4A7VA

Structure of human i113t sod1 mutant complexed with dopamine in the p21 space group
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Ligand Binding and Aggregation of Pathogenic Sod1.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7vA00
4L05A 3S0PA 2E46A 1DSWA 2R27A 3QQDA 3ECVA 4A7GF 3LTVA 1B4LA 3KBEA 3MNDA 1QUPA 4N3TA 2C9VA 1S4IA 4A7UA 3HOGA 3KH3A 3K91A 1E9OB 2JLPA 4BD4A 3PU7A 2Z7ZA 1IBHA 3GZPA 3QQDB 3KH4A 1IBFA 1SPDA 3GQFA 1XTMA 1RK7A 1EJ8A 1PU0A 1JK9A 1E9OA 3F7KA 1SRDA 2C9UA 1SXZA 1N18A 1E9PB 4A7GA 5KBLA 2AQQA 4MCMA 3F7LA 4OJAA 3GTTA 3CQPA 3GZQA 4A7QA 3L9EA 2AEOA 4OH2A 3L9YA 2GBVA 1E9PA 2APSA 1E9QA 1UXLA 2XJKA 1OAJA 1JK9B 2GBUA 2XJLA 2K4WA 4BCZA 3MKGA 4A7SA 1YAZA 2AQSA 1F1DA 2ZKWA 2ZKYA 1XSOA 1CB4A 1IBDA 4N3UA 1OALA 2WWNA 2C9SA 1HL4A 1EQWA 1DO5A 1Z9PA 2VR8A 2Z7UA 1E9QB 1BA9A 1YAIA 3HFFA 2ZOWA 3ECUA 4U4IA 1SDAB 3KBFA 2SODB 1COBA 3KM1A 1SXCA 1OEZW 2GBTA 2WYTA 1KMGA 2Z7YA 3SODB 4FF9A 1XTLA 2NNXA 1TO4A 1P1VA 1SOSA 3GTVA 2VR6A 1SXAA 3H2PA 4BCYA 1SXSA 2Q2LA 2WZ5A 2ZKXA 2Z7WA 3KM2A 2WKOA 3GZOA 1F1GA 1UXMA 2E47A 1MFMA 3RE0A 3HW7A 4A7VA 3T5WA 1U3NA 2WKOF 3CE1A 1BZOA 1JCVA 3ECWA 2WWOA 1Z9NA 2AQRA 3H2QA 2VR7A 5KBKA 1CBJA 5CU9A 1ESOA 1PZSA 2V0AA 2WZ6A 2AQTA 1Q0EA 1IB5A 1SXBA 1TO5A 2AF2A 1SXNA 2LU5A 1OZUA 1SDYA 2JCWA 1N19A 1IBBA 1L3NA 1F1AA 1HL5A 1YSOA 2WYZA 4A7TA 2AQNA 3CQQA 1FUNA 1B4TA 4B3EA 1OZTG 2WZ0A 1F18A 4MCNA 1AZVA 2AQPA 1PTZA 5KBMA
chains in the Genus database with same CATH superfamily
1BVZA 1KBBA 1FVCB 3I02A 4O00A 5EO1B 1J1PH 3Q2CA 4MMZB 3I6LE 1Q0XH 3QHZH 4P4RB 1T0OA 2VB5A 4Y19E 2QJDA 3Q0HA 3D0VB 4ZPVA 2JKTM 4JY4B 5ID1A 5LHDA 2R51A 4JDTL 4XMLL 2LAAA 4LP5A 1ZGLA 2Z31D 3MJ7B 5IW6A 3T6WA 4WI8A 5SX5H 3MUZ1 5EBMA 4DGVH 5I8OL 1J12A 1TSRA 3OMAB 5D1QB 2WCPA 1UG9A 3BAIA 2QKSA 4MB1A 4B5ZA 4RRPG 4Z7UB 3RFZB 3DI3B 2P5WB 4HCFA 3QZMA 4QRRB 1SY6A 2BC4B 4KK5C 3ZR6A 4B5EA 3NP4A 4L8DA 2EECA 4PV8A 2YXFA 3V7AE 4CMMA 4HH8A 4IOSD 4LU5L 3QFGA 4RDQG 3FO2A 4YSOA 4ZQKA 3WS6C 4JKWA 4E42A 1MOEA 3STZB 4TUKH 2KHAA 2ADIA 4ZOBA 4OJFH 4PEEA 2EDKA 1MW0A 2UWEA 1SDDA 4ZOAA 5IFHH 3FK3A 4M8QA 5T3XH 5F89A 4WENB 3SE8H 1PY0A 2AV7B 4OLYL 4ELKA 5FO7A 2RJMA 3HG1E 1NMBH 3VDCA 4MSWB 2VN7A 4AQEA 4HUXB 5KVEE 3HE6D 4X80L 3UZEA 4ODSL 4UWQB 3FN0L 1JF1B 4NBXB 4HFUL 4U1HA 4X6EA 2VXUH 3F6LA 3KBFA 2SEBB 3BZ4A 3LQZB 1BVNP 1XZ0A 3C5JA 5TF0A 1ZEAH 5AZ2L 1NCDH 5GS1C 3FQ4A 4FQCH 2QTEA 1WCBA 1TQBC 3BT2L 4UM8B 5AVZB 4IEFA 5KVDH 4CUCA 2C8NA 4M43H 1JPFB 5D2NE 1C8PA 1QLEB 3G6DH 3QO1A 3UAFA 1QO3A 3H4HA 2BZDA 1Q38A 4Y1AD 2X2IA 2VDQB 3SOBH 3U7WL 2DD8L 1FNEB 3QR2A 4AYGA 3BZEB 3CHRA 4OM0H 2R0ZL 1VKXA 1UA3A 1XH3A 2EXWD 3UTOA 2EADA 3MX0A 4YHPB 2IFGA 3UTZA 2CXGA 5IMLA 1IIIA 1PYWA 1VZIA 4OFYD 1RPQA 2IQ9L 2V2WB 3D3VD 1KCKA 1BF2A 4MASA 5I0ZA 5BJTB 3AQYA 3W39B 3RWHA 2IPKA 3QIUB 3VX0A 4JE0A 4XWGL 3K6DA 1YQVH 3MLSH 3G6JE 1PAMA 4KKRA 3U9PH 2VLRB 4LPYA 1LTXA 3F01A 4N2IA 3VXUB 2DI8A 3CFQA 2Y1VA 2FB4L 4JG1H 5HVFB 4PCKA 5IW3A 3KYNB 3GI8L 4DFHA 5BPPA 2YO3A 3T04D 3BFOA 2Z8WC 1BD2B 5T3ZD 5ETUB 4ZUUA 2MNJB 4N9GA 2D7OA 2BY2A 3TBTA 1X4YA 3CXDL 4IDJH 3X14B 1RXLA 2DQIL 1KN4L 4QXTA 4WHTA 1HU8A 1ZWIB 3FB7B 5C0AD 4CBZA 5HP5A 1ICTA 2AFNA 3TS8A 4PN6A 4LCYB 4BFKA 1HKLH 4ZUSB 4HCRL 4MCZB 3WFDH 3BKCL 2A9ML 2NDGA 2ZCKL 1PU0A 1JI1A 3ZTJH 2QGEA 4QRUB 4NFCA 2R56H 3C5XA 3D6GA 3BJ91 5B8CA 3TA3C 3K46A 1CZ8H 3E8UH 3SGKA 4FQIH 2GJ6B 3OLEA 2GTWA 1UADC 2FBRA 3NQIA 5C6PB 3UX9B 5KVFH 5DQJB 5LXVA 1GW6A 4L9LB 4N6RA 5L88H 2IG2L 1CQYA 2ICWB 5DDHA 3CDFA 1HINH 1QR1A 3KHOA 2F2HA 1GOFA 2ITFA 2DL2A 5GZND 1RZ7H 2P5EE 4QKXB 4KDTA 3W5MA 3WFEH 1PZUB 4AOFA 2C9SA 1T0MA 1XCQB 1FL3A 4OR1A 1Z9PA 1HHIB 3K0YA 3FOLA 4ES9A 4YDKH 3LKQA 1O6SB 5EOCJ 3F12B 1AI1L 1WCQA 5I5RA 4MMXC 3CSYB 5FO2A 2E5EA 4GFTB 5D7SL 4HBCH 3VFTA 1AKJD 1J0ZA 4TNFA 3QEQE 1OD7A 4HKJB 1Q94B 4P5TC 1HE8A 4F58L 4PI0A 1OSZA 1TVBB 2MTAA 3ATBA 3IJHB 1K8DB 3QCVH 5CLWA 1CGVA 1BOGA 4IRSB 4IJ3B 4PBXA 4LCUB 3ELQA 2OBGA 4G1EA 5E8OB 4PCYA 1IEAB 1U58B 4B27A 2IH3B 2OMZB 4GKNA 5HVHC 2W9LA 1MJJA 4ZRGA 4OZFH 2NZ9D 1F6AA 4IBYA 1PW3A 4IU2B 1IB5A 1NDMB 5I19L 1FI8C 4ZMXA 1XB8A 5C07E 2HLAA 2DTML 3TEUA 2R0KL 2P8PA 4NI3A 5C92A 2YQGA 1HL5A 1LO0L 2UXGA 4UOZA 3L6FB 4P99A 3UTPD 3A6BH 4U6TA 5EDXA 1VFMA 1X5JA 5JOPE 2NY4C 3GJEB 2H2SD 4MNQD 5D7KD 3I9PA 4N2OA 5EIIA 4APQB 4LCWE 2HG5A 4X5XA 4O02A 3CFTA 4JM2A 4M6OL 1A7PH 4WW2C 1R5VA 2NY5H 2NUPA 3ESMA 3QEHB 1UTDA 3ML8A 4L37A 5HHQA 3ZL4L 2VLJD 3R0NA 4DPAX 4F8TA 3QORD 4BFEA 4YK4B 1G9NL 1HZLA 3NACL 3SGDH 3W11C 4Z0XB 3RWGB 2H2PD 2EDRA 3O2WL 3DYOA 1UENA 1KPUB 1JZ7A 3F7KA 3SN6N 1BQHB 4NBZB 1GYCA 2H1PL 5F93C 2KI6A 4NZUH 1G7QB 1GY1A 3O3BB 3UYPA 3FONB 1C5CH 1H0DA 4AIEA 4XH2B 4G9DB 1DN0B 2R1YB 1ZLDA 3X3FL 1EFXD 4UQIM 5B1CA 4TN9A 3L5XH 4I4WA 1KWKA 1DANU 5D6DA 1ZHBA 3DPDA 2O6PA 4Y5YC 1R34A 3LPOA 4AQ1A 3MLUH 3BDYH 4M00A 1L7IL 5ICXB 3LX9A 1QBAA 4XN5A 2JB6B 3UBXA 2J8UF 5CFHA 4UOW0 3MLVL 3N43F 1EDQA 3KDPB 2ZT9C 5DJYA 1C08A 3QPXH 2WB7A 5LCVL 4HCGA 4G6KH 1GS6X 3LD8B 3GIVB 5D7HA 5D1ZD 4C54A 1SY6H 1DBAH 3WI9A 3ULVE 1K8IA 1J7VR 1QI5A 1PX4A 2WLYA 