2PCYA

The crystal structure of poplar apoplastocyanin at 1.8-angstroms resolution. the geometry of the copper-binding site is created by the polypeptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title The crystal structure of poplar apoplastocyanin at 1.8-A resolution. The geometry of the copper-binding site is created by the polypeptide
pubmed rcsb
source organism Populus nigra
molecule tags Electron transport protein(cuproprotein)
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1983-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pcyA00
3FQ1A 2XX0A 2EILB 1BAWA 4YSEA 1HAWA 1GY2A 1AS8A 2XUWA 4BXVA 1HFUA 2EIMB 2QDWA 3WG7B 3AG1B 4AKPA 2PPDA 4BDVA 1SF3A 2IDQA 2ZOOA 1W6WA 4HALA 4E9SA 2QPEB 4HCGA 4HCIA 1SDDA 1B3IA 5ANHA 3EH3B 2FQEA 1NWPA 3QPKA 4WTQA 2PCFA 3TU6A 3T6WA 1XMEB 1MZYA 3NJGA 4A68A 1BYPA 1OF0A 4PCYA 3CVBA 2PP9A 4G7RB 1EZLA 2CBPA 2FJSA 3NJKA 1IKOP 3NJMA 2AVFA 3H4FA 3ZBMA 1WS8A 4KO9A 1YLBB 2J55A 4QLWA 2B3IA 1BQKA 5PAZA 2HZHA 2W88A 1CYWA 1CYXA 4A67A 1KDJA 5TK4A 1OE1A 4F2EA 1OCRB 2YAPA 2VSMB 4YSOA 2UXFA 2BZ7A 3MX0B 1JZIA 1N70A 1ZDQA 2JKWA 3FYIB 1VLXA 2BP8B 3X1BA 1V55B 3X1FA 2BW5A 1J5DA 3NJLA 2PP8A 1OE2A 2HX9A 1KBWA 4E9QA 1SHXA 1KDIA 2TSAA 2IH8A 5B3SB 2GB2A 4ENZA 3HEIB 2FTAA 3RYMA 1MG2C 2UX7A 2QT6A 3FT0A 4L0PB 3SBPA 1E65A 3AY2A 3IE9A 3OMAB 5D4JA 2IWKA 4ZK8A 3FSAA 3UAAA 5I5IA 1KV7A 3S8FB 1AR1B 1NZRA 5I6PA 3FQYA 2PPEA 4YSQA 6PCYA 2YXVA 4BK5C 1TU2A 1AAJA 1A65A 2CAKA 1AZNA 2BW4A 3D12B 2GHZA 1ETJA 2GI0A 1E5ZA 1W8EA 1FA4A 1J5CA 4YL4A 3ASNB 2YQBA 2MTAA 3X1EA 1KCBA 2W8CA 1ZIBA 3N55A 2OCCB 1M9WA 1E5YA 4K9JA 3TBCA 2X87A 2YARA 4TXVB 3S3BB 3FU7B 5B1KA 2E86A 4DP5X 3NJHA 4Q8BA 2DY2A 1GY1A 2IDUA 3TASA 4G72B 4N8UA 4BWUA 4GY4A 3JTBA 1JERA 3V9EA 1AZUA 3PPSA 3WNIA 3NJJA 3EH5B 1CC3A 1KCWA 2YXWA 4RH4A 3ZIYA 2XV3A 1IBZA 2DWTA 2VMJA 2AZAA 1NIBA 3JT2A 1PLBA 1AQ8A 4HIPA 2A3TA 2FT7A 2RACA 1V54B 5I5JA 1NWOA 4M3HA 1ET7A 1A4BA 1GW0A 2P80D 2CUAA 2FT8A 3ABKB 4NAJA 1WAEA 4JHUA 1RCYA 1BYOA 1ZPUA 4F2FA 1URIA 2YAOA 2VW4A 3TBBA 1OCOB 3GYRA 2NRDA 4E9RA 1HAUA 4A66A 4A2FA 4YSTA 3AG2B 4GXFA 1AOZA 2IWFA 2H3XC 3NJFA 3QQXA 1KYAA 4DP7X 1IBYA 5D4HA 2GBAA 1GR7A 3EHBB 4E9XA 4W9ZA 1W6LA 3NYKA 4P5RA 2XV0A 1PMYA 4KO7A 3GXUB 1KGYE 2EIJB 2OV0A 3N2JA 4M4RB 5AZUA 1DZ0A 1BXVA 1WS7A 4HCFA 1ZDSA 3FYEB 1J9SA 3NSFA 3T6ZA 1KBVA 2FWLB 2PCYA 3UAEA 3QJTB 2IH9A 1PZAA 1A4AA 2VM4A 4HAKA 1JZEA 4E9TA 1TEGA 4HHWA 5I28A 1JXGA 1BQ5A 1FFTB 2UX6A 4NB7A 1JVLA 1OV8A 1AZCA 2ZXWB 2CALA 2DWSA 3CDZB 4FA7B 4YSDA 3UABA 1E67A 1FWXA 3X1GA 3T6XA 1MDAA 2R7EA 2HRGA 5B1AB 3NSDA 3MBWB 3GDCA 1L9SA 4YSSA 4AKQA 2XXGA 3ABLB 2CJ3A 1JZGA 2I7OA 4FAAB 2I7SA 2BWIA 3WI9A 2PPCA 5B1JA 4BDVB 1SNRA 2OJ1A 3FU9A 2JFCA 1QNIA 2FQDA 2H5UA 1XB6A 4NERA 1J9TA 3OMIB 1TEFA 2DYRB 1SDDB 1GYCA 2WO3B 3IEAA 1R1CA 2YAHA 2CCWA 2PPFA 5FC9A 4A2DA 2ZWNA 1AIZA 3ZX1A 5A7EA 4DP0X 1NDTA 4DP8X 1AS6A 1JZFA 3NT0A 5B7EA 2X88A 5AFAA 3PXLA 1QLEB 1A4CA 3UACA 5I6MA 2AZUA 1UATA 3QJSB 4YSAA 2HX7A 4UANA 3QJUB 4GP5B 2I85A 1L9RA 4G7QB 2GIMA 2YAQA 2LLNA 1J9RA 4BWWA 1TKWA 2FT6A 1NPJA 2J56A 7PCYA 2R7EB 1OOWA 1AZBA 3H56A 3BQVA 5F7BA 1JXDA 1SHWA 3BVDB 1BEXA 2VW6A 1EHKB 4E9YA 1WA2X 3AG4B 4G70B 4UF7C 2J5WA 2YAMA 1PLCA 3CVDA 3NSCA 4DPBX 2BHFA 1MZZA 1GSKA 2VM3A 2MRYA 1NTDA 2VN3A 1QHQA 4KO6A 1NINA 1AG6A 3ABMB 1ET5A 5B1JC 1E30A 2IDFA 2J57A 3DTUB 3WKQA 5PCYA 1ET8A 5LDUA 1JZJA 4YSCA 2PLTA 3NP4A 2WO2B 1NICA 2Y69B 4DPCX 3CG8A 1GS6X 2JXMA 3FU8A 1DYZA 2DYSB 1ASOA 2YAEA 2FNWA 2XVBA 3IN0A 3NJIA 3S8GB 4EF3A 1BXAA 4HZ1A 1XB8A 5B7FA 1WA1X 3FSWA 5AKRA 1WA0X 4JKNA 3WIAA 2WSDA 1CUOA 4YSUA 3FPYA 1PLAA 2QDVA 3UGEA 5I6LA 3IBOA 4N4YB 3OD3A 2BP8A 3TA4D 1CURA 3QJRB 4PAZA 1V10A 3SBQA 3OQRA 4KOBA 1AG0A 4AX3A 2FQFA 3EH4B 1NPNA 2IAAC 4JHVA 3ERXA 1M57B 2VW7A 2TSBA 2QPDB 3PCYA 3OM3B 5B1BB 1X9UA 4BXSV 2GSMB 4CSPA 1JZHA 4KNTA 2PPAA 2GC4C 5I6NA 4AKOA 1AANA 3T9WA 3T71A 1GS7A 1I53A 1PNDA 2XYBA 2BO0A 2HRHA 3IN2A 1GS8A 1L9PA 1OCCB 4YVUA 3AG3B 1ILSA 3AW5A 3PLYA 2UXTA 1PZCA 1JXFA 2UXVA 5B7MA 1JVOA 2AANA 3X1NA 1F56A 3HB3B 2IDTA 5D4IA 3WKPA 4DP2X 1N68A 3QJVB 1OE3A 3ABGA 1PF3A 2YAFA 4YSPA 4YSRA 4YVNA 8PAZA 3U25A 2UXGA 4F7KA 1ZIAA 3C75A 3FU7A 3X2QB 3NP3A 4CSZA 4P5SA 4DP6X 2BWDA 3DIVA 1L9OA 1AS7A 2DV6A 2IWEA 2Y1AA 3FSZA 3CZUB 3PAUA 2HXAA 3KW8A 2Q5BA 4E9WA 5I5MA 4G7SB 4QKTA 3H4HA 5EHFA 1AZRA 4AZUA 1RZPA 1MG3C 5I6OA 4X4KA 2B08A 1M56B 3PAVA 3UADA 1JOIA 1A3ZA 1ID2A 1NIDA 3T6VA 3FS9A 4AI7A 2GC7C 2BP0A 1ADWA 1ASQA 5I6KA 1NIFA 3SBRA 2XV2A 1RZQA 4W1TA 2XU9A 6PAZA 3QJQB 3FQ2A 1T5KA 2N0MA 4UAHA 3SQRA 2IDSA 2Q9OA 3CVCA 4DPAX 1SFHA 3AZUA 3FPXA 3G5WA 4Q89A 1RKRA 5F7AA 4A2GA 4G71B 3OMNB 1SFDA 4A2HA 7PAZA 2VSKB 3PAZA 2FQGA 2XX1A 3NSYA 2XWZA 4GP4B 3ASOB 3EF4A 3NJNA 1NIEA 1BQRA 1OCZB 2H47C 2HLEB 3ZDWA 3DKHA 1SF5A 4HHGA 2BZCA 5I26A 1PNCA 3V9CA 1ZV2A 2XLLA 4BWTA 1XB3A 4DP9X 1PCSA 4KNSA 1ASPA 4A2EA 4KNUA 1IUZA 2XXFA 1ILUA 1X9RA 1A8ZA 1PAZA 1PZBA 5IY5B 1AACA 2EIKB 4MFHA 4DP4X 1BXUA 1L9TA 2AFNA 2HX8A 2PP7A 3FSVA 1L9QA 4GP8B 3S3DB 4GYBA 1J9QA 1IC0A 1NIAA 4KO5A 3WNJA 5TK2A 9PCYA 3L45A 3KW7A 4KOCA 1SJMA 4DP1X 1PY0A 2P80A 4E9VA 2EINB 2BP0B 2ZONA 5E9NA 4WKXA 3S3CB 3CDZA
