2VDKH

Re-refinement of integrin alphaiibbeta3 headpiece
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
221
structure length
219
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 42
structure length 219
sequence length 221
ec nomenclature
pdb deposition date 2007-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdkH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vdkH02
3ARFA 2AEQL 2CRIA 3RIAF 1BWWA 5IFHL 4V1DA 1HWGB 2OP4H 4J4PA 2GJJA 1U8IA 4I2XA 2ATKA 4YWGH 3IXAA 3B2UC 5DZLA 4ETYA 4QHNA 4DZBB 3PGFH 5IVZB 5D6DA 1B0GB 1FJ1B 1R3KA 4OCMC 1RJCA 3QSKB 4OD1H 2R15A 1YMMA 4J6RL 3EO0A 3G9VA 4ZXBA 2EO9A 4U3CA 5BV7C 4H88H 1EX0A 2DQJH 5CP3A 4CMHC 4HIIB 1YY8B 2A6DA 3B4NA 3BWAB 1UB5B 4G6JL 3SKOA 4QRSA 4X80L 5E8NB 2VTFA 4QTIH 4HULB 5I66B 5KOMC 3MRRA 3QDGA 4XCFL 3VCLA 4TVPD 5AYQA 3ZYIA 4PGJA 4WV1B 5IBLC 3L3HA 1GOHA 3WFDL 1V7NH 1RAMA 3JV5A 5IT2H 5DJDA 4XNMA 5SWZE 2PW1A 3OF6A 4OJFL 5DC0A 1NGWA 3HC0B 3LRHA 2YRLA 1QBLH 4FABL 4RGNE 3GUTB 2VC2L 1T7XA 4GW4A 4APQA 4FG6D 1BFVL 5ITBL 2XN9E 4LASH 3MXVL 2EECA 4L8SB 1VACA 3QUZB 1UZ8A 3FTGB 4LHUA 4HEME 4OZFA 5EU5A 1BFSA 1DL7L 5DMIL 2Y72A 2HH0H 1UCBL 1JHKL 2EICA 3C5ZB 1IGCL 5BMFL 3AROA 3AAZA 4IRJA 4YDVA 5C0DA 1MVUB 4KAQL 4XPHL 1D5BB 4GFTB 4X5XA 4ZMAT 3H7LA 2H6PB 4XAWH 1JPGA 2GJ6B 4CKVX 3C60A 2UV3A 5AEAA 2JB5H 1MWAA 3IVKA 1XGRA 2MOVA 4PJ9D 1GCFA 4U7MA 5IEHA 2R0ZH 4OLVL 1C7SA 4QRQA 3RDTA 3SGEI 2COQA 1B6UA 1D6VL 2P1YA 4Y5XB 4H20L 1JV5A 3D85D 3SDAD 4LCCC 5FO8A 1YYLH 1RUQL 3TV3H 4KK9D 1MFDL 5C0JA 5CJOH 2V7NA 3W82A 1MFNA 4OGXH 3RUGE 3VJ6B 4OQTH 4X4ME 4XC1L 1OCWL 3HMXL 2HKFL 4RGND 3KPSA 3BH9A 5I1JH 4I0KA 1P4LB 2R69H 4KHXH 3W11D 3HB3D 2XN9D 4X7DC 3LRSA 5T3XL 1FVCA 3NIGF 5B8CC 1EO5A 1KIRB 3UTPE 1NL0L 5I75B 