4A7VA

Structure of human i113t sod1 mutant complexed with dopamine in the p21 space group
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Ligand Binding and Aggregation of Pathogenic Sod1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7vA00
5CU9A 1OAJA 1SXSA 1EJ8A 2WYZA 1E9OA 1SXAA 1B4TA 1SOSA 3GTTA 1SRDA 1TO4A 5KBMA 1CBJA 1SPDA 3KH4A 4B3EA 3GZPA 4N3UA 2C9UA 1SDYA 1Z9NA 2V0AA 2C9VA 1OZTG 3KM1A 1FUNA 1PTZA 1YAZA 3CE1A 4A7GF 2AQSA 1BA9A 2E46A 4A7TA 3GZQA 1U3NA 1XTMA 3H2PA 1KMGA 2GBUA 3ECUA 1F18A 1N18A 4L05A 3GTVA 1YSOA 1HL5A 1BZOA 3ECWA 1UXMA 1XTLA 1E9PA 1P1VA 3L9YA 1TO5A 2AEOA 2VR6A 1YAIA 1Q0EA 5KBLA 4A7UA 3QQDA 1SXZA 2WKOA 3KM2A 2SODB 2Z7ZA 3S0PA 2WZ6A 1S4IA 4N3TA 2VR7A 2ZKWA 1PZSA 1SXCA 2XJLA 2ZKYA 2AQTA 1E9PB 3ECVA 1DSWA 2WWNA 2GBTA 3LTVA 1ESOA 1PU0A 1OALA 1E9OB 2VR8A 2E47A 4FF9A 2R27A 1IBBA 4BCZA 3PU7A 2Q2LA 1EQWA 3F7LA 2WYTA 3HFFA 1JK9A 4A7GA 1RK7A 3F7KA 1XSOA 3T5WA 1OEZW 3HW7A 1E9QA 3MNDA 2NNXA 2Z7UA 4OH2A 2AQQA 3HOGA 2ZKXA 2AF2A 3MKGA 1F1AA 2GBVA 2ZOWA 5KBKA 1OZUA 2K4WA 1B4LA 3CQQA 1SXBA 3QQDB 3RE0A 4A7VA 2JLPA 1AZVA 4A7QA 4BD4A 2JCWA 2AQPA 2APSA 1SXNA 2WWOA 3H2QA 1IBFA 3GQFA 3KBEA 1MFMA 1F1GA 3L9EA 2AQRA 4U4IA 1COBA 2LU5A 2WZ0A 4MCMA 1N19A 2C9SA 1SDAB 3GZOA 2WZ5A 1CB4A 2XJKA 1IBDA 1JK9B 1L3NA 1JCVA 1DO5A 1QUPA 2Z7WA 2Z7YA 3CQPA 1E9QB 3KBFA 2AQNA 3KH3A 1F1DA 1IBHA 1Z9PA 3K91A 1UXLA 2WKOF 3SODB 4MCNA 4A7SA 4BCYA 1HL4A 1IB5A 4OJAA
chains in the Genus database with same CATH superfamily
2CNYA 1A14L 2X38A 1RHHB 4AEIL 2EILB 4WEBL 4BH8B 4FFZL 3VGHA 1SRDA 3HI1A 4OZFB 1OCOB 2Q10A 2BIOA 3W0WB 4L9LB 3LZQA 1L9PA 1XT5A 3PP3H 3WSQH 1ZKAA 3NSCA 2A9NH 4GP8B 4PJDF 1AGBA 2OV0A 4GUPA 4LVHB 3U1SL 2IQ9L 1IM3B 1XH0A 1XF5B 4XMUA 3IN2A 3DXAA 2OLDA 5IT2H 3QIWA 2A83A 1QACA 1YYLH 2RQEA 3GGWB 3AS1A 4QOKA 4V1DD 1NC4A 1NCOA 3G5WA 1WBYB 1OCWH 4DOHE 3D25A 1JF1A 4X6DF 4KI5D 3I9IA 4YBHA 2FYYA 2VGLM 3AS3A 4QRQA 1Z0MA 4EF3A 1EHNA 5L8LB 3ZO0A 2OXHA 4XAKD 5LQBH 3HB3B 5JUEL 2ZAIA 4AG4L 1JV5A 1YECL 1G0XA 4NBZB 5HHVL 1HE8A 4OT1L 4PJ5D 4JY6A 3RFZC 3VQ2C 1VGKB 4QY8B 4AKQA 4LOUD 2MFNA 3T2NL 1J10A 4C83A 1N2RB 4GRLC 1PEZA 3S2AA 1EJOL 2AK1H 2ZUQB 1QFOA 2F1BA 4LSUH 5ESAB 3ULUF 4XAWH 1XF2B 1DQMH 4FQXA 2EH8L 4OD2B 5HHMD 2NLJA 3NPSC 4NWTH 5F44A 2ADGB 1KJMB 3WNMA 2NNXA 1E4WL 5D9SA 5B39A 1C08B 1QRND 3MLYL 1LQSR 3MRJB 3RUGB 4A6YL 3GUTA 1MQKL 3AJ7A 4YUEL 5EO0B 4PJBB 4AJVA 4NN7B 5LXVA 3CLEH 4M4RB 1QLRA 5I1HL 5E9AA 3SKNA 1YEHH 1SUJA 2UVEA 3GT6A 2X3BA 2CK0H 4PWHA 3D39E 4BDVA 1RULH 3N43F 2J20A 1A4AA 4J3OF 2WUBH 4KO5A 4W93A 3RNKB 3KLLA 1AKJA 3DOHA 4L2YA 3UERA 2ADJA 5DEGB 5EWIL 3ZRSA 2R8SL 1XB3A 4S11A 5ETUB 3C8KA 3JT0A 4ZT1A 3UTTB 3UYRL 1RH8A 1OAYL 5F6HI 3N91A 4RFNC 2QVMA 4DAGL 2DQTL 1EEZB 4KPHL 4LLUA 3RWEA 2Y3NA 3AT0A 3C08L 1YEDB 2OL3B 3WIIL 2X9WA 3KHQA 3SGEI 1S3KH 5I2IA 2PF6A 2XACC 4GRLD 3UO1H 2YUWA 4LHUB 4N28A 1JPSH 4RMTA 3DOIA 4QHMB 1NMAL 2GJZA 2MTAA 2P8PB 3ASNB 3K5RA 3QUMB 4DEUA 2P52A 5IB2B 1A4KA 2R2HB 2P26A 1CLYH 4NO5A 1I8LA 3UTPE 2C1PB 4P2QB 3V52H 2XXGA 2BWIA 4WZ9A 2ZXWB 3CK0H 4JJ5A 3SGDI 3TNNB 3IF1A 2H3NA 5DC9B 5J11C 2X6AA 1T7XA 4IJ3B 1JCKA 4ZUVB 4PJGB 2DLHA 2YD0A 3F85A 3BJ91 4BXVA 1KTBA 1MJJA 2JK5B 2VE6B 2YD5A 3NZUA 2HFEB 3ZR5A 2FVNA 1XAKA 4H0LC 3FRPG 4AYID 4MNQD 3U83A 4AV0A 3NDYE 4IU3B 5HYJA 1FYTB 5FUCE 4XMTA 1YAIA 2NNAA 4PU2A 2B4CC 3FUHA 4ZODA 1FZMA 4ZPVB 5IVZA 1WIUA 1T20A 4V2BA 4ZX5A 2DQHH 3T0XA 4Y9FA 3UJTL 1TTCA 3JWNE 1UA6L 1WT5A 2VLRD 3EZ8A 2MPAH 1AI1L 4IJTA 4YDLC 5DYFA 1LL1A 2AJUH 3F6JA 5DHVA 4Z0BH 3DMMB 1FG9C 2ICWJ 2WWMD 3BW9A 1CWVA 3SBWC 3LN4A 4WTZA 3KPOB 2BSED 1N8ZB 3FTGB 5AG9A 3VD3A 1KXQE 5DSCA 3QNXA 1UCBL 3WS3B 1C5CL 3TFBA 3MLUH 4NM8L 4X42A 3DROB 4OQTH 2VXQL 4LCWA 1QFUL 2P49B 1R3HB 1OAUL 3VSUA 2BSRA 1B3IA 3KAAA 3T3MF 4MDJA 5JQIB 4J3UA 1U8CA 2YLHA 3V6ZA 1HX0A 1MCQA 3EO9H 4O2FA 4LLDB 5IROC 4KQ0A 4GMSL 4LP8A 3CN4A 1CE1H 4JW3A 4TVPH 1H5BA 3QFJE 4YE4H 5GRVL 1KN2L 1WFNA 4QUOA 5B8CB 2HVKB 2MEJB 2YR3A 4HWZA 4KXBA 2A6DB 4F27A 1TEYA 5IOKA 1BFTA 2OR8A 1XX9C 2AQRA 5IK3A 3AQXA 3AG4B 3MXVH 3P9LA 4HHWA 2YARA 4NHCH 1ZXQA 1TQBB 3WTTA 4XBPA 3MNWB 3B3IA 5A2JH 3MU3A 1MRCH 3IT8D 3VXUD 5IMMB 3BVDB 4WQOA 2I24N 3T0AA 4Z0XA 1CFSB 3PABA 1KTRL 1CD9B 5I6OA 3FTSA 1NFDB 1MCRA 5KYUB 2MHAB 2Y5QA 2Y7QB 3PL6A 4PY8I 5E1IA 4FP8H 1UXLA 2YO3A 1J0ZA 2K9UA 3EXLA 2A9DA 1WS8A 2ICEB 2DQDH 5EF2A 2MCPH 2V3EA 3EHBD 3FFCE 5B3SB 3K2MC 1DYZA 2CLZB 5KYNA 4L3EE 2VZSA 2Q8AH 2XRAH 4F15B 3QARA 1YZZA 4OZIE 2ENSA 1IC5L 3QA3B 1QR1B 5DHXB 5DD6A 6PCYA 4RGOH 4DP9X 2N1KA 5E1HB 2AQSA 2JKSA 1D5BB 3Q8CA 1E67A 1FL3B 3I84A 5F7BA 2X4RB 3ZE0B 1NAML 5E6UB 5IROD 5KN5B 1W8NA 2VXSL 4G6FD 4LLQB 3AGWA 4UQAA 1SEBB 3IFOB 2EYSA 4D9RD 3H42H 4PJ8D 4O9HL 4LNRA 5F7MC 1CFBA 4OZGB 2R1YA 4CSSA 3AT9A 3LXAA 3C5SA 3PGDA 1U58B 3GMNB 1F8TH 5G55A 4Z7AA 4W6WB 4HWNA 4L0ZA 5CBAA 1MHPH 5SWSB 3BWUF 2WINB 4NEHB 2NY0B 1J1XH 2QGCA 4UM9D 5IQLA 3B34A 5DJZB 4CSPA 3VJ6A 1H9DA 5D2NB 5AVWB 1ZS2A 1I9JH 2HKAA 4QHLB 4LLYA 4N6RA 1SGKA 1ZHKB 2OTUB 2MNWA 2XDHA 4L37B 4EOWH 3EO0B 1G7IA 2C3VB 3BVWA 5IWLC 1BZ9A 4RETB 3FOLB 