4A7VA

Structure of human i113t sod1 mutant complexed with dopamine in the p21 space group
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Binding and Aggregation of Pathogenic Sod1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7vA00
4A7VA 1IBFA 1UXLA 2C9SA 2NNXA 4U4IA 4A7GA 1MFMA 5KBKA 1F1AA 3KH3A 3LTVA 3S0PA 1F18A 4MCMA 4BD4A 3KBEA 1COBA 2ZKWA 2E47A 1AZVA 1IB5A 3GZPA 1PTZA 2Z7YA 1OZUA 1SXZA 2WYTA 1EQWA 1HL4A 1TO5A 2V0AA 2AQRA 3CQQA 5KBLA 4OH2A 2WKOA 2VR6A 2XJLA 4A7UA 2WKOF 1IBHA 1E9PB 3F7LA 4N3TA 3QQDB 1IBDA 1U3NA 2ZKXA 2AQQA 2ZOWA 1L3NA 5CU9A 1YSOA 3CQPA 3L9YA 2AQTA 2AF2A 3L9EA 1E9QB 3HFFA 4BCYA 1SXSA 4FF9A 1SXNA 1E9QA 2WZ0A 1SRDA 1EJ8A 2K4WA 1B4TA 1Z9NA 3RE0A 2WWOA 2SODB 2JCWA 2AQSA 2VR8A 4BCZA 1SXAA 3H2PA 3T5WA 1XSOA 1YAIA 2GBVA 1PZSA 4OJAA 1FUNA 2WZ6A 3KM1A 1OEZW 4L05A 2C9VA 2JLPA 2GBUA 1S4IA 1N18A 3CE1A 4A7GF 3HW7A 1TO4A 1E9OB 2ZKYA 1BZOA 1SOSA 3KH4A 4A7QA 1SDAB 4N3UA 3ECUA 2Z7ZA 4B3EA 1N19A 2VR7A 2XJKA 1F1GA 1JK9A 1IBBA 1P1VA 4A7TA 3MNDA 1E9OA 1PU0A 1QUPA 1ESOA 1JK9B 2AQPA 1SXBA 2APSA 1F1DA 2WZ5A 1CB4A 2AEOA 4MCNA 4A7SA 1CBJA 1XTMA 3KBFA 2WWNA 2WYZA 3H2QA 3KM2A 3PU7A 2AQNA 1HL5A 1SDYA 1BA9A 3HOGA 3ECWA 1Q0EA 3QQDA 1OALA 1E9PA 1KMGA 1SPDA 1JCVA 2Q2LA 1DO5A 3GTTA 3GTVA 5KBMA 1DSWA 3ECVA 1B4LA 2Z7UA 1RK7A 1OZTG 2C9UA 3F7KA 3GQFA 3GZOA 2E46A 1SXCA 2Z7WA 1YAZA 3MKGA 2LU5A 1UXMA 3SODB 3GZQA 1XTLA 2GBTA 1Z9PA 2R27A 1OAJA 3K91A
chains in the Genus database with same CATH superfamily
4PJAF 4N8PA 4P2RD 3HG5A 2NUTB 1A0QL 3IFNH 3MJ9A 4QAWA 3P30L 2PCPB 3MJ7B 4FHJA 2OZ4L 3FQRB 2R0LH 4BD4A 3FCGA 1BD2E 5D7EA 4ZO9A 3A6CH 2RJMA 3L45A 1L9QA 4LARL 4UNIA 4X9IA 4X8CA 5FLVA 1YEFH 2XWDA 4FQXC 3VTMA 2OKMA 4L5FL 1KDIA 4N5UA 4PW3A 4NZFA 2GEEA 3TBTB 5CKAA 1QRNE 3C6LB 4QKTA 5DRNA 3HC2A 2HB0A 4QXUL 4UOZA 1FDLL 2CKBB 3U7YH 2FZ3A 4E5XA 1P69B 2IDTA 3M1CA 5E6IB 4Q9RL 2XZQH 1VA9A 4HS6A 4I9WD 5J6GA 3TVMC 2QKSA 5I17A 4IRZA 4JHWH 3WY4A 5AVXB 3RWDB 3RP1A 1A6AB 3WTYA 1DQQA 4IOSD 2ATKA 1KWKA 1HSBA 3I2CH 3QZNA 2BNQD 4OJFL 4M5SA 2GJ6A 2DQIL 1ZA3B 5TQ0L 3KYMB 4K9EL 5B39B 4F2FA 1I8LA 1ZLDA 5IJCC 3QIUC 3UTQB 2OTPA 2ATPB 4LLYB 2K6WA 2GTZA 4LHQB 1IM3A 4HWEH 4P23A 3C60D 4H1LB 4IOIB 2VRQA 2GUOB 3VXUA 1IQWH 4KHTL 5IQ7L 3OR7B 3O3DB 3B4NA 4N0CC 3QO1A 4NT6A 5PCYA 1E50A 4UQ2A 3A67H 3AJ7A 1XMWA 1JZ3A 2X42A 4HUXA 4YUEH 4AV4A 1AD9A 4WW2C 1K4DB 5BZXA 3QFDB 1BEYL 3KYOA 5IMKA 1P5UC 5CO1A 5F6HJ 1CDBA 4K94C 2D03H 5A6IA 2X6MA 5D55A 4XMZA 5K5YA 2D2OA 2VE6A 3QHZH 5EF0A 4LEEA 3MRKB 3ME0A 1EMTH 1T83A 4PWKA 3TOPA 2YARA 1GPOL 3BN9C 3HHSB 1RHFA 3IWUA 4HT1H 4P2AA 4DAGH 5FECB 2V7HB 1I8KB 2J72A 5HGDB 1OPGL 1NC4D 2ZWZA 1ZWIB 3LPGA 2ZP9A 1ZT1A 4NUJB 4XO3A 1LQSR 2JQMA 4PRAB 3F7YA 1M71A 4LLUA 4YN3A 2VL5A 2H3NB 1VHPA 1E65A 4MQSB 1UB5B 3KLKA 5DZJA 3B9KD 3MOBH 4EOWH 2WVVB 3EYSL 3MGOB 2OMZB 2C9SA 5AW2B 4EJ1C 2JELL 1TQWA 3D3VE 1SJVA 5DZNA 4EPSA 5KYWA 3DJRA 4KJQC 2Y06H 3HAEA 2DBJA 4LCYA 3FRUA 2B2XH 2AXGA 3EADA 1G0XA 1KPVB 2XWJB 2R29L 3OAZH 3BAIA 4L4VE 3CV5A 3TEYA 1R5IB 1KEGL 3TIDA 4TLSA 5IR1B 3ESNA 3ULVC 2Q8AL 2F53B 2HFEB 3K2IA 3DX2A 2NQ3A 1JMZA 4FQQA 4YWGH 4F15B 2DM7A 2IO5A 1MFEL 3ZZ1A 4FNSA 3MRFA 4QTFA 1MSPA 1YHPA 3WO4C 3BFOA 3KVPA 2J6WA 4PSPA 3GKWH 1S5IH 5E2TL 2ZNXA 3MV7E 3MXWL 1M53A 3FT2A 4OFVA 1NC2D 1M42A 1HHHB 2NYZA 4OZHB 4XX1G 4NKOA 2D9QB 4PJAB 1OK8A 3NG5A 3Q6GL 3OC5A 4AX3A 3I9IA 2KLSA 3S5YA 4U1MB 4Q97A 1HYSC 4K4KA 1N18A 3QIBA 1WS8A 2HTLD 3BQUC 1UVQB 1NCNA 2ZKYA 3M8OH 5J11B 3EH5B 3PL6B 3M7OA 5C0JA 4R2GD 1YMMD 3P2DA 4ENZA 3RWEA 1KCKA 2V2WB 5EWIH 2ENPA 5C09E 1LNUA 3RL2B 2JB6A 4JQXA 5I1IL 4GUOA 4UT6L 2BCKA 2WP3O 1N7MH 1BQRA 1KTLA 1E9OA 4NRZA 2VZVA 4U6VH 5HHVL 1A3QA 3S35X 2EIJB 1GSKA 4NQQA 1H8OA 4HJUA 3SDAC 4XCCH 1KGCD 1X4ZA 3QYCA 2G0KA 3WEXB 3LQZA 1CD8A 4A6YA 5SWSE 5IJBC 2Z35A 4QGYA 4PJBE 1R1CA 5DVLA 3TX4A 1ZLVK 5IHWA 2P5WA 4C56B 1J87A 4DPBX 5IMMA 4W1TA 4EI5C 1E9PA 2YD4A 4J6IA 3II1A 1U58B 3AU0A 2IMNA 2ZXWB 3ECVA 2DKMA 2WCPA 4X9FA 4E36A 1AXTL 1CE1H 4LCWE 3SKOA 2WAQA 3GRWH 1T2QH 4I5BB 1SEBB 4HVBA 4FXGC 4ZQTA 2CBTA 2XTJC 2AJSL 4GP4B 4TL4A 3CN3A 3EYUH 1QATA 4KQ3L 4LRNH 4XAWL 1T22A 4ZOAA 4N2EA 3HBQA 2PR4L 1U8MA 5EHFA 2XQYA 2VSKB 1I9IL 2X4RB 1TF4A 4MHHG 1TTUA 3EO9L 2XFXB 3FU5A 4XGZA 4N87A 4IHOA 5C0FA 1X5FA 4F7CB 5DUJA 4RNRB 5I82A 4K7PY 1KBBA 1HINH 2X09A 3MRRA 4PJAE 3UOAB 2QVKA 4X4KA 1JWSB 4HFWA 5FHAH 1S3KL 3TIDB 4XPTL 1CICA 4LL4A 1G9NC 5B38B 2BH0A 1HDMB 2ZD0A 1LL1A 4N0UB 4HUVB 3NRPA 3BQUA 5EU4B 1YLBB 2X89A 5SX5H 1LHZA 1W8EA 2PPFA 1CLOL 3D4CA 3SBWC 2E7MA 3D4ZA 3DYMA 1VENA 1CZ8L 1S7WB 4EVNB 1JPSH 4O02B 3BEVB 4M5ZL 1JVOA 4ANWA 3F7YB 1JHLH 3MBXH 4PRAA 3VWKA 5LBSH 1AYRA 1IIIA 1FFOA 2R56H 1CT8A 4Y16B 1FE8H 5ESAA 3S34H 3CHOA 5LN8A 5DLLA 2F54D 2V7HA 2ZAHA 1VFAA 1YAIA 5HHNA 4FQJH 5F3FA 1E42A 3TWCH 5EU3B 2FHFA 5EU6B 4CGUB 4FLSA 4JFFA 1FFQA 5LAXB 4X9YA 2HH0H 1KBWA 1JRHH 4GXFA 1J12A 4ZW5A 5TF1L 3NCXA 3G5VA 2BVTA 2AAAA 1UOLA 1KCWA 1BZOA 2W1NA 4RBPH 4L4JA 1IAOB 5IMKB 4TTGA 5DEZA 4I48A 2GG1A 3JWNC 4JKLA 4DEWA 1LP9F 3BEWB 4LSPH 4HGWB 1EAPB 4R90H 1CURA 1KCLA 1TTRA 4UQ2B 