1D3CA 1EZSA 1P4IL 3T09A 4MA7L 5EUKA 3QWQB 2G4EA 2E7LC 1UUSA 1O75A 4WWOA 5LLIC 2BMKA 1IU1A 4YHML 1XGQA 1E5YA 1XF5A 2LT9A 3U2SB 3BO8B 5E2UH 3L8QA 3L08A 3RI5F 1Y6MR 3CSFA 4N5UA 3RDTA 2NNAA 4KJPC 5H2BA 2Y5QA 2VDLB 1Q0EA 1R3IH 5ALCL 1OGAB 3BKMH 3RWJA 1I7RB 5K59E 4QOKA 4R4BB 4U1LA 5EA0H 4P4KC 1ZT7A 4PRHE 2NQ3A 4MXQC 2XPZA 3K8KA 4DP8X 1A5FL 2AV1A 4L2YA 1ODAA 4X6BA 5T1LB 4E41B 4BFNA 1VIWA 1FV1A 3HI6H 3SDXB 1T21B 1HEZA 2H3NB 5ESQA 1HH9A 2VM9A 1PVHA 2GIXA 3QQDA 4RMTA 1WA1X 4KO5A 2JIXD 5BS0A 5GGUB 3ILPB 4DKFL 3V0FA 1AHKA 4MQ7B 4N26A 3QJUB 3H0TB 4M62L 5L2JA 4PJHA 3TT1H 4H8UA 3D4CA 2JLPA 4KXZI 3ATFA 2EDQA 1IAIM 2CO2A 4JHWH 4NN7B 5AAMA 1MXGA 4U2ZA 3I02B 1J88A 2F1BA 4NZFA 2FJFB 3H3KA 2IANE 4YGVA 3SE9L 5L6YL 2HA1A 4FJZA 4PJFF 1QX1A 4F15C 4DP5X 1SRDA 4UILL 4YVNA 1BBJB 4NCC2 3RA7H 2DICA 2CRIA 2YZ1A 5C3IA 5KBLA 4BZ1A 2JV6A 4MVBC 2AQQA 2F53A 1ZGLB 4FQLH 3LMJL 4Z7VB 4W93A 3PLYA 2FJHA 1FNAA 3KEHA 3NZHL 4MMZC 3T6VA 4Z3HA 2VM3A 4S1QH 3LVTA 3UC0L 1IBGH 4NLAA 4GIAA 3A67L 3JWOH 3WJJC 2FLMA 1MRCL 1GKEA 4K7PL 3ZYOA 3L3DB 3J07A 1IAOA 3CXHK 1ZIAA 2WWKT 4PMEA 3DDFA 5JIPA 1U91A 1U4EA 4LQ1A 5ICYB 1X9UA 3IDUA 4PTTA 4AGLA 3H53A 4E42B 5C8JA 3VVWA 2HRHA 3RFZC 3QNYB 2W60A 3AREC 5CJQL 3ATEA 2EE0A 4NI6A 1SDDB 2R29H 1PD0A 3AS1A 1XBRA 1XGUB 3LPGA 4OLZH 4RGNB 4G8EA 4MNGE 5EPMA 3PL6A 1OCCB 2HLFC 4NN6B 1KJVB 5CGYD 3T0XA 1ZVSB 7FABL 1HYSD 1MCWW 4AQEB 3BP7A 1OM3H 1MNUL 2MPVA 1WS7A 2WYIA 1AE6H 3FQRA 1I1AD 1MVYA 3C8KA 4U1HB 4WW1B 3RX7A 3SKJL 4AQOA 1UXMA 2YS4A 3LS5H 3PJSA 2Z9TA 3SPIA 1BIHA 1AAJA 2YPLB 4LKXA 4ZODA 3BZ4B 3DC0A 3KE0A 5IHZA 3MGOB 5MP6H 1WFNA 3LXAA 3OR7A 5DWPA 1HHJA 1LHZA 4AMWA 4NQSA 1GC1H 2EE9A 3MGTA 1NSNH 4TQEH 5C0NC 2Y4SA 3V6OE 1SEBA 3L4CA 1S7UA 2V0AA 3O3EB 5C2UB 1QO3B 1DFBL 4LBEA 3DOSB 2LAGB 2ESVD 1XR8A 1G0YR 4FYSA 2E27H 2IADB 2WSDA 1VKXB 1XH3B 1QUNB 4L5FL 2KC0A 3GBMH 3MX0B 3UTZB 4B9FA 5IMLB 3QI9B 3TNMA 1PYWB 3MMEB 1C5BH 3BI9X 5MENE 1F02I 4UQ3A 3QISA 2PKDA 5C0CB 1FFTB 4BHUI 3HFMH 2XWEA 1CD1B 4Y9EA 2C9XA 3FQXB 3QUKB 1IM9D 4S1SH 4NWUL 4DOHE 1MCSA 3Q43A 3D0LB 3CAFA 3SE3C 3MA9L 1JNLL 1K9TA 3ABGA 3AWGA 4PJBA 1SYVA 2IALA 2XN1A 3QDAA 4FQ2H 4L3FA 1E5ZA 1FLRH 4H5SB 3QIUC 4BKTC 3F83A 4PRID 4IRJD 4K2UL 4N9GB 2KZKA 5KJ7E 1CDJA 5IQ7L 3NFSH 5GQBA 1AD9A 1CGSL 3KZ8A 5E6YA 1TQTA 2J2ZB 2XTJB 4WHTB 5I8KH 2JKLA 2ZYHA 2FHCA 3OJDB 4PFEA 5DUML 4GAGL 1W0VA 3UZVA 4Y4HD 4KI5C 4L4TE 5AW7B 4GG6A 1NFIB 3V5HA 2EXTA 2GUOA 4WI3A 4E5XG 2WBJB 1IGCL 2X1XR 1UC6A 3HMWL 4RMBA 1EEZA 3QHTC 5I24A 1F4XL 3HUJE 4M3KB 2ICEC 5B8CB 5J8OA 3PY9A 1JXFA 4PVMA 5F9OL 1HXMB 3S5YA 2X40A 3H2WA 3CWGA 4YE4H 1BFSA 4N6RB 1E8WA 4UU9A 5IB1A 1JV2A 1TTRA 1MNNA 1QWHA 1XDTT 2GG1A 2OL3L 4JANA 4N0YH 1LO4H 1PEZA 2PPFA 5C08B 4ADIA 1KGWA 4PRAA 4K8RC 4FD0A 1JGDA 3OB8A 1UWEL 1E4HA 3D2UA 1FL3B 1P0SE 2C3VA 1AZZC 2GABA 1P6AB 4KVCH 2LVCA 2QFPA 4Y7OC 4YHKL 3V0VB 1CDCA 4H4NA 3LKQB 3SKNA 3W56A 5E56A 4XPBH 4PJ9D 4PB0L 2Y07H 3VMPA 5EZLB 5FGBA 1XGRA 4DKDC 2KL6A 4BH7B 2G60L 2KT6A 1E6JL 4FG2A 2Z91A 4PRBA 3T65A 2X2YA 3GINA 3T3PB 3TTSA 1NAKH 1XAKA 3D4GA 2QPDB 2XVGA 3KPMB 4JX0A 2VDPB 4RFEB 4TVSa 3Q13A 5AG8A 2X1QA 1F3DJ 3LIUA 3HRPA 4NCC1 5DO2C 2F58H 1PZAA 1FL5B 3PF2A 4XAWH 1EV2E 4TNEA 4NKIL 1QQDA 1WZLA 4AC2A 1KT2B 4GKNB 4TVPE 3K1DA 3I3EA 4WI6A 5DHYA 5F7EH 2GY5A 5AW2B 5FB8A 2ORBH 3IKCA 4IJ3C 4IRSC 5KBMA 2YRLA 1O9WA 3KG5A 5BQ7A 1HJBC 3I6LD 2FNWA 3FCUB 4YNYA 4GRWH 2PMZA 4RIRA 3M45A 3ATAA 4OQ1A 2WLHA 1KN2L 4I7ZC 1DHKA 1ANUA 1WPCA 3ISWA 4H20H 4LMQE 3H9YA 2CD0A 3MREB 2LU7A 3MSPA 5JPMA 1MH5A 3BVVA 4P5KB 4PJFA 4AK1A 5HSFA 1N8OE 1NUDA 1F45A 1U2HA 4O02B 4N9OB 4R97B 2H45A 3T2NL 4P0DA 2W9DL 5CINL 3DMMB 2NUPB 1YN7A 3I50L 1AHWA 4S0SD 3KNBB 2WN2A 5I82A 2UXTA 4JL2A 4L37B 4LLDA 5HD8C 3DYPA 3Q7JA 3GTTA 5ANMA 5CO1A 4APQC 3CFNA 2MCPL 3WELA 1AGFB 5HDWA 1FNGB 1E4XL 2XVBA 1TJHL 4KJQD 5I1GL 2C4FU 1LM8V 1W15A 3OJ2C 1OAJA 5D96B 1JZ8A 1QSEE 2LV4A 1MAML 2PYEA 1CB4A 1O0VA 3DIFA 4XMKH 2XN9B 3ESNA 3BIKA 5CEYB 2GPZA 2AJXL 2AKRB 2YEZB 3M6DA 5LGHL 1IFGA 1Y18A 4M5TA 1ZLSL 4B53A 1ZT4A 1UM5H 5CU5A 3KJ4B 2OMBA 1BQLH 1SDAB 5E6SB 3JXAA 3NN8A 4GEIA 4TSBL 4ZUWB 1G7IB 3EYOB 1XF4A 5T5FL 4AQ1B 1ZE3C 1MCIA 1KCVH 2HTKD 3WEMA 4P46D 2YKLH 1F4YL 1ASPA 3JT2A 4BZ1H 4YAQA 4XO5A 5GZOC 1JNNL 4GJTB 1C08B 2VE6A 1S5HA 3RU8H 2UY7A 4PLJC 4JRXE 4LDLB 5IIEB 5DD5H 3LVEA 3N2JA 4XCCH 1DEEB 5I1CH 3HS9A 4YDLC 3VTTA 2IXQA 3MBXL 3TWYA 5F3HB 3PQYD 2R2CA 3MJ9A 1K8IB 3UADA 2VDNB 1J10A 4ZQTA 1A7NH 5EUKB 4UI2A 3EH5B 5E8NA 2O4EA 3HCVA 2NW2A 5KVGH 4JFWA 2X4UA 5DUBB 4BFBD 4OV5B 2YQ2A 4G9FE 4QHPA 4FG0A 2XG5A 3EGDB 5I76A 4JDVA 3GGWA 4G43A 3FOMB 1J8SA 4UOJA 2NNAB 2D0FA 5A6MA 3BRFA 4KTEL 4Y5VA 1MWAA 5IEKA 5DJAB 4KZEH 4QOKB 1KCWA 1DP0A 2F54A 1IQWL 4PWIA 4U1LB 4XVUC 2V8LA 3ZKMC 3WTVA 3C6LC 1KY7A 4Q0XL 4BFIB 5JXED 1BEYL 2ZKHL 1MUJA 3SGDI 4EQ2A 3BZFB 3ULSB 1V3LA 1TLMA 4DVBA 3D87B 4PVNA 2FH6A 2GSGB 4H8QA 5I6MA 3ZKXC 2X89A 3U1SL 3KW7A 1UVQA 3QFJD 5FO8A 5A3ID 3L9BA 3QQDB 3IDJB 2YR3A 5E2TL 2AS5M 2AEPL 1S3RA 5BS0B 1YYLL 3S37X 4CC1A 5T8IA 4FI6A 1OCWL 3LEYH 3OJVC 2HH0L 1KGJA 2OA9A 1A66A 3RWIA 2JJSC 2V5MA 