4BWTA 1KG0A 5BO0D 4DCQB 4GSXA 4JN1L 3WJJA 2DY2A 2JQMA 3SQBA 1CR9L 4FQJL 1I3UA 4YDVA 3UZVB 1T6BX 3NACL 3LD8C 1MCDA 4D0CB 4F92B 3QWOA 1I1YA 4JVUA 5IW1B 3N0PB 3RB7A 4WK4B 4DHLA 3TT1L 3L3DA 3MUZ1 3HMXL 3AQYA 1QVOB 4F58L 4F3FB 1T1XA 1JDCA 1KCRL 2AJYL 4WWPA 4GI8A 1SNRA 2X1XR 5DS2A 2IWFA 3IJEA 5IQ7L 3IDGB 3S88H 5ANMB 3FTVA 3QDMA 1M1XA 1LYQA 3O2WH 2ZKHL 3ARDD 2JKRM 1T4WA 2E6PA 3EJSA 4TS6A 2XVGA 5C0IB 4YSOA 5D7IA 2DWTA 1LILA 1J88A 1JIBA 1TQCB 1KT2A 3ZKXB 2H3KA 1QI3A 3FT4B 1MCHA 5DA0B 1A7QL 2EACA 4OD3H 1A65A 1DR9A 1PL3A 2GFBB 2FWLB 4GMTL 4FI6A 5KYXA 2OK0L 3NEOA 5ELIA 1W72L 4WUUD 4WWID 1R4XA 3W0WE 1AFVL 1X7TA 5D96C 4WHDA 2ETWA 4EDWL 1HJCA 1E7VA 2X5PA 5LG6A 3MRGB 3O2VH 5D1QD 2RH0A 2EQDA 2JJSC 4KDTA 3RG1C 4GIPD 1C5BL 4G7YH 5BUGA 2APVA 4HIXL 4HCRL 1D5MB 2AFNA 2QZ5A 3VDAA 3S3SA 3AGVA 3GB7A 1U2HA 4FEMA 5C0NC 5DD0L 3V5KB 1R3IL 1Q4NX 5HI4C 4DW2L 5I0DA 1DZ0A 4G6JL 1ITCA 1CYGA 2OMXA 1CFMA 2WP3O 5B38A 1PNCA 1I7RB 2VAAB 1KLUA 4I13B 1IGMH 1AG6A 1HXYB 1MRFH 2A4EA 2R0KH 3ZTCC 3WJLC 1AHKA 1G9MH 2C3HA 3QP3A 3K72A 3MJGX 4TOYH 1BAWA 2C7FA 4ZO9A 3ZT5A 5GHWL 1L6XA 2VIRA 4K23L 2C9QA 2ZOLB 5FWQA 4BFIA 3MN8A 5AZ2H 2Y7OA 1MF2L 1L6PA 2X1QA 5AW7B 4JPIB 4FTVB 2B59B 2DOCA 4GIAA 4PVNA 4HOXA 3SE9H 4C58B 4N87A 1CFTA 2ZWLT 1SQMA 3K8LA 1Y18B 3BWSA 4XXCA 5AW3B 4TRPH 2Q6WB 4TQEH 1TCRB 3PXLA 1MFAH 2AJSH 5I6MA 5FGRA 3KWWA 4XMKL 1L7IH 3EOYG 3RUGE 1F4HA 2ODHA 4PJBE 1PAZA 2CRIA 3TN0C 4ZFOL 2C9XA 3VCLB 2XXFA 5FYJD 1RFDL 4U31A 3EGDB 3CSGA 3WEXB 1ORSB 1TIUA 3MRIB 4GBXC 1FSKC 5JMOC 2B5IC 2ZOWA 4TVSa 3TYFB 1TSRA 4H0GA 4XX1G 5C0ND 3RVVD 2WOYA 3OKOA 4XN4A 4MCYA 5JXAL 3EGSB 1H15B 5TDOB 3UTTE 5I6XC 4M7ZB 3FQWB 1F13A 4XXWA 4F9PC 4G8IA 1CU4H 4G9FB 2AQ1A 2VJXA 4U6TA 1TJGL 4BXSV 3HE6D 4MZIA 3D2TA 4ODVH 1HS6A 4B9KC 3OHXC 4CGUB 4DKEH 1TZIA 4YXKH 1E43A 2H32A 3FN0H 1H8SA 5HYSA 5ICYB 5EUOF 4EBQH 4HZAA 5T1DH 5F21B 1HE7A 3O4LB 4PJHF 2BY0A 5FV2A 5E6RB 1HEJC 4TUKL 5FFGA 4FCAA 1N6QH 1BAGA 2IFFL 4PJAA 5E2WH 1U8NA 1F1DA 1TFHA 3SE3C 1S7QA 1B9KA 2FX7H 4K3DH 3ARYA 3B7YA 4MCNA 2IANA 5F0LB 4P2QE 1N64H 1LE5A 5I1GL 1RIVH 2GT9A 4KXZH 3UZQB 3IJYB 3V6OE 3WD5H 2F58H 1MY7A 1UKQA 4KVNL 1EAQA 3TN0D 1YMHB 4PJGE 4H5SA 3ATEA 3PWUB 5J57B 4GBXD 1IIIA 2VM9A 4P2RA 4FFWC 5LCVA 3OKEA 3RL1B 4GXVH 1HINL 1RSYA 3U2IA 1FYTE 3U9WA 1OIOA 1XMWA 4XXDB 1YNTA 3MGTB 4J4PA 4UT9H 4PRHB 2FNWA 4U6HB 2A7BA 4J6RL 4E41B 3IDNA 4M6NL 2YLKA 2WNXA 4Z7QF 4LKCB 1W80A 4Y5YB 3J07A 3C75A 3TVMC 1C8QA 4PJXB 1KC5H 1X5AA 3T1FB 4FXGC 1NLBL 4XCEB 4AGLA 2VXTL 1JGVL 5D4IA 2IMNA 3MMEB 4KTEL 4H0HB 1ZEAH 3KPRD 1FFOA 3BP7B 1ROWA 1NIBA 1SYSA 1YY8B 1UZ6F 2R0ZL 3VX1A 1QPPA 1RK1A 2DBLL 5E4EB 1QEWB 4DP0X 4JL1A 4H7VA 4PLKC 2V7NA 4F7MA 2F5AL 2BIPA 1PKQB 5HPOA 2B9BA 3MBEC 1NQBA 1ACYL 1QLEH 5G4NA 4MNHA 3TFKD 3WKNA 1KCSH 4FHBD 3QK0A 5FUZH 1QBMH 3VD7A 2EIKB 4DIXA 3PJSB 1N26A 2HJLA 1BP3B 4NB7A 1S9YA 4DVRL 4ZG1A 4FFWD 5HYIA 5DJAB 1GC1H 3MROA 5H8DA 1BHGA 2XQYG 5GRUL 5CMAA 2X87A 4G7QB 4ORZC 4D8PA 2YSSB 4JRYB 3D30A 3D39D 2QHRH 1S7SA 4M00A 1OHQA 3D12B 5CJXC 3CLFL 3SBQA 2CIKB 2XPGB 4N8UA 4OFYD 3NQKA 3P0YL 2ID5A 1UHVA 4X98A 4A1RA 1EZVY 3NESA 2NX5B 5A7EA 2CMRL 1NFDE 2RD0A 1NGXA 1Q9OB 5DMGD 4R90H 4N2NA 2E6JA 2ZYIA 4OLVL 4I1NB 2UXVA 3PGCA 2D03L 3D2UB 1YPZF 3W2DH 4Y4KC 4TPRL 1KPRA 3K91A 4NN6B 5HHQA 3VFWB 3CH1A 1A7NL 2BRQA 5I66B 4PLKD 5C0DA 2P8LA 1BQLL 3SKOA 5D7JA 3P73A 5AW2B 2XWDA 2J2ZA 1VENA 3O6FB 1U8PB 2D2CC 2J5LC 3DK0A 2QKIB 3MBED 4O02A 3JWDL 4UT6A 4ZFZB 3RAJH 3O0RL 3OKLA 3OZLA 4KROB 3S9DB 5I8OH 2EDBA 2GK2A 3DGGA 3JVGA 3MBWB 1U8JA 3PCYA 1P4UA 3QXUA 3T3PF 1S5IL 4JM2A 3TIEA 3WXVL 3ZE0E 2DJUA 1HQRA 3QO1B 4OFQA 3UTPD 5EF0A 4JR9L 5FW7A 2ALWA 3X1BA 4YR6B 5HHXH 2E7CA 4NENB 2X09A 3LKPA 1D7FA 1A3QA 4OCMC 4KWUA 5GJTL 2H8PA 2IOOA 4GEJA 4OZGE 3NK3A 3UAEA 3V4UL 3E8VA 4X9IA 4ZXBA 3VGFA 5IR1A 7FABL 3IXAB 2KDGA 3JBG7 5SWSE 1ILSA 3ZYOA 2WOBA 1PDKB 1N5AA 4RMWA 5C8JB 5D2NE 1RLWA 4CC0A 3HG2A 2CKBL 2NSQA 5E03A 2CPCA 5F97E 3J7HA 4J2XA 4XNMB 1INEL 3CPLB 1UWGH 3R0MA 5DQ9B 5FW6A 3ZRCC 2NXYB 3ILPB 1KEGH 1INQA 4QEGA 1E40A 2XN9D 4DGIL 1R0AL 4KKBD 3GMRB 1ROCA 2PR9A 5LBVA 2Z4QA 1WCBA 1OP9A 3S6CA 1U30A 4GRWB 1A0QL 4LVEA 4TLUA 4AXWA 4HJ0C 2A6KB 3AQDA 5CLWA 5IT2L 3SDAC 4PJEB 1SY6H 3KVQA 5FKAB 3T2PA 4AQ1B 2WC7A 4HOMA 4FABH 1UQSA 3WL9A 3NCXA 3B1UA 3QCVL 4Q6KA 5J12B 4S1DC 3CFKB 4WV1B 3ULUH 2A1WL 4L4TD 1XD0A 4RFOH 3A0OA 4H8WH 5L2JB 1AHWC 4H88H 3TA3C 2MSPA 4OFDA 1GZHA 5ANME 5CEZE 2ZUWA 4V33A 1CGWA 3H0TB 2PO6B 2XHNA 1ORQA 3M17B 1J8SA 1BG1A 5D72L 3ARRA 2VCOA 4LO9A 4PJ7F 1CLOL 3FPYA 4POZC 2A6IB 2ZOUA 4ZW7A 4XAWL 1I1FA 3T8XA 1R75A 1AP2A 4P5KA 4J3OH 1GYWA 1DEEA 3Q7JA 3QJOA 4A04A 5DUJA 4YPGB 3ZE1F 4U0RC 3VXTB 3UJIL 3D0AA 4LARL 4J3WA 4YH6A 2MCG1 5E4OA 4BCYA 4EUPG 3CLEL 1FFNA 1KB5A 1IM9A 1UWXK 4Y16D 1FH5L 3O3DA 1UD4A 3SDAD 2CK0L 4YZFE 1X9LA 1UWXH 5BJTB 1RULL 4B95C 1R5WA 3ESVF 3REVA 4K5PA 1TVDA 3VXNA 4L3ED 2G75A 2G3MA 5AD0B 1OGAD 3B9AA 2WVVB 3FC8A 2H6OA 3KD4A 3TA3D 5DVLA 3MRLA 4HT1L 1JTOA 3F05A 4IRJD 5CLYA 5JIMA 4AIZA 1T1YB 1P69B 5I6NA 4GSQA 1CICB 2H0PA 1NPJA 4LPUA 4U3SA 4UTBH 5HVFB 1HHIB 3VO0A 