4I9WE 3BO8B 4HC1L 4W4NA 1HKLH 4PB9L 3GJFH 1FYTB 4GBXA 4X0KB 1QD0A 3OB8A 1C08A 1GGBL 1PZ5B 2FX9L 1IM3A 4LRNL 4MSWA 1S7TB 4BQBA 1AGFA 2ORBH 1K3IA 4ODUB 2Z4QA 3QG7H 2W60A 5I8CB 5AWNH 4PRHB 3PJSA 2Y23A 2CKBA 3S35L 4BUGA 4NNYA 4DUWA 4DN3L 7FABH 2JELL 4A6YL 2FIRT 1EK3A 4XVSL 5HVHB 1WF5A 2F53E 3SE4A 5DT1L 3ZZ1A 4LVEA 4U31A 3LDBC 2OJZL 3O81A 3RVXD 2XA8H 3PV6B 5T3ZL 5IOPA 1CE6B 3IU4H 1OF2A 3ARPA 3PWJB 5FDWA 2W9DL 2F8OA 3NCJH 4XI5C 3ECBA 2ESVB 3QCVL 4N0YH 3RZCD 5GRUL 3JWOL 3GMNA 4DVRH 2F8VA 1QO3B 4IJ3B 3TNMA 1YYML 3SCMD 2CD0A 2I24N 3WJLA 4I4WB 5F9JB 2X5PA 6CGTA 4GS7B 2B2XL 3BOVA 4NO0B 1WIOA 5L6YH 1W0WB 3MLRH 1N26A 3HZMA 4Y4FD 3EO9L 3UTPD 3EYUH 4KK8C 5ADPL 4I9WD 1T04A 3FKUS 1MI5D 2GUOA 5HPOA 1C5BL 1I3VA 4Q9CA 3HZYB 1A9BB 2X4RA 3SE8H 3VXNA 5I1CH 3IDNB 3W9EB 4UV7L 3VFNB 3O6KH 1LK2A 3U7WL 2IADB 3VWJD 4NN7C 3ZE1E 3QG6A 1S3KL 4YGAB 1KIQA 3D0VA 2Z92B 3T0EC 2X9YA 4XBPA 5EO1B 2BSTB 3EDJA 3VXUE 2VLKE 1FE8H 2OXGA 3MV7E 4PJGE 2IANA 1IM9D 2A83A 4ONGL 3VXRE 1CVSC 4PPTA 4PV9A 2F53D 5HDQL 2DQEH 4OM0H 5TDNB 2X89A 4DEPC 3DVIA 5E8DL 5BOZG 1F13A 3WN5B 2EDEA 2EZ0D 4ZFZB 4Z7NE 4KUCD 3TN0C 2AJUL 5DC4B 4JO3H 3RWCA 1M4KA 4D0CB 1PZUB 2Z91B 5D72H 3HZKB 1Z5LB 5DD6B 1EHAA 4AM0B 3CPLA 4YFDB 2ZOLB 2Q86A 5F7KC 1KELH 5FOBA 3R8QA 2QQKL 1U8OA 2GK0A 3EHBD 3MJ9H 3AU1A 5INCB 1GGIL 3ZYJA 1QRNB 1RZ7H 2PTTB 3IJYB 2QSTA 1T5WA 2EEBA 4JVUA 4JO4H 1ZTXH 3DX6A 3MMEB 2GJZA 3RRQA 5DZNA 2IALB 3SBWA 1UXWB 2EDXA 2FLBT 1UZ6F 3PXJA 1KXTB 3IYLW 3NA9L 3EAKA 4N1EA 4OZIB 1LEKB 5E70A 3H9ZA 5EO9B 4GAGH 1B3JA 2V9QA 2EC8A 3OR6A 3QXDB 4KMLB 4U33A 1ZAGA 1KPRA 3WSQL 4EI5A 4O2FB 2DYPD 3FONA 4XNXL 1T7VA 4H8WC 1EO8H 5LCVH 3L3KA 3GI9L 4U1HA 4P46D 5HI4C 3O11A 5EUOE 5HHOD 3S36L 2FJFA 1G7IA 2P8LB 1P7HL 3EDDA 3VXUD 