4A7VA

Structure of human i113t sod1 mutant complexed with dopamine in the p21 space group
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Binding and Aggregation of Pathogenic Sod1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7vA00
2E47A 1TO4A 2AQSA 1B4TA 1BA9A 1CB4A 1F18A 1F1DA 1OZUA 3ECWA 4N3TA 2E46A 1U3NA 2Z7WA 2ZKXA 1SXSA 1YAIA 1JCVA 1E9QA 1AZVA 3MNDA 2K4WA 1E9PB 1QUPA 2SODB 3KH3A 1SXBA 1S4IA 3KBFA 2ZKWA 5KBMA 1YAZA 2GBVA 4A7QA 1OZTG 3GQFA 4N3UA 2C9VA 1XSOA 3CQPA 2AQTA 3GTTA 1IBBA 1L3NA 1XTMA 1PTZA 2WWOA 2GBUA 4FF9A 3H2PA 1FUNA 2JLPA 1F1GA 5CU9A 1CBJA 1PZSA 4MCNA 1SRDA 1SXNA 1N18A 4U4IA 1B4LA 1DO5A 4BCZA 1ESOA 2XJLA 2V0AA 1SXAA 1XTLA 2ZKYA 1BZOA 3F7KA 4A7TA 3KM2A 2Z7UA 4A7SA 3KH4A 3S0PA 2GBTA 1F1AA 1MFMA 1Z9PA 1OALA 4OJAA 2Q2LA 1PU0A 3MKGA 2VR7A 3SODB 4A7GF 1KMGA 1P1VA 3LTVA 1EJ8A 2WKOF 1HL4A 2VR6A 3GTVA 1YSOA 4A7VA 3HFFA 1SXZA 2WWNA 3L9YA 5KBLA 2ZOWA 3GZQA 1OEZW 3CE1A 3HW7A 1IBDA 3ECVA 3GZPA 3T5WA 1TO5A 1OAJA 2WZ0A 3CQQA 1EQWA 3QQDB 2AF2A 1E9OA 1E9PA 2Z7ZA 2C9SA 2AQPA 2VR8A 2AQQA 1SXCA 1E9QB 1JK9A 3GZOA 1SPDA 1HL5A 1COBA 3H2QA 2WYTA 2WYZA 2XJKA 2APSA 1SOSA 2WZ5A 2Z7YA 4MCMA 1IB5A 3KBEA 1N19A 1UXMA 3HOGA 4BCYA 2WKOA 4BD4A 1E9OB 2AEOA 2AQRA 1DSWA 1Q0EA 2R27A 4A7GA 1IBFA 3F7LA 4A7UA 3L9EA 2LU5A 4L05A 1RK7A 2WZ6A 1IBHA 3PU7A 3RE0A 1JK9B 2NNXA 2C9UA 3ECUA 5KBKA 1Z9NA 4B3EA 3QQDA 3KM1A 1UXLA 4OH2A 3K91A 2JCWA 1SDAB 1SDYA 2AQNA
chains in the Genus database with same CATH superfamily
2VDRB 2YD1A 1KGIA 3LH2H 4YDNA 4NQVB 2EUZA 2HRHA 3S3BB 3GI9H 3O81A 2PCFA 4RNRA 4G6AC 4AJ0A 1E2VA 5J12C 4GP5B 1HXYA 4L1SA 1UXWA 3WGUB 2JJWA 3ZMRA 1NQBA 4IIQB 1F00I 4F9LA 2W80C 3HKFA 1S4IA 5EIIG 5D2NA 5T3ZL 3QE5A 1HINH 3NZ8B 3WE6B 1J5IA 2O61B 1CTOA 1K3IA 3LNIA 3MAWA 2IAAC 4N5EC 2MNJB 5CBAB 4N6RB 1EXUB 2HFEA 4KV5E 4LIQE 4NQEA 3SKJH 3DMMC 4IGBD 3PL6D 3LKOB 1B6DA 5I8EA 1YNTA 1XH0A 5IB4B 1BOYA 5D7HA 1JZJA 4FKKA 3G5ZA 2J1YA 3RWIB 12E8L 1UUSA 3RAJL 2QPSA 1TTFA 1Z0NA 1R33A 3QBTB 3EJZC 2A83A 3QJVB 3OLGA 4LPVA 4WGKA 4WJ5A 4YDLC 1FL3B 3KH4A 4YOKA 2E6PA 4Z0XA 2HFGL 1JV2A 2CSPA 3MRDB 3RUGF 1J05A 1ZV2A 3UTSE 4QGYA 4ZW7A 2HX8A 2BO0A 4PJXF 5I1DA 2R1YB 4RESB 2WKOF 4W4NA 1S7UB 1T7WA 2DQDH 4H1LG 2D3VA 1SXZA 3HMWH 4OGXH 4OLVH 1VGEL 4PJAA 5DK2B 3NN8A 5FW6A 3AU1B 1BZ8A 3E6FB 5CEYA 3MRLB 3KXFD 1HZHL 2VABA 4N6QA 3LB6D 3UBHA 2DN7A 4HT1H 1JTPA 4FFZA 4YWGL 2RQEA 5H4ZA 1QSVA 3DJ9A 4PV9A 2Q8BH 2H7WA 3G04B 2IPUK 3L6FA 2WYZA 3TCLA 4IU2A 4OQTL 2HFTA 1EBPA 1P69B 3TVMC 4IGBA 3S3PA 3TO2B 1FRGL 4XWGL 1NINA 4BDVA 2AEOA 3I6GB 1XV8A 4G80B 1EV2E 2OMVA 1MQ8A 1BAGA 1WHPA 3L1FA 5D96C 5H37A 3TOPA 5D1QD 2VLJE 4OZGF 4O51B 3D2UD 1FDLL 1PY4A 1BVNT 1QW8A 3EYFB 3WIFB 5DHVH 3HUJF 3Q13A 2XG4A 1UG9A 3KYOB 4N5UA 4UAOC 1FDLH 1RZKH 3AGVA 4Z7OE 4HIPA 1DJWA 1JZIA 4Q0XL 1YYCA 4H8UA 2F19H 2BX5A 1JMXA 3OHXA 3E0GA 1CQKA 5IM7A 4Z76A 1GYCA 4ZOBA 1PFCA 1NJ9B 2YKLL 1YEIL 5EZJA 2AI0L 1MHPL 4YO0B 4BE6A 2I26N 5T5NG 2C4FT 5HYSA 3NIGB 4EN3D 2EEBA 2DICA 1CIUA 3FO1B 1VPOH 3QISA 4LKXB 4ABUA 1M2OA 5CD5C 3VI3B 4OZFH 3MRRB 5IQ9B 1HHJB 1XTMA 4PJDF 3EIFA 3O3BB 3V5KA 2X2UA 5CCKL 4PJGA 2FAUA 4L4JA 3FU5A 3WO3B 3A4DA 2P24A 5GGSY 3LKQA 4UT6A 5DFTA 1RZJL 3U83A 2IBZX 2IGLA 4BHUI 1CWVA 3KXFA 2WLJA 1FF5A 3D87B 2F15A 5CILL 1LK2B 1YEFH 4Y4KD 1UZ6F 1CL7L 4MQTB 5B1CA 4B60A 4DEPB 1T0MB 4MSWB 2YUZA 1MRCH 4R7DA 3VM5A 3ZT7A 1R5WB 4JDVB 3RILA 4A55A 1UB6A 1OALA 2XA3A 1IZJA 1DBML 1WPCA 4AKPA 5CGYC 4QXVA 4ONOA 1WISA 1K4DB 2Q2LA 2BVOB 2JIXB 4WGWB 1JHKL 2DBLL 2EUXA 1V05A 3TJHD 3V5KB 2WBJA 5CIPA 2GBAA 4HSAC 3ZQ9A 2ZX9A 1KIPB 3GJFH 2ZONA 4D3CL 4Z3TA 3HPLA 2Q3AA 4I0PA 1ZVYA 4S1QH 4U49A 2MCAA 1JF6A 4PJIF 1ILUA 3OV6A 4XVUD 3GHEH 3NA9H 5B39G 2YWZA 3M7FB 5JXEC 3I50H 3IFOA 4YZWA 1R17A 1X7TA 3GRWA 5E9DA 1P5VB 3VX0A 5J13C 2CUAA 2VRAA 4PG2C 3DXAA 4UDUB 3QIUD 1JK9A 1QPKA 3NJHA 4XPHL 3WFBL 5FGCB 4GAYB 4HK0A 4NWUH 2JKJA 1J9CT 4WUUE 3UYPA 5FUZH 1IB5A 1MAML 5AVSB 1W8NA 2ZCZA 1XEDA 1ITCA 1DBKL 3LKOA 1TEYA 4FL4B 5I8EB 1AHWA 3B5HA 3P3UA 3T0VA 1LWRA 3RVXC 4P9HL 4ZMLA 1CFTB 4EN2A 4G42A 4EI6A 5ETUA 4EIUA 3LD8C 1G9HA 2AJYH 2BOCA 1IU1A 2YD0A 2F9BT 4HWNA 3RTQD 2GCYB 1MCKA 5DJXB 1H3GA 4L23A 3IJ9A 3UGEA 3JWDL 3U1SH 4NQCA 2Q1EA 1UA3A 2QKIC 4ANXA 1J11A 2AXGB 3ETTA 4XB3A 4C56B 5F9JB 4R97B 4DGVH 5KZCD 4LPCA 3BCFA 4NZTH 3PFUA 4PGDA 4XOBA 5ACZA 2ATAA 4APXB 1LTXA 2A6KA 1EANA 3H3PL 1CF8L 3GWJA 5MP6H 2BIMA 4MD4B 2ZIDA 3VFNB 4MJIB 1RUMH 3SDCC 2A7BA 1XGYH 3V0DA 5EEZA 3QDMA 1IUZA 4D0BB 1EGJL 4WNQB 4N2HA 5FB8B 5HHPB 4ONHB 4J28A 3HUJA 1X9QA 1KV7A 2CDFA 1OZTG 4JFOA 3SY0A 3DROA 1VCBC 2VM9A 1M2VA 4ZPTA 4WU5A 3BP6A 4GMTL 1A9VA 5ALCL 1FE8L 3VMNA 2VO8A 1TYJA 3EGDA 1P0SE 2R1YA 2EDNA 5T8IA 2ERJC 5C70A 3L3OB 4RFNC 4HPHA 3TO2A 1VDGA 2Q6WB 3P0YH 5CGBA 3FOLB 1ZLWK 3RJDA 4HHGA 4F7KA 3FK3A 3HHRB 5H37H 3WFHB 5KSBA 5I26A 3P3YA 3VFTA 1ZEAL 4H0GA 4HFWB 5F88B 2WLMA 3T4AA 5F7EH 5C9KA 1NCAH 1NCIA 3R0MA 4QAWA 2ZXBA 5G4OA 4HLZG 1N0LA 3ULVH 2FYYB 3BRGC 4F7EB 5JMOC 4N26A 4QHUB 3HAEB 1I1AB 1IGJA 4JVWA 4JZJA 3UL4A 3MJ6A 3HBGA 4Z3EA 4I3SL 2VKXA 4MJID 3QO1A 3AAZA 1MLCB 