4A7VA

Structure of human i113t sod1 mutant complexed with dopamine in the p21 space group
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Ligand Binding and Aggregation of Pathogenic Sod1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7vA00
4A7GA 3KM1A 1TO4A 1Z9NA 2APSA 1F1DA 2VR6A 2WKOA 2ZKXA 3PU7A 5CU9A 1HL5A 3ECUA 1SXZA 1COBA 3KBFA 1E9OA 1B4TA 1OAJA 1CB4A 1Z9PA 2VR8A 2AQNA 3CQPA 2XJKA 3KBEA 1SXSA 2WZ5A 3SODB 2GBTA 1IBDA 2C9UA 1Q0EA 3HFFA 2AQSA 2Q2LA 3F7KA 1CBJA 1RK7A 2AQQA 1P1VA 1SXNA 2ZOWA 1U3NA 2WWOA 2WYZA 1UXLA 1SDYA 3GZPA 4N3TA 1E9OB 2AQTA 5KBLA 1FUNA 1UXMA 2SODB 3ECVA 2LU5A 1OEZW 2JLPA 2WZ0A 3GTVA 3HOGA 1F1AA 3K91A 5KBKA 1AZVA 1OZTG 1SXCA 2C9VA 2K4WA 4BCYA 2AQRA 2AEOA 4N3UA 1XTMA 1YAIA 3H2PA 1E9QB 1B4LA 3T5WA 1E9PA 1JK9A 4MCMA 2NNXA 1SDAB 1IBFA 3KM2A 4OH2A 1JCVA 2E46A 1BZOA 1E9QA 3RE0A 1SOSA 3L9YA 4BCZA 2V0AA 1ESOA 2E47A 2Z7YA 4A7VA 2C9SA 2Z7ZA 1BA9A 1HL4A 1E9PB 4B3EA 4A7GF 1SXBA 1PTZA 1JK9B 1SXAA 2ZKYA 3GZOA 4L05A 1KMGA 1YSOA 1EJ8A 3L9EA 1IB5A 2GBUA 3KH3A 1N18A 1EQWA 2R27A 4A7QA 1IBBA 3GZQA 1TO5A 2WWNA 2WZ6A 3KH4A 1OALA 3S0PA 3QQDA 1N19A 4A7SA 3ECWA 3GQFA 4MCNA 1S4IA 1DO5A 2XJLA 2AQPA 1L3NA 2ZKWA 1SRDA 2WYTA 1F1GA 1SPDA 1PZSA 1MFMA 5KBMA 4A7TA 2AF2A 4BD4A 2VR7A 1F18A 1XSOA 2WKOF 4FF9A 2Z7WA 2JCWA 3QQDB 3GTTA 4U4IA 1PU0A 3MNDA 4OJAA 1OZUA 3LTVA 4A7UA 1DSWA 3H2QA 2Z7UA 3MKGA 3CQQA 3F7LA 1IBHA 1QUPA 1XTLA 2GBVA 3CE1A 3HW7A 1YAZA
chains in the Genus database with same CATH superfamily
2RA1A 2P80D 2VDKL 1RUPL 1EVTC 2DQFA 1QYGH 1SHSA 5EWIH 1IFHH 1HVXA 1UASA 1WIOA 2I7SA 5E9AA 4W4OC 2ZJSH 3EYFA 5K33A 2NY5H 3IETA 4LL1A 5C6PB 5MEQB 4L4TD 1G9NL 4KRMB 3Q8BA 5MEPB 2VQ1A 4CMHB 2EDMA 1S7QB 1KWGA 2EIKB 4HWEL 5J1SC 1KB5L 2YJQA 3X1GA 3CZFA 4ZO6A 1T04A 3VDCA 2A4CA 2ZOKB 2VLKA 3LKSB 2CMRH 4CRPA 3MACL 4PJAE 1XIWA 2VDLL 3EXJA 4Y5YA 1XH0A 3K3QA 3U25A 2YD5A 2QPFA 3MHZA 1PY9A 3IU3B 3HAEH 1FAIL 3WFEH 3KPPA 3DARA 3ZGHA 3IFLH 3OSKA 2B1HL 3VGFA 1TQTA 4NDMB 4YLBA 4QO1A 5FO8A 1M53A 3NRPA 4KK5C 1CURA 1PKOA 1BSIA 2D0FA 3WENA 1NCOA 3WIIH 2E5EA 3AXLA 4O2EA 1I7RB 3VAEA 3QARA 1KPVB 3HC3H 1N8ZA 1M2OA 4W9GC 1C1EL 2BIOA 2WTPA 4WWNA 1P7QD 4ZO7A 4KMTH 5J1TC 1A7QH 4ATWA 1FIGH 2ADJA 5AZEH 3LXAA 5I8EA 4F8QA 1KELL 2BNUA 2FATL 4LIQL 3TPKA 1NMCC 2AK4A 3UFIA 3FQ4A 1JK9B 5AD0A 3L54A 4LPTA 5T5FA 4MJ6B 5A2AA 1FHGA 4PRPD 3EYSL 1A4AA 2N7BA 3QJUB 4KUCF 3QHZH 5IHZA 2Q86B 1OTSD 2YAFA 1I75A 4HUXB 3RG1C 5J6GB 4N2FA 2E8YA 2XG4B 3L9RA 1GPOH 3STZA 1JN6B 4KRLB 1XGPB 5IF0B 1NPUA 2GITA 2YN3A 2WNWA 3WS3A 3LN4A 4MD4B 4ZSOA 2F2HA 5IESH 2ZUYA 4MQXC 4PTUB 1P5UC 1SJEA 2C1PA 1HU8A 3MLSH 2ORBL 3BDXA 4JLRB 4MXWL 2R56L 2IDTA 4AMXA 5E5UB 3OLGA 1KPUB 3TM6A 4GG8B 4QLWA 1WBYB 2CO2A 3PCYA 3ULVH 3RVXC 4OJAA 4UNUA 5KYYA 5J9PB 2B1AH 3CAFA 3II1A 3QJTB 4K9EL 5CJ8A 3LB6C 5IMMB 4ZQKA 2X9YA 2XRAL 3T65A 2KUTA 3N43B 4Q52A 3X1FA 3QZBA 2EDXA 4BCXA 1HE8A 1T21B 2VLJA 1BFVH 3MRKA 3D0LA 5IK3A 4OZHA 4OCSL 3PU7A 4HMEA 3CVHA 3HC4H 5DJYB 1OL0A 3T3MF 2NW3A 1FG9C 5HGDA 4MNGA 3RWGA 1RZPA 4WFED 4N90E 4YHYC 1GTFA 3EYVB 3UMNA 3V4UL 1K4CA 4WTWA 1NGQL 5KSBA 3CLEL 5IW6A 1OK8A 2IPTL 3L8QA 3SBPA 3UZEA 3TBYB 4O2CA 5ICXB 2Q2LA 5TE7H 3VB8A 1BQHB 5IHLB 1NJ9A 4HK0A 4I88A 1TLMA 1D7BA 3CFDB 3N1GC 2W9DL 3AXIA 4HWBA 4DGYL 4FADA 3QUYD 3UCQA 3B8SA 3BOVA 3QDGB 4ZXBD 2FQDA 1VFAA 1CFSA 3WN6A 4XPTH 4YHYB 1RUKL 5F3BA 3WNNA 1UM4H 2WLYA 4JO2L 4P4KC 1MCCA 2BP8B 3Q48A 4JQVA 3BP5A 3PQYE 4YHOL 5KS9F 2BSCA 5MHSE 4NQVA 4IOFC 2YBGA 2PW1B 4BEIA 1A64A 3K1KC 5F7LB 1H6EA 5E5LA 5AW2B 4IEFB 2VDNB 3KDMA 3EOTL 1IM3B 4XCCH 5DMIL 4PS3A 1N2RA 1KBGL 5HGAA 1SDAB 3P4MB 1QLRB 3IXTA 5DMKB 4XWGH 3TIEB 3T09A 1L5GB 4FL4B 2XPZA 3WAJA 3D2UA 2F53A 1I85A 2Z35A 2E47A 5AWNL 4L9LA 2HT3D 2QKSA 1LDPH 3ET9F 4D0CA 2WAHA 4PV8A 1BEYH 1D5BA 1RURL 4HXBH 5AZ2L 1U95B 2CUHA 3SGJC 4N8UA 3LPGA 2C3XA 4UUJB 5FM8A 4ETQB 2Z8SA 1PFCA 2VDMB 1I7UA 4GG6F 1PFOA 2YA2A 3B2UC 3KWWA 5GGVH 1FL6A 1GHFH 2G9KA 2X4SA 4U2YA 2IQAB 3VXSD 1YMHA 3MRPB 1CGXA 4B60A 2ZCZA 2APXA 4E0RA 1G0XA 2ETWA 4O58L 2CNYA 1UWFA 1A7OH 4JO1H 2ZX6A 2DI9A 4AH2A 4RRPG 3RVTC 4TLKA 2YKKA 4QHMA 4WFFD 2XV3A 1NCAH 1PZSA 4GUPA 4HZ1A 5FGRA 4D0DA 5IGXH 4NO0A 5E8EB 1E4XH 4MDIB 1F18A 1NCNA 2XVKA 2FO8A 3V4PB 1LK2A 1X5JA 3FU7A 5D7IE 5EOCL 3S3SA 1EA9C 4CNIB 3NDYE 5EC2A 5PAZA 4K23H 2DIEA 4DGWC 1JXGA 1Y18B 1BJ1H 4DP4X 1PW3A 2WWKO 5I26A 3TF4A 2ROXA 3QEQD 3RKPA 4YO0B 3SDAA 32C2A 3QW9A 2JIXD 2ZXQA 1E2WA 2B14A 4LLUA 1K72A 3PGCB 1AQMA 4XBEH 4DKFL 4AE1A 4QRBA 3B5HA 4MJ2A 1DDTA 1YCSA 4IHOB 4OF8A 2CLZB 5LNEA 4EXKA 4DZBA 3CSGA 5GGSA 4F2MB 1HEZB 2EDWA 2FLBT 2R2CA 4YSSA 3CC5A 5GSRB 2DZEA 3O3UN 1M05A 2BNRA 3I6KA 4UILH 5E4AA 5E6ZA 3T8MA 5CSZA 4WK4B 5D6DC 4Y7OC 3UROR 3NIDB 3NZUA 1PZAA 2QDWA 2NCMA 1AXTH 2X9WA 2YD7A 2VW7A 3HZMB 2ZWLT 4I3GA 4M5YL 1M1XB 3RAJH 4P2QB 4OFKA 4W6XB 3ARQA 3QEHB 4W9CC 1Z32X 4X6EA 2QHRL 1XT5A 3GTVA 4Q6IA 1BM3L 1JGEB 2MEJB 4PJ5B 5JW4Q 4FXLA 4LLWA 1QBAA 3G5XB 5LGHH 1XH3A 1NAMA 4LASH 2IG2L 1VERA 4S1RH 2BCKA 1OM9A 5B1AB 2VLRB 1R24B 4G7VL 1RZ8B 5FYKE 3OHXC 4A38A 4EVNA 2FBRA 1TNMA 4WWPA 4HVBA 3V0JA 