5L2JB 1OP4A 1CK0L 4JQXC 3W37A 1SBSH 3SDAA 2W65B 5AD0A 6PCYA 1JGUL 4JPVL 1KNOA 3ULUF 3Q5OA 4XCYB 4H2AA 3Q8EA 2EVFA 3X11B 4JFHE 3MCLH 2CH8A 2XJKA 4YGVB 4PJDF 4QIRA 3FQ2A 1VDGA 4LVNC 1GGBL 1EH9A 2D3JA 2VR5A 9PCYA 4EN3A 5GS0D 3T0DA 4EAEA 3HE7D 2HZHA 3HBZA 3W2DL 3BC9A 5IF0A 1LE5A 1HL4A 5L9DL 4GLRH 4PIBA 1RZ8B 1CICA 2FJHB 1KPRA 3QJHA 3KBHE 4JN1L 2XZCH 4JFXA 4LSPH 5B38B 2OK0H 1R24A 2X3BA 1X5KA 5KANI 3W0WA 2KH2B 1F00I 4LHUG 3SPHA 1KMGA 5F0PB 3D4ZA 4FA7B 3IMVA 4QRPD 4A37A 3TO2B 1F11A 1AY1H 3BQUA 4X4ZA 3LNDA 5D70L 4P23A 1XMEB 4I0KA 3HTLX 5I18L 3W38A 3CX5J 4OGXH 3IDYB 3F6IA 4XC3H 2EDDA 3WEBA 4CADB 2QVFB 4G8IA 4I1RA 3RB5A 2R69L 3D8MA 3L3IB 4HKBB 3ZZLA 3V5KB 5IBLD 3N85L 4PGEA 4BK4A 3IU4H 4G8EB 1P6FA 2WWOA 4F91B 1AZNA 3NT0A 4P49A 4BZYA 3QJOA 4XNZB 1AO7D 3QJSB 3ARQA 1A7RL 4RBPH 3NVQA 1ZV2A 4HG4J 3G6AB 4RWHA 3L7FB 2P44B 3M7FB 3CHQA 4NJ9H 3SGEH 1DQLL 4DIXA 2JWYA 1OAQL 5E23A 4P06A 1N64H 3BW9A 3BLBA 3OMIB 4IW4C 4NN6C 4NQCA 5JOPD 3A3YB 5IBTL 1S8DB 3CQQA 1HHJB 2V2XA 4NQSB 3VI4E 4FABH 1FE8L 3Q3GB 4XPHH 5GJTH 4QT5A 1SEBB 1P4BH 3APFA 3EJPA 1S9XA 4MAUL 4JHAL 4DK5A 3OWRA 4MGXA 4YDJA 3Q5YA 1XR8B 1DVUA 4H13C 5PCYA 3DPBA 4X4KA 1X5YA 4ZW5A 3WS3A 1UASA 5IMKA 1BSIA 2VZ3A 1UZGA 4HV8A 3HZMA 3UACA 2B8OT 4M7LT 3U0PA 1NIAA 2KZ1B 2H0EA 1G0DA 3RVUC 4M1DL 2Y6SD 4NIYE 3KLHD 5DD3L 1GCYA 1M7UA 3QI9C 4XXCC 2IALB 3RURA 1IT9H 1NCIA 1WYJA 4A04A 1NTDA 3MRMA 3TIDA 1VADA 5EUOA 1T1XB 4GQRA 4YHIA 2WUCH 4B7LA 2R8SH 3RZCD 1T66C 2CZNA 3VU2A 2HTLC 3MR9A 3BUYA 2PW2A 4PAZA 4W4OC 5ADPH 2NX5B 4JQVC 4K73A 3ZTNL 2HFTA 3D5OF 4ZW8A 4LLVA 4ZUVB 1F3RB 5E9NA 1V3MA 2DM4A 5D7LE 1OP3K 3V5HB 1OOAA 2CALA 4AEFA 4N5EC 3RILA 3EFOB 1EAJA 2XTJC 1EEZB 4UB0H 4F37K 3CZEA 3VGAB 3O3AA 1EBPA 2J8UB 5DMGC 3M86A 1TQVA 1ZANL 4HDIA 3N43B 1BEXA 3B9KA 1RUMH 3ECQA 5BXFB 3JTSB 2VJ8A 1JV2B 2WBJC 4Y0GA 5KUKA 2XPYA 3TF7C 1BVLA 3LN9A 3FTXA 2I5YH 4FNRA 3IDNB 1EEYA 1LWRA 3VI3E 5AB2A 4HIPA 2EIZB 1E50A 4NZTL 3GBEA 4KU1A 4UQ9A 1RUKL 3U4EB 5LGJA 5ILTH 3MRPA 3D2UB 4YZFE 1OTTC 4LEEA 1CBJA 2OTWA 3M8OL 3UJTH 2ZXDA 1V10A 3L3KB 2CDGA 3SKNB 2F08A 1EXUB 1BZQK 1YY9C 4FQPA 3MROB 3G5ZB 1I3GL 3QG7H 4GB9A 3L3HA 2IC2A 4CKVX 3ZTEA 3CBKB 1G9NC 1J9QA 5JW4R 2NZ1A 2Z91B 3T65B 1QD0A 2JFCA 3DX9A 4ZMWA 5JNYA 3SEPA 2IOMA 3WJMA 3O0LA 1CLZH 1TYRA 2A3TA 3KPPB 3MCYA 4L8SC 1NBVH 5KJRH 5FYKE 2A6IB 5IVZA 4FTDA 1AZUA 1IUZA 2RFXB 5AW9B 2LLGA 4QHLB 4MJ6A 4M02A 5IUSA 1A02N 1MI5E 2BWQA 5SWSB 1CGWA 3SE3A 3CFBA 3S8WA 1TU2A 4DPCX 3IFOA 2IAND 3IB4A 2KUTA 3WNKA 1N7MH 5AB0A 1IJ9A 1BMZA 2FT6A 5BZXA 3IFPA 4YNYB 3BEWB 3MO1A 4RIRB 1SF3A 3CVIH 3H8NA 2CLVA 4XVTL 4E0RA 2RALA 2OYLA 1YLBB 2Q7AA 2FJSA 1LP9A 4OF7A 9CGTA 2NXYD 4GMTL 3UYRL 1TOXA 3T3MF 3TA4D 1N5YH 1EHAA 1OF2A 4CN6A 4PJFB 4U6YA 5FWQA 2AJSL 4HD9A 4NO0A 5FIEA 1QHQA 2DDQL 3O6KH 1K4DA 1T5XA 2KDGA 2VUKA 2PTTA 1MQKH 2WAQA 1JZGA 5I8EA 4E9XA 5HTSA 2NY2D 3RGHA 1AHWB 1KEGH 2J5LB 3D0AA 1XSOA 4LLDB 2Q76A 3NFPA 5ANMB 2F5BH 4JJOA 5D2LA 1S5IL 1YMMA 2IBGA 4K5MA 3DMMC 1E3FA 2X0WA 3QXWA 3UERA 4H0GA 3OLIA 3GLDA 1BF5A 3DX8A 3N1QC 4AYMC 4JHZA 3T1WA 1L9NA 3PAVA 1YPZE 2PYEB 2F8XC 1WVZA 4BSVA 2DY2A 1RULH 5DZVA 1I7TA 1ONQB 1A6UH 1OP5H 3TBSA 3T4YA 3U4BL 3B5GA 3OKLA 5IJKC 5D96C 5I15L 1Y18B 2Y7MA 5IB5B 3T77A 4UQ2A 3MV8A 4R3SB 4OLVH 4BKSC 5BVJB 5IHHA 4UINH 2NDFA 3MCG1 2JQZA 2ZXWB 2PF6A 4N68A 1JZ4A 4AEEA 1DQMH 1H3XA 4YX2L 4NJAH 5IOKA 4LSQL 3UBXI 2QZ5A 3SJVE 2ZWYA 5I1HH 3DTUB 3O9WC 4HF5L 1T7WA 1BBDH 2GCYA 4Z76B 4YAQB 4UUJB 3EUUA 1U8NA 4TOYH 3HNTL 2EVJA 3BGFB 4HKZA 2UY7B 4AIZB 1NBYA 2FEDC 3H3PL 2VSCA 5KAQG 5HVGB 3EGSA 1J5OL 3EFDL 1RZPA 5IESH 4GY4A 2F7IA 3AITA 3FKUS 3RPKA 3QDGE 4LE8A 5GGQL 4LNVA 2AERT 4D0BB 1RIUL 3LN5B 3Q6FA 1CT8A 1XGTA 5ACLA 5DC4B 3TCTA 1HC1A 3OM3B 4RX4D 3MUUA 3VFUA 3HCVB 3V52L 2F18A 2NW2B 2RB8A 4V2CB 4BINA 2X4UB 3RPIB 3JV6A 1HNGA 3P54A 2WQWA 2E6JA 4HWBA 4BQ9A 4LOEA 5I76B 1ACZA 5FV2A 2NYYC 3GGWB 4G43B 1S2EA 2ZSVA 2BVQA 3LKPA 4QGTA 4NGHH 1XF3A 4Y5VB 1MWAB 1ORQA 5TJWK 4IU3A 2AQ3A 1XTMA 5INDA 2F54B 4OCRH 3BZ5A 3T0BA 1T03L 4N2BA 3L1OH 4ANVA 1MUJB 4UNUA 2AANA 3GSUB 4L4TD 3RI5K 4L3EE 2HWZH 2K3TA 3PXHA 4DP9X 5I6KA 1KXQA 1DLFH 1UVQB 4GP8B 1UA6H 1YNTA 5DS2A 4JGMA 2FECL 2BVPA 4BCZA 5HYJE 2DWDA 2ROYA 3DSNA 1XH1A 3QDHA 3RWIB 3VFRB 4A7SA 3HB3C 3ROLB 2XZZA 4IGBA 2Q8AL 1KCUH 2KQMA 4RAUB 5AD0B 3BPOC 1QSFD 3BVNA 4CVXB 4HWNA 3ZRSA 3P30L 4MXWL 2DM7A 2VXVH 3I6KA 4O2FB 2EYRB 4M5YL 3MUY1 3HNSH 3BN3B 5ERWB 3QS2A 3Q8CA 1ORSA 2P8MA 4BUGA 2VO8A 3WY4A 2Y5TB 3ZE1E 4ZTPH 3IGUA 5EU7E 2BZCA 4YO0B 4JMXA 3SQOH 3ZKND 1NBQA 3K2KA 4PD4K 4AYEC 5IF0B 4L48A 5C3LD 3FUHA 3QQ3A 3RLSA 4IYKA 1KPRB 3QJHB 4LLYB 2Z7WA 3T0EA 2WWKO 3GSQB 5HDBF 2A1WL 3I85A 3PWJA 1R24B 1T7YA 3S2AA 4YSCA 4LCCB 4JKKA 4XPAL 1HN1A 1NPNA 4KKQA 2WXJA 2ZSWB 3IXTA 4F7TA 3U6RA 4OAWA 1PNCA 4E9WA 1D6VL 3ZRCC 1F11B 5GSVA 5LVEA 3B9EA 1AGBA 4FADA 1GXEA 4MJ2A 1J8HA 2XPGA 1IRAY 1ZTXL 1ZLWH 3MV9A 1HE7A 2VMFA 3EJSA 4IQHA 2AK4E 1JGVH 2AJ3A 3IRPX 4P57A 5DLML 3U36B 3UTTB 1A6VH 1SOXA 5T5NG 1L5GA 1GGIH 3S35X 4L29A 5C6TH 1FZOB 4TVPD 4XPTH 2EC9T 2YAPA 4PGEB 2EEXA 4K5PA 2YGPA 1DZBA 