chains in the Genus database with same CATH superfamily
1CMOA 3D0VB 3ARBC 4NDMB 4XVSL 4PLJD 3HI6H 1AS8A 3BZ4A 2XUWA 4X50A 2MQ0A 4FCAA 4HEPG 3GB7A 5FA3A 1HFUA 1UM4H 2H0FA 4JFEA 2F18A 3G6DH 1B2WH 5IW1B 1ZVYA 1EV2E 4ALAL 1DBJH 1CK0L 1MCCA 4RFOL 2VLRB 2QHRH 4OZ4A 3RNKB 5I23A 4FS0A 4BSVB 2WXIA 3JWOL 1S3KH 3UP6A 4AXWA 1TSRA 1FL3A 4L5FL 3WS6C 1AFVL 2VDQH 1J0YA 3KPSA 2AJSL 3AM8C 3EDJA 4BFIA 3EUDA 2AV7B 4JM0A 2WXOA 4XN9A 2WWMD 3CH1A 3QQ4B 3QDGE 2ZWLT 3V10A 2OXHB 2EUXA 5DHMC 3AFLA 4X99A 5CLXA 2IJ0C 4JDVB 5KJ4A 1RIVL 5T1KB 3GPEA 3C8HA 1XCTB 3MCG1 1XTLA 1MJUH 3IMRA 3RWJA 4PBXA 3RX5A 3S4SB 2X9YA 2F8IA 5F3HA 1HX0A 5DC9B 3LEXB 4WENB 4AMKL 1SJEB 3WKNA 5I17A 5FYKE 1KB3A 1HNFA 4Y5YA 2VC2L 4KXZI 1BAFH 5FDYA 5F7HA 2WBXA 1EJOL 4GUQA 4BIKA 1F4YL 2BFVL 4AK2A 5B38G 4OFIA 2ZSVA 2I5YL 2FJUB 2QVFB 4K5PA 2DBLH 3PE9A 2K7QA 2PCFB 4PGEB 5IWLC 4DGIL 2HRLA 4FF9A 3N9GH 2WBKA 4PQXA 1ZT4B 4M8RA 2N59A 4NRXA 1FA4A 1L7TH 1RFDH 4GB9A 1QBML 4TLKA 4N2EA 5GGRA 3W3BA 2O6CA 2BMKB 2X4UB 4GS7B 4BZ1H 4G7YL 4AIEA 4H2AA 5AVZB 3O6FB 2D9QB 4I1PA 2PWHA 1K5NB 2L7JA 5JTWA 3GRGA 1C5DB 2EYRB 4ZJ9A 2NY7H 3CHQA 2ZWZA 3ARXA 3V4UH 2NCMA 5DZ9A 3M88A 5EA0H 3TBWB 1HOCA 3HNTL 5EOCH 2MJWA 1MAKA 2A4EA 4Y19B 1RLWA 3ARWA 4NQTA 3S5YA 5T3ZE 5MENA 1RSYA 2E86A 3RVTC 5AOKA 3V2AR 1MCIA 4YZFF 2DEXX 4JMXA 3WFEL 2OX5A 5E8OB 1J1PH 1WLHA 4FQHB 5CCGE 3JTBA 5KBNC 4HGWA 3BWZA 2ZX7A 1DO5A 1LGVA 3ISYA 3NJJA 4HH9B 3GSQB 5CLTA 4OCWH 1IBZA 1W72A 2KLSA 3BWSA 1S5HA 3JT2A 5C6TH 3QFDA 1AQ8A 1EGJH 2R0KL 3VVWA 3GRWL 4Y0GA 2G75B 4HIPA 5L2KD 1E40A 2B2XH 3HA0A 4HUXA 4M3HA 4XZUB 1YQVL 1ZXQA 4S1SL 4D9RE 2BNQD 1WBYA 2ZKMX 4Z7VB 2DQ6A 3I9IA 4EKXA 3HHSA 3P0YL 2VL5A 2ZKWA 4PY7A 3CLFH 4JFSA 1XD1A 3L9RA 1G9EA 4JHUA 3RE0A 4OCNC 4G5AA 5D72H 3MVSA 2WHVA 1LO5A 3A67H 4XP6H 1J0IA 4LFHD 5GS1C 2P8LB 1DTUA 1MFDL 3IPFA 4HS8H 1NSNH 3SDAA 5JZ7C 2JKSA 3O45A 1YEEH 4DP7X 2VDQB 2AERT 4JFDB 1HDMA 4W9ZA 5EZLB 2MQ3A 4UNTA 2OMTB 2GPZA 1PMYA 1RJLB 3CPLB 3GMQB 4MCZA 4MZRA 3ZZSA 1J1OH 4DW2H 4KI1A 2YRZA 5EZIH 4Y1TA 3LOWA 3QHZH 5LBGA 1JHLL 2A6DB 4OW6A 3RUGF 2P5EB 3SDYL 3H2PA 1T5XA 1ZDSA 1J9SA 1TZ8A 3FQUB 3JTSB 3NSFA 3O81A 1U6AL 4L4TB 3RKDC 4MAZA 3VCLA 1G9MH 3VXSD 4YDLC 1XF5B 5BW7C 2Y7OA 1KT2A 3TIDA 4DKFH 1OTSC 3QNFA 2IH9A 3UPAA 4ELMF 4TRPL 3UTSD 4DVBA 4AV0A 5GZOD 3G6JE 1RZKH 3MFFB 1RAMA 3W0WB 5KVFL 6FABL 4HULB 1JK9B 4PIBA 2B9AA 1RUAL 2EDDA 3QJHA 5FW7A 4IU3A 1S5IH 4PD4K 2CH8A 4YSDA 3CX5J 3VE0A 3ZTCC 4ZMNA 1E67A 4ONHA 3U82B 4AQOA 3SDXE 1BM3L 1RHHB 5FO8A 2BOCB 2ED7A 3MRNA 5CU5A 4ZW5A 2EKSA 2VLJB 3BUBA 5CZRA 5CBAB 1P5UC 4X6EB 4MD5B 2YPVL 2XXGA 4DFIA 1YN7B 3K6SB 4JO3L 4M48L 1GGBH 1O6TA 1I1RA 2R23A 3O8XA 4MJIA 4RGNB 5ANME 5FUZL 4KY2A 5B1JA 2ZNWA 3VXTB 1H3VA 4GIPD 3ULUF 4NC1C 4KRPB 4PV1C 1WG3A 4NQEB 2XV6B 4RFNB 4QTIL 2YAHA 4EMZA 1QUPA 3CFCL 3LKQB 1UYWH 3KLHD 1A6TA 3JWNE 3HG5A 4L5FE 5D96C 1BFVL 1ZLEA 5GGQH 5K9KB 1NEZB 4KDTC 5TE7H 2B59A 3EGDB 3IDNA 4JO2H 4NWTL 1MWOA 4M00A 1CL7H 3L7FB 4P99A 5JPMA 5IVNA 1C5BH 3IU3B 1IFHL 2QGCA 3VYNA 3VXMA 3MCLL 1FDLH 3WHXB 1DQQA 4Y5VB 1U8JB 3IRZA 1FZOB 1LO0H 1SJXA 2ZWKA 4GP5B 4M61A 1OM9A 1NUFA 2BSBA 4L8DB 2E7MA 1DLHB 4E0RB 4JPSA 1CE1L 1Q9OA 2P42B 5EC1B 2E6QA 1OAYH 3TPKA 3VJ6B 3K2UL 5I15H 2YK1H 1DBBL 1M71B 2GJZB 4P5TD 2VQ1B 2C3WA 5ID0B 2H0JA 2UUDK 5DZVA 1OOWA 3MRQA 3TEXA 3WHE0 5IEHA 1RK7A 2YEVB 3HI5L 4R7LA 5IESL 1NEUA 1H15B 4XBMA 3KPPB 3MA9L 1I9RL 3LRMA 3PJSA 4E9YA 3ZR6A 5IHHA 5LGYA 2WWMC 3AG4B 2ZUVA 4TQEL 3P77B 3SE3A 4AYEC 1RIUH 3MR9B 1Y1DA 3T0EE 4ANXA 1NINA 1AG6A 1OGPA 3TVMB 5CFHA 3TBYA 5DUPH 5ILTL 3VQMA 4OZGA 4N90D 2WQSA 3ABMB 4JG1H 4ZFOA 4HVBA 4OR1A 3GS7A 1BZOA 4PGCA 2F0CA 4MMYB 3UH8A 1VCBC 4PMEA 1V05A 4YSCA 3NP4A 3LZPA 4G59C 3WBDA 3L4ZA 3LRLA 3IVKA 2X38A 2FB4L 1HINL 5F7WC 4WF7A 2CO2A 4YPGA 5F96L 3SZKC 2AS5M 1WYJA 3EDKA 5DRWA 3BHBB 5MEPA 1JVKA 4XMXA 1DL7H 4IIQC 4A7UA 1WFNA 4GLRI 3LH2L 4WW2C 1AH1A 1NGZB 3RJDA 5I66B 4NP9A 1XBDA 3COOA 4FC3E 4EUPH 3MBEA 1J05B 3L17A 3IXAA 3TBSA 4CNIB 3NCJL 1ZT1A 4JKNA 4P9HH 4ZSOE 5C6WH 1MQ8A 3QNZA 2EDHA 5A6MA 2WWNA 3E7JA 2R0WL 2PNDA 3EFOA 1YEGL 3REVB 5I6LA 1FNLA 1BJ8A 2EEXA 1EXGA 1DE4A 3O9WB 5LGHL 1CURA 4WNQA 2VZ1A 2ZIDA 1BX2A 4G6KL 4CMHC 3ALPA 2WXHA 2CLRB 4XOBA 4G43B 2RR3A 4NPYB 1CG9A 4ES9A 3LRSB 1DUZB 3A21A 3OM3B 5EZJA 3EYSL 4M1DH 4WJG3 2EVGA 2CCLA 4ZFFB 4G9FD 3UDWA 3PJLA 4QDGA 4S1DD 1F4AA 2CO3A 2R27A 1NEZG 2KDGA 2V4LA 3GXDA 1X5HA 4KGLA 1JWMB 1RUKL 5C3LD 3O4LE 3FUEA 3FZUD 4RMVA 5F97E 2RIKA 4M1GH 3ZGIA 3Q7JA 2V17L 3RHWK 4L1BA 3TCTA 2F58H 3WN6A 4LGPB 3DIFB 1Q8MA 5GS0H 3VFGH 4ZYKA 1OCCB 2GK0B 4UUJB 4B9FA 4XOCA 3SHSA 5A6LA 1RSFA 3DYPA 3BP4A 5F21B 3RWCB 5AB9A 3HVDA 1QVOB 3QXDA 2VLKD 1E27A 4YDNA 5F3BA 4KVPA 1GYAA 5LAPA 5FYJL 5I0ZA 4Y1AD 4ZQTA 4U1HB 2LVCA 3BPOB 4UTBL 3X11A 3FRUA 4L29B 1AIFB 2YAFA 4JJOA 2C7UA 2WUBH 8PAZA 3T1WA 4KQ3H 3L4UA 3U79A 3B9KC 3B2VL 5H2BA 2UXGA 2DWDA 5F7FA 3GJFA 5HYJA 4F7KA 4Z23A 2ZX5A 5FHBL 3ULAB 1QR1B 3WY3A 1PZ5A 1BDYA 3RWIA 3MLXH 5AVYB 3LN5B 3F12B 2VGLM 2X4PA 4XBEH 3M17A 2IGLA 2FSEB 1RZ8B 1X5YA 4WY7H 1Z32X 1EBPA 1U0QA 1SEQL 3MYJA 4YHZL 1ZWIB 4OM0L 