4N2LA 4N8VG 4MCYA 3GBNL 2G3NA 1CL7H 1KPUB 1NH6A 4MA7L 2VM4A 4GUPB 4TLKA 2PXYC 1PW3A 2XG4B 4PH8A 4WI2A 5AZEH 1RZ8A 3C8KB 3CPLA 4I0CC 4AITA 2Z64C 3BKML 3CLEL 2ITFA 1WA0X 4HBQA 3BUPA 1HHIB 3HI6L 4Q6IB 2B08A 4HPYL 1UKQA 2OLDA 1E43A 5ADOH 3KYMA 3D2UA 1OP3K 4JQVA 4AENA 1ZA3A 3UJJL 4TVUA 4YO0B 5E0FA 2EE3A 4ZUUA 2X44D 2H0FA 3N1FC 4HISA 4LEXL 1MJ7H 1IC7L 2CR6A 1AGBB 2WUBL 1J5HA 3QEUA 1U8KA 5KSAD 2EABA 4CBPA 4O9HL 4AIOA 3L1GA 2AJSH 4XX5A 5FWQA 2H2SD 4P4KC 4N1CA 2WWMC 4JDTH 4NJAL 4HCFA 4FULA 1FO0B 2FHBA 3HC3H 2DKSA 5J1TC 4JL1A 4EMZA 1Z7JA 4HYTB 2RTTA 4FMKA 5DQ9B 5C0BE 5K9JL 1CLYL 1EGJA 2GSGB 3FSOA 5IB2B 1OE2A 3KGRA 3L5IA 2BDNL 3TEWA 1VESA 2ZG3A 3BPCA 1SVBA 3DMMD 2WIIB 5KBLA 3D4YA 4MDJB 4U1NB 2GY7B 4HCRL 3BYYA 1LO5B 4AQZA 4N90E 5DO2C 2PCPA 2NUTA 1WAPA 4RDQF 2VZOA 4JFPB 3M88A 2J8OA 3U30B 3DSFH 4PTUA 4WNSA 4TYUA 1CLOH 3LNIA 1GGBL 5DS1A 1EJFA 3ARPA 1JK8A 3QG6B 1SRDA 3MZGB 3CVIH 1EIBA 3GSWA 2AJZA 2VR3A 2B16A 4X6BB 1O0VA 4EZMA 1BYNA 4OI8A 4MAZA 3DSFL 2CNYA 3SN6N 4C47A 5D7JB 1PG7X 3VX1A 4L8SA 2QQKH 4DT2A 4OJAA 3HVNA 3IJYA 2OYKA 1UM6L 1HZHH 1UA3A 3H7LA 1UXSB 5FYJU 2UY7B 4Y4HD 2NNAA 5IUCA 3U6RA 5C07E 5CD5C 3CFUA 2BP0B 1WHOA 1DQDH 4N86A 4S2SA 3RVTD 2M2DA 4BFBD 2WOBA 3DNKA 3QFJD 1LO4L 4KH2A 4MJID 1PYWA 2P5EB 4NJ9L 3W81A 2BP5M 4OFIA 5TTRA 4AQ1B 1FFTB 5EO1B 4FG0A 4EIBA 4HFUL 1NCBL 1VACB 4FQXB 3GDCA 3HN5A 2ZSVB 3WTSA 1CD9B 4QO1A 1HX0A 2LFGA 1XGRA 2MEJB 1Z3GL 4YC2C 1D6VL 1EZLA 4POUB 4XCNB 1S5HB 3GIVB 2VDKL 4JPKL 3DXAE 3UTSA 4QJ5B 5F7DB 3QDMA 1V7MH 2B4CH 2EXTA 3VXPA 4H13C 3D18A 3O4LE 2CPCA 2XIIA 1CXLA 2ADFH 1IAMA 4LHUA 4OV6F 1FVCA 3D25A 4Z7VB 1J8RA 4X5QA 3K8MA 2ZSWA 3L7FA 5HJDA 4C4KO 2JKSA 1E3ZA 2R23B 2KLTA 4G5ZL 1ULVA 1R5VB 1YN6A 4U1SB 3GNML 3MREA 2NY2C 4WSGA 1YNKH 4PJHE 2WPGA 3CN0A 4F92B 4J4PC 4Y8AA 5EO9B 2FLBT 1EAJA 5T1DH 3M45A 4HKJB 3JWOL 3T6VA 3HZYA 3HI1B 4P5MB 3E6FA 1BPVA 2RCSH 3EOAB 5EZOH 4I8DA 3QUXA 4PU2A 1X3DA 5C0IA 1IB5A 3JV6B 1E4XI 1ANUA 3MRDB 1A0QH 1XL4A 4LHJB 3WS6A 4B9ZA 2XQYK 4FHKA 4CNIA 2WLIA 3BW9A 3PNWA 1WWCA 1JS4A 4AIZB 1E4HA 2A9NH 3LNEA 4H8HA 5E9AA 1GYAA 2Y5TB 3NJGA 4NOFA 3GSVB 4Z5RB 3QK0A 3N9GL 1T7WA 4HK3N 1WZMA 4ODVL 1XB6A 3AT0A 1RI8A 3JTBA 2QSCH 5F7KC 3GSNB 2KI6A 3FK3A 3CSFA 4GBXA 2W60A 2YJQA 2BVQB 4Z23A 4I13B 4Z8FH 4Z7QB 5H2BA 2C4FT 2HT4C 1WIOA 4JGMA 5F3HA 5ICXA 2BERA 4HP5A 3LNGA 3LZOA 1A64A 3WKMH 4AUYA 4I0PC 2EILB 4X4XA 2E6JA 1E2WA 2FEDC 1YY9C 4M7KH 4GRMB 2IALA 2ID5A 3VFVB 1L9OA 1YEJH 4ZD3H 1YMHB 2Z91A 2HPTA 2QGBA 4RX4D 2VTFA 2WY3B 2D31B 1NCCL 3GUFA 4GSUA 3FUNA 3FFDA 4XVTL 3V5KB 1JHTB 2IWEA 3NA9H 5H35A 4XCFH 5JXEC 1A4KA 3OKMB 5DJYA 4NRXB 4EAEA 3T6WA 2HTKD 2BPBA 5DMIL 3AXLB 4HIEA 3B7TA 1RZ7H 1I1AA 3UTTB 3DOHA 1NBCA 1MIEH 2E27L 4L3EE 1T1XB 3CZJA 3VFTB 1XH1A 4MLIA 4WHTB 1XF3A 2UXFA 4L3EA 1M2VB 5IVOA 1F0LA 5INDB 4YX2H 2AGJL 1L5GB 1TCMA 1MLCA 5EOCJ 2WUCL 2XPZA 1QVOA 4Y4HA 4BZ2A 4MS8D 4IKLA 1XCTB 5IHUL 2CJUL 5CGBA 4U1JA 1BFSA 5F7NC 1DQDL 3ZE0E 4XCCL 1ZE3C 4JFVA 3S2AA 2JKIS 4E9LA 3FT4B 4U1KB 3S0PA 4XBPA 1BM3H 4X6EA 1FIGH 3SD2A 2EDYA 1E2ZA 1NMBH 1TEGA 1QO3A 4GLRH 3A3YB 3S5ZA 5E08L 1THAA 1SN5A 4GXUN 4J3SA 4S0TD 4CMMB 1A6ZA 2DIAA 3BZFB 5F9OH 1SJXA 1VFMA 4UTAA 4HW6A 2JJWA 1FBIL 1X5LA 3GS0A 4JEGB 4TUKH 4R4FH 5IIEB 4H25A 5IV2A 3FYIB 1JWUA 2YC1B 5JIIA 1Y0LB 2FWUA 3BLPX 4AVKA 4HIHA 4UQ3B 1TLMA 4ANUA 5JOPD 2BVYA 2UY6B 3EO0B 3NEXA 3IJSB 4FP8L 4PUBH 5DSCB 3IDNB 5TQ0H 3C6LC 2VDNH 1D7DA 5K9OB 3REWA 1JZ8A 1BVOA 1X5GA 5FGRA 1RJZB 1J1XH 2AABL 4MXWL 3ILEA 4YE0A 4MNQD 1AIZA 3FBQA 3CFBB 2Y36H 4R5VA 4WI6A 1XF2B 4RSVA 3WNPA 1NGQL 4WJKB 3TZVA 3ZDYF 5D2LF 4HC1H 2DBLH 3GKZA 4IIQB 2GFBA 1FGVH 4DZBB 3OTTA 1N0XL 3H7BB 1SY6H 1VFBA 1JYVA 4G3YH 2VWEE 3O6LL 3OV6A 4Q2ZA 2YRPA 2A0LC 1ZVHA 5M95B 3NJIA 2XV0A 1PAZA 3GZKA 3VGAC 4AMXA 1MNUL 2SEBB 1U8OB 2ALAA 4F7PA 1AY1L 2JCCF 4PGBB 4JZNA 1JF6A 4NWUH 4JG0L 5MHSE 3FUMA 2QVMA 2WXNA 3ESUF 1JGVL 4M5TA 5HDRA 5KS9B 1IM9D 4KKRA 5DHMC 3I74A 5CNHA 5IBTL 1MCKA 1QLEL 2WTRB 4MQTB 4Y5XB 2FH8A 3ABMB 2Z65C 1ESOA 1JGDB 4IDLA 5FPIA 3O3EA 4YDZA 2F19L 5IM7A 4ODWA 5T1LB 3S35L 1ZGLA 5IVXF 1XMEB 5DK2B 3VD7A 2IXQB 5KW9H 1DJIA 2XTJD 1HQRA 2VUYA 2P48B 5J5EA 2EO7A 3GXFA 2F1AA 1FORL 2VL4A 3FH8A 5D4JA 3TNMB 4GJTB 1MCJA 1JGEB 1SDYA 4GQQA 5KSAC 5D7LE 2ZXQA 1P4UA 3S35H 3LH8A 3IJHA 1Q9KB 2VDRL 4RCAA 1MI5A 4RFEA 5PAZA 5HHOB 5ALCH 1CL7L 1UWEH 5FYKE 3L16A 2WSKA 1G9EA 3T0EA 3QDGE 3A4EA 2NR6A 4UDTB 4A2MA 3HB3B 4FI6A 5EOQH 3AROA 5MERA 4BSWB 1KY6A 3BH9B 1IKNC 3JV4A 4F9PA 5I71C 4WY7H 4N2GA 3KLHC 3PDOA 3ILPB 4UOQA 4WENB 2FT6A 3BKJL 3SDCD 5J1AA 3RGVC 3L2LA 2OJEA 3OKLA 1LO3L 1QPPA 3QJQB 5C0ND 1OT1A 5CF3A 4J6RH 4JDVB 1BFVH 4G80B 2NX5A 2DQIH 2F9BT 1WAEA 1GYVA 4OZFA 2DQGH 3WNMA 2X4NA 3CZFA 1PSKH 4KK8D 4QRTB 5FKPA 4POYA 5AD0B 3ZYOA 1KIPB 2ORBH 4UAHA 4WW2A 1AMXA 2DY2A 5C0CD 4JFHE 3GJEB 3RB5A 3VFMB 4C56D 4YDLC 3DVIA 4F9LC 4ZMOA 4QXGH 2OTUA 4HX1A 2GBAA 4E9WA 3IJ9A 1A6TA 2X4UB 5DS8A 3CVDA 1WT5A 2H45A 3EJUA 1X5AA 4OQTH 5HJBA 4H2AA 1OTSC 4NC2B 1H8LA 5AOMA 1GCYA 5B1AB 5I1JH 2FL5B 1E3XA 5IUSA 2HRPL 2P49B 1IEAA 1Z0NA 3QISA 4LP8A 1F3JA 3FUJA 2KQNA 