3FZUC 3DJTA 4YFLF 5LAXA 4D8OA 4ERSH 2Y3NA 5IVZB 3V4LA 4Y88A 1RKRA 1G94A 5EH1A 4WGWB 5ADOH 4NC1E 2NNRA 2C7FA 1MCWW 1CL7I 4QOKD 3MU3A 3V5DB 2Z7YA 4UM9B 5GZOA 1H3WM 1UKTA 1UWGL 3NDZE 4KVNL 3EGSA 5E2UH 4C4KO 3ZE1E 1U3HA 1W72A 3AWFA 3NRQA 2NYZA 2VR3A 3OHXB 3VX0A 2WW8A 4Y19D 1QD0A 1R0AL 4Z3FA 1BECA 3V0WH 4HOMA 1LMKA 4JM2A 1BVKB 1JTTA 4G6AC 2VLLA 1MWOA 1ZVNA 1I8LA 1B2WH 3FU8A 4I85A 4OVUA 1EEUA 1LHZA 3A24A 3QUML 4AYFB 5EN3A 4JZJA 1YY8B 3IDMB 2X28A 3GJEA 2PPFA 4N68A 5DZVA 4OD1H 4NKMA 5LB1A 5CGTA 1ZEAH 3JTSB 4BK5C 3QO0B 1GIGL 3EO9L 4P04A 2BFGA 1R46A 4CA4A 4AEHL 3L7EA 2Z7WA 1WA1X 4JN1H 3QQDB 2AEWA 5GGVY 1UWEL 3D52A 1IGYA 5JO5B 4UTBA 3T6QC 1GH7A 4J28A 3N44F 2GQHA 2QT6A 4RMUA 3BLPX 4JQIL 4WI0A 5HHOB 3GJFK 1TQVA 3NAAL 4FTVE 3R8BB 3WO4C 2ZG3A 4JFDE 1IE4A 4Z0XB 1E4KA 3R1GL 3RL1A 3VXPA 2J5WA 2CM5A 4IIQA 5DCCA 5E8PA 3V9FA 4MJIA 4KMQA 5AW3B 4KVPA 2I9TA 3KYOA 2C34A 3LEXB 2NNCA 1I4FA 1CD9B 3G6AA 3I3EA 2K45A 2V37A 5IB2A 2ICEC 3S37X 3ROOA 2XG5B 2GTWB 5I0ZA 4TOYH 1ZTXH 3S5LB 3IFPB 1SM3L 4CW1A 4DH2A 3L5HA 3MRDB 4S1SL 5ACMA 4BHUA 1G9NC 3KLAB 4B0MM 1OE2A 3AWEA 2BZDA 3V6ZB 4LDLB 3K5SA 1SYVB 2DMHA 2FJFA 2MPAH 3CH8A 4DTGH 3BGMB 3T0AA 4FQQB 4YFEA 4HH8A 3VI4A 1VPOH 1WISA 3U6RB 2ICEB 4I18A 2HLAA 1U8LB 4EEEA 4UQDA 2JJTC 2X4OA 1UXWA 1GTNA 4WWKC 3GIVA 5D5MA 4X9FA 3BKMH 4GRLC 5EDXA 3S5YA 1I8KB 1I31A 1E8WA 5DEGA 3FO2B 3TVMB 3QIWC 1BAFL 3S34L 4ZOEA 1DANT 5JHDD 3T5WA 3FO1A 1HZKA 1HCZA 5KJ7E 3IDJA 4QRPE 3FHAA 1D6EA 1KB5B 3MCKA 3ISRA 2KMWA 4MD5A 5F6IC 5SX4I 4GXFA 4RMVA 4DQOL 4HG4K 4IRJC 1JERA 1DJSA 4KI1A 3IJEB 3VWJA 2IBZX 2VDLB 3B7UX 4WWKB 4UYQA 4GRLB 4ABUA 5CIPA 2PW2B 4IBTA 1DQDH 3KLHD 2D3NA 4HW6A 3QIWB 2FVNA 3WMSA 3UEZA 5H35B 5SWZB 1NMAH 3FQNA 3REVA 5TDPA 4Z0BL 2WLLB 4IHBA 3E7JA 5F6IB 4MSWB 2AJXL 2JKSA 3HVNA 4NFDA 3NCFB 2IWEA 2N59A 4Y4HC 4IDLA 4IRJB 4ILDA 2Q7YB 5MEND 1JPGA 3KH4A 3DTDA 3ILPA 3HTLX 2VT0A 2BVPA 3MV7E 4ZTPL 4KKNA 4FFZL 4MRCA 2XWTB 3IDIB 4MMXC 4PJGA 3WEBA 5JYMA 4YIQB 3SE3C 4YDVB 3OGCB 3MV8D 4NPYB 4QHKI 3U7YL 2CIIB 4MQSB 4ZMWA 3HJ0A 3WLBA 5E00B 5K9KB 4ZUTB 3VD5A 5CCKH 3RWCA 1OSPH 4Y4HB 3UPAA 3QZNA 3GDBA 5C2UB 1EAQA 2G5UA 5ID0A 2EYTA 3ZE0B 4U6YB 3ZMRA 2F68X 4ZFZA 1PU0A 1YYML 4JDTH 4KY1L 2WXIA 5AKTA 4MMXB 4IRZH 5I8CA 1OP4A 3FW6A 3VFSB 4AMKH 3S4SB 3M88A 1P1ZB 4FZEH 4P0DA 4PJEB 5AYUL 1IEBA 3G5YB 2CJTA 3IS1X 4K9EC 4FLOA 5CMAA 1IAKB 4O00A 5FYJE 2YXVA 4CADB 2BY2A 4OD3L 1SBSH 3Q0HA 3ZT5A 1WPCA 3LQMA 5FK9B 5H2BB 3KL0A 1FO0L 4P5SA 5E2VL 2A4ZA 4HUWA 3BAKA 4MA7L 5FYJU 1SOXA 5D5MF 2Y23A 1A8ZA 1AY1L 2ZZUT 1M6OA 3WHXB 3SYOA 1NIEA 5EU5A 5INCA 3VXRB 1BZDA 4DO5A 3FSVA 4GAJH 3SKJH 4QGYA 4JE4B 5LBGA 2GTZA 2WINA 3UP1A 3UCRA 2K8QA 5FGCB 5CD3B 1RL1A 3AC0A 4OFYA 1WZLA 3IM1A 4QYAA 2GPZA 4DHLA 2X6UA 5EU4A 3FULA 5SV3A 3ESUF 3US9A 4PJ8D 3L5XL 4WK2B 1PDKB 4XOEA 2QGDA 3VM7A 3SE8L 2QR0B 5F7HA 4LSRH 4N0CD 4V2CB 1HSBA 3BP6A 3ESMA 2GK0A 1F3RB 2HLFD 1FHNA 2J72A 3OF6D 1ZIBA 2YGVA 3AS1A 3Q2WA 4ISVA 2OS7A 4HPOH 4UIKL 3MX0A 1P4IL 4G7YH 4U1JB 4JZOB 5CP3A 4M6OL 2EE3A 4R6UA 5INDA 4GP5B 3ALPA 2BZ7A 2JB5H 2K7QA 2ZP0T 1AFVH 5HDRA 3VYPA 5FA4B 4EI0A 5L0QC 3X2QB 1VFUA 1OPOA 2AXFA 3L16A 4R4ND 4ODBD 4Z7QF 4EBQL 2P9RA 3PDDA 4N0UA 4V1DA 2DIAA 5I66A 4RFEB 1HH9B 4GMTH 5D1QD 4OW6A 1A6UH 3NSYA 3E9TA 2X9XA 1DBAH 1WAAE 3GUTB 3HG1E 1KJMA 4HBCH 1FVCB 2YD0A 3DOIA 1QW8A 3DJRA 3L2MA 5E94B 2WKGA 1E4HA 2OR9L 5L0QB 2EXWD 2LHAA 3IPEA 1S7VB 4YHKL 4QNPE 3GI8H 1Z3RA 3RJDA 4X5XA 4M7ZC 4RIRB 4I3SL 2WXKA 2B5IC 4XBPA 1P5VB 1OO2A 4HT1H 4YDIH 3J8F7 3FQWB 3WTYA 4WU7B 1CD0A 3V7AE 2GI7A 2PCFA 4FHJA 4RNRA 1N0XL 3VFGH 5EZOL 3SGKA 1FZMB 4AVIA 1BAGA 5AB2A 3SYQA 4M6NL 3ZL4H 3GSNA 4B9FA 1JVLA 4D9RE 3HLKA 4HJIA 3THML 1X9QA 4M7ZB 4CKQA 1JG9A 4BA8A 2B5IB 1OARL 4U0QB 3DVGA 4GP4B 1OAKH 3DJ9A 1HHIA 5JW4M 1D5XB 4YSAA 2WIMA 2Y1ZA 5I9QC 2H41A 2D9QB 1I1CA 5T5FH 1JGUH 5K39B 2SEBA 4K7FB 4G43A 3RVWC 3ZL1A 4G80B 4P46A 4F3FA 2EIMB 4H5SA 3IGFA 4U6VH 3D3VA 5DLLA 2OCJA 1BFSA 1AIFA 4TVPL 2O4EA 4NYLB 4DN4H 5DJ8B 5BRZB 1KYDA 2DWTA 5GQBA 3H9SE 3AAZB 3CDFA 1YYLL 3LZQA 4CVUA 3OLIA 1I7ZB 1MI5B 2XFXA 4G6JL 3TBTB 5DJZB 4DKTA 4F33B 5I9QB 3O9WD 1MFVA 4NM8L 3DGCR 4Z7NF 3EJYC 2QKIA 5DJ0B 4AI7A 4OLZL 1W6LA 1M4KA 2UUDH 4ZS6D 1T83A 4RMBA 4PUBL 4L8SA 3EO0B 2OA9A 5FOBB 1OPGH 4H2CA 4N2KA 3T0EA 3KPQA 4S10A 3MV9D 4XNMA 2IWKA 2FQFA 2GJ6D 2ZCLL 3OPZL 1ZRUA 5E2WH 4MCMA 4FA6A 1BV8A 5FO7A 5JOFB 2FNWA 3W9EB 2CSPA 2I26N 4HOZA 4LLQA 4O9HL 3T77A 4ZYKB 4EN3C 4XHQA 1EZUA 1QBLL 1NOAA 1CIDA 2B3IA 1RPQA 4N8VB 4PYGA 3CVHH 2ZOUA 1LO0H 1VACB 3OHMB 2VN5A 1P4UA 1E28A 2PKDA 3RWDA 3ZDXB 2YRBA 3AQXA 2XOTA 3DHMA 1MH5A 5I1HH 4KVCH 1JZDC 3WSQL 3BSZA 3DV6B 1BIIA 1JNHB 2Y5QA 4EN3B 3DV4B 3H1ZA 4P23A 2F8VA 1XCQB 4HWBH 5B3SB 3D9AL 1SEBB 1XD0A 4MKMA 4X5RA 3TEZA 3HKZA 1TR7A 2Z8VC 5C0IA 1CFNB 4N2HA 1CI5A 4YDZA 2E7LC 3DHPA 4C58B 1ND0B 4I89A 2WLIA 2FBOJ 3UTTE 2VAAB 1FA4A 1IEHA 3NSCA 4OGAC 2FAUA 2LT9A 4DW2L 4L4VB 1J9SA 1T1WA 1BZ9B 2WNGA 5HHQA 4KRPC 1MQKH 4EI5A 1MDTA 5F2FA 3MBEA 3IGLA 2I85A 1Z1WA 1J12A 2EADA 5LCVL 3G5ZA 5E6UB 1OTTC 5EF3A 1IBHA 2JJUA 1QBBA 4U3SA 3D69A 2YPVA 3KGRA 