 3FT4A 3BVNA 5ESQA 1A8JH 4L3EA 5DHVB 3TV3H 3U7YH 4OV5A 4LCUB 3V8OA 5C0AD 4TTDC 1QSFD 1TJHL 5DK0A 1J0HA 5HI5C 4S2SA 3B9KA 3FMGH 3TBWB 4NQDA 3MRCA 1ZEAH 1BBDH 3IFPB 4DGIH 5FYKU 2CRYA 4HKBA 4JO2H 1KCUL 1RHHA 2ICES 1KG0B 5E5RB 1IGMH 1E4XH 3GMQA 2P8LA 4X7TA 5B38G 3PG2A 1XAUA 4Q9RL 4ZAKC 4L9DA 1JPST 1DR9A 2B4CH 4Q7DA 3QUZB 2DTMH 2QQKH 3HR6A 1G6RH 1BVKB 4JN2B 2R0ZL 5EOTA 1YPZB 4Y2DC 3O8XA 1N7MH 4OLWH 1XFPA 1A6VH 2ED8A 4I4WB 5IKCB 4G42B 4ORGA 1BD2E 3CZFB 4I9WE 1FVCA 1Z0MA 1P9MC 3ULUL 3NCJL 5CJXA 2IEPA 3OAYH 3C08H 3CX2A 3EYFA 2O5YL 3GSUA 1JHTA 1NUFA 1KCRH 4Y5YB 1KCVL 3W82A 2FJHB 5F7HA 2OP4H 4ZNEE 2CIIB 4PP1C 1G7QB 5ITBH 2E8YA 3S34H 1AXTH 3DMMB 4HIJA 3L7EB 3GSRA 4UV7H 4UUJA 4LCCB 1CWVA 4PJBE 5DJZA 2F53A 3E8UH 1CFTB 5HHNA 5KSBB 5C6PB 4YFDB 3GMNA 1HK6A 3WHXB 5JA9A 4JZJB 5FDWB 2JJUA 2UY7A 5EG6C 1JWMA 1IEAA 3FOMB 3NZHH 4JGJA 7FABH 3BP4A 1JYVA 5KZCD 4QT5A 3QDJE 1YY8A 1EFQA 2G2RA 4HGWB 1G9EA 1CGTA 3RY6A 3S35X 3LRGA 4K3DL 5IFHH 1BJMA 2DM3A 2BOCA 3Q6FB 4FNLH 2BDNH 3ECBB 2FH8A 4RA3A 5TH2B 3PE9A 1FO0H 3LKQA 3CLEH 4N8VB 4MVBD 5BS0B 1FN4A 3SDXA 4LIQL 3EO9H 1EFXD 5EIIA 4R4FL 3WFDH 1BJ1J 3MLXH 3Q6GH 5EUOE 5FO9A 3FT2A 1URLA 3KJ4B 5E6IB 4Z7UE 2W38A 2Y9RT 5D7LD 5SWQB 3WNPA 2YK1L 5EPMA 4ELME 4OGXL 1GPOL 1KGCD 5IV2B 4YBHA 5HHME 3LKOA 4IOIB 3WDIA 3LN9A 1JTTA 1ZOXA 3NA9H 4QY8A 5GZND 3O3AB 1A4JB 5C71A 3FOLA 3RGVC 2QSTA 4PY8I 3LPWA 1JGDB 1B2WL 1GH7A 1NMAL 2Q86B 3REVB 3VXPB 4LKXB 3L3JB 4HUMB 4NGHH 4GRLB 2NY1D 3TO4C 5C0JA 3KLHD 5HHOB 4NKIH 1WAAF 5I2IB 5MP6H 1W0WA 4TOYL 1OHQA 1TPXB 5IMOB 1CQKA 3QULB 1EV2E 5F7EH 3EJZD 4RGMC 4I2XA 3ULSB 1AGEB 1MWAH 4MJ4A 4TRPL 1MQKH 3DXAE 3HMXL 4DGYL 5C0RL 2UYLA 2V2WA 1I7UB 3RVVD 5ADPL 5F1IB 4GMTL 12E8H 3RP1A 2E9IA 1DEDA 5JTWA 4NC2B 2ZNWA 4LSDA 3GFUA 2QLVB 3WO4C 3QEUA 3KHQA 5TF1L 4Z18A 3SGJC 3GSXB 4OLUH 5IESL 3VI4E 4GRWH 2FD6L 3SE9H 2GJZB 3NOIA 4HWZA 2HT2C 2XA3A 3GI9L 2Z31D 3QUMH 1QSEA 1V3MA 4NRZB 1OAXL 