1NOLA 3B2UC 1TZOA 2CG9X 2FH8A 3C8DA 4HIEB 3CHSA 5TQ0L 5C0BE 4QD2E 3L3HB 5HYQA 2CJUH 3BKMH 3ZHNA 1BDYA 3CC5B 1N70A 3BSHA 3ZVVA 2XTJE 4MXQD 5E2WH 4MMYA 4OLXH 5DTFB 3MV11 1VFMA 1COBA 4OAWA 4PRPD 1YC8A 2MPAL 1PIFA 4CSTA 4FCAA 4PLKD 2LLNA 4BUGA 5DZAA 2XZCH 2E3VA 4ZFFB 2QQLH 2NPLX 1G84A 1MJJB 2ZXWB 1R3IL 1MG3C 5IHZA 4G6KH 4NN5C 4FL4C 5EU6D 1ID5I 2WXKA 2YD3A 3UAJC 2UZXB 3EOAA 2NQDA 3QDMD 4XMXA 5TDPA 3UTOA 4HWBL 3IDXH 3Q9PA 5D1ZC 2R0ZL 4UMGA 2RD0A 4LP4A 4TKWA 4WF7A 2ZNXA 4OH2A 4QF1B 3A3YB 3P54A 3ULSB 1TO4A 2WN2A 3GLEA 3QJOA 4TVPL 3WTXA 1NCCH 5D7LB 4E5XA 1EEZB 3WXVH 3EBIA 3UBXA 1IBYA 5E94B 3MJ9A 4G7SB 1T5WA 5F89A 3RDTA 5TK4A 2IC2A 3Q8AA 5JA8B 2LHAA 4AEFA 5DQJB 1CFSA 3G5VA 1ETA1 5E6UB 3LRSA 2ZX6A 5HJBA 2YPKB 5E6IB 4KTGA 5FA3B 4JFXA 2VMFA 2DM4A 1KJ3L 4PS4L 3O6LL 1ZOXA 4YGAB 1OK0A 4ELMB 5KSUB 5TGBB 4ZODA 4L5FE 25C8L 2G2RA 3U48A 4M4PA 1BD2B 2FWUA 1IAOB 2H45A 2J2ZA 1A4CA 1LYQA 4TNWK 2H3KA 5EO9B 5J9PB 3L1OL 4QXTA 2B2XH 2BY3A 3PIQB 2DD8H 4YSPA 3ZY7A 2CALA 1JG9A 3IS1X 5EU6B 1ODAA 3DMMD 3WNIA 3C87A 4GMSL 3K4ZA 2YD2A 4O2EA 3QIWA 4M9PA 2BOCB 1U33A 3H9SE 4GSQA 2Z93B 1HFUA 2IH3B 4N0UB 4AW4A 1MCJA 3CXHJ 4N28A 3NGBB 5EZLA 1IE5A 4MDIA 2VXQL 1KIQB 2I9TA 5EBWA 4Z78A 4FQQB 5HHOB 5JHLA 5KJ7E 4G6AD 3RA7H 3ZKSD 2J20A 2WCPA 3UTTD 5DD6A 1NCDH 3EH2A 1O5DT 4APXA 1K5WA 1OT1A 1HESA 5IHHA 1MCSA 3U2SB 1JHKH 1BEXA 4OZGE 4NO2A 4ODUB 4QNPF 1KYOJ 3W0WD 3W56A 5FV1L 2NY0D 2FNBA 3GMRB 3IDGA 1L9TA 4G1MA 5AYUL 1WAAE 3BQUA 3TJEH 2YAMA 1CICA 8FABB 1BBJA 3EG9B 1ZGLM 4IKKA 3B9EA 3EJCA 2CCVA 4P99A 3M1OA 2OSLA 5ENWB 5AVZB 5BRQA 2TAAA 1QBLH 3LSOA 1Q1JH 2PCPB 1ZS2A 1MNUL 2K9FB 4X6CF 1WWAX 4J8RB 4EN3A 4AQEA 3L4ZA 2D7PA 4UZSA 1LHZA 2DMBA 1W6WA 4I18B 4NSKB 1A6UH 2FSDA 2VDMH 1DJYA 2HVKA 4EUPH 5IQ7H 3RLSA 1JPFA 3MNMA 1ZTXH 1DCLA 8FABA 3UTTB 15C8L 2NY1D 5C1MB 2VZVA 1DQKA 1H6UA 4EDXB 1YN6B 4UINL 1U91B 1UB6B 5B1JC 2BSCA 4MWFA 2JIXA 4GUCA 1JP5A 4HQQL 3HFML 5DF0A 3PP4H 5KBDA 3V6OC 1KTLB 1A6VH 4HCRH 1YZZA 3HS0A 4IM8A 3PL6A 4M48H 3T0DA 2V17L 2F7QA 5I6PA 2F54E 4KRMB 4K8RL 1M56B 4K3HA 5ISZE 4FNPA 2PWFA 1KJVB 3D2UA 1EAQA 5IHUH 2N7AA 2IXQB 4WHTB 2XPZA 4WEBL 4A2HA 3P11H 1OTTD 4UBDC 4G6FD 3CDZA 2Y1VA 1DJGA 3FU9A 1DVQA 1BJMA 3VFGL 4B9IA 3B9KA 5A6IA 3N40F 4QRAA 4FADA 3GIZL 4NO5A 3KCPB 1ZT4B 3SE3A 2X28A 1HNFA 3DRTB 1JGDA 3IXTB 1L7TL 4AM0A 2WTOA 2NW3A 4Y5XB 1AQKH 2GITA 4K15A 5AVXB 3SE9H 5JLZB 4K71C 5J6GB 1XCQA 2FIKB 3FSAA 4I88A 3OZKA 1Z3GH 1IM3A 2PP9A 3MYZA 4AGPA 3ATDA 1B88A 2EDKA 4BYHA 1IBGL 3W0WE 3WNJA 3KPSA 3RI5K 3LAFA 5FHBH 2DRUA 1IVTA 5IMLB 4PLJD 5D6DC 1I8KB 2VLRB 3MNZB 3T0EC 3VXSA 1WQVT 1RJLB 3BVWA 3HLKA 3VACA 2P5PA 3EHBC 3L2NA 3PWPA 1LE9B 5B3NA 2CBPA 4H4NA 3FQXB 1N10A 3RI5F 2DYPD 3MA9H 3L4VA 3EUDA 4MJIA 2VM4A 3QQNA 3ULSA 1GSMA 4KJQD 1CK0L 4WU7A 5D9SA 4HPYL 4L3EB 1BMZA 4AUYA 1ZVSB 2OXGB 3GS4A 2V9QA 5EO9A 3STLA 2VTFA 4I18C 3UBXB 5CKAA 2A2QT 2CR0A 2DQ6A 1MUJB 3ZE1F 1TVHA 2D7MA 3MJ9H 1SN5A 4UU9A 2VH5L 1WTLA 4YL9A 3LH8A 1YY9C 3IK2A 5DURD 5B21A 1DSWA 1H5BA 4J3OG 5D1XD 3S3SA 3HZVA 2CJTA 4PJ7F 1KB3A 4ZTPH 3RAJH 2ATPB 2IPUG 3GZKA 3QXWA 1SYVB 1TQCB 1QFHA 1TZIA 3EJQA 3ZZQA 3ECQA 4LLQB 2JCWA 1U8IA 4Z7IA 4FQ2L 3D69A 3BXNB 3QZOA 5ESVA 3QA3B 4FZEL 1DN0A 2X9YA 3TFKC 2JH2A 1CB4A 3IRPX 3HE6B 4M5YL 4DKAA 4TM9A 2JK5A 3GF8A 3OTTA 3AABA 1FL3A 3SPHA 4NHUA 1O7SA 3BH9B 2DTML 3VXSD 3NFNA 2YN3A 3KH3A 2XQYK 1PL3A 3T3MF 1KN2H 5DDHA 2WO2B 3CFBB 4YHNB 3OKLA 2D31A 3DDFA 3L5WA 1QKZL 4L3CA 2Y7QB 1XF5B 1TLMA 1EZVY 2WXOA 1NBYA 3GRGA 4WI8A 5EBLA 4AYEC 2FK9A 3ASWA 3Q2LA 5FUZL 3OVUB 5SWZA 3OKNA 4S0SD 5MEQB 3D85B 3L2MA 2F7RA 1FP5A 3CXHK 1TSRA 1XZWA 3C9NB 4JY5L 5CEZE 4DK3A 2XYBA 4AZ8B 4JB9H 1T04A 5HBBA 3VFOA 3LYRA 1Y1DA 3PWUA 2GQHA 1M3JA 2IDSA 1NMAH 1KGJA 5I1HL 5IIEA 4K3EL 5PCYA 5AKSA 1SDDA 3N42F 2ZWYA 4ACPA 3L4UA 3AQYA 4LSUH 4GXVH 3BH8A 3R7RA 3QCVL 4LOEA 2OL3B 5B1AB 3FTGA 3ZU8A 3FQNB 3IKCA 4NZRL 2XQYG 1WBZA 1FC1A 4R96A 4JFQB 3DBSA 4Q0XH 2AABL 3GO1H 1JD7A 3LRMA 1JPEA 1T5XA 4LSRL 3T77B 4P06A 3K8MA 3IF1A 2CIKB 2H0JA 4L4TA 1PCXA 3GZQA 1M4KA 4JNXA 3WN5B 5E5RB 2WQVA 3STZA 2GFBB 1SLUA 4CBZA 3AQXA 2BSRA 5E2VL 1SJEB 4KK9C 4YHLH 4Y16A 4JM2B 5ICZA 1FFRA 3RTQC 3SKJL 4XNMB 3EGDB 3CK0L 4PRHE 1B2WL 4P4KC 5HHOE 4LL9A 2UZIH 3RFZB 3IAPA 3AU0A 1K8DB 4JVUA 3MREA 5M94B 4X6DB 1HXMB 4PRNA 1AGBB 5EN3A 2A4ZA 4ZRGA 4PJFE 4M5ZL 1YRKA 1J1XH 1NBQA 5TDNB 3D3VA 3QRGH 1N7MH 4NDMA 2BH0A 2DQHL 2PXYD 5EU4A 4RA0C 3H9HA 5ACMA 1S3KH 1BVLA 4D0CB 3GMPB 5CS7A 1A14L 1OGPA 5DHXB 5ICXB 4WI3A 1XCQB 1JTTA 4FXKB 4P23D 5D2LF 5EZLB 3FF7A 3C6LD 3CLFL 1XGQB 3B2XA 3MV7B 5DK3A 4LCWE 3C6SB 3CZFB 4HUUA 1A3ZA 3ARTA 1A6WH 1NGXA 3DK0A 3GMOA 3QR2A 3HS8A 3MGOB 2NXZD 2JNZA 3MCKA 5FYLD 4PJHE 3LNEA 4GG8B 4JM2D 3ZHDA 1WRFA 4DOHB 4IW4C 5I2IB 3OQRA 3BOVA 2CKBA 1R24B 4HC1L 4OSUH 1ZANL 2WWMD 1ZLUH 4L4TE 4P23C 3IFLH 2WXJA 1JZFA 3CBKB 4LEBA 2GIYA 5EORL 3UYRH 3H2PA 1NDTA 3S37H 1NM4A 1NFAA 1QG3A 3BN3B 1NGWB 1PZAA 1BEYH 2WV3A 4NC1E 4YAQA 2YGVA 1R3KA 1FGNL 1Y1UA 1HHGA 1RP9A 5E0FA 1U8QA 3QUXD 5HYJA 4FQIH 4LPUA 5EBMB 3RG1C 1R0AH 3UZVA 2CIIA 1DDHB 3H42H 1U92A 4TL4A 3LSOB 4PJ9A 