2J88H 3N1QC 1ZJBA 2WKGA 3MRPB 5EHFA 1AZRA 3N1GC 2IOIA 1BV8A 2BP5M 4YHNB 4BHUI 1D6VL 3DVNA 5I6OA 3OHMB 2Z7ZA 3HS8A 4HIHA 4Q6IA 2PW1A 4LKCB 3UPRA 1ID2A 3DC0A 3FS9A 4I88A 1U8QA 5DDHA 1FNHA 2OTUB 5I6KA 1QSEA 4FHBD 4PJ7A 3SE6A 2FAUA 4NO3B 4D7BA 2R29H 3ZIMA 4PW4A 3ML9A 3B2XA 5I1HH 3L5WA 5DZNA 5AW6B 4G71B 3THMH 4UT9H 7PAZA 2ED9A 4FQJL 4PJ9D 4NNXA 4PG9A 4EOWH 3VRLF 3O6KH 4YDKL 4WGKA 3WUZA 1N4XH 1SF5A 4HHGA 3KHOA 3F7RA 4AOFA 1CLVA 2YA0A 4FI8A 4QHUB 1N7MH 4IOSA 2G0LA 3RTQB 5ABDE 1H6FA 4ZMTA 3RGVA 4LLDB 1I1AC 1PIFA 3KWWB 1O75A 3HMWH 4LASL 1FHGA 2CM6A 1NCWH 1PZBA 4LAJH 4YZFE 2R69L 5GHWL 2FZ3B 3NA4A 1JV2A 4H88H 4N87A 5ESAA 5AW9B 4GXVH 5KVGE 5JOPD 3VNZA 5MERB 4EUPB 3FN0L 1VZGA 4J6IA 1YVLA 1NIAA 3EGXB 4KO5A 4HUVB 1ADQH 1A25A 2APSA 1XGRA 2X4TA 2E7LA 2MCPH 3Q1EA 2NR6A 3HLAB 1T66D 4XP9L 1DQJA 3II2A 3GEWB 1LO4L 4XPAH 3TPUB 1IM3A 5DTFA 2ITCB 3KLHC 5EBGA 4HOMA 1QSFB 4QJ4B 1P4IH 1VPOH 5EO0B 1PQZA 1AC0A 1T1YB 3DSFL 1L5GA 2HFEB 3LIZH 3QAQA 2YN5A 3DVGB 4PWFA 4MXWH 5JNYB 4WFHE 1WDAA 1X5GA 1DBAH 5D6CB 1I8IA 2YD6A 4BKTC 1HQ4B 4P2CG 3TH2T 3KXFA 1W6WA 2TRYA 4PRPE 2V3DA 5IROC 3NTCL 3BEVA 5FB8A 1AGFB 4Z78B 4WIQA 2D4FA 4NQCB 3FF8A 3L3OC 3L9BA 2FQEA 3QPKA 4WTQA 1DVFD 1JRHI 1C16B 4EIZC 3O2WH 3VU1A 3TYGL 1KXHA 4P5TC 3SYCA 1BZDA 1HYRC 3NPSB 4IM8A 1LE5A 4OT1L 4GFXA 2Q2EB 3QUXC 4I18B 3VFSB 3GT6A 4A6YA 4QYOA 3L08A 4PM1A 5EU6D 3RUGE 5TE4L 4OZGF 4AIOA 4LIQE 5IKCA 5C0AE 1MI5B 3NJKA 2JK5A 3Q1SH 3NJMA 4X8JB 4YHLL 4PJXE 1I75A 4IKIA 3VFRA 2WTOA 3ZE2B 4DTGL 1AP2B 1E3ZA 4PJHB 4ELME 2X1XR 4ZG1A 2ZZUT 2X4SA 4OSUH 3FCBA 4HK0A 4PJIE 4YSOA 5EU4A 3PHQA 1YPZB 3KLDA 1U4FA 3MCYA 4PRNB 1NBVL 3IMBA 3FU6A 3HI1A 1GAFH 5C0CB 4YR6A 2HN7B 1QFUH 5I1CL 1KIQA 1URLA 3T3MB 3K81A 5AKVA 1DUYB 3SO3B 5DJDB 5DD3L 1NKRA 1WEJL 3I02B 1NMAL 4G1MB 1VFBB 3QNXB 2BIOA 3ZL1A 3ETTA 1QKZH 3MJ8A 2VLLB 4F3FA 4AL8C 4DEPB 3T0VA 3DK0A 3ULUE 3EJQA 3SBPA 3UX9B 2EEBA 1E65A 3V6OA 5CEZE 5D4JA 2IWKA 5JHDE 2D73A 1Q1PA 2GY5A 2ZUTA 3D8MA 5C1MB 5I5IA 3WUWG 1NBZA 4JFEE 2C3XA 4KDVA 3LMJL 5KN5A 4HU2A 1IARB 4GKSB 5F9DC 2WVUA 3WTSA 1BF8A 3ORJA 1CIDA 3F5WB 3MRCB 3QAZC 1MWAA 4ZOEA 2A73B 2DH2A 2RJMA 2Z31C 5TDOA 4FFWD 3TA3B 2V2WA 2BW4A 3FB5A 1A0QH 2OR7A 4BFNA 4P57A 4Z7QB 3I3EA 3FT3B 4YHYB 3BP7B 1X4XA 3EYVA 5FM8A 3KPSE 4Z5RB 1LQBC 5KBLA 1XHHA 3GLEA 1VADA 1ZIBA 4Z7OB 5KYNA 5E8NA 2VR9A 3OBAA 3APCA 2X87A 1G1KA 3TJHC 4UNIA 5HI5D 1FNAA 4I1NB 32C2A 4APXA 1AO7A 5HDBB 4JGJA 3MJWA 1WICA 4QWWD 1OB1B 2KZWA 3IJEA 3D85A 3G9AB 3V4LA 1PEZA 4P23B 3PF2A 5DXWA 1FIGL 2P3YA 4W4OC 2GTWA 3K4ZA 1RJYB 2AQTA 3MLVL 3UEQA 2IF7A 2RQEA 3RKPA 4AT6A 2BS9A 4NI3A 1NIBA 2A9DA 5JDSB 3VFVA 1LXMA 4KQ0A 4U6YA 3MV9B 4RMWA 4DERA 2E9IA 4X4XB 3VRIA 2P8PA 3O6MH 4P04A 4Y9BA 4P2YA 4KXDA 5DQDH 5A2FA 5T1KD 5D9SB 2IV8A 1UURA 1U8HB 1KPVB 1CFQA 4RDQG 1WD8A 4MX7B 3PAYA 1GC1C 4HFUL 5SWQA 4YXLL 2IMNA 3QJXA 3KMDA 3WNMA 1RUQL 2NYYC 2VMCA 3P3SA 2OR9H 2DW5A 2J7LA 2YAOA 3S5LA 1INEL 1HKFA 2DQCL 2CDEB 4DCQB 5F72S 2QMJA 1HSAA 4NM4H 1XQ4A 2YN3A 3MC0A 4JPIA 4LCUB 4ZFOL 4JHBA 4YSTA 1KJVA 3MUJA 4JEGB 3NACL 2WVSA 1IVTA 1XCWA 4G1EA 1CFSB 2VR6A 2XA8H 1FL5A 2XDHA 3GHPA 4PJ7F 4BE5A 3NYKA 1RK1A 1JPTL 2BS71 2C7FA 3MREA 5E6RB 3KPOB 2YUWA 3FQWA 3EAKA 3N2JA 5I6XB 1G7LB 3BYTA 4TYUA 4J3BA 3WELA 4U6XB 1DZ0A 2CZNA 2EC9T 2X12A 2PCYA 3BKML 5D71H 2ESVA 1VHPA 5HI4D 2FK9A 3MUHL 3SBWC 3S7GA 1A4AA 4P4KB 4GAGH 3BFOA 1BVKA 3FU0A 5MENE 5F8QC 3WNOA 5KUKA 1KCKA 3B5HA 2VR8A 4NB7A 4OGAC 4AJVA 1ITCA 4LXFA 5L8KB 1BQSA 4ZS6C 5EIIG 1IAOA 1JZ7A 2NUTB 4YBQC 3AS3A 5K39A 4HS6B 2XWBB 1NCCL 3ECBB 3FHEA 5IFHH 5H94B 1ID5I 1N0XH 4U1IB 2GT9B 2DQIH 2OZNA 3VFMB 4Y19D 3DMMB 4AEEA 2HAZA 2I7OA 4XH2A 3Q05A 4R0LC 4JQVA 3A24A 4OBRA 3QDAA 2W0FB 2N3JA 3QZLA 4FZ8L 4ZPVA 5K59F 1I8AA 3MRGB 3H55A 5FF6A 3BDBA 3IETA 1T7VA 1J9TA 2Y3AA 2Y7NA 4P2OA 1KLUB 3P4NB 5HGDA 5AAPA 2XG4A 5DJYA 1P84J 4RNRB 5CGYD 1PY4A 2PPFA 1VKXB 4PBWD 4CVXB 5DJ2B 3OXSA 1T66C 3OTTA 4ORZC 4XNXH 3P3YA 3PNRB 5EH1A 2QPUA 2IBBA 5EPMA 3O6LL 4G6JL 1Q94B 1R3LB 4GAJH 1KFAL 5JPNA 1G84A 3SQOL 5T3XH 1UATA 4YSAA 4XMUA 1CVSC 2D7TH 1TJHH 1FLRL 4AQ1A 1CD8A 1L9RA 3ZJAA 5GJTH 5DR5L 5AL8A 3SPJA 4HWEH 1J9RA 2EACA 2Y07L 2FT6A 3WY2A 3RG1C 4NIYE 3TFKD 4N8CL 3BQVA 4N5EC 2IAMB 5I75C 3QUKA 2WLNA 4JFDD 2H6OA 3V52H 1DVFC 4PB9H 2QJDA 4ZTOH 4JPKH 3ESOA 1OD9A 2FLBT 3CVIH 3VGBA 1ZV9A 2WLZA 3GF8A 5K1NA 2F19H 2J5WA 1I9IH 3BQUA 5DZLA 4X4YB 1E43A 2A1WL 1LJMA 2P5ED 2PR9A 4LKXB 1P53A 3HHMA 4L4TD 4OF6A 1S9XA 3GRBA 4L3EB 2YA1A 3VRLE 3BO8A 3MOAL 4DQOL 2X4NB 2J57A 5FOBB 2X28A 1T80A 2CJSA 5I1LB 1RIHL 1IGMH 4MJIE 2I60L 2CRMA 3DRQB 4YGAB 2Q6WA 1N59A 3VD5A 1T22B 3IDGA 3AGVA 1KN2L 1U30A 5IFJA 4KUCF 1O6SB 2CM5A 1R5IA 4EN2A 3GGWB 3NJIA 4PJFB 2CBMA 2XTJC 3DETC 3MJ9A 4QKXB 1R47A 4F92B 1AGDB 2P1YA 1TR7A 3OF6A 4Y2NA 4ZT1A 2AXHA 4RGND 2GUYA 3QUYA 3WIAA 4G5ZH 1VZIA 3MZGB 3UAFA 3WFHA 4KRPD 2VR3A 2B1AH 3LCYA 5C07E 2KL6A 2PYFB 1I7TB 4NQED 4UI2A 5CJQL 3OR6A 3RQ3A 3VXME 3HG3A 4JM4L 3QXTA 1ZLDA 5ADOL 2UY6B 3APFA 4GEIA 3N43F 5C3IA 1PX3A 1BEYL 1Y0LA 3C87A 3JV6B 5T33H 5JW4N 1JGEA 1F90H 3SE4C 3L2NA 2H3NB 2VQ4A 2DN7A 4OF7A 2X4QB 3QUZA 4NC2B 1I1YB 1IGIL 