3NG5A 2BZCA 5KVDH 4KMLB 1QI4A 1BLNA 2H45A 2A73A 2H6PB 4FTVE 3U9UA 4BKTC 4HKBA 1CGTA 4POZD 3OHMB 4OU3A 2DL9A 3K2IA 4O4YH 4WWKC 5E9NA 4ONHB 4ZYKB 5HVGB 4J28A 3PYCA 3CVDA 1L0XA 1CXHA 4FNRA 3X12B 3FCBA 2PW1A 3OAWA 1U92A 2F74A 3LRSA 3VAEA 1AXSB 1K6QL 4LDOB 5I8EB 1FFRA 2XZZA 3R8QA 5IVOA 4A6YA 1IGCH 1UATA 3NJXA 4XR8C 3FZUC 2WYTA 1QA9B 5F7EL 1B6DA 3NIGF 1JGLH 3CAFA 3F7VB 1X7QA 1KIQA 3NJVA 4PI2A 4PRDB 3K3QA 2AANA 1ICTA 1WGVA 2P80A 4G3YL 4Z7WF 1Y0LA 4QRRB 1QPKA 3L3OA 3VB8A 5I0ZA 1PX4A 3SIKA 3MJ8B 3CFCH 5A16B 3LPPA 1IQWH 3GXFA 2NY4C 3FQTA 1IGYA 2GPZA 4G9FE 1JERA 3EYVB 1V7NH 4LEOB 5EOTB 4HWBH 4NQSA 5F93C 1MFDH 3MLXH 4R4BB 4TULL 3NOIA 2WNKA 4OLYL 5L2KA 2QVKA 2MPAL 5J6HA 1JZDC 4GPVA 1INDH 5GGQL 3I85A 3HB3C 4GAYA 5DQDL 3FN9A 3NABH 2Z8SA 3GFUA 3O4LE 2XWEA 1ETB1 5FYKE 5E7BA 4WWKD 1U8IB 3QDHA 5T33L 3IXTA 1FH2A 3DDFA 4G7VL 4P46A 5E6IA 1NGQH 2YK1L 1GGCH 3OGCA 2J5WA 3HC0A 4MHHG 3PXHA 2D7TL 4IIQA 2EEBA 4AE1A 3QQ9C 2VDLH 4OQTL 4ICXA 3ZKNC 4PVBA 5C07B 3V6FA 2A77H 2WXQA 5E5MA 4C55A 1AQ8A 1X5ZA 1J9TA 3FZUD 4HHAA 2WQUA 4HJGB 4WW2B 1AIFA 2YD7A 3VFPB 3B2PA 2EVFA 3EO9L 3JTTB 3W5MA 3T0VA 1GSMA 5K9OA 2MPVA 4CVUA 5LVEA 1D5ZA 4Y2LA 4HG4J 1JMXA 3ME0A 3NGBB 3GWJA 3Q43A 4GQQA 1NH6A 2R2EB 4ONFL 4TVPL 1G7MB 4JFDD 1DUZA 1HILB 4Q6YA 2C26A 4RA3A 3L81A 1IM3D 1RI8A 2QPFA 4PRHE 1SEQH 2HG5A 2WLMA 2XV6B 2H1PH 4W9GC 3UAJC 4E41E 2BZ7A 4PTTA 1Q9LA 1TU2A 2NY4D 4R4ND 1GGIL 4PCKA 4PBVC 5HGAA 3WGVB 5DUBA 3FRPB 1EUTA 5EU4A 5KTEH 3V7AE 4PJXE 5F72S 4Y4HB 1YNKL 3CU1A 4HS3A 4AYDC 3AB0B 5MEOB 2QQNH 1N3NB 1NA8A 4FKHA 1M7IB 4JJOA 3L6FB 4PMFA 1GZPA 3HB3D 1JHLL 2DMHA 3THML 1NGZA 1CN4A 1JPFA 1JGEA 4TKWA 1KGUA 1P7KB 3FTYA 4P57B 4U1MA 2XWBA 2X6UA 3B37A 1MWAB 1AQHA 4X9FA 2YPVL 2WN3A 3LZOA 2Q8AL 3V0FA 4ECNA 1DJXA 3PWJB 1M9SA 3QQ9D 2HT4C 1PKQE 3UJJH 3AG2B 2Q7YB 3P40A 3BIKA 2VXQA 4HFWB 2HUEA 4PBDA 4ZUSB 4Q9QL 1U8KB 5HJDA 5TK4A 4F7KA 4MJ6B 1BZ7B 3A4FA 1ZLSH 1NEZA 1ZD6A 3HW7A 2XQBL 4KTYA 3EYOB 5AW4B 2KPWA 2VQ1B 1GHFH 3TT3H 3GEFA 3U7YH 2J1YA 3HOGA 2XIDA 3MFFB 2ZX5A 3H42L 4ZTPL 1QW9A 2E5EA 4RRPG 2QBWA 3E6FA 1ZTXE 3DX8B 3BMWA 2A0LC 4JRYE 5D7HA 3SKUD 4WY7H 1ID2A 5KSBF 3BAWA 4PQXA 5DMJB 1Z1WA 1UM6L 1XCQA 1AZVA 5F1NA 1WGOA 4U05A 1F8TL 4K4KA 4H26A 5T3ZD 1BFVH 4JFOB 2NX5E 2XYCA 4PR5B 4PW9A 1MHPL 4GUQA 1KDIA 1FZJA 3GSRB 2ZG3A 4ETQB 3T0WA 1J1XL 2EIEA 3UTTD 1WBXA 1XGTA 3SDCB 4KKCC 2VZUA 3DBXB 4IEFB 5E6ZA 2CO7A 3WS6C 2CO2A 3PHQA 1RJCA 3CDGA 3VXOA 1CF8L 3S34L 3JWOC 1T89A 3FUIA 3C60A 1WWCA 3NMEA 5DC0A 2R7EA 4OCWH 2VWEE 4IGBA 1BFOA 4IU2A 4XNZC 4JHAH 4AK2A 4EDXA 4LHUD 1A6ZB 4OKDA 3K6OA 5TK2A 1VADA 1DFBH 4DP5X 3ETBF 4I88A 5BO1H 1NCBL 4I7ZC 2ORBH 4HUXA 3IGAA 4DP4X 4LCUB 3ZKSD 5F8QC 1I9IH 3B83A 3FFCA 3W57A 3ET9F 5HGDB 4WUKL 4X2UA 4TMPA 5EPMB 4HIEB 1XGRB 2VKWA 2BOCB 2WQWA 1R6VA 3DI2B 3LS5L 3N1FC 5E8DL 2AJVH 1P6WA 3S88L 2DDQH 3KPNB 2UZIH 1IO4C 2ZUTA 3MV8D 4JG5A 2QFPA 2A0LD 1M42A 2WXGA 1Z5LB 3WENA 5M94B 2EXWD 4HEME 4CMMA 5F6HJ 5C97A 1ACXA 1MW2A 3B2XA 5CJOH 4NQVA 2YGOA 3FU6A 3OTTA 3H3BC 5GS0H 2V2WB 4HGWA 2K3HA 5CHNB 2APFA 1FYTD 4KQ4L 3EUUA 3T65B 5IOPA 1ZCRA 4MMYB 4X7EC 3VFTB 1EANA 1U3HB 1GGYA 3QIWC 3F6IA 4KKCD 5KBLA 3VQLA 3QIUB 3FK3A 4GG6F 1DQTA 2IWEA 2RR3A 3NDZE 4ZMNA 2JJUA 2YBRA 1UVQA 3BFWA 4GKOA 4PV9B 4KMTH 5EZOH 4PB0H 4UTAA 3ZKMC 3GMLA 1NEPA 1GMEA 2PYFB 1L9TA 4GRWE 2R4SH 1R47A 2G2RA 3C6LA 4N2KA 1C12B 2AABH 1DQLL 3DMMD 4PJEE 5F89A 4ADGA 1TCMA 2W88A 3FCSA 2F5BH 3TS8A 3DC0A 2HFFB 4CSTA 3F2LA 3O4OB 1XSOA 1J18A 3H8NA 4JM0A 1F41A 3PUCA 1TXKA 4GRMB 3PNWB 2JCCF 1MRFL 1G9ML 1JZGA 4H8HA 5GGVH 4ZFQA 3ZL4L 3HUJB 1M7UA 2YJQA 4AYMC 4ZMYA 1M05B 4PRAA 2D3VA 4G70B 3CWGA 1SYVA 2WKGA 3MODH 4CVXA 4LP4A 3A6BH 3H6AA 5T3XH 1MREH 4ODHH 2H0EA 5KW9L 3ULVF 1H3VA 5ABDE 4XWOD 3RWIA 4TQEL 5E6YA 3VFSB 2OCFD 4U1KA 4Y5XB 2M8XA 5J6SA 1AE6L 1MCSA 4WKXA 1RZIA 1GGBH 2FHFA 3R4RA 5EU5A 2VLKA 4AITA 1W72A 4I1PA 4JZNB 2YRLA 2D3JA 4X6CB 5EU7E 5IHBA 1USZA 5K9JL 2AITA 2WTRB 4PUBL 1NOLA 1EXGA 3QHZL 2OFQA 4GQZA 3LQMA 4MJ5B 3B4NA 4S2SB 4RLDA 3AU0A 4ODBD 1GYAA 1MLBA 4C54A 3FH5A 5DTFB 5DEFA 1KEMH 5DZPA 2R83A 1F3JA 4AIOA 4HEPG 5IGXH 4BJLA 3P2BA 5E2UH 1GY1A 1RZKH 4NKOB 4Y19B 3CVHB 4HKZA 1CU4L 3T3MB 5FCSH 2NY6C 4L5FE 5I8CB 2X9YA 4ODVL 1NWPA 4PGDB 3ATAA 5DD5H 2XZCH 4I2XA 1I8LC 4OZHB 4UYPA 1PZ2A 4YXKL 1U3NA 5ITFB 5FA3A 1DLFL 1DE4A 3FN0L 5EZIL 4C4KT 5CEYB 2E86A 4EBQL 2VDNL 1PEWA 5T1DL 3GTVA 1F11B 2WIMA 4HP5A 5HJ3B 5DS8A 4DO5A 3DIDA 4XC3H 4Y2OB 4ZMTA 4GKLA 3F62A 3QG7H 4JFQB 4O51A 5E2WL 5ISZE 4UM8A 1IFHH 3HS0B 4HIIA 5DFVC 3W9EB 3LNDA 5D7KE 4LESA 2P5EB 1KUMA 2HRLA 4PJIF 5SWSD 5ESAA 2YAEA 1RIVL 2ZKYA 4I18B 2NY0D 5FWRA 4UINL 1XF2A 3WO3B 2QSCH 4ERSL 4OD2A 1K2DB 2NUTB 2Z93A 4QT5B 1BMGA 1S7UB 3ILDA 4P9HC 4ZFOA 5F3FA 3G3LA 3IU4H 4L0PB 2V8MA 4QRRE 1BYNA 5LB1A 4M61A 5FECB 3DTXA 2YKKA 4GXVL 5LAXB 4LQFH 2GY5A 4AJ0A 3LIUA 4M4RA 4XZUB 1TOXA 1ZA6A 2ENJA 3LMJL 1TVBA 3TASA 4E9YA 3GSXB 4HC1L 3D7PA 3OMNB 4LCCB 1UB6B 5FCUL 1NBVL 5EZJA 4Y4FB 2C4XA 3AREA 1PZ5B 2X3AA 3UTQA 5CEXB 1P5VB 1B90A 3CIQA 4LF3B 2OI9B 4M56A 5DEGA 4WIQA 5AW9B 1AZNA 1NAMB 4MLIA 3RWCB 2QLYA 