2FL5B 5GRWA 1RIHH 2UWEE 4NQCD 4B0MM 1KPVB 1LO2L 4PJEA 4Z7OE 4KY1H 4JB9L 4U6HA 5FYKL 4G8GD 4NP4H 3OKLA 1NC2A 5E7BA 3WDHA 3FO2A 3F12B 1U3ZA 1FIGH 3W39A 1AO7B 1W0YT 3HB3D 5HPOA 4I77H 4WCYL 3SE3A 3EZJB 1GGIL 5FKAA 1C8PA 5I1EH 2Y07H 5C09B 4U7SA 2YR3A 2UVEA 1N59A 4F58H 4UTBH 4LSSL 5I71C 1C16A 3QISA 3P73B 3UBXA 3UPRA 2E8ZA 4I0PC 3SOBL 2X4SA 3VMNA 1CLZH 3IRZA 1WCBB 4UQ3B 4D0DA 4HLJA 4M62H 2VIRA 4Z0XB 1WZ1H 3P0GB 4XMKH 1JNHA 1S7VA 2H2SD 3ZYOA 1BVLB 2X4RB 4C55A 2JIXA 1B0GB 2IALB 5FKPB 3C6LC 2JB6B 1U58A 5E8NB 1UH4A 3MJ9A 1YA5A 4UILL 5HYSB 1JF1B 2OI9B 4MA1B 3QIBC 4Z9KB 5FM5M 1PG7L 2CO6B 3T2OA 1KTKE 3U0PA 4XNXH 2DI8A 4U0RB 4DVBB 1WTGT 2R2BB 2OM5A 1INQA 5ETUA 3IYLW 3H6JA 3IJSB 1Q0YH 1U9KA 3SDCB 3BGMB 3SGEI 4LLDB 4K71B 3TBYA 2CUIA 4KJYA 4HK3J 1X5KA 1HH9B 4XC1L 4P9HC 3B3IB 1X5GA 4L3CB 3GIVB 3KG5A 2C1PB 3OKEA 2Z92B 5D7KE 4M6AA 5B4MC 1JZ4A 1IM9B 1KEMH 1N3NB 5CJOL 3MFFA 5I17A 1XCQB 3LKSB 1JRHH 4G6ML 4LQ1A 43CAB 4HG4J 4Y4FB 3S4SG 1L0YA 5JDSA 5LKNA 5F70A 1FV1B 4WTZA 5D8JL 2HWZL 2VDML 2X5PA 3HZVB 5IW6B 4H1LG 3JTSB 1VGEL 2X70B 4JDZA 1TJGH 5IEKA 3KLSA 3VXOA 4LHUG 4YFLF 2DQUL 4BH7B 3RWDA 1XCTA 1A3LH 5HDLA 4PY7A 3KPNA 4AY0A 5TQ0L 1R3IH 5D7IF 3PGCB 3P2TA 3RWHA 4R90H 3NCBB 3HC0A 3LOWA 2DYPB 3ARGC 4QOKA 3EYSH 1TETH 1Y0LB 4KUCD 4OI7A 3QEQA 1U8PB 3OXRB 1DEEA 1JWUA 3BKML 5FYLE 1YN7B 4N0YH 4Y4KD 4JQVC 5T1KA 4NO2B 5A3ID 3RVTD 1JZ7A 1M4KA 2A77H 3N1MC 1YQ2A 5I73C 1MVUA 5AG9A 2BVOB 5BRZE 4FQ1L 3MLWL 4EIGB 1IM3A 4LPUA 3KPLB 4D9RE 2IADB 4WHCA 3W9DA 3EDEA 2CPCA 5I76A 2ARJQ 3LQZB 3QAZB 4F7TB 4OD2A 4N0FA 3PJSB 1NLBH 3MLYH 4U6XB 4HUUB 5I18L 4XPFH 1PKQB 2NY5H 1S7XB 2XT1B 1CDBA 4PJHE 1WZLA 2BNRD 3Q3GB 4ALAH 1G7MA 2P8MA 2A6KA 4Z0BL 3T04D 1RPQA 3TFKC 2B1AH 1IAMA 4NQDE 2HLAA 3BKYH 3V52H 1NDGB 2X40A 4H8WC 3VJ6A 5KVDH 5L9DH 3VFPA 3U4BL 3BUYB 1R0AH 5CINH 2JCCF 4NCDA 4PLKD 1C5BH 2HJKB 4EDXA 5I1KH 1T2JA 4MJIE 1J1OL 3RWIB 3QFJE 1JGEB 1P7QD 3PWPA 4PTTB 4XCNB 