4N9OB 3P73B 2D73A 1CF1A 4Y2NA 4PRBA 3D51A 4NQEB 2NXYD 3VGGA 3WNOA 3UZVB 1NAML 1UWXK 5KYUA 4NN5C 1NANI 2A6DB 3ES6B 2CKBL 1K4CA 1EEUA 1LMKA 1PF3A 1K4CB 2GJZB 3N44F 4S1QH 4MMXB 5HVGB 3L3JA 3Q48A 4L0ZA 4NIKB 4M29A 1RZKC 4F9LA 4A7TA 2DI7A 3FYEB 2X6BA 2FEEI 1JK9B 1T2JA 1VCAA 2WJ5A 1SN0A 3P73A 5DVNA 3VXTB 3O0LA 4H8VA 2F08A 2Z8SA 5I5RA 3MNWB 1LEIA 4GG6F 1R3LA 1JFHA 3KVQA 4MMZB 1OAXH 3LAFA 3EDDA 3Q8EA 1T0PB 4N6RB 3LKSB 1AI1H 1MREL 2O30A 3KXFB 4IEFB 4L5FE 4NQEE 4PLKD 6PAZA 4AW4A 1S7XA 2EH7L 2OTUB 3MACH 1PX8A 3C5ZB 4P46D 1JXFA 2A5UA 1G94A 1G7JA 4K0OA 4KGLA 4X80H 2VH5H 3ZE0B 1ID5I 3U4EA 3CHSA 4FNLH 1INDH 4QTHB 1UURA 4P9HC 3CZFB 4QRTA 3VXMB 2HJFB 1IGIL 3FT1A 3C9NB 5GS1A 3UBXA 4WF7A 4KJWC 5I66B 1DDTA 3MUUA 5CJOH 4Z7UA 1CTMA 1NMCB 3LKPA 1L7IL 2IFFH 3OKLB 1KYOJ 4QNPE 4G7SB 3T6XA 3S4SG 5TE7L 4XVUD 1UEMA 1N0LB 2BVPB 4Y9GA 4DW2L 1QKZH 4BM7A 5DD6B 1M3IA 2XG5B 5DHVA 3UG5A 3CCHA 5A6MA 4O2CB 2F5AH 4ONGH 5HHOD 3QAZB 3UIYA 1KELL 1UHVA 3B7RL 4NAQA 4TUOB 1EDHA 4PB0H 3INOA 1D9KB 5F6HI 3BWUC 1YNLL 4AQOA 1KB5A 1UD5A 2M1KA 4PMEA 5DQJB 1VZHA 3DIFB 4XRCB 5I74C 1F42A 3SDCC 3DGDA 1YECH 3CZSA 4G6KL 3BP6A 3VFRA 4F2EA 3HHRB 3W39A 1QASA 1QR4A 5FXCH 5TDOA 1EEZB 2DS4A 4PRPD 3MROA 1HXMB 1PLBA 1F4XL 1W15A 2X9WA 3FQ1A 2EDHA 1VEMA 4ODWB 4RZCA 4ADIA 4J6RL 4BE5A 2YUWA 3FAXA 1NAKL 2E9JA 3CBRA 1QABA 4ZX4A 1NCIA 2AQ2A 2YQ3A 3UP1A 2O5XH 4H88H 3ZDZF 3NIDB 5JIQA 3KDMB 1BF5A 1XR9B 5AW7B 3S36L 1RLBA 1MNNA 2ESVB 1NINA 1J1OL 1E8YA 2GT9B 5B38G 5E08H 4M8QA 4TULL 1B2WH 3NSDA 3ULUL 2X70A 3BQVA 4UIKH 3SY0B 1RK0B 2V6HA 1NPJA 3ZBMA 4FNQA 4TUKL 3MBEA 3BDBA 5FFGA 3DTXA 4K94H 3DX1A 3HRPA 3H7BA 4RFNC 3ETSA 4ES9A 3JQOB 1S7UA 2VXQA 1E4WH 4AH2A 4KHTH 5IQ7H 1OTTC 3VXRD 3HCVB 3CFBA 1IQWL 1SZNA 4Y2LA 1QZ1A 3VI3A 1GY1A 4FEMA 5JMOC 1CFVH 4YUEL 3V0FA 2BNRD 4PRDA 1BZ9B 3FO0H 3HPJB 4ZMPA 4QOKD 3BZEA 3BUIA 1MRCH 2OMXB 3TURA 2UY6A 2OMTA 2XT1B 1K3ZA 3BXNA 4UI2A 5MEND 4NFDA 3U1QA 5IBLD 4YNYB 4BUHA 4DP0X 2P44B 1BZDA 3DYPA 1W0VA 5AAMC 1T66C 3HRZB 1FZJB 4FLOA 4PGEB 4D0CB 4GRWB 1G9NL 3I50L 1ZPLA 3SOTA 4PJDB 4DP1X 4JFOA 3MV9E 2PTVA 4PRHE 1ODAA 1TPXB 3DGGA 3WEBA 2V8MA 1AG6A 1CTOA 1ZANL 3CVIL 5EDSA 2IPKB 2C4FU 8CGTA 2BVOA 5T5FA 3ZKNC 4ZPVB 1NAMB 3L6FB 1XGQB 3IDYB 2DDQH 3DTDA 4FX5A 3X2QB 5JNYB 5BVJB 3EXLA 2JJTA 2ADJA 4UT6A 2Y5QA 5ENWA 3MLSL 4F7MB 1NOFA 5CSZA 4MRCA 5LVEA 4QPEA 2AF2A 1C9SA 4WWNA 1T1WB 3P2TA 5GIRA 3LRLA 1WEJL 2I9TB 5CWSA 2LTQC 4RAHA 1EVUA 3GBDA 1FORH 2DTSA 2V2TA 4UIMB 4MVBD 4WFHE 4Y1TA 2AXJA 3O41A 5LXGL 5INDA 4POZD 1QI5A 4U4BA 3BLBA 4OJCA 4A68A 3FTYA 1MFAH 1CGSH 5EZJA 4FQ1L 4GI8A 5BJTB 3M17B 4JFXB 5E99L 1OEZW 4Y4KB 2IGFL 4AE1A 1I1AB 1SLWA 3V7AG 4Q7DA 3B3IB 4PRID 4WI9A 3KCWA 4OLWH 1MFEH 4HIEB 2NY6D 3H53A 5ERWB 3LS5L 3CH1B 4WUUD 3TU6A 1HHGA 3KPRB 4AWJC 1SDAB 1U3HB 5GRVL 5T1KB 1FP5A 3TO4B 1HSAB 3O81A 4LEXH 4WWKB 4YE4L 4JGNA 3KCPB 2QKIC 3L3IA 2CBQA 3ZHKA 5GZOA 2MNJB 4I77L 4RQQA 1OF2A 1AHKA 3B2UC 5I19L 1HINL 3L3OB 5GRUH 3VFVA 4M5YL 1FN4B 1MHHB 2DPKA 3NZSA 1O75A 3GFUA 5IF0B 3P40A 3VXOB 1U4EA 1NLBL 1P7BA 4Q6IC 1DJZA 5F3HB 3PP3H 3C12A 1Z32X 1DUYA 2E59A 4WUUE 4HAGA 4N8CH 4WFGD 4DO5A 2ITDA 3H8NA 4G6AC 3K6NA 4AK2A 3WXVH 4EQ3A 4BWWA 1TT6A 8FABB 3MU3A 3S5LA 3PF2A 2NNCA 1JHKH 3MSPA 4KDVA 1V8HA 3U4AA 1BHGA 4JQIL 3LH9A 3HA0A 2G9HB 2KMWA 3VGEA 3HS8A 5C09A 5CAYB 5LUMA 3KLLA 1F4YL 1SJMA 4X99A 4NCDA 5T8IA 1UXMA 4JHZA 1MCOL 1DUYB 4HSQA 2ICEB 5EN2B 2B1AL 4FYQA 4NNPL 5DCCA 4LDCA 5JHMA 2DMHA 5HI4D 2OL3A 4FS0A 3QUXB 4JN2B 5D8JH 2APVA 2E75C 3EOAA 4LNRA 1I3GH 3HG2A 4P59L 4XOBA 3NCJH 1B0RA 4G6ML 5AW5B 4R4NC 3H3KA 4QRBA 4N8VB 1QRKA 3ULVE 3WIIH 4OLEA 4BSJA 2O6DA 5JUEH 3NIGB 2P42B 2V4LA 3SDXA 1TJMA 4R90L 3KNBB 4N0FB 1BVNP 1OB1A 4PI2A 3FSWA 5BQDA 2WQAA 5HY9A 2NY0B 1MHCB 5GS0L 1WV7T 5FOBA 3UCQA 2OI9B 5SWQA 2COVD 1MF2H 2F7RA 5IB3A 3PAZA 4JFYB 3T4AC 1WHPA 3IEAA 1J1PH 3I3DA 2OP4H 4FFVD 1E9QB 3CXDH 3DTUB 3FU7B 1N64L 4BGLA 1TJXA 2AITA 5T3ZE 3O0RH 4HJTA 4QXWA 1AO7A 5F7DA 3GLEA 4M1CC 4ZFOL 4ERSH 5ETUB 4ZUTB 1AVAA 4LCIH 4LOFA 4CA4A 1G7HA 4GUCA 2ICWA 2XBDA 3G7TA 1MFUA 2ZSVA 4JNXA 2IQAA 2Y69B 4FQXA 2NW3B 4K2UH 3T3PB 1A6VL 4R97B 4DEUA 4F7MA 1FL3B 3X3GL 2J1XA 3HW7A 3B3BA 3NQIA 1QQDB 3VD2A 1SFDA 4L4TA 5T3ZH 2FR4B 1RVFH 5F71A 1TU2A 1OCWH 3KW8A 2AK1H 4LOUC 1WGOA 3BOVA 4UTBL 1DCEA 3O4OC 2DDQL 5AVQB 1BAFL 5G4NA 4G8IA 2N3JA 3HC3L 3GNMH 2I26N 1K6QL 1T89A 3T4AA 5HDWA 1AGCA 4KKPA 3WEOA 2VB5A 1J9SA 1KN4L 2EDWA 1I7ZA 4D0CA 2BDNH 1FZJA 2FJFA 1CICD 1YQVL 5CD5D 2E7LA 3IFNL 4TVPH 3MVSA 4L8SB 3N44B 2DWDB 2CO6B 1ASQA 2Q6WB 1G4MA 1IVTA 2E4FA 3CVHH 4MNQB 4FQHA 1EA9C 1HL9A 1U92A 2AJZB 1IV8A 5BV7H 4X4ME 4OCYL 1YMME 2R1YB 4GB9A 3HZMA 3ZK0A 2JE8A 1L7TH 2EDOA 4P4RA 4WK2B 3T3PE 3VI4B 1DJYA 2V2XB 3O45B 2ODIA 3F6IA 2GVYA 2O1AA 3ET9F 3QQXA 2P7TB 3TJEL 2L0DA 3P9MA 2C3XA 2NSXA 3IU4H 3AT8A 4ZMLA 3CN4A 1LO5A 3RWGB 4MB5A 1S7UB 4U1NA 1AQMA 3JVFC 4PGCA 4RAVA 2QQKL 4Q0XH 1UXLA 1TQCC 3WN6A 5HYIA 5AW1B 3HI6H 4Y7OC 5IB2A 3KJ4B 4WI0A 2RHEA 2OV0A 1RK0A 2X70B 4NKQB 5EZLB 5T5NG 1HI6A 2X0VA 3SY0A 4MTMA 3ZTEA 3B5TA 1M7XA 1U8JB 4WEBL 3KBPA 3WNLA 2FD6H 5E94A 