2PCYA

The crystal structure of poplar apoplastocyanin at 1.8-angstroms resolution. the geometry of the copper-binding site is created by the polypeptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
b'IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
molecule tags Electron transport protein(cuproprotein)
source organism Populus nigra
publication title The crystal structure of poplar apoplastocyanin at 1.8-A resolution. The geometry of the copper-binding site is created by the polypeptide
pubmed rcsb
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1983-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2pcyA00
2J56A 2FJSA 1PZBA 4DP8X 3PAZA 3D12B 1MDAA 1ADWA 1VLXA 2QPDB 2ZXWB 4DP7X 4GYBA 4YSRA 2GSMB 4YSQA 1L9QA 3NJFA 2B3IA 1NIDA 1X9RA 2CCWA 3ABGA 3EH4B 2YAFA 4BXSV 1QHQA 4YSSA 3X1FA 1JXFA 3HB3B 3AG4B 2XV2A 4X4KA 2DWSA 1SFDA 3WNIA 1SDDA 1XB8A 2PP7A 2WO3B 2IH9A 1J9RA 3FPXA 3FU8A 3PLYA 4YL4A 2X87A 2YAQA 4BWUA 3CVDA 2IAAC 1URIA 2AFNA 4N4YB 2LLNA 3DKHA 5FC9A 4P5SA 2XVBA 4NAJA 2PCFA 1SJMA 1NZRA 2AVFA 1PMYA 2HX7A 2IDUA 2EIJB 2MRYA 4YSDA 1AG6A 4JHUA 4HCFA 3X1GA 3TU6A 2FWLB 2YARA 1OE2A 1AS8A 3SBPA 5PCYA 1IC0A 5F7AA 1KCBA 4JHVA 1WA2X 5B1JA 4CSZA 1AZUA 3H56A 1WA0X 4UAHA 4ZK8A 2VW4A 4G70B 4BDVB 1J5DA 3OD3A 2EIMB 4KOBA 4KNTA 1NIEA 1KDIA 5B1BB 1BQRA 4A67A 2VM4A 3QJQB 3QJTB 4KO6A 4E9VA 4HHWA 4FAAB 1AZNA 3QPKA 2DYSB 8PAZA 2Q5BA 2H5UA 4AKQA 2VMJA 2DY2A 4KO9A 1TKWA 1KV7A 3X1NA 4G71B 2BP8B 2J57A 1JVLA 1JZHA 4YSAA 5AKRA 2OJ1A 1JVOA 2XX0A 1M56B 4CSPA 1M57B 1AIZA 3T71A 1RZQA 4KOCA 2YXVA 1B3IA 2BZCA 1ZIAA 2A3TA 4HIPA 1JXGA 1ZIBA 2HZHA 2YAOA 1CYWA 2YAPA 4F2EA 2CJ3A 2PP8A 4Q89A 4A2DA 3ASOB 2I7OA 1JERA 3NJMA 5D4HA 3SBQA 2AANA 3HEIB 2TSAA 2QDVA 1RKRA 4A66A 4DP5X 2RACA 1AQ8A 2PP9A 3GYRA 2JKWA 3S3BB 5AFAA 1J5CA 3N55A 4DP9X 1TEGA 3T6VA 2QDWA 4GP5B 1NPNA 4E9WA 1ZPUA 2YQBA 1OCZB 1BXUA 1A65A 3FYEB 2XWZA 3DTUB 2HRGA 2FT8A 3PCYA 4BWTA 3OQRA 1L9TA 4PCYA 3JTBA 1AZCA 1L9PA 4F2FA 3EF4A 1OE1A 4YVNA 4GXFA 3ZIYA 3KW7A 4A2FA 2PLTA 1CYXA 4DP6X 3WIAA 4AI7A 4RH4A 1ETJA 2UX6A 2CBPA 5I5JA 3ABLB 2FQDA 4K9JA 4M3HA 3UABA 3AW5A 4P5RA 2GBAA 1BQKA 4TXVB 1E65A 1AANA 2Q9OA 1AR1B 5I6LA 2CALA 4A2HA 3AG3B 4DPBX 1SHWA 5I5IA 5A7EA 1V10A 3CG8A 3RYMA 2VSMB 4E9TA 1AZRA 3X1EA 2BWDA 4NB7A 3WNJA 4YSEA 3IN0A 2ZWNA 1FWXA 1L9SA 3FQYA 2J5WA 2R7EA 2YAMA 1GS8A 1E5ZA 3EHBB 4HAKA 2QPEB 3BVDB 3NSFA 3FYIB 3NSCA 2BHFA 3GDCA 1BEXA 4E9SA 1AS7A 2W88A 3NJIA 4WTQA 1N68A 3IN2A 2ZONA 1JOIA 2JXMA 1PY0A 9PCYA 2GC7C 4MFHA 3FPYA 2IDQA 7PAZA 1BYOA 1SF3A 1HAWA 3FT0A 2W8CA 3IBOA 2FTAA 2HLEB 5I6NA 1I53A 7PCYA 1ASQA 3CDZB 4W1TA 2DV6A 1XMEB 1PLBA 1CURA 1OV8A 1JXDA 2DWTA 2CUAA 1WS7A 2PPFA 2FQFA 4DP2X 2IDTA 3FU9A 4UF7C 2BWIA 3UACA 3WG7B 3PAUA 1ET7A 1EZLA 2UXFA 2ZOOA 3ZX1A 2VM3A 3C75A 3NP3A 1MZYA 1UATA 1XB6A 3IE9A 2R7EB 3TBCA 2BP0A 1MZZA 2DYRB 1A4AA 1V54B 4Q8BA 2UXVA 2IDSA 4KNUA 1AACA 3MX0B 4E9XA 2QT6A 5D4JA 1L9RA 2P80A 2XV0A 5F7BA 2XYBA 5B7EA 4E9QA 1FFTB 4YSUA 4W9ZA 2FQEA 4DP0X 3PAVA 1KCWA 1SDDB 4UANA 5E9NA 1KDJA 1AOZA 3CZUB 1BXVA 5B3SB 1MG2C 1QLEB 2WO2B 2XV3A 1T5KA 3H4HA 4L0PB 4E9YA 2XX1A 1RCYA 2YAHA 2HX9A 2H47C 2GC4C 4AKPA 2BO0A 4G72B 1W8EA 1QNIA 2PPEA 1GS6X 2BW5A 3OM3B 2VW7A 3SBRA 3FU7A 2IDFA 1NWOA 4G7SB 2H3XC 3CDZA 2IWFA 1AS6A 1JZJA 4KNSA 1NDTA 2XUWA 1NIBA 1JZFA 1IBYA 2BP8A 6PAZA 3EH3B 2IWEA 4GY4A 1PAZA 1GW0A 4AX3A 2CAKA 1OCOB 3SQRA 1BYPA 1NICA 1ID2A 3NT0A 1E67A 2YXWA 4KO7A 3S3DB 4A68A 5D4IA 5B1JC 2UXGA 2NRDA 1PF3A 1TU2A 1E30A 2UXTA 3TASA 3DIVA 1J9SA 1SF5A 3H4FA 2GB2A 1GSKA 2WSDA 3T6ZA 4DP4X 5B7MA 3QQXA 3V9EA 2EINB 2TSBA 1OE3A 3NJJA 1MG3C 3QJSB 2UX7A 4HCGA 4BK5C 2HX8A 2MTAA 2PPDA 2JFCA 5B1AB 3UGEA 3WKPA 1GYCA 2PCYA 3QJRB 1NTDA 1IBZA 3NSYA 1OCRB 2I7SA 5AZUA 5B7FA 2GHZA 4G7QB 1IKOP 2GI0A 2XU9A 1NIFA 2HXAA 3QJVB 1ASPA 3NJKA 3FSZA 1AG0A 3KW8A 1KYAA 1CC3A 1HAUA 3IEAA 1J9QA 5ANHA 2Y69B 1JZEA 3N2JA 1NIAA 4YSOA 4AZUA 1WAEA 2BP0B 1WA1X 3S8GB 3ERXA 4AKOA 2P80D 1XB3A 3CVCA 1ILUA 4BWWA 1OOWA 5IY5B 5I6KA 3CVBA 5TK2A 1TEFA 1IUZA 4FA7B 1HFUA 2EIKB 3EH5B 2FNWA 3G5WA 1NPJA 1PZAA 3BQVA 3X2QB 4E9RA 1BXAA 5PAZA 3PPSA 3OMAB 3FQ2A 5I6OA 1M9WA 3OMNB 6PCYA 1ASOA 3TBBA 4BXVA 1EHKB 4BDVA 5LDUA 3FSWA 3NYKA 1GY2A 1JZIA 3S3CB 1ILSA 2VW6A 3JT2A 2J55A 3AY2A 1AAJA 1PNCA 3V9CA 2IWKA 1A3ZA 5I28A 2E86A 1AZBA 4M4RB 3QJUB 4G7RB 3FSAA 4WKXA 3PXLA 1YLBB 1JZGA 1F56A 1DZ0A 2AZAA 2Y1AA 4YSPA 2N0MA 2B08A 4HZ1A 1ET8A 3UAEA 3WKQA 3ZBMA 2EILB 2PPCA 1DYZA 3U25A 3FU7B 1W6LA 5B1KA 2FT7A 5I6PA 2GIMA 3TA4D 2FQGA 1L9OA 4EF3A 5I5MA 3NSDA 3NJNA 3AZUA 1J9TA 3NJLA 4PAZA 4YSTA 2XXGA 3ABMB 4DP1X 1ZDSA 4QKTA 3MBWB 1N70A 1OF0A 1ZV2A 2IH8A 3ZDWA 2AZUA 4HALA 3NJHA 1CUOA 1V55B 3ABKB 4NERA 1SFHA 1SHXA 3GXUB 2VSKB 4GP8B 1A4CA 1W6WA 1X9UA 3OMIB 4JKNA 1NINA 4A2EA 3ASNB 4YSCA 1RZPA 1BQ5A 3L45A 3X1BA 5EHFA 1ET5A 1A4BA 4DPCX 1SNRA 4HHGA 5I26A 1PLCA 4GP4B 1E5YA 1A8ZA 3T6WA 5I6MA 1PCSA 3UAAA 1NWPA 4YVUA 4ENZA 2VN3A 2FT6A 1WS8A 5TK4A 3AG2B 4KO5A 2X88A 1GS7A 3AG1B 2OCCB 3WI9A 3UADA 1BAWA 2OV0A 3NJGA 2BZ7A 1GR7A 3NP4A 2XXFA 1ZDQA 2XLLA 1PLAA 2YAEA 4HCIA 3S8FB 3FQ1A 2PPAA 4DPAX 2I85A 1KBVA 1PZCA 1PNDA 1OCCB 4A2GA 4QLWA 4N8UA 1GY1A 2BW4A 1R1CA 4F7KA 3T9WA 3FSVA 1KBWA 1FA4A 3T6XA 1KGYE 3FS9A 2HRHA