2JCWA 5TD4A 1S7XB 1W9XA 4P48A 4JFWA 4DN3H 1HEZB 2ADFL 5CEZD 3LAFA 3HHMA 2K78A 1CFVH 1OF2B 3MNVA 4FZEH 5BS0B 1P7QB 4QRTA 1H5BC 4IS6A 2VMCA 5DFVD 2F7QA 1N0LA 2JB5L 4FS0A 4PBWD 4KZ0A 1MJ8H 2Q3ZA 3RDTB 4HPHA 5C07E 1F4YH 1DO5A 3U30C 5C70A 1QLEL 5BOJA 4FHJA 4WDIA 1QNZH 5JYLA 3BI9X 5FUZL 3QR2A 3ZSSA 4PP1C 1J87A 3NFPA 3DPBB 2FEDC 2NY5C 1BVOA 1DN2A 5FDWB 3IEAA 1OB1B 3G7TA 3VE0B 3CH8A 3UROR 4ANUA 4KRPB 1BOGB 1LK2A 4TF4A 3C9NA 4LDLB 4XCNA 2ZSWB 3POHA 2KUTA 1CT8A 2K70A 2OJEB 3G9AB 4NQDD 3WDIA 2HFEA 2UWEA 3HZVA 3PAZA 4FQQB 3SKJH 4QXUH 4NI6A 5D4HA 1DVQA 5AYTA 2W0KA 3VFMB 3SYAA 3B2VH 1E5UI 4B9PA 1CUOA 1U8HB 3CSBA 3WUZA 4HETA 2WQAA 2FO4B 1TMCB 3UYPA 3ZL2A 4Z6AT 1KWGA 1VACA 2EEAA 3LKOA 4R5TA 3WIHA 3EBHA 1JN6B 3DSFL 4ODWB 1G5AA 4YDMA 3W2DL 3UPRA 2XNAB 5HGHA 4FTVD 5HSFA 1RMFL 5JPMA 2F15A 3APNA 3GS7A 4YDKH 4TTDD 2XXMB 1ZHLA 3GJEA 1UB5B 5EIVA 1YEIL 1TQWA 3BSZA 3EUDA 3KPOA 2O6EA 1VFAA 3FTGA 5I5MA 2CO6B 2ADIA 2HJKB 2W1NA 3ZTEA 3HAEA 4E42A 4LFHD 4ZMXA 3DROA 3GJFK 3T9WA 4JFEE 3WFHA 4DKTA 2FEDD 1R3HA 5DD3L 3GJFH 5T5FA 1OKEA 1MRDL 1NDGA 4NQXB 4P5TB 2VUYA 1I1AB 3HBPA 4RGNC 3QIBC 2KC0A 2OJZL 1PNDA 4OZ4B 4G8EA 4KRLB 4L3FA 1N7MH 5SX4I 4HMDA 4XP4H 3P0GB 1BGXH 5ABAA 3EYUH 4N0FA 3KG5A 5E5UB 4JFXB 5I26A 3FOMA 3WJJC 1MSPA 3U0PA 1I9RH 3SD5A 2ZPKL 1OOWA 2CBMA 4MZ3A 3OAUL 2HRGA 3AAZA 1UKSA 1I3VA 5MP6H 5ECJE 4B96A 3BN9D 1QR4A 4G9FD 5ESQA 3F65A 4N68A 3VACA 2VXVH 3OZ9L 3RWFA 4FZ8L 2J1KA 4DGVH 1V8HA 1LP9B 3Q06A 5IMMA 4EMZA 1YJDH 5FLUA 1FNFA 2F54A 5EHFA 3WTXA 3CZGA 4U1JA 3O4LD 2CO3A 3E9TA 3ESOA 2VC2L 3T6XA 5E2VH 5KZCB 2P8MA 3STZA 3H9SA 2ICEA 4FABL 4YSQA 2IPTH 4JKKA 3SDYH 5G5DA 2YGPA 4I3SH 1CDYA 2IH3A 1CCZA 4XNXL 5FV1L 4UAOC 5BRZA 3LPGA 5C0AA 4P4KB 4Y0GA 4LZKA 5CU9A 5I19H 5JDSB 3VFRA 3WEMA 4PWJA 4BH7A 3MA7B 1XBRA 3CPUA 4BZ1H 2H2PC 3D05A 1D5BA 3QIBD 1G84A 1IGTB 2OMVB 2ED9A 5LDUA 5HHPB 2CUIA 2FECL 4FHKA 4DKFH 1MJUL 4KZDL 4KDTC 1U8QA 4PRHD 4RWYH 5ADOL 2QHLA 1ET5A 2C3WA 2OCJA 2DN7A 3CU7A 5L0QB 5H37H 4OIAA 2EDMA 1J7VR 2UZYB 5CSZB 2VW7A 3TBSB 1BVKA 1NCDL 3L1EA 2X4SB 3AS2A 4JHBA 4U1HA 3S4SG 2HSIA 2WINA 1OTUC 3IDYB 1SXZA 3ARFA 4YFLI 5HYQA 5H35B 4IRZL 1E3ZA 1SN5A 1RUPH 5F7WC 1D2PA 1KPUA 2DYPB 4JDVB 1DVFA 1V55B 4BK8A 2F8XC 5B1CA 4XO3A 3SGJC 1LDPL 2FBJH 2WNGA 3OKMA 4NPYA 3H4HA 5JHBA 1CMOA 5IFJA 1TLKA 4RAHA 4XXCC 3A6CL 3T4YB 4JRFA 1NGWA 4DUXA 2NZ1A 3UC0L 2QKIC 1XCXA 1DL7H 1J0HA 2UY7B 3GMPB 3K0YA 3C09B 4MDIA 5EOCJ 1E5AA 3HUJE 4N2CA 3BWAB 1ZS8A 4BM7A 1X9UA 1ASOA 3NA9L 2EIMB 4UTBL 2CDFB 4X4XB 1G0YR 2H2PD 5KVEL 1QVOA 5C0BA 3BPCB 3D0LA 1PZDA 3HPJB 1KIUB 3LQZB 3MLRH 2FZ3B 4G80A 3MGOB 1B4RA 3CFDA 4ZD3H 5F7HA 3FT0A 4ZSOA 4O4YL 3BOVA 1G7JB 4JRYD 1FAKT 1HCZA 2FAUA 5IZ7A 3CSYB 5D7LA 5BQDA 3QXAA 1KJ3H 3WY4A 8PAZA 1PLGL 2NYKA 4OCRL 3MUHL 3ABLB 3CFQA 4X6CE 2NX5D 3ISYA 1D9KA 4L1BA 3QFGA 4PJFA 2W9DH 5IBTH 2Q8BL 2BWDA 1DN0A 1IGCL 1PCSA 3LH2H 4JKNA 1LO0L 4B0MB 4HXBH 2BC4A 2GFBA 3SOBH 4I9WD 4DPAX 5I1CL 3SQOH 2L7EA 3KHOA 4UQIM 3TJEH 2YGVA 1CVSC 3VXMB 3D2UD 4LT7A 1CDGA 3FCTA 1KJ2H 3L3IB 3B9KB 4EUPB 1H6UA 3JV4B 3MRRA 5DR5H 4HX1B 4EN3A 1YY9C 3MRHA 2G3NA 4Y19E 3T3ME 4KX9A 4B9FA 3GO1H 1SM3L 4FFVC 4I77L 2QQLH 1C5DB 1MFDL 4KROD 2HRPH 1U36A 4X7SL 5LGKA 4WV1C 3WTYA 4PS7A 3N41B 3LDBB 4FQLL 5EEVA 4E68A 4OZHE 5F3BA 1TO4A 1R24B 3D33A 3TO4B 2H2SD 4C47A 5KAQF 1JUFB 2IFGA 2VAAA 3HC4L 4PRPD 1MFVA 4JHWL 3GSNH 5I30H 4KQ3H 4R0LA 5KS9F 1ZPUA 3NN8A 2ATPA 3TJPA 5DO8A 2WIIB 2PO6C 2WMPA 3KLKA 5ENWB 3U6RB 3U7WL 3MV9B 3QHFH 1T7ZA 2DQJH 2P5EE 5EBGA 2RTTA 1T0NB 5KBNC 3F58L 2LHAA 2GBAA 2VDLL 5E0FA 2YKLL 4J4PC 1KCUH 2H3XC 5C7XH 4QXTB 3R06A 1KGCE 2A77L 2DWDA 4Y8AA 5EORL 1KPVB 1H9VA 3OSKA 4OSUL 5E9DB 5EULV 2VR7A 2ZUXA 2WKLA 3F84A 1FBIH 5E8OB 1KCBA 3G04B 3QUYB 3WUWA 3K0WA 1BD2B 2YXWA 1TTRA 3WE6A 3A24A 2BS71 3L7EB 1NAKH 1CYXA 3J2PA 1DQQB 2CLVA 2LU4A 3ARTA 4KTDH 1FC2D 1J8HD 5DDHB 2NQ3A 4KO9A 3O3AA 3MRIA 4WTQA 4XX1E 5ICXB 1BCIA 1BZEA 4H0IA 4JREC 2GJPA 2X2HA 4FFVD 5KSVA 1LE9A 1YNLH 2Y5TB 4UNIA 5C9JA 4K71C 3BUYA 2JKIS 3QH3B 4KKAD 2O72A 4MRCA 2HLEB 5TDOA 4NNPH 3HLKA 4LEEA 3FQWA 4OGYL 1F6AB 4EI5A 4TNWF 3Q5TA 2QADC 5C0GB 4WW1B 4HIPA 4PJ9A 4GSUA 2PO6D 5BS0E 5ITBH 3AXLB 1SUHA 5CCKH 1T5WB 3LZPA 1A02N 4YL4A 1I8KB 3IN0A 4R7NB 4UNUA 4AV4A 4MD5B 4AL8C 5K9KA 2HG0A 5CIPH 5ICYA 1YDPA 2LFGA 5HGBA 1RAMA 3L9EA 1TZGH 3QJRB 3UJJL 1ZE3H 2V5YA 4J4PD 4OQTA 5E51A 1E4KC 2XTJC 2BSTA 2WXHA 2ERJB 1LM8V 1YUHB 2CKBB 3HJ0A 2WXIA 4QF1A 1QYGH 4J6IA 5GRZA 1GZQB 3FF7A 1VDGA 1IC4H 3L1OL 1GHFL 3IPEA 4WNQB 4PS3A 1Z9LA 4HZ1A 4JGNA 1UWEH 1IL1B 2WVTA 4V11A 2NUPB 5F0PB 2L04A 1XGYH 2FQDA 2EUWA 1KJVA 3RL1A 3ZYIA 4AQOA 5F70A 1ZMYA 4ABUA 1BFVL 5K1NA 3FAXA 5HHOA 3UC2A 4F33A 1ASPA 4XPAH 5D7JC 5LBSH 3TYGH 3JYBA 4PRNB 4Y5YA 2AAVA 5GSVA 5EFIA 1H0DB 4UV4L 1TUPA 1ADQL 4BQ6A 4RZCA 4XCEA 5DXWA 2XLLA 4BKLB 1WZAA 3RA7L 3MMEA 2ZUYA 3LKRA 3RWDB 1T80A 1N68A 4DP7X 2DQFA 3NFSH 3A4DA 4CRPA 5J6GA 3GXTA 3L48A 1LQBC 3N85H 1IGJB 3QISA 2XTJD 1I4FA 1GA2A 7TAAA 2HLFC 1JXFA 5D7KD 2J3SA 4QO1B 3S3PA 2GUOA 3QZWA 2ZP0T 2ZOOA 2WGNB 5LXGH 1G7QA 2YEVB 5LO7A 5GJSH 4DTGL 1IBBA 