2IQ9L 3FCSB 2BSCA 4NZUH 4W6XB 4C83B 1CGVA 3THMH 3WJJA 1J1OH 1U8KB 4IRJC 5JR1H 3KDMA 2LU7A 2WWKO 3C8HA 3IDMA 3BT2L 4JAMB 3T77B 3DXAB 1RURH 2HSIA 2I9LA 4PJ9A 3AY2A 1PG7H 2E3VA 2KERA 5LGJB 2CUAA 4NNYA 1SBSH 2PCYA 3QARA 4V2BA 4ALAC 3QNZA 4G83A 2AANA 5K9JH 3VYNA 4ODSL 4NIYE 3GHBL 1B3IA 5SWZE 2OSYA 2UWEE 4PLJD 5TDOB 3PG2A 3BPOC 4H8WH 1ZHNB 3ZZQA 2DZEA 2QDWA 3FFOA 2PP7A 5GS1C 1TJHL 3G9AB 1NCDL 2C3GA 3MRMA 3AREB 4DZ8A 4PJBF 5DQJA 1RZ8B 3C8KA 4E9SA 4P59H 4R97C 3SB3A 3S98A 3VSQA 2W8CA 3PP4L 4MCYB 1YNLH 1HTYA 4HWNA 1FZOA 1H15B 1U2HA 4PRNB 4Y5VA 3IETA 4XPGL 2WVTA 2XKNB 3CLFL 4AGNA 4JM2A 5FX3A 2XN2A 1SF3A 3BEWA 4Z76A 4M1GL 4AEHL 3DIDA 4HF5L 3F7QA 4O2CA 4W93A 3SJVB 3TESA 1ACYL 3KPPA 4NZDA 3CDFA 3V79C 1IAOA 3ZZSA 2F58H 1GHFL 5DHVB 5BOPA 4J3BA 5DJ0A 5FO9A 2G5RA 4PWGA 4XVJL 5D1QE 3LKRB 4JFZL 1SOXA 3HE6B 4FQIL 2Q7YB 2CIIB 1T6WA 4OVVA 2ZUYA 2D7MA 4JFWA 5I1EH 4Z7UB 2YJLA 4JL2A 1G9NH 3I50H 3NK3A 3GHEL 3ZY7A 5FA3A 2FX8L 1UZ6E 3EYUL 3DVGA 3NTCH 1YCSA 3P4MB 2EJ1A 3UJIL 5FO8B 4QTHA 5FYJH 1I9IH 1OALA 2J4WL 1BMWA 5FYLH 3GMNB 4NHUB 3KL5A 3BEVA 4H4NA 5BUPA 3H1ZA 4IBZA 3H9SD 3EHBB 3GXNA 2C3HA 4P0DA 4WU5B 4TV3A 1CXHA 1ZHBA 3HEIB 4J27A 5GGQH 1G6RL 3OLIA 1BBJA 1RH8A 5KVGE 3LKSA 3HZ3A 4MMYB 3UL4A 3BZDA 4DKEH 5IT2L 5K69A 2NLJA 2F68X 1FFRA 3O11B 1HDMA 2DWYA 3AQDA 3QCTL 4IK6A 4LLQB 4U6YA 5C2UB 5JW3H 1W8NA 4H0HB 2YAHA 3MBXL 4RNRA 4LVNB 1SMOA 4OZGE 2GI0A 2Q7AA 5EUOE 4IHOB 5C0FB 5CSBA 1BLIA 1GOFA 1B9KA 2B0SH 2XXMB 4M8VA 3QI9B 4OD2A 1N2RA 5K39B 4OM1H 2C1PA 4OF0A 1N67A 3ABGA 3L3JB 4TLTA 2EUXA 5FGBC 4FEIA 2DD8L 4Y2DA 4LLDA 4FABL 5BOJA 2WXGA 3JUYA 5L8JB 1ZTXH 3DK0A 1KT2A 3KHQA 1V3LA 5FDYA 3BD4A 3BUQA 1C5BL 1UC6A 5CINH 1BPLB 3B2PA 1BBDL 5E6IC 3UZVA 4G8GB 3ZVVA 4PRBB 1B4JL 1ZXQA 1XAKA 2J1WA 2Y1YA 1QSEE 3O8XB 2VDLL 3ULSA 4U1GB 5HHME 1OQXA 1DQML 2RQEA 5MI0B 5IMMB 4IS6A 1Z9NA 1KEML 3EKCA 1WFOA 3LIUA 2OZ4A 5G5DB 5TDNA 2C9XA 2EC9U 4JVUA 1DLHA 1JFQL 3WEXA 5KBDA 1T5XA 3QWRD 1ZDQA 3F7RA 1OAYL 4LCWB 3HZKA 3FN9A 2WYHA 3C5XA 2C9VA 1YECL 3C2AL 4G6KH 3UYRH 4NLAA 2YXWA 2NR6C 4K8RD 3CE1A 4TNWK 2BY2A 1E4XH 3QEGL 1AANA 4ORGA 3GJFH 3KH4A 3D8MA 2BOCB 1UKSA 4W81A 4GI6A 1OOAA 4LMQI 4KGJA 2VOTA 1WA2X 2MPAH 2V2WA 2AEWA 3IU3A 1CDJA 1IFGA 4QRPD 3WDJA 2X4NB 2CDEB 3GSOA 1UVQA 4EN3A 4OZIF 3CZGA 1NL0H 4BQCA 5DR5L 4PMFA 1MCWW 5IMOB 2CBOA 3J7HA 3SYQA 3WFBL 1BD2B 1TKWA 4HDIB 1PDKA 2UUDK 1OCRB 2BVUA 2BJML 3OLGA 3LS5H 5J06A 4P5TB 3OPUA 1HCYA 4JO5A 4XB7A 1BA9A 5SWSA 4P2RA 4KK8C 1R3JB 3G5WA 2FYYB 4RGNC 3DOSB 3K8LA 3VJ6B 2EXYC 2IC2A 2FH6A 3KPOA 1TMCB 3RNKA 1W72A 1BYOA 2EEBA 1OM9A 5TF1H 4ZNEE 3K2KA 3Q43A 4PJGE 1ROCA 3VD3A 1LEGB 2UZPA 5DMKB 1EERB 1AOHA 1L0PA 4U6XA 1O9WA 1TQSA 4G42B 4ISVB 4YHPB 2P5WE 2CK0H 3SKMB 2VDML 1CFNA 1ZGLB 3ZT5A 4RA0C 5T1LA 1F18A 4PJFF 5ID0B 5MP6L 2FO4B 3P3UA 4XO9A 4OT1H 4TNWF 2GAZB 4Y5YB 4IJ3B 1JZDC 2EXWD 2ERJB 4JFFD 4CVZB 3MGOA 3ZZLA 1JYWA 2MJWA 1IGML 3D07A 4F8NA 1JWMA 2V5TA 4NQDD 4MD0B 5KS9A 5IVZA 2MNWA 1K8IA 3HS0B 4Y4FC 3BSZA 3O6KL 3O6FD 3OF6D 5EIQA 4I89A 3FTGA 1K6QH 3GI9H 4P4KB 1UM5L 3QDAA 4PJHF 5FECA 5DMYA 4B96A 1VB9A 4GRWF 2H0PA 3FSAA 3AQXA 2H3KA 3LN4A 1DZBA 3MRKA 3V4VA 4L4VB 1S7RB 4BHUA 1VEPA 4GG6B 4DZBA 1EAOA 1KJVB 1SXAA 5HI3D 2NT1A 4JFFE 3ARFC 4DKDC 3PGFH 3ZPDA 2E7DA 4XPHH 1ZLWH 1GZPA 3FUEA 5D4QA 2VZ3A 5D4HA 3MLPA 1XF2A 4PUBL 4XC3H 1YUHA 2PO6B 2WJ7A 4EI6A 2LLNA 3L4TA 2X2IA 1RJZA 2DM2A 3EGSA 4HUXB 4A7GF 4Z6AT 3KXFE 5LXGH 5T1KD 2JK5A 3I6LD 4MXWH 2QADB 5BS0B 2I07B 3OR6B 4UZSA 2Y7QB 3IJSA 4ZMZA 1QNZH 2MWCA 2P3YA 3SDXF 5AB9A 4P23B 4HXAH 4M6AA 3AGWA 6TAAA 2WLKA 2ZAIA 3EHBC 3MNDA 1UH3A 4LLWB 2P5ED 3PFQA 5IIEA 3APCA 5FM8A 3NCFB 2DEXX 3MOQA 4BUGA 4KZEL 2WXJA 4HEME 2GJ6B 4JK0D 3QJFB 5KVGL 3PIQA 5I1HH 1NPNA 1OP5H 4HZ1A 4X6EB 1DQQB 1A6AA 1IGYA 2N7SA 4MDIA 4XMPL 1XT5A 1PFOA 1PLAA 5D1XE 3GGWB 2KH2B 4U0RC 3WIHA 3VD0A 1CWVA 2YWZA 5JO5B 1IGCL 2XHNA 3SE3C 4X7SL 3VXSA 1XCTA 3DO4A 3EYFA 2HG5A 3HMXL 3RU8L 5LQBH 3KPSB 4JO1H 3J2PA 2ZP8A 1XWVA 2EH8H 4JG1L 5AVUB 3WNIA 5AW0B 3KWTA 2XZAL 4TPRH 2X2JA 2CRZA 3PPSA 5KOVC 4PVLA 2X4PB 3IN2A 3EBIA 3DROA 4ZXBB 4KXDA 5IW1B 3TF4A 3PJLA 4BEIA 3FQRA 5F9AC 1KIUA 3PJNA 4PJBA 3PHSA 2XQBH 4G7RB 3PABA 3ARFD 3H0TB 4XZUB 2E56A 4JLRA 1VGEH 3TYGH 5B8CC 1JNJA 5LHDA 5FKAA 3V0VA 2PW1B 2F18A 3GM8A 3I2CL 3OKMA 3QJUB 4RWYL 4P2QD 2PXYB 3OJDB 2YA0A 4U0RB 3X1GA 2I25N 3R4DA 4A7UA 1DN2A 1KY7A 3I3EA 5E5UB 1UJ3A 1RP9A 5DEGA 3LV3B 1QD0A 1NKGA 2CHZA 4YFLF 5MENB 1UATA 1I1CA 4NRYA 3RHWF 4XVTH 3QJVB 3AW5A 2DM3A 3GSUB 3MNZB 3ATAA 4PS8A 2ZJSH 1I1YA 1O6SB 3MV8A 1NCUA 5CMAA 1JERA 4YHML 2R2BA 4WO4C 2AJVH 3ZDZE 2EUZA 1R24A 4GS7B 4OUUA 3K6SA 1CTNA 2VWEC 5D7SL 3CFTA 5AOZA 2HH0L 1CI3M 1UZGA 2BS8A 1S9XB 2EH7H 4P2QE 2PPCA 2VDKB 4FCAA 2VN7A 5IQMA 3L2NA 2NPLX 3HBGA 4KXAA 2YGVA 5EUKA 1J5IA 4M5YH 3V4VL 1YMMB 4JMXA 5D7IE 4EUPA 4MNQE 2BFVL 5IT2H 2R2HA 3BVXA 3BW9B 3PNWB 1AAJA 5EC2A 2BX5A 1ZDSA 2BSRB 3S36X 5J1SC 4XNAA 2EE9A 5EIIA 5DMJB 1DFXA 2O6CA 2VRKA 1U42A 4HK3J 4WWKD 5IQLA 3BMVA 4QRRA 2VXSL 1QWHA 4I1RA 5EO0B 2QGDA 2OMVA 1QSFE 3GK8H 3VE0B 2ZYSA 4W9IC 1I9JH 3O2VL 5I76A 