chains in the Genus database with same CATH superfamily
2R9HC 2FJSA 3V4PH 4CL7A 4AQ1A 2GK0B 3D12B 1MXDA 1QOKA 1TPXC 3LPOA 3V2AR 2P9RA 3GF8A 3CLEH 5AL8A 5ITFB 1JYWA 4PMFA 4RIRA 3US1A 2WYHA 4RLDA 5DVKA 2IGTA 1FL3A 3SYOA 1KLUA 3TN0B 3GMPB 4ZFZB 4YSSA 1IQWH 2A7BA 1VEMA 3I9AA 3Q44A 1MLCA 4AXWA 4ZUVA 3MJ8A 5DYOA 3QVAA 1MVUB 2VABB 1PZUB 2D31A 1KTBA 1SDDA 3F58H 4OH2A 1SXCA 5I23A 3T8XB 2G75B 3HHSB 1K4CB 4XVJH 3VACA 1UEYA 3ZW3A 1DN0B 4YUEL 3WEOA 2HLAB 3NZUA 1OHZA 3CSYB 1DTUA 1C08B 4AYFB 3QULA 3KYAA 5GSRB 4ZNCD 1NDMA 2VDRB 4N4YB 2A6DB 1HL5A 3DKHA 1XH0A 3GUTA 4I13B 4Y4KA 1DQJB 4HIIA 1PY9A 1DVYA 5DO2D 2HX7A 4HPOH 1L3NA 3FAXA 4KMTL 3BP6B 3MNZB 2GCYB 5I0XA 4JHUA 4NUJB 1N3NA 1JPST 1JGUL 1MRCL 1UD3A 3AU1A 1CL7I 5EZOH 5LQBL 3ENEA 3PNWA 3OJDB 5CN1A 5KSBF 1KCBA 3TH2T 4FA8A 1WA2X 4KQ4H 4MDIB 4OIFA 1FV1B 1WA0X 1UWEL 3S3SA 2VW4A 5D71H 1IAII 4DKEH 3DJ9A 3E2HC 5I8OL 3S3JA 1W72L 1QKZH 3LRMA 3MCLL 3BVWA 2IOOA 1MH5A 4IBYA 3AXIA 4P4RB 4EN3C 4JFED 5KSAA 4QY8B 4AKQA 2Y5TA 2LE9A 4KTDL 2YMXL 2GUYA 1V27A 4LHUB 4WI9A 1BQHB 2CUMA 5ITFA 3FFCD 1W80A 3LXUX 2XETA 5I8CA 5JNYA 2AEQH 5L9DH 3GK8L 3T77B 2AQTA 2EECA 2EVJA 1BF8A 4GFXA 4LVNC 1AMXA 2X7LA 3LHPL 1UQSB 1XD0A 5L6YL 3F7VA 1SLVA 1ZANH 3VI4E 2A3TA 4KUCF 1JXGA 5I16A 4F2EA 4IS6B 2EAEA 4A2DA 1KLGA 3A6OA 2WTOA 4X4MA 3C6LD 3C8KA 3CPLB 2MCG1 1QZ1A 5FCUH 3O6KH 1JYVA 1C9SA 1KTDB 2BK8A 1CXIA 4JFHD 1NANI 2XPGB 5HXMA 5D70H 2Y2WA 1AQ8A 3HUJF 4O2CA 4ZDHB 4ZOBA 1GPOL 1WBYA 1CE6A 3RDTC 4NKMB 4DP9X 5JORA 1TQSA 3P3UA 2GJ6A 4WUKL 4MS8C 1QVOA 3GSNH 1PX4A 1N59B 3EG9A 1EO8L 4L4VD 3SDAB 4HGWB 1CTOA 3TO4B 3EXJA 1YEGL 5T1MB 3WFHA 2FB4L 1WFUA 1NCCH 1WWCA 4FFVD 4NZDA 1D5ZA 3E8UH 4NO0B 4XC1H 3CZEA 3PWNB 5DZPA 3VAEA 5F1IA 1O6SA 4XR8C 2DB8A 2W07B 1XT5A 4BKLB 1L7IH 2PWDA 4AYMC 1E4XL 3L5WB 1UT9A 4W9DC 1TETH 2IGFH 5F0MB 2OYKA 4Y4HD 3U1SL 4F7TA 1DBJH 1W0VA 5I9QB 3GRWH 2JKLA 4YJZL 1J5HA 4KZDL 4I5BB 2XG4A 3F5WA 2GBAA 4U1NA 4R7NA 3KJ6H 3GSWB 3GBMH 3U7WH 2W9LA 3GMOB 5I6LA 4XAKE 3ZMNA 3A6BL 3T0EB 3S96A 3BW9B 3QI9B 3DPBB 5ENWB 3V7AG 1F6LL 3V0JA 3AACA 1HHHA 1A3RL 1SXNA 1OALA 4PJGF 5HGGS 4PJGA 2XICA 4H8PA 3ZTNH 5FOJA 4D9LH 2VLMD 3H53A 3NRPA 2CR0A 5FYKH 2NX5A 2WIIA 3MACL 1R3LA 3SN6N 4OV5B 1GVIA 2DTML 2K78A 1JRHL 5IB4A 1D3CA 3NZSA 5AOZA 1A9BA 1OAUL 3GJFK 4IEFB 1E5AA 3SGJA 4BE6A 5D1XE 4AEHH 4E41B 1NAMB 4G9DA 2I69A 4OCNC 5CEZL 4X42A 4LLWB 5AOMA 2AGJH 1OAQH 3WIHA 3EFFA 5AOIA 5F9DC 3MLTB 1PTZA 4WF7A 3P02A 2XTSA 2W94A 4GS7B 2NXZC 4M62H 5F9JA 2IANB 3V0GA 4Q74A 4X5RA 1YY9C 3MRFA 2R4RH 5C0EB 4DP2X 5E7FA 1L6PA 4DVBA 2FD6L 2WY3B 2R4SH 3BVXA 2BSRB 2YWYA 1XR8B 1QA9A 3NG5A 4LKXA 4EDXA 2VB5A 4N1HB 3KBEA 3CVIL 4AYID 3FONB 2XN0A 3VXNA 1KNOB 4JDVB 4YDKH 1YYCA 3EOTH 2J43A 3OJMB 4MJ4A 5IG7A 4P23C 1DVTA 1R47A 5CBAB 4V1DA 1FL3B 1NFAA 2KBGA 1RZIB 4YFLI 3QISA 3QIBC 2Q7YA 4AV5A 4E9QA 2Q3ZA 3LZQA 4JO3L 3MRFB 3V4VH 2XRAH 3HMXA 3M46A 4ZMTA 5KZCD 1UOWA 1N7ML 3UO8B 1FRGL 2DLGA 1AOZA 3CBKB 3O9WD 4Z7UF 2TRHA 3BZDA 5EWIL 3VD1A 4BE5A 5H37H 3WGVB 3IGLA 2Y07H 3K4ZA 2YQ2A 3RWEB 3CSFA 2ZX5A 5E08L 3VH8G 2JXMB 4MQTB 2LFGA 4G72B 4XPGL 1UA3A 1IGIL 3ULAB 2LU5A 2NCMA 1EDQA 1IFHH 2DQDH 1JZ7A 5FHBH 1T22A 4G1EB 4EN2A 3IMTA 3F7QA 4G7SB 5B22A 1KMGA 4F20A 1AS6A 3LZPA 4LSSL 3L5XH 4LPYA 3GSRB 5F71A 1XCXA 4Y1AD 4BZ1A 1DVXA 3GPSA 3V4VL 2HB0A 2YUXA 4J6RH 2XZAL 3MACH 3NBNA 4GW5B 4Y1SA 2AMGA 2A6KA 1NANH 2JTDA 5LBSL 4XNBA 5LN4A 3KD4A 4KO7A 1ZHKB 3VRLE 2X4TB 3EOTL 1EFXB 3BEWB 4XP9L 3MI6A 4EKJA 1H8LA 1KELL 2ENQA 3CMOL 4N0FA 2XG5A 3PU7A 4FLSA 3FONA 4NKDB 4NQCD 4OD3L 4TPRH 3V0AC 5IFJA 1SY6A 4N6RA 3UO1L 3BUYB 2OMUA 1MWAB 5H94A 1CD0A 3I3BA 4KXZI 4X5WA 2AXFB 4NP4L 3OZLA 3PPEA 4NQED 2IF7A 3H9HB 3C5JA 4MD4A 2CA4A 2ZUQB 3V9FA 1OAQL 4IRSA 4X83A 5EUOA 5D6CB 2VDKL 2Z8SA 3NSYA 1J5OH 1G6VK 3GSOB 2WB7A 2AV7B 3OKDA 3CC5A 2AP2A 1NIFA 4YFEA 1C5BL 1IGYA 1Q38A 5INCB 3U46B 1IEHA 1A1NA 5F1OB 1P69B 5L8LB 2FGWH 4RX4A 5C70A 3GTVA 3WUWG 4JFZL 4GAGH 4MNGB 1T1XA 2OMZA 3B5TA 3E1F1 3L2MA 1R5IA 4XNQB 1OK8A 2XXCB 4K8RH 3TCTA 1NIAA 4MMYA 5CGYC 1INEL 4ERSH 2BP0B 4HIQA 3EFDH 4UQDA 1AKJD 1R3LB 5DZLA 4OV5A 4N2KA 1T1WB 4NZFA 2J12B 4ZUWB 5FO8B 2VLRE 5LGHL 3T77A 3P77B 3FQ4A 5E4EB 1N8ZA 2YD4A 3ME0A 2OTWA 5DEFA 3BAKA 2WAQA 4TNEA 1IUZA 4QYOB 1KB5A 4UZGA 3UTQB 5D1ZA 2ZOTA 5BO1H 4OZIB 4ZAKC 2D7PA 4X80H 4BJLA 1CDBA 2W60B 2EH8L 4M00A 4HUXB 2WB1A 1K8DA 4KAQL 1L7IL 4PJ5D 4Y16C 5FHAL 1DLFH 3QORA 4FQ2L 4MZRA 2R39A 2MH4A 3QH3B 2WLKA 4HSQA 1QHPA 5EO0A 3VXTB 1EHKB 3FSWA 2YLKA 3B6SA 4QHPA 3V6FA 4LF3A 2D8KA 3ECWA 5DQJA 2W9DH 4ORGB 2C26A 1PNCA 4EI5A 2HTLD 2FJHA 3AADB 4I0KA 1CT8B 1FLRL 4KI5E 5CZVL 4I48A 4PLJD 1MY7A 3ARDD 5CIPB 2MCMA 3QJUB 5L0QB 1BZ9A 2WW8A 1KGJA 5IR1B 1WCBB 4UIMA 2ICEB 3WFHB 3CFCH 1Z3RA 3O3AA 3FB5A 2OM5A 3K3QA 1DL7L 1S5HB 2F19L 4N0CC 5C07B 4N8VA 1JGUH 1NUGA 3G5ZA 3STZB 2D0FA 2J1KA 3H9SD 5DJ0B 1OTTC 4FNRA 5DSCA 1Y6NR 3Q5TA 5K1JA 2FX8L 4JANA 4TUKH 5LNDA 4FQPA 4OFQA 2DYPB 4QNPF 5F1KC 1VFUA 1SEQL 2XXGA 5JHMA 2R1YA 3WLBB 2ZWKA 4PGCB 2WLHA 4HG4J 5FYLD 3VRIB 4L37B 2ESVA 4MBRA 