1FN4A 3PDDA 5L9DL 2JIXD 2VLKD 1JF1A 5CILH 1MELA 5ERWA 5M94B 4MQTB 1XGTB 1R24B 4JFOA 3KPLB 4YZFE 5SX5K 4KJWD 5JDJA 5EA0L 3QXAB 3IFLH 1F8TL 2CK0H 2F9BT 5C0GA 4ENEC 5CJ5A 4P9ML 3OXSB 4NCC2 3BIKB 3CMOH 3WBDA 2NZIA 2ARJB 3KPOB 3MYJA 2PF6A 3S96A 4HDIA 1JVKA 3HG1A 2ADFH 5DVMA 3LEXB 1T03L 2EDOA 3SDCB 1VFMA 3OJVC 2ERJC 5B39G 5KW9H 4PGCA 3R4DA 3RWFA 3MOQA 4QRTA 4XVUD 3Q3GB 3MRJA 4GAFB 4IRSC 3FT4A 4KQ3L 3DTXA 4KRPB 3D18A 2YWYA 4LAQL 1NGQL 3RY6C 3WO4C 4F9LC 4Y5YC 1KTLB 2VLJA 5TF1L 1AD0A 4MNGA 3VRLF 1MCPL 4Q9QH 5AZ2H 1OAYH 3F7RA 3U6RA 4KZDH 4UAOB 3R06B 4WO4C 3MV9E 5D2LB 1Z9OA 4F58H 1T1XA 2VL4A 3ZE0F 1QUNA 4HFWA 4UU9B 2RFXA 3JVGC 4M7JH 1KF9B 4JZOB 4Z78A 1EHLH 1C12A 2PYEA 1IQWL 2P4AB 1QLRB 4LLWB 1EDQA 4HS8L 2AXFB 3O2VL 3JTTB 4O51B 5ICXB 4DKDC 1UENA 2X9XA 5IMLB 3PQYB 3O9WC 4GG8A 4K8RD 3VFGL 3G5YB 5E56A 5CLTA 3KPQB 1R6VA 4CAGA 5DMYA 5HHNA 4R4BB 4P5TD 2EKSA 2IF7A 5F1NB 2QSCL 2P24A 2R2CA 4JFDB 2WK2A 2ZUYA 3BSZL 3O6LL 4HPYL 4QTHA 3OPZH 3QIWA 1KJ3L 3V5DB 4XX1E 4PP2B 3QEQB 4NQDA 4WY7H 1F2XK 5C9JB 5KAQG 1OSPL 4Y2DB 3SE3C 3V0VB 3QFJD 4NQTA 1C5CL 3M45A 3H2WA 4BSJA 4CNIB 1AD9B 1JWSA 3VFVA 3HE6D 1X6LA 3RHWF 3O8XA 4JO1L 1LO0H 2YD5A 4TYUA 2CKNA 2PNDA 3QNZA 3MRGA 1NUDA 1T5XB 2DQHL 2J8UB 4O4YH 2EIZB 4CVZB 2YR3A 4ZAKB 4KK6C 3BAEL 3P0VH 4LKXB 3TBSA 5HI3C 3KPRA 1NKRA 3B9KD 3FFCA 4WEMB 3RL2A 4XNYH 1EERB 5CP7B 1L0XA 3MV9D 1S7UB 4NZRL 3QPQC 1LO2L 1LVEA 1BZ9B 2E5EA 3P4OB 3LN9A 4F33B 1L7IH 3ZDZF 2JJTC 4K9EL 1MHPH 3UEZA 2XKSA 4H0IA 1RZFH 1HXMA 5H2BA 1A6TB 4X7CC 3GBML 4PLOB 1TPXB 1G7LB 5C0AE 1D5XA 5KVEH 3ZYOA 5CEZH 4DKFL 5H94A 2QV2A 4Q9RH 4L3ED 4M9OA 5IR1B 5KZCD 4WI6A 3QCUH 4AG4H 2P5EA 4JFXA 5I18H 3SKNA 5GHWH 3U7YL 1E27A 1EUUA 2DWDA 4X4ZA 3OX8A 4JANA 3UBXA 3QJFA 4RCAA 1HK6A 