1INQB 4KDWA 3CHRA 4WKZB 1NCJA 3TZVD 1A66A 4JFQA 2EEXA 4WFFE 4JFDA 5FM4A 1TFPA 1EBAA 5DJ8A 5IFHH 1JI2A 3D39E 4XC3L 1SPDA 1CLCA 3O6FB 2PR9A 1QR1B 1XXDC 2A77L 3GPSA 1HL8A 4P9HH 1TEYA 4O4YL 1CK0L 4X5RA 1LP9E 4UBDD 3BI9X 1IAIH 1H8NA 4YQXL 1YAZA 2BRQA 2CCLA 2XLLA 3OKEA 3U1PA 3V6OA 5JORB 4XMTA 3BUYB 4KROB 5TQ2H 2HX7A 3BP4A 3D18B 3WCYA 1Y6MR 4HPOH 4XC1L 2MKWA 1NCBH 2X4QB 3SSGA 4Z95L 5D7JC 3UTSB 1S5HA 5CUSH 1W9XA 3QEQE 4NQUA 4XNDA 3EW3B 4R8WH 2NY5C 2YXMA 2OYMA 4XP4H 5GGVH 3GMQB 3JTSB 4LRIC 4EE2A 2EVHA 1U95B 1UWYA 3ESMA 3FO2B 1FRGH 4OFDA 5SX5K 1FNEB 1R3KA 1QFUL 4Y0GA 1DQJA 4QRUB 4R7VA 5BRZD 2L8AA 3NPZB 2A6JA 1VIWA 3HAEG 2D03L 3U7WL 1KJMA 4OI7A 2ENQA 5E1IA 3C5SA 4H0IA 2CAKA 2ZIDA 2ZICA 3EGXB 3VDAA 1OSEA 2IANA 5DWUH 3TCTA 1NUFA 1XGZA 1TJGH 5EC1A 3GMMB 4ETQB 3HAEH 1A3RL 4TNFA 3V6FB 1KCRH 3DRTB 1EDQA 3BVUA 5T3ZL 5BCAA 5D5MB 5F1SA 4PTTA 4WW1A 2QR0A 1T0MB 2HT2D 2XWZA 3JSSA 1AGDB 4FF9A 3F7VA 1H5BA 1K5NA 4LO9A 3T0ED 3ZT6A 4N9GA 5I9QC 1CBVH 3ZE1B 2V9QA 4AQEB 4KKAD 4H5SB 1FJ1B 2VUKA 3MFFB 2WYIA 5M94B 2Z8WC 4OF3A 1T4WA 1CUOA 5F7MC 4OUOA 4Z77B 1AO7D 4OLUH 4BH8A 1SVCP 4JKMA 1WK0A 2G5UA 4ZTPH 1BSIA 4XNYH 4KMLB 4KY1L 4UTAH 2CJTA 1DFBH 1GGCL 4LKXA 1BGXH 3T2LA 4HS8H 1IAII 3MLTB 3P3YA 4HLZG 4XPFL 3TVMB 4KKLC 3IVKA 4KQ0A 2BSTA 1KJ3H 1SYVB 2GPZA 1PZ5A 4XP6H 2LOEA 5K59F 4HH9B 1TITA 2AQPA 1XXFC 5TE4L 3QDJE 3CUPA 1QFWI 4HKZA 2HYMA 3I75A 4TOYL 3K4AA 3T6ZA 2OK0L 1CGWA 1AO7E 2EIDA 3OLDA 3WKQA 3RFZB 5GS0D 4KKCD 3WHXB 2UVFA 3US0A 1JPFA 4P2QA 3UDWC 4Z7OF 1P0SE 2NX5E 2DBLL 2VLRA 3F83A 3WNKA 3SE3A 3TASA 2PO6D 4JFTA 2EYSA 4TVPL 1N68A 3IAPA 4X4ZA 5E00B 3BFWA 3BKJH 4HUWA 5LCVH 2KZKA 3EF7A 3O6LH 2Z7UA 1I75A 1R5WB 1C7TA 5DD1H 1YPZF 1B9ZA 5GZNA 1MDTA 1Q0YH 5DEFA 4OKVA 4AYBA 5DYFA 4YO0A 4ENED 1Z9MA 5I8OL 4FN0A 5F88B 4BINA 5FFLA 3EH1A 2CUMA 1AR2A 2CBMA 3BIBX 5F72S 1T21B 1XGTA 3R7QA 3N5AA 2YQBA 1OLLA 2WTOA 1RPKA 3FRPB 2XXFA 2C3VB 4DPCX 4UQDA 3BGFB 4EN3C 4YPJA 4NLHA 4P2OD 2IOIA 4J5VA 1MZZA 1LP9A 7PCYA 4AYFA 3NJNA 5I8CA 5FO2A 3MGTA 4M6OH 5C9JA 3N1PC 2ALWA 4GUPA 3KBEA 3VRIB 5E5MA 1COBA 2X4OA 3NCWA 3WKNA 3FCBA 3ABKB 3KPMB 4GW1B 3ZQXA 3ZU8A 4XNMB 3G5YA 2QTEA 4PLJC 3MLWH 4RAUB 2XWTA 5GGUA 4NQCE 5IBLC 1EO5A 1I1FB 1KLUB 4OGAD 4YSTA 2B39A 1Z9SB 2AFNA 3FL7A 1JV5B 1KIQA 4OCMC 2WVUA 3IXAA 1I8IA 2R83A 5E5RB 5I0ZA 5JOFA 2DQJL 5DA0B 4ALAL 5CBEA 1A47A 2AEQL 4GKOA 3DUUA 2CHDA 1PL3A 1KCVL 5BS0E 1QLEB 1UTDA 3MA7A 1BM3L 1CYWA 1HWGB 1N10A 4NM4L 5JW4N 5DS2A 3MRBA 3ZTNH 4S1QL 3RTQB 1SVZA 4AJWA 5DUMH 4WFEE 5IHBA 5HHNB 4Z7WE 2H1PH 2ZWNA 5DVKA 2J56A 5AEAA 4G6JL 3OKKB 3WE6A 3SO3B 2XDHA 3EJSA 1RJLA 3L9BA 3MUHL 3UJTH 4PJ7B 1XF5B 1IEHA 2CLVB 3WU1A 4F8OA 1L9MA 2GBUA 3LN9A 5IWLC 1ORSA 3IE9A 3P1VA 5INCA 2IMMA 3TGXA 4DP6X 1UT9A 2FX8H 4URTB 3AQYA 1MCOH 4UF7C 1QACA 3O6FC 2HVKB 2AABH 4XP9L 1BYPA 3W2DH 1PCSA 4ZK8A 3D30A 1HIML 3TA3B 4Z7OB 1RK1A 3F5WA 1N6VA 3HFML 3B9DA 4PW9A 1UQSA 4WLCA 3QIBC 1UA6L 1VDGA 2YAQA 3DECA 3UC0L 3QUMH 1QEWB 3ML9A 2BZDA 1N6UA 5LXVA 2LE9A 5H37H 4KDTC 1DBBL 2ZCHL 4PBVC 3ARDD 2Q6WA 4MASA 2ZCLH 1YPZE 4JDTL 3WGUB 3A21A 3E6HB 5HD8C 5FYLD 3ECWA 3M46A 3VXNB 4AV5A 5F89B 3B7UX 4KUCF 3EH3B 2A73B 2JJUA 1OARL 1SEBA 1TZHB 2E7BA 2EVJA 1EHNA 3IRPX 4N2MA 2GY5A 3HG1E 5IROC 1XF4A 1DLFH 1HXYA 4M00A 4OLXL 4XP5L 3HIZA 5SV3A 1JUFB 1J8KA 2P5WB 4C56A 3UABA 4EDXB 2VZUA 5CP7A 1ZA6A 4X6FB 3KAAA 1SBSL 5E56A 3N1MC 4OIIH 1EFXD 4GNKB 3P4NB 3QXUA 5E2JA 2Z35B 4F27A 1SNRA 1G5AA 1X6NA 5IY5B 1MH5B 2WUCH 3CFJA 3SQRA 3RWIA 5B4MD 2VERA 2C7UB 1JXJA 4FKHA 1XL6A 2IEPA 3BKMH 1NFIA 3NJJA 1QLRB 3NOIA 1NEZA 1YDPA 2XC8A 4NRZB 4OAWB 4BZ2L 3Q5OA 5GGSY 4PJ5B 5I5MA 1E28B 2AZAA 2JKLA 1P7KB 1WCBA 2Z8RA 1EVTC 4JDZB 4G9FD 1RUPH 3GDBA 1YY8A 4LVOC 2VUOA 1X9LA 2G2NA 3SDCB 3B34A 4NPKA 3VGHA 5AFAA 3GMPA 4FTVB 3F7LA 2CM6A 1JOIA 4DFHA 1F6LL 4ORZC 1IARB 4A38A 1FPTL 2QPSA 1OGAB 3BZ4A 3QIBB 4UTBA 3HTLX 3VFOA 2JJVA 4MBRA 4GRLA 3KLQA 2OMWB 1NAKH 2WQRA 3LZQA 1JGLL 4FQCL 4DGYL 3HFFA 4XP1L 3GXIA 4TL5A 4XX1E 5B4MC 1RU9H 4U6HA 4WNQB 1F3DJ 1VGEL 5EEYA 3LXAA 4EEEA 3FZUC 4V11A 3QG7L 4F2MA 1IJNA 2OXGA 4HJGA 1MY7A 4JDEB 1OCZB 4LLVA 1UENA 4PIBA 4ZSOE 3RKPA 4L0YA 4EDWH 4MHHI 1X9RA 3S96B 2RQ8A 4UDUB 3FQYA 1JZ7A 1FFNA 1JGVH 4Z7UF 4WWKC 2WW8A 4G1MA 4AEIL 5SWSD 1MFDL 3OMNB 4OKDA 2C1OB 1R75A 2WBJB 4JPKH 4TSAH 4NO2B 3RIFK 2N59A 1W91A 2K1MA 3LKQB 1BG1A 1UGNA 4HPOL 4WGWB 4XC1H 4HG4J 3PWPE 3Q06A 5TQ2L 3TCLB 2ZX9A 5GGRB 5CILL 2VR7A 3NDZE 3KZ8A 2EKSA 3F12B 4G3YL 3PWPA 3NFNA 4AT6B 5MEOB 4E9QA 2R69H 1CD1B 1KPVA 1SY6L 2XWJA 2QBWA 3ZRSA 4G7VL 2FATH 4LCYB 1Z1WA 2QZ5A 4K3JL 4EBQH 1CD0A 1FZMA 4X5LA 3M1BA 1EXGA 4QRSA 5ITBL 1KJ2L 2AEOA 2V17H 4G8GE 4DQOL 3EJQA 4NKMB 1RSYA 2BK8A 1FVEB 2X2UA 1XIWB 5GS3A 1BW8A 1UD8A 2DQEL 2ZUWA 4WCYL 3ZE2F 3GTNA 1ZSDA 1D5BA 3P9LA 1MWAA 3ELAT 2NY0D 1L6PA 5KBMA 3DJSA 1X5JA 5T3XD 3QRGL 4N5ED 5LGKA 1NMAL 3UAJA 3BH4A 2F6AA 2MHAB 3OAZK 3CFMA 3QA3B 1MRDH 2H32H 4QTIL 2A74B 1A7PL 1XAUA 2YMOA 5GS2H 1GPOH 1XTLA 2AJUL 1ZJAA 4Q6YA 4HT1L 4DAGL 1ZANH 4LSRL 3VWJD 5KN5B 2W0KA 3D1MC 1AGEA 3DHUA 4JY4A 4C4UA 5DDHB 5HHQB 4WV1B 6FABH 4OJYA 3RA7H 