3TH2T 1WFOA 3V6ZB 4DQOL 3ZDZF 5F9JB 4TSBH 4YXKH 1LE5A 1KCKA 5J0BA 1BQHA 3MLUL 1MAKA 3OR7A 3MMEA 5D1XB 5IMKB 2YD2A 4MX7A 4AMKH 4QRPA 4CJ1A 4ZAKA 5J3HD 3QQ9D 5EBGA 5C86A 1X6NA 4NQUA 1I75A 5LWYH 1U8NB 5ILTH 1QFHA 4KK9D 1U41A 2K7QA 3MV7D 5IR1B 4NO0A 1OP9A 4Y2DA 3KYKL 1H5BC 3STLA 4O00A 2XWBB 1UJ3B 5FOBA 4NKQB 1K8IA 3FZUC 4LVEA 1P9MA 5KVMC 4OAWB 5CSGA 4HC1A 1FCGA 4NUGL 2A83B 2BHYA 3WNMA 1II4E 1Q94B 2AJSH 2D0FA 3C6SB 4JPIA 5GGTA 1NAML 2NXYC 3IDJA 3MRIA 3H3BC 1W72A 4Y1AB 1OP5K 3VDAA 3V6OA 2F53E 2W92A 3WFCH 4JVUA 1ZA6A 3PABB 4LCYA 1CDIA 2DLHA 3TA3A 1KPUB 4OZ4A 2YD8A 1YEIH 5DRWA 4PB0H 1EH9A 1JUFA 4RFEB 1FNAA 4XPGH 5CMAA 3CFJA 3NAAH 2XWJA 4IS6A 2FO4A 2H9GB 4JZNB 3UTTE 2E3VA 4APQD 1LP9F 4QLRA 3DI3B 3ULVC 1XGPB 1UQSA 2VXVL 4MAYB 4G6AC 1FDLH 2E6JA 5T5FL 4QEGA 3WS6C 4EQ3A 4LKCA 3SDXE 1MLCB 4JN1H 4HDIA 4LEOB 4DEPC 3QG6A 3I6LE 2AQ2A 3E1F1 5DQJB 4HUXB 1VB9A 4PJXF 3IDXL 3PHQA 1HWGB 2YD9A 2FEEI 5GS0C 4DN3H 4JY5L 1PZUB 3BO8B 3IS0X 3RWJA 2R39A 2P45B 4IJ3B 2MNUA 3X11A 2FIRT 4CJ0A 3WS3A 1EZVY 4DGVL 1EVUA 4DJMA 2FX9H 3ISWA 5JQ6L 1AE6H 1JJUA 1A6AA 2NY0D 3TNMB 5LVEA 4OLVH 4UU9A 3QP3A 2IGFL 5C0DA 3S98A 3U0TA 3D0LA 3FFCA 1OSZB 2MHAA 3EGSB 1WTLA 4YEFA 1NMCC 1N5YL 2H6PB 2FEEL 1LO3H 4F33A 3UDWC 3UC0H 4FQ2L 4QHUB 3VGAC 4QRTB 4I2XE 1YY9D 4NQVB 2R1YB 3ZHLA 3TO4A 1RIVL 5BQ7A 1AQDA 1FGVH 1OAZH 2DQHL 3MRNB 5CIPB 4ZFZA 4EJ1C 2X4OA 3SY0B 4LFHD 4Y0GA 1KJ3H 3FFDA 4ZXBB 3TIEB 2EDWA 2F58H 4TVPE 1J12A 3NACH 4YAQA 4ZUTB 3HZMA 5KTEL 3VFGH 3WL9B 2VJXA 4PJAF 3QWRA 5FA4B 4L29A 2VZOA 3TJHD 3RUGF 3CH1B 2UV3A 4HEPG 4Z76A 3T1FB 2VABA 5C2BH 3MNVA 2WINB 3SGJA 1Z6JT 4U1HA 5ERWB 3D18A 3T0EB 1ZTXL 1OOAA 4EKXA 3VFRA 3VXSA 3FT3B 3K2UL 4A6YA 1A64A 5FECA 5CD5D 1BZ7A 2MMXA 4NZTL 4YHIA 1S7TB 3V7MA 1NL0L 2VDQH 4JLRB 3R0NA 3S5LG 1EERB 3CVIH 1AY1L 2IQAB 5E9DB 2H3NB 1CE6B 4FQJL 1U42A 4OM0H 1WISA 5ALBH 4P57B 5MEOB 3RJDA 1NFDF 3CMOH 1OVZA 3WUWA 1UB6A 2AXJA 5CJ5A 3GNML 