2MQ3A 1CFBA 3NZ8B 4KKBC 2BERA 1UVQA 4CN6A 5GPRA 5JO5B 3EYOA 3GSVB 4P2OC 5KVFH 5FA3A 1VFOA 2LVCA 3LN4B 2PO6B 4XVJL 4AQOA 4ZQKA 5TGBA 1SEQL 4JG1L 1Q9LA 1WT5C 3HR6A 1S9WB 1QLFA 3ZSSA 1NBZB 1VA9A 1FO0B 4MJIB 3OG6B 4KDTC 1IGYA 1RIUH 1EAJA 4YGVB 1KEMH 3K2UH 1NUFA 1JL8A 3OAUL 2VZTA 4HG4J 4LDEB 4WJ5B 1WITA 4U1IA 2R0KL 4PJFF 1AKJA 3QZWA 3IJSB 5DD1H 4ZNCD 1OQXA 4MWFB 4XZUB 3B2UD 3RY5A 2IH3A 3QUMB 1MJUL 5H35B 2H1PL 2Y6SC 1CT8A 2AJ3A 4JRXE 2W0FA 2RJMA 2W92A 5DJYB 5C0AD 4BZ2L 2O5ZL 2BFVL 1HN1A 5EPMB 1E4WL 3PL6B 4AEHL 4ZYKA 2AJSH 2XQYK 4R4FH 4GW5A 4RDQG 1R5VA 2WWKT 4UV4L 3GSNA 2YBRB 2A73B 2DTSA 1ORQA 2EDTA 1CD1A 1KTDB 3BUYB 2OZ4A 4Z7WE 3DUSA 3QO1A 2UVFA 1OT1A 3RPIA 1TJHH 5GGUA 4W68A 2JJUA 4ZUWA 1U41A 1A3LH 2W07A 3SO3B 1OPGL 5FYLL 4X5WA 4XP4L 1P7QD 3C5SB 1MRCL 1MWAL 1MFCL 2VQTA 3MFFA 4UT9L 3K1KC 3JWDH 4EUPG 4DTGL 1A6ZB 4MMZC 1I85A 2ATPB 5DD3H 5F88B 3FQUB 3S3PA 2I07A 3DUUA 3PUCA 3D48R 4LCIL 5IIEA 1MJJB 4UT7L 2VDOH 2NW2A 2AVGA 3RL1A 5DURB 5F7LB 1BREA 2I5YL 1U58B 4HH9B 4RZCB 5I30L 3LOWA 3BKJL 4HBCL 4NHCL 4YQXH 4JZJB 5GGVY 3ARBA 3T65A 4KKNA 1QSVA 2A77L 1FGVL 4D8PB 1M05B 4GRWE 4XWGL 5J1AA 2M26A 5FGBC 4RX4D 1TVBB 3AREA 5DUBA 4U1MB 1JNJA 5JOFB 5EULV 3FL7A 4UDTB 1J05B 4QOKA 4I18C 4EUPB 3BQUB 1FFRA 4C59B 4OCRL 1S9YA 2IAMC 4WUUE 3BXNA 1I9EA 1IC5L 1XGYH 2XFXB 3PGDB 5K9OA 2R1XB 4UQ3A 5MENA 5DTFB 3MBXL 3HE7B 4JFFE 3PABB 1JZ4A 5EC2B 3I2CL 3RVUC 2DLHA 5FUZH 4L4TA 4JFYB 3NGBB 1M1SA 1AXTL 4MA1C 5KVMC 5DA0B 2AK1L 4WDIA 2DQFB 2BNUB 3UAJC 3S37H 4X6CF 3VDCA 3VXSE 4LLVB 1KCVL 1MHEA 4WHCA 3VXMA 2NQCA 3QNYA 1JYVA 4HF5H 2NTFB 3QI9A 3OHXA 4L9LC 4NRXB 3U0WH 3PXHA 4BSWB 1WZMA 3CIQA 2G60H 1X4YA 3I3DA 4YC2C 4ZOEA 4PRDB 3RNQB 4ZFOB 4ONFH 1F42A 1NDGB 3VA2C 3WKNA 3U4BL 4Z7VB 1JHLH 