3UYPA 3EG9A 2UZIL 1WTGT 5CCHE 5IOPB 1K4DA 4M43H 2VAAB 4DEPC 2HFGL 3FT3A 1A4JA 3FW6A 4UUJA 3WIFB 4PJGA 1FC2D 2EYRA 2Y24A 3QS3A 4HIJB 4MQ7B 5TFSL 3KL3A 3HBPA 2FTAA 1VFOA 3WV0A 3VXUB 2J55A 2GUOA 4A2HA 4A2FA 1RZIA 1F4HA 4D7BA 3NVQA 4HJSA 5GGQL 1G6RB 2ZKXA 4LLYA 2G5BA 4IU2B 4OIFA 32C2B 4PW4A 1CL7I 2W9LA 2XN0A 4BE6A 4ZNEA 1FSKB 1RHHB 3CMGA 5DUPH 1BQLL 2ZUXA 3DETC 3TPUA 1JNHB 3VVVA 5EFIA 2V5SA 1I4FA 5IOKA 1QP1A 1EO8L 4M3KB 2CA3A 3P3SA 4YK4C 1E4JA 5E2UH 2DMCA 3ULVD 4HIXH 1H6TA 4YDJA 2R7EB 2GIXA 3RWDA 1BLNB 1TQBC 5IGXH 1G1CA 2H0EA 2FSEA 3WN5C 5IVXA 3IKKA 4YGVB 3LYRA 5HYEA 3UTOA 4ZO7A 2CHXA 2R0WH 1USZA 1I7RA 1BECA 4PHZA 2W91A 3L7EA 4MJHA 4NQSB 5I6NA 5L6YH 4UT9A 5E6UB 5DRNB 1MJ8L 4MQXC 5TH2A 4UM9B 2KHAA 3P0YH 2DJMA 3ZDYB 4ZG1A 4JREB 3L3DB 4HUMB 3ARUA 1MCDA 1MELA 2VDLB 4ZFGL 1JPTH 4AG4L 1MFBH 5C0AB 4D8PB 3N9GH 3GO1L 3CU7A 1G9ML 1OGTA 1UYWL 3QZWG 2CLZA 5FW6A 4GG8A 3O3AA 5SWZA 4Z3EA 3S3JA 1QZNA 3OAYK 4MCNA 4XNZB 1JV2A 3QNYA 3Q44A 1J0YA 5I73C 1BQHA 1ILSA 2JI1A 1FCGA 5ALCL 5KJ7E 5JPMA 1EZSA 5JPMB 1BWWA 3AREC 2MOGA 4KZEH 4E68A 4D9LH 2ZX7A 3BHBB 4PG2A 1TOXA 4YS4A 3EH2A 3RGHA 4OLYH 1CGSL 3U7AA 1JNNL 5IK3A 4UNVA 5E2WH 1J9TA 4GG8B 4L1HA 4J3WA 4NM4H 4RDQG 3S3SA 1OGTB 3IAQA 5H4ZA 2LV4A 3KGSA 2IAMB 3MKGA 4Y4FD 5C0GB 5D96B 1F4WL 4XVSH 4Z7QF 3IGAB 2BY0A 2P8MB 5DR5H 3VI4E 1KOAA 4A7VA 1AQKL 3S4SA 4UM9A 1YPZB 4MA3B 3UYRL 3BN3B 3ESVF 3OGCA 2WQVA 3PL6C 2K3HA 1I7RB 4MA8H 1J10A 5FYJE 2OYLA 4ZFZB 1ZHLA 2YD1A 4XPHL 2VXVL 1E27A 4GAGL 3T0BA 4OGZA 2VXTL 2YD7A 4XNZC 4Q8BA 1KNOA 5D72L 3VFNA 1M1SA 2AV7B 3EBGA 5SX4I 3V0WH 5FV2A 2XQBL 5HHMB 5GZND 3U36B 4QHMB 2X3BA 4JY5H 4X6DA 4X8JA 4PR5B 4L8BB 5EFIB 2PCFB 3ZKSD 2F15A 2ICES 2BM3A 2WMPA 3VXRB 2VMDA 1BOGA 4X4YB 1W6LA 1FCCA 2APFA 1TZ8A 4X7CC 1L0YA 1MVUB 2CUIA 3QULB 2Q8BH 4IU2A 1LE5A 4QHUA 3MUY1 1H3XA 5D6CB 3QCUL 1FG2B 5DYOB 3E1F1 4KI1A 2A4ZA 2W9DL 2YPVL 3UX9B 5GRUL 4WRLA 1I3RB 4NO0A 5E7BA 3U4BL 1IGTA 3ZYJA 5HYQA 5EBWB 1SLVA 4LAJH 5F6IC 5HSFA 2XUWA 2EYRB 2UZIH 1ET8A 2XXCB 3FH5A 1JZIA 1MW2A 5IOPA 1M1XB 1IAKA 5DZAA 3BH8A 3CHQA 4Y2OA 4YSSA 2A7BA 4GQZA 2FIRT 2ZYHA 4JPIB 5AKTA 5TFSH 3LEYL 5CBAB 1ACCA 4G8FA 2VLRE 3C60A 3DHPA 3G6AA 1AGEB 5I75B 3V9CA 3BP7B 4QJ3B 4X98B 2ZXBA 2LAAA 1AKJB 2PMZA 5BUGA 3OZ9H 2PWDA 3C8DA 2YPVA 4KQ4H 3GWJA 1DANT 3GSNL 5EU6D 5FGSA 1JZJA 2D4FA 4PB9L 2HMIC 4JFDE 4EXKA 4FD0A 2BP3A 5DVMA 1HILB 3CVHB 2OAAA 2EO1A 3L5HA 3MCYA 1S9VB 3CH8A 3PGFL 2BSBA 2O5XL 3B8YA 3SJVE 3VDBA 3WD5H 3LRGA 1NUDA 5LNDA 3PU7A 2MCMA 1DQVA 4DP8X 4Q9CA 3W37A 1FVEA 4JG5A 5I2IA 5J9PB 3W11C 3U9UB 1A14L 4DEPB 3M1BB 1ZVYA 2B1OA 3HG0A 1VSCA 5E0QA 5FA4A 4NI6A 4N20A 2H47C 4P99A 4PV8B 5I75C 1ZY9A 4YR6B 1D5ZA 1T1YA 3WY3A 5ISZD 3PWPB 5H37A 3S5LG 3PWUB 3CZEA 3DSNB 3INUH 2X28A 3BPNB 3K1DA 2F7IA 4DQAA 2HA1A 2DB8A 3BIKB 5I9QB 3L3KB 1Y1DA 4AYSA 4UCFA 1OGAE 1NBYA 2A6IB 1CG9B 1UOKA 2PYEA 3A24A 3BCFA 3NZ8B 3OXRB 4RMUA 1NGWB 4ZS7L 3TN0C 2JKNA 5AB1A 3D39D 5LBGA 3VXMD 2D7TH 3B1TA 3HUJB 3D05A 1V7NH 2AJ3B 4MNGE 4N2NA 4ZFOB 1IVLA 3MBWB 3TPKA 3ESPA 2FWOB 2JI2A 1NCCH 4F2MB 3HHMA 2Z0UA 4UB0L 3V5DA 2AQRA 1OSYA 4U1IB 4QWWD 1WE5A 2IOOA 2XXGA 2XX0A 5JA9A 4WEEA 2LGNA 2VERN 1H6EA 3PHOA 4GSDL 5EORL 2H41A 4WI4A 3V0WL 4TNVK 3FCTB 1OGAA 3BZ4B 5DJ6B 4KRLB 5AWNL 5KSAB 4UANA 4QOKB 3UTPD 4HJEA 2BWDA 4PJEA 3WNJA 1ZRUA 3U0TA 2B7DT 3SDCA 1RMFH 3HNTL 2VGLM 4R0LC 4PVBA 1HOCA 2VMEA 5BRZE 1SHSA 2Y23A 3ZKXB 1UJTA 4XNBA 4JPWL 3C08H 1A6WH 1NFIB 4OAWA 2ZF8A 2TSAA 5JIDA 1A9BB 1NM4A 1RULH 2A9ML 4QRPA 4Y5XC 3O9WB 4O51B 3IFOA 3ARFA 1E3FA 2EZ0C 1ZPUA 3KYNA 4BKLA 4ZBJA 1IL1B 3AC0A 3VFPB 4O2FA 3OKOB 4PJ8B 5JLZA 5CP7B 4YHKH 3QBTB 2VABA 4W4NA 3VFUB 1KXHA 4V1DD 3DPBB 4CJ0A 2DLEA 2BS9A 1DQKA 1KLGA 3SDYL 5LCVL 3L95A 1QTSA 2BNRE 2AJVL 3PYCA 1TZHA 4CSZA 4F57H 2C34A 2Y7OA 5LNEA 4R8WL 3MV8D 3OM3B 1KEGH 2Y0SA 1UACL 3VXNA 1HZKA 5KVFL 1QSFA 3WMSA 2AC0A 4OGQC 1KFGA 3FQNA 4LCCB 5DRXA 5E4OA 3M7FB 3OAWA 1KYAA 1MHPL 4BA0A 2F5BH 2EDQA 2IDCA 1U93A 4PJHB 3CIAA 3US1A 1HE7A 3MXVH 2F53D 1UQSB 2C9UA 5J6HA 3S7GA 1F4AA 5CM1A 3OMIB 3TA3A 2GSIA 1KDJA 4BK4A 1I85A 4CVUA 1GIGH 2HFFA 4WI8A 3NCYS 2NYYD 3EDKA 3F8UB 2EYTB 5L88H 3CLFH 1KCSL 2IANE 2Z31C 3RVUC 4KKCC 4HS3B 5D9SA 5FM5M 1L0XA 5ABZA 3B9KA 1ZCRA 2CLVA 3B9KB 3D12B 3O9WC 4BFKA 2CO7A 1EUUA 1SQMA 4XB3A 3RU8H 5HJGA 4MRBA 3KPLB 3FO9B 4R7DA 4MJ5B 2DWEA 3LDBC 3TNNB 4X7SH 1IIKA 2VDRB 3G5ZA 4K5NA 4LQFL 5AQ0A 2OFQA 2WWMD 3O4OB 5T33H 1JTOA 1UB6A 2EYTA 1OKEA 1MREH 4PJFB 3WSQL 4AGLA 1J9RA 1MWAH 2WNGA 2N01B 3ZR5A 4F7EB 3DUUB 5K33A 3PY9A 2DL2A 2BY1A 3N85L 2H32B 5I18H 2XA8H 1BG9A 2QSTA 1N5AA 3TT1L 3CFNA 3ARGC 5C07A 1I8IB 5JUEL 1SF5A 4AEEA 1Z9SA 4W9HC 4LOVA 2EEAA 4ANXA 5A2IH 5AAWA 4LCCA 2XWTB 2EDXA 1VJSA 1WZAA 4YVNA 1XB8A 5I8KL 2JLLA 4E42B 3WMPA 3D34A 1DSFH 5D7HA 3L3GB 1O9VA 4IDJL 3L8QA 3MAWA 3VMOA 2IFGA 3U2SB 3IFPA 4OCSL 3LXBA 5D7IB 5I8CB 1IU1A 1MRFL 4NB7A 5EPMB 5KVDL 3MJWA 1A4CA 4NWTH 1FG9C 4FXKB 3DPBA 4RGND 4W9EC 3X13B 2QL1A 3FRPA 4FFYH 1MIEL 2X3CA 4LSUH 3VGAB 5KSBA 2EQDA 3L4VA 3OKOA 1A7QH 4PJ8A 5I8OH 5JLZB 4LPTA 1IE5A 4LDLB 1IL1A 1KCUL 3VFPA 3FQTA 4ACTA 