5JIIA 4C54A 5BS0D 2NX5B 3LV3B 3PG2A 4FFWC 4LE8A 3FHAA 4KXBA 3WY1A 1Z6JT 3FO0H 2FIKB 3P69A 4MS6A 4DSYA 2QGDA 1T4KA 3MNVB 2N7AA 3T71A 1IC4H 1Y6NR 4KKPA 3CCHB 1IKFH 5FUCC 1F13A 4XX1G 2AF2A 2JQMA 5L88L 1EQWA 5HYQA 5DHEA 1FG9C 3AG3B 4O4YH 5HI5C 4XC3L 5I8CA 3MXVL 2BSED 4HXBL 4PV8A 1Q4NX 5IF0B 1JMZA 5DURB 5FUOH 2KQNA 3QP3A 1VESA 4OZGE 1REIA 3V6ZB 4C83A 1FZMB 3L48A 2XCMC 1J12A 4K3JL 1NCGA 1S7VA 2L7EA 2XG5A 1JWSA 1KWGA 5FWQA 4X5XB 3CC1A 3IKCA 2HVKA 4PR5A 5KVMC 2H32H 3IJ9A 4A6YL 3QZWG 3OG6B 4ADIA 3TVMD 3GKWH 3KL0A 3TS8A 3NN8A 5GGSA 1P1ZA 1B4TA 1NCDL 1WVZA 5IV2B 1L9OA 3HRZC 4N0UA 2NLJA 3IJYB 4HKJB 4HX1A 1FO0H 3PAUA 4IS6B 3OKEA 2JJSA 1C12A 4LEOB 4H8WH 4U7MA 2HPOA 5FLUA 5KEZA 1KG0A 1AY1H 1ETB1 4HBCL 4ZRGA 3BN9D 3RNQA 1K8IA 5CO1A 5GRYA 2CIIB 2NY5C 2PCPA 4ZMQA 2WTRB 4WJ5A 2R4RH 4CDGC 2V2XB 1ADWA 2VISA 3SBRA 5T1LA 3VFTA 4ZMLA 1PVHA 3QXVA 1AKPA 2XV2A 3SODB 2YEZB 1MCWW 2WLYA 3L5HA 3WO4B 1FE8H 5F7UA 4JG9A 2IDSA 5KSAA 4CU7A 3FKUS 1GH7A 2W9DH 3FPXA 1O7VA 4NZTL 1XSOA 3O9WD 1SFDA 5TD4A 3CSFA 1P0SE 1U92B 3NSYA 4KBPA 4GBXA 4FQCH 1QRKA 5HI4C 1CDBA 1AD0B 1WZKA 4XGZB 2LR4A 4L9LA 1JGUH 1TTGA 2ZJSH 1MREH 3D4ZA 3ETBF 4E5XA 4ONFL 4IBTA 1GTFA 3O6FC 5ALBL 3HS0A 4UINL 1N12A 2R1YA 3KG5A 5DGQA 1XD0A 3VA6A 4WHCA 4PJDF 2VMFA 3OZKA 4DPRA 1ZRUA 5A2AA 4EXPX 2MHAA 2ATKA 3QISA 1JFQH 5C0RH 4OZHE 1X5ZA 1KBBA 4MDIA 4OFKA 2WC7A 4HMCA 5G2NA 5F70A 2DWXA 1W9XA 4HC1H 3KW7A 4HFWB 4WFED 1MCWM 3KLAA 2XFXA 3HZMB 5MI0B 4ORGA 4LLVB 3WGUB 2WM0A 3DI3B 4E9VA 2EINB 3QO1B 4RSVA 1TTRA 4DKEL 3V0AC 3C08H 1EZUA 3H2QA 1GJIA 1MFCL 1PX4A 2HSIA 3AXIA 3CDZA 3QR2A 5CGYC 5DMIL 3PWLA 2WLHA 1J7VR 3M1BA 4K07A 2R0ZL 5DF0A 4JFVA 4TQPA 1B0GB 2V7NB 4UZSA 2E7CA 1A22B 3B2UC 3STZB 4RMUA 2EE9A 1A1OB 2WMPA 2FEDD 5IVXB 5SX4I 3N0AA 4IHOA 5JLZB 3TBTB 3KM2A 4KUZH 5DT1H 1AQDB 2P24A 1XR9B 3VI4B 1QSEE 1A7PH 4N2NA 4YDIH 2AI0H 2GTZA 3RPBA 5L4MA 2ZOLA 3BAYA 4HJJL 3UGXA 4LLWB 1Q72L 4PB0H 3K1KC 4X9YA 3PABA 4FFVC 5TQ2H 3I6LD 2ID5A 3KYOB 3TFKC 1T0NA 1A4JA 2EO1A 4M3JA 4Y16B 3C6SA 1J9CT 2BVQB 2XICA 5CZVH 4KI5D 4OF0A 1S7TA 5ITFA 3BH9B 4RBPH 3ZL2A 2VLMD 2VZUA 2FJSA 1EO8L 1IKOP 1TZIB 1UJ3C 4PWGA 2V37A 4AW7A 4EN3B 1YAIA 5FYKH 1U91A 3W82A 5I0YA 1JYWA 1Y18B 2FEJA 2H32B 3UG4A 2KZBA 3EXLA 5DZAA 2OMVB 4LSSL 1G1OA 3VDAA 1BYNA 5J1TC 5JW3L 1MHPH 2YAPA 1EXUA 4PJ5A 3D34A 1TTCA 4AYSA 4DN3H 3ZHKA 5EO9A 5GSRB 1N5AA 1G7HB 4JFYA 1OSZA 3ROLB 1G43A 4IGBA 2UZIL 3WFCH 4V1DE 5JO5B 4HS3A 5GJSH 1J5DA 5D1QA 1V7ML 2CR3A 2F08A 4IBVA 3QEHA 3NABH 4MWFB 4TNWK 1G6RA 3RTQD 1AXTL 4BRJA 4LU5L 2CGRH 1X3DA 4S10A 2H2PD 3GSNA 3C5ZB 4G2AA 5K59E 4G8FB 3RY4A 3AROA 2OMWA 4JO4L 2XN9B 3CFEA 3GNMH 1G5AA 3V5DA 1IX2A 1UG9A 2FGWL 1GGUA 1FNEB 3VACA 3SYQA 1YMMB 2FGZA 4GO8A 4PJBA 5HHVH 3PQYB 2RALA 1MW0A 2GSGA 1FFPB 4RGNC 1NAML 1IM9A 3W2DH 5KYWB 5IQ7H 1ZANH 4MNQB 3DWTA 4ZODA 5LGJB 3BWAB 3HZKB 3FN3A 4RFNC 3KXFE 4YL9A 2VM9A 3LHPH 5T3ZH 3QWRA 1QSFD 2XKNA 5MHSD 1H3PL 5FPIA 2PR4L 1T6WA 1XGUA 4XNZB 5TPWL 1T2QL 3GO1L 5D7LB 4PPTA 4G3YH 4Q7DA 4LCIL 4NO5B 3GMLA 4Y5VC 2NW3A 4AYID 5K5YA 4TUOB 2FUQA 3SKUD 4YE0A 3DNKA 3ARVA 4XMPH 2XQBH 4XCYB 5KBPA 1MJJA 5GS0D 1NBYA 3EBHA 4NQCD 5HVHB 4B3VA 1JRHL 2D31A 3HZYB 3EH5B 5E2WH 2LOEA 1ZSDB 5A3IC 3D39B 4P2QD 4YLQT 4JZJB 1MCNA 4R4NC 3RB7A 2X70A 2GVYA 1KGJA 3K91A 2Z1PA 1MI5D 3BAKA 2ED8A 3NCFB 2HLFC 5KOVC 1IAII 3RL1A 3HE6A 3R18A 4WFFD 3D06A 1J5IA 2P80D 1JGDB 3ILDA 3ABKB 3MYZA 4JQIH 4FYTA 1EHXA 3LH9A 4ZMYA 4GG8B 3G6AA 3UFIA 2WB7A 1BYOA 3BIBX 3ILQC 4XXCC 5C0CD 5BO1H 1JPST 2HCZX 2PTTA 3TBBA 1M1XB 3QDGB 3IDIA 5IB3B 1QW9A 5F88A 2Y2TA 5GGUB 1ZLUH 3W81A 1DSFL 2WLLA 1ZT7B 2WYHA 4OD1H 4Y9CA 1ZGLB 5DQJA 1SQMA 1DLFH 1QA9A 4NSKA 1U42A 1S7WA 3GMNA 4G8AC 4Z0BH 12E8H 4PLNC 2F1EA 3SGEI 1XGZA 4AC4A 4XNYL 1XBRA 4HCFA 4KY1H 1JPSH 2W92A 1EUUA 2R1XB 3MJ9L 1RHFA 4K3EL 5CEZH 2BNUB 5EEVA 3OPZL 2N01B 1ZA6A 2D03H 3I6GA 4NN6B 4AMXA 2EC8A 2NY6B 3ET9F 4G11A 4KNQA 3RWHB 3VXPA 1G9MC 2HFFB 2NUPA 3O9WC 1BQ5A 2W65A 3QO0B 4N0FA 2MPAL 1GA2A 2O61B 2J4WH 2KI6A 4U1NB 3WDIA 4XVUD 1CDGA 1WZMA 2AC0A 3I50L 2YOCA 1GZQB 4LRNH 5GGVL 5CMAB 1JDDA 3WJMA 2F8VA 3JWOH 4PVLA 3L4CA 3CBKB 4KTDH 1CDHA 4M5ZL 1H3XA 1BD2A 3JWNH 1FL6B 3KNBA 4L5FH 5ESVA 2UVFA 4FOMA 1KEML 1OAJA 4IRJB 3ZHNA 1XR8A 1VGKA 3FTVA 1CD1A 3OXRA 1XB6A 4QF1A 4ZOCA 5IJVA 3RIKA 3QR0A 5C9JB 3SJVA 2GUOB 5JA9A 3AWFA 3UYRH 4QXGH 4DHLA 1QFHA 1GIGH 5AWNL 5JIQA 4Y2DA 3CNKA 2DQDL 5DUJA 1AZZC 3MV9D 4XXDB 1QEWB 5C0GA 2FO4A 3VWKB 1XIWA 1NDTA 2A9CA 3L1FA 5LNEA 4OTXH 2EUWA 1MFEL 2VUOA 2WQRA 4GRLB 4HJGB 4ONGH 4BJLA 1AGCA 4FLOA 3TZVD 1NGWA 1RP9A 2CBQA 4YBLB 3K0WA 3QJSB 2X6UA 4AMKH 1RZGA 5BXFB 2FEDC 4QHPA 4XNQB 2ILLA 3W57A 1DFBL 3SO5A 2OMUB 2EXYD 1PTZA 1CF8H 2FJFA 4X7SH 4YIQA 5GSVA 3TO4A 3MN8A 4S1RH 4FFZA 4FG6D 4Y4HA 7PCYA 3CJJA 1JV5B 1F4YH 1RZJL 2C1PA 1HILB 4I0PB 4X6FA 3U0WH 1SHWA 3PDOB 2ESVE 4KTGA 4ZQKA 2I5YH 1BEXA 3VXUE 3TJEH 1TFPA 1UCBH 4M5YH 4MAUH 4FABL 4Q9RH 3EO1B 4LESA 4KI5C 3D3VA 4G70B 5CIPA 2ZAIA 3NZ8B 4GQPH 2ATPA 5DYOA 4BE6A 2DQEL 4Y4KB 4DPBX 2BHFA 3T09A 1CXKA 4KO6A 4CVZB 4FMVA 7CGTA 3TM6A 4HU8A 4P4KD 5I1KH 4HXAH 5HYSG 3WKQA 2J1KA 2NYKA 1BQUA 1AD9B 5TF1L 3ML8A 