4M1CD 3S96B 1N9PA 2W0FA 5CAYB 3T0EA 2GJPA 2DICA 1ETB1 3UERA 2ZOKA 1S9WA 4GKZB 2ZXBA 3P4NB 5D7JD 4ZO7A 3NJHA 3M1BA 4IBLT 4KXZH 5IOPB 4OFKA 3OKLB 3N40P 3VD4A 2ITCB 5IEKB 3LEXA 4UOJA 4O4YL 1JAEA 1KN4L 3MA7A 3X1BA 3T0VA 1TJHL 1SM3L 4J8RA 4KQ4L 4F24A 3ZKMC 1PLCA 1T1YB 3OGOE 3JUZA 1AR1C 2WZ5A 4IEFA 2R1YB 3WLBA 1U9KA 4JRXD 1BQSA 4FFTA 1Z2KA 5TGBA 4PB9L 5ADOL 1S7UB 5TE6L 5C0RH 4N2OA 4K23H 5EFIA 1OP3K 3JWDC 3HS0A 3BP5A 3ZO0A 2EEFA 4UQ3B 2VN3A 3TO4A 3HG1B 1BFOB 3FUNA 3DX6A 3O3BB 3ULUD 1LNUB 5TK4A 4GSRA 4PY7A 2FUQA 4WFEE 4GG6F 1E3FA 1QQDA 1YDPB 4V1DD 3U9UA 3WI9A 1CIUA 2DM7A 2OV0A 3ULVF 3OHXC 1U8LB 2B7DT 2DQGH 4PVLA 3QUML 5KS9E 2CDFB 4OZGA 5F9OH 4UQIM 1J5IA 4GRMB 4YUEH 3WTSA 5TE7L 1OW0A 3WN6A 5KVFL 4EOWH 4BZ2H 4XP6H 3KYNA 4G9FE 1I85C 2AQPA 5J57B 2EDLA 1YYML 4PUBL 1TTGA 3NRQA 3QYMA 2VXUH 5I17B 1BD2A 3ARDB 4NPJA 5CJXA 4MKTA 3LN5B 4PREA 3S5LA 3AQZA 4Z8FH 1FA4A 3C5ZB 4N5EC 4U1GB 1BMWA 5F1IB 4JFEE 1HE8A 1RLBA 3KH3A 4C59B 1DBML 5E1HB 5GIRB 4WIQA 2APBA 4Q56A 3KXFE 2OMZB 2X5PA 2CKBH 1ZK9A 3EYQD 3AQDA 1X9RA 2H6PA 2WUBH 3SDDD 5KSBA 1ZT7A 1GGCL 4GO9A 4PYHA 3HB3B 2QFPA 5E1AA 3W57A 4YXLH 4UMGA 2DWDB 4X9HA 2ZXQA 2WZAA 1UFGA 2ARJA 3RIKA 2M8XA 3H2PA 1KOAA 4FNTA 4ZNEA 4DKTA 1V3KA 2WQAA 3CHOA 2MPAL 4M8QA 3RBGA 3QIWD 3IRPX 5EFIB 4K73A 4UTBL 2Q8AH 1UB5B 4ODWB 2P3YA 4CA4A 5F3HB 4IJ3B 3QZOA 1MNNA 3UX9B 3B8YA 4DNLA 2C4XA 4GEIA 4Q9BA 3L4WA 5EO0B 1ZLEA 3D4YA 4OLVH 1K5NB 2F61A 1RK0A 3WUWA 5JHLH 4ZFGL 4MCYB 5EUOF 3KPOB 1ACXA 5KBPA 1EFXA 3BEWA 4JPVL 5GQBA 4G80B 3P0YL 3VGHA 1CVSC 4DT2A 2EDRA 2YA0A 3UDWA 4GNKB 1ACYH 1EBPA 1PSKL 4ZQKA 5DJXB 1AZUA 3HI5L 2ZX7A 3JTTA 5BOPA 3BPOC 3O6FC 3MJ8B 4OIBA 3K2IA 4KOBA 4W6YB 3VTMA 4P04A 2Q5BA 3NK3A 4OQTL 1J05A 2NY7L 3MV7E 4NQEE 2IV9A 4P46D 4X7CC 2EUVA 3FBKA 4IKKA 2VUYA 3KPQB 5INDA 3ULVD 1M3JA 1OTTD 5BZDA 3NIDE 2Z1KA 4GW5A 4ODSL 4OJAA 2EE2A 1Z5HA 3UJIH 1U8PB 2ZSVB 1P6WA 3MRBA 2VDMB 5JOFA 2XKNB 2FX9H 3NN8B 5ACLA 1PZ3A 1B3IA 2A99A 4DGVL 2ZWLT 2CHNA 4FZ8L 4GLRI 2A9NL 3RY6A 4I48B 1BGXH 3QE5A 3UCRA 3FHAA 3CFUA 4Y89A 2P24A 1HOCA 4FQXC 3UTPE 2SODB 4KHTH 4Y5YA 4K55A 4PBVC 1QP1A 2YPLA 4OD1L 4PRPD 4UQ2A 2UY7B 5C0CD 1XIWD 4S2SB 4QJ5B 4XTRC 2OR9H 3MYJB 3N55A 3VXRB 4NN5B 1KJMB 5KYXB 1FZOA 2ZUSA 4FFZL 5FGCB 1UWGH 1U8JB 2E9GA 2C3HA 2ZPKL 4ANVA 1OL0A 1G9ML 1CFNA 1L0PA 3EUDA 4BWTA 1P53A 3KS0H 5FYJU 4MQ7A 3RIAK 3CFDB 3QUXD 3VFMA 3BSZL 1T2QH 4QT5B 4IOSA 2E9IA 1LDPL 3MODL 1JPGB 3S5YA 5HJBA 2PLTA 1T21B 1IBHA 4MX7A 5EU7E 4BBWA 5ABDE 2WUCL 5C86A 2KKQA 1MQKL 2VSDA 1HEZB 4MKMA 1D9KD 2NTFA 2QR0B 5ILTL 2XN1A 3GMMB 4IOFD 2BVOA 3V6BR 3AREA 1QSFE 2WUCH 2XPZA 4UBDD 4K9EC 4QUOA 4EI6A 4I18B 2NLJA 1G1YA 1RJZA 1MFCL 4FMVA 2CK0L 4A2HA 1T5WA 5CSZA 4C4KO 1NGXA 4I3SL 1P2CB 1HKLL 1DDHB 4LLDB 2HT2D 3INOA 3MV11 2YD9A 4XHJC 3O4LB 2CLRA 1FDLL 4GQ9H 4Q9RH 2PWHA 2GIXA 4FG6C 5D6CA 4XO5A 3D06A 4GO6B 1I9RL 1CICB 1NMBL 3GDCA 4AJVA 2OR9L 1CFQA 4ZAKD 5K93A 3MLWL 2R56L 3LQMA 1E9QB 4H8WH 2YEVB 4OGQC 3BKCL 5I0WA 1KYFA 1JHTA 3HHMA 1SF3A 4Y4KD 2H0JA 3ZIMA 1FNGB 1W0VB 5DGRA 4KWUA 5HYEA 3N0AA 1J8HD 1SOQA 3DBSA 2DWYA 2AABL 3GNMH 4JRXE 5D1XD 1VCAA 3C5ZC 5CGYD 2XWDA 2CLVA 2F74B 3LMJH 5IF0B 2CDEA 3R0MA 2IDTA 5KYWA 5I2IA 3IDJA 3IRCA 3D4CA 1N8OE 1CLYL 3EO0B 1QATA 5TDPA 4ETYA 4KK5C 1R3IL 3MV8A 4IOIA 5D7IF 5DUMH 5L88H 3IFNL 3WUWB 1F1DA 1UXSA 3SKNB 3Q2NA 4Q8BA 3ULVH 1MUJA 2Z31D 3JV6B 1T83A 3RVUD 1J0IA 2H41A 4EI6B 2C9SA 3GS4A 5D4JA 3C09C 3QC5X 5DT1L 2VXSH 4AGPA 1IM9D 4IBQA 1Q9KA 4A2MA 2ODIA 3P0YH 4DP0X 2GTZB 3UMNA 3T09A 2WXOA 2NY3C 2XWJB 4XWGL 1FBIH 3W3BA 3BGFC 3HAEB 3FAWA 3DWTA 2Y1ZA 5CINL 4TNGA 1MCCA 2BY3A 5BV7L 1QWUA 2MQCA 1BZOA 2H47C 1ZSDB 4KY2A 4PJ8B 4WSGA 1QNIA 5AW9B 5E4AA 4KKCD 2OX5A 2JJTA 4ZPTB 2K45A 2Q8AL 4EMZA 1G7MA 2VL5B 3FBQA 1A6WL 3H9SA 5L7XH 3O2VL 4HUMB 2VDOB 3GI8L 3R18A 4MCYA 2JK5B 5GIRA 2FLBT 5IG7B 1CXEA 3QZLA 4R4BB 5IREA 4JRWA 4QKXB 1F8TH 1BA9A 1NIBA 2BP8A 1E3ZA 3LD8C 1FGVL 2ROYA 3VWKD 5C09D 5IMOA 1GW0A 4PJXF 3P30H 1NGZB 1OKEA 2VUKA 1BYPA 2VDLB 4LCWA 2JCCF 4N2EA 1AZZC 4I85A 5T3ZE 5KTEL 5KSVB 1XR9A 5GJSH 1MW1A 2H32B 1QBAA 3VXSA 1JNLL 1YN7A 2GCYA 4YK4C 5DJDA 5BPPA 5AVZB 3O11A 5D1XB 2UX7A 1U93B 3PFQA 4PI0A 4ZXBC 1JZ2A 4JRYE 3L9YA 2IG2H 1ZTXE 4R8WL 4RSYA 4JG0H 4XH2A 1F41A 3K4DA 3CFJB 1IGJB 2DLIA 2DQCH 4NJ9H 4HJ0D 5CMAB 2AAVA 4JFUA 2GT9B 3T4AC 1A4JB 4OIIH 3G7TA 2KZ1B 5DJ2B 3ZHKA 5A6LA 5DRZA 1XF2B 2BVQB 3F7YA 1MFAH 2X7LB 2Z0UA 5IW6B 4OZFA 4J4PD 1ZV9A 3LKQA 3QA3A 1ASPA 1O7VA 4D0DB 3UP1A 4EI0A 4Z77A 1ZT1B 3GEWB 3GGWB 1RZGB 4OUUB 3NCJH 4JO2H 4YLBA 1HAUA 5EU4B 1MCKA 1SBSH 2D9QB 5T3ZH 4O00A 4PBWD 4BQ6A 2Y69B 1F97A 1UM6H 1E50A 4NCC2 4WV1A 1QUNB 2BSTB 3N2JA 3RZCA 4AZUA 1MFBH 4M6OL 1H6TA 3DIFA 3Q8BA 5HHMD 3UBXG 1UB5A 1JF6A 1MRFH 3KVPA 1ZE3H 1P5UB 4MWFB 3B3IB 1JNHB 5EF3A 43C9A 3ILDA 4ZXBD 3MV8E 1WRFA 3U7YL 5GPRA 3P4OB 1IARB 3STZA 3SE8H 2P8PB 3C8DA 4EQ2A 3RWGB 2ZKWA 1VZGA 3BQVA 3L3HB 4OM0L 4B9IA 4JK0D 3O41A 5HBBA 1U8KA 2YN3A 4OM0H 2G3XA 3NGBB 3P9LB 6PCYA 2WXQA 3DMMB 3NYKA 5I1AA 1JZIA 2K3HA 3BGAA 1SMAA 3H8NA 4KHXH 4N0UE 1NGQL 4UM9A 4ODUB 1JPTL 4KY1L 5DJCB 1XQ4A 2EEAA 4O2EA 4ANUA 5F3BB 1A3ZA 1BOGA 1DO6A 3MNDA 4FJYA 