4KUZL 1UXWA 2QDVA 1MCHA 3QDGD 2EDEA 4KTEH 3GMOB 5BRPA 2NY3D 3NA9L 4UM9D 4D0DB 3DPDA 4DF9A 4FI7A 1LO2L 2A83A 3QHFH 4PV9A 2Q76B 3SBRA 2NZ9D 3WLWC 2WXIA 5HGAB 5D2LE 5HYJA 1QEXA 1N5YH 2YN5A 2VLRB 4P04A 3WHE1 2OCFD 1BIIB 1WAAA 4J3OD 3T2PA 5ACZA 4NQTA 3WUWA 4I2XB 3GTTA 4AL8L 3H54A 1OAZH 5DUBA 3I75B 1KULA 5KSAA 4LGSB 3NBNA 1ZV2A 2Q8BL 4DN4H 4N2HA 4H7VA 1KJ3L 2DMKA 2R4SL 1FH2A 3GBLA 1QFWL 5IBUB 4M56A 1LO4H 2OR9H 2ZUVA 3U0WL 2VISB 2WVSA 1HS6A 4YSOA 3L5JA 5ITFB 2UZYA 3T0EC 1RIHH 2V37A 2D3VA 3I9GH 3MLTA 5DZOA 2DQHL 3V8OA 5C7XL 2BSED 1QLFA 2DH3A 4AEFA 1BXXA 2XV6B 4GXVL 1NBZA 3L4UA 3ARRA 3G6JB 3D85B 1CPUA 1RU9L 4BH8B 2XQYG 4I0PD 4YZFE 5T3ZD 2OMNA 3TH4T 3B2DC 2VW6A 1EXUA 3X12B 5CEZD 3JWDC 3W11D 4HGKC 5HDLA 2X87A 1KTJA 3B6SB 3DHJA 4JRYD 3DSNA 4G9FA 3IDGB 5ID1A 5GGTH 3DWTA 5CEXA 5FUOL 5L2KA 4JANB 4G9DB 1YN7A 3BESR 4N3TA 5JW5A 4TUJB 1YO4A 3QUMB 5F0MB 5FYKL 4JUSA 2HMID 2ZPKH 3HC4H 4LCUA 4XAKE 1KTKE 43C9A 5ISZB 2P47B 1EJ8A 1WFJA 3WS3B 2BSSA 4ZTEA 5J9PA 1LJMA 3APNA 3EYQD 3K80A 3UTTD 1N59A 1ZEAL 1XD1A 4U1HA 4R7NA 2WOYA 5J56B 4MJ6A 2VMCA 1MLBB 3Q7JA 4P46A 2ISDA 2HFTA 2K6ZA 3Q3GA 3KPRE 5IBTH 5HVHC 2O5NA 1DR9A 5F0JB 3S37H 4S11A 4FG4A 4RGNB 3DV6A 1FL6A 2ARJB 3JTTA 5KANG 1JPSL 1IQDA 1P9MA 4OZHF 3WO3B 4QHNB 1LWHA 1CVSC 3NIDF 3ZTJH 4WWID 4GKZA 2A9AA 2FGWL 3TZVC 1AKJA 1NCWL 2GHZA 4U3SB 1NGZB 1YEKH 3BISA 4PGZA 3NUKA 1IGCH 1F90L 2BOBA 1X9QA 3HG1A 1WPCA 4PN6A 3BQUD 2UWEF 3ROOA 1IAKB 1QR1A 3E9UA 4CILA 2ZAGA 1JYNA 1B0GB 1RIUL 1HYSD 4HD5A 1CBJA 1OAYH 4TNGA 3ZL2A 2OSWA 5F9WC 5J89A 3FN0L 3JV5A 4NO0B 5TF0A 1DQLH 3HOGA 3H9YA 1XGUA 3CFEA 2YBRB 4D9RE 4X8XA 1ACYH 25C8H 2PWFA 4JZJB 2FECI 4QRRB 3GBNH 4FE9A 4WVRA 1LMIA 2XBZA 4L9LA 3T65B 1C16A 1VERA 5EIIB 4QXUH 5ESQB 1X5KA 3T2QA 5EC2B 4X0KB 4KK5D 4CSTA 4UWQB 2N4IA 2WSPA 4MCZB 1WIUA 5D7LB 1LDSA 5FDWA 2MPVA 2AV7A 1UA7A 2BXYA 5D6DC 3NZUA 1M3JA 1G7IB 1J8HD 4R0LA 5HVHB 4ZFZA 1GYWA 1N64H 1BREA 1CCZA 1UD4A 3FU8A 4C55A 3GZPA 4YIQA 4MX7B 2K9UA 4NNXA 3RA7L 3WTWA 3QW9A 2W0PA 1PJ9A 2BHZA 1TIUA 4N2AA 2P8MA 3TBWA 1WJ3A 3IGAA 2IDFA 2YMTA 1J5OH 1WQVT 2DLFL 4L8SC 43CAA 3CVBA 5GXBB 3N04A 1F6FB 3SCMD 1XBDA 4R6UA 1EJ6A 3NZHH 4XODA 4WU7B 1BVLB 5FK9A 4R7LA 3EYOB 4FFZH 5IVXE 3RWJB 4JY5L 4E0RB 5I6XC 3WKPA 1SXSA 1I3UA 4M6OL 2WXPA 1HEZA 1Z5LA 3P11H 2GJRA 3FO1B 3LZNA 3OJDA 2N0MA 4NNPH 4O00A 5FKAB 2NTSP 3V0VB 2GBVA 3GMRA 1DANU 5CD3A 3OB0H 3RKDC 2XWEA 5E9DA 3LVTA 5CZXD 2VW7A 3VRLE 5D70H 3X11B 5KAQF 3J27A 1WFIA 3CX5K 3B7SA 1ROWA 3MV7A 2H9GA 2CALA 4NQXB 1YEGH 2CLZB 5C6TL 4L1LA 4LPVA 1VCBC 3ZKND 3EGDB 4M6NH 2YKLL 3HMXA 3MMEB 3MRNB 4WJ5B 4A7QA 3EIFA 1FZKB 2H2PC 4LP4A 4BSVB 4FC3E 3ZRCC 2EE2A 3I6SA 2PF6A 3VXUE 3VFWA 2BC4B 2WZAA 4NUMA 4NQSA 4YHZL 4N2OA 5BV7C 4EOWL 3HE6C 1NZRA 2YLHA 5EA0L 1NGQH 1O7DE 1KG0B 2MCPH 4OF8A 3W5NA 4Y16C 4FYRA 2OTWA 4DO4A 5FB8A 4YXLL 5HGHA 5C0DA 4XP9H 3L08A 3CC1A 3LB6D 2IIJA 1CDGA 1RK7A 2P8LA 1RHHA 1KLFB 1ASPA 2DIBA 32C2A 4LLWA 4WEBH 3QUYD 4BQ8A 3ARZA 5AW6B 2P52A 4OZGB 5EUOB 5KVEL 4F37F 3GSRA 2AK4B 3N1QC 3UTZB 1EEYA 2CDGA 3QEHB 5DC4B 1JL8A 1NGXB 2ROXA 3RILA 1TEFA 4B3VA 1RUKL 4OZ4A 4TQEH 2D0HA 3OR6A 1CZ8H 1V55B 1U91B 4J2XA 1U8QA 2VN3A 3QJXA 4DERA 1KJ2H 3KDPB 4YDVB 3HBZA 3VWKD 1A2YA 1OM3H 1UD6A 2W0FA 2FLRT 3EDFA 4OCSH 2VAAA 1CE6A 4XZ4A 3UBXI 1CBVL 4EI6B 5F7YC 1QUNA 3X1FA 1G1OA 3AAZB 3Q6GH 5CKGA 1DVSA 1XH3B 3UYPB 1EBPA 4WHYH 4M03A 5JQ6H 5HHQA 5KYYA 2XZCL 2BNQE 3GBMH 4MJ4A 2R0WL 3RDTC 3V0EA 3AGVA 4MMXC 4W6YB 5KN5A 3V4VB 2X89D 4JUTA 4PWIA 2QT6A 2AXFA 4BH7A 4GIOA 4O02H 4P2OB 4LFHG 1QHOA 3EYVA 4L2LA 4M8UA 1YA5A 1MCFA 4PRIE 4UU9B 1FL5B 1ODUA 1KSRA 3WDIA 3WS6C 3MLUL 4KVCH 3VWJB 1DVYA 1WRFA 4ONHB 1MCIA 2AV1B 3KJ4C 2I27N 3FTGB 3SPVA 2D2CC 4Q74A 2EIZB 1K8IB 1TMQA 2JB5H 3EFOA 3KGTA 5I5JA 4PJEE 3RWHA 2AQSA 1AE6L 3MLUH 4KVCL 3B37A 1XIWA 3ARBA 3LDBB 5F93C 5C3TA 4CVZA 1U3YA 2HFGH 3UAJD 4Z95H 2YGOA 3LS4L 1YYLH 1FZMB 2CLRB 5ID0A 3KBHE 4NO0D 2ZWSA 1XQ4A 3EOBB 3AS3A 2DJUA 5C8JA 1H0DB 3ZKMD 1WD8A 2EADA 2VC2H 3S8GB 4WO4A 5AOLA 1DTUA 2NUPB 5DMKA 2EKSB 3F12A 4KTYA 1MY5A 4HSAC 2V5MA 4DGYH 5GGRA 3V4LA 5J13C 2WQUA 2WXRA 3MRGA 3Q9PA 2G3XA 5D2NC 5C0EB 4LB8A 4MNHA 2VCOA 3EJJX 1PBYA 4HUUA 3O3UN 3QFJB 1FFNB 4HWBA 4HHGA 3HC0A 4UDUA 4A04A 1Q4NX 1I7TB 1P4LA 1ITBB 1BM7A 4C58B 5SWSB 2FX7H 4M61B 3K2MC 2OXGB 4XXDA 3QO0A 4PJFE 2VZSA 1HL5A 2HKHL 1NDGA 3LRMA 1BJ1H 2XOTA 1FNGB 4DN3H 3BO8B 2WLLB 3GC3A 1HJCA 3TFKC 2NY3C 1ND0B 3LIZA 1G9HA 3WL9A 4OLVL 2V17L 3BWZA 3IAGC 4Y4FA 4P9MH 4R4BB 3R8QA 1WWWX 1YY8B 1WLHA 5C3IA 4JDZA 4H8PA 1GOHA 1JXDA 1WCBB 5CEZH 2ZUQC 1KYDA 1HC1A 4IRZL 5CSGA 1HKLL 4ZMNA 1NCHA 3DJTA 1NIDA 5FYLE 4JY6A 5EA0H 2EVGA 3HNTH 3MLXH 4A6YL 4XBGA 1HWWA 1GJWA 1SXZA 3LD8C 2YPLA 1ORQB 5G5DA 2O5ZH 4X6FA 5A3IC 4GW4A 1F8TH 1UKTA 4Z18A 2LABA 4ONOA 1KN2H 3STZA 3CSYB 4J28A 2P80D 4CVWA 4DP5X 1I8UA 3QORD 3CMOL 3VAEA 3TV3L 4RBPK 2BNRA 2QMJA 2WZ0A 1KT2B 3GIZL 1KIRA 2J2ZA 3CFCH 3N43F 3H56A 4LLDB 3WFHA 3GI8L 3U6XA 3NJXA 3E6HA 5AZ2L 2VIRB 3W5MA 4DUWA 1IGIH 3VG9C 2C1PB 3I6GB 4P3CH 4GAGH 1JPGB 1P2CB 2D9CA 4P23D 4X9BA 2JLPA 3QCTH 3V0DA 3WI9A 5JW3L 