3SY6A 4FL4C 3PUUA 4PJDE 4KK8C 1ASOA 1OHZA 3LKOA 4HUNB 2XYCA 1IU1A 4PJBF 1MNUH 4NKMB 1WIPA 4RAUA 4L9DA 1PG7W 1FVEB 3DMMD 3MOBH 3QUHA 3C9NA 4Y2OA 3EDDA 5FDWB 5HVFB 1HCFX 3ARFB 4KVCH 4OIBA 3DLQR 1SJVA 4HZ1A 1I85A 2NZIA 4JFZH 2X1OA 3FSWA 3CZNA 3HN3A 2VIRA 3SD5A 1TQWA 2A9ML 1TZGH 2UWEA 4L0ZA 1MIML 1CGUA 2VSCA 4QTFA 2J2ZB 2ICES 3EJYD 1CLOH 1CFTA 5JW4R 4UZUA 3SDXB 4L05A 3SKMB 2GJ6A 1K9TA 4J3OG 4U1JA 1SHMA 1MAMH 4BXSV 1HI6A 2WIIB 1JZHA 4QEGA 2ZYRA 3SCMB 2DQGL 3JTTA 1QUNA 4KNTA 1CBVL 3LPGA 2Z4QB 4MCNA 1VFOA 4B95C 4DKAA 4HWBA 1CVRA 4B9KC 4ZDHA 2BO0A 2VOTA 2D3NA 1PSKL 4IDLA 1PAMA 3EO0B 1Z0NA 3CU1A 3VFUA 4ZXBA 1SBBA 2QFPA 5CEXA 5FCUL 5DFVC 1BQHB 1BIHA 2P44B 5GS0C 2IAMD 1Z3GL 4KJQD 4PFEA 1TTUA 5JXEA 1K8DB 1WE5A 5DCCA 3NPSC 2FL5A 1FZKB 1XSJA 4I18C 1RJZA 1ZEAL 2P8MA 4YHPA 1KXQA 4HHAA 4IRSA 3V4VH 1QZNA 4MZ2A 3PV7A 2ZCZA 5IMKA 5D7JA 1FAIL 2A2QT 1G6VK 3C75A 2AEPH 3D30A 3LS4H 3HB3C 4L3ED 2G60H 3GXNA 4U6HB 1HXKA 4TTGA 3BPLB 2G4GA 4OFDA 4MAYB 2WZPD 4G6ML 2WBJA 2XIIA 5EUOA 2CK0L 2ZUQB 2HXAA 4A7SA 4EBQL 4QAMB 2RQ8A 3EZ8A 2FR4A 5C3TA 3F85A 2W38A 3U36A 3SO3C 3FOLA 3TLRA 4JO3H 1GL4B 4GG6F 3T0EB 3P0GB 2C9QA 1UB6A 4M8UA 1LQSR 1I8LA 4FFTA 4EDWH 1G6RL 4PH8A 3U48A 4CA4A 1I3UA 5DMYA 3FO2B 3H6AA 3IAPA 5I82A 3X12B 4AEHL 3S3PA 3GSNL 4C4UA 1T0MB 5M94B 2YD5A 4AH2B 2A0LD 35C8H 2A83A 4FZEL 1QRNA 3HPLA 3OMNB 4K3DL 3S34L 1KCUH 1JE6A 1MEXH 3PAZA 5DJCB 4GP4B 2WZ6A 2ZQKA 4W6YB 2QVMA 2DQMA 3F84A 3FF7A 4AM0Q 3EJTA 4JB9L 2YA2A 4XAWH 3TA3C 5KVGH 2NX5D 2NNCA 3F00A 3U4AA 3ZVVA 3CIQA 1P9MC 3BIKB 3Q0HA 4DJMA 2VZ3A 4MLIA 2LTQB 1TQVA 4XVUC 4YHYC 2JSFA 4BCZA 4BYHA 2QADB 4PHXA 1PAZA 4ENED 3K2UH 1HCZA 2IEPA 2WANA 4IU2A 2GFBB 4U6VL 4HDIB 1UD5A 3AREB 4MZIA 5F6HI 2Y7QA 3S3DB 3INOA 3T77B 2OXGA 3KBFA 3E1F1 1JNLL 2JB5H 5TK2A 1TVDA 2VJ0A 4UM8B 5DURD 4G7VL 4AQZA 4I4WB 3L13A 4I89A 4P23C 1N3NA 2BVYA 3LQMA 3UJJL 2V7HA 2WLIA 2VDPH 4N0UE 3O4LB 5D2NC 4F9PC 4B53A 5F6IB 4R7DA 3RB5A 3S3JA 3MX0A 3NJXA 4YSEA 3GHBL 1FCCA 5ILTH 1OLLA 2ZP0T 4TL4A 3H9HB 2X2JA 4OFYD 1VSCA 5IR1A 3P0VH 4QRUB 3B9DA 4TQIA 1OP5H 3NG5A 5IFAL 4R4BB 5T3XD 4RX4D 3W5MA 1XAKA 2XN2A 2V9UA 4HEPA 1RY7B 5T1MB 3UMNA 3UYPB 1SYVA 1EAPA 4HCIA 3IS1X 2B7DT 2FB4H 3B7YA 4AUJA 4LIQH 3LS5L 2YPLA 2KHAA 4JANA 1B3IA 1ZD6A 2MQCA 1MSPA 1VDGA 4U05A 3BH4A 5E6IA 4Z7AA 4NUPA 2EXYC 5KG9B 2OL3H 4MBOA 2JB6A 4FQIH 2DWYA 4PYHA 4NFBA 5EZPA 4FG6C 1AHMA 1VIWA 3DBXA 4MDJB 1TO4A 1CQYA 1E2WA 1QATA 5E24E 2D7NA 2X1QA 1KGWA 3ARDC 4OZFA 4ZMVA 3NCJH 1T4WA 5JOEA 1DQLL 1BLNB 4U33A 3NK3A 4HJTA 5EUKB 1ULVA 3ZBMA 1ECYA 1HCYA 4Y88A 2G5UA 3UO1L 4QLWA 1T3FA 4F57L 3EOBB 3V4VB 4HQQL 4Q2ZA 1CYWA 1KDJA 1HHIB 2QBWA 2JIXB 2PYEA 4KJYA 1KIUB 1ZDQA 3LAFA 3X1BA 5IB2B 4P4KC 3EYFA 1OF2A 3DBSA 2HMID 1EFQA 2WKOA 3P2BA 4P3DA 1JL8A 5FKPA 4MJ6B 4AY0A 3ULUH 4JNXA 1RUKH 2LU7A 1I82A 1P6WA 1NKGA 1HK6A 3WS3B 1JNHA 4O2CB 5ABAA 4B9GA 2NY3D 3EADA 5CJXA 4X6CA 3CU7A 1GOGA 1LLAA 2UX7A 2E27L 3DMMC 1AYOA 3AY2A 3IE9A 3P11H 4Q74A 1UWXK 1PCXA 4Z0XB 1TJMA 4AVJA 1DVUA 4LEXH 2AXFA 2XBZA 3GMRB 2APVA 4NX0A 1YEHH 1PDKA 2HLAA 3QWOA 1ZLSL 1C9SA 1EEYA 4M6MH 4NCDA 2DMHA 3Q6FA 1OAUL 3BUYA 4M7LL 4QRTA 3EJYC 1I7RA 1JWUB 1Z9LA 2CG9X 3HE7A 1Z2KA 2DKMA 3O3BA 5FHBH 3WFBL 2AMGA 3FQ4A 4PCSA 5D6DA 2P5WE 4HUMB 1SXZA 5F1KC 3QIUB 3VD3A 4ETYA 1S78D 5BOZG 3X1EA 1B4RA 2QSTA 2ZCKH 3D18A 1E5YA 1YJDH 3S8WA 2HRPH 4YHZH 1EJ8A 4OM0H 1T20B 2FWOB 4L1LA 1GZPA 2K4AA 5FA4B 5CBEA 5HPMA 1KBGH 4OM1H 4UT6A 3FB7A 1PKQA 4L8BB 3V0JA 1K3IA 3V9EA 2E47A 4FULA 1AZUA 1FV1A 1TZHA 1XGTB 3NEXA 3ZHDA 4CSSA 5BMFL 4JJ5A 2BVOB 4KVNL 2P26A 5MEQB 4XPHL 3WJJA 5D7IA 4EI5A 2NW2B 2DWTA 4Y16D 4TOYH 4PJ5E 4Y9EA 5MP6H 1LMKA 2CBOA 3T2NL 3WENA 4KJQC 2H9GA 3DOIA 4LSPL 2VDPB 4QO1B 3HG2A 3I9PA 2FT7A 4TSBL 3RPIA 4EN3D 5DHVA 3DPDA 3PNWB 5D1QE 1K5WA 5IMLB 4HEME 5HJGA 2NT1A 1UT9A 4KK6D 1CLYL 2E8ZA 3AU1B 1QWHA 2BNRA 1YO4A 1GGCL 3ATDA 5GZNC 3U46B 2BSRB 2IDCA 1MCRA 2NRDA 3CD4A 2HFTA 3RUGB 4KGJA 1JMXA 1KC5H 3BPCB 3GTTA 3QEQA 4GXFA 5C0AB 2EO7A 2EDWA 1ZLWH 4LASH 1GZHA 4PV9A 4PJXB 5GHWH 2OL3B 3W38A 2Q76B 3UTQA 3HC4H 4ELMB 1Z1WA 3GHEL 2CU9A 3C5ZD 1P4BL 1KGYE 3FN0H 5B8CC 4PJIB 2CE6A 1VEMA 4H2CA 3TNMA 2XN9D 2OW6A 1CDCA 4TSAL 1A2YB 5F1NB 1YMMD 2EYSA 4WWOA 4A39A 3PQYD 2H8PA 1NMCB 1OAZL 2R2HA 5ETUB 3FQRA 3LRGA 5C2BH 4MNQD 3STLA 5IBTL 3CFDA 3PWJA 3D1MC 4MNGE 3DSFH 1GOHA 1W72H 1NGXB 4NS0A 5AW8B 4F7MB 1FLTX 2CKBA 4PJEA 3LQAL 3V9FA 2VRKA 1EMTL 3KPLB 4NP4H 1BAGA 3MLTA 3T8XB 3C6LC 1UD6A 2DQHH 4XPBL 4D3CH 3MLSL 4ODBD 5B39G 4AITA 5JHDB 4GUCA 5DMGD 4XBPA 3BMVA 1HNYA 1SN0A 1KY6A 3G5VB 4YHKL 5D7LD 4EI6A 3WFZA 5BRZE 1PZDA 3WI9A 1QFWI 1JTPA 3V5KB 4OZ4B 1JNNL 3TYGH 5EF2A 4PTUA 3EOTH 1QPPA 4HZAA 1N67A 4AXWB 3HPJA 2Z7YA 3VGEA 3T65B 1FL3B 3D39D 4L3CA 3WEOA 4K8RL 3EBGA 3KPSB 5CWSB 2PWFA 1MVUB 4HIJA 1NCAH 4XMVA 4BQ6A 3CH1B 1SDYA 4W93A 2QPFA 4HJIA 1IAIL 2G9HB 1ES0A 4HIEA 1QLEB 2J1XA 1KB5H 5I6MA 4X99B 1XZWA 2EP6A 4LSRL 5I1CH 5D4QA 4OUUA 4TSCH 4F15B 1M7IA 4E41E 3ZRFC 1QYGL 4GIOA 2LQRA 3RWJB 43C9A 1E6OL 3QDGD 4B9PA 4HT1H 4TQHA 2OMBA 3RBSA 3QT2A 2ZSWA 4GG6E 2BERA 1ORQA 2EDTA 4L4JA 3U4BH 1C1EH 3ZKXC 5A16A 3ELQA 3MHZA 1S9WA 1S9YA 