1D5RA 1S9YA 3LEVL 2X53A 2XT1B 3BAYA 3BQVA 2DQCH 4GKZB 4JCLA 5FYJH 3IDYC 1ITBB 3H6AA 1MG2C 3RTQA 4N0CD 1IBYA 1MCFA 4AC4A 2CJSA 5IKCB 1TTFA 3O2VL 4BFJA 4TXVB 4ATTA 1PPIA 3WXWL 2P7TA 4ODHL 4R4FH 3BW9B 2X2UA 2YZ8A 3MLZL 4XNZC 3B34A 5EEYA 4QY8A 3K91A 4XVJL 2OP4H 3C6LA 4IKJA 1I9IL 4J39A 3RX8A 4QT5B 4OCWH 4L1DA 3CMGA 3OZKA 1TZHA 4KMTH 3I6GA 4YC2B 3S96A 1QFWM 4H88H 2BHUA 5T1KD 1EDHA 2ODHA 2QLVB 4Q6YA 1KB5H 3ZZQA 4U1SB 4HEPA 1GOGA 2XVLA 2K3HA 4A39A 3WS3B 4H25B 4DEWA 5IMKB 1V5JA 2XZQL 3MRDA 1AZRA 1GMEA 1OB1B 4HV8B 4NNPH 3KYKH 4PGCA 5I1DB 1W6WA 3Q8FA 4GKOA 4BQ6A 3U0PB 4XT1C 3MJ8B 2GBVA 1QFPA 4KHTH 4ONFH 4X8JA 2QADB 1QSED 4JO4L 3FTGA 5FOBA 5JOFB 2ZWZA 4D3CL 2G2RA 3FFCA 4NQEB 5C0JB 5A2IH 2CLRA 3C87A 4GLRI 1IILE 4OGYL 1KBGL 3QULA 3PGFH 4KH2A 2BZ7A 3TEWA 1FG2A 1OD9A 2HUHA 3CLWA 1VADB 3D51A 2DQFA 4MJIE 4XZ4A 4YHOL 5ANHA 2VR8A 3TIDB 1WBXA 3B37A 5B4MC 1PIGA 5CEZH 4FXGC 2M8XA 5FUZL 1S3KL 2BIHA 4QYOA 3O41A 1U3HC 1P84K 5I1AA 1QABA 1FNSL 4G6FD 1PSKH 1MW2A 3DUSA 5IQMA 4LLVB 5HHMB 3Q06A 4QRTB 3E2HB 1UFGA 3NJIA 2X7LB 4L4VE 2L7QA 4NO3A 5DMIL 2WGXA 2WNGA 1JPST 3RAJH 3TJEH 3H56A 4HUCA 4ZNEA 4MA1B 3G7TA 3L4VA 2VXQL 3ZZSA 2LW3A 5EN2A 3T5WA 3TL5A 3PPSA 4JKNA 5B39G 4KHXL 1XIWB 4IIZA 3OPZH 1G6RB 3F3HA 3QNZB 3K80A 5HYSG 25C8L 5GRVK 1CTNA 1FFNB 4HDIB 4JFPA 3WD5L 5T3XE 1MAKA 2GFBB 2H8PA 2QQLL 4HUWA 2GTQA 1QASA 4UV7L 1AVAA 1EMTL 3MFFB 3GB7A 4HEMA 1GR7A 4OI9A 1T4WA 1V27A 4X6CE 2RBLA 5H4ZA 1AQDB 1FA4A 3OBAA 5SWZA 4D9RD 1G7MB 1MFAL 5C0RL 5ADOH 1MFCH 3MRPB 5TDOA 4CW1A 4CSSA 4OZ4B 2E46A 2XQBH 2O1AA 2CDGB 1TENA 4NQDB 4OU3A 5AOMA 3WTXA 2FO1A 2WV3A 1CDYA 1J86A 1MFDH 5KVDE 2IH1A 3CPLA 2N3JA 2PNDA 3L3HB 1MCPH 2BM3A 2YA0A 1GZPB 5KSAD 1RI8A 2WUBH 1U6AH 3GMOB 2YFNA 3HS0B 2R1XB 2H32A 4F80A 5JW4N 4A38A 5JIKA 3S48A 3E3QC 3VFNA 2L4OA 3ESOA 4JPKL 5DJ8B 3CSTA 5FUCE 4BGDA 4AG4L 5JNYB 3LH2H 5HHOA 3WJMB 1RSFA 4XTRC 2JJTA 2VH5H 4A2HA 2Q3XA 5I1IH 3VCLB 1IC1A 3T2OA 1MHHA 3QW9A 1A4KA 4MJ6B 3DX2A 4TNVF 3B2DC 2E76C 2WLIA 1BGXH 1ZHNB 1TU2B 2WBKA 3IFOB 3GI9H 3KLAA 1FH5L 5ABAA 4HC1L 4FA8A 3QUXD 4LHUD 3DROB 3IFPB 1MHPH 1S78C 5F70A 3HC3L 3GBNH 5FGRA 2Z0BA 2A4CA 3SBRA 2NTSP 3GSVA 1UH2A 3KWVA 4ZTOL 4WUUE 3QPKA 4PGDA 1CL7I 3SDCD 5KZCD 4W4OA 1T89A 2WXGA 4DTGL 1AC0A 4F7MA 4HWBH 4PJDB 3FRPA 5GPRA 4OLXL 4LARL 2VT0A 4NO0B 3FTUA 3PWPA 2FBOJ 2CKBL 3NPSB 5MEOB 4K3JL 3IMWA 2ZUTA 5I8EB 3O0RL 5CWSA 1D7DA 1BFOA 1KGCE 2DMCA 2GBAA 4YHNA 4ZS6D 3P9MA 5KW9H 4FLRA 1UZ6E 3N91A 1WBZA 4MX7A 3QG6A 4LL4A 4NUJB 1HI6A 2ZUUA 4ZMTA 5SWQA 3KL5A 4PJAF 4PRNB 1YMMB 3VD0A 5B7MA 2Z1PA 4YDIL 1U93B 3LV3A 2D2CC 3CHSA 4MAYC 3EDFA 5HPMA 1DVXA 4JRYE 5KVFE 4MYWB 2UUDH 2J5LC 3DX8B 4W6YB 2I9TA 3H9SB 5EDSA 4AYBA 1ZDQA 1M53A 5C0DA 3WKYA 4XZUB 1XL4A 4I3SL 3DUUB 1WZAA 4XN2A 4KRPD 3TBSB 3OKLB 5E99H 4RAVA 2GW5A 3TN0C 3LQAH 1NGQL 1TO5A 2NTFA 3T77B 4UQ2B 1RZJH 4KQ4H 5EU6E 5HGBB 4HXAH 5C0GA 5I71B 4FXLA 3NIFE 3EJCA 5BRPA 1T2QH 1XEUA 4NSKA 4JPSA 4WWKD 2GCYB 1EAQA 3PAZA 32C2B 1NC2A 4ZMQA 3EBGA 1UWXH 2BNQA 1ZE3H 2YRBA 5CMAA 3TWCL 4M8UA 2QSCL 4HKZB 3KYOB 4N6QA 5CJOH 1UD4A 4KKBC 3EGSB 1WITA 3NGBC 2VC2H 4L8SA 5FW7A 1BFTA 3IFLL 3WY3A 3TVMA 4RDQF 3QUZB 1OTSC 4GPVA 5D5ME 4LRNH 1BM3H 2VQ4A 3BGFC 1CT8B 4LFHD 1JSYA 1AHMA 5C0FA 2CO7B 4PH8A 5E9DA 1KTBA 2I24N 1QPKA 2HYMA 3GFUA 4J3OC 2RD0A 1FJ1B 1KXTA 1D6EB 1T04A 4CMHB 3LKRA 4OJAA 3HHSB 1QTSA 3UG5A 2OAAA 2ZSVB 3ZX1A 1XF3B 1ORQB 4JDTH 4FNSA 4XMLH 4IU3B 3S5ZA 1NPJA 4NRZB 2X9YA 1IM3A 3TBYB 2X41A 3FBQA 4LKCB 4OZFG 5IJDC 3HLAA 2WIMA 3IS0X 4TLUA 5I8OH 2XXCB 5JR1L 5MEPA 3ZDYE 2I7OA 2EKSB 2JB5L 3D9AL 1DR9A 4YSEA 2DW5A 4M7ZC 4OLUL 2WQXA 1YNLL 2NY0B 3DUHA 4KUZL 1YNTB 1CYGA 2PPCA 3RKPA 3TYFB 3ENEA 4TTDC 1Q9OA 2CCVA 2NXZC 4LU5H 4ZXBC 4WU5B 3QH3A 4RDBA 3DSNB 5DVPA 4ISVA 3VSUA 1DCEA 4F5CA 3A5VA 4AGOA 4YQXL 3QIWB 4NERA 1E6OL 2B14A 4I1NB 5JIDA 3QGVA 4ZX4A 3JWNH 3HE6B 1H8SA 1LVEA 4OLYH 4HOZA 3EOTL 3ZT6A 1DSFL 3Q9QA 43C9A 4K7PY 5IM7A 1GRWA 3EF7A 4L3CA 4X80H 4ODSH 3FN0H 4HFUH 5D7JD 3KPRA 1A4JB 4CU6A 3D18B 4DP0X 3O45A 4PBVC 3WKML 3L16A 4OIFA 4JFOA 1PLBA 3DARA 3QQ3B 1A6ZB 2XIDA 2VOTA 2WY3B 1WAAE 4N90E 4P2CG 5AZ2H 1X6NA 3MRLA 3RWEB 4Y1AB 3MYZA 3FTYA 2WMPB 1JZ3A 2R1WA 2WTRA 1SUJA 1MCDA 1A25A 3BT2H 3DURA 3X13B 4YHZL 5I17A 1KIRA 5KSVB 4MXVE 2YWZA 3BPNB 2D3LA 2H1LM 4QTFA 3PWVA 3G6JF 2BSED 3U7WH 2DD8H 2QKIC 4MCNA 4HHGA 4M7KL 4Y2DA 2XKNA 4GFXA 2R0ZH 3FQNA 1OVZA 3Q2WA 5IQNA 3CK0L 2RH0A 2Y2YA 2VQUA 2XPGB 3TCLB 1ACYL 3FW6A 3UL4A 1A6AB 4LCCC 4P57B 4MDJA 5AW0B 1JHLL 2IQ9H 1HHGB 1L5GB 3B8SA 3ZQWA 4L29B 5C9JA 4IHOA 3ECBB 4WVRA 4XWGH 1S9YB 2B2XL 4JKMA 2J5WA 5CM1A 2AMGA 2FIRT 4M3HA 3BAJA 1F3DH 1ZIBA 2UWEE 2YMOA 3RTQB 1UYWL 2F7QA 2MIZA 3M1CA 1JFQL 2R39A 3RY4A 3VXQB 4KK9C 2FB4H 1BP3B 4TLSA 1SXZA 5KANG 3O4OC 4PM1A 3GI8H 3RQ3A 4A7GA 4XCEA 5F9JB 5E24E 3FSWA 3US0A 1R3LA 1TZ8A 2WZPD 3T4AC 2X10A 3IXAA 1F41A 3CXDH 4N1EA 4Y4KB 3WSQL 2DQIH 3SYAA 4WNJA 1WDAA 1KN4H 1KTKE 3B2MA 3QNFA 5BRZA 4JBSA 4POZC 3S96B 4EIGB 1R9FA 1SJHA 4HCRH 3SD2A 4PG9B 1DQJB 2WQRA 2X44D 4Y4FD 2CJTA 1W2KT 3ARBD 3BKCH 3MRDB 3T3MB 2A9MH 2ZCKH 3II3A 5F9DC 1MF2L 