5I28A 2OP4H 2QADB 4Q6IB 3UZVA 5AZEH 4G7RB 4W9LC 3FSAA 4GG6B 3FT3B 1MFBL 4M6OH 2QSCH 5I8KH 1DZ0A 1DL7H 1I85A 2FH8A 5DUPH 5EBWA 3UBFA 2O4EA 3MMEA 4HZ1A 1ET8A 4JDZB 3AT9A 2V8MA 2KYIA 4HHAA 4J39A 2B20A 4UQEA 3BIAX 3FU7B 3GMOA 2Y5QA 3HA0A 3QORC 2VYRE 4CDHA 2FQGA 1MFAL 1DUZB 3CH8A 1JUFB 3NSDA 4ZMOA 2GFBA 4PJCB 4Y2DD 3RVTC 2M26A 1Z9MA 2DQCL 4OJYA 5D7SH 3NJVA 1FIGL 1TZGH 4GG6A 2FBOJ 2JB5H 5D7LE 2NY6B 2VLRB 1M1XA 4P2OB 1JTOA 1E7VA 3GD1C 1UURA 2DQTL 3NEEA 4R5XA 2WBJD 4DEWA 1T3FB 1P2CA 1PKQE 4PJHF 4X80L 2YFOA 3IDMB 2WLYA 1OGAA 1QWHA 1TFHA 3CHXA 2JKXA 4Z1PA 1W91A 1I82A 2E4TA 2X09A 2OSLA 1A3LH 2JMRA 1X9UA 4GSUA 4OFYA 3U9PL 5CLWA 2D7MA 3CSGA 1OAZH 4B5ZA 3DA0A 3LPWA 1BVKA 5AAPA 4S1SL 4FTVD 4FQCH 3RL1A 1CXHA 5D7KE 1WUZA 2W38A 3CN2A 2XPGA 3M8OL 3VNYA 3RNKA 1RZGA 2HG5B 1QEXA 1ITBB 3UAAA 4E0RA 3F2LA 1NWPA 3KL3A 4K8RL 1A1OB 3CQFA 1FGVH 4RQQB 2XTJD 4RRPG 3ZE1F 2OL3A 1CR9H 4POUB 1II4E 3H9HA 4FABL 1NJ9A 4K3DL 4Y4KC 5FUZL 1PKQA 4DN4H 1TZAA 3UADA 5CF3A 3ILEA 3IJYA 2ZXDA 3D8MA 4LCYA 4L37A 5DQ9A 3SODB 5JIPA 1TF4A 3P9MA 3HB3C 1HCVA 1KJMA 2CO6A 3P3RA 2OPCA 1GRWA 2X4OB 4NKOB 5KYXA 4P49A 1NUDA 1MRFL 2VDKH 4J2QA 3LVTA 3MLUL 2BX5A 3BE1L 3MAWA 1CFMA 3EJUA 4WI2A 2WZPA 4CNIA 4D7PA 1VHPA 2NR6A 2VJXA 1KFAL 1U8KB 1WICA 4NO2A 4Y5XC 1HKFA 3KS0J 5C08E 3GC3A 1MF2L 1I7ZB 1KBWA 2ALWA 2ZCKL 2BIHA 1JN6B 4KQ0A 2J56A 1TVHA 4MAYC 3UO1H 1DVZA 4ZUSB 4GAYA 4AL8H 4HJGB 2WBKA 4U1HB 5EN3A 1FG9C 5C0FA 4R7DB 1KELH 1T66D 4OLZH 5JYMA 1A02N 3NCFB 5HPOA 1YEJL 1D9KC 4GQZA 1E43A 4B9ZA 3BH8B 3MZGB 2KQNA 3MOBL 1LWHA 2HVBA 2NX5B 2ZYSA 2C1OB 1JXFA 3UPCA 2XZAH 2IG2L 2HFEB 3IYLW 4G1MA 3AG4B 2Y6SD 4LSQH 4W9HC 1TJGL 5LG1A 2ZIDA 3P69A 3U0TA 3EO0A 5TDPB 5E9AA 4ZPTA 2N7SA 4YDMA 2VZUA 4HIJA 2ED6A 3WJMA 1M6OA 5CXPA 3CSTA 1ED3B 2YAQA 4Z7OF 1WEJH 3MLRH 2IAAC 2RFXA 4NN7C 4NNXA 5IHUL 4TL4A 1KF9B 1SEBA 4TF4A 2ESVE 2PXYB 4A7SA 4KTYA 4RFOL 1TEYA 4PJIE 2EIZB 3QUYD 1CFSA 4OZFG 5EU3B 5FA4B 5CP7B 1YEKH 2AEPL 1EFXD 1IFRA 2IAMD 4JN2B 3MBEA 1I8UA 2G30A 4H8WL 4TRPH 4LGPB 2R56H 4R84A 3UIYA 5E56A 4QCIB 1Y0LB 1B6UA 1OE2A 4M8RA 3TBWB 4MNQA 2AJUH 1BBJB 1FZJA 5FECB 2HKHH 2ZCHH 2LHAA 4OGYH 1G0DA 5DEZA 2APFA 5EOCJ 5AYQA 4QHMA 3NH7L 2FZ3A 3C60C 1XH3A 3FQXA 4FHJA 3ATFA 2ENJA 2IANE 2AV7A 2VZVA 1PD0A 1GGUA 4GRLC 3QJQB 5DF0A 2Y3AA 1HL8A 1JZDC 3HI6H 4XP4H 2H6OA 5EC2B 4UT6L 2H5UA 1BG1A 5D7IB 4NWTL 1B6DA 5B21A 4Y9FA 5HD8D 1SPDA 1H15B 4LOFA 2BP8B 1KXVC 3GMNB 1V5JA 4KJWC 4L2LA 1FLTX 2K9UA 3K6DA 3SGJC 2JKRM 4Y4FD 3WY4A 1VIWA 5DZVA 5I71C 1L5GB 2VXSL 3LZNA 1ZHBB 5DHVH 1MJUH 4X98B 2BZCA 5KUMA 4MLIA 1JYNA 1LDPH 4HUXA 4I2XB 1L6XA 2RALA 3S5ZA 2VMDA 2X9ZA 4CN6A 1HHGA 3NJMA 5CEZH 5EIIA 1KB5B 3FOMB 4FXTA 4FZEH 4Z7UE 3OXRA 3VI3E 4EVNA 3BD4A 1K3ZA 4KKAC 1G6RB 4P2AA 4J2XA 2P8MA 8FABB 2K4WA 3IDYB 5D5ME 1EJ6A 1I3RA 5EZIH 3KH4A 3R8QA 2V2TA 1QLEH 1ZSHA 3WMSA 3FUHA 1EXGA 2K8QA 2F8OA 2HRGA 1F3JB 5D7IE 1KIRB 1QLFA 2FL5B 2IXQA 3OKMB 3VXSD 1DQIA 3NAAH 4J4PA 5IV2B 2YEZB 1BF5A 5LXGH 5GGTL 4H2CA 3FKUS 5C0DA 4YGAB 3FO1B 1JS4A 1AXTL 3ISRA 4EZKA 5JXEA 4HIHA 4KZDH 2DD8L 4AQAB 5CCKH 2WBJA 1HEJC 4BV1A 3TCLA 3EJRA 2NNXA 5DS1A 1E4XH 3N44F 3ULUF 1BQKA 2Z91A 5E2UH 1OM3H 1RVFL 1UZ6E 1XSKA 1JK9B 1T7VA 4IGBC 4OBRA 2HVKB 3V10A 1L7TL 4M6ML 3ARBA 1RZJH 3RYMA 2HFFB 3D2UB 1NCCL 2CLZA 2XVKA 1YEGH 1MFCH 5FM8A 1GYWA 3TWCL 3WCYA 2YPVA 2ESVB 5I18L 1NEPA 3DX8A 4QXVA 3ZLQC 1E40A 2R7EA 1QFWM 5HHXH 3QFJA 3VA6A 5IESH 2BHFA 1PKOA 2CIKA 5JHLL 5D70L 3PREA 4Q2ZA 4A6YH 2YOCA 4OZHA 4CW1B 3K6NA 3KEDA 5FX3A 1E9PA 4KKBD 4KBPA 1GZQB 3IDNB 3Q2VA 3GGWA 3IMVA 4BH8A 5SWSE 4TSCL 5DFWH 4HQQH 4L4JA 2FTAA 3T2NH 5HYIA 2X3BA 4Z7VE 4B27A 4C47A 5TPWH 2OSLB 1EVUA 4PJXB 2QLYA 4POZD 3HRZA 5EO1B 4UQ3A 5C0EA 1INDH 3WENA 2MPAH 1E7UA 2G60L 3IMUA 4JCLA 5IV2A 3TPUA 4C8XA 3WFZA 2ZOOA 2O26U 1MHEB 3HG4A 3JT0A 1WYJA 1DLHB 4F8TA 3BSGA 4AMWA 3QAZB 2EUXA 3RWEA 5GGVL 2ZF8A 3QFDA 1JUFA 4ZAKB 1WGVA 5I1EL 3MUY1 2DLFL 1B0GB 2NXYD 3FQRA 3GJFA 4P2RB 2JTYA 1F4HA 2QT6A 5IFAL 4DK5A 4ZODA 4G83A 4N90E 2O30A 5DRNB 1TT6A 3PAYA 4Y5XA 3S4SB 4ODSH 4PJDB 1JGVH 3FUMA 5H35A 4WI4A 1ZGLM 2QZQA 3MVSA 2P26A 3WD5H 4JDEB 1WZLA 5DLML 3UP6A 4NM8H 2WO2B 1MCRA 2A9MH 2VR8A 2YRZA 3B2PA 1A66A 2HX9A 5C9KA 5FO2A 1RP8A 3QDME 4PCKA 1KB5H 2EIDA 3OM3B 4M8QB 3A3YB 5AVTB 2EVHA 1I7UA 5GISL 3SO3B 4XCCL 4MSWB 4L8BB 3DV6B 2DWDA 2EVIA 2YXFA 4E5XG 4HMEA 1EGJH 1AOHA 3ARED 4MA1B 2X70A 4M5YL 3QIWA 1DHKA 2QSTA 2FX7H 1ETZA 1WCQA 1QO3B 4ZFGH 1NLDH 2HTLC 1T20B 1DJGA 4KVNH 4K23L 3WD5L 1IBGL 3ZXAC 1S9VA 4PGEA 4UT9H 4MD4B 1KCRL 5JXEC 4JLRA 1WISA 3TIEA 5T3XE 2OJEA 1IE4A 4W4OC 35C8L 1LO0H 2QGCA 1DJXA 1PF3A 4LGSB 1OP3H 4I9XA 3AXHA 1QUNA 1VFMA 2BSTA 1DQJA 1QYGL 2VLME 3QI9C 4HIIB 1Z9SB 1QFUL 3DIFB 3LRSA 1LO5B 5GHWL 1ZK5A 4AL8C 4JKKA 3W5MA 4PRIE 5BV7C 1OB1A 3EYOB 2PNDA 5I71B 2HFGL 5DHMC 4YXLL 1FO0H 3FCBA 1H0DB 4AGLA 3W0WE 1MI5E 3QJRB 4M1GH 4ELKB 4X6BB 2VERN 2IALB 2VRQA 5C09B 2I7SA 1I7TA 4N0UA 4Y9CA 4IIZA 4R6UA 1M7IA 1TTCA 5B3JF 4YEFA 1EQWA 1KLUB 5I6XC 3OXSA 4IMKC 4DCQB 4R7LA 2HXAA 3B2VH 2NUTB 4ZMYA 4K5PA 1J12A 4K9EL 3POCA 5JUEH 2J8OA 2NY2D 3WNKA 3WS3A 2F19H 4ODUA 3A6CL 5DJCA 2WQXA 1OSYA 3UTTD 1HWGB 