2UZIL 3TIDA 1JGDA 4XN5A 2LAAA 1J1PL 1YHPA 3CX5J 4X5XA 2WV3A 1IGFL 1JK9A 1MCBA 3MJ6A 3DOSA 4LRNH 4QRRD 1MFCL 2C7UA 3SPVB 4MASA 2Z3FA 3EGXA 2EIZB 4ZUUA 4X0KA 4JFZH 1T6VN 4JO4H 2Z9TA 3UG5A 4TSBH 1L7TH 5D7JD 1KTDB 4NJAH 2F2HA 1BJ1H 2UX7A 3X1GA 2R69L 3ZPDA 2BLFA 2ZAHA 1RU9L 3EKCA 2Z34A 5T1MA 4JL2A 2VMJA 1OZUA 3NCYS 2NW2B 3E6HB 4LCVA 3RYMA 1ASQA 2PABA 1MHEB 2PXYB 3WIAA 4HJSA 4PWEA 4IBYA 4WI8A 4H2CA 3N04A 1UXWA 5D1ZI 1OQOA 1WZ1H 3QCTL 1GZHC 3JZYA 4AZ8B 2QL1A 4G43B 2DMGA 5FEBA 1FLRH 3IYLW 2CCLA 4BFGA 4X6FB 2GJ6A 1BVZA 4AKPA 1G9HA 1BXAA 1TNNA 3QXTA 2QJDA 4N9OB 3ULVH 1J8RA 2QSTA 3R8BB 2HLFD 3HG1B 4NKDB 3MUGA 1Z9MA 1S7VA 1EFXB 5C07D 2NXZC 2J12B 2Z7YA 1YEJL 3HRZA 3MRKB 4L0YA 3O6FA 1OTSD 4ZFZA 4X9YA 2X4QB 4BFNA 4FMKA 3DIFB 2HVJA 1XR8B 1FNSH 1K4CB 5F7DA 1TQVA 4APQB 2OA9A 2A99A 4YHZH 1T5XB 3A6BL 3SHSA 1ZHNB 4M5TA 2HT3C 5T3XL 4X6BB 1GY2A 2X42A 1CVRA 4UZSA 1N70A 3OQRA 2IQAB 2EADA 3DUSA 2DJSA 4E36A 4MJJA 3B7SA 4MXWH 4R97B 3VFOA 1EBAA 2ZXQA 4DEPC 3TC9A 3IU3A 3D1MC 5I71B 2H4EA 4HEMA 1HAWA 3QPQC 4Y4HD 2DWYA 3IFNH 4PGCB 3GSOA 1BLIA 1GTFA 2ATKA 4YX2H 1GAFL 2D9CA 4QTHB 2C4FT 2HPOA 1EV2E 4G1EB 4BQBA 1W0YT 1E0OB 5JW3H 3T77A 3MA9L 5BXFA 4MD0A 2VM3A 2W65A 5TDNB 5I1LB 3EJYC 4UILH 1SXCA 1KNOA 4DT2A 1A4JB 1IAMA 2BVOA 2ZOKB 3Q05A 2GBTA 1NMCB 5K9QI 1L9SA 1RZKL 2NXZD 2Z0UA 3LQAC 4GSRA 5FKAA 3PRZA 2Q76A 2Z91B 3DUHA 4NFBA 4N22A 1ED3A 1AY1H 1WHOA 1M6OA 2NQDA 2UY6A 4HCIA 5DD5L 2XZCL 4KKNA 3ZQXA 2GYSA 1TZHB 3ZE2F 1QSFB 4JY4B 4FL4B 2VDQH 4Q89A 1OSZB 4ZI8A 4FLRA 1KB3A 4G8FA 4Y5VA 1IAOA 2HT3D 4UF7C 3I3DA 1YNTF 5IJCC 3AWFA 4XPTH 5GS3A 4RAUB 5BRQA 2ICCA 3SKMA 1TJMA 1M71A 2VSCA 3QG7L 3IKCB 1CGUA 2XN0A 1VHPA 1C7TA 5AUMA 1H8OA 3L3OC 3QPQD 3RGVA 3C5ZB 5TGBB 2EECA 1AGDB 4MQXC 2V5MA 4PP2A 5AAMC 4D2NA 3I3BA 2QSCL 3SDCD 4N2AA 5J9PA 5EN2A 4X99A 4CAGA 4OGXH 3QG6B 3VXME 4NUJB 1A3LL 4OB5L 1NGYA 4ZQKB 4GW4B 1T1ZB 3EJYD 3FU9A 3GKZA 1XGPB 4PRBB 4Z18A 4JZJC 3IRZA 2OMZB 3LS4H 4JM4L 5DJCA 4ZAKA 1HH6A 4P46C 4M5ZH 4WNSA 3RHWF 1A1NB 5HVWA 5IMLB 4AUJA 3UBFA 3NK4A 3HC3H 5DJ2A 4IIQC 5JPNA 3PWVB 3VWKA 2IOIA 2QPEB 1UH4A 2WVVA 3ARVA 3VU2A 4KZCA 1KFAL 3QORA 5FYLH 2GSIA 4DN3L 3G08A 4GJTB 1P0SE 1O7SA 3BP4B 2XY1A 2OKMA 1IFGA 4UDUA 3MVSA 1QWHA 1QWUA 4AM0A 5D5MA 1CS6A 1MJ8L 2YQ3A 3PV6B 4M8RA 3KPQB 1U3HD 4MQXD 5A2BA 3QUKA 5CN3A 4EEEA 5E9DE 4R5VA 4M1GL 1K5NA 3L5JA 3QIUD 1EEQA 2DWEB 3O3EB 2HX8A 1QNZL 4JCMA 5ISZA 5TDPA 1BD2E 3PY9A 3OJ2C 1KGWA 4LSVL 2PUQT 5JA9A 3FH7A 4OM1L 4QYAA 2AEPH 1WZLA 1MJ7L 2XVLA 3S37X 4CMHC 4YXHH 4JPKL 3KDPB 1U3ZA 3GPEA 1T03L 1S7RB 3O11B 2WHVA 4OJDH 3SSGA 5DJ8A 3VU1A 3MJWA 3F7VA 3QC6X 4UT9A 5GRJH 3WY3A 3O9WA 1L4IA 3ZU8A 3QULA 3ZDYB 1OL0A 5MEQB 5ALBL 3ZT6A 3OQ3B 3DVNB 3QT2A 3V9FA 4B9ZA 1YC8A 3SKJL 3QDJA 4MA7L 3FQRA 4FXKB 4KTGA 4M8VA 5HDRA 3B2VL 1JGIA 3BPNB 4XT1C 1NJ9B 1ZLUH 2OR9H 5KYWB 3BZ5A 3DUUB 3X11B 2PCPA 3CHQA 4QXGL 4OH2A 4LEOA 5E7FA 5EOTA 5FO9B 4K5OA 1K4DA 1UWYA 4R4BA 4E9TA 1UH3A 4IW4C 2O6FA 4WI0A 1KLGB 3L2LA 4R8WH 1RSFA 4GFXA 2Y25A 3TNMB 2LAGB 4ZDHB 1GOGA 3BH9B 4YN3A 2GB2A 2UXGA 4YDKL 4YQXH 4G6MH 1F45A 4L9DA 4JFHE 3S98A 5EEUA 4FQ2H 1T0MB 4IOSA 1HC1A 1B3JA 2VW4A 2YJLA 3RL2B 3MUJA 3GRBA 1RHFA 2Z1KA 1WFJA 2AEQL 4Z3JA 1UOVA 3UTSB 5I1AB 3DHJA 1XF1A 1OPGH 2C9SA 3N9GH 1B9ZA 3FT3A 1JNLH 2E7DA 3WMSA 2Y5EA 5CZRA 3PQYA 2AJ3B 3VFPA 1B2WH 3LXCA 2MQ3A 1IBZA 4NWUL 4UIKH 3QEQD 4PRIA 3R19A 3C60C 1T04A 1N7ML 1P5UA 2R2EA 1T1WB 3WCYA 3B8SA 4ZS6D 4HK3N 2B77A 2IADA 3QUHA 2IGTA 1B0RB 1CDHA 4TYUA 4XO4A 1F42A 5JZ7D 1MHHA 5EC2A 4GQ9L 1WK0A 3AUVA 4J12A 4Y19D 1JRHL 3FB5A 1TJHL 3MC0A 5ICZA 4NNYA 2XZAH 2A9CA 3BKYH 3L3JB 1XF3B 4DGVL 4NT6A 2OI9C 4Q14A 1G7LA 4I9XA 1QRKA 2DTMH 4MA1B 1N3NA 1KLFB 5JIHA 4JE0A 1LO5A 2MMXA 2RQ8A 3FO1A 3KWTA 3GBML 4C57C 3KWXA 1D7DA 2PYEB 5LN4A 5GGSA 4YO0A 3D50A 5F0MB 4GS7B 2EKSB 3DRTB 2CH8A 2PWEA 1AQMA 1O6TA 1P7KA 2P5WA 5FA4B 2VLME 4GAJL 1QBAA 5A3IC 1JPTH 3QZPA 3VI3F 2P5ED 3SDXA 1D5RA 2VITB 4K7FB 2J1ZA 5ERWA 4B5EA 4Z3HA 2MTPA 3OKNA 3BD3A 4PJCB 4FQIH 4HHGA 5DU7A 3M1BB 2FK9A 2CJTA 2JKWA 4MB5A 1CGVA 3WFBL 1KTCA 3E8UL 4BSJA 4RMRA 5MENA 3LZLA 3MRFA 4NZJA 8FABB 4KO6A 4DGYH 1OGTB 3U4BL 2VQ1A 2KS0A 4DP8X 4JFEA 4KRPC 1G6RH 4PJDA 4UOQA 1BIHA 3C6LC 5LJYH 4N0YL 4NYLB 4QTIH 4M48L 3GI8H 3GI9L 1AD9A 3T5WA 1CI5A 1Q9KA 2BHUA 5AEAA 5EDXA 4QKXB 4G42B 1KB9J 2KYIA 2H41A 1WTLA 4WO4A 4Y4FD 3RVWD 2AXGB 4QLWA 1UEMA 1VKXA 4X6DA 3DV4B 5TQ2H 4ENEC 1KBGH 3P4NA 5I5JA 5SWZB 1P4BH 3QJFA 1VPOL 1KYFA 1IGIL 5F7YC 1AGEA 4OI8A 3LZNA 4Y9CA 2Y9RT 2WLYA 1DTUA 2CHXA 5E8PA 4IEFA 2DM4A 5LAPA 1K3ZA 4K3JL 2AQPA 1JV2B 1L0PA 4JLRB 4PTUA 2VDNB 3V5DB 4XOEA 2QT6A 1FO0H 4TLTA 5BS0D 3PWLA 1SY6A 4P4RB 3K2KA 1I7UB 4BFFA 4BRJA 1WC7A 2WQRA 3NCBB 2VDKL 3HG1E 1GJWA 4O2EB 2YAOA 4XO8A 4LKXA 2LQRA 2FWOB 4XVJH 3RDTD 2ZCKH 2GC7C 4H25B 2J4WL 2ZWYA 1DL7L 4I1RA 3AM8A 3MRDA 5FFLA 4HALA 3CD4A 4XRCB 5EF1A 5I6KA 1CURA 1X6NA 5EO1B 2UYLB 2FWSA 3SBRA 1S9WB 4UV7H 4EVNA 2VN6A 4XOAA 3WE1A 4MQ7A 1MCOH 4KRPD 3B1TA 1I1AC 3TEYA 2ZIDA 3FUJA 4LL1A 4LOFA 2V33A 4XP5L 4MRBA 1C16A 5D4JA 1KJ3L 1PIFA 2FGWL 4W9DC 3AG1B 3Q9QA 3T65A 3CBRA 