2HX7A 1WD8A 2E6QA 5DR5L 2GHZA 4YC2C 4S1DD 4ZFZA 4AENA 4DERA 5FF6A 1FH2A 2H32H 3C5ZD 4X8JB 4DWHA 3DHUA 3FTGB 2R9HC 4U4IA 4FFYL 2X4RB 1YNKL 2G2RB 3COOA 2DLHA 4LESA 2NY3B 3NCFB 2FEEL 5BCAA 1T2XA 2IG2H 4UBDC 4EF3A 3QULB 2QGBA 4DP4X 3OQ3B 2QADC 2V37A 1KLFB 4AZ8A 1LO3L 2DQFB 5JA8B 3BWAB 3U2JA 5L2KD 1UKQA 1WBXB 3KM2A 2E47A 2WXQA 2HJLA 3IE9A 4E9QA 1E8YA 2VN3A 4R2GC 3ETTA 1YEGL 4LVOB 3CIQA 2HKHL 2QZQA 5FA4A 4JFVA 3SDYL 3DUSB 1AI1H 1FO0L 2XV2A 4ANUA 2PCFA 2WXKA 1Y1UA 5D7SH 2PW1B 3L17A 1CFSA 1O6TA 1KGXA 5DQ9B 5JA9A 1NGYA 4F58H 5EN2B 2CO3A 1QSVA 1TZGL 4EIUA 5L8KB 2WBXA 3LRGA 5EU3B 3VXTA 3OX8A 4Y16C 3QDGD 3E2HC 1IC4L 1V54B 2GSIA 2CM6A 3IPBA 4PHZA 5G4OA 3GUTB 1J0IA 3QUML 5GS3A 3WO4B 4NXKA 4A2FA 2PO6D 5I75B 4MA1C 1HWGB 4RRPA 4I0PB 4NQVA 5CN3A 5IHLB 5DCCA 4Y19A 1V7NL 4F7PA 4DUWA 1BREA 4KX8A 1USZA 4ZI8A 5I19H 1CC3A 3AB0C 3P4MA 5SWZB 1AXIB 3WL9A 3BPCB 2DTMH 2R0KH 3IF1B 4IOIA 3UGEA 4CW1B 2EDWA 4MNQB 1LO0H 4N2EA 5AL8A 3CXFA 1IBFA 1P4LB 1UGNA 3DA0A 3OF6D 1CLYL 4YDVA 3FU9A 2JKIS 2IH1B 5H35A 3CPLB 4DESA 1EHXA 3RGVD 3D69A 1OHZA 1QZ1A 4ELMA 3P3UA 4NZ8A 3GO1L 1FFPA 2W07B 3B7TA 3F7VA 4G80A 4M6OH 4LT7A 1ND0B 3L1FA 4MDIB 4MYPA 5DJ6A 3QORB 4AIXA 2RA1A 3D85D 3VFNB 4Z7OE 2VZUA 5IMMA 4P5SA 5HYJD 4Z7WA 1NBZA 3BD5A 4FNQA 3ZL4H 3FYIB 4K9EL 3T8VA 1M4KA 5CSGA 1G9NH 3NACH 4QRSA 1G5GA 4JUTA 4MJHA 1EXGA 5DJXA 1E5CA 4FQHB 4JZOA 3KPLB 3HS0C 2OL3A 3HG1A 3O2WH 4YHYB 3FT4A 2EDLA 5DS1A 1G0XA 1VB9A 2MCG1 2HPTA 2WLIB 2AXWA 2H1PH 5BOPA 4GMSL 3MUJA 1QACA 3II1A 4HIHB 2Z7UA 5IVXE 1EFXB 1H3UA 4A6YA 4HS3B 5HYIA 2SODB 1NQBA 4FXGA 4WY7L 3B6SA 1DTUA 3X3FH 4PGDB 3APCA 4QRBA 4JFEA 2B77A 5FYLD 4LSTL 5FX3A 1D9KC 4EI5C 1KEML 7TAAA 3ULVF 1ZLUH 1KJ3L 5LQBL 3OB0H 3HRZB 3MRRA 4XHJD 3PWPB 3P1VA 2Z34A 2FD6L 5DK3A 1L7IH 1NIFA 4PI2A 5B1JA 2Q10A 5E70A 4QHMA 4MBOA 2ADGA 3MLVH 5EG6C 3ULUC 2VO5A 3MRGB 5D1QD 1TSHA 1PCSA 4YHNB 5EWIL 1FGVL 5TQ2L 2M83A 1KF9B 3SDDA 2OX5A 1LEKB 5LCVH 2H5UA 2P5WD 2F9BT 4QRRD 5SWQB 5I1JL 1ESOA 3NPSC 4QCIB 2CUHA 3VXPA 3LV3B 4Y2OB 2OW7A 1M9SA 5K59F 1A6WL 4XBGB 3G6JA 4HFWB 5HPMB 1FNFA 2V9UA 2Y7OA 4GAYA 3EBIA 1W9XA 1HHKA 5D1XC 2ATAA 1P4IH 4MA7H 3O6FD 1XMWA 2G4GA 4ENED 5EIIG 1B0GA 2Y3NA 4YHMH 3EDEA 1JZ2A 3O8XC 3K0WA 3MXVL 5DS8B 4HGWA 4KY1L 4TTGA 1OTUD 5HPOA 4X9FA 2NMSA 5L8LB 2XFGB 3C9NA 4HJ0D 4W9HC 2HAZA 2D7QA 5HGHA 4BK5C 3V6ZA 5ALCH 2GK2A 4XMTA 2FT8A 1QR4A 1JPSL 4NDMA 4LOFA 4Z6AT 2NR6A 1DJYA 2HUEA 1A5FH 1NC2B 2ZUWA 4AH2B 2JIXB 2YA1A 1FYTB 5CMAB 3U0WL 2BDNL 3WFZA 1I7ZA 1Q72L 2Y23A 3NSXA 2CSPA 1SOQA 1M2VA 1EJOL 1Z5LB 2COVD 1SJXA 2EZ0C 2GUYA 3BSZL 4OFVA 3WE6A 1IEBB 4JG0L 2AABL 4GRLD 4DKFH 3KPTA 4NFBA 4Q14A 5LG1A 4P5MB 2D8KA 4GKLA 4POUB 4M62H 3F05A 1UXSB 2F6AA 1KGUA 2BOCB 2VDOB 2LOEA 2Z4QA 5E9DB 4UTCA 5AYQA 2P5EA 3G3LA 3QZWG 4AXWA 3C6SA 3EH2A 4FN0A 3LCYA 1VFBB 3BIBX 4P59L 5L6YH 3GSNL 3SE9H 1RJYA 3QUZC 4GRWE 5T5FA 3UBXG 4UILH 2CG9X 2DWYA 3VGHA 1JMXA 4WGKA 3P73A 4M29A 5IK3B 3T2LA 3PWLB 4OZHF 5ITFB 1Z32X 1YQ2A 3HG3A 3VXUD 3HFFA 3LMJH 4DQOL 4B96A 2YRPA 1V7ML 4NHCL 4L23A 3NZHH 3HLAB 3QEQA 2QVTA 5GIRB 2Z31C 3BYTA 1BD2D 4L4VD 4NCDA 1X5AA 4H8HA 2VW7A 1MRFL 1WHOA 3UC0H 1G7PA 3A67H 2VNCA 2FK9A 2OMXA 4JGUA 4PR5B 3EJRA 5HDQL 1QPXA 5DLLA 1MRCH 2E3VA 4K7PH 4RSVA 4OGAC 4UYQA 1J0YA 4NO2A 3QH3B 2CO4A 3NA4A 2X4OB 4J27A 4JJ5B 5AYTA 2MQ3A 4NQUA 4YLBA 3O6ML 1E5AA 2ROXA 1SF5A 3VWKA 3VXNB 1H6EA 2Q2EB 5CJQH 3VD2A 3K6IA 4AL8L 1XZWA 1K85A 3HC0B 5IY5B 1YEEL 2WXLA 2FL5B 1F90L 1I1AB 4RESB 4XRCA 5C07A 2Y5EA 3E8VA 3VM7A 4PJHE 3VA2C 7FABH 5JIHA 3B4NA 2W38A 2DWSA 1B4RA 4L3CB 1MNUH 3GMNA 2ZUSA 4POYA 4XAKE 3KPQA 2DQHL 3SKJH 2MCMA 5IG7A 1KELL 3HE6C 3QFDA 5ES4B 2DWTA 4LCWA 1Z9MA 3FN9A 4H1LB 4XP5L 5EO9A 4HISA 2X70A 4G8GE 4PYHA 1CR9L 1L6XA 5K9KA 4ZFFA 5EF3A 2ALWA 4LNRB 4AJWA 1UOVA 2WTRB 2F53E 3DURB 1M6UA 5KN5A 1KIRB 3LRSB 5E8DL 3QUYA 3PWVB 2VUYA 1DFBH 3NABL 5FUOL 1H6TA 5CD5D 1T1ZA 1X5ZA 3ARSA 3H7BA 2BLFA 4IRZA 1OAYL 4S1RL 4UZSA 2WO3B 3SGJC 4Z78A 2BOLA 4L5FH 4F7KA 5AW8B 4FFWD 5MHSE 2PABA 3ARGB 3BPNC 3I9AA 5DF0A 1IM9B 2EXWC 2CO6A 4Y1SA 1NC4D 3M46A 2VL5A 1JN6A 1P69B 3WGUB 3IMUA 4OVVA 2UX6A 4NWUH 5KVGE 3ETBF 1QWNA 2IEPA 4KK8D 3MA9H 1JNLH 3P40A 4C55A 3SQBB 5BZDA 2Z8SA 1KLGA 4IRJB 4MRCA 2ZP8A 4GBXD 3QHFL 3FHAA 5BZWA 4OLEA 3WJLC 5BUAA 3KS0J 3HUJF 4KX9A 2ZKYA 3VXME 2DJ4A 4F1SA 1UD5A 4XP4L 1R3LB 3FO9B 4K2UH 4AJVA 3MZTA 1EQWA 5IQ7H 3IXAB 1CGSH 4Y4HB 2G3XA 5BMFL 2D73A 3AY4C 1JK8B 3D2TA 2AXJA 3K5RA 1NLBL 2P52A 1EZLA 4R7NA 5D72L 3HN8A 5DUMH 4GAGH 4W4NA 3VG9C 3L4UA 4FNPA 4UCFA 1NCOA 4J6RL 3ZIYA 3JT0A 1IGCH 1H3PL 3GC3A 3HMWH 3MNWA 4K0OA 4ZFZB 1F4XH 5HI3D 2BW5A 3QCUL 3BWSA 3DVFA 5F9OH 5I5JA 1MFMA 5HHPB 4ZFQA 1G94A 4ZAKA 1JUFB 3MZGB 5DA4A 4OKDA 5DVKA 4N8PA 5A1AA 1F2QA 2NW3A 3SBWA 4PJAB 1Z3GL 2YGVA 4B60A 2OL3H 2EDYA 4YDNA 4FMVA 3Q1SL 1H8LA 3GIZL 3SKMA 4PRHA 2ZP9A 5DQDL 1UWEH 3CN3A 3GS0A 4PJBE 5GZNC 1O9VA 4WI4A 3PYCA 4PJEA 4YHKH 1J18A 2OXHB 5FA4B 2WGNB 2Q0ZX 2WZ0A 4HIEA 2PCFB 4PB0H 4A2LA 4XP1L 3CH1A 2G2PA 2E9JA 3I75A 2EC8A 1NCAL 2Q86B 2X3AA 1CFSB 1BZ9A 4FQJL 2G60H 1BVOA 4O2EA 3PHQB 1E6JH 1NGYB 5EF1A 2CUMA 