4EI0A 3UOAB 2JELH 3S37X 4B9YA 1ZPLA 2NY6D 4LIQL 5E94A 4NQEE 5D71H 4IRZA 4YFDB 1PU0A 5DI8A 5KJRL 2VLRE 4XN5A 4XBPA 3L7FB 4TLTA 2D3LA 4NT6A 4A7GF 2EIZA 2JLLA 4NQSA 1JPFB 4QOKE 3QFJD 4QTHB 4UT6L 5KYUB 3C8KB 3QWOA 3HAEH 3G6JE 1EMTL 3GJEA 2B9BA 1AGCB 1IARB 4FFVC 5DYOB 2FTAA 2ZUUA 4ZDHA 4BH7B 3S97C 4W4OA 4XCFH 4AT6B 3CQQA 1A7NH 1G7HA 3IETA 4FFYA 2AJUL 1S9XB 3JVFC 3LKNA 4KI1A 5CMAA 1MREL 3VD7A 5E8DH 2BSSA 4YDVA 4OZGA 5FWRA 4AG4H 4Z7OB 5SWZB 3ZKMD 4K7PH 5D1XA 4RETB 5FPIA 1MREH 3MX0B 5GJTL 2Z31A 3QIUB 5FGBC 4L0ZA 3J2PA 4WI0A 1X7QA 5HGDA 2W0LA 2OL3H 5C0JB 4FQ1L 2ZAIA 3PHOB 1HXKA 3V4VB 1BLNA 1NC2D 1B2YA 2XBZA 3VWKD 1QPXA 2UYLA 2DQEH 4OZ4B 3VM7A 3ME0B 2EDEA 4DP6X 4YSQA 3S8WA 1M1XA 2GK0B 4HJ0D 3MJGX 4KVNL 3CFKA 4XVJL 3AS3A 1O9ZA 3ORJA 1MFVA 2ZOUA 1CFMA 4KK6D 2P43B 4N25A 5BV7C 3ZO9A 3EGXA 2FT7A 1DQTA 2AQ1A 4HEMA 4P3DB 2ICCA 1T5XB 4P2OD 3T77A 4D9QE 3O3EA 1A5FL 1AXTL 2JVUA 3MBXL 4NB7A 4ZFZA 2BIQA 1HWGB 1YAZA 4R84A 2J1WA 2PXYA 1WC7A 2Z91A 5I8OH 1LP9B 1LP9F 4F20A 4JQIA 4NM8L 3EJTA 4D9RE 5C8JB 5HHQA 1C9SA 4C55A 3EBAA 3T6ZA 5FA4A 1PTZA 1W8EA 3EFOB 4KVCH 4DP2X 1UZ8A 2F53E 1C7SA 2E59A 3H54A 2N0KA 2YZ8A 3QG6A 4WI5A 3WNLA 3ZRCC 4KZEL 1A3LL 2RFXA 5DR5H 4FQCL 4GLRI 5AAWA 1HYSC 2VH5H 3SPIA 2VITA 1EDYA 4RFNB 3VSQA 4WWKC 1YEWA 2WNKA 1GRWA 4MDJB 2VLLB 3FQRB 5DRXA 3W38A 1FVCA 2OX5B 3DC0A 4JFFB 1EFXA 1B0IA 4L5FL 2EXWD 3JV5A 5KANI 3QZWB 4NKMB 5BRZE 1EERB 1JRHL 1MPAL 2ZCLH 1SJMA 3DOIA 4IS6A 1NAMA 1I9RH 2I25N 4OF6A 5FCUL 1BGXH 1HL4A 2PTTB 3FRUA 5H35A 3BLBA 2NQ3A 4UT9H 1QO3B 4KDWA 5CBEA 1INQB 3IPFA 1G7PB 4OFVA 1YN7B 3BEWB 5ETUB 3NQKA 3ECVA 4Q8BA 3MHZA 3QDJD 5MEPB 3CMGA 4MJ6A 3PDDA 5FR3A 2N01B 5AW5B 2G75B 4PRBB 3K6IA 4S2SA 5EA0L 4CADB 4ENED 4KDVA 5GGVY 1WZ1H 3DPBB 3VG9C 2X1WL 4YHKH 3DTDA 3IJSA 5E2VH 1CDBA 3WELA 1BAFH 4X6CA 4AEIL 1U92B 4JJ5B 4MDRA 2DD8L 3EJZD 6TAAA 1HHGB 1E90A 4HJJH 3BWUC 4Y1AA 2JCCB 4PGBB 5I1CH 2F5AH 2QQQA 1E4HA 2WVUA 2YFNA 1TCRB 3WYRA 5HVHB 3QDMB 3D4ZA 2IV9A 1SUJA 1JZDC 4M3HA 3MLSL 2DQUH 3SDDC 2XQ0A 1FG2B 3D06A 3FQUA 5LCVA 1BG1A 3PWPB 2ZKXA 1DVTA 2FWOB 2AEWA 4IU3A 3FULA 4RWHA 1JWUB 4UTAL 3BP7B 1NGPH 3QDJB 4B0MM 1U4EA 4IOSA 5TQ2H 5IZ7A 3FRPA 3K6SB 1Q94B 2QADB 1GJUA 2Y6TE 4AJWA 1KTRL 5IWLC 5D7IB 4A2FA 3MLWH 2E7DA 1NCBL 2GBVA 4MNGB 5EEXA 3RVVD 3IS0X 4TQHA 1BZ7A 1UZ6E 4DSYA 3RL2A 2Q3XA 1MIEH 5JW4M 1FZJA 3KPRB 2W65A 1FG2A 4PV8B 5L2KD 1TQBC 1B2WH 4HBCH 4NO0A 1MWAH 1IILE 2GSIA 3DWTA 4MS8C 4KAQL 1KJ2L 2OYLA 1Q1JL 2XFGB 3EJYD 3Q6FA 5JR1L 4PJDE 3SGEI 1EAJA 2DLIA 4NQCE 2C3XA 2YRPA 1F41A 1A6AB 2ITEA 4FFYH 5EU5B 3V0JA 4PJFF 3C6EA 1EA9C 1XH2A 2DWDB 3M45A 4UV7L 1BWMA 2O5NA 4PJ8B 1J5OH 3CFEB 4J23A 4QXUL 5C3LD 3IAGC 2BOBB 1V3MA 3BGAA 3T4YA 4W9ZA 3RWHA 3TIEB 2VDQH 3O3AA 4IIQC 4GI8A 1J1PL 5BPPA 4LKCA 3VQMA 4FP8L 2OJ1A 4ZSOE 4G3YH 1FZKB 4BSWA 1GVIA 5AWNL 2GTQA 1H8NA 2Q5BA 4FXKC 3SBPA 1ASPA 1IBDA 5DJZA 3FT4B 2B1HH 2EVJA 3TGXA 4CJ0A 4MA3B 1DANT 3H9YA 4I13B 4KPHH 3LIZL 4OBSA 4P9MH 4IRJC 4EDXA 4CRPA 4JREB 1KBKA 3IVKA 1R3JB 2XXGA 3B2VL 3DDGA 2E4TA 2ZSWB 3L45A 2IBBA 4JY5H 3TO4A 3MRKA 1WIPA 5IG7B 3RWHB 4DGYH 4AYMC 1AY1L 1N19A 5LWYH 3VFOB 4PJGB 1RU9H 2HT4D 2A6DA 5DRXB 5E03A 3HHMA 4J5VA 1F11A 5F93C 1J12A 3NSXA 1NGWA 3GMQA 3MCLH 2J44A 4WFEE 4DUWA 4KJWD 3WU1A 2AJZB 5FFGA 4ZYKA 3UG4A 2B08A 4CNIB 4Z3IA 1YDPB 3G5XB 5FWQA 1XGTA 4NNXA 3QIBC 4P57A 3WN5C 1CD0A 3V9EA 2CLZA 1G7JA 1M7DB 2E9JA 4ZUTA 5FYKE 4AENB 2PETA 4Y8AA 5F97E 1L9OA 4LVHB 5CBEB 1ZHNB 4WQOA 2G60L 4HUKB 3SKUD 1JN6B 1HS6A 5JW4N 2VLKE 3HG1E 4KROB 3MLXH 3KPOA 2ZKWA 4XWOD 1ZLWH 5C0FA 3GSVB 4X9BA 3TT3L 2NUTB 2WGXA 1S7SB 1ZT7B 1O6VA 1EO7A 4LDEB 3GTTA 4HUXA 2RQ8A 3SE4C 2WO4A 5A2BA 2IH3A 3VGGA 4N0FB 3HVDA 2YQBA 1A0QH 5B7FA 5FC9A 5EO0A 3HI5H 5G2NA 2WQRA 3B9AA 1A7BA 2AZUA 4U0RC 5C0AB 1S8DB 2X87A 3TJHC 1BJ1H 3TVMD 1A7OL 1DO5A 1G6RA 3MROB 2HG5A 3JWNC 5KVGL 2MRYA 3SPGA 5IQLA 4AM0Q 2GK2A 4P04A 5IFAL 4HKBA 3ZR5A 5CJ8A 3TBYA 5IHZB 3NABL 1FNLA 4UYQA 4BSJA 4CKVX 5D4JA 3MGAA 2Y7SA 5JHDD 3P2DA 3RPIB 5L2KA 2HWZH 5GIRB 3NABH 3GBLA 4PIBA 3FH8A 4JZOB 4PMFA 1F3JB 2WANA 3KBHE 2WZPA 1A8ZA 3V6OE 4RDQG 2DBLH 1AIZA 3GHBL 5KAQG 1Y0LB 1ED3A 3QUYB 4I77L 2OULB 4UAHA 4UT9A 2NY3D 2P46B 5JUEH 3B2UD 1OHQA 4JGUA 4X4ZA 3QQDB 2A4CA 3SZ6A 1MKFA 3OKMB 5ESAA 2VERN 2QGEA 1MW1A 1EH9A 4YXLH 4Z7UA 1QRNB 4RSYA 1N2RB 4L8CB 4WEBH 4NM8H 4MYPA 1UOWA 4JKPH 4Y19B 4JJHA 2X0WA 1AG6A 2FX8H 5IB4A 5C0AD 3T3PF 3HI6L 3VXNA 1NCHA 3TA3D 3CZLA 2YPLE 5C09A 3NA4A 3WFBH 4JKPL 5DZLA 2YAPA 1CLVA 1I8MB 5T3ZD 2BNQB 5AOLA 1P7QA 2W1NA 4N8VB 4KRPB 2BP0A 3QDGD 4YBQC 3T6QC 4FXGB 1QHOA 1HVXA 3ABLB 3MV9A 5AOMA 1G6RL 3B2MA 1IC4H 1JK8A 2XWJB 2EICA 5E9AA 3TEYA 3U4BL 2PPDA 4X6EA 5HDQH 4F93B 1NPNA 3EJPA 5GRUL 1GZPA 1ID2A 4XN8A 1OZUA 2CUHA 4K94C 4QIRA 4BH7A 3ARXA 3K6OA 5ISZD 5IHWA 3QJFB 1EHNA 5JQ6L 3BUDA 2IANE 4E36A 3ZL1A 3P3TA 4ZNCD 1TPXC 2K7QA 1CD8A 4LVOC 5E7BA 3EF7A 3QRFM 3FQTB 3FMGH 3MRCB 1J9RA 4PJIB 5LAPA 4HPYH 3AREC 4G43B 3KWTA 2RJMA 3VWKA 4HXBL 2BWDA 4XNYL 4W9GC 3ULVF 1JGVL 1N0LB 2GYSA 4KOCA 4I9XA 2Z92B 1Q9WA 4Q14A 5DJ6A 1D5BA 2FL5B 3GMLA 1TENA 3QJZA 2W07B 1PZDA 