4NSKB 1PGRB 1YEGL 1J87A 5I0ZA 3R1GH 4OIAA 3TN0B 4MNQD 5J57B 4I0PA 4WENB 1JGVL 4F7CB 4PRPD 1D5ZA 3E2HC 4UTAL 1HQRB 3BGAA 5AYUH 3PV6A 3O3BA 8FABA 1KIPB 1HHKA 3BKCH 4N0UB 5ACLA 3CCHA 5BZWA 3DVIA 1KTDB 4OD3H 4RGNB 1IAIM 1VADA 1UM5H 2R2EB 5IOPB 2DQJH 3OKMB 4FQHA 2AEQL 1I1AC 1QQDB 2DI7A 2L4OA 3C6LA 3CXHJ 4YO0B 3UYRH 2R1XA 2YA2A 1KTRL 3BMWA 4QXUL 5KVFL 1MCSA 2CK0L 1QO3B 2XZQL 1QKZL 3LN5A 3S36L 4BZ2L 2P1YA 4HH9A 4RQQA 5C2UB 4C56D 3AC0A 4JREC 1G9MC 5ICXA 1PYWA 1TZHA 4KJWC 4WNQB 2DIBA 5DGQA 4HW6A 4OM1H 1ZGLA 4KTYA 1TLKA 2I07A 1RFDH 4IRJC 3DGGB 5HHOE 5FAAA 1Q9LB 3P9MB 3W2DL 2A38A 5GJTL 1TZIB 1YMME 3GHBL 3PUCA 1SBSL 2EYSA 3N1FC 2BVPA 2NY4C 5J6GA 4H26B 1N4XH 3OAZK 1QSED 2V5RA 4Q0XL 5HYQB 5GZOD 3FJTA 4AENB 4X98A 1WC7A 5DWUH 4NM4H 4Q6IB 5D2NB 1J1PL 1NC2D 2XYCA 3HNVL 4EI5B 4FFWD 1CGSL 1FH5L 5H94B 4MWFA 2XNAB 1DVFD 1NUNB 5D7IB 4F7PB 1YN6A 2IAMB 4YHPA 1JFQH 1NBYA 2R0WH 3LSOB 4WFFD 1A6ZA 3GMOA 3KPPB 4XP1H 5JIKA 4HXAH 2AK1H 1HKLL 4QOKE 2XTLA 5KJRL 4JM4L 1A22B 3GMPA 4PJ9C 3QEQE 4UV4L 4P3DA 4WI5A 1J9CT 1H8NA 1DLFH 4O58L 4AG4H 5DLMH 1S7WB 4M6NL 3P4MA 4WUUD 3CDYA 4JFDB 1ZVSA 4MJ6B 2YEZA 1ZGLP 5IBTL 3ARGA 3U82B 3ZO0A 3DOSA 3WFHB 1J0IA 2I9TB 1DBAH 5F6IC 4I3RL 2JIXD 4P5TC 1D5XA 4RMQA 1RURL 5I66A 3HI5L 2GSIB 5C3LD 5J13B 4LCWD 4R26L 1KENL 1CD9B 1JNLL 4YHYC 1E4XI 5JXEC 2HTLC 2YPLA 1L6XA 3ZZ1A 3VXUE 4WHTA 1I8LC 2EDHA 5HDOA 5JHDD 3O6ML 3EBAA 4K8RH 3U2SB 1SYVA 3CFKA 5LCVH 3SDDD 3TV3L 4Y5VB 4B5EA 2HFEB 1XF3B 3FMGL 4J8RB 3AM8C 4FQCH 1BBDL 1QLRB 4DGIL 3OR6B 1QBML 1UZ8B 3OG6B 4FXKB 4JO2L 3BP7A 4JPKH 4QHMA 5CBAA 1IGML 1E4XL 5EU3B 3FO1B 4Z7WE 2ADFH 3MROB 3DUSA 2JCCB 1TVDA 3D69A 2BRQA 4OT1H 5FM5O 1LE9A 3BPNB 1LEKA 4PGBB 2CDEB 5C08D 4EN3D 4XP9L 2B4CL 1AHWC 4JRYA 1RUQH 2QQKL 3NBNA 1MAMH 2GJ6D 3PWPE 5JZ7D 1N7ML 4OLWL 3FL7A 2EZ0C 4D0CA 3T65A 3DGCR 1H0DA 3DTXA 1A6VL 3BPLC 3N85H 4KROD 5DJXB 4AYFA 1DN2A 1BQLH 4K3JL 2VLME 2OK0L 3C08L 3HCVA 4YFLI 