3DUUB 2VZ1A 1YY8B 2XBTA 3ECBB 4PUBH 2H32A 4NM4H 3UC2A 5BV7B 4L8BA 2WLLA 4QHUB 2J2ZB 1S7VB 1JD7A 1WA1X 1C16A 1WFJA 1YPZA 3EOAA 4NQCB 5EU6B 1HDMB 4M6NH 4EBQL 3WJJA 2MTPA 4J5VA 3LQAC 4W9IC 4BWWA 5J1SC 3G3LA 4NO2B 5IY5B 4BKTC 2O5YL 2YD6A 5JQHC 2BJML 4I9WE 1FFPB 2VAAB 4PLKC 4RMBA 5T1KB 1PZAA 4HFWB 3UTSB 1Y0LA 3BEVA 1BFVH 4JDEA 4A55A 4PG2C 1TTAA 4UM8A 4YNYB 1DVFC 1BF2A 1R3JA 3FQ2A 3SD2A 3CV5A 4QRPA 4QRSB 3QO0B 5EZJB 3GBNL 2MQ0A 1T89C 2A74A 1BVZA 2P8MB 3S3CB 2VW6A 1M1SA 5G4MA 3VXRE 3D2UA 2GSIA 5C7XH 4YWGH 5C9JA 1CLZH 4ES8A 1AZBA 1OEZW 1P7KA 4QY8A 4DN3L 1TJXA 3NAAL 2OCFD 2ZQKA 2FBRA 3IETA 4FXGA 4XP5H 5GZNC 3M1CA 3GIZH 5DD0H 5CEZE 2NT0A 2WMPA 3AXLA 1HINL 3FU0A 2YEZA 3WFBH 3ZKQD 3RX9A 1DYZA 2Y06H 1B4TA 5JXAH 1QLEL 2X38A 5I6PA 2YMTA 4Z3HA 4UOQA 1QWNA 3ZMRA 3K80A 2X44D 3ZKXB 4M03A 4JB9L 3SDYL 2V2XA 1YEFL 1FC1A 4KKPA 4OLWL 1J5OL 1KY7A 1SYVA 4HG4K 4B7LA 3KWUA 1EO7A 8FABA 4I0PC 5AVXB 4PD4K 1XH3B 3GB7A 3T0EC 5HSFA 1VGEL 3QAZC 4JRLA 2IBZY 2OMWA 3FCGA 3CFCL 3FRPG 3QCTH 1RJLA 3AGVA 3KVDD 3V8OA 5HYJA 3DX8B 2CLVB 2WM0A 3D09A 1RERA 3OMIB 3PJNA 4WSJA 2Y7LA 4FNLL 4NWTH 3U4EB 1CGXA 4OLYL 4U6XA 2PN5A 5G55A 4Y0GA 4DEPB 2FJUB 2X6AA 5I26A 5EEWA 2NZIA 3MNVA 5DLLA 3QQ4A 3T6WA 2R69H 3D0VA 1DBAL 1OIOA 4LDLB 4KX7A 5HYFA 4K07A 1MAMH 4FFYH 5AVUB 1V3JA 5C0JB 2APWA 2Z7ZA 3KJ4C 3QNZA 4N9GB 1V7NH 4Z7QE 4BH7B 3RGVA 4MS6A 3BISA 4N8PA 1MREL 2ICES 3EF7A 4UUJB 3L3JB 2E47A 3DX9A 3NJGA 5GJTL 4LIQE 1LO3H 4Z7OE 5JO5B 1TR7A 2XWJA 3FU5A 4AMKH 1KIQB 3MSPA 1Q0XL 4PLNC 1EV2E 4NQSB 4WJ5A 3FDWA 4XPGH 3FQ1A 2EZ0C 2J8UA 1IX2A 1QBLH 1OCCB 3HUJA 1NH6A 5MI0C 4L1HA 3E3QE 4X6DF 2XQBL 1CL7H 5CCHE 3MBWA 4YDZA 3CE1A 2BVOB 4L0YA 2VDPH 1F00I 2F53D 3IJ7A 3DVNB 1V05A 2FGWL 2MMXA 3T6XA 3P73B 1HTYA 5ELIA 4ONGH 1KEGH 5BZWB 1XH1A 1Z6JT 1ZY9A 5KYYA 3PWVA 3MCYA 1YEWA 3QUYA 5T5FH 4POYA 3R7RA 4X6DE 4YSQA 3SYCA 5DMGD 4JFVA 1AP2B 4ZUWA 5I1GH 3L9RB 5A6MA 5I0DA 1N67A 3ABGA 2QHRH 3RURA 5KUKA 3BCDA 5HYSG 3D1MC 2NY5H 4LCYB 2XV2A 1R24B 2XWEA 4LPCA 2X0UA 3WNIA 3GS7A 3VFTB 2EDNA 2M1KA 5AZ2L 3ZKNC 3HR5B 5A16A 1I1YB 1FPTL 1WBZA 5E6IA 3D9AL 1SOKA 5HDBE 3DSNB 1HSAA 1PQZB 4M6AA 3SE6A 1RIVL 5JZ7D 1PW3A 5LO7A 1KFGA 2QHRL 5IT2L 2NYKA 2P42B 4GRMA 2IDUA 3NABL 5I1GL 2N7BA 3S2AA 1E28B 4ZUSA 1JBJA 4HKBA 3ZKMD 5CS7A 3OGCB 5C9JB 1C7SA 3QRFM 3NCBB 2UWEB 1KACB 3QZNA 3ZDYE 5FYKL 3ZT7A 5CILH 3SYPA 4YH6A 1CL7L 3RU8H 3JWNE 1AZVA 3WTWA 4ZK8A 4G70B 5E6UB 5FOBB 5KW9H 4ZPVA 2QZ5A 1HHKA 4L3CB 3BLBA 2EIMB 4A39A 5IB3B 1TXKA 1QA9B 1KDIA 4LKXB 4A67A 5L2KD 4PJHE 4RGMB 3B7UX 1MRDH 4FYTA 4NLHA 5TDNB 1E8WA 2N7AA 1HVXA 5B1CA 3BT2L 4GSXA 5HDRA 1R0AH 1C5CH 3KYOB 3QB7C 3KJ6L 3DETD 4P2YA 5EU6E 1SEBB 4YSAA 1JV2A 4BK8A 1JWUA 2VZOA 3UXFA 1LVEA 3R4RA 2VAJA 1DANT 3FTWA 1DQTA 3H9YA 4MNHA 1U8IA 3FT2A 1F4YL 2HZHA 1O7DC 3CK0L 4PRBB 2CJ3A 1QLRA 2ZX6A 3ASOB 1FIGH 4I1PA 2JJUA 2I7OA 1KWGA 1AGBA 5F89A 4L5FL 1U4EA 3DGGA 3SQBA 5BRZD 3V0EA 5HPMB 2HG5A 4E0RB 1DBKH 1E27B 2C3VA 3GSNL 4PJ7B 5HDBB 4MAYD 5CR8A 5CJBA 5A2CA 2WMPB 1TEGA 3KPLB 4H20H 2F7QA 1MI5B 1RU9L 4ORZC 2BVEA 3NRFA 5FUOL 3WL9B 1T2JA 3VXOA 4B9YA 3IFOB 3IVKA 2P48B 4JZOB 3SE9H 3DTUB 4X6BA 3PCYA 3O3EA 5J12B 4MSWA 3UTTE 3I75A 3JTBA 3V0HA 1VA9A 1AZCA 5IB4B 1I7RB 4OLXH 2BNUB 4HHAB 2WOBA 5CJQH 4GXFA 4X6FB 5F3FA 4XXCA 5L6YH 5E24E 4JB9H 2QQNL 4K3EH 3QO0A 2V6HA 5AKVA 4P2RD 5EC1A 4DP6X 5ESQB 1TQBC 1OAUH 4ORGA 5ALBL 5JHDE 4DWHA 3LNIA 4IGBA 1GIGH 4LLUA 4MBOA 4JDZA 2FQDA 4QHKJ 5FYKD 5DMGC 5AYUH 5CZXC 1KCLA 5ANMA 3BJ91 2NQCA 2X4RB 2D2CC 1NEZG 2IQ9L 2YMXH 2WZ0A 3KWXA 1H5BA 3IJ8A 3FT1A 4JM0A 4L1DA 2XQYA 4TN9A 4P9HC 5EA0H 1CPUA 2WINA 2WN3A 2YOAA 2B77A 3TVMD 4EN3B 1Q94A 1DDTA 2PCPA 3C09B 2DQHL 4WDIB 2L7EA 2CGRL 4HX1A 5D71L 4DKEL 1FNAA 4GUPA 3DO3A 1F11B 2WQVA 2ZWNA 4J4PC 4NYLA 3HVNA 4ZTPL 1P5VA 1HH6B 1M42A 5I0YA 3BVDB 5B3JE 2P5WD 3RP1A 3VB8A 5L0QC 3NSCA 3PWNA 2EICA 2IGFL 3HNVL 2Z34A 1AD9B 4QWWC 3Q2WA 1FJ1A 1U30A 2V9TA 1J11A 1BFVL 5EZPA 1AQKL 5HDWA 4D8PA 3DLQR 2FATL 5KVDE 2KLSA 4WWKD 4XCEA 3MGTB 4B9JA 1PL3A 5F1NB 4GUPB 1I53A 1D6EA 3IGAA 4D9QD 1H9DA 2XZZA 3I9IA 3T0DA 3ZHDA 4UU9B 3IDGA 2N59A 2DJUA 4XVJL 4I87A 1E6OH 4KITB 1W8NA 1GJWA 5IEHA 5F1SA 1ZAGA 1G7PB 1R5VB 1UUSA 3WFDH 1QABA 4AVKA 3U6XA 3DARA 5JW4Q 1JG9A 1NCBH 5DJ8A 3O6KL 2IOMA 1YEHL 2BY0A 4N6QA 3UTSA 4PJ9B 3EYVB 4DUVA 4TKWA 3IXAB 2D3JA 3TBYA 1UKSA 1CQYA 4CMMA 1MIMH 2OX5B 2P80A 3L3KA 3SHSA 2L7UA 1YSOA 2OMVB 4FYSA 2FQEA 1RULL 3RDTA 3PAVA 3BESR 2JQMA 5KVDH 1W0YT 3P30L 1M53A 4Y7MA 5E9NA 2IDCA 3EFOB 4FGMA 4X8XA 4YHMH 1LO2L 1N6VA 3HG0A 2XQ0A 3MLSH 4JQIA 3DI3B 1COBA 5GS1A 5I1HH 4PHXA 5IR1A 1XF1A 2VMCA 4XVSH 1RCYA 2YAHA 2FWOA 1LEKA 4LSUH 1H8NA 4FXKA 4X4ZA 3PABB 4XVTL 5T5FA 3T8XA 4OCXL 2C9VA 4G7YH 5IROA 5E6ID 1LO0L 4FTVA 4AQ8C 1XAUA 1PEZA 4F9LC 2DTSA 3UZQA 2F5AH 5BXFA 3GSXB 1NDTA 4GI6A 4UT9L 2HVJB 3PWUB 5JW4N 4KVNL 5JNYB 1XGPB 2IWEA 1CFSB 1AP2A 3R1GL 4ELMA 1YNLL 4OJFH 4ZO6A 1CBJA 2R15A 3JWDL 4NN5C 1NCAH 1T03L 3A5VA 1E9OB 2PW2B 1ID2A 3VFNA 5C92A 3JZ7A 3HE6A 4H2AA 4XGZB 4G6JH 3P4NA 4MQ7B 3NQKA 4IMLA 4D2NA 1LQSR 4W70A 1PYWA 3X3GH 4P4KC 3H55A 1NAKL 5C0BE 3PDGA 2BVQA 3F7YB 4BSWA 3FO1A 1SQMA 5LB1A 3ZYIA 3VW3L 