5JLZA 1WITA 5BZWB 4PMEA 3FU6A 4XX1G 3CFKB 3L08A 2XXFA 4KJPD 5BZDA 2AGJL 1KG0A 1RAMA 5L7XH 4Y5YB 4Z7QF 4KGJA 2VE6A 1QATA 1PF3A 1KPRB 2BHYA 4BZYA 1O5PA 1QBML 4TUKH 3VDBA 1TKWB 3D39D 4DKFH 3HG1D 3C5ZA 4GFTB 4KK6C 4AGMA 2HLFC 5I19H 2C1PB 4CN4A 3MREB 1EJOL 5A2FA 1HHKB 3O3EB 1ORSB 4AXWA 4Y2DA 2G3NA 4Y2OA 5A16B 1ZDQA 4F9PC 3P4OB 2M83A 2CO4A 2MQGA 2D3JA 4F33A 5BVPH 3N85H 3FQ2A 1KYFA 1MI5D 1NC4D 4NCC2 5BZZA 3VD3A 2QSTA 3W9EA 4JPKL 1DSFL 4BH8A 3WKQA 4X0NA 4OIFA 4LPTA 3TFBA 5BV7H 1IQWL 2EIJB 3LQAL 4DO5A 3GSXB 2RALA 4YC2B 4ZUTB 3AXLA 4XPBL 4XHJC 2WSKA 1GTFA 3GHPA 1DQQA 1IEBB 1G1YA 4K7PX 5C0NC 2OQJA 5I17B 2ICWB 3WJMA 1EHLH 1I85C 2DI9A 4GSRA 3D39B 1CG9A 4K5LA 1XCTA 3ZJAA 5KVFH 4ECNA 4JRYE 2IDQA 1U30A 3HB3B 5EBMA 3IDIB 3QHFH 5L9DH 2GHWB 1ZHLB 3WIHA 4UNUA 2GJ6A 3LKRB 4JFFE 3C60B 4BJLA 1FFQA 3BUIA 3QHFL 1PMYA 1F18A 3QEQE 3LXAA 4JN2B 2NT1A 5GS0C 3UBGA 4OFDA 2WCSA 2P49B 3HLAB 3ABGA 3Q7JA 4LCUB 3TBVB 5KYWA 1MI5B 1SY6L 3MN8A 1HDMA 1BOGA 4QHNB 3WJLC 3HMWL 2H1XA 4OGXL 3D4CA 2C3GA 2Z0BA 1A7QL 2BXZA 4PWHA 1FJ1B 1OW0C 2YLKA 1DZBA 3LY6A 1L6PA 2OZNA 4ENZA 1AO7A 1VESA 2B2XL 2CHZA 3KWVA 5EDSA 1W72B 3LOWA 4LEEA 5FGSA 5JOFB 2KKQA 1PGRB 3V8CA 4F7TB 1QUNA 3B37A 1MCNA 4P4RA 2DLFL 4QAMB 1RK0A 3ALPA 4DVBA 2V5YA 5FYKU 4WV1A 1Y6MR 2VJ8A 9CGTA 1FNEB 2A38A 5F7HA 1J1XL 2I07A 2F61A 1GMIA 3QCVH 2R9HD 2CAKA 1SQMA 3BAYA 3Q1EA 2Q8AH 1ES0A 1PDKB 4GINA 4D94A 3K0WA 4IMLB 5C08B 1HZKA 3HE7D 1E50A 3CPLA 4NI3A 3SYAA 2CNZA 5ITFB 5D7KD 1Z9SA 2FRGP 2QGBA 3MRHA 1IAMA 3QUMA 4X6EB 2ZX5A 4HUMB 5J6HB 3US9A 1XBRA 2PPCA 4HHAB 1TTAA 1I8IA 1YEKH 2RA1A 2XVKA 3VRJB 5CAYB 4I1PA 5E1AB 1OGTB 3W39B 4PRPE 3H9SD 4HIEA 3QJUB 5ALBH 4KQ0A 2AXFA 3VXOA 1EJFA 1O7DC 4XMPL 2NCMA 4LOFA 3VXUA 3P73A 4PD4J 5I76B 3B2PA 5C07A 5ALBL 2WN3A 3BHBA 1CE6A 5FKAB 5I71C 4LCYB 3VG0L 2XJKA 4GRMB 2QHRL 3DTXB 3W2DH 3DUUA 2D03L 4XBGB 1A21A 2Y7NA 3O2VL 2Q6WA 2YJQA 3GSQA 2GEQA 5EUOE 1L0QA 3TBSA 3PDGA 3C08L 4R2GD 2WK2A 3P30L 3SBRA 3E2HB 4FQCH 3L5JA 1WE5A 5EZJB 1I7RA 1DLFL 3G6JB 3L9EA 1H15B 2CDGB 5A6MA 1VAHA 3GINA 3QS3A 3MCYA 4WCYH 4GSUA 5D1QC 5C09D 3V0VB 1IMHC 2F6AA 4AXWB 3E38A 3OAUL 5FYJD 4DQOH 4DUXA 5JQHC 2EVFA 4OCSL 5CJQH 5T1KA 4I0CC 2YSSA 3BIAX 2FBJH 1CFSB 2FBOJ 4XHQA 4KBPA 3UPCA 3KDMB 5E99H 2PWDA 4HKBB 4WEMB 1U3NA 1BVKA 2VW4A 2DIBA 1MJ8H 3P4MB 5DQJA 1J8HB 2EVHA 4KXCA 1X5JA 2X4RB 1L6XA 2GTWA 3LPPA 5B1BB 1OGAB 1FYTD 1QNZL 4KJQC 1O6SB 2IGFH 1HOEA 5K9OA 5EPMB 3B3BA 3SKOB 5EO0B 5IT2L 3DRTA 2F08A 1SN0A 3AS1A 2GJ6D 3PYCA 4WWKB 4Y5XA 3VXPB 3O2DA 3V2AR 5K39A 5DJ8B 1S9WA 3DETD 1X4XA 4L8SC 4NWUL 1MJJA 3D3VE 2NMSA 4FULA 1I9JH 1PYWA 1L5GA 3BPOB 5DZOA 1ROCA 1T4KB 2VSCA 4TUOB 4EOWL 1I8AA 4XNQB 4JQXA 3VXNB 2E9BA 1D9KA 2HP4A 4HAGA 2B15A 4IKNA 4PJAB 1HIML 5E9DB 3OLIA 3QT2A 4WK0B 2OMWA 4P2YA 1IAIH 2DDQL 3MBWA 2A74C 1BSIA 5FHAH 3RP1A 5I6NA 1RUKH 4IRSC 4ORGB 4OB5L 4PJCB 1FAIL 4X99B 2KPWA 4C56E 1OVZA 3TEWA 2Y07L 4BELD 2JI2A 1XD1A 3HPLB 3MV9B 3JQOB 3JTSA 2W0FB 4LCUA 3TBVA 4CW1B 3NDYE 2VSDA 2EH8L 5CLZA 3IBEA 1KEMH 1H5BB 4NC2B 3V4PB 3NAAL 3SYPA 2ZP9A 3BZEB 3WNOA 1OP4A 1T22B 1ZV5A 2ITDB 2VDNL 3RZWA 2GJ6B 2ATPA 3LKRA 2OJZH 2P8LB 4H44C 3MBEB 4WWKD 2JJUA 2AHIA 3FN0H 4Y1AE 1M7IB 5E1HB 1WEJL 2APSA 4UYPA 4I9WD 2IDFA 4G8GA 4FI7A 3MRPB 1JZGA 3WY4A 4PGJA 3EHBD 4G7YL 3UGUA 1S3RA 2DQTL 3FCTB 5LO7A 5DD0L 5K9QG 4LVNB 3GJFA 5DJXA 4QRRA 3T8XA 3QNXA 2YO3A 3RE0A 3TIDB 1OAYL 1AZRA 4M56A 3RVXD 4QEGA 4B7LA 5FM4A 4ESKA 4KK5D 3WHXB 5J56B 5GIRA 4A63A 3OR7A 2LW3A 1YEDA 2NYZA 1SDAB 4NQDE 4UNIA 2BZCA 2X89D 4YLQT 5AW7B 1LEIA 1YPZB 3R4DA 4HF5H 4A38A 2X4QB 2DWDA 2QQNL 4Y0GA 4JX0A 4JQVA 1MVUB 1S9KC 2CM6A 3QPKA 4WY7H 4UOZA 3N42B 4NRXA 2R4SL 2IAMB 2X3CA 3JWOH 4U1GC 3PWPD 4RVBA 4IKIA 1OP3K 1FO0A 3E9UA 2BNRD 1GGTA 4UTCA 1CLOH 4QRBA 1BG9A 4ATTA 4NZDA 1SHXA 5GGSB 3QZNA 3EO0A 4UANA 3TONA 3HAEG 4JPKH 1CJYA 2FSEB 3OR7B 4B3VA 1KJVA 1KJ3H 4F37K 3X1GA 2YUXA 3IXAA 4XCNB 2Q7AA 5LNDA 4OKVB 3HZYA 3ARFC 3T0WA 2IQAA 4XMLH 7FABH 5DWUH 4UNTA 1BQRA 1S7XA 1KCUL 3MRKB 1JPSL 4X98B 3V5DB 1IKOP 3U36B 5CP7B 3VXUB 3ARBB 3GXUB 4X4YA 1N3NB 2HXAA 3HN3A 3ZPDA 2HJKA 4E9YA 2F7IA 1II4E 4DKDC 1G7IA 4PS8A 3EBGA 3LS5H 4K3DH 3APDA 4RBPH 3LKQB 5H2BA 4MJHA 3W5NA 3M1BA 2V3EA 2CBMA 1P4UA 5J11B 2FLRT 4NHCH 4FTVA 1X4ZA 1EJ8A 3SE8H 4EMZA 1KXVC 3KJ6L 4UTAH 1CR9L 2OM5A 4X5PA 2IALB 1JMZA 1FL6A 3ARRA 4GY4A 1Y07A 3CC5A 3CE1A 4O9HH 1D6EB 5FV2A 3QAZC 3FS9A 3OB0K 4BFEA 2ATKA 4HS3A 4JO3L 3THML 4DZ8A 4ZTOL 1IM9A 2P5WE 4AEIH 2H1LM 1PD1A 2TRHA 4FLOA 1F4XH 3OC8A 4AEHL 5BJTB 2WHVA 2NLJA 25C8H 2PP8A 4QHMA 4PRIA 4N2OA 3GUTB 1J9QA 1KJ2H 3VW3L 2HT4C 1SEQL 2COVD 2XN9B 3HZMB 4XP5H 3FFOA 4RBPK 4AMKH 1TMCB 3N1QC 3KMDA 3MCKB 4LBAA 2LU5A 4M6OH 4ODTL 1NGXB 1U8PA 5KVGH 5MI0C 1ZK5A 4NIYE 4UV7H 4YVUA 3NJXA 3QJHB 5E5UB 5AW8B 1ZGLA 5I1EH 2B1OA 5JHBA 4F33B 4LLAA 1M9SA 5I5MA 4ZS6C 2ZJSH 2JI3A 3T2NH 3PREA 1T1WA 4S0HA 4KV5F 1J5CA 1LDPL 4P2AA 3V4UH 1YPZE 3VA6A 2QEJA 4XNQA 4ZW3A 4LRIA 1PKOA 2EIEA 5AOJA 4H2AA 4FQQA 3GS0A 5F7NC 5KS9E 3FSVA 3CLFH 4NX0A 1MJ8L 3O2WH 3MCG1 5E95B 2OXHA 3CAFA 1ERNA 4U05A 5IB3A 3DIVA 3H8NA 3TCTA 