3QUMB 4XHJD 1LEKA 4DVRH 4FG6C 3GEFA 4JL1A 4AUYA 3ELAT 2R0KH 1A6AA 1F8TH 3M6DA 4KRPB 1GKOA 4R90H 5F1IA 4BUGA 5LN4A 1R3KB 4YLQT 1HCFX 4IGBC 5IBUB 3TH2T 5CEXB 1JZ7A 3BLKA 1AE6H 2A6IB 5DHEA 1A9VA 4WFHE 1RSYA 5FHBH 4XMXA 3U0WH 4MNHA 2AJVL 4OLVH 1DBKH 2XBTA 4DKAA 1EO7A 4KROD 5B39A 1EEZB 3KYKL 4WW1B 4PP2B 1BPLB 2K9UA 4XGZB 1VF5C 1OP5H 1FYTE 4Z77B 3Q8FA 3ASNB 2J2ZA 3LNDA 3V0GA 2BY3A 1S2EA 3OL2A 3VRLE 1YN7A 4HAKA 3PDOB 5IR1B 4IGBB 2A74C 4NQXA 5CEZD 1CGSL 3ZYJA 2Z3FA 1F4YL 1YNLL 2E7DA 2NXYC 2R2EA 4HH9B 5HJBA 1D9KC 4CBZA 5L8LB 1DVFA 5CINH 4YPGB 1Q0YL 1KB9J 4QHNA 1A4CA 1E9QB 3CXHJ 1EIBA 3FQXB 2OSLB 3HUJB 3ZTJG 3BW9B 4FLHA 2Y7LA 3SIKA 1UZ6F 3BN3B 1W91A 2A9NL 3HHRB 4EKXA 4QAWA 4WF7A 4P5TC 1V7MH 2C4FU 3D85B 1IBFA 5I1DB 1TQBC 3PL6A 4M4RB 2RAMA 1MRCL 1ZV2A 3RE0A 4AQAB 1DLFL 2UZYA 2A74B 2MPVA 4G9FA 4DK3A 4LGRB 4HS8H 2NXYB 3FOLA 4R8WL 5C0AB 1D9KB 3FOMA 4GMSL 3DMMC 4MNQA 3VO0A 3DBSA 3HE6C 4RWHA 5FYLL 5KEZA 3FQRB 1KC5L 4IKKA 4FNSA 5FECA 5BZWA 1MG2C 4P5TB 4R5TA 4YC2C 3OX8A 1N18A 4UDUB 1TQBB 5KTEL 1V55B 3N91A 6FABL 5AW8B 4RWYH 5D70H 5KYNA 2V5YA 5DURD 1H15B 5DDHA 5HJDA 4OAWA 1GAFL 5MEOA 1KJ3L 3K2MC 1JE6A 3DMMB 5DFWH 4TRPL 5E5MA 1HHKB 1J9TA 1KPRB 2AW2A 3HE6B 4XC1H 4CC4A 1RMFH 5GGUA 3UDWA 1BD2D 3QFDB 5C0NC 1M3JA 5D7LB 4QHUA 1ITBB 4X7CC 5JXAL 4JKNA 4POZD 2VLMD 4YC2B 2PXYD 2HVJA 1A9EB 1W2KT 2C9XA 4Y4FC 5DR5H 3DIDA 3LKQA 4UZUA 3HNSH 3DX9B 2DEWX 3LQAL 1NAMH 4NWUH 3NZ8A 4PJHA 2F5AH 1A3LH 5D9SA 3V0VA 5E8DH 3BUBA 1SFHA 3E0GA 3RDTD 1XGRA 4K7PL 5CZXC 1UVQB 5DJ6A 4HOWA 3QCUL 1ES0B 1B0WA 1SUHA 2YK1H 4LMQI 1Y7VA 3DPBB 2H6PB 2P52A 4K71C 4IK7A 4NI6A 3FONA 2NLJB 4Y4FB 1FIEA 2B59A 1T2QH 4BZ2L 3GM8A 3GS0A 2D7PA 5FGSA 4YSQA 4O51A 2FDBP 1UZ8A 1YQVH 3QNYA 2B9BA 3OC5A 3QJFB 4XBMA 1D2PA 1B6UA 1J8HB 1OF2A 3DXAA 4NBZB 4OZFH 5IMKB 3FF7A 3KMDA 2EUZA 3UTPE 3QCVL 1YDPA 4MQTB 4S1QL 4ELKA 1P0SE 3KZ8A 2DQEH 3BP4B 4XI5D 3BD3A 4K71B 4E2OA 1S7UA 3NJKA 3QJVB 4WI8A 3JWDH 3A21A 3KLQA 5DMGD 4I48B 1AS6A 5HHXH 1U8KB 1L7TL 1XZ0A 5HGBA 5C3TA 4GSDL 5CZVL 4NERA 5AW1B 3MNVA 5C3IA 2P80A 2RFXA 2CM6A 4NENB 4PRHB 3CSYA 5JORB 1CUOA 1UWYA 1MW0A 3HB3D 2AEIT 1KBKA 4BCYA 4FQ1L 1FO0B 2H1XA 4E9QA 3WE6B 3CFIC 1ZAGA 4L4TA 1XTMA 2ENQA 5D2NE 3O2DL 4X6FA 4N5EC 4X6BB 3Q1SH 4KK8D 2NQ3A 1DUZA 1N67A 4UTBH 3R7QA 1J10A 2HKHH 3BDYH 3AT9A 2VQTA 5FCUL 3S37H 3GRBA 3B2VL 2H9GA 1KIUA 3VJ6A 3BUQA 5CBEA 5DRNB 3PWUB 2ALWA 3CFCH 2BNQE 1I8IB 4AEFA 3SKOA 4RX4A 1FAKT 2HRPH 1IC4L 5ACZB 2XI9A 3M17A 2K8MA 5CO1A 2NX5B 4AKQA 1V7NH 2P5PA 3I2CH 2F7IA 3GSQB 1YEDB 3LS5L 5DJDB 3H42L 3U0PA 2COQA 1TO5A 1UENA 1RURH 1UZGA 2JB6B 4ANKA 3LDBC 3I9PA 5IJDC 4DP2X 1FG2A 5L4MA 3UG5A 4AQ1C 1O0VA 3MOAH 5I8KL 1I8AA 1S4IA 2GFBA 1BVNT 5B38B 5EBWB 1P7QA 2WBXA 4FQLH 1HYSC 5KYUB 3UJIL 3OKYA 2DKSA 4KTGA 2X09A 2VOTA 3B2PA 3H7BB 4L3CA 4NXSA 4YZFE 4PRPA 4PIRF 2OL3A 5IM7A 1BXAA 3LDBB 1CK0H 2I32A 1S5HB 2OX5A 3L45A 3RRQA 2ZUQC 3EFDL 4GINA 1XGQA 4ZFOB 4AQ1B 3HAEB 4P3WA 4BUHA 5L2KD 5HI4C 1I82A 3MCLH 1EGJA 3VD9A 4NP4H 4WW2F 5G4OA 2YD8A 1I9JH 1QSFD 2OYPA 3F5WA 4H8UA 4Y2LA 3B5GA 5CIPH 2C1OA 4C55A 2YZ8A 4ZMAT 5BO1H 5TH2B 5ITBL 2BOCA 3W5NA 1BX2A 4XNBA 3Q01A 4TUKH 4BKTC 2DMKA 3ZBMA 3WJLC 5IFAL 4AV0A 1BJ1J 1U8MA 5DA4A 5C6TH 3N40F 3VD7A 2VXVH 3T6XA 3NCJH 4GEJA 2NTFA 5E99L 4HU8A 5IV2B 3WTVA 1IQDB 1LWJA 4F7TB 5ISZB 1B88A 3B6SA 4HIJA 1NMBH 3MJGX 5ESAB 3OC8A 1UHVA 2YLHA 4PY7B 1OT1A 1ZK9A 2RTTA 4YHLH 3SPVA 5I30L 5IHWA 3NZSA 1QSEA 4Y16D 2J1XA 2OMVA 4MASA 1CLOL 1TQUA 4IOIB 1FJ1A 5DUJA 4N9OB 4AT6B 2CXGA 3QUYA 4TNGA 3DGGB 4ZXBA 1GMIA 1GS7A 2WTRA 3RVUC 3IYLW 4X99A 5HYJE 1IGFH 1E2VA 2ZIDA 5B1JC 1S7TB 3KLDA 1AR1D 1OGAB 2XTJE 1U58B 3RY6A 3ZRFC 5KVGL 3ZHNA 4OQTH 3HRPA 4K55A 3CJJA 5IFJB 2LLGA 4FP8L 2FD6H 4L1DA 3N3EA 2EKSB 3CSBA 1XSJA 3CVIH 3QDGE 5F96H 5AZUA 1BXXA 2ZOTA 3NCWA 3RP1A 5FF6A 3FQ1A 1D5ZA 4M9OA 1TJIH 4WFGE 4OTXL 4PJBE 4KITB 4X80H 1WICA 4NC2B 1QLFB 3NQIA 1L0QA 3NA9H 4TULH 5DD1H 3CNKA 3IWUA 3K4AA 2NY1D 2R0LL 1PKQB 3SDXA 1RK0A 3F64A 1Z3GL 1EDQA 1OXYA 2NY4C 1NGZB 2C9RA 4YBLC 1LMIA 5GSVA 1Q9KB 4XCEA 1E4WL 1JDCA 2O5ZL 3QDJD 3CFBA 5ADPL 4X4MA 5GRXG 4PRIE 4KBPA 4TSCL 1PIGA 5DU7A 1AZNA 1T6BX 1F3JB 5C0GB 3HG4A 3OB0K 5K69A 5GS2H 1TUPA 1DSFH 2W60B 4XO4A 2FX8H 3J7HA 4IK6A 1MF2H 3ZKXC 4OF7A 4GOSA 4XWOD 2NY4B 3BPLC 5L9DH 4YBLB 4YXKL 2CR0A 4FC3E 3VXSA 3L3OA 1OGPA 5KWYC 3GTNA 4QXUH 3OWRA 3ZDYB 2YZ1A 2O5YL 3TYGL 5HVWA 3TBBA 5E70A 4J8RB 5CP3H 2J21A 4TL4A 2DIJA 4KH2A 5A43C 2J20A 4UQCA 1M9WA 3FB6B 4P2YA 3V52L 5E2TL 4EDXA 1MAKA 3AQZA 3ZKXB 1NDMA 1KFGA 1RIUL 5GGRA 3BPLB 1WUNT 3VXTA 1V3LA 2C3WA 1I1YA 1N64H 1WS8A 1FPTH 1WEJL 2D2OA 5C0BB 5F9JA 1PX8A 3LZFL 4XZUA 3QEQA 1E5AA 1HNGA 1PYWB 1QHPA 2JIXA 3NT0A 2EVIA 3AM8C 4LVNC 5CFAA 4J3TA 3GMLB 4P59L 4JDZA 5ALCL 1AZVA 2OW7A 3NYKA 3BCFA 4HGMA 5DVNA 1RZJH 1AS8A 1R17A 1JGDB 2ZAHA 4X6DB 3PABB 3PP4L 3EBHA 3ISYA 2GJPA 1FFQA 3PHOA 1CBVH 1MKFA 2DS4A 3EYQD 5BXFB 4IKIA 1IGCL 1G7QA 1TEFA 2V7NA 2ZWSA 3QUXA 3GT6A 4W9HC 5FA3A 1L0YA 3PGFL 3SJVD 4Z7AA 2CRZA 1NBVL 4CVZA 1PEZA 3QZWA 4LVNB 4BGLA 3ARWA 4LCUA 4M7LH 4LEOA 3RPKA 4GW5A 3VXUB 2NR6C 4OCRH 