3CPUA 5F9WB 1T1WA 2AQPA 3PHAA 1CU4H 4LARL 4Y5YB 1U58A 5ECJE 4EVNB 1J8RA 1SLUA 4IDJL 4H8UA 4QPEA 5GISH 3P1VA 1PG7H 4W9IC 4AGQA 4D94A 4XN7A 5ECGA 4HMDA 4FI7A 2ZSVB 2MEJB 1NTDA 4PP2A 4XPTH 2AEOA 5FYKD 1TJIL 1ML0A 4H5SA 3A6BL 3O3UN 1OARL 3LTVA 4OFPA 3CK0H 5KSUA 3ZGHA 2NY6D 1DBKH 5AENA 5E00B 3DHMA 1E5UI 1HEZA 1BD2E 3X17A 1ET8A 1IJNA 4GSUA 5F7DA 3EGSA 5GGRB 4X6CF 4XCCL 1V3JA 4PMFA 1D9KD 1SPDA 3LSOA 4WW1A 1ZAGA 3SJVE 3CDGB 2D0HA 2VR5A 5TDNA 3UBXA 1OM3L 2K6ZA 3A47A 3QCVL 1QQDB 1HOCB 2AV1A 2W9LA 3MRIA 2CPCA 3CTTA 3P4OB 5L6YH 5E6SB 2I07A 1HZHH 4IRJD 5MENB 4JG0H 1V8HA 3OZLA 3KYNB 5I18L 1SRDA 2OX5B 2FDBP 2OSLA 5C6PB 3PIQB 5C0EA 4OLVH 3T0DA 4A1RA 5I1GH 5ACMA 1NLBL 2AQ2A 5B3JF 2IAAC 2C4FT 3WV0A 4LDLB 3VWKD 3B6SA 1W72B 4PGDA 3VYOA 1YNTB 5T3ZD 1DJSA 3ZQ9A 3MRLA 4FNPA 1S5HB 3VWJC 1G7QB 4GRLD 5ACZB 1RUQH 3WE6B 2J3SA 2EJ1A 3T9WA 1DSWA 1E2ZA 2J8UA 1S78C 4LRIC 5HHOB 1INEH 2ZUXA 1T04B 4KH9A 1UVQA 3HHSB 2IANA 2VL5B 5I9QB 3L9RB 3D3VE 1CICC 1Q0YH 1P2CB 5CD3A 1LO5B 4NKQB 3VXOA 1JXFA 1LEGB 4X6DF 3PWPA 2P48B 4ODWB 1M2OA 1JPTH 3SDAB 3NOIA 3HR5A 3BVTA 4POUB 3K46A 3RL2A 4N8VA 3CXDL 1YNLL 1KZYA 4X4MA 5DRNB 2APTA 2ADGA 1EBAA 1HDMB 2Q8BH 3V4PA 4DO4A 1UHVA 1AGBB 2HFGH 4XP5L 3CDFA 4KX9A 1BLIA 1OGSA 1XWVA 4Y4KD 5H4YA 3PP3K 1ONQB 4EN3C 1MHHA 3B5TA 1WFOA 3DJ9A 3FU7A 3X2QB 4Q0XH 1KB5B 2WQ8A 5I19H 3KJ4C 1T5XB 4X0KA 2AITA 3TV8A 5AOIA 2YD2A 1AI1H 1F1AA 3PFQA 4DEUA 3GM8A 1W8OA 4K4KA 4BQBA 5T1DL 4WWPA 4QNPF 1BIIA 4Z3TA 4H8WC 1XH0A 4M3KB 3QJHB 3W9DA 4X5QA 3IGLA 4A55A 2NY2B 3VE0B 4AQEA 3QORB 4ONHB 3T3PB 1ASQA 1D7FA 1M2VA 3ARFD 4PCKA 4DVRL 3MRNB 3MUZ1 5FO8B 2A9NL 5JQ6L 5M95B 2EKSB 2XU9A 3UC0L 2PWDA 5F3FA 3MCKA 2WJ7A 4LCWA 5LQBH 5IQ9B 2QSCH 1BJ1H 2OS7A 3IFLL 2R23B 3WTYA 1QTSA 5F7KC 1ZK5A 3MV7B 1UZGA 1N8ZB 2NXZC 4NRZB 1KB9J 3O2VH 1X4ZA 4XE0A 2VRQA 3UOAB 5I71B 5HHXH 4MB1A 1CGTA 4Y5XA 3QI9A 1BA9A 3OLGA 1KTLA 1A6TB 2HLEB 4NZJA 4I2XA 3TWYA 1ETZA 3BRFA 2B59B 2G2PA 2OTWB 3IDNB 3SCMD 1FLRH 1TF4A 4GO9A 5IEKA 1GXEA 3GJFH 1AE6L 1QBLL 5C07B 3T2OA 2XXFA 5IY5B 5JPMB 2W95A 2F68X 4DGYL 5LLIC 4XNZC 1I3RA 5I1DA 1OSYA 2EECA 4DAGL 2BSSA 2DI7A 1AKJA 3IWUA 4NRYA 1INQA 5CLZA 1UKTA 1NLDL 4HSAC 2VT0A 3OJMB 4A7QA 2EDXA 4NC0B 4RFEA 3ZL4L 5HVHC 4ZD3L 4UT6L 1E4KC 3PHOA 5A2CA 2XPGA 3MRQB 5IEHB 3MLRH 5E1QA 4JZJC 4WKZA 1BAWA 1SXAA 3DX4A 5IMMB 4FTDA 3HG4A 3DVFA 3WXWL 3B2PA 3MBWA 1DQDL 1ZHNA 5TGBA 4JY4A 1G9NL 4HKZB 4QRPD 4DQOH 3CC5B 3AG1B 2VO5A 2IDQA 4MAYD 1RIHH 2QKSA 2R9HC 3MJ6A 1WK0A 2O5XH 4IBYA 1FJ1B 3TBVA 1DEEA 4JVPA 4H13C 2WTPA 2K3HA 3CFJA 1ZHKA 2J12B 2C34A 3IVKB 1QRNE 3T0ED 2MWCA 1FN4A 2X05A 1R17A 4G7RB 4PRAB 5I1JL 4PJ8B 2Q1EA 3H4FA 4MQSB 5DS8B 2BRQA 3GSWA 3SE9L 4I8DA 4GI6A 3A3YB 4JDZB 5L7XL 1MRDH 2BIPA 5ESQB 4WU5B 1MCOH 1ZTXE 4PRBA 3KWUA 1BEYH 5IMOA 2GHWB 3IXAB 3TBSB 1GSMA 1ZT1B 5F9JA 1HH6A 5FO9A 5F93C 3QNZB 4QHNA 5C2UB 1BG1A 3PV6A 3EFOB 3MLUL 4WO0A 3CHPA 4WO4C 2ERJB 4NN6C 3EJJX 5JUEH 2JKWA 2NY6C 3FYIB 4QOKE 1XGYL 4HSCX 4U7SA 5EDSA 4DZ8B 3OX8A 4I7ZC 4BKLB 4A2MA 3FULA 4LHJB 4JO1H 4M6OH 1FVDB 2C4XA 4APQA 2OAAA 3QIBB 2QADD 4FQXD 2PN5A 2AEQH 1AVAA 4J6RL 5CN2A 5IM7B 3LEYL 4XC3H 5JA8B 1JDCA 5E6ZA 4HXBH 4E36A 3MNMA 3EUUA 2OYLA 4O02A 3ARED 4OVUA 1OHQA 4P59L 1XF3A 4AM0A 3UG5A 3FBQA 3VI3F 4WEBL 1UUSA 1F97A 3RAJH 4ZYKB 4K3HA 4FYSA 4K3JH 4LF3B 3DSNB 4FYRA 3S97C 5I5RA 3ZZ1A 4J3OC 4UZGA 3QXDB 3TEZA 1E27B 1E8ZA 1TU2A 3DTXA 3Q8EA 2AJVH 5F3BB 3O4LD 3QYNA 3FO1B 2CAKA 3S96B 3C60B 2J8UF 1RUML 3L3GA 3I6SA 2HJKA 1NJ9A 2YPLE 5F7LB 3X11B 1T03L 4YL4A 1AR1C 3DX8A 2ZD0A 4JRLA 4OZHB 2Y2WA 5IZ7A 2C7UB 4GRLC 4HD5A 1TMCB 4WRLA 4W6XB 5C09B 3OZ9L 2FO1A 5EU3A 1EVUA 1MAJA 1U3HA 5H8DA 1DVYA 2WQUA 3NJHA 2F7OA 1YN6A 4M62L 4G72B 4L37A 4OQ1A 4HBCH 5HJBA 3PGDA 4NHCH 3T4AC 3LEVH 3FT9A 3L16A 4Y4FA 1HXYA 4F80A 3F7VA 1AMYA 1DVSA 3BGAA 4NYLA 4I0PC 5E2VH 1WV7T 3DVNB 2O5NA 3VB9A 5E5UB 1QNZH 3PDGA 1X7SA 4N2IA 1EWHA 1LEKA 2OFQA 2PW1B 4Q6IB 4QGYA 4EJ1C 5D1XB 2F7RA 2GCYB 3HAEA 2XQYK 5HYEA 1D5RA 3IJHA 1QSEB 1A6AA 1FVCA 3OKYA 4CBZA 3BAJA 2O4EA 4Z77B 2EDNA 5KVDL 4Z8FH 3OR7A 4JRXA 2VDOL 3IS0X 4NKOA 1MVFA 3QIWB 4YHMH 4OF8A 2JIXD 1MHEA 3L5WB 4X6CE 3TOPA 2CNYA 5E9DE 4JN2A 5BV7L 2O72A 1KIRB 3MODH 1QEXA 3RZCD 1YYMH 2X3AA 2I69A 1MWAH 5AOMA 4PG9B 5A2IH 2WLKA 4PWJA 1IE4A 1KYAA 2IGTA 2FD6H 3S35L 3U0PA 3BKJH 2YD7A 5D55A 2XTJE 3MROA 2WAHA 5CP7B 1BVNP 4MVBD 2HH0L 3W5NA 2Z64C 2WP3T 4JFTA 1IQDA 3RGVB 4ZUSB 3K3QA 3QCUH 4M1CD 3DRTB 4LOVA 1SJHB 3KLLA 3Q2CA 2F6AA 4L8CA 3CBJB 2BWQA 3EYUL 4V1DB 4UQBA 5B3JE 3GZPA 3M1OA 3V5HB 4OIIH 1Q1JH 3T08A 2PXYA 3EH1A 1O7SA 2R0ZH 4YC2B 5D5MF 1KJMA 1Q38A 4AV4A 1UEYA 4JREC 4I3GA 3SGJC 1N5YL 4O2FB 2GITB 4FA7B 1IEAA 1IM3B 3QIUD 5DTFB 4X9HA 4NGHH 2R7EA 3QA3A 4QHLB 3KPMA 5FUCE 1BWMA 1GJUA 2WCPA 1XF2A 3GDCA 1YECL 3VVVA 4GMTH 1RJCA 4H1LA 3C5JB 1X5AA 4XI5D 4X6DE 1F18A 2F74A 3KXFB 4LVOC 3JWOC 5AB1A 3S37H 1EO7A 5IHWA 3IRCA 4HIXH 4JPWH 4QIRA 1A6ZA 1Q0XL 2P52A 5FB8B 3BZEA 1LO2L 1H0DA 2DYRB 4LQ1A 2XWJA 4X7DC 2GI7A 2JKIS 4WFHD 4CKVX 1X5IA 2BNRE 5DFTA 2XACC 2KDYA 3MV8A 4PLOB 5I1EL 4XP1L 2ETWA 5FGRA 3SQBB 5A7EA 2R56L 3FUJA 1AS6A 3NBNA 2WV3A 3JT0A 5JW3H 5HI3D 5IKCB 