1IEAA 4BKTC 2X1XR 1HHHA 4R4ND 3WFEH 4N8CL 1D7BA 1LO4L 1RZKC 5IROC 4DAGL 1AGEA 1A22B 3O6FC 3O0RH 3T8XB 3MRPA 1F2XK 2ZCKH 3CG8A 3NRQA 2YKKA 3T2LA 2FJFA 3TFKD 1I9IH 4WENB 2G3MA 3O6MH 4YSTA 3WE1A 4DO6A 3SDAC 3ARFB 2BSTA 4R4BA 2IAND 4XCCL 4OZ4A 1GL4B 2CRYA 2HT2C 1KPVB 5JNYA 1MZYA 5KJRH 2Y0SA 3NCYS 4EOWH 4Z7WE 1M7IA 3F62A 3E8UL 2KS0A 4P0DA 3WKPA 2BPBA 4R26L 1SHWA 3I9PA 2WLLB 1AIFA 2R29H 3FQNA 5E00A 3GBNL 4E9SA 1LXMA 4EI5C 2AXFB 3VXOB 2Z31B 1F86A 4OCSH 4X80L 1BX2A 2H3NA 3CH1B 4U0RB 5I18H 5HDBE 3E8UH 3OJDB 5DZNA 2OI9B 3SE9L 2CLRA 2EXWC 1F4WH 4H25A 4JPSA 3V8OA 3G5YB 4PJBA 5C0CD 3DHJA 4PWGA 3VXMA 3D8MA 3F5WA 3GYRA 2V2XB 3C6LC 5CP3A 5BXFB 4BA0A 1ND0B 4PN6A 3SDXB 3KJ4B 3S2AA 2E6JA 3LRHA 4MXVE 3TT3H 1ITBB 4MAYC 2K8MA 1EGJH 3DGGB 3K71B 2VSMB 3WD5H 2UY7B 3FCBA 3QQ9C 2BSED 1UTDA 3GKWH 1DEDA 3MRIA 1FH5L 1HKFA 4ZFGL 1JNLL 1E27A 5ALCH 4HFUL 4MAYB 2DV6A 4OY9A 4RWYL 5I6MA 2A9AA 1I7UB 4W6XB 4ZQKB 1MHCB 1KJMA 1CLYL 1NUDA 2W60B 4HGMA 3TEXA 4I48A 3VFGH 3TBWA 4P3WA 1JN6A 4MMXC 4K8RC 5I0WA 4P2OC 3B6SA 1DQMH 3SDXE 5AUMA 2YQ2A 3ULAB 2GABA 5IJVB 2LV4A 3QXDB 3CNKA 3RGVD 3P0VH 4HZ1A 3BZ4A 1WC7B 2Z91B 4M1CD 3TZVB 1A7PH 3D0LB 1MW2A 4KVNH 3FB7B 2G3XA 1XF4A 4ZZFA 4NN7B 1IIIA 3OAZH 3MRRA 1J1OH 2AFNA 5GGTA 1ZIBA 4C57C 2VDMB 4WSKA 2DH2A 4CMMB 4KKRA 3CZGA 2PW1A 2EXTA 4FS0A 2QGCA 1E9PB 3K5SA 3NEOA 2SODB 4F7EA 4KY1L 4QDGA 4Z3HA 4CL7A 2QZQA 2XVBA 1AXSA 1RULL 2MH4A 1A4BA 4JPVH 1AGFA 3NP3A 1PS3A 2D0GA 2MQ0A 4DHLA 4MFHA 4YXLL 3HRZA 3KWWA 4URKA 1EO8L 3B3IB 4QGTA 5EF2A 4MKMA 4F58H 5E8OA 4XRCB 5FUCC 1MFEH 1INDH 3PCYA 3WIHH 4RFOL 4R0LC 4MAYD 2MMXA 5IR1B 2CLVB 1CXHA 1OTSC 4MJ2A 4MXQC 5E9DE 1OO2A 1XAKA 5SX4H 4FAAB 5DA4A 4J7RA 4N2NA 3L3IB 3L4YA 1JDCA 1V7NL 3ZX1A 1IGYA 2OMUB 4O2FA 1H6TA 1FZOA 4CDHA 5KVDH 4U1LA 1TNNA 2F54D 1VFAB 3D3VB 5LBGA 2Z0UA 1RPKA 4GRLB 5CUSL 1C8QA 1YEEH 1ZLVH 5HI3D 5BVJB 3DA0A 3WOVA 4LHJB 4GQQA 5I82A 5E5MB 2OMTA 1CFVL 1HE7A 3MXVH 3GUTA 1R6VA 5JYLA 4PS3A 1HHIA 4D8OA 3OKDB 4OF5A 4HF5L 3FT3B 2R2HB 3O8XD 2YA2A 1YMHA 2WVVB 4A7VA 2V7HA 1K6QH 3OGOE 5HHNA 3EJSA 4UDUA 4EE2A 4AQ8A 4OF3A 1LEIB 3V10A 1J8HE 4RMRA 1U8MA 3HW7A 3PQYB 2K4AA 4MX7A 1WA2X 4YS4A 1DVFA 5FX3A 3IDUA 4WVRA 4WLCA 1CDIA 3CN1A 3VQ1C 4NXSA 1BF8A 3BKCL 3LEXA 1X5MA 3OMIB 3NACH 1KY7A 4AGQA 3JXAA 2WSPA 4I85A 3BVNB 3F00A 4LP8A 4PBXA 2WXHA 4G80A 1U8QB 2OKMA 4J4PD 4P2QB 4XMLL 3O9WC 2JI1A 2ZF9A 4ZO7A 3WJJC 4UTBA 3SDDB 4OZFG 1LE5B 2CR3A 5IV2B 1RK0B 4Y4FC 2J8UA 4GRLD 3E6HA 1AS8A 5E51A 5GZND 3RBSA 4UT7H 5J11C 4HU2A 5L2KE 5IVNA 1KB9K 1I1AC 2GHZA 4JM4L 3U36A 2MOQA 4FRWA 4KX8A 1UXLA 4O5LL 2XN0A 4P2RA 1E4KC 2A9DA 3W5MA 3LS5L 2FGZA 2JB5L 4K3DL 3BWAB 2OMZB 5ICUA 5T5FH 1FPTL 1V10A 3C9NA 5AW9B 2DPKA 4KUZH 5TQ2L 2DIEA 3DK2A 3W11D 4M7JL 1SBSH 3IMVA 1HINL 4PPTA 2QLVB 4K07A 4WFFD 5HI4C 3IGLA 2CJUL 1UT1A 5EH1A 2OJEB 1KG0B 3L5WB 1LE5A 4M93B 5FFOA 2H2PD 3FU7B 4DW2H 1PLCA 3HR5A 3KYKH 1NDMB 2R8SL 2ZWZA 1NGPL 2G9HA 3DGDA 4JRYB 4FEIA 1S5IH 2R0LL 3WSQL 1XSOA 2FQDA 5T3XH 1UXWB 1H6FA 4U1JB 3APMA 2XQBH 2V4LA 4EXPX 2XWCA 3RIFK 4HGKC 1F4XL 5LGKA 2UXFA 1Z0MA 2EKSA 2VDOB 4MYWB 4GIPD 1G0XA 5D93C 5JDJA 3GFUA 4YBLC 5HYIA 4RGND 4I48B 2QT6A 1JPTL 3KPMA 5DJZB 4Y1AD 3LZNA 4XNZC 4GKSB 4L9LA 1TFHA 2VRKA 3MLUL 4XCYB 2BSRB 2J5WA 4Y19E 4OCMC 4HJEA 3D0VB 4NKIL 1GC1C 5I76A 4APQD 4I0KA 3K72B 4EDWL 3S9DB 2VLKB 2W8CA 3S4SG 4XXWC 4PYGA 4X7TA 4BH8B 4XO9A 5I6XB 1RZFL 1HSAB 2HFGH 4H8QA 1D5RA 1J8KA 3NJJA 2B0SH 4NZ8A 1PG7H 1UOLA 4FXGA 1Z5LA 1DE4A 3L5XL 4NAMA 1HNGA 3ZIYA 3KL5A 3HNSH 1TZHA 3KEHA 3KWWB 1BD2D 1LM8V 2OSWA 5EC1A 1E28A 1BVKB 5CJOH 1P84J 4RIRA 3SIKA 5KTEH 2WWKO 2G5BA 1I1CA 1VGEH 2XNAB 3FB5B 1QNZH 3SJVA 5CP3H 2QZ5A 3U4AA 3P40A 1YQVH 4IDJH 5KSVB 4P3CH 2BIIA 3O3UN 1JZHA 4F92B 5EULV 1F8TH 3BMWA 1GTNA 1JI1A 4PRIE 5CLXA 1BQKA 4P4KD 5BV7B 4Y1AB 2E7HA 1S8DA 2R0ZH 1ZGLB 1PZ5A 1U8LA 1AXSB 2B59A 4MZ2A 3TA3C 2XZQL 1MRFL 4P5SA 4M62H 4N0UE 4XAKD 4X7EC 1NCOA 3DX0A 4RAUA 4ODXB 1KCSH 4R2GB 5J6SA 4J3BA 2R7EB 1KCRL 3B9KB 1ICTA 1SDYA 4EIZC 4JHWH 2RHEA 4B53A 1RSYA 1ETJA 3MV9E 2H1PH 3QPXL 4HGWB 1MXDA 3ECWA 1T89A 1W72L 3L3DB 3EZ8A 4QRSA 1W72A 1UACL 2GK0A 2HX9A 3CVHA 1G7MA 1G7PA 1BFOB 1BD2E 1KN4L 1VZGA 2R2CA 3QPXH 5FHBL 3MODL 3O4OB 2O61A 5I71B 3S96B 4MAUH 1PG7W 3B8YA 4JL2A 5GRJH 4H7VA 2XV3A 5JIDA 4Z7WF 3O3DA 1MW0A 3UMNA 2LFGA 4IMLA 2DM3A 4HSQA 4DNLA 1AXTH 1YJDC 1KGYE 4Y2LA 1UD6A 4N20A 3EZJB 3ULVC 1CLZH 3CQPA 4ZS7H 4GYBA 2QHRH 1Q9LA 4NUMA 5D5MA 2XPGA 4EVNB 3CCHA 3V0AC 1MNUH 1KGCE 3JWDC 4L3CB 3OZLA 4WO4D 1PZSA 3L54A 5E5LA 1CQYA 2CGYA 3GXMA 3VNZA 2EABA 3BAWA 4KK8C 3FTYA 4FFZH 4WEUD 3NH7L 4XXCA 2EDJA 1IJNA 1MUJA 1QPPA 1B9KA 3C5JA 4B97A 2DQEL 4HIJB 5KSBB 1MCIA 5KUMA 2YXVA 3L9RA 1F1AA 3GBDA 5CJQL 2OMBA 5E24E 2X9WA 2FUTA 3MKGA 2JB6B 2O26U 3QFDA 4PJIE 4XBGA 2E75C 3QR0A 1AKJA 3GEFA 2XWZA 3NA9L 2EE3A 5C0DB 4M7KL 4XC1H 2A1WH 1CICB 5DA0B 4KNSA 1NFIA 1WLHA 3ARUA 2PYFA 3O2WL 4CC0A 2HVJB 3EDEA 4HWZB 4ZAKC 3QFJE 3KLHD 1K5NA 3S5LA 4GW4B 4HC1H 1QI3A 1GKEA 4KX7A 2YBRA 2G2NA 3GHEL 1N67A 3WUZA 3ZYOA 4IYKA 2A0LD 3N41F 4Q2ZB 3TO4B 2IANA 3SO3C 1FO0L 1IFGA 4A6YH 1DUZB 