3UPCA 4K3JL 1U8JB 3KLKA 3O6LH 4MAYC 3EHBC 3FRUB 1GOGA 4XRCB 3B56A 3HMXA 3FUEA 2UV3A 3GMQB 4MA3A 3MLVH 1CD1A 4XVUC 5IMLB 2P45B 1E5YA 4LCWD 3B7SA 4H1LG 4X5PA 1KMGA 2DQTL 2MOVA 3NIDE 1JL8A 1QOKA 4JHVA 4Z7VA 1NDGB 3FT3B 4HGWA 5HHNB 1YMMD 3X3GH 4NWTH 3P9LA 4PJDB 4P2QE 4LBEA 2ZCHL 4Y4KC 2XA8H 4MAYB 3MA9L 3QIUD 3EHBB 4NPKA 2HA1A 4WJ5B 5ETUB 2F19L 1TCRA 4KJWC 1DVTA 4PJ5E 2XZAL 4LQ1A 5ICZB 5ITFB 4Z78A 4KXZH 4KKLC 2HTLD 3FFDB 2Z4QA 4QOKA 4S2SB 3MROB 2X0UA 5DRXB 5HHPB 2XZZA 2FL5A 1SRDA 2VDQL 4WNQB 4KK9D 1G7JB 1HKFA 1OCRB 1WYJA 1MRDL 2VLRE 2X5PA 1SJVA 4LCYB 4ODVL 4QHLA 4TPRL 1ZE3C 4JDEB 4Y19A 4XMTA 5KYXB 4Y4KB 4PG9A 2KPNA 1ZSHA 1G1YA 3KJ6L 2YOAA 4AV4A 3ZLQC 5GS1C 4AYMC 1EXHA 3G6JF 3NSDA 2NSXA 2AEQH 3O6FC 4FD0A 5LGKA 3U9UB 5T1KB 4GAGH 3LQAC 1N70A 4K3DL 3ZZ1A 2GIMA 2LV4A 1V27A 4KX8A 2Z31C 3V4VH 3UIYA 1TKWA 2FT8A 1DDHA 2HRHA 2W0FB 2G2NA 4OI7A 1TZHA 2WKOA 5CLYA 3I02A 1S7XB 1HQRA 4HKXA 1VGKB 1TTRA 3KBFA 5GS1B 4X8XA 3GPEA 2HZHA 3O6FB 5IW3A 5DD6B 4JFPA 3WKMH 1IBDA 1KN2H 4NQSA 2I5YL 4D7PA 1Q0EA 5I1EL 2P24B 2Z31B 4AG4L 2OMZB 2ZWNA 4HIEA 4J39A 4HALA 2E74C 2YAHA 3HLAB 4N28A 4PJXB 3EJJX 4ZS7H 1FYHB 4ZX3A 5E24E 1YPZB 4FXKC 1YLBB 5IQLA 1SHXA 4XB8A 2GC4C 2BPBA 4DPRA 1J8KA 5EIQA 4XBGA 5KVFE 1MZZA 3CTTA 3C5ZD 5C0EB 2UWEB 1LLAA 1OCWL 1CICD 2A3TA 4FFYH 5C7XH 1RZFL 2MCPL 5HGHA 2DH2A 4UQ2B 5HJ3A 2J88L 4WEUD 3U0TA 3X12A 5HHOE 3BIKA 3WE1A 3WS6C 4JN2A 3STLA 4CN6A 1PSKH 4FXKB 1IRAY 1IGTA 1UJTA 3D07A 3NJJA 3T71A 3BH8A 1HL9A 4UWQB 4DUWA 1EANA 5BOJA 1VGEH 2NY2C 5C07B 3OAZK 1QPKA 3TJEL 4Z7VF 5TE6H 3TC9A 4JNXA 3F62A 5EV7A 4Z5RA 2YPLE 2IIJA 3BZ4A 2XTLA 2YPVH 2NXZC 5JNYA 1S78D 2WXMA 3IFOB 2BK8A 3ZZQA 3LPPA 3P4LA 3GJFH 2VO5A 4NUQA 1O7DC 3EDDA 4WU5B 2EJ1A 3ZIMA 1WD8A 4LOEA 3UACA 4FNLL 1RVFL 4L05A 3QWOA 3M8OH 2NY2B 4OI9A 3UPRB 2P5EB 4XCYA 2B2XL 4CJ1A 1N6QL 2BSSA 3WLWC 1E67A 2QADD 1JIBA 3CHOA 1KLUB 2NXZB 3DVNB 1F2XK 2G75A 4JCLA 4M3HA 1DJZA 5F0PB 4URTB 4B27A 3LXUX 5GRJH 4YSTA 2YKLH 1VEMA 4FFVC 1YJDL 3IJSB 3HI5L 5DF0A 4JO3L 3MGTB 1BOYA 2J44A 3ZZLA 4Y2DD 3DI3B 4G7RB 1H5BC 4OZIA 4WVRA 4OCMC 4PVMA 2WKOF 2E59A 1N7MH 1P6FA 1PAZA 4LP4A 4P5KA 3F7VA 4OD2A 3OAWA 1FH2A 2XN9B 4ZD3L 4NJ9H 1MLCA 2V2XB 3QZWG 1AGBB 4ODXB 3D33A 5LQBH 2BRQA 5T33H 4Z95L 5MENA 1JPFA 4XXCC 4NT6B 1WC7B 3IBOA 1NBQA 5D1XC 1UWXK 4HJ0D 4P2OD 4DAGL 1H5BB 1U2CA 4RDBA 1OLLA 3IGAB 2BRRH 3MV8A 3I75B 1QUNA 1NLBH 4XMLH 4UOJA 3QDMB 5D2LE 4D0BB 3A6OA 3H9HA 4KZDH 2VW4A 4LSUH 1U8PA 1CVRA 4YBQC 2F61A 2XJKA 3OKMA 1FRGH 1QI3A 1LP9B 1J1OL 3OKEB 2CJUL 3AACA 2PYFA 3IF1A 4KX9A 3T3PB 3KNBA 2CKBA 4W6YB 2ATPA 3RQ3A 2ATAA 5D1XB 3ZL2A 1HI6A 2IQ9L 1TVHA 4UV4H 4FA7B 1B9KA 4ZK8A 5DWPA 4BWUA 1ZANL 1JUFA 3VGHA 4LIQE 1MFCH 4RAVB 1G7HA 3UGXA 5I1GL 1H3TA 1G7LA 3MUJA 2AXGA 4P57A 4R96A 3ULSA 2IADA 3T6VA 1A6ZB 1BZQK 2OP4L 3L08A 2ZOLB 3I9GL 3CFKB 4OCYH 1Q0XL 1YYLH 2R1XB 4DEUA 1HFUA 1A02N 1OAXH 3NH7L 1T5WA 4FXGC 5DO2D 3SOBL 4XVOA 4MDRA 4HLEA 1TZOA 1HESA 4POUB 5E56A 3NVQA 2R29A 4U1KB 3RIAK 4JPWH 4YHZL 3WTSA 4KY2A 4N90D 4K94H 1W72L 5CZRA 1LO5A 3P9MA 4HHAA 3RGBA 1QRKA 4FN0A 3RBSA 5EA0H 4HCFA 4BQ6A 1CFQB 4FXGB 2DQHH 2OMWA 3IMBA 4GXUN 4KV5F 4PJ8A 5JZ7D 5EOQH 3VXRE 1UEMA 5F7EL 1QBLH 4XNZC 1KGUA 1I7TA 2XC8A 3BRDA 5MERB 4RVBA 1ED3A 5EBMA 2ITFA 1VA9A 4PWJA 2GUYA 1DQML 2YR3A 2OMXB 3EF7A 5FV1L 1YEFL 4MB3A 2X38A 1WFJA 3IE4A 3PQYD 1F41A 3GBDA 3SBQA 5AVXB 5MHSD 4A2FA 1SDDA 5EFIA 1MCPL 2VN6A 1XGYL 5HDQL 1P7KA 3P3YA 1MQ8A 1RPKA 4XNZB 2OTUA 5IBLC 5HY9B 3ERXA 1AGCA 2AMGA 3CUPB 3GINA 2KS0A 3CK0H 4XCNA 1K85A 3VCLA 1U42A 4HZLB 4YR6B 4ZAKC 1J5HA 4JGNA 2WVSA 3IDNA 3BEVA 1KLGA 2DWEB 4L29B 5EBGA 2MQCA 1RHHB 2H3NB 4XX1G 4LARH 4ODTH 4X9GA 1FFOA 1JBJA 4QWWD 3Q3GA 4HS3A 3L1FA 4DCQA 2H8PB 5ICYA 1LO2L 2BHZA 2R0ZH 4U1NA 5C2BH 2ZTBA 1V54B 2HN7B 4J3SA 2C4FT 5A6IA 3OJ2C 3L1EA 1N12A 4ZAKB 3MFFA 2AQNA 5IHBA 5A7EA 3FCGA 2X2HA 4KQ4L 3LKPA 5BQ7A 4J6IA 2QLVB 1A1OB 3O2WH 3F7YB 1QQDA 2X4RA 1QFUL 4N2OA 2CNZA 4WHTA 5DK2A 2XWBA 2DQFB 4NQDE 2GSGA 5J5EA 3BMWA 2DWYA 3FFOA 4X7TB 5EBLA 1T03H 1XIWC 2EECA 2NY0D 3EYFB 4Y5YC 3ZK0A 1OP9A 4XNUL 2R83A 2LW3A 3W56A 5DHDA 2VQ1B 1KCUL 2FUTA 3CDGA 5E6SB 2KZ1B 5CKAA 5KAQF 1T22A 2CDEA 3EFFB 5F9OH 4DESA 2FT6A 4XXDA 1B0RA 3Q7JA 3WFDH 43CAB 3CZFB 3FN0H 3MJ9L 3QR0A 4B95C 2OL3H 3T4YB 1KJVA 1XIWB 1BOGA 4Y5YB 4EIBA 4GIOA 4PJFA 5TFSH 4KKRA 4GI8A 3HBGA 4G82A 2EH8H 1BAWA 3RYMA 4L8CA 5TGBA 1PNCA 1TMQA 2DJUA 2YAPA 2FTAA 3H9ZA 4U7KA 3T2QA 4AX3A 1ACYL 1OY3B 4KKBC 1X7QA 2R23B 3O9WA 4QO1B 5FO8B 2XIDA 2BP0A 2E4TA 2OSWA 2FBJH 2K6ZA 4LBAA 4JB9L 3P0VL 2DDQL 5DK0A 2Z65C 1C8PA 2EILB 3LKNB 4M1GL 1E8YA 1X6LA 5F7YC 3MV9A 3K80A 3L9EA 2GHZA 2GJ6A 1CLZH 3KWTA 1MI5E 1P2CA 5KS9B 3QZOA 3FHEA 1KIRA 4YNYA 3NACL 4AIEA 2R69H 4N0YH 5I8EB 3HI6L 2BNUB 4HU2A 4PS4H 1BM7A 5FIEA 2AK4B 2BXZA 2E86A 4AJYV 1PD0A 5AD0B 3AITA 1KXVA 3BD4A 1GC1H 1FBIL 5HDOA 3ZQXA 2TSBA 3RI5F 2IGFL 1NFDF 1ECZA 3IDGA 5IHZB 2WQ8A 1QASA 3ZKNC 3HI1A 4OUUA 1NC2A 4DEPC 1KGXA 1RERA 4XOCA 2XBDA 2CDGA 2GITB 3LN4B 4ZSOB 4UB0H 5DHMC 1I9IH 4KI5F 1SJEB 4ZMTA 1JYWA 3MVSA 4PSPA 5HI5D 4GG6B 4G59C 5IB1A 2Z6FA 