2V5MA 1J1OH 2FHCA 1OB0A 3H6JA 3LPGA 5C0AA 1MG3C 3MA9H 3N1FC 2ZJSH 3QHTC 5F3HA 4D0BA 1R3IH 3EH2A 4F80A 1U3HA 3RFZC 3VFPB 3VSVA 3C08H 5EIQA 5E2TH 2NNCA 1BOYA 2C7UB 1CICC 1GYCA 1E28A 2VXTL 1IAMA 4MASA 5GGVY 4XPTL 4KI1A 1S9KC 1B9KA 3IAGC 1UWFA 4IRSD 3QZWA 1IC7L 4G7QB 5FUCE 1M7UA 2ZNWA 5MERB 3G9VA 2R0KH 3LPFA 5ACMA 5CD5D 4GXVL 3KW8A 1GL4B 4LQFH 5SX5H 1CC3A 3EDDA 4AW7A 3I6KA 2FJHB 1HYRC 1J9QA 3BKCH 4MCMA 3VWKC 5LKNA 3QXDB 5ERWB 3ZZQA 4LRIA 5ICZB 2EUZA 1LGVA 5DC0A 1FN4A 4N1CA 1NMBH 3RVVD 3S7GA 4N6RB 4PJ9A 2ZP8A 1T6WA 4YHLL 4HUVA 1WIOA 2FWUA 3L4UA 4TQEH 4XMZA 4MVBC 3CN1A 5HDQH 3LN5A 4XVSL 1VGKB 4CBZA 4I0PA 2H9GB 2FECI 2O1AA 4U31A 2GABA 1LO4L 1XR8A 4BCYA 2HKFH 1VPOH 4EVNB 4LLYB 4IRJC 1KLFA 5FB8B 2BMKA 2CRZA 1GZHA 1U8OA 4BFKA 1NPJA 2Q7AA 4YDIH 4OGXL 3HC2A 2X53A 1DLHA 1D6EB 2V2XB 3IMBA 3DXAB 3TBBA 4K2UH 4WW2A 2DL9A 4WW2F 3LCYA 3RUGB 2V2WB 4X6DA 3VD0A 3L8QA 3RVXC 4MQXD 3CZNA 2VDNL 2WWMC 3JT2A 4KH9A 4BELD 1XSOA 4JMXA 4MNGA 4JQXA 5DJ6A 2ODHA 3AAZA 1BCIA 1T04B 3ZE2E 3N43B 1RZJL 3ZZSA 3HAEH 2H2PC 1E6OL 4YS4A 4G7VL 1AI1H 4TNVK 1G9NL 1Z7JA 3U4AA 2X4SB 4J8RB 2X1QA 4IM8A 1T89A 1CE1L 1I1AA 3V55A 3ZBMA 1EO5A 12E8L 3VGFA 5B4MC 2FZ3B 3ISWA 1NGWB 2PW2A 2AJZA 4IDJL 3CH1B 1UHVA 3Q43A 4OD1H 1JF5A 5C0JA 5HYJE 1TVDA 2BSEA 4WWNA 5AOLA 4AITA 4C4BA 3BKML 1J9TA 4JL1A 1YRKA 1LK3L 4BK5A 3HNVH 3TC9A 4FZ8H 4S2SA 3O6FB 4G8GB 3GMNA 1QR1B 3S36L 3GTNA 4HKJA 2OQJB 4HW6A 4HLZG 3ZL1A 2BVPB 4WK2B 3TJPA 4A7GF 3VXMA 4B53A 1GAFL 3UGUA 4N8CL 3DBXA 2NY7H 1IAKB 2QQLL 4XHJD 2CBMA 4L3AA 3TWYA 3O3AB 4Z9KB 1SNRA 2DWEA 5L8JB 4L4TB 4UQAA 2HJKA 4L8SB 3J8F7 4IJ3C 3NZHH 2FVNA 4A38A 4NUGL 1PCSA 3EJPA 3VD5A 4F15C 3ZE1B 4YBQC 3ESMA 1Q9WA 4XMKH 4KV5F 5J4MA 4U49A 3H3PL 1TVHB 2WCSA 4OLXL 1BAWA 4X99B 3RWIB 1DP0A 3OKKA 3H7BA 4MMXB 4HGKC 4OLVL 3UG4A 1QFOA 3H9SE 2XN9D 2EDFA 3DHPA 3OKLA 5JDJA 5A3ID 1PG7W 1PEWA 3ROLA 5JTWA 2HAZA 1LE5B 1YUKB 2YSSB 1ZT1A 3L9EA 15C8H 5I76B 2FHBA 1AY1H 3DI2B 4PSRA 1PG7L 5FO8A 1UYWL 4O02A 2DIJA 4WTZA 4QRRB 5IJDC 4HMCA 1MLBB 4TNWF 3B7YA 2YQ3A 1Q1PA 3CK0H 3DYOA 1K4DB 1G6RH 5AW7B 2BFVH 4I89A 2OMXA 3X17A 5IQ9B 1BBDH 1YEKL 2NUPA 1A14H 4DP7X 1R75A 2X2HA 3VGBA 5E2WH 4A7QA 5J1AB 2F6AA 3UGXA 4AT6A 2YAFA 4WI3A 1QHQA 2DPKA 5DMIL 5DHVB 2G2RB 2X6VA 1MWAL 3N41B 3QJHB 5EOTA 1LEKB 5GZOA 2YFNA 4PJ5E 4PJEB 1AHWB 4ISVB 1BZDA 3U4BL 4PGZA 2IH9A 4WFFE 1FIEA 2I9TB 4IU3B 4A37A 4TQIA 3B7SA 3DHJA 4U1IB 4GRLB 3MR9A 1A9VA 2PR4L 4HVBA 3W5NA 5HGHB 5INDB 4XCYB 3ZKSD 3GZOA 5T1LD 3HJEA 4GLRH 2NZ9D 4NUPA 5FYLH 5HHPA 5IMOB 3WNNA 3VXPB 5LXVA 1BD2E 1THAA 3C60D 1MVUA 2OAAA 2K7QA 3C5XA 4M7ZB 1I7TB 4N0UB 2XWTA 2BNQA 1CCZA 3DVGB 1H6EA 4OTXL 4NNPH 4XCFH 5AW3B 2R2HB 3L9RA 1D2PA 1MF2H 3RTQC 5F7AA 3HPLB 2FE0A 1CTMA 5B1JA 2E9JA 1RIVH 3E6HA 2WVVB 2JJVA 4NQTA 5TE6H 5C0RL 3GJFB 5AVWB 3BE1H 3K1DA 3QP3A 2UV3A 3WE6A 4NN7B 1CLOH 3EDFA 3LSOB 1QG3A 2E0PA 5AALA 3WO3B 1UFUA 3CUPA 3W82A 4OAWB 4O9HH 3D05A 2AVGA 2VNCA 4KJYB 1RXLA 4QXUL 1AIZA 1S5HA 2WLMA 3TZVB 5ICUA 3VX0A 4FADA 1BVNT 3I50L 3OKOB 1SBBA 4ZYKB 1TPXB 3EYQC 1KEGL 1A6VL 4L1BA 1J1XH 2ZG1A 3IDXH 4HEPG 1Q9LB 4CVWA 4NQDD 4AYFA 3EADA 1HXMA 4DP5X 5AAWA 3LY6A 2PP9A 3UZEA 4MLSA 3S3BB 4G8EB 2HWZL 4YGVA 1G9HA 3ZR5A 5L4MA 3CX5J 1G7JB 4G2AA 3GZQA 2CRMA 3BAXA 4J3BA 2GITB 4Z3TA 2VL5A 2MSPA 2BOCB 4XVOA 4JJOA 5DJZA 1YN6B 4AMKL 1U36A 3HBZA 3OQRA 5EPMA 2A77H 2E75C 4ZMWA 5HP5A 3B9DA 1XDTT 1OE1A 4LHJB 2W65A 1E4WL 3B2XA 4GBXC 3ZIYA 1OARH 4D0DA 4Z77B 3OR6B 5J13C 1E8YA 1EHLL 2FSEB 4A7VA 5ID1B 1AHWC 2YD0A 3SDCC 2AJYL 1MNUH 2CBPA 1TQCC 3TYGH 3MJ7A 2D0GA 3TV3L 1IB5A 2V3EA 3DVNA 5BQ7B 4JANB 1WTLA 3AAZB 4M7LL 4P5RA 2DJMA 2KPWA 3S35H 2X9YA 5FHAH 4MJ2A 5K39B 1A7RH 3VXMB 5HPMA 2EH8H 4JFTA 4OLYH 4KXBA 5DURB 2RIKA 3JUYA 3V6FB 1EWHA 1KCSL 2VQ4A 2VR6A 2KUTA 3Q1SH 43C9B 4AG4H 1V10A 1A6TB 1X9LA 2VSMB 3O45A 4B41A 2AXWA 2XBDA 4NB7A 5KAQG 5KBLA 4U6YA 3QCTL 1ZLDA 3KL5A 3VFOB 3CHPA 1DUZA 1TZOA 1E5ZA 2YQGA 2DI7A 1SN2A 1BPLB 4NUGH 4JY4A 3WEAA 1I3RB 4LSPL 1AS7A 1KGCD 3K6FA 3OPZL 4JREC 4Z7VA 4FFWC 1DBBL 1N68A 1I1YA 3LKQB 3WY2A 4MJ6A 2X6MA 3RRQA 1NFDE 3CBRA 2R2EB 3OX8B 4UTBA 5DK0B 4X6CF 2CJSA 1HAWA 32C2A 3L6FB 2FYVA 3C12A 3FT0A 4LVHC 4P99A 5T33L 1KPRB 1QRNE 2W8CA 4EZMA 1JF1B 2VLKB 2BSBA 5TQ0L 4KH2A 1AKJA 2I24N 5C0IB 2MNUA 4PR5A 1RPKA 2DV6A 2B9BA 3KPPB 4JQIL 4QOKE 1ZA6B 3S36H 4GJTB 5GGSA 1YO4A 1GGIH 2CUAA 3LH2L 4P5TD 4FQLL 2CO1A 2FQFA 3PP3H 3FU9A 1I1AB 1E3XA 4P9HL 1BLIA 1OGTB 4R4NC 2W0LA 4AQAA 3ZYJA 2NT1A 4DHLA 1NGWA 5JXED 4DFHA 4UZSA 1MZYA 1XB6A 3VRLF 1BD2D 5CIPA 5I0VA 5K1NA 2DYRB 5D1QC 5KYNA 1T4WA 3DOSB 1KCVH 3TBVB 1S5IL 4ODTL 3TGXA 5MHSE 2ITDB 4AIZB 3VXUA 4QXTA 4XN9A 4IDJH 3MRMA 4MCZB 5EZLA 4EO5A 4A6YA 4CC1A 4E9XA 1PJ9A 3MRJA 4PFEA 5BZDB 4PVNA 4YSUA 5CUSL 1AGFB 3VSTA 3RUGA 4PJCE 3W81A 3GKZA 3BWZA 3KXFA 2YPKB 4H25B 4TNVF 3TA3A 2A1WL 1B0RA 1RZ8B 4X5WB 1N0LA 5GZOD 1H3XA 2XYCA 1S3KH 4HA1A 1ZCRA 1RURL 1EXHA 4L0PB 4E9YA 3MJ9A 3T04D 4MJID 2ZYHA 2VLKE 2GC4C 2GTWB 3L4VA 5T1DL 4NOBA 1KSRA 3Q06A 2X1PA 4B9FA 2VQ1B 5IK3B 2MCPH 3FO9A 4QJ3B 5DU7A 2BDNL 4MMZC 4TTGA 1RZFL 4AH2A 1ZVNA 5H4YA 1JZ8A 5KTEH 3R0NA 4PJIA 4R2GB 3BVNB 1JZJA 2CR3A 3BJLA 