2J4WH 1N5AA 3VFOA 1FGNL 1S7RA 3B6SA 3K8LA 2LE9A 4ZUUB 4TOYH 5JW4Q 3O3EA 3MJ7A 3LN5B 3T0EE 4D2NA 3ARFB 4NQSA 3VFRA 4JPWH 4V1DB 4ORZC 1MCWM 1U8IB 4I2XB 2ATKB 5TE4H 1MREH 3IXAB 1DBBH 1EA9C 4PS4H 5LGHL 4P5KA 4QHNB 1B90A 3BP5A 1A4JA 3DGCR 4GAYA 4XB8A 1R3KB 4Q6YA 3G6JA 3FQXA 5A2FA 4JHWL 3VGDA 3BP4A 4Z9KB 3EO0B 3QQ9C 4XTRC 4ZXBB 4YJZL 4ETQA 5JXAL 5DJAA 4MMXC 4OZFG 2DQUL 4ZS6C 2EXWC 2A6DB 5D6CA 3SKOB 4QRSB 3CVHL 4ODSL 3MO1A 5KS9E 3HI5L 1H3WM 3V4VL 2ZSVA 3MRRB 3QDGB 5EU6E 4XI5D 4Z95H 3VCLB 3VFPA 4PJBE 5CWSA 5FYKH 1I3RA 5HHXL 3L3HB 1QSEE 3VXSD 1JGVH 1EZVX 1A7OL 3QUKA 3R1GH 5DJDB 4XNMB 3K80A 4YWGL 2CR3A 2PW1B 3W0WD 1NGWB 2D7PA 5GGRA 3PGFL 4GW4B 4FOMA 4APQB 4KK8D 3CK0H 3WKMH 3TM6A 4OD1L 4MYWB 4KKCC 3VGBA 3FAWA 4QRUA 4H88L 1VACB 2DQJL 1UZ8B 4LHUB 4OZFB 5EU5B 1KC5L 1MHHA 4JGUA 4ORGA 5JXEC 4K7PX 5EOTA 4HGKC 4QTIL 5IHBA 2EO1A 4JZNA 3T0ED 1WWBX 3AXLA 2OL3A 3AAZB 3QWQB 4IRJB 4YDVB 5C0DB 4NM8L 3EJZC 3B9DA 4FQJL 4X5XB 3P4LA 1AGBA 1V7NL 2R56H 3I3BA 5E2TH 5IT2L 4KVCL 3C60B 5GRJH 3MRQA 1MWAB 3IVKB 1XGRB 1FPTL 2KUTA 3ZHKA 5JORA 1FNLA 4HS6A 1QSFE 1QBLL 5IEHB 1BVZA 1X44A 4QRQB 4MQXC 3TN0D 2GI7A 3I84A 3RDTB 2YPKA 2O5YH 5TF0A 5DYOB 4OF3A 3DO3A 1WIUA 3IB4A 1JV5B 5DJ2A 4PJ9A 2D2OA 5EU6D 5FO8B 2HH0L 1DQDH 3RVVC 2P47B 5F7UA 3GJFK 4Z8FL 5C0JB 1QSED 1I1AC 2V7NB 3QAZB 1HZHH 2CIKA 1WAAA 3D85A 4F7EA 2X1QA 3SDAA 2JB5L 3KPSB 3BW9A 3BH9B 1YY9C 3QIUD 3QHZH 5GZOC 4JQIH 5DI8A 2R0ZL 3LRSB 4K07A 1NUNB 4F80A 1FVCB 4JDTH 1INEH 1X5FA 5C0CE 3VFMA 1UKQA 4CN4A 1W8OA 3ROLA 4XPFL 1UADC 5TFSL 3T2OA 4GBXB 5GJSH 5HI4D 1C08B 1QYGH 2VDRH 5HGAA 2YN3A 5B3JE 2WZPD 5DRZA 3TV3L 2XN9A 1BHGA 1BZ7A 1IM3B 3OQ3B 5ID0A 4AJ0A 5JOPE 2FATH 4MSWB 1SYSA 2Q76A 5CJOL 3AS2A 1AGFB 4AIZA 2Z4QB 4D9LH 3LAFA 5A40E 