1H8SA 5KYWB 5KJRH 2Y07H 4F24A 2VN7A 2R59A 3T2NL 4CKVX 3QAQA 4Q9RH 2CLRB 4LSSL 4DEPB 2VDQB 2IDQA 5AQ0A 2NNAA 1WJ3A 1JZ6A 5KYYB 4QKXB 1HQ4A 2E7BA 3PUUA 2VR4A 4ZQKB 1XGZA 1ZHLA 4PLKD 3MCG1 5I16A 3O6KH 5DUBA 4C83B 3MRKB 5IK3B 4OZHB 1JHTB 3CWGA 3NEEA 4FABL 2DJSA 4WLCA 5ID1A 3T1WA 4HETA 1D7CA 5HGDB 4MNGB 3IVKA 4PN6A 3SPJA 3SO3C 2YXWA 3VQMA 2UVFA 4L4VE 4PJFF 1UD3A 2Q7AA 4QIRA 3AU1A 4CGTA 4OJFL 3ZVVA 5HGGS 5IW6B 1YNTA 4O2CB 4P4RA 5HYEA 4JO8A 1OTUC 4PIBA 5TJWK 1NJ9B 4HK0B 2H1LM 5JW5B 4LU5H 3BQVA 4OGYH 3OMAB 1VFAB 1S3RA 1CFSB 4FTVD 3ZTCC 2TSAA 4JFDD 5K59F 3MC0A 1DBMH 5BMFH 1HJBC 3SO3B 5IEHB 1AAJA 2I7OA 3WUZA 3O41A 4ORGB 5DVMA 4OZGE 3BP5B 2H0PA 5E4IA 1JV2A 3ESVF 3KDPB 4BSVA 3ARRA 1EDHA 4LEXH 3DIFA 3WHE1 4NQVB 4L9LC 1XCWA 5FPIA 3IXAA 3WNIA 3ZDZF 4YVUA 1CDHA 3C8KA 4D3CL 3KDMB 1TF4A 1Z9OA 2M1KA 4I87A 2JK5A 5J6SA 5HGAB 3QT2A 5AEAA 1F42A 5EUKA 4KWUA 3WIHA 5JW3L 1JWSB 3FT4A 2BMKA 3S5ZA 1GOHA 5DQDL 1FH5L 1VEOA 3Q13A 1I3GL 1SY6L 4N2BA 2A1WL 3A6CH 4O4YH 4L9LB 3CV5A 1CDBA 4FEMA 2ESVA 2ZSWA 2VZVA 2N56A 1CFBA 2J12B 2QFRA 5DS2A 1I7UB 2EVJA 2XQBL 3JT0A 3TZVD 4ODWA 3HUJE 3KWWB 2X4SB 2H3KA 2G4GA 4NRYA 3OQRA 2A6DB 4QRPD 1YMHB 4KXZI 4PW3A 4NNYA 5H37G 1YEKH 5C09E 3KPLB 3SYCA 1HKLL 3GSNL 1JRHH 5DHYA 2D8KA 2IPKB 3WXWL 5I1JL 4UV7L 3DETC 1AOHA 3P0YL 4XVJL 3SDAC 1I1AC 3WY3A 4GUPB 3WMPA 4D0DB 2D7OA 3OD3A 1RCYA 4HUVA 1AIZA 4PGJA 2ERJC 1LK2B 4M3JA 4L1BA 1JI1A 2NUTA 1BD2A 1WCBB 2OXGA 3MRCB 4YSDA 3NEXA 4HMCA 4BJLA 3NJNA 1MJ8H 3F05A 3HMXH 4N2EA 5EC2B 3TN0C 3GI9H 2PXYA 1B4TA 2ZXWB 1TENA 3RPIA 3S8GB 3MV7D 2QEJA 1A3RH 3SDAB 1QPXA 1I1AB 1DSYA 32C2B 4TNWK 1RIHH 3V6OC 2EDNA 3DJZA 1ZLDA 4IBYA 4LLUB 1P1VA 3RDTA 4BFBD 4DGIH 3Q43A 2ERJB 5D7LE 1WBXA 2ZF9A 2M8XA 3ULUF 4Y9CA 4F5CA 1AGDA 2ZX7A 3TN0B 5HD8C 5D96C 4DZBB 5GGSB 3N5AA 1WWWX 2CUIA 4K7PY 3PFUA 2EDDA 4PBXA 1VFOA 4WI2A 5D4QA 4UQAA 5A3ID 4BFGA 3DX8A 4OIBA 5L4FA 1M05B 3I6KB 5SWQA 4YAQA 5JPMA 2WLNA 3V5KA 5CSZB 2Q8AH 3QH3A 4NKIL 3GZKA 3BHBB 4G83A 2CJ3A 1A4KA 1JYVA 4NQUA 3GSOA 5FB8A 3VFOA 2ZSVA 1Q1JL 4MS8C 4X6EB 5D96B 5FYJD 2VRKA 4BE6A 3IKCA 2IBBA 4E5XA 4HCRL 4LLWB 5DRZA 1J8HE 2H47C 1E0OB 1XH3B 1NAMB 2LAGB 2W07A 3T2OA 3BSZL 4G5ZL 4ATTA 4A37A 1U3HC 2BCKB 4JR9H 3IPFA 1PTZA 4EVNB 2YPKA 4MX7A 1FL5A 4LLYA 1UACH 5LAXB 1QTPA 1FVEB 3X14A 4YGVA 5TQ0H 4DNLA 3L2LA 5CBAB 3MLYH 5DO8A 4LHUD 5K9QG 1TETL 1U8NA 3UH8A 4PRHE 2VC2H 4KK6C 2LGNA 3D05A 2OI9C 2X53A 3EGSB 3QGVA 4KXCA 5C0FA 2Z1KA 1U3HB 1T1XA 1W72B 1XAKA 2CLVA 2O6DA 3PJSA 3QPQD 1D6VL 1WWCA 2X4QA 2E7HA 1U36A 3C6EA 2LVCA 1IT9L 2R1WB 2Z91A 4RAHA 4JM2B 3JVFC 2VLLB 3PHAA 3ZO9A 1EWHA 4N2CA 2DTSA 2HT2C 3GLZA 3CFTA 1MFDL 1A0QH 1NFIA 2DQUL 2OI9B 3MPCA 3H2WA 3B1TA 1AACA 4YHPA 3EKCA 4DEWA 1ZT1A 5J0BA 4NKMB 5D7SH 4GSXA 2GG1A 3CFQA 3IE9A 2X4NA 1SJHA 2WZAA 3L7EB 5EZIL 15C8H 2NX5E 1EAPB 4BBWA 2XBZA 5FM5M 1MFAH 1SXZA 2FH6A 4NJAL 1CB4A 1S5IH 3T2PA 1LL1A 2OJ1A 3GYRA 4AGPA 2EIBA 1AZZC 3HMWH 4WI0B 5I1CH 5IMOA 2IDUA 3OGOE 4HQQH 3LSOA 3HG1D 25C8H 2QPEB 5I71C 3Q8EA 4L5FH 1V3KA 1G7PA 2XKSA 3D5OF 5E8PB 5T1LD 4C56E 3ARFD 5L2KA 4MJIB 4TQEL 4UAHA 1KEGL 3KYOB 1UOVA 3CN3A 3L3JB 1QSFA 1N5AA 3ECVA 1IM9D 4J2QA 4J3OD 4OFVA 3WTTA 4JFXA 4KKAC 1CPUA 4W9ZA 1DYZA 3MNMA 4CW1B 4S1DD 4PRAB 4QEGA 7PAZA 2G0KA 5I71B 2PR4H 3A4FA 1BBDL 4FQXD 1X6NA 1FZOA 4X6CA 4MGXA 2FJFB 1F02I 4TVSa 4X7FC 4D9RD 2AP2A 4JFHE 3NJLA 1QA9A 2Y22A 4AYGA 2WXLA 2HLAB 3DOHA 2X4OB 3VWJC 1AD0A 1UXWB 4TTDD 1G5GA 2WQAA 3BUDA 3FTGA 1G7MA 3GIVB 5D5MB 5FUCC 3WXVL 4Z3EA 2XICA 2DIBA 3AGWA 3GKWL 5DEGB 3CN0A 4FI6A 1EFXB 2OXHA 2O93L 2ATKB 3L6FA 2X05A 3PP3K 1DVQA 4K5NA 3IDJB 4PR5B 3V79C 1ACZA 1D6EB 2A99A 3C8DA 3MCKB 5FUZH 1PQZA 2FT7A 3QYCA 4MD5B 2E6JA 4ONHB 3SDYH 1EUTA 5FW7A 3H9SD 4Y16A 5AW5B 3VWJB 5ISZE 2AI0H 2CKBH 1TZ8A 2H1PL 4OGXL 3K6SB 1IGIL 3EG9A 4HJGB 2WOYA 1QR1B 4YSOA 3GK8H 1G1KA 3PWVA 2IMMA 2YEZB 4MHHG 3FQNB 3REVB 1SBBA 5TDPB 3B37A 3EOBA 3HC0A 2IVFC 3D0VB 2FR4A 2E56A 5HXMA 1GCFA 3P9WB 3EFOB 1MPAL 4IS6A 4JRXB 3G04A 2YUVA 4X98B 4NZ8A 5F1KC 4G70B 3EGDB 4TVPE 5KBPA 3ILPB 4N2AA 2BVPB 4U4IA 3QQ9C 3RL2A 1UH4A 4P9HH 1XSIA 3C60D 4PJGB 5GZNC 1AVAA 3KYNA 2AS5M 5ANMA 1OGAE 3FN9A 3OWEA 4G6FB 3L5WA 2R29H 3WLBB 2G9HB 5AOJA 3K0YA 3RWCB 3FT2B 4F37K 4Z7QB 5A40E 4UIMA 1ASOA 5I1IL 5EUOA 5MI0C 3QDJA 1T80A 3CQFA 2BSRA 4ZFZB 3TONA 4M7JH 2VITA 3O4LE 4NQTA 5J11B 1I9EA 1Y1DA 2FWUA 2H4EA 2JJSA 1INDH 3QI9D 2D3VA 2QQLL 4MAUH 5I8CB 4KDWA 1M71B 3HZKB 3RIFF 2WQVA 4B7LA 1JPTL 4F9PC 2AQSA 1SEQH 1IEBB 3J27A 2VMFA 3RKDD 4HFUH 2NZ9D 4JGUA 3UTTD 4WY7H 5T3XL 5D7KD 5FFLA 1MN4A 5BUPA 4HLZH 4JMXA 4OLXH 1Q9LA 5MI0B 1DBBH 3H3BC 2QJDA 4OKVA 2Q6WA 5BZDA 1I9RL 3LRKA 5KN5A 2WYIA 2Y2TA 3AU0A 1UXMA 1AD9A 1EXUA 4HUWB 2AQ2A 2LU3A 5HYFA 4GT0A 1GGIL 1S9WA 4FJZA 3WD5L 1JZ4A 2CU9A 1M6OB 5EU5B 5INCB 4OCXL 3LJ3A 3M1CA 3W5MA 3ZDYE 5HP5A 1MFEH 1UCBH 3CD4A 4PJ7A 3EYUL 3CHQA 4ELDA 2CBQA 4MMYA 2X41A 5AOIA 3OB0H 4AITA 4X5WA 4CJ0A 5EU4B 3F6IA 3MRQA 3IB4A 1CXEA 2FYYB 2P44B 4A6YA 4PV9B 3K1DA 5CF3A 4Y1AA 5EU3A 1B0GA 1JGVL 1K8IA 4MB4A 1KCRH 3UGEA 4BELD 1KIQA 1TNNA 3X11A 4LQFL 1HSBB 2D73A 3BP6B 3HNVH 