4I1RA 4NDMB 5EU4B 2WTRA 2LVCA 3GXIA 2VRQA 4XOCA 2FB4L 5D70H 1JZ7A 3GSOA 5HGDB 3N04A 2XZAH 4JFSA 3ARGB 1XGUB 4NQCB 1TJXA 1W9XA 4RGMB 3VI4E 1I3GL 5HI5C 4CNIA 2FT8A 4IRZL 2EVIA 3BUBA 1TJIL 1TFPA 3D9AL 4J6IA 2JELL 1SY6A 3KAAA 4WI9A 1NSNH 2HLAA 2YPVA 3C6SA 2QDWA 4HUUB 3WLWC 4XCNA 1PZUB 4P9HH 3ZQWA 1AQKL 5J13B 1YUKB 3R8QA 1CDYA 1NKGA 1QWUA 3ARDB 3MV8E 4KK8D 4ZXBA 1JYNA 2VLRD 3D33A 2BM3A 3D5OF 3UTQA 2MNWA 4ZD3L 1E4XH 2BCMA 3KPNB 3P9MA 3W1ZA 3II3A 3PWNA 4YPGB 5EEVA 3CX5J 3ILPB 3RFZC 2AC0A 2AJSH 2VW6A 2NR6C 4YC2C 2OR9L 1DQDH 3QUMB 4LSRH 4PBWD 4NM4H 1WAAA 1QZ1A 3CSYB 3VGHA 4F7MB 5JW3L 4TVSa 4Z95L 4NRZA 5GRVL 1DQDL 1SEBB 5TE4H 1KPRA 5C7XH 4UQ9A 1KLUA 5FYJU 2J8HA 4WO0A 2PYEA 4FERA 2NRDA 3WAKA 3ZUNC 1P7KA 2BOLA 3MJ7A 5HSFA 5I1GH 1HOCB 2P42B 1MF2L 3FB6B 4BFJA 5AW0B 5F0PB 1YEGL 1JHTA 4NN6C 2OTUA 5L88H 4ODSL 3D0AA 2NY0C 2DM7A 1OCWL 1A6ZB 3RY6A 1U93B 1E6OH 1FLTX 2XKSA 3B6SB 4HEME 1UKQA 4B96A 3HE6D 2Y23A 1NUGA 1JVKA 1T22A 2ITDA 2Z8WC 3U9WA 4AGNA 4L8BB 3ZHFA 2O6DA 1XXDC 1H8LA 1XO8A 3MRJA 2P7TB 3QXTA 3GSRB 5HPOA 1TJHH 3TF4A 4RFEA 4P9HC 2DWEB 4WFGD 1H3PL 2HKAA 2X05A 4DUVA 3N85L 4R7NA 3RKDD 5I19L 3BKYH 5KVGE 5MERB 3GI9L 5IMKB 1ADQA 1OLZA 2PABA 3I3DA 3OXSA 5FGCE 5J1AB 1F13A 3NJLA 1W91A 1CLOL 2Y1ZA 3FHAA 2OJZL 3QO0B 3VB9A 3U9PL 3ZMNA 3DSNA 4S10A 4L4VD 1H3WM 4G83A 2EXYC 3PGCB 2BFVH 3FTSA 3DX3A 5LQBL 1YVLA 1HZHH 2BHZA 2DQJH 2QQLL 2MQCA 3PE9A 3GZOA 3CD4A 4G8AC 4MDIB 4N8PA 4JO5A 5CSZA 3RL1A 1HL5A 3RWJB 1TTBA 3X3FL 1DSFH 3Q48A 1AJ7L 3L48A 3EG9A 4B9ZA 1P7QB 3S34H 5IKCB 4OLXL 5HYEA 3U6XA 2X6MA 2ZP0T 3I6KA 1TXKA 3LV3B 1GYVA 3RWGA 4Y4KA 4XP1H 3QQ4A 1E65A 2DWSA 2YMXL 1D5MA 3WKNA 1A1MA 2P28B 2ZZUT 1A1OA 3BUTA 1RPUA 4WRLA 3FT3A 3DETC 3I6GA 3AUVA 4LLWB 1P7HL 2X4SA 3KXFE 4DPRA 3Q1SL 1KLFA 3VD2A 1FIGL 5I1JL 4PRPA 5FDYA 3ETSA 4JANA 1PCSA 2O4EA 4LQFH 4JZOA 5HP5A 4J3XA 1FA4A 3K6SA 1R46A 3CXDL 1KPVA 2YXMA 5JNYB 2OMNA 4DGWC 5HYSG 3NJVA 1NCCL 4KUCF 5C0GB 5DHDA 5LGHL 1SXBA 4PW9A 4QJ4B 1C1EL 4PJ5D 1JFHA 2Y5TB 1ADQL 5ILTL 4ZMWA 2SEBB 2P47B 3MUZ1 4LLWA 3L17A 3HC4H 2ZUSA 3UCRA 3QI9A 3AREB 4FHKA 4JO2L 4EEEA 2ZAGA 2WWOA 1OM3L 3HE7C 5E1AA 4HDIB 1WBXA 4PJ9D 4L9DA 3R1GH 3CFIC 1UM4L 5BZWA 3ZRFC 5CFHA 4MA7H 1IAIM 3AT9A 2NTFB 4IHBA 3HG5A 3VFWA 3MXWH 5AVYB 3R1GL 4J6RL 5I0VA 5C0GA 4YDKL 4FI6A 1NLBH 2X9XA 4TOYH 4N0FA 5EFIA 4A7SA 3OC5A 4EI5D 1VACB 1WWBX 1XIWC 1AANA 3MLRH 4XVOA 4WDIB 4ELKB 4RX4D 4UCFA 3ROLB 1KCRH 4LE8A 3RDJA 1ZK9A 4PRIB 1OPOA 1YQ2A 3F85A 3AAZB 3DVGA 4GQRA 1NCNA 2DQCL 4H20H 3V6BR 2RCSL 3IN2A 2ARWA 2EADA 4H8WL 2X7LA 3HFFA 3MA7B 1N6QL 4UILH 1RHFA 1X6LA 4GW1A 2UZXA 4QXGH 4W6YB 3KCPA 3RYMA 4JAMA 3MBXH 1IIKA 5CINL 5EFIB 1YNTB 1CFBA 3FONA 1DLHB 3IAQA 1H3VA 1X44A 4J4PA 3QEHA 1I1FB 4XMPH 1RIVL 4HG4J 1AI1H 2ICEB 2WZ5A 2LQRA 3KDMA 4JR9H 4AVJA 3VSTA 1TVDA 5C0ND 3CPUA 3ZDXE 4ODTH 5GGRA 4P5TB 1H19A 2F53B 1GC1H 2HFFB 5IHBA 1QRNE 2E8YA 2B5IB 3DOSA 3KZ8A 5TPWH 2I7SA 3PU7A 1X4YA 3VWJB 15C8H 2J6EH 1PJ9A 1TQSA 2X4RA 4WNSA 1GYWA 5ENWA 5CD3B 3KWXA 1NKOA 4B3EA 1Y7VA 4QRPA 1ETB1 1T0OA 1NOFA 1S7XB 3IGUA 4Y4HD 3ROOA 2XFXA 3QAZB 3SB3A 3QXVA 4QRUB 3AWFA 1BOGB 3Q2WA 2NUPB 2YIHA 1WFOA 2BMKB 5H4YA 2Y6SC 1BA9A 2COQA 1HTYA 2P9RA 3FT9A 5I73C 2H9GA 3V0GA 1HDMB 5JHLL 4HA1A 2CCLA 2R0KL 3POHA 4HOWA 5C0FB 4W9IC 4YHOH 1A7NL 3NCEB 3WFDH 4J39A 2FJFB 1V55B 4ODBD 4XNXL 1YQVL 5D2NE 3IJ7A 4Z78B 3UEZA 3A21A 1ZWIB 1GGBL 1N6UA 1A4AA 3EYOB 1RVFL 4HZLB 2WXQA 4IEFB 4LCWA 3RJOA 4QRPE 2J8OA 4AM0B 3OM3B 3BFQG 3NACL 3MKKA 5C0AA 4BFOA 4ENEC 1R0AL 1UCBH 1ODUA 3HEIB 3WEAA 4Y4KB 1IL1B 4L4VE 1FE8H 1NMCC 4MMXA 4OD3H 4XCCH 5F3BA 4UQ3B 3BCDA 5AW6B 4YXHL 5BW7C 5JHAA 5EU6A 3C8HA 2RR3A 1TG8A 2WBXA 1I3GH 3CX2A 1HKLH 3LMJL 3FCSA 5EF1A 4JHVA 4WZ9A 4Y9GA 1OCWH 1PD6A 4N68A 5CSZB 2MSPA 4AT6A 3QIBB 5KSAD 4HETA 4JE4B 2VT0A 2ZKHL 4KH2A 1OAKH 4DPCX 1I1AD 3EDDA 5AVRB 3ARPA 1QZNA 1VB9A 4X9IA 1YMMA 5CGYD 5K1JA 4ELME 3ZKNC 2BFGA 4GKNA 4X4ME 1KGXA 2Z65C 3RDTD 4GO8A 5T33L 1TQBB 4NENA 1OTSD 3IDMA 3NSYA 4QPEA 5EN2A 5E08H 3PABB 2V2TB 1CTNA 1QVOB 2GUYA 2E7MA 2XC8A 3O8XB 2MCMA 3TA4D 3FCTA 2R0WL 3O45A 4RMSA 4F58L 4P46C 3ESPA 4I0PD 3NIFB 4S0TD 4F91B 4DN4L 3HN5A 3F83A 4M6AA 2XN2A 3IGFA 3FJTA 2KYIA 3U2IA 3FO0L 1YMMB 1T0MA 1U3JA 3QAQA 4MSWA 5DUBA 1UXMA 4UUJB 1P5UC 2X70A 4I18A 2QKIA 1GA2A 3LX9A 4V1DA 1ASOA 4GI9A 3PAZA 3DVFA 2BINA 4K9EH 1JNHB 3ARSA 3V9FA 2CIKA 4L4TB 2VGLM 1UOVA 2ZUQB 1A2YA 3KYAA 4HOMA 5KANG 3BESR 4NKOB 5EOCJ 1DBMH 2EDRA 3TTSA 4E68A 2E9IA 4OAWB 3PV6A 4PJ8C 3NCCB 3D2TA 4HS6A 4NPYA 3FFCE 4ZUWA 3V0HA 3CFJA 1NJ9A 1N6VA 1XH3A 3T3PB 2YQGA 3VA2C 1ZHKA 1E8WA 4ZW5A 5IESL 4YO0A 3D07A 2RIKA 3BT2H 4FHJA 4TSAL 2W95A 3MA7A 1Z6JT 1PEWA 3IMRA 3BQUC 1OANA 4PTTB 4DVRH 1QLRB 3U9PH 1AQDB 4N8VG 5DSCB 1ACCA 4Y8DC 2IFFH 4ELKA 1ZAGA 1FO0H 4UB0H 4L29A 1A7QH 3RGBA 5EZIL 2DIAA 1IBBA 4XMZA 5K39B 1T20B 4AC2A 2ICEA 3JTTA 4FQPA 5TE6L 1QR1B 5J3HD 2N59A 3AWGA 2JLPA 5CJBA 1P9MC 5CBAA 4HALA 3DPDA 4Y4HC 1MWAB 3HZKA 3EH3B 4BA8A 1BYPA 4N0CC 5K9KB 2AZAA 5FYKL 4JO2H 1W8OA 3NIGF 4EI5A 2PO6C 1U3HD 5F9DC 4OM1L 4OZHA 3MRBA 4YSSA 2NY2C 4LSUL 1IAOA 5J9PA 4Z23A 