1ECZA 1E5ZA 1T80A 3B2MA 4JPVH 2DWXA 2NY1D 3B43A 3B2XA 1SOSA 4WUUA 1YUKB 1JD7A 1BJ8A 2J6EL 2X7LB 3EUUA 4F24A 3HPLB 1TLKA 1R3HB 4PRIA 2BXZA 5F44A 5MI0C 4Z1PA 2YEZA 4O02L 1MEXH 1IBBA 2J8UB 1R6VA 2G75A 3PGDB 1RL1A 1ZHKB 5KJRL 2A4CA 1BZQK 4BJLA 2K6YA 1RFDL 5KS9F 5TGBA 5CN3A 4L4TE 4PYHA 2V3DA 1MUJA 5KVEE 2GJPA 4TVPE 4X6CA 4XP5H 3DO7A 5F7WC 3KLHD 3WJMA 3A4DA 4QY8B 2NDFA 1OY3B 5FIEA 3C5JA 2Y7MA 2E9GA 1QBLH 2YD8A 1RZJL 3KS0J 3KBFA 2YK1H 4L8DB 3DGCR 5FO8A 1XGYH 1EXHA 1YZZA 3I6LE 1URIA 1T7ZA 4BFEA 4P4KD 3CZNA 1PLGL 3ATFA 1T03L 1XR8A 3AS0A 2WB7A 4WWPA 5ANMA 3KJ6H 3M07A 3RDTD 2VSCA 5IQ9B 1BF8A 5K9KB 4V1DE 1I7UA 2VNCA 3EFFB 4NQDB 3IE4A 4I3SL 2D0FA 1SQ2N 4PM1A 4YPGB 4LFHD 4N0CD 2DRUA 1MJJA 1GJIA 1JBJA 4HWZA 4DP2X 1JV5A 1KIQB 3SJVA 3TFBA 1R3IH 3L3HB 1KLUA 1KWGA 3F04A 1C5CL 3MOAH 1XZ0B 2QHRL 3G5YB 4W9LC 1S7TA 1X5YA 5CXPA 5DD0H 5D4IA 1EHXA 3ZDXB 5FC9A 2M8XA 3CC5B 1P4IH 4F1SA 5C9JB 1NTDA 2CMRL 1PTZA 1SYSB 2L4OA 2VITB 5BZZA 4N2FA 3KYKH 3G6JF 4BFNA 1SHMA 2V0AA 1ZHNA 3D85D 1HK6A 5EOQL 2EEFA 2PP9A 4NQDA 2VDOB 3CXDL 1RAMA 2PYFA 2VR6A 1II4E 1IRAY 2J8HA 4IKIA 4CKQA 3IBEA 4BELD 4JRXA 4Y19D 2CCVA 3QNZB 2Z8VC 4A63A 2F61A 4ADJA 3ZMNA 5LGJA 1EWHA 2A0LD 4TSAL 4U6TA 1R5WA 1M4KA 4CMHC 1GA2A 2EDFA 2WBKA 4FP8H 5C09D 4BCYA 3FU0A 2MQCA 3DO7B 4RMWA 1WUNT 2EYSB 2KPWA 3UO1L 3MR9A 4HD9A 4G43B 1DVFC 5ACMA 2E86A 1HEHC 5DVOA 2G75B 2B59B 2JMRA 3V4PB 3ZE1E 1MCPL 1SMAA 2NY2B 1J5OL 3ULAB 2NYKA 2YEZB 1KB9K 3HNSL 4G5AA 4PRHA 3SGJA 5EZLA 2LFEA 4KO6A 2EDRA 4HH9A 3QHZL 2VH5L 1WIPA 1LDPL 1IGJB 3O4LA 2LR4A 1A5FH 3OHXA 4LK4A 4PGCB 3ALWA 1D5XA 1GAFH 2DQUH 3TVMA 1KCBA 5IB5A 3ARVA 1JPGA 1P1VA 1PD6A 1RUPL 4G1EB 4IRSB 4LT7A 5BO1L 4I1PA 2WIMA 3H9SE 4PD4J 2V7NA 3SHSA 3MTXA 3I6GA 1P4BH 4JR9H 4NBZB 4K8RH 4ILDA 4B9PA 5L7XH 4QCIA 1EDYA 2R4SH 4MXQC 3T1FB 3GT6A 3VG0H 5KSVB 3BGMB 3QEQD 1XCXA 3FB7B 1AZCA 3R19A 4MNQA 4F33A 5LDSA 3STZB 4DUVA 3LMJH 3T0WA 5ILTH 4GW4B 1HNFA 1M6OB 5AG8A 4WW1B 5I6OA 1NPUA 5D5MA 5ADPL 1ZJBA 2ZUTA 4NKDB 4PJDE 1EANA 3DRTA 2Y1ZA 2H6PA 3MRPB 4XBGB 2HPOA 1HH6A 2DF3A 5CLTA 3GYRA 4IRJA 5C6WH 1ADQH 1I31A 4TOYH 4G70B 3DDGA 1JXKA 4GMSL 4EI5D 4Q9RH 3C5SB 4HPYH 1ZIAA 4DESA 5C0CB 1S7SB 3P77B 3NIFF 3PREA 1TTCA 4M7LH 1OTSD 2IBZY 1VAHA 5F0PB 4DP7X 3KH3A 4ECNA 4OD1H 4ZUWB 2IQAB 3TM6A 3C2AH 3FO2A 3O2DH 2AVGA 1WZLA 4XXCA 3EJRA 3UBXG 5C08E 2VDQH 2V5RA 5IGXL 4K23L 2HLAA 4OFYA 3HLAA 3CQQA 2VLME 3F65A 2X4QA 4R4FL 2N56A 1ND0A 5CINL 2C9RA 1X5HA 3BP4B 4UT7H 5BQ7A 3BWUF 2VQ1A 1NBQA 4PWFA 1NUGA 2I5YH 4MA1C 5DZ9A 3UZEC 5IB3B 2R0KH 4JE0A 4U1LB 4X2UA 4WGKA 3QFJE 2FO1A 1SDDA 2XTJB 3F6JA 5F7FA 2CZNA 3U4KA 1WT5C 4LSSL 1I7TA 5E51A 5HY9B 3HC0B 2DYSB 2NOYA 5EH1A 4JFQB 3WXWL 1KJ2B 1RJCA 3MRGB 4UT6H 1G7PB 2Z31A 4WKZA 4DK5A 4DVRH 3VE0A 1JZ4A 4LNRB 2AGJH 3DVNA 3TJPA 4NZTL 4LMQE 4JN2A 4AQ8C 5BW7A 4AOFA 5JDJA 2RFXA 4LASL 5FFOA 3QAZC 4TXVB 1VGKB 4PWJA 3FO0L 2NXZC 4HKBB 2YD5A 3MI6A 3ZO9A 1QHQA 2OI9C 1S78D 3SEPA 3ZSSA 2R2HB 3FUFA 4PHXA 1A7PH 4MWFB 2DLHA 1TVHA 1Q9LB 4O2EA 1FI8C 3FF8A 1TJIL 2QGCA 4AV0A 5KBNC 5EUKB 2ADYA 4K15A 4CC0A 4GAFB 2FX9L 3CSPA 3ASNB 1S9XA 3MUGB 4KJQD 2AV1A 2F19H 1AQKH 1SUJA 3SPVB 2GIMA 1R24B 1E90A 2K9FB 3B9KC 5F70A 2OMUB 4P2OA 2BNQB 4ODVH 4XCYA 4HFUH 1FN4A 3EJYD 1CIDA 1I3VA 3HMWH 3FOMA 3NA4A 1D6EB 3L3OA 2VDOL 4RQQB 4N26A 2VC2B 1D2PA 2I7OA 4Z8FL 3GXDA 3JWNG 3T8MA 1BAWA 2FJGB 3BVTA 3SODB 4J39A 2PWEA 2YAOA 1NGPH 2ZF9A 4KTEL 4ZMVA 1F45A 3O3BB 1ZK5A 5DC9B 4YDVA 1BF2A 4KHXH 3UPRA 2IGFH 1M56B 2CE6A 1GXEA 3PABB 3BVWA 2Q86B 5KG9A 3TBYA 3ZT7A 4OV5B 4IMLA 4YHLH 1KIUB 3T3MF 4DCQA 1IJ9A 4FJYA 3ZGIA 1EEYB 1AZVA 2YSSA 3AM8C 3SIKA 1IUZA 1FE8L 1IZKA 1LK2A 2J5LC 4F3FB 1VADB 4Y5VC 3Q2VA 1B4JH 4RISL 1BMZA 1OP4A 2QMKA 5LBSL 4DNLA 2QQNL 3O6MH 1G7LA 1FC1A 3PJSA 3ZE2B 5D5ME 3PAYA 4FQJL 4C54A 2IQ9H 1B88A 5T1DL 3QDGA 1WAAF 2WXHA 5CSZB 3VXSB 3S8WA 1GGCH 4FZEH 5JO5A 3DX4A 1TZIB 3D69B 2DYPD 3L9EA 1RURL 4O58L 3QWNA 4PJ8C 4YLCA 4M6NL 1M7DB 3WKYA 4NZRL 3V5HB 1OD7A 1QI4A 2Y2TA 3DRQA 2BVOB 3ATDA 5F9OL 1R34A 5HDBE 3WTUA 5CLYA 5E03A 5EEWA 1AQDB 2IBZX 1XSOA 3L2MA 2BC4A 3MC0A 2NQDA 1PZSA 1FV1A 2CK2A 3I9AA 1RUQL 3LEVH 3ZL1A 4YFEA 3TWYA 1IC4H 2XRAL 4APQC 1SEQH 1WH0A 4RSYA 4PGEA 5LWYL 5BZWA 2XA8L 1J9CT 4OF7A 2GJ6D 1VADA 2YZ8A 3BKCH 2B1HH 3LSOB 2YSSB 4ELMF 3BXNB 3PQYD 2CA4A 1WVZA 5C7ZA 5D7IF 4LASH 4R5TA 5DUPL 4XN5A 5E9DB 3LXUX 5KG9B 1BZ9A 1D9KC 2QHRH 3JBG7 4OU3A 1PQZB 4F1ZA 5F3BB 4KJPD 3EGSB 3FO1A 3SOBL 5IEKA 3AACA 1C7SA 4KJWD 2YS4A 2KQMA 1P4IL 4RRPG 1G7MA 1M7IB 2XIDA 3C87A 4E0RA 4HWBL 4IIZA 4U05A 4TSBL 3ULUF 4B9JA 1KJVA 4GG6A 2HTKC 1SJHA 5K1NA 3BWAB 1MCCA 4L4VA 5C2BL 4GKLA 1CYXA 2F0CA 5FF6B 5ABDE 1AH1A 4U7MA 4A39A 1KPRA 4ABWA 5B7MA 4PS4L 3BDYH 1C1EH 2PPEA 1QWNA 4P4KA 4U3XA 4XPGH 2BMKA 3DMMB 3F2LA 4GBXD 4YIQB 1NFDE 4I18C 4JFEA 4HCRH 4PJ7F 3LZLA 1EMTL 3DKHA 1G7IA 1OW0A 3BDYL 4HUNB 3VDCA 4Z3IA 1U8LB 2XFGB 2X4SB 3EJYC 2HWZL 4S10A 2ZCZA 2HT4D 1CGYA 3AU1A 2NY4B 4JO8A 2BIMA 3H4FA 4HJIA 1PLCA 1A6VH 3VD5A 2CIKA 5KVMC 2QQQA 1WFMA 3QR1A 1J48A 3F64A 4OB5H 3ZE2E 5K9QI 3MODH 4RFNB 2RFXB 1OZUA 3UP6A 4FA6A 1EEZA 2K7PA