2ZCHH 3HC0A 2IXQA 3V4PL 4KHXL 1MRFL 3VFRB 3K71A 2FLRT 1JTTA 1R5VB 3F58L 2X4SB 4LLUB 4HK0B 1V7MH 5DEGA 5DC0A 4Z7UA 5DJAA 5EORH 5J8OA 5CILH 3BCDA 1TKWA 3BKYL 3FC8A 4XWGL 5C0BA 3WAJA 3KEDA 4LCCA 3ME0A 1XGPA 1V3MA 2FJHB 5DSCB 2G2RB 3FRPG 4NQVA 2FECL 4H0GA 1A3RH 5HHME 3VD9A 3AITA 1JXDA 1VJSA 3BVDB 1SOKA 3QUGA 3GKZA 2IGFL 1M6UA 2VJ8A 4UTAA 3WIFB 5EDXA 2XWCA 1WA2X 3MJ8B 5E03A 5GRUH 3MMEA 3PJNA 4F3FB 4XXWC 3K6DA 1TVBA 4NUJA 3TESA 1R19A 3QVAA 5FO7B 2VDNL 2FLMA 3K72B 3KWVA 5DD6B 4WWKB 1KN4H 3ULVF 5DRZB 1JF1B 1F8TL 1FH5H 2Q8AH 2IH3B 1HVXA 3KWTA 4BQ9A 5KN5B 4F7EA 4F7PA 3WHE1 3C2AH 4H8VA 4J23A 1MWAB 2KT6A 1T2QH 4GINA 3K8KA 3ULUD 2FBJH 2DPKA 1BP3B 1UXSA 1U2YA 3TYFB 5JHDD 5HDQL 2FNWA 4P57B 1ZVNA 4XHJC 3EO9L 1Z9MA 2LTQC 2ZXEB 4XNMB 3EYVB 5JHBA 3NGBC 4HWNA 3SKJH 2C9UA 3HC3L 1JAEA 2OBGA 1QFWL 4N0CC 1KULA 4D0DA 1TG8A 4EZMA 3MNZB 3FDWA 1T6VN 2JKTM 3IJEB 4BCXA 3IBOA 2OYPA 1EHLH 1DJYA 2XZCL 3KPSD 3QZMA 3GJEA 3W39B 4J8RA 3LRKA 3EDFA 3ARUA 1KYOJ 4TVUA 1MVYA 4M43L 5KW9H 3V7MA 1DEDA 3LZFH 3VRIB 3OB8A 1MCPH 1H6EA 2Q3ZA 4R26L 3OKLB 5HGHA 3P73B 5K9OA 1HZKA 1F1DA 3SKNB 2YMOA 1V7NL 1UKQA 4L8SA 1RULL 5K9QI 2Z35B 3BUTA 1RZ7L 3PL6D 5FHAH 3WDJA 4FNUA 5KVDE 2AP2A 1V5JA 1TCRA 3S5LB 4J12A 3O3EB 1H6TA 5J9PA 4K8RD 1HSAB 3A22A 4M8QB 1R5WB 1L7IL 1KJVB 1WWAX 4PJCA 1WWWX 2QR0A 1BBDL 3K7UA 4B50A 3WTWA 4QRSA 1PX8A 3U6RB 1T0PB 1J18A 1M7UA 4DP2X 1HWHB 3CVHA 4I3RL 2YRPA 4G8GD 1OE3A 3MJ9H 4YSPA 2L8AA 3N40F 5TQ0H 4MMXA 1RK1B 2VZVA 4LLYA 3MREB 4XN1A 4CVWA 2K1MA 4RDQF 2HPTA 1CIUA 3FQWB 3U25A 4NHUB 3VXQB 2DYPB 1JGVH 5EBLB 1WQVT 4P5SA 3GSVB 4M7JH 2MPAH 2AXGA 3QE5A 3D69A 3ULSA 2W5PA 3QZWA 4GMSH 2ESVB 2BVUA 5C7XL 3TJPA 3Q43A 4I0KA 4WI6A 3VXUB 1RV6X 4M6NH 3I50H 3U0TA 1SMAA 3ZE0F 2CUIA 1BVKB 3CBRA 2YGNA 4FI6A 4BH8A 4NUGL 3DUHA 4FNSA 5AYUL 4ZPTB 4U3HA 1IAOB 2QZ5A 1KEMH 4BFOA 3CSTA 2E6JA 2EDRA 3DV4A 1SYSA 4MVBC 2DLGA 1WJ3A 3VI3E 5F7EL 1RZQA 2HT4C 2VRAA 1CI5A 1T5KA 3OJDA 4XH2B 1CFBA 1IBBA 4LEEA 5DO8A 4M1CC 1RKRA 3QHFH 2DQDH 5FF6B 4A2HA 4PJDB 2J8UE 4JQXA 4OD2A 4P49A 2DAVA 3FAXA 4AWJC 3UAJD 4P2OB 4EDXA 1P7QB 1K85A 4FLHA 5CP3A 2XG4B 1MPAL 5DJYB 5HGDB 3WIHL 2FX9H 3WD5L 1F3JA 4NT6A 1LK3H 5MEOB 3ZDWA 4KJPC 5BO0D 1KY7A 2M8XA 3OXSB 1HXMA 5ADPL 3JWDH 5ID1B 3PWPE 4GUOA 1F45A 1PD0A 3QIUC 1CD0A 2XBDA 4OQTA 4WI0A 4ZAKB 5HHQA 5HHOD 4JY6B 1A7OH 1U8PA 3QCTL 1IGJA 1NFDA 1UWYA 4JDTL 4XN5A 4RDBA 4DP4X 4X4ME 3WN5C 3NSXA 4MA7H 3RX8A 1D6EB 1TEYA 2ICEC 2VDRH 4K7PH 4KZ0A 3ARBB 4G6AD 4GYBA 5L2KA 3SDCA 3H1ZA 3WEBA 1UWGH 1X44A 3R1GH 4JKPL 1S7SA 2BNQA 3D2TA 3SDAD 4DP1X 3ESMA 1DBML 2DQJL 3OHXC 5EEUA 3ALWA 3S5LG 3KDPB 1K4DA 3NA9H 4ZTPH 4GUPB 4HPHA 5D1ZC 4QRFA 3MRKA 2GIYA 3CLEH 1ZTMA 4H0HB 1ETA1 4FERA 5A1AA 4Z7UF 4O51A 3BQUB 3AC0A 3QWNA 4OLYL 3HZVB 3E8UL 1I1CA 3D4CA 2IOOA 3A6CH 3V8OA 5GGTL 5DEFA 5TF1H 2ICWA 5J6GA 2QPEB 1WBZA 5E0QA 4X4ZA 4W68A 5ANHA 3QJZA 4WUKH 3EH3B 4LCWE 4LQFL 1TENA 1P7KB 1SVCP 3HNVL 1BVLB 3UTZB 5BPPA 4S1QH 3SGDI 1QACA 3NJGA 3VXSA 3CFKA 5JORA 2L4OA 4UIKL 5DD1H 1NGPL 3WO3B 2Q6WB 1N59B 4C4KT 1OAKH 3IDGB 3KCWA 4IMKA 3QORD 2HT3C 3EYOB 2HTKD 4BKSC 2YD3A 2APXA 5TFSH 3UTSA 5GZOA 1IIIA 3RWGA 1IAIM 2CBPA 4ZW7A 1U3YA 1OP3H 5C71A 1U8KA 1DCLA 1JYXA 3SD2A 3UP1A 2D4DA 3QXAB 4I2XE 2ICCA 3ZHFA 1I9JH 4LO9A 4FP8L 1FUNA 1CYXA 1U8LA 3RPKA 5L2JA 2ZNXA 3LKNA 3OPUA 1DJIA 5D5ME 3MV7D 3TGXA 1NMCC 1NFKA 3BWUF 3PWNA 1MY5A 4CADA 2IO5A 2I9LB 1N70A 4R7NA 4BZ2A 4LSVH 5DLML 4BM7A 2WXRA 3QW9A 2PP8A 5DI8A 1JGEB 2IADA 3B1UA 3SDDA 1Q90A 5KTEL 2CJTA 3JVGA 5E99L 2NZ1A 1TJGH 4X7FC 3NCBB 4RVBA 2R1WB 2WINA 3BKCH 2TSAA 5LXGL 1CDIA 5C07D 1PSKH 2F53A 5JQHC 1KXTA 4WNSA 4KKCD 3LN4B 5L4IA 1IQWL 3RU8L 3H9SE 2ZP9A 1MH5B 2ITFA 1T0OA 4Z7NE 4GJTB 4QHMB 4TNWF 5D7EA 5EB9A 5HYQB 3S8FB 1A14H 4YO0A 5I8CB 4FFYA 2QVTA 3GXFA 5HGBB 1MHCB 1MCQA 3MRRA 2CDGA 4XT1C 2X9ZA 4GRMA 2DJ4A 7TAAA 4LHQB 3Q5TA 1IC5L 3GMOA 1B4LA 3D12B 3DHUA 1KGIA 4C83B 5DK0B 1KBKA 3BP6B 1QLFA 1XF1A 1UOKA 3L3IA 4H0LC 1TVHA 4HUUB 2B4CL 2ARJQ 4XCFL 3O0RL 3DV6A 1KFGA 3PP4L 1CTMA 3KL3A 5L8LB 3FN9A 4AYFA 4S0HA 4K9JA 3TT3L 3UGUA 3WLBB 4DK3A 3FTYA 1YEKL 3DUUA 5BVPH 5GGSB 4F15C 1GY1A 3TASA 4JFQB 4PJCF 4AUUA 3NQKA 3QZPA 4N0UB 4R3SA 1KYUA 1YQ2A 3N42F 4GY4A 1LP9B 2VXQA 1JERA 2YJQA 5DJZA 2VDRB 2BHYA 3U7WH 5LO7A 4RRPA 3OKNA 3X13A 2RGSA 3OWRA 1KG0B 2VR7A 3ECWA 4O9HH 3IRPX 3MRHA 2C9VA 4WHTA 2AZAA 3AABA 1OSPH 1Q9WA 3OSVA 3RNQB 3QS3A 4AEHH 4AYBA 2K6WA 4MQ7B 3LQZB 5EU5A 4Y5YC 1ORSB 4PJ8D 2V9QA 5GS1B 1IV8A 1HQRB 1MJ7L 3UTTB 1ET7A 3AB0C 5E5MA 3POCA 3ULVE 5ICZA 3WL9A 2AAVA 4GW5A 3NK4A 3H42H 2VE6A 2A9BA 3FH5A 3I2CL 5KSAB 3HKFA 5AOZA 4F2FA 4WWID 1URIA 4U2YA 2VITA 1YNKH 1KZQA 2B0SL 4OLWL 5KWYC 3SOBH 5TDPA 4A66A 4P3WA 4A2FA 1IGYA 1E5BA 4YWGL 3QQXA 4M6AA 5DD0L 3V0HA 1MFMA 2HTLD 3SE8L 3ZMEA 3EHBB 5CJ8A 1KNOA 3QIBD 1JPFB 4YDLB 2CO7A 3QEGL 4BA0A 1JN6B 4R2GC 3JZ7A 3P4MA 4KO7A 4YK4B 2P4AB 3BE1L 2EUZA 3BH8B 4AJ0A 4OU3A 4F1ZA 3BSZL 3VGFA 1A6UH 1JNLH 4RA0C 4K9EL 4HOWA 4G7VH 4J2QA 2ENYA 2PUQT 2DTML 3T6ZA 3MUGA 3MJ7A 4B7LA 3UAEA 1MIEH 4LPYA 4BUGA 4FXLA 3VSVA 2VM4A 5I0WA 1JZEA 1TEGA 2QSVA 3L6FA 3MBXH 1O0VA 2C1OA 1YEFH 1SOQA 1RZFH 3LVEA 