4OLWL 3MNZA 2W9DL 2R29H 2K6ZA 2RCSL 3IDIA 4HXBL 3SOBL 1CLZH 1AO7A 3VXSB 1TYEB 4RX4D 3CSFA 3EF7A 3V4PL 4PCYA 2HKHL 4HSCX 1T22B 3J27A 1J9SA 1KJ2L 2BVEA 5EEZA 3BP6A 4YFDB 3KPMA 3CHPA 4G1MB 3WHE1 5DR5L 1JWMA 3HS8A 1TFPA 3K7UA 4LLVB 4QRSB 4XNDA 5EDSA 1WZMA 2ZKWA 4XHJC 2XJLA 4DERA 3IVKB 3QEUB 5FGCB 1FL6A 4U6XA 5AYUH 4KNQA 1QSFE 1E9OB 1PW3A 2X4PA 4Q9RH 5TJWK 3PNWA 3ARBA 3ARQA 3GSNL 4LPYA 1Q9WB 1FYHB 1DJWA 2N7AA 5HDLA 3WHXA 5AKTA 1QO3B 2DH3A 1SFHA 4P5TD 5JNYB 1I1AD 1WWAX 3HUJA 4KH2A 4Y7OC 2R2BB 4YHNB 3LKSB 1E27A 3Q6GH 1X5XA 2JLLA 4G2AA 3WLBA 4WKZB 4X7TB 4G8GB 1S9KC 2KQMA 3IJ8A 4MNGB 4L2LA 2AXFA 4AVKA 1KCUL 5C7XL 3NFNA 3WFDL 1PCXA 2ROYA 1UD5A 1GOFA 3VFSA 2CJUH 3QQDB 5GGUB 3MUY1 1LGVA 1UASA 2DQEH 1FBIL 3L5WB 1HHGB 3ZO9A 1HXMA 1S7TA 3AREC 4TNWK 5CBEA 2CJSA 3K4AA 1ES0A 3V4VL 2LU7A 4AT6B 1T3FA 1GPOH 1MLCB 1Z3GL 1EH9A 3QZOA 1ZVHA 4KTDL 2Y1YA 5IEKA 2IPKB 3O6KH 3PPSA 4Y2DB 2BOBB 4LSRL 4XHJD 2VDRL 3SCMB 5IB3B 5CU5A 4D0BA 4HWBA 3TPKA 1OANA 2XG4A 4OJYA 1HYSC 1NKRA 4B7LA 4CNIB 1CQYA 2NR6A 3VFVA 4Z8FL 1Y7VA 3IFPA 3C09C 5DJDB 4NKOA 3CVHA 3BDYH 3VFNB 3VDCA 4XBMA 5ITBL 5IVNA 1FP5A 3P9WB 3LVTA 1ZVSB 2DIEA 2VNCA 5DJXA 4UI2A 2VUOA 3BO8A 1HH9B 3QR1A 5KUKA 4FNTA 5KBPA 3E2HB 1U93A 3BIAX 3FHQA 3MLSH 3DYOA 2FQGA 1F11A 5AOMA 5HJ3A 1YUKB 3ALPA 4KK6C 1WYJA 5I1KH 1MDTA 3HMWL 4FLHA 3ZVVA 1QYGL 2EKJA 5EZLA 5I16B 3DHMA 4K7PL 3WFCL 1N6VA 1WVZA 1IC4L 2AW2A 3L3GA 4GUCA 1EO8L 2X05A 1K2DA 4QRUB 1S7UA 1WE5A 3MRQA 1UWEL 5GQBA 3WV0A 3AU1B 3MCG1 3QPXH 4M5SA 1DBKH 5I1JH 2FD6L 1ECYA 4RZKA 3BCFA 4HPOH 3ZDYE 2VC2B 1A7OH 2FX9H 1J1OL 4AY0A 1XGYL 2A74B 1ID5I 3IE4A 1RUQH 4NI3A 3WN5C 5JPMC 4MCZB 3P3UA 1JNHA 1HYSD 3E9UA 3IAQA 4XE0A 2ZG2A 2Z0BA 1F02I 2B39A 4XPAL 4OZIF 4PJ6A 4X5PA 3TPUA 3R1GL 2DLGA 1TQTA 2ZXGA 3EBGA 1ZGLB 2XKSA 4MVBC 3QDGB 3TO4C 3SJVA 4JO1H 4NO3B 2OMWB 1XR9B 4MTMA 5D7SH 3FYEB 1G7HB 2J56A 3MR9A 2LTQB 35C8H 4IOIA 4WHYH 3DO3A 3CMOH 4YDIH 3NFSL 2CD0A 2GITA 2ZP8A 3QFDA 4NS0A 1I1CA 2E7MA 1ZXKA 2VLJD 1U3YA 5D93B 2R9HC 3UTSE 2ITDB 2J88H 2ZAGA 2YGNA 3GXNA 4YBLC 1H6FA 1PQZB 4ZX4A 2WTPA 3DSNA 4XWGL 3PPEA 2M26A 2OZNA 4U1NA 3L16A 4P06A 4NZRH 4H1LH 4P05A 4JMNA 4PWKA 3QWRA 1D5IL 1F90H 4QHNB 1EZLA 1RIUH 3C87A 1ZOXA 3LPFA 1FNEB 1LWHA 1AXIB 5HVHC 5FDWA 4GW5B 4Y88A 5KJRL 3RKPA 4MS8C 2OTWB 4MB4A 4YHPA 4TSBL 2EDXA 4NGHH 3O3BB 2AV7B 3GHEL 2X28A 5I24A 1P7BA 1D5XB 2OJEA 3JWDC 5B1JA 3EDEA 1NC2A 3WKQA 1NICA 3OF6D 1HHJB 1IAKA 4MVBD 3TO4D 1UFUA 2HN7B 4XH2B 2DI9A 4HIJB 5EEYA 1G87A 2Q2EB 2Z92B 2PYEE 5IEHB 4R7XA 5BVJB 1A6AB 4AGPA 3LZFL 5F8RC 3V0GA 5FF6B 1CG9B 1S46A 4ODTL 1E5ZA 1QTSA 1H3PH 1IZJA 1YRKA 3IJHA 3ZUNC 3MRBB 4XMLH 3MV9D 3FO2A 4OLZH 1BM3H 4NUGL 4QRPD 2XNAA 3JQOB 3ULVL 5F1OB 4UQDA 2R9HD 4XGZA 3SY6A 1N18A 5HY9A 1A9BB 4PJCE 5LGJA 3FB7B 5IUCA 1F58H 3DX9B 5DMIH 5CD3B 2QTEA 4YHKL 5EU3B 1MXGA 5E9DD 2IAMA 1FRGH 2XFGB 4U1SB 2IALA 3BWZA 3EO1B 2FH6A 5F96H 1FNSL 1J05B 3U9PH 4CVZB 1JZIA 1BD2D 1Y1UA 4JE4B 5GXBB 1EEYB 2HKFH 3TZVB 1YQVL 3ARFC 5F7LB 2YD8A 4M6MH 2X6BA 3VSQA 43C9A 5C09D 2EIJB 1TVHB 2X4NB 4MS8D 4X5WB 1AXTL 3G6AB 1LO3H 4NQXA 4MXWL 4ELKA 4L8BA 1Z5HA 1DVFC 2IPUG 2MOGA 3N3EA 4KXCA 1XCTB 3PWPB 5SWQA 5D70H 3IFNL 4W70A 5SWZE 1HKLL 4LASH 4Y7MA 4JFXA 3ROLA 3UL4A 3EJJX 3D85B 3L3HA 4A38A 4YX2L 2JV6A 3I75A 4K5NA 3IFLL 2E9BA 2QR0A 3V0EA 1IKNA 5JW3L 1A5FL 3ZKQD 4Y9EA 4YHOH 4UOJA 5TH2B 4ZX6A 2R23B 4JFFB 4GKZA 4S1RH 5FOBB 3TBTB 4L8SB 3GNMH 5IJBC 3RURA 1MFUA 2BHYA 4LU5H 1U95B 3OR7B 5DRNA 2QVFB 4RIRA 2BFGA 3EJPA 5JW5A 4HPYH 1XH3B 1HJBC 1P1ZA 2Y69B 3EDFA 4ADJA 4LVOC 5LWYL 3CXDH 4GQPH 4JQIH 4GIOA 3BAEH 1H3XA 1TJIL 2GCYA 1D9KC 1A7RH 3NIDB 4G72B 1VERA 1QQDB 2I7OA 4P4KA 4RGMC 3RUGF 1E8ZA 2OQJA 3LHAA 1BWWA 3QQ3B 4FNLH 3D0VB 4PJBF 4JGJA 4FG4A 1DCLA 4PFEA 1MW1A 4GINA 3FQUA 4XPFH 3P9MB 4D0DB 2WLIA 4P9ML 4CKQA 4BELD 2WANA 1DVFD 1OM3H 3ZUCA 5IB4B 4HMCA 4XI5C 1NCWL 3MJ7A 3RHWK 3UBGA 4FQ1H 4EN3C 2E7HA 3VW3H 1AH1A 3P3YA 2J44A 3C8HA 3PGFL 4U6YB 3VXSE 1NBYB 1K72A 1O6SB 3CFEB 2YEZA 1SDYA 2PN5A 4PCSA 2YOAA 2J57A 4OGXL 2H26B 4BFEA 2YC1B 4QD2E 5DRZB 4W4OA 4MFHA 2I60L 4Z77B 4HUNB 5EUOA 4YWGH 1DQIA 3BRFA 2YQGA 4R0LC 1EJ6A 3LS4L 4X83A 1IT9H 4EN2A 3EG9A 3LYRA 4PJHA 3L5XL 1NIFA 1CE6A 3C6EA 4ELMB 3RP1A 4LQ1A 5FM5O 1RURH 3DYMA 4M5ZL 2DYPA 1FAIL 2MOQA 1W6WA 5FGCE 4JBSA 1IU1A 4KUCF 1CGXA 4OTXL 3WG7B 2R56H 3HC3L 1MZZA 5D55A 3M45A 3KL5A 1JTPA 2DL2A 3WO4C 2A6JA 4YNYA 1QRNB 3Q48A 3T4YA 4WU5B 1J8KA 5A2AA 3RTQA 2CCVA 3FQYA 2X70B 2IDTA 5AOLA 2IH1B 2VN5A 4KZEH 2OCCB 5AWNH 2JJTA 3PV7A 4NUQA 1JZFA 3DRQB 4PJGF 1BBJA 4QMEA 5FPIA 3HZMB 4G8GE 1KIUA 4P3CL 4KNSA 3MGOA 4KVCH 4XI5D 4HUVA 2CLRA 5JW4R 4R83A 2UV3A 4CJ0A 3GBNL 2EEDA 1G7JA 4KXAA 4UT6H 5DZAA 1J48A 3PHOA 1TQUA 3GSWA 2CBOA 1DDHB 5CJQL 1A22B 1A4CA 2ZXCA 1SJEB 4E9RA 5F9AC 1C8PA 5E4IA 3LRMA 4I4WB 2Z35B 4AMWA 2ALAA 1SXBA 2EINB 3CQQA 4HK0B 3FQNA 5H4ZA 5HPMB 4YHLL 4KK8C 3II3A 3FNKA 5IHUL 2BVPA 4EI5C 3F64A 3BUPA 4GRLB 2GK0B 3P4LA 4W9HC 3CDFA 3EH2A 5L88H 3SZKC 3VXMA 4KJYB 2ITCB 3NPSB 3L4VA 3L3IA 1CC3A 3VMOA 5I17A 1IAIH 5MEPB 3TCTA 1KOAA 2NY2C 4CU6A 4M5YL 1I7ZB 2OR9L 5H4YA 