1AGDB 3VX1A 3FMGH 4ABUA 5KN5A 2O6DA 3LRSB 4HK3N 2FYYB 2PW1B 3HN5A 4M43H 1Q9WB 3KPSD 3DMMD 1NC2D 4GQPH 2IMMA 2BY1A 4LCUB 1T83C 3HZYA 4PJAA 4QO1A 1KBPA 4M1DH 2WWMD 1NAML 2C1OA 3ISYA 3R8BB 1N7MH 1EEYA 4OFIA 5CGTA 2EDDA 2OA9A 1ZS2A 4A68A 1LM8V 1MCFA 2PYFB 3QXWA 3FU6A 3O2VH 4M1GL 5D4IA 3ZO9A 3VD2A 2NRDA 3L4TA 2WOYA 3TEUA 4MQSB 2CDGB 1N2RA 5EO9B 3TO2B 1GSKA 4DP4X 1CMOA 2V8LA 3DOSA 1H3UA 1OE3A 4MAUH 1UM5L 3LKNB 5DA0B 4BFFA 4Q97A 4GXVH 1Q9OA 3MRNA 2ZWZA 4ALAL 4LHQB 2AKRA 4JPKH 1E2WA 4L8DB 2G3NA 2JFCA 5FV1L 2VDML 3WFEH 3KGTA 4HU2A 3IFPB 3RZWA 4JKPH 4DTGL 4DW2L 5DTFA 3GSNA 4FYQA 3ZZLA 3F12A 5CZRA 3BX7C 1EEQA 1R46A 3ULUL 4HS6B 2LABA 3P2DA 2E7LA 1EAPA 4E42A 1RUQH 2L3BA 4I1NB 2DYPD 5IJCC 3FUKA 1TCRA 2XA8L 4YPJA 3LKNA 2EADA 4K15A 2BY2A 3RI5K 3BYTA 3FOLA 1MIEH 4YE4H 4XCCH 4YHKH 3VMNA 3S37L 2BRRL 5C2BL 3C2AL 3FTYA 3HCVA 3WNMA 3ZQ9A 2NXZD 2DTMH 3BHBA 4F15B 3VJ6B 2AERT 1AD0B 3B9AA 4NI3A 3NSXA 4LKCA 3HBPA 2OTUB 1IEBA 2VDQB 3G6JA 2X42A 1T03H 5HGBA 1LTXA 1BDYA 3S88H 3GIVB 5DJYB 2KZWA 4OFDA 5C08A 1KG0B 5IVXF 3WBDA 5LBGA 4XPHL 1QUPA 3BIKA 1RFDH 4NP9A 1U8HA 3K6IA 2K3TA 2NQ3A 2VLRA 3GRWL 4NBYB 3E6HB 3LKRB 4M5ZH 4HLJA 1ZT4B 4WTWA 4WHTB 1KJ3H 4GINA 2J55A 1NDMB 3TBYB 3QUMB 4N1EA 4NQVA 4ZUTB 5CD3A 1RZ7H 3G6DH 3NGBC 3ZSTA 5JDSB 4M4RB 5FKAB 1HKLH 2NNFA 3CHRA 3L54A 1AQHA 1OXYA 4WKXA 4IGBB 4V2BA 4XAWL 5DK2A 5FAAA 1F13A 4DO4A 1BVLA 4GT0A 2CM6A 2N0MA 1N5YH 4NDMA 3BDYL 5BUAA 1C1EL 3U0WL 3FN0L 4HV8B 4LLAA 3GSWA 3O81A 3SDCB 2BZDA 3ULSB 1IV8A 4EQ3A 4EZJA 1MW2A 4QXGL 4X9GA 5E5MB 3NJNA 4QXGH 3ZTJH 2EC9U 2APSA 3SJVB 1ZLVK 1TZHA 5C3IA 3DMMA 1ZDSA 2QQQA 4LSRH 4QHNA 4XBPA 4EI5C 2I60H 3D39E 1FV1A 4GUQA 1ZWIA 3ARVA 2IH8A 1SY6L 3MNWB 4QWWD 1TTBA 4R5TA 1WIUA 4XO4A 3FTSA 3V4VA 5I18H 3OHMB 1G1OA 2RD0A 4WWKB 4KC3B 1A9BB 2GG1A 3OMZA 5FW8A 4M6MH 4ZI8A 1T0OA 2FATH 4JBSA 5C07D 1KXQA 1RZPA 1Y07A 3L45A 1Q8MA 5EUOE 4PJ8D 4R4ND 1TZHB 3FO0L 2X41A 2HT3D 1OGAE 4HC1H 1W72H 2EO9A 4HS8H 1CFVL 1Q0YL 4HBQA 1CO1A 1TZIB 3FTVA 3KXFD 5FLUA 4ZTPH 3V0IA 1TYEB 5CZXD 4K7PX 3BOVA 4ZD3H 2IGLA 4TOYL 1OQOA 4AGNA 3DRQB 1O5DT 2EDHA 3HMWH 3U48A 4XI5D 4O5LL 3S0PA 3F6IA 4EE2A 2PO6C 3OG6B 2BNUA 3W1ZA 4KMTH 4XN1A 2Y4SA 4S0SD 3TPUB 4NO0A 5LLIC 1IGCL 4OIAA 3VFSA 1TLMA 1RJYB 1J8KA 1N59A 3EG9B 1TSRA 4JY6A 4TS6A 1PSKH 3B56A 5F7DB 1SY6H 5K33A 5GGUA 4G6FB 4QI3A 3B7RL 2HRHA 3TVMC 1S8DB 1YDPA 4V1DE 1R19A 4Z3JA 2OW7A 1UZ6F 1E9PB 3I6LD 2J6EL 2VC2L 1BQLH 4L4TE 1P9MA 4V11A 4U6HA 3V8CA 2FO4B 1T0MB 5LAXA 1WBZB 5E6IB 3AS3A 1UWXH 4GYBA 2DJSA 1CT8A 3M1BB 1PQZA 3WIHL 3RLSA 3P2TA 4IHOA 4LCWD 4KDTA 4QLRA 3A22A 2B0SL 5HHVL 5FUOH 2BNQE 2NY1D 4PREB 4ALAH 1NC4A 3P3SA 3UC0L 1JMZA 4IMLB 1DBKL 4G8FB 1DFXA 3EDJA 4AUUA 1FSKB 5C0CB 4MAUL 4MJ5B 5HI3D 1E9OA 1OZTG 4LBEA 2R51A 4BWUA 3B2MA 3QPQC 3KYKL 3RBSA 2MIZA 5F93C 3S6CA 5FC9A 4FLQA 4P5SA 1IGMH 1BX2A 4NS0A 4W9CC 1HHKB 4HUNB 1HWWA 1KJ3L 2APTA 1NZRA 3HKFA 4MMZA 4E42B 3V7MA 1PMYA 3VRIA 3ZQXA 2EEDA 2F2HA 5SWZD 4ZXBB 1ZHBA 4C57C 4JFPA 4FA6A 5C0AE 3O6ML 3AITA 4LARL 5AWNL 1EZVY 4X7DC 3V52H 1Y1UA 3FMGL 4Z8FL 1ZGLA 4LOUC 1Q9KB 1HXYA 1EEZB 3NFPA 1XWVA 5E0FA 5EOTB 3HNTL 3JV6A 5IHUH 3WAKA 3DDFA 4F91B 1X7SA 1ZRUA 5CILL 4KNQA 1RHFA 4E9VA 2VN4A 3KYMB 5F9OL 2J21A 2QSVA 3ROOB 3VU1A 1TNMA 4XPAH 1W9XA 3QIWC 1G7LA 4IRSB 5EUOB 5FW7A 1E42A 2AV1B 2ADGA 2DMGA 4L4VA 4F7MA 4NOFA 2APXA 1X5YA 1D6VL 3S3PA 5MENE 1JPSH 2VISA 5IKCB 5EOCL 1CI5A 1RZIA 2XA8H 2IPKB 2ORBH 3MV9A 5F9WC 5J1TC 3U2IA 4M93C 4LLVB 1J8HA 1CDIA 5CUSH 4U0QB 5F96L 3QWQB 1F45A 2PWGA 4L3EB 3EJSA 4P8QA 4X6EB 2GBVA 2XKUA 3V0WL 3N44B 4HOZA 1PIGA 2KZBA 3AB0C 2MFNA 4KROB 4UIKL 3PWPD 3ZDZF 3ME0B 1CXFA 4RDQG 2WLZA 5ABAA 2ZXEB 1YQVH 2XFXB 4W81A 4Z0XB 1PIFA 1F3DJ 4XMVA 2NY6D 4HKBB 2NY5L 2VKWA 5KYUB 1NEZB 1UM5H 3KLLA 1UVQB 1BXUA 3MLUH 3SIKA 4WU7B 4XX1E 2EKJA 5JMOC 3EXLA 5L4IA 3CZGA 3ES6B 1I1AD 5BJTB 1U8NB 3KLHD 2XWBA 3KDMB 2PYEA 2JELH 2QL1A 2XWZA 2VR3A 3FFCA 3I6SA 4NQQA 3IMSA 3IMRA 3B83A 3DOIA 4PWFA 4CMHC 1NFIB 2WLIA 2QMJA 1F4WH 1T04A 4GW1A 1HESA 1D5XB 2FX8H 3FHQA 4JKWA 3NIFF 3QQ9C 3T65B 3K4AA 4NXKA 3I02A 5E7BA 4OJEH 3L4CA 5F8RC 4G42B 3DURA 1DUYA 1QBLL 3MRPA 4XXDA 1FORL 3ES6A 4MA7H 5BJTA 4MAYA 1HZHH 1XIWB 2ATKA 3OXRB 3QUHA 5C0BB 2GJRA 2BSCA 4QF1B 3WTTA 5HVHB 2V5SA 2Q9OA 4F93B 1TKWB 3M7OA 1E6JL 1SHWA 1UB6A 3AU0A 3E9TA 2I07B 3HIZA 4Q0XH 3KZ8A 3HC0A 1IC5L 2EC9T 4P9MH 1SUJA 5D93C 5IROC 5E4OA 1OAXH 5DZAA 4P59H 5CP3A 2TRYA 5IB2A 3T3PE 5DJZB 4X4XB 5E9DB 5FPIA 3BEVB 4G42A 5B3NA 5CBEB 3CZJA 4UDUB 3CXHK 2H7WA 1MKFA 1R3JB 3QSKB 4X7SL 3NJIA 5B39B 1XIWA 1GGTA 1O6SB 1I8LA 2ATKB 3MC0A 2KI6A 4L23A 4PVMA 3MRRB 4WTQA 1EX0A 5DRXA 4Y5YB 3ELAT 4R83A 4JZOA 4JY5L 1EHLH 4R0LA 4TVPH 2LVEA 2QPSA 1Z66A 4IRJB 3BDBA 4JN1L 3RHWK 4I18C 3FUFA 4M61B 3HI1B 2A77L 4Y4FA 3ZE1E 1GGBH 3LH9A 3PP3K 1E6JH 3W9EB 4MB1A 2WYIA 1XMEB 5C3TA 4L1SA 4G82A 3L08A 2DWTA 1WS7A 2BXZA 5B39A 3W39A 2ZKXA 3HS9A 4KTEH 1QEWB 1QX1A 3GXPA 3NOIA 1T3FA 1PD1A 4GKNB 4GW4A 5AW5B 3TIDA 5JIMA 2NY5C 2VM3A 3NP3A 4OLWH 4OGAD 1UXWA 1FO0A 3T1FB 1UACH 4W6WB 4Q9QL 4WEUD 2ZUXA 2XQYG 1S7WB 3DJRA 5TQ0H 4OZIA 3CXDL 3BO8A 4HWBL 4NZRL 4UM8B 3WAJA 5JMRA 5KBKA 4OU3A 