4XB7A 5DRNA 1LD9B 3W11D 1FG9C 3WIFB 3GKZA 2OSLB 1KCRL 1ZAGA 4JKWA 4G6JH 4ZFOL 3MBED 4R7NA 5M94B 1T7YA 4JFFD 2OP4L 4M03A 2Q8BH 2G5RA 5FYLH 2F5BH 4XX1G 5GRXG 3QJFB 3QXAA 5I0DA 1M71A 3FQTB 4PJFF 5ITBL 3S34L 2EDYA 4M1CD 2R69H 5CEZE 1AXTL 4NO3B 1GHFH 1FL5B 3Q5OA 5C7XH 4RFNB 3EO1B 4X8JA 2NR6D 1YEKH 4Y5YC 5T1KD 2QSVA 4KTEH 4L4TD 3E8UL 3C9NA 4XTRD 2VWEE 4U3CA 3O0RH 5FUCC 3S3PA 4CVXB 4Z7QF 4M8QA 4ZDHA 4OLYH 2PO6B 3TCLB 4OF0A 5D6CA 3NZHL 7FABL 5C0CA 3V6OE 4PG9B 5J56B 3FTGA 3MLRL 3ARVA 2PTTA 2D31B 3VFNB 4LCCC 2B1HL 2ARWA 4K9EC 1KLUB 5IFHL 5F1OB 1KCSH 4ZYKB 1A9BB 4FNLL 5ID1A 2BDNL 1LP9B 1KYOK 2CXKA 3VD5A 2FH6A 1FO0L 5F9AC 3CLEL 1FFPA 1T22B 1MFBL 3FN3A 4NRXA 3EO9L 2BNUB 2ADIB 5IVXB 4Z95L 3WFDL 1HN1A 3VH8G 4PP2A 1Y6MR 3MLXL 3Q6GL 3D2UA 1ITCA 5FYJE 3QNXB 3TVMA 4L5FH 3GSQB 3MC0A 4E5XA 4P46D 4RIRB 5ESVA 4AIOA 4GSDH 4MZ2A 4PJXB 3HI1A 3MBXH 4DTGH 2Z35A 1YEFH 2NX5B 4OCRH 3NA9L 5H37G 3WS6A 1EGJA 4TTDD 3V5HA 1WBYB 2B20A 5K9QI 3KJ4C 3TZVC 5E6IC 5DF0A 3NCYS 5HJ3A 3O2DA 2VLKA 1V05A 4U1IA 1N0LA 4NGHL 5DA4A 4P3CH 2JTDA 2HKFL 5DDHA 5HD8C 1B0WA 1J05A 2V2XB 4FXLA 4HZAA 5DJ6B 1A3QA 1FZMB 1U8HA 4FFZH 5MP6L 3V0WH 4G7VH 2OLDA 5DD3H 3NCEB 5C8JA 1HZHH 3HC3H 4IRSB 1D5IH 2AP2A 4KKBD 2A0LC 5EBLA 2WUBH 4RZCA 2ILLA 3U30B 1MWAL 4GRLC 3DVGA 5ACZA 2V2TA 1MQKL 1QRNA 1ZK9A 3V79C 3FKUS 1U3JA 4C83B 4XPAH 1DQMH 12E8L 1VDGA 2VQ1B 3ARSA 1TTFA 5JXAH 1TPXC 4KUCF 3BHBB 4MD5B 5IFJA 4OLUL 5F1KC 1UH2A 5IHUH 1DCLA 3SE9L 4LHUD 3H0TB 5CJQL 4PJAB 1N2RA 2HFFB 3QXDA 5HVHB 2VAAB 3QUML 5A2LH 2X9WA 1RIHL 4X5LA 2HT4D 3RUGB 3UZQA 1NMBH 4X8XA 3TM6A 1NCAH 5C0BB 4KY1L 1N0XL 4LSTH 5D1QD 2XKNA 3PHOB 3M17A 4IDJH 2NTFA 4TN9A 2ICEA 3IKCA 3TP4A 3LKPB 3VRLF 4FFVC 1FIGL 1RJYB 4P2OA 4I77L 3CFDB 1F8TH 4WI3A 1WWWX 1JMXA 1NBQA 5DRZB 4XP5H 5I1EL 2Y07L 3QIWB 3KVQA 3ZE1F 1RK1A 4UTBL 4F37K 1OTTC 1QA9B 2PUQT 4JQIH 4X6CA 5E2WH 3ARYA 4OZHA 1CLZL 5JORA 4E41A 2FLBT 1C5DA 3V6FA 3CSBA 3Q5TA 1WZ1L