3X2QB 4P59L 3NAAL 2CCWA 2ICWI 1J86A 4TUOA 3VRJB 1KCVH 2IBGA 3CUPB 4R26L 4LRIA 2XA8H 1PY4A 3N55A 4APQD 4WGKA 5KSAA 3U4AA 1I8AA 4Z3EA 4FL4C 3VNYA 4WJKB 4R8WL 4MMXA 2HX7A 4Z76B 1JUFA 4F8QA 3BZ4B 2Y2WA 5C6TL 2BHZA 5F3HA 4HF5L 4Q56A 3TWYA 5FS5A 5FYJH 2X4UB 4YE0A 4UQ2B 1BEXA 2WIIA 2F7IA 1CIDA 2FLRT 2XWRA 4G71B 3T4AB 2BO0A 2GTWA 3FB6B 3A21A 1M7DB 3P77A 4F7PA 3MACH 3O2DH 4RFNB 2EYTB 2F68X 5CUSH 3SPCA 1JZ5A 4LCYA 3AY4A 3QQXA 3AY2A 5BCAA 4QXTA 4KK8D 3RPBA 1JPGA 5E94A 3U2SB 3F5WB 1F18A 3QYNA 4B3VA 1NFDF 4S1QL 3B5TA 4XPGH 4EI5D 1LMKA 2R0WH 3HZYA 4FA6A 4N2BA 3QUYA 2PMZA 4Y1AB 4P5MA 1ZLDA 2X6MA 4J8QA 1BQSA 1YPZA 4PGBA 5AW6B 4HQQL 3B9DA 4U1GB 5FHAL 3L13A 3GKWH 1NMBH 1E4XI 3NJHA 1OAZH 1DQQA 4CU7A 1RZ7H 4YS4A 2KL6A 1OLLA 3LTVA 3ZSTA 1L0QA 4HKJB 1RERA 3QDGE 4TUJA 2Y5TA 5J11B 1SMAA 2R2CA 3S5LG 1VEMA 4CDHA 1TKWA 1P4IH 3F12A 3IETA 3UH8A 3ZE0F 4AYFA 4TVPD 2Q3XA 1ZAGA 4OFPA 1O7DC 4F2MB 4JRXA 1NIDA 5BQ7B 4LL4A 3L3KA 2XI9A 1HHKB 4WW1A 5D1XA 3L7FA 2DQMA 1GR7A 4AUUA 4O2CA 3AVEA 1MNUH 2WQ8A 4OZGF 4K8RL 4S0SD 1JNNH 4OJFL 4S1SH 3VWJA 3JZ7A 5CD5C 2E9GA 4NP4H 1XMEB 4FQIL 5BV7H 3QUXA 3CVBA 4YSAA 2H0FA 4I3RL 4YDLB 1F86A 1G7PB 2IEPA 2PKDA 2R39A 3GJFA 4PY7B 1HZHH 1FGNH 2OSXA 3RDJA 1Q0XL 4YBQC 1HHHB 1FV1B 4LHUG 1L5GB 3FO0L 3LEVH 4KJQD 4WNQA 3TH2T 1Z9SB 5BZWB 4FMFA 4RMVA 3SBPA 1VFOA 4QCIB 2XJKA 3HCVB 5LLIC 5EN3A 2YPKB 4BINA 2EZ0C 1I8IB 2IJ0C 2F53B 2O30A 3LKQA 4XPBH 1ZT1B 4MAZA 5ID1A 4UIMB 1SMOA 4XVSL 5KVEE 4KKQA 3ZTJG 2ROXA 3QS3A 1MW3A 4MWFB 5FB8B 5GGVY 1G4RA 3KE0A 4OFIA 3CZFB 2YHGA 1CO1A 1KGIA 3FS9A 3PJNA 2Z64C 4M62L 4PV8B 2LABA 4PJ7A 1D6VH 5CSBA 1J0JA 3AW5A 4QGYA 3WNKA 2C9VA 4E5XA 5HDQH 2O6DA 1X6LA 2BSBA 5CD5D 3BLKA 2HLAB 3LXUX 2X1WL 4MZ2A 1CL7L 1VFBA 2G5BB 4U33A 4ZZFA 3Q3GB 4YBQD 4BZ1A 3UG3A 3H6JA 4M43H 5TQ0L 1F3RB 1XIWC 2P24B 4OKVA 1Q94A 4YGVA 5GGTH 1HI6A 1PGRB 5DD1H 4YSEA 3TEUA 5E0QA 2WWNA 5TF1L 5INDA 1IC7L 1IBGH 2EZ0D 2CQVA 3PWPE 32C2B 2AC0A 5H37A 5AAWA 3TBYB 5I28A 4G6KH 2Z31B 4YZFF 4RRPA 2AMGA 2EIZA 12E8L 2QGBA 2Q86A 2JWYA 1VGEH 1JOIA 1GYVA 4CW1B 2GSMB 3HHSB 2DLEA 2R29L 4I0KA 4N8PA 1G9MC 4R7LA 4BQCA 1UOKA 5GGRA 4X4YA 2VABB 5CZVH 1JBJA 4WJG3 4JFFE 4JCWA 1KF9B 2PXYA 3EFDH 3L4XA 2D0GA 5FK9A 5I1DB 4TNFA 2E74C 4X5LA 4NOFA 4G43A 1WFOA 2EVHA 2W59A 4GNKB 1NPUA 5ID0B 5IM7A 2IVFC 2YN5A 2YAFA 5F0JB 2V2TB 3TV8A 1J9QA 1ZIAA 2BNQB 3KPLA 4X5RA 4GG8B 1RZ8A 4RQQA 1FZKB 5AYUL 3K74B 1GH7A 3RGVC 4ES9A 5IIEB 3K6SA 4D7BA 1T0OA 2KLTA 3HG1A 4WUUB 1R9FA 1EERB 3FCUB 3NIDE 5T1LB 2G60H 2F61A 1XIWD 4AGOA 3ARGB 3OJDB 3EYFB 3GZOA 1WA1X 5A2CA 5JIQA 4ISVB 2YA1A 1GKEA 4ZMZA 1XR8A 4M6OL 5GS1A 3HNVL 3P2DA 3Q6GL 3JWNH 4PGZA 4Z7WA 3MRMB 3LD8B 5AYQA 1F00I 2B7DT 4EKXA 3APDA 5CJBA 5T1KB 5CGYC 2AQ3A 4KI5E 5DHYB 4K9JA 5FXCH 1RJLB 2J8UB 2HAZA 3BP5A 4PYGA 5A2LH 4R96A 1BX2B 2CR0A 3VRIB 3BZFA 5B39G 4KKLD 5MEOA 4LGSB 4N0UB 1NCJA 4HIQA 4R7VA 2BJMH 5I23A 1TLMA 1ZT7A 4ODUB 4KAQH 4K94H 5JDJA 2Y22A 4G11A 5JPNC 3WKMH 3VWKC 2F18A 1KJ2A 4LCIL 2PTTA 3OL2A 4P2AA 3QORC 2H9GB 1DSYA 4ELME 1G1KA 3NCWA 1U8MB 4WLCA 3OAZK 3L9RB 2WQSA 3HI6L 3W82A 1E3FA 3MV11 4X6EA 4OV5A 4LNVA 4N6QA 1IE4A 3MV7B 3OAZH 1QASA 1YEGH 4G6AC 5D2LB 2J1WA 3WY1A 1YN7B 1A4JA 4EQ2A 1QRNE 2D9QB 5J13C 3OJVC 1VEPA 5D96B 3O6LH 4Z7UB 4ODSL 3GSNA 1MHCB 3DVGA 3HC2A 3ES6B 3DO7B 2PCXA 4OGAC 3GXUB 3BHBA 2WWKT 2CRYA 3ROOA 3W9DB 1QSFA 3QJSB 2CK2A 4J1UB 1DQJA 4RMBA 1OSZA 2K6WA 3NQIA 3OXRB 4OCSH 1TTAA 3CC1A 1LD9B 1VJSA 5JHLH 3KJ6H 1R5IA 3LNIA 1C9SA 4UDTB 3RKDC 4I0CC 1RK7A 3HA0A 5DZJA 3O9WC 4ZJ9A 2DW5A 5I1KL 5CF3A 3I50H 4OUOA 1P53A 2OMUA 3MOBL 5SWZD 5TGBA 4PJXF 2LE9A 4NCC2 5AKSA 5DZLA 4CUCA 5A2KH 4ORGA 4UU9A 1MXDA 4ONGL 4DK5A 3EIFA 4RSYA 3S8WA 3FT2A 3QWQB 5FO8B 1U6AH 4AQEA 5I1JL 1DBKL 1NEUA 2GIMA 4E9VA 4X7CC 3MCKA 4HPOL 3CC5A 4MA3B 3KXFB 3UBHA 1IFRA 2FX9L 5DLMH 4G6AD 1RUQL 4EPSA 2I9LA 5FM5M 4NCC1 2Y1AA 4PRBA 2F8VA 2OMTB 1CJYA 5IW6B 4WFFE 3I6GB 5JLZA 3NH7H 1UJ3A 4UTCA 3ISRA 3PAYA 4QJ5B 1EVUA 3JTSB 2VZTA 3TN0B 4ATTA 4NM4L 2W0PA 4CADB 4Z23A 5I15L 4OGAD 4QJ4B 3II1A 5JHAA 4GBXB 3MCLH 4HV8A 1MEXH 2B5IB 5D7SL 2ZXEB 3VVVA 4JCLA 4BK5A 2XKNB 1GC1C 3B7TA 3CMOL 5CIPA 1N59B 4YDIL 1MUJA 1SHMA 2BMKB 3EDDA 3WELA 4AH2A 5KSBA 2V3DA 5I6XB 2P42B 4GT0A 2BP0B 1E8YA 4G9DA 4NXKA 2FATH 3DA0A 5E00B 4P23B 1NDMA 1I85A 3QUZA 2CUMA 4UOW0 2J88L 4MDRA 5CZKA 2F7OA 1VA9A 1DANT 2D0FA 3Q01A 2HX9A 1IVLA 1QSEB 2DQCH 3OHXB 3TCLA 4KUZH 1Q0YH 3G6JB 4RFEB 1R3LA 2VH5H 1YAZA 3KPRB 4KMQA 3P3TA 1RLBA 1HSBB 1KMGA 1FNAA 5F1KC 3NEXA 3MXWL 2JE8A 2Y06H 3MREB 4HJJH 4HH9A 4YIQB 4L05A 2WO3B 1KY7A 3HLAA 4GY4A 3ZZSA 1VB9A 5DUML 2VDKB 2NY7H 1CD1A 3ELQA 5LBSA 3IDMA 4NRXA 4RISH 2F8OA 3L4UA 4Z7VB 2VL5B 1IEHA 3UGEA 3T2OA 2X12A 3E3QC 4OCXL 4TQPA 3DJ9A 3UBXA 2IGLA 3X14B 4PYHA 3P4MA 3RY5A 5DI8B 1LNUB 4F2ME 3OX8B 3H53A 5IBLC 1UT2A 2YD9A 5IQ9A 3BPLC 4OLEA 3HG0A 3RVUD 5AOZA 1E6JL 4QR7A 3TURA 2TSAA 3VG0H 3ZZ1A 1H3PL 1WWBX 4OZFH 3UAFA 1GKOA 1IE5A 1BM3L 3OPZH 4G8GD 2R51A 4FLOA 1CGSL 5FGSA 5JQ6L 2EH7H 4LIQL 3H3PH 1MCKA 3TVMB 1S78C 1F58L 1MKFA 4FXGB 1PBYA 1RVFL 3QI9A 4C56A 1TTBA 4R7DA 2PWGA 1FRGL 