1DQMH 4OGXL 4KI5F 1Y6NR 3PJSB 2CKBB 4NNYB 1BX2A 4OQTL 1QSFD 4Y88A 4ENED 3GHEL 3PNWA 2MQ0A 2NY1B 2R69L 4KHXL 1Z3GH 1FNFA 4HXBH 4LSSH 1RJYA 4GKSA 5HTSA 1MAMH 4Z7UF 1X4ZA 3LHPL 1NGZA 1A02N 4MAUH 1KJVA 3F12A 2DLFH 1VGKA 5IOPB 1Q9OA 4N8CL 4K3HA 1OF2B 5FDWB 3X13A 2BRRH 3W2DL 4YX2H 5C0EA 5GGVH 3ECBB 5IVXE 2R2HA 4IRSD 5CEYA 2ORBL 3GMNB 3QG7L 1D7FA 4QHKJ 3TNMB 5AWNL 5M95B 1W0VA 1U8NA 1RUKH 2B5IB 4ISVA 4WO4D 1XGQA 5E2WL 5FCSH 5C0CD 5KVDH 1CYGA 2VAJA 3HZMB 3RUGA 3K0WA 3F62A 1A64A 25C8H 2Y9RT 3RZCA 1T04B 1NLBH 4UNVA 3SGDI 2GUOB 3SCMA 5FGCE 2X4RB 3VXNB 2ZCKH 5ILTH 2XA8L 3QA3A 1CFVH 5EIIA 1LK2B 2DLIA 2GYSA 3O9WD 5IUSA 5JOPD 5F1OB 1CGWA 3QG6B 4Y4FA 1KIQB 3D0VB 3IFPA 3NCJL 1TNNA 1FCCA 4M1GH 4XBPB 1O5DT 1JI2A 3OJDA 4N0YL 1UXSA 1MI5A 3E0GA 3SDXF 3V2AR 5HBBA 4DVRL 2JF1A 3O2DH 4YH6A 2IANB 2PW2A 3WIFA 1X5ZA 3S5LG 5CLWA 4PV9B 1YEGH 3VWJA 2ZUWA 4U1GB 1OAUL 3MLRL 4AEEA 1WUNT 4NKIH 2R2BA 3EYUL 5MERA 1PJ9A 3IDJA 3RWCB 4RFOH 1YEHH 2XIDA 4P99A 1IM9A 3CPLB 5EZIH 3ZL4L 3SE8L 1KLUA 2Q86B 5FOBB 3UC0H 2F53A 1U8OB 1FLRH 2GK0B 3MLYH 3D3VE 3AU1B 3DECA 2IMMA 5GRVK 5I74C 4GG6F 4LCUA 4KK6D 3DARA 5HI3D 3KLHC 1T5WB 4TSAH 1FE8L 3DX6B 5GGTA 2GJZB 1HHHB 2HT2C 1UM5H 2R0WH 4CDHA 1N64H 4L1DA 3QPQD 1IMHC 2DQEL 4OM0L 5D7IF 4Y19E 1UJ3C 3OR6B 2BNRE 4JO3L 1FRGH 2YA1A 4NKOA 2AERT 4EI5B 4EVNA 1OVZA 4Z7OF 3FONB 1A3RH 1KELL 5HYJE 1U8MA 3ESUF 2ZUQC 3L3KB 4LL9A 5JUEL 4U1HB 1KB9K 2BCKA 3O11B 2FJFB 1G7IB 2AJYH 5C3TA 4P59H 1SM3H 1FN4B 6FABH 3P11L 1JF1B 3PIQA 4FZ8H 1RZ7L 5ERWB 4JB9L 3QHTC 4KUZL 4JFOB 5DQ9A 4JO4L 1CN4A 1ZTXL 2DYPA 3T0XA 4GXVL 2MCPH 1GZQA 4MLSA 3FB8A 3BI9X 2LQRA 4S1SL 4P46A 5HHOA 5C0GB 4KKBD 2ZG2A 4OCSH 4LP5A 5L8JB 3VXUA 2JIXA 2VLKA 5LGKA 1ZHNA 1QFHA 4KTEH 3ILQC 4GAGL 4P2OD 3MYJB 