1TKWA 3H55A 5KSVA 4WFHE 3GBEA 4QXTB 1CS6A 2PTUA 4PJCF 3S0PA 2WMPB 3QDJE 2J73A 4U3SA 3TN0C 5D9SB 5FCUH 4Y7MA 3HMXL 3QHTC 4NZFA 4G2AA 4JFHD 2WBJC 4P59H 4LPWA 2HKHL 1C16A 3KW8A 4JN1L 3ZTCC 4WNQA 4GKOA 4B41A 5DGRA 5FDWA 2UXGA 4N2DA 2H9GB 4QHKJ 2DJSA 1BQHG 4W9LC 1RUPH 3US0A 3ZW3A 3K6DA 2FX9H 4KRLB 4N2IA 4YZFE 3ZDXF 1U95A 1SMAA 2JKXA 2KLTA 4MJIE 1QWNA 3VSUA 1JVLA 1MZZA 1XF4B 4PB9L 3GJEB 4ZDHB 3KVDD 3US1A 4YSDA 3BKJH 3JV6B 3O6LH 1PQZB 2LLLA 2EZ0D 3ABZA 2UVFA 3VXME 2CUIA 3UAFA 4M7ZC 5DS1A 2J3SA 1KSRA 4L3EA 3HE6A 4WJ5B 35C8L 4AOFA 1UFGA 1IGML 4E9WA 5HD8C 1HC1A 3KBEA 4E41E 4WI4A 3HRZB 2WKOA 3MX0A 1W6LA 2AGJH 5CKGA 4XOEA 4L8BA 1IFHH 3V4PL 1QLEL 3ZGHA 4KZDL 5CILH 2KQMA 5GS2D 2XPGB 1T2JA 3QEQB 2A6KB 3S88L 3O0LA 2NY1B 3KW7A 2F8IA 3OPZL 5DLMH 3MLRL 1TCMA 2EC8A 1EIBA 2I60H 2JKLA 4FQXB 3HR5B 1TR7A 4J3TA 4F7TA 3NZ8A 3WE6A 5C0IB 4NHUB 1FGVH 2J5LC 3T8VA 2Z3FA 4ZW6A 3N41B 5IREA 3L5XH 3E8VA 1WCQA 4L1BA 4P5RA 3BO8A 4AJYV 3EJUA 4PJBB 2SEBA 5TJWK 1I53A 3JZ7A 4WJKB 5G4NA 2P8PA 3ZXAC 5DC9B 4UILL 2EVGA 3MBEC 5SX5K 4G71B 3L3OC 3KBFA 3NJGA 4XO4A 1EGJA 1EUUA 4LSSL 4X6BA 1UD5A 2NDFA 4M3KB 4YJZL 2EDDA 4GUPA 3IU4H 1NIEA 3HRPA 1H0DA 1AD9A 2B4CH 3PHQB 3TVMA 1AJ7H 4C83B 4HISA 2YXFA 4OF7A 5JIPA 3U0TB 1AI1L 3U7YH 1OOAA 3PL6B 3O2VH 2B3IA 3RWCA 1UYWL 1LO4H 2PPFA 2BWIA 2DW5A 1MRFH 3L3KA 1ND0A 4NKIH 3NFPA 2G5UA 3BLPX 3OHXC 3BP6B 1UM5H 2EXSA 4LDLB 4YSEA 2XNAA 3FB5A 3SJVB 1N0XL 3MLYH 4LDCA 1MFMA 1T66C 4YH6A 4WUKH 4MA3A 4OJAA 3HC2A 2VL5B 3S35H 3JWDH 3UPRA 4QRTA 1QFWH 4YHMH 2XN9E 4KROD 5D71L 1R75A 4QOKD 1OLLA 5DD5L 1GY1A 1JXDA 1IKFL 3GSXA 3ZDZE 3ZKMC 2ED7A 2UWEA 4XZUB 2IADA 1F5WA 1YEIH 1MEXH 3L3GB 4QRRD 4BFBD 4W9CC 3O11A 3KXFB 1HEHC 2HRPL 2C3VB 2BY0A 5GRVK 2FO1A 3ARVA 4O02L 5G5DA 4U6HA 1U8KB 1PVHA 2AQQA 4TTDD 2O93L 5HD8D 1SF3A 3C8KA 3RKDC 4XTRD 4DK6A 4E9RA 4HVBA 4ALAL 3B7UX 1ZV9A 2AJUH 4FQHA 1T3FA 1GHFH 2R69L 2IF7A 2K45A 4JKKA 3EYUL 2O6EA 4F7MA 1YDPA 1YEGH 1MY5A 3KR3L 3O4LB 3QORC 4V33A 1T1XA 4UM9B 4U1JA 3BISA 3Q9QA 2WNGA 1AQ8A 5F1KC 3HVNA 2FJGB 4EBQL 4BZ2H 1KIUB 1NEPA 3JTBA 2LFEA 2FATL 1U2CA 4XMKH 5FYLE 1AVAA 3VFMB 1AGFB 1WVZA 2MCPH 5HJ3A 2NY3C 3DXAB 4MXWL 1NCDL 3B7SA 4PY8J 4DN3H 3HNVL 5JOEA 3O8XC 1A7RL 2OMTB 1BXVA 3HS0C 5ID1B 1E7UA 1OAKL 3IFOB 5CZXC 1TNMA 4X8CA 4NEHB 5E4OA 3VWKC 3C5ZB 4WW1A 5TDOA 5C6TH 3FQUB 1NCWL 1I1YB 2R56H 4X83A 4CA4A 3OPUA 2IH1A 4UDTA 3PQYE 3MLTA 3MC0A 3MSPA 1UWXH 3G5WA 4O4YH 4Z7UE 1VIWA 4PVBA 2V3FA 4E9VA 3MOBH 1HH9B 4R7DB 2EO9A 4ZFOL 4EPSA 4KHTL 1A25A 2HLEB 1QYGL 1J87A 1DQIA 3RY5A 5EOQH 4YK4B 2HTKD 5DVOA 3SDYL 2DMCA 3OQ3B 2FHBA 3UTPE 2L4OA 1XTLA 3ZTNL 1QYGH 3ZTEA 5A2IH 1KELL 1U8CA 4XO8A 1KIPA 4KKLC 4G8IB 5IBLD 3TPKA 2B4CC 4A66A 5A2KH 2VQ4A 3EF4A 4K3EH 4TVUA 3NZUA 5HHXL 1NBCA 4OCWL 3BIKB 3H85A 4PWEA 1UVQA 1SM3H 4FZEH 1ETZA 5TE7H 3X17A 1GOFA 2B77A 3ZR6A 5EO1B 5C0EA 3D12B 4KKLD 4KHXL 1EFXB 4XP6H 3HMXA 1KIQA 2O5XH 1QSEB 3QUGA 3BKCH 1K6QL 1E5ZA 3MV8B 4M8QB 2VZUA 1H3TA 1P6AB 1E0OB 5DMIH 1GGBH 4U7MA 3D25A 1JHLH 4PCTA 3FPYA 2ESVE 2O6FA 2HLAB 3T4AC 3LHPH 4TNVF 3OX8A 3RVUD 5I1GL 1HN1A 2F5BL 2K8QA 4JFQA 1O6TA 5DURB 3A5VA 3L16A 5DTFA 2B5IC 4ZTOH 3GC3A 1FFOA 1VKXA 1PX3A 3T3ME 2MHAA 3V52H 3MZTA 4BWTA 4IGBB 4AQ1B 1FZMA 2JKTM 3CK0H 5E9NA 1WBXB 4YQXL 3BUQA 4Y2NA 5IOPB 4CMHC 2L7QA 3QC5X 4O5LH 4M02A 3W11C 1HIMH 4ZMAT 3QH3B 1A9BB 3NCYP 3HBPA 4JM2A 4YGVB 4KXZH 4OLZH 1UD3A 2PXYB 2DQUL 3QO1B 4H0IA 4HDIA 3WXWL 4TOYL 4HLJA 4OZFA 3UABA 2YD7A 5DUPH 2Z64C 3TX4A 2ETWA 1CF8H 3UPRB 3ZT5A 2NW2A 2QVKA 5HHPA 2B1AL 3C6LB 5D1ZI 4GO9A 4HAFA 4U1HA 2NXYD 1MIMH 4QTIH 2KL6A 3FMGL 2EDFA 4I3RL 4L2LA 4IBZA 4RZCB 1QNIA 3MMEB 3TASA 4GLRH 4QXGL 3VRJA 4PG9A 2EYRB 4LFHG 3G6DH 3II1A 3NESA 1BCIA 4DGIH 4UIMA 1T21B 5F72S 2DQJL 2V7NB 2A6JA 3WY3A 4XCYA 4HUVA 2AW2A 3S4SB 2OMWB 3MACH 1PPIA 4Z5RA 3VFSB 3ZDXB 4B50A 5DO2C 4AQZA 1KCBA 2CLZB 3FDWA 5BQDA 3NBNA 5EB9A 1AZBA 3BAKA 3SYCA 1C08B 3S36X 4Z7WB 4BINA 1A4JB 2MTPA 2OW6A 4PJDA 3VI4B 1JZ3A 4KNUA 2QR0B 2BIPA 4IOIB 2VLLA 5ECJE 3VXPA 4FLQA 5HGHB 1C5CH 1QLEH 1ZSDA 3MRFB 4HS3B 3BP5B 4AYDC 5C71A 4HW6A 2EDLA 1PEZA 4BK5C 4GKZB 3NK3A 4U1SA 5IQ7L 5IMMB 1QASA 5I1JH 3WTYA 4A04A 3T71A 3OAUH 1MWOA 3W0WA 5E6IC 3T0EE 1GAFH 4K9EC 2BS9A 5C0RH 2JJSC 3BDYL 4FDWA 5E8EA 3CN0A 4B0MB 5IF0A 3VTAA 4UT6H 4PVMA 1J10A 4HU8A 4UDTB 5AYTA 2B3RA 2ENYA 2H3NB 5CZVH 4XI5C 3HFMH 1U3HA 4NGHL 1E8YA 2I9LB 3MJ8A 4LVOB 1NLDL 2E4FA 1BVNP 2HFEB 1UZGA 2Y25A 4K8RH 2VDLB 4OLWH 3BGFC 4XP4L 4Z7UB 3HR6A 4LLVB 3VWJC 4ZMZA 3FQ4A 3OD3A 5JORB 3M86A 3C60A 4Z77B 1L7IH 5EPMA 5EBWB 5HHOA 1CC3A 2JTDA 2NY5H 3SDDA 1WFNA 3ZK0A 4QY8B 4HIXH 3GXNA 2C1OA 1DUYB 2IH1B 3GBML 5D55A 1YPZF 4XE0A 2Q20A 5CR8A 3O6ML 1MI5A 2NNXA 5LXGL 1HOCA 2ZYHA 3GMRA 1UD2A 4OCYL 5FDWB 2N56A 1IEAB 1KJ2B 1JXGA 3AY4A 3VWJD 1OAUH 4V11A 2XDHA 2DLHA 4R8WL 4F15B 3FO2A 3MU3A 4OB5H 3VD0A 3QIBA 2WVVA 3GK8H 4KZ0A 1MHPH 5I0YA 1F58L 1UJ3C 1FHNA 4OJDH 4ZS6D 3ATFA 1F6AA 5T1LA 1A1NB 3FUNA 1W72H 1REIA 5E1GA 3FTZA 3QG7L 4PGDB 5AW1B 2X4QA 5KVEE 5KBMA 1N59B 2KC0A 1WT5A 2DOCA 2I5YH 1OB1A 5LJYH 3WEOA 3K2KA 4MA7L 3KWUA 3QG7H 3CX5K 