4WFHD 2GK0B 1JZ5A 3TESA 4S0TD 4TF4A 1EJOH 2W0LA 5C0BE 4Z7NB 3MX0B 4YE4L 3Q8CA 3WI9A 4QRQA 1FYTD 3I50L 3SJVA 5INDB 4I2XA 4HYTB 5I15L 5G5DA 3MLRH 1L4IA 3E6HB 5DUML 4BFIA 1U2HA 3T4AA 4AYDC 4X6DE 3QE5A 1ZPUA 1JF1A 3QORD 3X1NA 3ALXA 1IBGL 4U1IA 4N0UB 4YE0A 3MLXL 5EUOF 5T5NF 3UZVB 5I66B 3ATEA 1KV3A 3IU4H 4EIGB 3RJOA 4LCWA 5JDJA 1LYQA 1EGJL 1FNSL 4G1EA 2DYPD 4WO0A 4PS7A 4TSBL 3OZKA 1KF9B 1YMMA 2WLKA 3SGKC 5KSVA 1KBPA 3GSXA 5LXVA 4LNRA 2HFGL 1DL7L 4FDWA 4YWGH 4BZYA 3ESOA 5JOPE 1WDAA 2IO5A 4X5XB 2DPKA 5CJBA 3KCWA 3BGFC 4XBPB 4DETA 4OU3A 1CQKA 3X17A 2I60L 1TVBA 4JO5A 1QZ1A 4QJ3B 1HC1A 3RWIB 4PJDE 3NGBC 3OAYK 3ABLB 3RUGA 5LG6A 3ML8A 3S3JA 1H6TA 3NN8A 2MNJB 3GSNB 5HI3D 4ABVA 5DZPA 3KPRB 1ZIAA 1WIUA 1A6WH 3A4AA 4WI5A 4YS4A 4X4YB 1NL0H 3ZKND 1SXNA 1CLCA 3FTYA 4KJQC 4PWIA 3DVGB 1AO7A 1MVFA 1A2YA 2BERA 1HHIB 4CSSA 5LXGH 1OAUL 2PWGA 3QIBC 3I6LE 2ZX5A 5FYLE 2E9IA 1KBBA 2SEBB 3FU0A 1IC5L 3NGBB 5EN2A 4N8CH 4F3FB 4H5SB 1T83C 5E0QA 4ZDHA 1MRFL 3D3VB 3QK0A 4L8SC 4WNSA 3H3KA 1AIFB 2QQNL 2XN2A 5K9JH 4RESB 2AEPL 5FKAA 1WTGT 1IJ9A 5IHUL 2XFXB 2NUPA 2ITCA 3TTSA 3BKCH 3QIBB 4PCKA 3L9BA 5CN2A 4NO2A 1DTUA 2AABL 2MOQA 4DIXA 2FGWH 3OJDA 4TUOA 1F4WH 3PJLA 4PBWD 5T5NG 4LSVL 4L8SB 4X8CA 5GJSL 3KPQB 5JQ6H 4WI3A 4XNMB 3UTPD 1A6TA 2FLRT 4HUMB 1CICA 2OZ4H 2CA3A 2HT4D 4M48H 3BAWA 3L4VA 3MODL 1JNNL 2AMUA 2FECI 2VH5L 5K93A 3DECA 1TZGL 4TQHA 5C9KA 2D7TH 2AGJL 5CJXA 3T77B 1NIBA 1RH8A 3BAXA 1F13A 4QAMB 1A7NL 2D9CA 2CR3A 1AR2A 5E08L 3P3SA 3ECWA 5CJQL 5I82A 2UWEE 3P1VA 1T5KA 5FAAA 1E28B 5BNXD 4A2MA 1Z66A 3GGWA 4FYRA 3OMZA 2NYYC 3MI6A 1A22B 4G6MH 1BIIB 3H54A 1QBML 1UUSA 4QTIL 1L7IL 2VXQA 4P2RA 3NFNB 4ZODA 5DTFA 1SZNA 5C07E 2JCWA 3UTOA 3FU9A 1YUKB 4G8EB 3RNQB 4JFQA 4PJAA 2WLIB 1HIMH 1ZA3A 4Y8AA 1YRKA 3FUJA 3LKRB 1MLBB 1ROWA 1ZK5A 2BNQD 3NCBB 5F89A 3FB5B 1B3JA 2BVTA 2ICWI 3HPJA 5HHQB 3D18A 2R0WH 3GIZH 3CFEB 4TQIA 4W6WB 4HKJA 1MNUL 2P5EE 4Y2DA 3KBPA 5CEZH 4UT9L 1OAJA 4AW7A 1Z9PA 5C0RL 1FC1A 4PBDA 2E9GA 3WKPA 1HAWA 3ETSA 3TS8A 1VIWA 2Q20A 1FF5A 2W9LA 4JJOA 4LSPL 5L88H 4HFWA 3WIHH 1ZGLM 2FIKA 4U3SB 4K73A 5KSAD 3D69B 4JKPL 3N9GH 1LEKB 1O7DE 1CBJA 3N2JA 5JTWA 3NABL 3WKNA 5C08E 1A6AB 4J5VA 1QLEL 4L2LA 5F1IB 3W9DA 2DL9A 2GSMB 2ZPKH 2OJEA 4JE0A 1RZ7H 4KQ4H 1Q8MA 2APVA 3UG3A 4YQXH 1AKJD 5EEXA 4AZ8A 2J25A 4QD2E 2WZ0A 3JQOB 3F85A 4PB9L 1S7SA 4OFDA 2BSTB 2IOMA 5LNGA 1DVFC 4MNHB 5AB0A 4FAAB 3QJSB 1JJUA 2PTVA 3QJXA 1CIUA 1B4LA 5D6CA 5E0FA 4BQBA 4NIKB 1PZUB 3TO4A 5HYSA 3E8UL 3QWQB 1P4LA 4KK5D 5TTRA 3RWEA 3PL6C 2G2RA 1YN7B 2J6EA 2L7QA 3H0TA 1IAIL 1MREH 2R2EB 4IKNA 1DVFB 3NP4A 3MLTB 3U4AA 2VMJA 3FTXA 1I8MB 2CQVA 1PLCA 5BO0D 2PPCA 1BDYA 1SXBA 1WAEA 3FYIB 3T3PE 3QQ3A 2AERT 1UWXH 1CLYL 5D1XE 4IBSA 5DRWB 4JFEB 2WLHA 1Z5YD 3PL6B 1ZTMA 5J7CC 4AMWA 2GK2A 2UZYB 1AC6A 4AYSA 1A9BA 3FQTA 2CKNA 3EJTA 4TL5A 4M6MH 5D8JH 2R8SL 3FOMB 3F00A 2MKWA 2O5XL 4MNQB 3KYAA 1YUHA 1A25A 3UDWC 5JXEA 5CGYC 1RZKH 1XGUA 4HEPA 4XMPH 4HD5A 3SPGA 5FECB 5BZWB 2CE6A 4MQXD 1NKGA 1NM9A 2XN0A 2GUOA 1CXHA 4BZ1A 3APDA 4P9MH 5ESQA 5I6OA 1BQLH 4IBQA 5DDHB 3LZPA 1D3CA 3LEYH 5MEOB 3IBEA 4H40A 5CGBA 2W8CA 4XP4H 4XP9H 5E5MB 2JV6A 3E80A 3ZY7A 5HYJD 3RVXD 2EDRA 1DO6A 4MXVF 1IZJA 2XTJD 3KGSA 3LH2L 1G5AA 4HD9A 4K94C 2F0CA 4QHUB 4Y9GA 3V2AR 4B9JA 3LB6D 1XVSA 1H3PL 4LOVA 3QEGH 3PQYA 3VTMA 2H2SC 2WNXA 3LKQB 4JKKA 2NNFA 5CHNA 1CDUA 2XWJA 3OVUB 3QDGD 3NZ8B 4PJHB 4PP1C 3VRIA 1NFAA 1F6LL 3DUSB 4APXA 6CGTA 5IG7A 4LSQL 5D9SB 3V0VB 2FQGA 4QRAA 4WFGD 2BVQA 5B7FA 5M94B 2WXQA 3GKZA 1A7RH 2CBOA 3MTXA 4ADIA 1RHFA 1TU2A 1J5OH 4WW2C 5EEWA 4W93A 1JFQL 1N68A 3DOSB 3TTYA 1V3MA 2B59B 5BJTA 3U4BL 4O51B 2YQ2A 1JNLH 1UZ8B 3QNYB 4AEIL 4PRID 5KVGE 2AJZA 2F54D 1OF2B 1IM3D 4L4JA 3EO1A 2A9MH 3U9PH 3ZSSA 4Z23A 5ES4B 4P4KD 1L9OA 4Y9BA 2VMEA 4E41E 3CXHK 4HUKB 4P5MA 1RJYA 2WKLA 4WW2B 5JHMA 1CE1H 2X6MA 2F8OA 1NWOA 3AG3B 4NM4H 5EC1A 2CA4A 5C97A 1S7UB 4HF5L 5AVYB 2JWYA 2ED9A 4IOFD 2VKXA 1RJZA 4PJEF 1R9FA 2V8LA 1XD1A 2KZWA 4LSTH 3MNVB 2RFXB 3S96A 3AY4A 3CSYB 3OKDA 2I25N 4A04A 2EABA 5D71H 1FGVH 1UCTA 3B7RL 3HRZC 3JUYA 4RISH 4QXTA 4X9YA 2FJHA 4L4TB 1G6RA 3D06A 5B1CA 1CI3M 1KWKA 5D4JA 3H4FA 5D7IA 2QLYA 5C9JB 3VSUA 5GJTH 5HTSA 1DUZB 4PRBA 1N4XH 4X5LA 4FNRA 3D48R 3VTTA 3CZEA 3AS2A 3MLUL 3TIDA 1RD6A 1MFNA 4H2AA 4U49A 1KIUB 3VJ6B 5CBEB 1YEGL 3HRZB 3GZQA 3VGEA 2Y06H 3II2A 5DUPL 1AP2A 5DVLA 3RU8L 1YEJH 3GMNB 3OZLA 3SKOB 2CHWA 1NC4D 1F4XL 1CFTB 4M7LT 4W4NA 3V5HA 2CPUA 5AAMA 1OM3L 4OUOA 5HVFB 3QWNA 3RVTD 3LAFA 1AQKH 3N04A 3T3ME 1SY6H 3JV4A 4KJYB 1F2QA 2EO1A 2FO4B 3RGVA 1TQWA 1GGBH 1MFBL 3KVQA 2VJXA 5SWSB 1NKOA 5HYSG 1OTSC 5GHWH 4AYBA 3EH3B 5KVEL 4KZEL 2QFPA 3MXVH 4IMLA 2Z7UA 4PRDA 1P7QB 2VL5A 1AKPA 4EUPA 3FSZA 5A2JH 1BCIA 3LZLA 1BFOA 4MDJA 4OLWL 3RBGA 4ZFGL 1IL1B 3N0AA 1NOFA 2LLLA 3BJ91 5CSBA 1EBAA 4LRNH 1HL5A 5IM7B 5I75C 2LAAA 3ZT7A 1JS4A 2OX5B 2WXRA 3RVVD 4JFVA 1U92B 1XGQB 5KS9E 1XXFC 4P2QD 2ADGA 3E1F1 1TTGA 2ZD0A 5F88B 1Y6KR 4OV5A 1CS6A 2ICWJ 4GAYA 3CVBA 4PJ5D 3F7RA 3P3TA 2QMJA 4QMEA 1P7BA 4ODHH 3F5WB 3MRMA 1NWPA 3G6DH 2C1OB 5CAYB 3OSVA 5CCHE 4G11A 1ZLVK 