4LVOC 5DYOB 2K7PA 3O4LA 1WP6A 1MVFA 5AAPA 4FTVB 3TEXA 2ICES 4ONHB 3VXTB 2XYCA 4ZD3L 3QRLA 2GSIB 3KVQA 4GG6E 1NAML 5JUEL 2WN3A 4NN5B 4NKIH 1I85C 4NQVB 3GHPA 5EORL 5EBLA 1LILA 2NQDA 3UJJL 4QUOA 4TLKA 1CGTA 1H5BA 3VJ6B 4BA8A 1S7SA 3WO4C 3BEVA 2NZ9C 3N1GC 1UHVA 2BSSB 3CBRA 3C8HA 4LEOB 4XE5B 1YEWA 3L3JB 1KN2H 5FKPB 3OAZK 3NP3A 2B1HH 2G3ZA 4YDVB 5H35B 3ZT7A 1N59B 4IBSA 5GJSL 3BP5A 3L3OA 4TL4A 1OGAD 4G71B 3LXCA 1JXGA 2H2SC 4U05A 2EVHA 1P7KB 3T2NH 3FRUA 4IKNA 2VDML 5CINH 3V4VL 2XRAL 5DJ6B 3I50H 3D05A 3VRIB 1G1KA 2HSIA 1T5WA 1U8CA 3DXAA 4TL5A 5KJ4A 4E41D 4HAFA 2MKWA 4BFRA 4QJ5B 3BVUA 1LQBC 2MCPH 2PTVA 3K4ZA 1N70A 5HVWA 5ITBL 3VQMA 1DDTA 1E4XH 3HG1B 1TJHH 3QORC 4RZCA 5E00A 3FH5A 5I1GH 3VMOA 3FT4B 2WLJA 1ILSA 4AM0A 4HIJA 1SOSA 2H2PC 4ICWA 1DUZA 1MAMH 1N68A 3N41F 4OF8A 1G4MA 2BP5M 3SZ6A 2ZKXA 4JFZL 3IAQA 2V3DA 1T7ZA 4G1MA 4GH7B 4FG6D 4A6YB 2HFFB 4YHYC 1MLCA 2AJXH 2CDFA 2CGRL 2W92A 2Z93B 5LGHH 2E9GA 1ZLSH 1IE5A 4J8RA 2CGZA 1RHFA 3A22A 1JBJA 4TNVK 3PGCB 4P46B 4YH6A 2WB1A 5D2NB 4N90D 5L7XL 1TMQA 4TSBH 5DTFA 2I9LB 4CKQA 5T5FH 3BN9D 2D9QB 1TG8A 3MRRB 3ORJA 1XXFC 2N7BA 3U1QA 1F4YH 3WV0A 1ACCA 4ZDHA 4NO5A 1IZKA 2ADGB 1QFUL 3DRTB 4LLWA 5G55A 2DL9A 1JNNH 3GUFA 1WFUA 2QPSA 2VRAA 1TKWA 4AMKL 5JMRA 2OX5B 2P24B 3PQYB 3MNVA 2JKSA 3EBAA 4Y16A 4FKHA 1I1YB 3F64A 4XBEL 3U7AA 4FMFA 4NBYB 3EO0B 3MBXH 3G6JB 3FB6B 2WINB 3MA7A 1S7WB 4NP4L 4KNSA 1JZFA 4GXVL 3U6XS 1HHKB 1TF4A 1YEHL 2D9CA 5D1ZC 3UZQB 4J5VA 1UJ3A 3CCHA 4OCSL 3HIZA 4N2GA 5GXBB 3FU3A 3OR6A 3QAQA 2H3KA 4E5XA 4PWGA 1MJ8L 4WI0B 4RGND 3OKNB 2CKNA 2BW4A 4LVHB 2J57A 4FHJA 4CVZA 4ODWA 3QR1A 3B2XA 3QJVB 1ET8A 4KTEH 1HH6B 4W70A 2VABA 3WNIA 5CD3B 1IQWH 3HR5B 5F1IB 1YEKL 1RCYA 2IDQA 5IB3B 4OIIL 4Q0XH 4HS6A 4WEBL 1FPTL 1BEYH 2ZKHH 4P05A 4HHAA 4R0LA 2EDMA 1E5UI 1JE6A 1KBVA 4WTQA 5DVMA 2VERN 1JHTA 5HJBA 3U1SH 1M2VB 2C34A 5I2IB 3IJ7A 2YPVL 4FQXA 5E2TH 3WE6B 1T80A 4S0TD 2AEPH 1YYLH 4OFDA 1YEFL 2HB0A 3KW8A 1OCWH 1L9QA 2O6FA 5ID0A 2HH0H 2JJWA 2BNRA 1HT6A 3VH8G 4BE6A 1BYPA 2VGLM 2WXHA 1AC6A 1RJCA 2R23A 1CK0H 2PCXA 1FL6B 3ZMRA 2ERJB 1D5IL 4QRQB 4QRFA 4JPVH 2UZXA 4W9IC 1XSJA 3MXWL 2P5EB 4OI8A 1RUPL 3AS3A 3TXAA 1OF0A 1ZOXA 1CDUA 2JCCA 3H4FA 1RJYB 4XO8A 2QLYA 5M7QA 1CLOL 1TCRA 5AOJA 5FXCH 2NNXA 2ZXCA 1GGBH 3C75A 4GW1B 3FN3A 1IGJA 4M4RB 2UZIL 4YGAB 1DBJL 1CG9A 4P9HC 4J3OH 3NJXA 3DNKA 3VYPA 3W2DH 1WBYA 5L9DH 4J1UA 3OKDA 2WTOA 1KTCA 4C4KT 3QEQB 3CSPA 3SPVA 4ZUTA 5CIPA 2W0FA 4JN1H 3ZUCA 3HS8A 2DPKA 4OW6A 1FRGL 1G7PB 5FECA 1J9TA 2AQRA 2OMXB 4GQ9L 4X5RA 3NJLA 4U1NB 1PZSA 4WI7A 3IAGC 4HOXA 4PS4L 4NUPA 3CIAA 4UMGA 2CA4A 2XN0A 1IC5L 2BJML 5D70H 3VFSA 3W1ZA 2KLTA 3BLPX 5I18H 2Y25A 4IOFD 4MD0A 2UZYA 4NRXB 4Q2ZB 2CIIA 1HXYA 3VI4F 1G9ML 2R69H 1MPAL 1AO7B 5FKAA 3N85H 4XRCB 5C07B 4KO6A 4WLCA 4FULA 4X7FC 2BIMA 3FCTA 1A7RH 3GMNB 5EIVA 4PJ7A 4HK3N 5CGYC 1HYSC 3R19A 3SSGA 1DQLH 5CN1A 1I1AC 1OAQH 3QDMA 1JGLL 4RQQA 4PJXA 5CSBA 4U3SA 3ARTA 5IBTH 4X4ME 2ED6A 4M6NL 3L7EA 5CCKL 2E4FA 1R3KA 1FE8H 3FT3B 5E5MA 4OCMC 2FE0A 1U8LB 3BHBA 3QUYB 3VYOA 3RIFF 1TETL 3UJIL 1QFHA 4MAUH 5HDLA 1T1ZB 4JHAH 4NXSA 3SKOB 4PWFA 1FVEB 4NC1E 3VGGA 4KKCD 3SBPA 4EOWL 5F3BB 5CJXC 2C26A 2K78A 3VD9A 1MREL 3MV11 5F7FA 3C6EA 3GMMA 2GK0A 2YBGA 5I1KL 1WEJL 1DQDL 4M1DH 2PWGA 4G7VL 3IJ8A 2VL5B 5JPNA 5DD3H 1W8EA 1DO5A 5KBPA 3QWNA 5AL0A 5GGRY 4FXKC 4MLIA 2GITB 3OC8A 5BZDB 1S7VA 3MRNA 3PDDA 4PCTA 3RZCB 1UB6B 5DU7A 4KITB 2VWEC 5KYUA 5FDYA 1AKPA 2AJZB 4KO9A 2X6MA 4U0RB 4AEHL 2QQNL 2YSSB 2C5DC 2VCOA 4JFTA 3GXDA 4I5BA 1N26A 4J3SA 4K4KA 1YY8A 3QDJA 4IRJC 4C56A 3ZTNH 1W72A 4NQCE 1OSPL 3B1TA 3L5WA 4JRXA 4R7NB 1HWHB 5F2FA 4QWWD 5F9WB 3GXMA 1QBML 3PNRB 3VI3F 4JM2D 1E4KC 4Y4HC 4Z7QE 2J1KA 1I8LA 4RFNB 3MNWB 4YZFF 3E9TA 1TJIL 2MQCA 5B1AB 3EYUL 4U1JA 1L6PA 2YARA 3FF7A 2XV6B 3EDJA 1ZANH 4PMFA 4N2FA 5TGBB 4EPSA 5HYEA 1KPVB 4GIOA 4G9FA 2L7EA 3GKWL 1EEQA 4AY0A 1HHHB 2UY6A 4LIQL 3ROOB 5EB9A 1HTYA 2AJVL 2FQDA 2P49B 2VDMB 4LCIL 4YPJA 1J48A 2VXTL 2OS7A 4NZTH 3A6OA 3B7RL 1RUKH 2DKMA 4PRHB 1L9SA 2XN9D 2WNKA 4HZAA 2XBTA 3S36L 3M8OH 2C1OB 3RVXD 3TU6A 4ZFOL 3G9AB 4F9PC 3NUKA 5GGRA 3POHA 1ASQA 5EUOE 3V5DB 3IKKA 5I9QB 4PLOB 4HIIB 3AG4B 1I3GH 1M7XA 4FS0A 5I6XB 2EVIA 2Y2TA 3LSOB 3CH1B 1DVFA 4J23A 4PJCA 4LCVA 1JD9A 1BZ9B 2ARJB 2Y9RT 3QARA 4KXBA 2YD6A 4PJ9C 4OSUL 1FIGL 1XV8A 4UTAL 4FRWA 1WG3A 3VTMA 1EUUA 4P2YA 4HULB 3ML9A 3T2PA 4OZIE 1ZA3B 2GAZA 3G5VB 2CU9A 2IANB 4KNQA 3G9VA 4N0UE 3HG2A 5EBLB 4AWJC 2XG4A 3D3VA 4XX1G 3STLA 5FYJE 1EZVY 4HJGB 4H26A 1M3IA 3DTXB 3QRFM 3VM5A 4X9IA 1AR2A 4NN5C 3BEVB 1CURA 3WIHA 5M94B 5IZ7A 1DE4B 2A83A 2K0RA 2VLKA 3VXMA 2D31A 3NIDE 4XVTH 1A22B 3E7JA 3RB7A 3SYQA 4NZJA 3CH8A 3NDZE 4GMTH 4HUUB 4YSPA 3UYRH 3WFHA 3BJLA 4MNHA 2FLBT 3RDTD 2VXQA 2NY2B 2AJSH 4C58B 2DDQH 1DL7L 4QOKD 1V05A 1YPZF 4KQ3L 3CFJA 2PN5A 4EKXA 1IZJA 4GSDL 4HLEA 1GPOL 4M5ZL 2NYZA 2AXHA 2XQYG 2QSTA 1FQ9C 3DV4B 3MV7E 3B3IA 4XOBA 5KAQF 5CHNA 1S5IH 2AEQL 4MNGB 4GYBA 5BS0D 4RZCB 3HZVA 4BH8B 3DBXA 4AYFA 4N2AA 3C8DA 2I60L 4HIJB 2X4NA 4TV3A 3UFIA 1D5XA 4UQEA 4KJQC 2WZ6A 4I1PA 1WO2A 1ZD6A 1CXHA 