3V52H 3S96B 5D5MF 4HDIB 4WRLA 1KULA 3D87B 3HG1B 4ZPVA 4AEIH 4BFGA 2YXMA 3AB0B 5GRVL 3D3VD 3T2QA 1EO8L 2CJUL 2RIKA 1EXUA 4RGMC 1XCQA 4PGCB 5HHPA 3RWFB 4QRTB 1JK8A 4HMCA 3HPLA 3D6GA 1QR1A 4OCXH 4WFEE 3DTXB 4PJAF 1WBZA 3D18B 5GS0C 1IQDA 2NXYB 2ED9A 2VLJB 4NM4H 1AD0B 5FGSA 5JHDE 4Y19D 4MNGB 2CK0L 3IJHA 3U6RB 2Y6SD 1T1XB 3CMOL 2DJSA 3TT1H 1K6QH 4JHZA 4HFWB 2E6JA 2RFXB 5HYJD 4JQXA 4Z78B 1C12B 2XOTA 2PYEB 2W59A 4P3WA 3TNNA 5KW9L 2PUQT 3MRLA 1J0KA 1FSKC 3LD8C 5EFIA 3ROOA 1NMBH 4KPHH 4UT6H 4OSUH 4GKOA 5HHNB 2EKSB 3T1FA 2GQHA 3OXRA 2P24B 5FO9A 1MCOL 4QTHB 1XH3A 4Q9QL 5AZ2L 3QIWB 4YBLC 2E3VA 4KY1L 4IDJL 4KXZI 4KZDL 1J0HA 4NQDB 1H9VA 5A2LH 1HIMH 4F58L 1A6WH 1NGXA 2GKIA 3WFZA 4OGZA 5C6TL 4BJLA 4P5TA 4NYLA 4M7JL 1JWSB 3VFVB 1EHLL 3WEXA 2APBA 3O8XB 3NIGE 5CUSL 4FHBD 2NX5D 2XG4A 5BZDA 3QNZB 3MRGB 4LGRB 1XF1A 1F6FB 3OR7A 4FQHA 4F15B 4M61A 3JWOC 3RVTC 1GJIA 3QFJA 1SJHA 3TBSB 3C5JA 3KPRB 4HWBA 3HE6A 5JHDD 3FFCB 4YK4C 3OZ9L 3VI3E 1IGTA 5D4QA 3RL2B 5I0ZA 5TQ2H 4BZ1H 5F21B 3OPZL 4KU1A 1LGVA 4DCQA 4DKEH 4WY7L 4HXAL 1TQBB 4MXWH 3VG9B 3B9KA 2CIIA 5HYEA 2B0SH 5H2BB 2IAMD 5I1LB 1D5XB 1R3IH 1LE5A 3MV9A 4G6KH 1LO0L 2AAVA 4ODWA 5H94B 3RVUD 2ADGA 3ORJA 4O4YL 5C6WH 4EJ1C 4KJQC 1ZT1A 2P5EB 4JFXB 2C7UA 3SKNB 3UAJD 1KN2H 3MRMA 1E27B 1FL3A 2DWDB 1G6RH 3RWGA 3TO2A 1JYWA 3OX8B 3MACH 4XNYL 4JANB 3UBXB 5D96B 4C57C 3QJFB 4JREB 5DS8A 1NPUA 1LDPL 4L3EA 1UVQB 5IB3A 3BRGC 1L7IL 1BMGA 3OV6A 2YUZA 3EYOB 2X6MA 4D9QE 1RZFL 1G7QA 4UIKL 4CJ0A 3TFKD 4B7LA 1Q94A 5C9KA 5FA3B 3BPCA 5KVEL 4OTXL 3TH4T 5I17A 4ZQKB 5TGBB 4FP8H 4U4BA 2B1HH 5LKNA 1Q9LB 3DX9A 4OKDA 4I0PC 1U92A 1QLFB 1YN6A 2R4RL 2VDMH 4PRNA 2HJFA 5ANMA 5AZEL 4Q9RL 4JFED 4B41A 1IGYB 5J7CC 4R26H 4AG4L 5I18L 5L0QB 3MCKA 5GHWL 4NSKA 