3C60D 4ORGB 5DJ8A 3W1ZA 1TETH 4UOW0 1AZCA 1NFDF 3CDZB 1I3GL 1CGVA 3PWLB 3X1GA 1TZAA 4HGKC 1A6WH 1SY6A 2VLKA 3BZDA 4LLMA 4TF4A 5C09D 3GQFA 3A5VA 2YUZA 2WJ5A 4Y1AA 2WMPB 5D96B 4KZDL 2I7SA 4XX5A 5AW7B 4NZUL 3US0A 3QUMB 4DN4L 2D3VA 2QLYA 3KBEA 5I9QC 1KENL 4KKLD 4J3SA 5IHUL 1SEBA 5BUGA 4G6AC 2P5WB 4OLZL 1WPCA 2KUTA 2A74A 4ZUVB 3KPRA 1DQLH 2KPNA 2ZOLB 3H7BB 1MN4A 3QPXH 1WZLA 3C8DA 3SDAC 3WJLA 1A3LH 3UO8B 3PWUA 2Y06L 4H44C 5E4EB 1T0NB 1A4JB 4WVRA 5DJ8B 1QWUA 2DOCA 1UH2A 3BLBA 4RISL 5D1XD 3IXTB 2GKIA 4AEIL 4FKEA 5D2LA 1BMZA 3D7PA 5IB5A 5KSVB 3CVHL 5KJ7E 2VABA 4HIIB 4N86A 4JN1H 2HX7A 3G04B 3B7UX 3QIWD 4YFEA 4AIZA 4PJGF 3H0TA 2BXYA 3GMMA 3ZE0E 5KAQG 3ZYIA 3PU7A 3T0BA 4PJ5B 3KPNA 2ZXGA 5C0FB 1CXEA 4AIXA 3U9PH 1N5AB 5KJRL 4K23L 1WWCA 3P2TA 1UASA 4OZIE 3RZWA 5CM1A 4HS3B 3QULB 1IVLA 4KK5C 5EO1A 1NBCA 2A6KA 5BCAA 1X5JA 2E27H 1YEJL 3VX0A 1QABA 2R51A 1MFVA 4PJ9A 1FGVH 1Q9LA 2NY2C 4JZNA 4TULL 4E5XG 2VZSA 3QORC 1OCWL 1JUFB 3ZE1F 1ZLSH 3GK8H 2Y1ZA 4V1DD 3V5DB 3HLKA 5HY9B 1OAUH 5CUSL 2Y36H 3VNYA 2CKNA 3O8XC 5B1JC 1IM9B 1M4KA 4ODSL 4IIQB 3TV3H 5FM4A 1KPUA 5E4IA 3EOAA 3L4VA 4WW2B 4O58H 2NR6D 1KPRA 1PY9A 3FQXA 1F41A 1IBDA 2PETA 5I71C 1NICA 3VO0A 1ODAA 3NQIA 1IM3D 2CGYA 1R3JA 3RFZA 2DLTA 3MLZL 2JXMA 4NLHA 4ETQA 1F4XL 2BVTA 2VXTH 3FUMA 5CGBA 5JOFA 3K8MA 3BGMA 3IDXH 5AOLA 4KRLB 1HKLL 4ZX5A 3CZLA 4WHYH 3MV8E 4FQPA 5JPMC 4ZNEA 4GKZA 2ADYA 3TN0A 2Z91B 4OQTL 4C57C 4H26A 1G5GA 3KXFD 4MNGB 3T1FA 5CD5D 2ENSA 2J6EL 3X3FL 4Z95H 4B0MB 1X7QA 4D9LL 2MOQA 1MFAL 1UZ6F 1EHAA 4FFZH 1MJJB 3ZYOA 1NBYB 3QDME 4LSPH 1K6QL 1RUPH 3SBQA 1GGIH 5D2NE 2D31B 1LM8V 5E51A 5IJDC 1USQA 1D5IL 2YFNA 4GSRA 4I77L 1KEGL 4I9WD 4N2DA 4Z7UE 1WBXB 2X1PA 3K8LA 1AC6A 3L3KA 4YHOL 5C0BE 3T4YB 5BRZB 2IMMA 4U3SB 5D70L 2QQKL 1UENA 3LPWA 3VW3L 5ALCL 1L6PA 1EEUA 2HG5B 4XPFH 4POYA 1DVFA 1H3WM 5IG7B 5GRJL 4NBZB 5CEYB 1GGCH 1H8LA 4HG4K 3HE6B 1IGCL 2R2EA 1MFBL 1HNGA 3SE3C 1A7RL 3BP5B 3RLSA 5IOPB 5EU6A 3G6AB 2BINA 3L3DB 4YVUA 1VB9A 5DMKB 4KROC 3B9KB 5C0NC 3D25A 1IAKA 3GHEH 4ZFQA 2AJYL 3NCMA 2X6AA 4N1HB 1E9QB 1T21A 3GPSA 5JHLA 2WLLB 4TS6A 2E75C 1B0RB 4E41B 5BOPA 4IRZL 3KR3H 4NSKB 1G7MB 1S7WB 2FBRA 4UMSA 1EDHA 2EE6A 1IC1A 2F7PA 3N3EA 1KCRL 2VMEA 5FFOA 3HOGA 4GG6B 1FAKT 4Z3GA 3MBEC 4WWKD 3VXNA 3GZQA 4PRDB 2KZ1B 3LQAH 2Y1AA 3FSZA 3QNYA 3CZUB 1ZA6B 4R7XA 5EF3A 1WIOA 2DWEA 2DMBA 2ERJC 2OP4L 2XZAL 3NIFF 4G80A 4TTDC 1I8KB 2W65B 2Z8SA 4N0FB 3ZMRA 4ZUTB 3QRGL 4YHKH 4F1SA 1KCSL 1J8HB 4BZ2L 1DN0B 5I16A 1ICTA 4YFLI 1BQLL 3OLEA 4R96A 3ZO9A 1RD6A 1ERNA 2N0KA 3SE4A 1G87A 3IE4A 6TAAA 1S4IA 3PHSA 1G7PA 4HWBH 3UDWC 2C8NA 3DOSA 2R4SH 3WJMB 2E7BA 4BUHA 4OD3L 5CJOL 3D0VA 2VDMH 1TOXA 2JELL 1VERA 4DPAX 2ZX6A 1VAHA 2O5ZH 1XR8B 1VGKB 3OXRB 1I1AB 4MB4A 5IJVB 4KJWD 1RPQA 1UA3A 1S46A 5E2UH 3JBG7 3SJVB 2APBA 2JV6A 5DRXA 1MCKA 1U8IA 1JYVA 3ZT5A 5CCKL 3OKOB 1FG2A 4KK9C 4BSVA 4MS8D 5DA4A 3C60C 3QQDB 2FO4B 1XIWB 1MF2L 4FNLL 1QYGH 3MLYL 4N26A 3LVTA 2CBTA 1YY9D 5K9JH 4QRAA 5DGRA 1E6OH 4PJCE 4P5MA 3HG1A 2LGNA 5J3HD 2XWRA 2OSXA 2OXHA 2DLFL 1NAKL 4HLJA 3L4WA 5EOQL 3C8KB 2EDFA 3TCLB 5E94B 3UBHA 4JDVA 3KVPA 3KD4A 4ACTA 3L45A 3TONA 5GSVB 4YIQB 1GC1H 2C3VB 3TO4B 1AZVA 4GRWE 4P46D 3WSQH 5D2LF 4Y4HB 4JX0A 5DJ0B 5DVLA 4MQTB 1QSVA 2HYMA 2VXQL 2C1PB 2AJXL 4OB5L 4RAVB 3S4SA 2P45B 3LEXA 1LE9B 3QWQB 1QI3A 1E9OA 1HE7A 1NGQH 1LD9B 3X14A 4NOBA 4DH2A 3SY0B 5KVEL 4Q6IC 3D3VB 1INDH 2DYPD 3QBTB 5GRWA 1JCVA 1DDHB 3ALXA 4LAQL 1D5ZB 2J21A 4R84A 2QQNH 4JGMA 4G6FB 2ESVD 5JYLA 3VXUD 3SGDH 4PW3A 2DBJA 5ISZE 3LKRB 2NY0B 1NM4A 2PCFA 3UJIH 4ILDA 3AU0A 3QCVH 1ZTXH 4F8TA 1ZT4A 4PCYA 1DVXA 2PP9A 4K7PY 3FTXA 1XL4A 5E2TH 3IGAA 3WY4A 1D2PA 2BMKA 2X4UA 4ATTA 1D7CA 3RGVC 4Y2OB 4XVTL 5A6IA 3C9NB 4YJZL 4GT7A 2VN6A 1OOAA 2WQXA 4HJ0C 4GQ9L 5BZWB 4JFPA 1NLBH 2VIRB 4DUWA 2VSMB 2DQFA 2BZ7A 3TBWA 2J71A 3VX1A 1P7QD 1NFDE 2XNAB 1HEJC 3NFNB 4JKKA 3WKYA 4KPHH 2BW5A 1MQKH 1N6QH 1OE2A 2E7LC 2NR6C 5L2KE 1AJ7H 4FQHA 1SHXA 2TRHA 4P9ML 1XCQA 5ITBL 4ZAKD 2EKJA 3GSQA 4HH9A 6CGTA 1QUNB 1A7NL 2B8OT 1N64L 3QAZB 5IQMA 5DVMA 4JFOA 4KKBD 1JGLL 3ARBD 3FB8B 5CD5C 5EOTB 3OKMB 1KV7A 2CLVA 1LDPL 2VDMB 3I84A 3VFUB 3WAKA 1AGEB 2XC8A 3X3GH 5JHAA 4NJAL 2JVUA 4TV3A 4J3OF 5AZEL 2HKHH 3MACL 1OWWA 5L0QC 4B3EA 1HZLA 2A5UA 4UM9A 1CL7I 2VAAA 3K74B 3KBHE 2VR4A 4FQ1H 4UV7H 1UFUA 2IPUG 2VXVH 5CINH 1QMUA 3ASNB 1LWRA 5FYKU 3QQ3B 1FNFA 2P8MB 4YHPB 1NOAA 1NOFA 4PJGE 1NL0L 3RP1A 2Q3AA 2OCCB 1M9WA 2XTSA 3TBCA 4UDTB 4JFDA 4U1MB 5IMKB 1QFWM 5D7JB 3MZTA 4G8IA 3HN8A 4YDMA 2OMTA 2J25A 2O6FA 3UTSE 2UZXB 5FGCE 3E3QC 5F2FA 1WCBA 5AKSA 3ISWA 5EULV 4BWUA 4KHTL 1SLXA 2P5EA 3NCEB 4TVPE 3JTSA 4JS7A 1IBGH 4L4TA 4C4BA 4AE0A 1G7JA 4DVRH 4JL2A 2ZT9C 4AMWA 2J43A 3L5XH 2C3HA 4OAWA 3UC0H 4LDCA 4HGMA 1P5VB 3ZE1E 2L7UA 2IG2H 4FG0A 3MFFA 2IFGA 1I7ZB 3CQFA 1JK9A 1BZ9A 4ICWA 3QR1A 2YLKA 1M7DB 4L4VB 1ZMYA 4JO5A 4TNVF 4NAJA 3ARSA 3TC9A 3ROOB 1FPTH 2JKXA 1RHHA 1WO2A 2BOCA 2F53E 4I5BB 5IQLA 1CGYA 5IIEA 5L9DL 2EVJA 2CO6A 3P9WB 5CBAA 5IT2L 1O5PA 4X6EA 4ODTL 5CLYA 1VCAA 1OCOB 3VG0L 1HAUA 2QL1A 3AS0A 3GBML 3RTLA 3RVVD 1CFVL 3VXTA 1Z0MA 1T89A 2GBAA 3TNNB 4ZX3A 1ZCRA 2EH7L