3QBTB 5LHDA 4GAGH 1UYWL 4PSPA 5DQJB 1E4XH 4GG6A 1XAUA 4JDZA 4QYOA 4WO4C 2X0UA 1FVEB 3OC5A 5E2TH 5F7KC 3KL0A 5DK0A 5ANHA 5AVYB 1XGQB 4BYHA 3UTSA 2FJSA 5JHDA 4NO2A 3V4PB 2OP4H 1OE3A 1UWFA 4NC1E 4J5VA 1QTPA 4ZZKA 4M6ML 1M2VA 2VJ8A 1KENL 4ANKA 2FQEA 3H7BB 4NO0A 2AJ3A 2AV1B 1LO3L 2AGJH 3H9YA 4GRWF 4R84A 4Y2DD 3BH8A 1EDYA 5DGQA 3SCMD 3L4ZA 2F53E 2P5WD 5ADPH 2O5ZH 1EAPA 4PJEF 4WWNA 3HE7A 4JZOB 1EUUA 1NFAA 4K0OA 5D70L 5DK3A 4MXVE 3QPKA 1AANA 1FNGB 1NBZA 1NFIA 1NUNB 2A5UA 1B0RA 2GY7B 3ULUC 1QUPA 2N4IA 2V2XA 5C0FB 4H8WC 4UAHA 4NFCA 2ESVB 3TP4A 4FFYA 4NKIL 1F6FB 4YDJB 3REWB 2W60B 1YCSA 3RWHB 1MVUA 1XF3A 3N06B 2V7HB 1SDDA 3QCUL 3KLHC 4RDQF 5LCVL 1QFWL 3G6DL 2ZONA 5C0CB 1E50A 3KLDA 1XH1A 2RBLA 1SLUA 2BNRB 4HPYL 1FZOB 4A55A 1FG2B 1URLA 3ZTDC 4J3OC 4PS8A 1NKGA 1UJTA 2CXKA 3M46A 4HAKA 3WU1A 2PCFB 2V5RA 1T7YA 3BAIA 3BXNA 4JQIL 4F37F 2XN9B 3DV6B 3FB8A 1YEFL 1A7RL 3ABKB 1DQDH 4KJPC 1JYVA 3GRWH 3M1BA 4Y4KB 3V4VB 3GSVA 1OD9A 2VR6A 2ZF8A 3APMA 3STLA 5BMFL 5E8NA 4X8JA 3O41A 1DUYB 3VB9A 5F7UA 1S5HA 2FX8L 5TE7L 2P4AB 5B7MA 2J5LB 3TONA 8FABA 1A6UH 1OGTA 5EBMB 5T33H 7CGTA 1I8MB 2VDRB 2OL3H 4LSPH 2P28B 4BSWB 1CBVH 4ZFFB 1FIEA 4WI2A 3VW3L 3MRPA 1HXKA 5KYYA 2BNUA 2A38A 4KKZA 3QUMH 2D2OA 2FUQA 1JHTB 3F3HA 3QDGD 5JORA 1WFMA 1A6WH 1PZBA 3BT2L 3TL5A 2O5YH 3VXRB 3ARBC 1KTLB 1I7TB 4G83A 2B2XL 2FEEI 4YWGL 2IGFL 3LEXB 2CWRA 5JOPE 1JXKA 4OIIH 1DBAH 5F1IB 3MKGA 2XVBA 1FE8H 3EW3B 3VFGL 2Y6SD 4ZMWA 1G9NH 2DJ4A 2EYRB 2BNQE 5B38G 3B56A 1A6TA 4MMZA 2G4EA 4PJIA 4WUUE 4A7VA 4O2EA 4YSRA 4G82A 5K39B 4OD1H 3CZJA 2FIKA 4S10A 4KJPD 2V9TA 4ALAH 4A2DA 4Z95H 4IDJH 3FRUA 4MXQC 2P43B 5FAAA 3S5YA 1UT9A 4XRCA 5F6IC 3KPSB 4R2GC 3ZTNH 3SDAB 4IBSA 4L4VD 3LRLA 1QZNA 3CCHB 2WZ5A 3QEGH 3KR3L 1JHKH 4IDLA 1U41A 4PB9H 4KVCL 4MX7B 3X17A 4IKJA 3P30L 4WSJA 2J8UE 1FGVL 4CKVX 3QNZB 1AHWB 4O02L 1OGAB 4UT6L 3TA3B 5IVXB 4L8DB 4N0UE 2IXQA 4EIZC 2WKOF 3M8OH 4NQCB 1A6PA 1S9XB 3RPKA 2NR6C 3I02B 1EGJH 3ARBD 3T8VA 1MPAH 2AKRA 3CVIH 5EBLA 5T5FH 2X7LB 1SOSA 4Z5RA 4OLXH 4B53A 3P11L 2ZQKA 2VDPB 2HWZL 4M1DH 4LPWA 3S4SA 1U0QA 3MV7E 4FNUA 3MCYA 5IBUG 5D2LE 1T22A 2VN7A 3HNTL 4KRNA 3WXWH 1I1RA 2YPLB 2YN3A 1IAIL 3Q5YA 5GSRA 3S37H 3RVTC 4L29A 1UM4H 4WHTA 1YN6B 3KYOA 5KWYC 3GYRA 4LSSH 4Z7UE 4U0RB 3CGTA 3ELAT 3A67H 5BZDB 4CL7A 4HKXB 5J0BA 3IVKA 4MXQD 3SDDA 1KCVL 4AX3A 3WFZA 1ZSDB 4F7CB 2Q7NA 4WW2F 5EC1A 3POCA 2WLHA 5DYOA 5A7BA 5HYSG 3EDJA 5IMOA 3BX7C 3INUH 2GAZA 4R2GD 3WTVA 1DVYA 1W0WA 1JGUL 1Q1PA 3TZVD 1JWSA 1OSPH 5KVMC 2YAQA 1T0PB 4JQVC 1F56A 1QEXA 5D6CA 4HDIB 5HDOA 3NJKA 4AE0A 2R1XA 3BVUA 5C08A 5C0JA 1JZ7A 5DCCA 3W37A 4X7TA 1LEKA 1HCVA 3GSQB 2W0FB 3KNBB 4AYBA 3DGDA 2FSEB 3D85D 2NR6D 3DX6A 4UANA 3RWGB 4UUJA 3ECBB 4OIBA 4XB8A 3ZHNA 2I5YL 3WMPA 2R15A 1QD0A 1JSYA 1HHGA 2EUVA 2DQ6A 3KDMA 2Y6TE 3BYYA 4Q2ZB 3KXFE 3OKDB 4U2ZA 4YXLH 4JFFD 5IHZA 5JW4N 1T4KB 5BW7C 3VD4A 4F7EB 4APXB 4YSPA 1P2CA 4JFYB 4YAQB 3FONB 2R0LH 4GYBA 1OAZL 1R46A 3VGGA 2IDQA 3H9HB 1S9VB 1TJXA 3S96B 4LBAA 3VQ1C 2WLLB 3C8DA 4R3SB 2Q3AA 5F7NC 2A9AA 3P0VH 2CBQA 4DUVA 4BGLA 1YYMH 2QDWA 3EYQC 1WIPA 3BWUC 1AGFB 3ZT7A 3HZKB 4ZMAT 4JFDB 3U4EB 2UZPA 1KB5L 3MUUA 1WEJH 3B2MA 1MIMH 2BM3A 3T71A 2A9BA 2NY4B 4ONOA 2NTFB 2KLSA 3KGSA 4F8NA 2NDFA 4ZUWA 2OYMA 3AZUA 1YMMB 1HH9A 2ZNWA 1ILUA 2CHDA 1EHLH 1A2YA 1QSEE 1V3KA 1JPEA 2EDYA 3VH8A 1MIEL 1QTYT 5FC9A 1ZGLM 3KPRE 1M7XA 1B4TA 1QUNB 3L95B 1AR1B 2WAHA 4GSDL 3QZNA 4XBGB 1FGNL 5B1JC 5I9QC 4TSCH 3T0DA 3NZ8A 1LEGA 3LEVL 1TR7A 1U91A 1MAMH 2ZP9A 2ZX7A 4IRSA 4QRUA 1QBLH 3KJ4C 4AQ8A 2FL5A 5CEZH 3LQAL 4E2OA 4M7KH 3RILA 2WO2B 1ETZA 2XU9A 5GZOD 1RZJH 3WIFB 4XPBL 3LNFA 4Z7VE 2BP8B 1B4JH 1BSIA 3VI4B 4NNXB 3JV6B 3EYQD 2N56A 4XCCH 1CFNB 1AHMA 4DJMA 3ZIMA 5C2UB 1M53A 2GHWB 4P9HH 5CWSA 4MJ2A 3S5LB 2HRHA 2GSGA 5EUKA 2CGRH 3C5JA 3CFJB 2ED6A 2OMWA 3O8XC 2YA2A 2DLTA 4EQ3A 1AQDA 1XR9A 3RZCA 2YRBA 3NSYA 3CDZA 2NT1A 5HDQL 5GS0C 4E9LA 2GABA 2V37A 3K1KC 2I85A 3FQXB 2P1YA 3T4AC 2BDNH 2XG5A 5C0RH 5D6DA 4JFSA 4Q6IA 5DVMA 3DGCR 4LLWB 43CAB 5IREA 5SV3A 3E7JA 2NW3A 1BQHA 1BBDL 2G30A 4M43L 1RZGA 2NNRA 1R3JA 2BIQA 5DMKA 2F08A 3RBSA 4XMPH 5CNHA 3QQ4A 5AVSB 5GGTL 1G6RA 5FHBH 3ZYZA 1IKNC 3MBXH 5DT1H 3GIZH 4D3CH 3TO2B 1DBML 4PVMA 5IB1B 1ZT4B 4NZFA 4U1GC 1MH5A 5FO7B 3MZTA 3N2JA 1VGEL 3MX0A 5AL8A 3RX7A 5HHNA 4WFFD 2AV7A 1JFHA 1IBDA 1T21B 4MJIB 1CGYA 3QNYA 5TE4L 4AMKH 3A3YB 5L6YL 3H3KA 5DUPH 2J6EH 5CLZA 3HUJF 1MFEH 3MV8B 4NSKB 1EEUA 1FO0A 1MCFA 1IQDB 2HH0H 3O8XD 4HIJA 3WKPA 5C0CE 2NY5H 3LEYH 1EJFA 2VDOL 2NY3C 1L9MA 3WLWC 1UG9A 4PEEA 2BNRE 5M7QA 4JFPA 1S8DB 5TFSH 1FNHA 1GXEA 4AIEA 4BZYA 2CPUA 3HI5L 3NSJA 1JVLA 2EVIA 1FJ1B 1I3GH 1QNIA 2E8YA 4FQHA 2XN9E 1RK0A 3QXDB 1H3TA 1GOHA 1NLDL 3DX9A 1L6ZA 5CD3A 4ZNEE 2O61A 4X6CF 4NN5C 2YQBA 2PW2A 4XNZB 1JDAA 4Y1AD 4ZTEA 2QPDB 3EFOB 2RFXB 4CVZA 4W4OC 5G2NA 3B6SA 2D3LA 3TBVB 4PW3A 2W9EL 1DLHB 5D1ZA 4NC1C 5TE6L 1Q0EA 2D73A 1KYUA 5D4QA 1ITBB 4L4TE 4FNQA 1TVHA 3IGKA 5FYKH 2WJ5A 1KYOJ 3G6AA 1V7ML 2PETA 5EG6C 5EU6A 4FYSA 1UD2A 2R29A 1RZKC 5GZNC 1RY7B 2BJML 3TLRA 2JKTM 5FUOL 4XC1H 3SPJA 4L48A 3WKML 3VXRE