3GMRB 3RX5A 2SEBA 4F33B 4PN6A 2GJZA 3L81A 2MQGA 4W9ZA 4GSDL 2EIEA 1SN0A 3PL6B 4F37K 1RPUA 4PB0H 4Y5VC 1KDJA 4WUUD 3V0VB 4DN3H 2RA1A 1CFNB 3ATAA 1EH9A 2ICWJ 1K6QL 2DBLL 1UXLA 3ABZA 3OZKA 2H32H 2W1NA 1NLBL 4U1LA 1YMHB 4ZMPA 5LNEA 3K72B 2HFEA 4G1MB 3LYRA 3TA3D 1UH4A 4DVBB 1Q9OB 4KXDA 2BRQA 4UTAL 4AG4L 4ABQA 1BMGA 1LD9A 1W8OA 4U1GC 4QHKI 1IGFH 1NWOA 3K8MA 2R8SH 2GJ6D 2LW3A 3WTYA 1C5DB 1SBSL 5T3ZL 2FO4A 5LAXB 3T0EE 2XA3A 3BUPA 5LBSH 2DQFB 5E9DD 1IM9B 3RKPA 1X7TA 1J7VR 1U4FA 3MUHL 1JZFA 4WNJA 5EBMB 3X12A 1ZGLB 3UYRH 5HHQB 3TH4T 5IQLA 3MBED 7TAAA 2IFGA 2CAKA 4HCRH 1ZS8B 5CEXA 1ZD6A 1U3ZA 1NDGB 4XNAA 1E4WH 3VVWA 1KPUB 5FYLL 1AKPA 3EYVA 2UXGA 4I5BA 4R9HA 2CXKA 1NUNB 4MJ5A 2UXTA 4PJFE 2PR4H 3D6GA 1PKQB 2F08A 4CU6A 3H0TB 1OPGH 2XQYK 5EC1B 5BW7A 2VDPB 4OZHF 2FO1A 1YEIL 4R2GC 3TJEL 1RSYA 5IKCA 3SQOH 2E6JA 2GAZA 4H26A 1FVCB 4JFEA 4LARH 4NWUH 4WNQB 1MH5B 3HPLA 3GMLB 4PJFB 5E8NB 4GIPD 1G7IA 1RUML 3ALPA 2WTRA 4TVPE 1FRGH 4UQ9A 3CHQA 3BGMA 4URTB 1A7OL 1B2WL 3AT8A 1SZNA 3QIUA 1BP3B 1ETZB 4FJ6A 3UDWC 5I1IH 2ADYA 5E1IA 2GI0A 1UD8A 1HHJB 2G4GA 4PGEB 3K5RA 1HXYB 1P4LA 2JB6A 2Z8WC 3MOAL 3GS0A 4KRPB 5J06A 1NCWH 5IVOA 2OZNA 3ZRSA 4BFGA 4APQB 3JV0A 2Y72A 4HUCA 4IHBA 3V6ZA 1KLGB 3ESOA 1XXFC 1CDJA 3UC0H 2UUDH 3WN5B 3BPCB 5D1XC 2O5XH 3FW6A 4FXGB 2EC8A 3JVGC 3QIUB 4H0HB 4RDQF 1XB3A 2GFBB 1XBDA 4PJCA 3FO2A 4LCCA 1O7SA 2YD1A 3T3MB 3T0BA 3KPTA 4S1RL 1HI6A 4QRFA 1H0DA 1SXZA 4JFXA 4JFHE 5CSGA 1FBIL 4JFWA 2AGJL 4AEEA 1VSCA 1ZLWH 2WXMA 2FX7L 3OB8A 2Q3XA 5KSAB 3DJTA 1NCJA 2V9QA 3SDCA 4DZ8B 2AI0H 5J8OA 2NR6C 4FQ1H 2J8UE 1X7QA 1T0NB 3FQRB 2H3NA 5ALCL 4WK4B 5JW4R 3UTZB 4Q6KA 5I6OA 4W9EC 1R3HA 2E6QA 4WKZB 2O5ZH 1T7WA 4KJPD 3B34A 4Y2DA 2JCCB 1HN1A 2HT2C 3QIBD 1AAJA 2GK0A 2A9CA 3IJSA 2DIBA 3IFNH 1N64H 3INUL 2A0LD 3DUSB 4FQXD 1XGTB 5SWSB 2JJTC 1SJXA 1C16B 3EOAB 1F2QA 4TOYH 2DQFA 2OMVA 3RDTB 3U7WL 1P7HL 2FO8A 5HGDA 5MEQA 1K2DA 4PJAF 2XIBA 3GHBL 5J6HA 4F7PA 5DMIH 1G1CA 4FOMA 1KG0A 3AWGA 2F5BL 3U6XS 3O6LL 3N1PC 1LWRA 4ATWA 1FC2D 4PRBA 1P1ZA 3VE0A 1G4RA 3NIGE 4Z7WA 5BRZA 3HZVB 1I75A 2BFVL 1SGKA 5E6SB 3WUZA 1O6TA 5F7WC 5LN8A 1TFPA 5ANME 3WU1A 2G60H 3DRQA 1OLZA 2ARWA 1WZ1L 3JV4B 1TQCB 2CMRL 2J72A 3HR6A 4OZGF 1WBXB 1U3NA 4X0KB 4UAOB 3IXTB 1H9VA 1CLVA 1UB6B 5C71A 2N3JA 3GMLA 4PJFA 4ZT1A 1SFHA 2X2UA 5TDNA 2YGQA 4YXHL 2Z91B 1UXMA 5BOZG 4W4OA 1YMMB 2ADFL 4YSCA 2NQDA 2GT9A 3CHSA 1ECZA 1T7ZA 4LP8A 3MRQB 1TITA 1WF5A 3RTQA 5IVXE 4GP4B 1E5YA 2JQZA 3WGUB 3VD9A 5I1JL 4HZLA 1MCWM 2YWZA 4N28A 5I6MA 3UIZA 5AKSA 1DQQA 1QBMH 4J8QA 1F42A 2NZ9C 3AS1A 5SWZB 4YPGB 1FHGA 3BPLB 1YPZF 1EZSA 5EZLB 5SX4H 4OKVB 5KSAD 1XGYH 3PQYD 2WJ5A 3EYFA 1S78D 4LLQA 5D7HA 1N4XL 3D4GA 1I8LC 1CYGA 1TMQA 2HFTA 1A22B 5C0DB 5KVGH 3BXNA 3K0WA 3KHQA 3P3YA 1XGUB 3LEYH 3IDNA 4PVBA 3KPNB 2CKNA 5EEUA 3IDJB 4G8GD 4GEJA 3ZOAA 3P4OA 4HIXL 3PFUA 4LVOB 4YHLH 4AIEA 1QKZL 5IHLB 5IVXA 1KBVA 1PNDA 3QO1B 4FMFA 5EU7C 4P5KB 5J5EA 1BBJA 3AGWA 3UTZA 1Z0NA 3SEPA 1D5BB 2VABA 1XTLA 4KHTL 2R29L 1J9CT 2DEXX 1JJUA 5E9DE 5F9AC 5I73C 1WG3A 5I82A 3RDTD 5BMFH 4JFFA 5GRUL 4PM1A 5D1ZB 4HUUB 2XTJB 3CQQA 4L4TD 4MX7B 4M8VA 1YPZE 4WAFA 3BKMH 4ODVL 1ADWA 5GGQH 5EUKA 1VFBB 4ONHA 5E5LA 4X4YB 4HPOL 4RGMC 2YD5A 4P4KA 5F6IC 2GYSA 4MAYB 1JV5A 3ARFC 2DIEA 3VFOA 3IM1A 4K71C 1JPFA 4DO6A 2CLRB 3GXTA 3G9AB 1ZSDA 4X4KA 2BRRH 5C2BH 5DK3A 2DQIH 4H0LC 1AI1L 5IZ7A 3DTXB 4G43B 2X2JA 2AQ1A 5IW1B 3BN9D 4D9RE 4Y16B 4OZIF 5JPMC 5E8PB 3HBGA 1EA9C 4KK8D 3ZDZB 4P0DA 5JLZA 1FFNA 3GXMA 3FUJA 3IMWA 3HI5H 4RMRA 2WKOF 4R26L 1R5WA 5BZZA 4NAJA 1IM9A 3EOBA 2CDGA 4JUTA 5D2LE 3QIBA 2VITB 1QNZL 2VR4A 2Z31A 3ELQA 2EIJB 4DOHE 3H1ZA 4YSDA 1I7UB 1KY6A 3EJQA 3HZ3A 3MLZH 4TSBH 3VFRB 3VI4B 3HZMB 1OGTA 4L29B 4YE0A 4BUGA 4L1LA 2H6PB 3CJJA 5PCYA 1DVFA 2RFXB 4HAFA 4ZX3A 2IC2A 3HE7B 1T6BX 3OZ9L 1MLBA 5LWYL 4YHPA 5BVJB 1DQMH 1MHHA 4Q7DA 2UZPA 4FQQB 3HB3D 4K94L 3VFUB 4B50A 1DSFL 3A67H 4Z7NE 1MFEL 2W59A 1NIEA 3NH7H 4OM1H 1BQRA 4TQEL 5GRYA 3QJTB 4WJG3 2YD7A 1A6AB 1UKTA 4GQQA 1MFEH 1X6NA 4OM1L 5F88A 3RTLA 4N0FB 1GC1L 3UZQB 5AVQB 4AC4A 1MJ8H 2AF2A 1TENA 5MENB 4HT1H 1AJ7L 1ORQB 4FNUA 1NAMH 1S7QB 1MCOL 4LU5L 5TH2A 1HQ4A 5EBLB 3CGTA 4XBEH 5KOMC 1DQKA 3D08A 1GGCH 5BS0E 3RGBA 4Y1AA 2AQNA 2NYYD 3L13A 2VC2B 4CVUA 4BSVA 4KOCA 2CKBL 2FR4B 3OJ2C 2F58L 1CQKA 4G6MH 3VSUA 2J8UF 5CHNB 4MXVF 1RZFH 4PWHA 2YKKA 1K8IB 2EYTA 2IEPA 3C60B 3L1EA 1USZA 4PRHA 3MJWA 1HL9A 4CAGA 2KHAA 4CNIB 2H0EA 2XPYA 3TZVC 4O02L 1P1VA 2IAMC 1NSNH 4H1LG 3TT1L 5I73B 4RA0C 5IQ7L 4XN8A 4D0BB 3WFDL 2ZXGA 5IBLC 2NSMA 4IIQA 4PJAB 4H0GA 2HKAA 4QRUB 4RRPA 3W9DA 3L1GA 1NBZA 4TUJB 4YHNB 3SGDH 1YEJH 4KJPC 5DYFA 3ZZ1A 1LILA 2VJ0A 3ARRA 3GBEA 5IWLC 3WDHA 2LAAA 2YBRB 2WO4A 4JHZA 3IETB 3SKJH 3X3GL 1ONQB 1M2VB 3KR3L 4CJ1A 3QI9A 3EF4A 3EYOA 3ILPB 1S5IH 4ODTH 1KCVL 3NIDB 4ZS7L 4A2FA 4ENED 4QJ4B 3K6SA 1A6UL 3FT4B 1ETJA 3ARYA 3KDPB 4OJFL 4UAOC 5GGQL 2D73A 3C87A 5I5JA 4JPQA 4KROD 3VFUA 4NSKA 3C5ZA 5GRUH 4WHYG 2I27N 4NRXA 4A1RA 4YAQB 3S36X 3H9ZA 4HIEB 2QGEA 3QNYA 4S11A 4UMSA 2WP3O 3ASWA 4TXVB 1YJDL 1QNZH 4KGLA 5FXCH 2R2CA 4XBMA 1BZEA 2A6IA 5A7EA 4O4YH 4OZHE 3CG8A 3CXFA 3CZLA 1IVLA 2X0VA 4QRPE