3FNKA 4BXVA 1OZUA 3R8BB 4XAKD 3EW3B 3DGCR 5KSBF 5E8PB 3U4BH 5C7XL 5CEZE 2CDFB 5H4YA 1NCJA 4PBWD 5I15H 5DRNB 3MLWL 4J8RB 4PS7A 5GZNA 3UPRB 2F8VA 4D8PB 1SYSB 2F53D 5I6PA 4YX2H 5KBNC 1L9PA 3GMQA 4LSQH 5SV4A 1LP9E 2QGCA 1QUPA 3PDOA 1IKFL 2CGYA 4HF5H 4ZDHB 1RFDL 2HTKC 5GSRB 4P46C 4LLWB 3C09B 3HOGA 5MENB 3K2MC 3HNTH 4PRPE 1TKWB 2EH7L 5CIPH 2VSMB 4JFDE 3N40F 5CFAA 3F5WA 3H3PH 4UDUB 4WV1B 1BIIB 2EUZA 4JQIA 4MBRA 5ACZB 1J5OH 3EFDH 3KLDA 4U3HA 1KJMA 2F74A 4WWPA 2PTUA 5GGQH 3INUL 2J6EA 1IGYA 1RVFL 2OCJA 3I3BA 1RIUH 1ED3B 3KXFE 5TDNA 5D2LE 3UMNA 5IB2B 3PWUB 1P9MC 4PJ8A 4CL7A 5KSUA 4OF3A 2W0KA 3V52H 4E5XB 2A6KA 4Z95L 1FG9C 4BSWB 3L3GA 2YEQA 3J7HA 3PL6D 1BLIA 4Q9RL 2UZPA 5I28A 4ODWB 1MCJA 4GW4A 3AM8C 2EEDA 4GRMA 1MHEB 3PWNA 2CJUL 2Y7NA 4RWYL 4L4TB 1VZHA 3MV8E 3PRZA 1T03H 2VDRB 4LVHC 2IWKA 5GISL 3VGFA 1E4XI 1HILA 1SFHA 3HUJB 3OVUB 4X5PA 4B3VA 5JXEC 1TTBA 2ISDA 2WHVA 3ZE1F 1R1CA 1FBIL 2O5XL 5EOCH 4AL8C 4KXCA 35C8L 5A3IC 2COQA 1KGYE 1F58L 2Q8AH 1H3WM 3BT0A 3ZHDA 4I3GA 2UZXB 1AD0B 3IN0A 1HS6A 3QXDB 3P30H 4MXWH 3TO4A 2V9RA 4B0MB 4I87A 4M5YH 5FA3B 4IBWA 2Y1AA 1TCRB 3QXAB 4KNUA 5B3NA 3WDHA 4M7JL 2ERJC 3WGVB 2XNAB 3QIBA 1HQRB 1TNNA 1L0PA 3EOYG 1HYRC 1WBYB 2GJZB 3NRPA 5FWRA 4DAGL 5K9OB 5GS0C 3MRCB 1A14L 5FGCE 2ZUQC 3HE7C 1RERA 1U0QA 3AAZA 3V0IA 2LLNA 4KMQA 1PAZA 2ZNXA 1UWGL 1HSBA 2ZAIA 2H26A 2A1WH 2APTA 4U0QB 4G70B 4XPAH 5E6RB 2WXNA 1VFAA 1UZ8A 5HGGS 2F19L 5ESVB 3ZK0A 4U3XA 3CVHB 4F7CA 4JPQA 4NKOA 4WKZA 1D6VH 1UXWB 3I9GL 2A6JA 3AW5A 4G3YL 3GXPA 1R47A 2LU4A 1JVKA 1UH4A 1ZTXH 3K8MA 1MI5A 2CUAA 1H3VA 5JZ7D 1ODUA 1D5MB 2NY6B 5DLMH 3HC2A 1IC0A 2CIIB 3IJSA 2LLLA 4F27A 1RHHB 1DJHA 2JQAA 3CU1A 2BP8A 4KRMB 5D1ZA 5KUMA 1RMFL 1Z2KA 2IMNA 1P5VB 5F7NC 4KK6D 4LSUL 5H37H 2YD1A 4APXA 2ZOLB 1CIDA 3LEVH 1EJ8A 3IGAA 4RGOH 1KYAA 5IBLC 3FHQA 3W81A 4YBLB 4H8PA 3SY6A 1OK0A 3O3DA 2AAAA 1MFNA 4FQQB 4JRWA 5C6WH 4KXDA 8PAZA 3FUKA 3O2VH 5BW7A 2DTSA 3FZUD 3WXWH 2O6CA 4ODHH 3VXSE 4U3SB 3A21A 3MLZH 3BP6A 2XWDA 3VWJB 3L7EB 4JZNA 4XVJH 1R3KB 2B0SL 1M05A 5T1KB 3D2UD 1I9IH 3P4OA 5HHNA 2DM2A 1Z5HA 2X28A 3BHBB 3DSFL 3OZLA 2OMVA 4OIBA 4DP6X 1Q9LA 2AK1L 1T20A 2ATPB 3HAEH 5K1VA 4B9YA 4I18C 4PUBL 2JSFA 3T0EE 5FYKU 2EEAA 3DLQR 1TZIA 2XZQH 4PJIA 5FLUA 3OHXA 1RK1A 3GSRA 4ZBJA 1QSEB 3UC2A 3F7YB 3L95A 5EZJB 3GMMB 2GK0B 2IDSA 2OR8A 2FIKB 4JO4H 2NYKA 5AVTB 2WANA 3K2IA 3MV9E 1S7RB 5JPNB 4D3CH 1CBVL 2BPBA 1G1CA 2Y6SC 4X7EC 4OGYH 1KBGH 2V6HA 2X42A 2DBJA 1BWWA 3BZDA 3KLHC 1A3RL 1ZPUA 2CCWA 2N1TE 3QK0A 2QQQA 5K9JL 2IV8A 2VITB 1UT9A 4YHOH 4E9SA 3ARFA 3FDWA 2FTAA 4G6FB 3MNZA 3SJVA 1JAEA 4Q97A 5FUZH 2X88A 3QAZC 3N41B 2OXGB 1S3KH 4LGRB 1P2CA 1HSAA 2FQGA 3GXUB 3ISYA 1FNSH 3ETBJ 1YY8B 3RZCC 1D7FA 1W72B 2N59A 3E80A 3F7PC 3L5WB 3ILQD 4JRXB 5DMIH 1SDYA 3PNWA 2EIMB 1JDDA 4PREA 1YSOA 4W6WB 1GW0A 4X6CF 3L9RB 4U0RC 1JPTL 3LRLA 5G4NA 3WLWC 4CSTA 2VXQH 5AG9A 5F6HJ 2CHXA 3RZWA 1UA7A 1BVKA 2FT7A 4KHXH 2B59A 2HRPL 1INEL 2FDBP 25C8H 1G84A 2VN4A 4OM1L 1IGML 2GYSA 1K72A 2AVGA 3JWNE 2X0VA 3WD5H 1NWPA 1IKNA 3LY6A 4G9FB 3CC5A 2QQLH 3MRBB 3MRKB 4UV7H 4XXWC 5J1AB 1EMTH 2V2TA 4JM4L 1MFBL 5AZEL 3K6NA 2CCLA 4YBHA 3WG7B 2PYED 3FFCE 4YDMA 4F2EA 1MFAH 5C0RH 1LDPL 4MKMA 1LJMA 1ZS2A 2H3XC 5KSAB 5F8QC 4XNQA 1KFGA 3THML 2GSMB 3JBG7 4P2QE 3GPSA 5LUMA 3RL2A 2C1PB 5CJ5A 1DQTA 2XY1A 4QXGL 4S2SA 3DV6A 3BDXA 5C0BA 1RUAL 3FQ1A 4JPKH 3IGLA 4OT1L 3TONA 2IH8A 4AG4H 3NZ8A 1NANH 5I6XC 3ZR5A 4X5WA 4M1GL 4HPYL 5IB4A 5K1NA 5K39B 2RQ8A 3FSOA 5AW1B 1TYJA 4LHUB 5B21A 3STLB 3U30B 1KJ2L 4RMRA 4HIQA 4N8CL 4MD4A 1LEIA 1FH5H 4HC1H 2UV3A 1J1XL 4W9JC 4U4BA 1DCLA 3HC3H 2NOYA 3V4PL 1UZ6F 2A83B 2BCMA 4ZTOH 4UT6L 1I9RL 1E8ZA 2GC7C 1PS3A 1IAIL 2WZ5A 2ATKA 2WP3T 4DF9A 4MLSA 1UD6A 4WJKB 3FTZA 1M3JA 4JO2L 3MTRA 1ZLVH 3LNEA 3WFHB 5J6HA 4MNHB 4DTGH 2VIRA 3BFQG 3KWWA 2BIOA 1LNUB 2ADJA 3Q6GL 5FW6A 4OLXH 4X6DA 5EZIL 4LARH 3B2UD 4V1DE 2NXYC 3PXLA 4MHHI 1EO8L 2WAHA 4NWTL 4P2AA 4MCYA 4MDRA 2CKBH 3FC8A 2F54D 2PWHA 3B5HA 1IVLA 5DHXB 4ZPTB 1O7VA 3O0RH 1NBCA 4X83A 3QUMA 2AK4A 3F58L 1AG0A 2B08A 3O6LL 4DK6A 2RR3A 1MCEA 4YIQB 2AF2A 3WN6A 1AZCA 2VQ1B 2NY2C 3T08A 2AMUA 3VXSD 5ISZA 2X89D 2CO1A 3FQUA 2YAQA 4YDIH 1BOYA 3NIFF 1HESA 3CJJA 4EZMA 3K1KC 4K9JA 5HHOE 4P2OA 5AKRA 3ZHLA 4XNBA 1WF5A 4BE5A 1FZMB 5JHLL 4AVIA 2VLLA 3EF4A 3SDAD 1WICA 4I3SH 2MQGA 4LSSL 1A1OA 2YAOA 1KWGA 3RY6A 1I8KA 2JF1A 4N22A 3VI4B 3CBJB 1NGQH 4FL4C 4WTXA 1J5IA 3OXSA 3RG1C 2MKLC 4EN3D 4WWKB 4XP6H 3UXFA 3V0EA 4A2GA 4OFPA 3PABA 1EUTA 2OW6A 3OGCA 3AG1B 4ZMAT 3O3UN 1MCOL 3UBGA 2UXFA 1CICD 4F92B 4WO4A 1YG9A 3JZ7A 4OI7A 2WM0A 3TWCH 2ZE0A 2QSCH 5FYLL 1ZT1A 3W0WD 2QHRL 1UWFA 2FSEA 5GRJL 2YC1B 3QR0A 5CLZA 3WLBA 1EHLL 3IFLH 2QVKA 2AXFA 3BQUD 3GEWB 4IMLA 4P23D 2H9GA 3C09C 4R83A 5DHDA 1CYWA 3ELAT 5J89A 2DIEA 3UTTD 3ZDYF 3IMBA 4WV1C 4MJIA 3FRPG 4UDTB 3TYGL 3IN2A 4DZ8A 3BPLB 2FZ3A 5B39A 3BGMB 5G2NA 4B9ZA 4UOW1 3FHEA 4CGTA 3TEZA 3KL3A 4IK7A 5HYSA 3FO1B 5JHDE 2EXYD 1BYOA 4GRMB 1NFDA 2BRRL 2X4SB 3PWNB 4RCAA 5AQ0A 4DN3L 1XWVA 3PP3K 1BZDA 1DUYB 2OR9L 5D7LB 4NQCD 2FH8A 5JR1H 1HKFA 1W0YT 2JB5H 3D9AH 5A7EA 