3EYFA 5A7BA 3KPMB 3TWCH 3GSNL 3NTCH 5E4AA 1MLBA 3Q5TA 3IU3A 3OSKA 4RAVA 5TDNA 4NAJA 4LBEB 4B9FA 3N6YA 3ATBA 1R4XA 1AZUA 3ARGA 2D7NA 4KXDA 1YO4A 5DVKA 1YNLH 4OZHF 4F57H 2NY6B 5CCKH 5IR1A 4APQC 1WA1X 2DQHH 4K9EL 3ZE0B 4JPWH 3HC0A 3QJSB 3GEWB 3T1FB 2HPOA 2DEXX 4R90H 4OT1L 1WP6A 1JF1B 4XPAH 4G43A 1T04B 5F1NA 4R90L 3CJJA 5E6SB 1RZPA 4RQQA 4W9DC 2QADC 4KDTA 3QIBD 5KSAB 2HG0A 1FNHA 3CTTA 3JV0A 4K8RD 4GOSA 3LPFA 2QQNH 4GUPB 1X3DA 4HK3N 4MS8D 5I75C 1X7SA 3BZ4B 4FJYA 4YX2H 1F6LL 3FBQA 1PSKH 3FTUA 1DFBL 5IJVA 3BJ91 1CXKA 5CGTA 3WS6A 3N0PB 4QTFA 4IIZA 1MCFA 2KZ1B 1QKZH 3FUHA 2V7HB 2BVTA 3O2DH 4NSKA 1PSKL 1DFBH 1ZJAA 2BVYA 2DMHA 3U7YL 1HEZA 2OTWB 1C08A 4Z7WA 3TBBA 1NC2B 5HHMD 4U1MA 1X5HA 3U7WH 4J3SA 4I8DA 3MOBL 2V3DA 5GS0H 1XEUA 2XWJA 1OAXH 2B14A 4M6NH 5E6YA 5I17A 2B16A 4MJ6B 4XHJD 4CILA 2F1BA 5EOQL 1BAFL 4ODXA 3SO3B 3HNTL 3RU8L 3OXRA 3QIWB 2VXUH 4E0RA 5FHAL 4G82A 2O5ZL 2XIBA 1R47A 3B83A 1KCVH 3CZEA 3WIIL 1FNSH 4Z6AT 4Q6YA 2R4RL 5KSBF 5DQ9A 1AC0A 3HIZA 3UERA 3G6AB 3RWDB 1MN4A 2J4WL 5DHEA 4XMVA 4JG0H 3T0BA 3APNA 3LQAC 4WU7B 3U0PA 2WINB 5BUGA 5TE7L 2X3AA 4XNXH 3VXRA 1XMWA 4TNFA 4D7PA 2ZWLT 3ROLA 3B7YA 2ZX7A 1TETH 2XIIA 4GBXB 1G5GA 4N9OB 3INUL 1C16B 2KI6A 2IOIA 4WEEA 1CK0H 4C58B 1G4MA 3GQFA 3CC1A 3HC3L 1WEJH 1ZS8B 1V3KA 5SWZE 4YHLL 1C5DB 4PGZA 2AKRB 3VYNA 4FQHB 1LEGB 2XA8L 3CFDB 3RPIA 5L2KB 4P48A 4GRWF 2BVPB 3MNWA 3Q43A 4Y2DD 4HLZH 1EJ6A 4NJ9H 4YK4C 1F1GA 1NL0L 3LMJH 3PIQA 4G6FB 4MCNA 1M9WA 1PZ5B 1VZIA 1NDGA 2A77H 2BIHA 4QY8A 2CH8A 2BVUA 2ICWJ 3A6OA 4P2RE 4KC3B 3C5JB 3P9LA 1FFOB 2ZKHH 1VKXB 5I8CA 2WWMC 5DS2A 3MTXA 5I1CL 4A7TA 1D5BB 1U3HB 1WV7T 4NRYB 4KQ3H 4ONHA 1S9VA 4JLRA 3V4PA 1OE1A 2AVGA 4FJZA 5CHNA 5F7KC 5IBUG 1RD6A 2WP3O 5K9JH 1FAKT 3WTUA 1KB5H 5SWQB 3GSWA 2OMXA 2YJLA 5TQ0H 2JJVA 4DCQA 4FA8A 4X5RA 4Q9RL 1NCWH 3V55A 3AT8A 1A5FH 2BSSB 4YDVB 5DRZA 2Q9OA 4KXZI 2ZWKA 1ACXA 1QSFD 1V3JA 4MNQD 4V1DE 3TU6A 5IIEB 1NMBH 1DBJL 4MNGE 3L1GA 4KITB 1SJHA 2JJTC 2NY1C 2UXVA 4QKTA 3PAYA 2MPAH 4BV1A 3T65A 2VR8A 4XPBH 3G5YA 1L9RA 4FG4A 1L9MA 3MRDA 4HKZB 1YNKL 2R1XB 3ARBD 4JREC 4MASA 4FG0A 4PJEA 3UZQA 4DO4A 3KD4A 1IGJB 3PHQA 2VCOA 3QUZA 3L7EB 4WTXA 5KVDL 2CRMA 4R97C 1ADWA 2X41A 3I6LD 4B9JA 4Z5RB 3PGDA 1UYWH 3QZBA 1D5XB 2UZPA 2Q7YB 3PUCA 1D7CA 1LK3H 2G9HB 4JRYA 1HWWA 1U8JA 5TFSL 5ADPL 3DRQB 2WM0A 4P49A 4PY8I 3QNFA 1FHGA 1DJIA 1MHEA 1T7YA 3C5SA 4P59L 5EUOB 5K69A 4Z1PA 4ZOCA 2ZUYA 4OLYH 1BIHA 2B9AA 1I9RL 3SE8L 2NR6D 5DUML 1RUPL 1G87A 3MMEA 5ECGA 4AQ8C 4ZUSB 5DU7A 1IE4A 5AVTB 3PV7A 2OJEA 1U91A 1SYSB 3CDGA 2GTWB 1XDTT 1HQRB 1SEBA 3GMQB 4MWFB 3K46A 4LCCB 5KW9L 1HEJC 4NKDB 4JZNA 5FO8B 4W9JC 1E7VA 4F1ZA 1OARL 3CZKA 4K3JH 3PP3K 2XN9D 1QSEE 1Y18B 4NO0D 1JZ2A 2N1TE 3LIZH 3UTSB 2WW8A 2F5BH 4LF3B 4MHHG 4YSOA 5DJCA 3V0VA 3FFCD 3ZKND 4XT1C 3OHXB 4G8EA 2FD6L 3ARBA 1BXUA 3UADA 3L4WA 4OFQA 4QR7A 4YN3A 5IOPA 2NNAA 4U3CA 1VADB 1ONQB 3CFNA 3PDOA 2FJSA 3VRIA 3COOA 4KKNA 2YEVB 3QH3A 1P4IH 4YBLB 2IWKA 3CZNA 2Q7NA 3NSFA 4J8QA 4AMKL 1HL9A 1NLBL 2Y72A 5DK0B 5ICXA 5CEXB 1CGXA 2I69A 4BCZA 3KGUA 4LSPL 1U95B 2BVQB 1UA7A 2XN1A 4RGNC 4Z0BH 1SGKA 1XGQA 3MPCA 4FQLL 3EYSL 1HHJA 1XBDA 3VI4F 2F7PA 4WAFA 1KCSL 4X6FB 2Z1KA 1BFVH 3FO1A 5KS9B 3CHXA 5E0QA 1NEZB 5T1KD 3L4TA 4AYBA 5C07B 3T2NL 1ONQA 2Z4TA 3PDOB 4F5CA 3QARA 4RZCA 4G1EB 2IQ9L 3K3QA 4HSCX 4BXSV 2Y5QA 5FYLH 3FO2B 3P4OA 3WFZA 1AR1B 7CGTA 3LRKA 5E5MA 4OKDA 3RHWF 4X5XA 1NA8A 2K7PA 1N9PA 3OKDA 4HHAA 5FLVA 4PB0H 4NYLB 5EOCL 1QSFE 2Z93A 3ROOB 1U8PB 3BFOA 4WHYH 4OZIB 1XH1A 4CMMA 1MOEA 1XB8A 3I75B 1JERA 1KYUA 1WTGT 1MCDA 1H9DA 4QRPB 2VMCA 4GS7B 1DUYA 4AL8C 1UJ3B 4ILDA 2XIDA 3TA3B 3OG6B 2XWEA 4QRUA 3SQBA 1FG9C 4IBVA 1AQDA 1KOAA 3NCFB 4LRNL 1TSHA 4IMKC 1R5IB 1HH9A 5L4IA 1RK1B 1R5VB 1Q0XH 4Q2ZA 4FFYL 3MRFA 1JK9B 5CJXA 5KSAC 4MRBA 3CVIH 5LDUA 1OAXL 4M6NL 2O5YL 4WUKL 1AO7B 4YHZH 3Q2VA 4HH8A 4QRFA 4ONFL 1BPLB 4PJEE 3ECBB 1D3CA 2EO1A 2PR9A 3BAIA 9PCYA 3SEPA 4U1NB 4JGNA 1N64H 1CN4A 1B4TA 1L6ZA 1KWKA 3NCWA 2OR8A 4F8TA 5HHXH 4YHOL 3H9SA 2VABB 5CIPH 4R0LA 5B8CC 3LZFL 4HIJA 5E8EB 3HLAA 3UDWA 3T65B 3O6KH 3I6LE 4FN0A 1TTRA 4XX1E 1CDHA 3BIKA 4L1LA 4TPRH 5L8JB 4YAQB 2WP3T 4IBQA 2DMKA 3QJTB 5F9WC 4NPJA 2PCXA 2C9VA 5D2NC 3VU1A 4AYID 3P4MA 3CCHB 1WBYA 4NUJB 5B38A 1LMKA 5AVUB 5JW3H 5LWYL 4DCQB 1X5KA 4L3ED 4YXHH 2MFNA 1CD1B 1DBAL 2EDYA 5DZVA 1MCPL 1CFNA 1D5XA 2Q7YA 3L7EA 4HIXL 3VFWB 1XSJA 2V9RA 5F96L 1HH6B 1T4WA 5MEOB 1KBWA 3O41A 2RFXB 4KKZA 1EZSA 3CVHH 1I9EA 2Y06H 3F7VA 1HILB 3GDCA 3GBNH 2V2WA 1S9WB 3NCJL 3P0YL 2F5AL 4OCXL 1AHKA 2LVEA 1LILA 4K23L 1FZMB 1XMEB 5A3ID 4GBXC 2V2XA 1BIIA 2NDGA 3F58L 4N2EA 3VJ6B 3K71A 4TQIA 4OGZA 4GIOA 1IGTB 2EH8H 3HCVA 3EKCA 2R2EA 2VR6A 5C8JA 3VXRD 1P1ZA 2VW7A 1CFQA 2NW2B 2Z4QA 5IBTH 3WTWA 4YXKL 4YBQD 4KTYA 1E3FA 4QO1B 3WD5L 4BEIA 1JGEA 1XGZA 1SLWA 1QRND 2C1PA 2H2SD 3PJLA 1WAPA 4A37A 3BGFB 2X53A 2LE9A 5T3ZH 4RFOH 4GAJH 2YBGA 1E3XA 4ZFOB 5CCHE 4BFNA 2YRLA 2F54B 2AEIT 2VN6A 1LO0L 1UUNA 5D1QA 3UTZB 5I16A 1IM3B 3GPSA 4LP5A 3RUGE 5MENA 5DHMC 1LJMA 1SJEA 1I7RB 3QDHA 3BVTA 3KPQA 5F7AA 1OP5H 1UWXK 3TM6A 3U0WL 2E0PA