5I75B 1NCBL 3FCBA 4HEPG 3TJPA 2VLRD 2WQXA 2BOCB 3JWNH 1BX2B 3K71A 1WFMA 1WFTA 5FUOH 2L4OA 1FORL 2FX7H 4H1LB 5DQ9A 5EF1A 3UTSE 3LHPH 4ZSOE 4JQXC 4M8QA 3NCYS 2YC1A 2YUZA 3CBJB 2LFEA 2NTFB 2NY7H 4FQCL 4XTRD 1HT6A 4KQ0A 3LXCA 1IKFL 4PY8J 4J12A 2EIZB 1BZ7A 2WCSA 3IK2A 4X4XB 4GG6E 1JZGA 1LQSR 5F1NA 1UM5L 3B6SB 4ZMPA 2V17H 4FQIL 3QUYC 2P3YA 4IDJH 4ZXBC 3SYPA 4P3CH 2DBLL 2F5BH 1E50A 3FZUD 3BIBX 3SPVB 1B6DA 4R5VA 2R2HA 3RY6C 1QSEB 3ZIYA 2C9SA 4LCCC 2DI8A 3TCLA 2YUXA 4TUUA 2AV1A 2OMVB 1VEPA 4GKZA 3PWLA 2PR9A 4AIZB 1FJ1B 4JJ5B 5LGYA 1G43A 1LD9B 3VH8A 3QUYB 3VG9C 1VCAA 2Y3AA 4ZXBB 2WTRB 3PNWA 2FEEL 4FTVA 4QXWA 1F3DJ 4JFDA 5E51A 4BFEA 3I3BA 3MUGB 3PXLA 4AJ0A 2F74B 4LCCB 1CVSC 5MP6L 1LGVA 3N1PC 4Z8FH 5C0DA 1WH0A 5KVDH 5D4HA 3VG9B 1HDMB 1A14H 5HHOD 1F1GA 2P43B 4K2UL 1BVLA 4ZZFA 1D5ZB 3EOAA 1F90L 3FF8A 2HB0A 4LHQB 3T04D 2QQKH 4HXAL 1ULVA 5D72H 3EJCA 3KEDA 3JV6B 5L6YH 3L4WA 4HWZB 1QW9A 1HXYA 2YPLD 3NFSH 5GSVB 4XCEB 3L3OC 3VDBA 2X0WA 4KNSA 3WTXA 3NSFA 3CFBB 3MQIA 1MSPA 2O6FA 4DP7X 5EHFA 1XTLA 5FR3A 3ZDXF 1NSNH 3PDGA 1C7TA 3F6JA 4I77H 5E1AA 3EDEA 3Q2LA 4JREC 1PX4A 2Q2EB 4YMPA 3A0OA 3VW3H 3TZVA 3ARZA 3HS8A 5J12C 2E6QA 2WQSA 5FW8A 3A4EA 3K2IA 4DK6A 4QRPA 2B1OA 4YDJB 2F7PA 2GHWB 3VNZA 3VXSB 3L3OB 4IYKA 4XNQB 2XV0A 5GS0L 4KTEL 3JV5A 2GIXA 4Y5XA 5KJ4A 2BW5A 2QGCA 4M43L 5JUEL 3WFZA 2P26A 2K6YA 4ZI8A 2A5UA 4JREB 1PG7W 1KCLA 3RGHA 3QRBA 2RCSH 5LAPA 3MZTA 1NDMB 2WGXA 3G6JB 5J12B 5IQ7H 3IGKA 2FE0A 4JFFB 3M7OA 3NRFA 1SLWA 3U2JA 4M5ZL 4UT6L 4BDVA 4N6QA 1I1YB 4WUKL 2GTQA 4GRLD 2P8PA 5HYIA 5F9JB 4AQEA 4G8GA 1J1XH 4GRWH 3LNIA 4JHWH 4W9LC 3QIWD 3QUXC 1WZ1H 4PJ9D 1BMWA 1TQCC 2JIXB 1MCSA 5DHVA 1ZS8A 3IGUA 4PB0L 2QPDB 3K74B 2EYRA 4NNPL 3BFWA 2DQDH 1QLEB 5FHAH 5DJAB 3QG7L 4IRJD 35C8L 3IMRA 4MVBD 2QVFB 2VIRA 3B9AA 3PHOB 5E9DB 2P5WB 2NW2A 5I1KH 3VVVA 3B83A 3QUXB 1BQSA 1NTDA 3AROA 3GHEL 1A7PL 2X42A 5FA3B 1Q94A 1TQCB 5K9OA 4CVZB 3LY6A 3QZWB 4WTQA 4LCUB 4LL9A 1S7RA 3HR6A 1DN0B 2Y7QA 2MSPA 3GLEA 5IFHH 4Y4HD 3HE7A 3I3DA 4BXSV 3S8FB 3MA7A 4H0LC 2DI7A 4WHCA 4MA3B 3O45A 3QP3A 3QHFH 3CXDL 3V6OE 3F7PC 1JHLL 2J1YA 3U7WH 2ADIA 3BKJL 1LK3L 4HIIA 1G9ML 3VD2A 4Z7VB 1CF8L 3RILA 5K9QI 1OAQL 2AKRA 2N01B 2WK2A 3R06A 2AF2A 4QPEA 3JVGA 4B0MB 1DFBL 5EU6A 4LBEB 5C8JA 3G9AB 4IU2A 2HSIA 5IWLA 1MHEA 3GO1L 4WGVB 3MREA 2GABA 1T0NA 3CQQA 1IKNA 3AREC 4LHUA 3X1BA 4FFTA 4KNQA 2FL5B 2AV7A 1SQ2N 2OKMA 2BOLA 2VUOA 4MFHA 5F8RC 5J56B 4ZUSB 3PXHA 1GRWA 4K9JA 4OM1H 3NIFF 5DT1L 4QHLB 3L3KA 3EJPA 4Y19B 2Q3AA 3VXRD 1KCVL 2Y6TE 4RZCA 4B9YA 3I6GA 3Q5TA 4NN5C 1FZJA 3TURA 1RUQL 4ODUB 4JY5H 3WUWA 2AJYL 4YXHL 5HPMA 1SOKA 4TKWA 4KHTL 1DJHA 1TKWB 1DDHB 2DM3A 2QPUA 1XCXA 2QHLA 1TZHB 3K6DA 4OZ4A 2EINB 1JXJA 1HQRB 1SMDA 2P46B 4PWKA 4F7KA 5KSBF 1XF5A 4RMTA 3KVDD 4HKXB 2VB5A 4BH8A 2XWZA 4UINH 1UOKA 4NN5B 5D7JC 3WFCH 2I9LA 5TE4H 5CJOH 4QR7A 1IAOA 3ULUL 4HIEB 3QYMA 1RFDH 2VXQH 2VC2B 4FJYA 1T4WA 3CN1A 2Y25A 3F8UB 2KLSA 2ZT9C 4WAFA 1OB1B 3GLDA 2VMDA 2D03L 4XBGB 1G0DA 5F6HJ 1KXTA 4AL8L 1E6JL 1J9RA 3D4YA 4NAMA 2CGRL 2W9EH 3ARFA 5DLML 3VUAA 2XZCL 3D09A 1MCWM 3FDWA 2DL2A 5HGHB 2WO4A 4ACPA 2AJUL 3JWOL 5AOLA 4ZW5A 2FX9H 2DD8H 3U0TB 2OSYA 3X12B 3BIKB 1C7SA 2PWFA 4JN2B 3STLB 1IGTB 4JBSA 5ILTL 3S88H 3BH8B 5GISL 4FQJL 3IPBA 4KUZL 4UMSA 4NQDD 1J11A 2ZUXA 3O3DB 4FQXA 2HPTA 3RWJA 5JA8B 1EQWA 4Z5RB 3S35X 4AQ8A 2ZKMX 3BZ4B 2DLFH 2EXYC 3D4GA 3QZPA 1SMAA 1UJ3A 2J7LA 4B97A 1RUAH 5TF1H 4A7SA 3WHE0 1R3IL 3CDYA 4U4BA 5CEYA 4AVJA 1FFTB 2JXMA 1U6AH 2WOBA 2E76C 2P49B 3CLFL 4JM4H 4XP6L 4LVEA 3TO2A 4OJEH 3MXWH 4YX2H 2VDOH 3QISA 2XJLA 2EDBA 4CSZA 1QABA 4OCWH 3U1SL 1OK0A 4XCYB 2FB4L 2BSSB 3NPSC 5CILL 1C8QA 2XT1B 3ZN6A 4NGHL 1FN4A 5T1DH 5GRWA 2B7DT 3V6FA 2OBGA 1J87A 3H9SA 3R19A 4A2HA 5D5ME 3H2QA 1X9RA 4HJUA 5F7UA 4XNXL 4B3VA 3MKGA 4X4ZA 1CGVA 4ZOAA 3VFMB 3UL4A 3QPXL 1DR9A 2ARJA 5DD0L 4XO5A 1CJYA 2YA0A 5E9NA 4M00A 1A65A 3NPSB 5ECJE 4WCYH 1UD4A 1TFPA 1QO3B 2APSA 2CHDA 4AGOA 1T4KA 3F7VB 1UG9A 3D6GA 1KTLB 2BFVL 1A47A 3MRLA 5J13C 4ZG1A 1MLCB 3QG6A 2EYSA 4LEBA 4H0HB 1MI5D 3IT8D 4PU2A 1KN4L 1UKSA 3K46A 1U41A 3Q6FA 2UYLA 5MENB 4JPKH 1DJYA 1JPFB 1N6VA 2HP4A 4N2IA 4LFHG 1IQWL 3RVWD 4HPYH 4IMKC 5I18H 1U3YA 1RK1B 1JWMA 4WKZA 3MV8B 3LIUA 1QUNB 2B0SH 1NCWH 4LDEB 2VR9A 2ZNWA 3F01A 2FWSA 1KOAA 1YNKH 2DYSB 2EDTA 4JRXE 1XR8A 5J13B 1XFPA 1GGCH 4NN6C 4R4FL 2K1MA 1N3NA 1HZLA 3OKMB 2KDGA 4ZQTA 2XUWA 4OJCA 2PYFB 3LZRA 3BT2L 12E8L 3EJYD 2VXTL 2WTOA 3IF1B 2CKBB 2ITDA 1EV2E 2ATPB 4BZ1H 5LVEA 1HI6B 2DRUA 5FWQA 5IKCA 1TVHB 4V33A 4NP9A 1JUFB 2WO3B 5DQJA 3SCMD 1FL3A 3CMOL 3T6WA 4G9DB 4AZUA 1G7LB 2OCFD 3BRGC 3UTTA 2AXGB 4NN6B 3ULSB 3DO7A 2IADB 1PLGL 2IOIA 1XF2A 5I19L 3WOVA 4ZO8A 2I27N 1CT8B 2QVTA 2J5LC 5LLIC 3TNMA 2AEPH 2B4CL 4EN3D 5FGBA 2ZWYA 5ALBH 1UYWH 5DFTA 4M62H 2A0LC 2Q87A 2ZF8A 4J4PC 2MH4A 3WUWG 3ARTA 1HL8A 5A2BA 5AB9A 2BXYA 1XR9A 4G8FA 3DX7B 1INEL 3AGVA 1OANA 4O5LL 4XCFL 4JG0L 3TBSA 2GEEA 2R9HD 2XIIA 3A67L 2B9AA 2J5LB 3P02A 1IFRA 2HLFC 4HKZB 1F97A 1QPPA 4L4VD 3WNJA 1T1ZA 1RU9L 4XP1L 5BS0E 5HYQA 4QGTA 4UMGA 3QXDA 3WN5A 2ILLA 2OMWB 4OR1A 