3D06A 4PTUA 4Z5RB 1OAUL 3VB8A 4OLUH 3EJZD 4X9BA 5DEGA 5F7AA 3KS0H 1YNLH 4KUZH 1R3HA 3RWDA 3DX3A 2Y06L 1NUNB 5JIIA 1GZQA 2X4PA 5HGDB 4GXUN 4PS8A 4QJ3B 1DN2A 2BNQE 5DXWA 5T1DL 4B9GA 1SJEB 2ZXGA 1M71B 2DQDL 2VR9A 3RWCB 1WAAF 4YQXH 5DI8B 1E6OH 4F2MA 2XIBA 1OQXA 4X6CA 3K72A 4GO6B 3VI3B 3WTUA 2G3NA 1QLEL 2XDHA 3TO4B 1YMHA 1AANA 4MXVF 2VDQL 4I48B 3EOTH 4X8GA 1DSFH 2OSLA 3PV6A 3B43A 1QRNA 3U2IA 3BVDB 1KTLA 4KZ0A 1WUNT 4LDOB 4G7YL 4ABUA 3TNNB 1I8MA 2A9BA 1CD0A 1T4KA 1UCBL 1JS4A 3LKNB 3WKMH 1I1FA 1SM3L 2XUWA 2ZOKA 2RHEA 3GEFA 2ZCLL 4Q6IB 3ZKNC 2CM5A 2YXMA 3DETD 3BKYL 3FCBA 4OQTL 2V3FA 5LBSL 1HSBB 2H26B 1E4WL 4YHZH 3HVNA 1VFAB 2QR0A 1PEWA 1C12B 1YDPB 2UWEF 4GP4B 3FU5A 5F1KC 5HHMD 1CO1A 1FC1A 1E9OA 4M7KH 2J12B 4Z9KB 3SY0A 2WYHA 4Y9CA 3CK0H 1ZJBA 4GW5A 5J9PB 3GK8L 1ACYH 3RNKA 1MI5B 3GPEA 1N8ZA 1NL0L 3BESR 4XB7A 3IJSB 3PG2A 4XR8C 2E59A 1WA0X 1PF3A 2G75B 1JHLH 3GSNA 2BP8B 2UVFA 1XIWD 2X4TA 3N50A 1P9MA 5E2JA 3UTQA 3B7UX 1YJDC 2X1PA 4H0LC 5ELIA 3RNQA 3M1BA 2B2XH 4NT6B 4F5CE 5BV7B 1AR1B 3S3PA 4Q9QL 2DBLL 5IEHA 5F8RC 3B9KD 4WUUA 3IPEA 1AOHA 4FI7A 4LMQI 3VQ1C 3QQ9D 1G7LA 1UYWH 3KD4A 5DD1L 1CPUA 1JFQH 3AXLB 1L9TA 4L18A 3O3DB 1IBDA 4BFOA 1ETZB 1PZ2A 5DZ9A 3KBPA 2QPUA 1Q9WA 4N0CC 1JF5A 4XXDB 3SPCA 1TQCC 4NUMA 4QGYA 1KFAL 2CLZB 1M05B 3KPRE 3G08A 4K8RL 4YBLC 2FECI 3JTTA 2ZX8A 3L4XA 4ABWA 1NFKA 2OMVB 4IBQA 3ARBB 5JXEA 1NCDL 1BJ8A 4PWJA 4N24A 5MI0B 1U42A 1SXAA 3MC0A 4JRYA 1RK1B 3GSRB 5E0QA 1MF2H 5DR5H 4MD5A 4DKTA 4F8QA 2RCSL 1YPZB 3PHOB 5JMOC 3RIFK 5JIMA 2Q8BL 4OM0L 2I7SA 3DIVA 4L8BA 1ZSDB 4DGWC 4FFYH 1ID2A 3VO0A 1YNKH 3W9DB 5CSZB 5EU6A 2MHAA 4XMPL 4Y5XA 1A6TB 4DO5A 4TPRL 2WQ8A 1OSYA 4X6FA 3WXVL 2BCKB 3D25A 4A63A 1LO3H 1S9VA 3ARFB 1TJGL 3ZJAA 1JWMA 3SJVB 1GYUA 4YHLL 1WRFA 5HBBA 1SVBA 4G6JL 4ODUA 3ZRFC 1VCBC 3IK2A 1GGCL 3FSVA 5FR3A 1HSAB 1YEGH 1J0HA 1PZDA 1T22B 1FAKT 2HKHH 5TK4A 2Z0UA 1P5UC 4LSRL 3SDYH 1FO0H 1MW1A 4AQ8C 4EZKA 2QDVA 1UH3A 3FUEA 4PREB 4NO0D 1DLHA 3QDGB 5BRZE 3AY2A 4OD3L 2ZICA 5D5MA 3RL1A 1TUPA 1TZGH 3HG0A 2EUXA 2EDJA 4JFUA 2VW4A 2B59B 2OMWA 4OZFA 4EDXA 5DRXB 1IC4H 2H6UA 1G9HA 3QUMH 2VDKB 2R2EB 1YMMD 4U6XA 2XC8A 2I07B 4RMWA 5D9SB 1V7NH 3S3SA 4ZMZA 2V2TB 4UT9L 4QTHB 4N2LA 3H9SD 4K07A 4Z7OF 1RAMA 3QT2A 1E9PA 4OUUA 5A16A 1MSPA 5BQDA 4P3DB 1HOCA 4Y9GA 3RGVB 3P2BA 3X2QB 4XNQB 4L3EB 5LN8A 3MV8D 3UBHA 4WTZG 1KCRL 1CLYH 4E36A 3OG6B 1OW0C 4MB4A 2WJ7A 4EUPA 2LQRA 2FHBA 3TPKA 2P28B 3D52A 2AQ1A 5I8CA 2ITDA 3F65A 3RKDD 3GO1H 3R1GL 5HYJB 2R2BA 4S2SB 5I74C 3E9UA 3ALXA 5KSAC 5J6GA 1HDMB 4L5FE 3X1FA 1XCTB 3NZ8B 1EVTC 3EBHA 3CFKA 3MHZA 3R06A 4K9EH 5E4EB 4NHUA 2AZAA 4QO1B 2QL1A 1A1MB 1S9WA 5IB4B 4A55A 3H2PA 1IAKB 4M4PA 3R18A 2CA3A 4J4PD 5AAWC 3VFWA 2YGNA 3ZE1B 2YLKA 2CHZA 5JW5B 2BSBA 2AZUA 1U3NA 4GMSH 1LEIB 1OL0A 1EBAA 3MBEA 2MOVA 3JWDL 4D9QE 4E68A 4NPYA 4YFDB 3WMQA 1WAAA 2ENYA 3KCWA 5AOIA 1EXHA 4Y8DC 4JM2F 3QUXC 1UOKA 4WY7H 1MLBB 3U30C 3CHXA 5HGAA 3I74A 3HI1A 3L81A 1QHOA 5CCHE 3LKSB 3MRHA 3V0JA 1GJWA 4LSTH 1KEMH 2ADJB 3T8XA 1KJ3H 5LQBH 3SDCC 4JO3L 2F5AL 4YPGA 2FD6H 3L1GA 4H7VA 1K3ZA 4UQBA 3K6SB 4ORZC 4MMYB 3IGFA 5DURB 2H6PB 2ZP0T 3BVWA 4PV9A 3Q5TA 2ZWNA 5EWIH 1FGVH 4ZO7A 5TQ2H 4ELME 4N87A 5TE4L 2MOQA 2NY0D 2YFOA 4ZS6C 2VDLL 5I1JH 2JI2A 2H1XA 1H6UA 1YHPA 4KY2A 1CDBA 1A6WH 4Z7WE 4P2OB 2VUOA 3AWEA 3O6FB 3CUPB 4UAOB 4IGBD 2HVBA 1XXDC 3KH4A 3QIWD 5DD6B 1NIEA 4JN2B 3CN1A 4WHDA 4BKLA 1DQVA 1I8KB 4RA0C 4Z3TA 3KPSE 3C60B 2AP2A 3QSKB 2XOTA 3RIAF 3MXVH 4LLUA 3FCSA 1CLCA 4KY1H 4KRPC 4ZW7A 2OSWA 3VXRE 1FN4A 4DH2A 2Y1YA 4G82A 2ENJA 2QHLA 3B83A 3V4VA 2R2HA 2YJQA 3X12A 1KYOK 1JPSH 3GJFB 1WC7B 2BNUB 3APNA 3CLFL 3F85A 3NJMA 4IMKC 3IT8D 1SOKA 2AHIA 4QLRA 4L8CA 1HZKA 4W9FC 1L0QA 4NKDB 1CCZA 1U2YA 2IPTL 4JFEE 5J7CC 3LZNA 3EO1B 1KGIA 1FZJB 2B4CL 4WO4B 2A6DB 3QA3A 4WAFA 3T0ED 1I8UA 7CGTA 3U0WH 2BDNH 4GRWF 4GRLB 4WWKC 3T2QA 1D5ZA 2JJUA 4UNTA 1ZT1B 3GMRA 1EJOH 1KTDA 3L4YA 3GRWL 1QEWA 4UYPA 4JG0H 2AABH 3WLBB 4DGUA 1AMXA 4OIAA 4IMLB 1YYCA 1SMDA 4G42B 1GS7A 1FFOA 1H9VA 1NUGA 1VACB 1J8HD 4OJEH 5FK9B 3MV9D 1X44A 5CZVL 1LD9A 3BH9B 4MJIB 1WTLA 5DJZB 2I32A 3FU0A 3GSOA 2B3IA 3EFFB 2A74C 1P1ZA 3EYFA 4P59H 3ZO0A 3GSNH 3BWZA 1F1GA 1SBBA 1R3JB 4W68A 5D6CB 4CC4C 2B5IB 3NJFA 5AUMA 3RTQD 2AXGB 5DJ0A 4L4VB 4I13B 1IJNA 1PX8A 3MRIB 2XLLA 1QLRA 4MJ5A 4DQOH 5F7UA 3BPLC 1K4CA 4E9LA 1V7MH 4NHCH 5DJDA 2X6AA 3WNPA 2Z65C 4F37F 1A7OL 3S9DB 3REVA 6FABL 1RJLA 1XSKA 1MRFH 3E1ZA 2X6VA 1R3IL 4HKXA 4PJHF 3DO7A 5LNGA 4Y4KD 5HDQH 1R5WA 4CC0A 3RWDB 1JTOA 2R29A 1V8HA 1XF1A 5DMJB 5JORA 1RUQL 5IROA 4HK0A 3VFVA 2ZYRA 3OZ9L 1EK3A 4HETA 1AZVA 1T83A 2HPOA 4E9RA 4JK0D 1E7VA 3O6MH 1FSKC 2DQTL 5KEZA 2CR3A 1E2WA 1I1CA 4X6CB 4UM9A 1F4AA 1TEGA 4X42A 4AL8H 2FX8L 5IV2A 4G8AC 1YEEH 3PJLA 1YMHB 1F90H 2C9VA 1OLLA 2A9DA 4JDEA 5HYFA 4HUVA 1URIA 4Q4IA 3IAPA 3EYVB 2EACA 1SMOA 3MV01 3K3QA 3FFCD 4KJWD 5JIQA 5F7BA 3FS9A 2NY3D 4JREB 2BSTB 2Z7ZA 2DQHH 3VFOA 2AJUL 1I8MB 3KDMB 3AT0A 1KELH 5A43C 1IVTA 2OMUA 1OV8A 5D7JC 4XP5H 3IU3A 5EN3A 1CR9H 1A8JH 3OAWA 5CP7A 3GT6A 4ONGL 4MCMA 2YPVA 1RKRA 1K2DA 3W9EA 1ZS8B 3OGOE