4E9RA 1TJGL 4M5SA 4Q14A 4X8GA 4PFEA 2Y5TA 5J06A 1T5XA 2DQCL 1ZMYA 4J6RH 4K3EL 4OGAD 5EBMB 4WEBH 1T2JA 3OBAA 5IOPA 7FABH 5F7KC 2A73A 4KRPD 1WQVT 4RETB 1YECL 4CL7A 4TSAH 2WVUA 3D08A 3F65A 3ULVF 4ICXA 3F3HA 1SDDB 5EFIB 1FYTA 4NHCH 3BZ5A 1P7KB 5E03A 1OTTD 4G5AA 2V9TA 1AYOA 1AGCB 1MCEA 4UM8A 2I69A 1S3KL 1TO4A 1Z9NA 4XCNB 3B5TA 3G5VA 3VCLB 1G6RH 2EXWC 3BZDA 4Z7NE 3V7AG 1BPVA 4KI5C 1EZVX 4GEIA 4XPGH 3JTTA 1NFDB 1V3JA 4NQEA 2DYPA 4IGBD 4HS3B 4DCQB 5ICYB 2DTML 3LEVL 1F58H 2L0DA 1W0YT 4U1NB 1MJ7H 5GS0C 3UO1H 3DLQR 4O02A 1KGWA 3VB9A 3QJHB 3CZUB 1WO2A 1G1OA 1H3VA 3BAEH 3DVFA 4GQZA 4Q8BA 1JWUA 5C09D 3UYRH 5BQ7B 3HOGA 4GQ9L 4MZRA 5KG9A 2X4RB 1ZPLA 4Y2OA 3HR5B 4WHTB 4I1PA 2XWBB 2BC4A 2GSGB 1FDLH 3NK4A 2Y0SA 1ADWA 3MJ7A 1D9KD 4HK3N 1E9PA 3OZ9L 5CP7A 3U6XA 4FZ8L 1HS6A 5E6YA 4ZX6A 1NCDL 1QG3A 3T0WA 3NA4A 1JCVA 4EUPH 3SDDC 2CRMA 2CDEB 2FRGP 2XQYK 4LF3A 4XXDB 1B0RB 3BT0A 3ZYZA 4IJTA 2WXGA 3NZHH 4KTDL 2ENYA 3IJHA 3VG0L 4EOWL 5FWRA 3SEPA 4ZMYA 1S9VA 1KJVB 1BOGB 4U1LA 4JUSA 3KPRE 5FYKH 5I8OH 3ZU8A 2LABA 4PJFB 1ZGLA 1A6VH 3IDXH 3GXPA 4DWHA 1IBZA 4X9BA 5D7LD 2ZKHH 1F6AA 1G4RA 3SDDB 1IBBA 1X5KA 3WFBH 1JZFA 1X7QB 1I3RA 5EOTA 2AXHA 4NLAA 3L3IA 1OALA 3OAYH 1BZ8A 3SQBA 2BP0B 4UQ9A 1X5MA 4HCIA 4PH8A 3QDHA 5KW9H 1KXVC 4XZ4A 4PQXA 3MV9B 4MZ2A 4N9GA 4JG5A 1SPDA 2GJ6B 5C0ND 1P2CB 1KCSL 2DAVA 2O5XH 4YNYB 4C4UA 3S3CB 1G9MC 1USZA 3FH7A 3U9WA 1U8OB 3RHWK 3FXIC 3HZVB 2Z8WC 4KPHH 1J8HD 1DQJA 3FS9A 1Q72L 3MRIB 1XF4A 4XPBL 1NC2B 1ZCRA 3DTXB 2R7EA 2CDGB 1JPSH 2QELA 3P2BA 3RFRA 4PGDA 3BH9A 1MWAA 3TP4A 1H3PH 5CZKA 5F1OB 3QCTH 4D9LL 4ZFQA 4PRNA 3LN5A 4PRHD 4Y9FA 5IB1B 2MCG1 5JIMA 1IC1A 5AOMA 4GBXC 1UZ6E 5C0CA 1MY7A 3KGUA 2DQMA 5F3HA 3ARDD 4ALAH 2WMPB 2BNQA 2NNAB 4PWGA 1GZPA 1EHAA 1ZHLB 2FJGB 5KBKA 5DUBB 1IFGA 4KQ3H 1WF5A 3V4PL 3WJJC 4EMZA 5ID1B 2Z4TA 2NDGA 3R7RA 1QEWA 2QSCH 5E6IC 2O1AA 3IVKB 4HWNA 5KSAA 4A6YL 4X7DC 5IT2H 1QKZL 4N5ED 1A1MA 4JPVL 1P4BL 2FZ3A 4ENZA 3AU1B 4ZUWB 2NX5D 3EBIA 1PG7H 1D5MA 4PLNC 4P4RB 3HBPA 1BJ8A 1HJCA 3N0PB 1AKJA 4AL8C 3LMJL 3P30L 3DSFH 1RLWA 4L18A 3NTCL 5E6IB 4CU7A 3PHQA 3TJHD 1ASQA 2OTPA 1DQLL 3GMPA 4QXGL 2FNBA 2Q5BA 3VXQA 4RFOL 5KUKA 3PXJA 5F44A 1KJ2A 1JV2B 3FU6A 5I17B 4C56D 3C9NA 2MJWA 3LIZA 4I9XA 3WAKA 2M26A 3DIFB 3NEOA 1OCZB 3UBXI 3IXAB 4JVPA 5EORL 1C5CH 3QS2A 1TT6A 3FTWA 5EO0B 1EHLL 1HSAB 2JK5B 2Q86A 3L1OH 1E6OH 5J6GA 1DE4A 4KAQH 2YJLA 5EUKB 4UOZA 2N0KA 3Q6GH 2BMKB 5IBTH 3GXTA 1JN6A 4P8QA 2XKNA 2Y72A 3GSWB 3UJTL 2F9BT 4MD4A 4KJPD 4JFHD 2IJ0C 4D8PA 4OB5H 3SBRA 2ESVB 4FNQA 2DEXX 5DHVH 1R47A 2F58L 1QRNA 2JNZA 1PMYA 4GG8A 3TFKC 3HG2A 3LNFA 4ODWB 5DSCA 2X89D 3BI9X 3L81A 4YHMH 3O0RH 3CN2A 5F7DA 3IDUA 4XPHH 4HC1L 3HN5A 1WZMA 3ZKMC 1OGTB 4JFEE 3BE1L 1TJHL 2PXYC 3KXFE 1P5UA 4FFWC 4TLTA 5AUMB 5ISZD 4ODSH 2E9WA 3UEQA 5A6MA 2MFNA 1T21A 1RULH 5DURB 3SPHA 2XHNA 5GIRA 2C9UA 2WCPA 2P8MB 4MNQE 5HYJA 3EYVA 4HUVB 2MQ0A 4R7NA 4QRRD 2NUTB 1BD2B 4LCIH 5FYJH 2PXYB 4N24A 2AQTA 3ZSTA 2YXMA 3CFDA 3RPIB 4TVPD 1MCOL 1DEEA 3QDGA 3K8KA 5JPMC 2A83A 2M83A 4Y5VA 3ABKB 3MNWA 4PJBA 2DY2A 3RDTB 1OGAD 5JHLA 1NCBH 3QO1B 1WBXB 1X5YA 3F12A 1YEWA 5LBSL 3O6ML 4XI5C 1AGDB 1VZIA 3PREA 5JOEA 1Z0NA 1GGTA 1EX0A 2NNXA 3LQZB 3MRGB 4JFOA 1CCZA 4TYUA 5DMGC 3U83A 4DKEL 2PW1A 3HG0A 3X13A 4PJIE 3N6YA 3WNMA 3DX8B 4PVBA 4PRIA 3O4LD 5JPMB 1CE6A 4IEFA 2F54A 3ME0A 3RVUD 3WEXB 1XDTT 3V5KB 1IM3A 5TK2A 4JFZL 4OJDH 5K5YA 3QH3B 1A3QA 2RBLA 4P4KA 4B96A 4N6RA 1ML0A 1A4KB 3V0DA 2B4CC 3VFOB 5FB8B 1IIKA 5DZNA 1NPJA 3VD3A 1RIVL 2YMXL 4GO8A 2CO1A 5L2JA 4KDTA 2DQJH 4QRFA 4R26L 3S98A 4BH7B 1XMEB 3IKCB 5IB4A 1JGLL 5DRZB 1NGXA 2X70A 3MRJA 4NZUL 4CMHC 1EMTL 2W07B 1Z5HA 4OSUL 1NCGA 2UY7B 4LXFA 4DGUA 2XSKA 5JMRA 2V5RA 3FTUA 4XP5L 2NY4D 2RQ8A 4TVUA 3KPSA 2E27L 2ZUSA 4LLYB 1R34A 5DS8A 3CFMA 3X14B 4YGVB 1ET7A 3VFNA 1BVNP 2ID5A 3QDAA 3N50A 3RX7A 5T3XE 3VNYA 2A9DA 3UG4A 5FFOA 5C0FB 1KGIA 5LHDA 7TAAA 1O6VA 2X4QB 4NSKA 4YL9A 3K2UH 4KNTA 1ZT4B 4MDIA 4NKDA 4W9EC 3VTAA 3QUKB 4HDIA 5AVWB 1JZIA 2Z91B 1MDAA 4OIIL 1BGXH 1NC4A 2IFFH 3NSXA 4WV1A 3RB5A 4CNIA 2WXOA 3S35H 4TLSA 2PN5A 4X0KA 4J3OH 5C0BD 1TYEB 1LO3L 4YO0A 4YHPB 3K2KA 1ZT1B 3ARBA 2EH7L 4KC3B 4QJ5B 3GNML 4FI7A 4WQOA 4WDIB 5ESVA 5JQIB 3MBXL 1UA6L 4TQPA 4YHIA 2CHXA 4IHOA 4ZUVB 3GBML 1SFDA 3QRGL 2JSFA 2W59A 3HN3A 4JPSA 4JO4H 3MSPA 3WGVB 3OR6A 5GSRA 5T3ZL 4UTAA 3FMGH 4JRLA 5DD5L 4PREA 1KUMA 4JHAL 1CYWA 1LWHA 3OKLA 1E5CA 2WY3B 2LQRA 2VDRH 5AL8A 5SWSE 2PTUA 2WAQA 1EO8H 4JRYA 1CFVL 4DPCX 2OM5A 5AG8A 2VXSH 1LO4H 4ELMF 2Y24A 3POCA 4JPQA 4P2QA 1G7PB 3MRBB 3NQKA 4CUCA 1RI8A 4NO3A 5L2KB 2J6EL 3IFNH 4K8RL 5BV7L 5JOPD 3ROLB 4PJ5A 1QSFB 1N5AB 3DHUA 2ICES 4JFXB 1Z9LA 2GBAA 3WDJA 3TV3L 2YD6A 5IVNA 5BQDA 2VLRA 1R24A 3CX5J 1RZ8A 1MCDA 2NR6D 4AW4A 2WBJA 3QXUA 4X6CB 3AVEA 2HJFA 1FZOB 1ZV5A 4MAYD 3EHBD 2VO8A 5I6LA 5IVZA 2XQYA 4UNVA 2WM0A 4UZGA 3W0WA 3BAYA 2KLTA 3SDCC 2Q7NA 1BVOA 4X2UA 1QA9B 4A2GA 5BW7C 4WTZA 1AD0B 1DJGA 3FTGB 1AI1H 1AJ7H 3K6FA 5FYLD 4V11A 2OXHB 3TBWA 4Y4KD 4PGEA 2XXMB 4M1DH 4M93C 4XPFL 2R4RH 1FFPA 2V7HA 1OKEA 1YY9C 1PQZB 4ZW6A 1A5FL 3SDCB 1L3NA