4U1IB 1AKJB 4WEUD 3QZWB 3Q5YA 2E9IA 1RUMH 4TVSa 2VUYA 2APXA 2IH3B 4TVPL 2Q3AA 3CFIC 1CT8B 2AJ3B 2W0FB 3C2SA 4G7YL 3QQ9D 2R29L 4XTRD 4K7PY 4ZYKB 1LK3H 2CXKA 4ZS6D 2EXWD 1R5VB 4K71B 3GSNB 5E4EC 2W9EL 4OLYH 1T21A 1ORQB 1CD1B 3DUSB 3QO1B 5C0AA 3OKMA 4DFIA 4G8FA 3RPIB 3K2UL 1J5OH 5GGUB 5EZJA 4ZUWB 5C07E 1DBAH 4YDKH 3VD7A 4KJYA 5CJBA 3MFFB 4NHUA 2VL5A 1L6XA 4WIQA 4D9QD 2DM7A 4WTZG 1UZ6E 1LO5A 4XCCL 4XCEA 2HJLA 3TA3C 2I07B 1I9IL 3DUUB 5IIEB 2AJSL 3TIEA 4R4FL 1P7QA 4M7ZB 2NW2B 3RL1B 3EKCA 5JXED 2VLRD 2MJWA 1TTGA 3ARBB 1UA6H 3T65B 2IH1A 4M7KH 3ZKSD 3D2UD 1Q0YH 1TJHL 3EJZD 1CD9B 1NEZG 5E00A 1A3LL 5J06A 3OKEA 4WFGD 3WO3B 3AREB 4YBHA 5DUBB 1RIVH 4FFYH 1BQLH 5CCKL 5EOCL 2G5RA 1UKTA 4QOKB 1MHCA 4MQXD 3CFEB 4NFBA 5DD3L 3F8UB 2HT4C 4RX4A 1S9YB 5K9OB 3BXNB 1I3GH 1N8ZA 4PJ8C 3D5OF 3K8MA 4QHMA 4UQ3B 5MENB 2VDOL 2R0LH 1D6EA 4N9GA 4M5ZL 3RVVD 1IAMA 1BIHA 4YQXL 4L4TB 4DOHB 5C07D 1I1AD 3DSFH 4N5UA 1HYSC 1M71A 4WDIB 2IPUK 2ICWJ 4PY7A 3KR3H 2GCYA 2BSSA 3O41A 2AV7A 4MA8H 1MHEB 2EXYC 3VXMB 3FB5A 4WHDA 5GZOD 3EW3B 2Y1VA 3QNYB 5EN2A 1UGNA 1EIBA 2Z8RA 2QTEA 3VRLE 3QI9B 3OHXB 1XF2A 1J18A 4P48A 3DRQA 3ULUH 3D39E 5C2BH 2DD8H 3QWRD 5I15H 3ZE0E 3BMWA 1B88A 2AJVL 3U9PH 3NGBC 4QNPF 3GEWB 1CFQA 3P9MA 5FUZL 1N5AB 3VFOB 1S7RB 3B6SB 5B8CA 4DGYH 1TETH 3O3EB 1EEYA 3MJ7B 4GOSA 3BPNC 3H9HA 4NQSB 3QCTH 3VFRB 1LMKA 4LLAA 1N6VA 4XAKE 1UEMA 2R1YA 4KI5C 4K9EC 4P5KB 4IIQB 5D1ZC 3IAGC 1A4JB 4HF5L 4GAYB 3HN3A 2IMNA 3G6JB 3FQXB 1CDBA 3U0WL 4ZSOE 3BP4B 2RR3A 2X05A 1VEPA 1OAZH 4ETQB 2UVEA 5DJAB 2G60L 3CU1A 2M1KA 3NAAH 3GKWH 2Y07L 2GHWB 2YUVA 5E94A 1JGLH 5D6CB 3MR9A 4ONFL 3MO1B 1EEZA 2DM2A 1KLGA 2ZSVB 1JHLL 3VFPB 5L2KE 5LQBL 5CWSB 4TOYL 1I3RB 1PY9A 5DWUH 2OMNA 5JLZA 4JPWL 3MUHL 3O4OC 3QUKB 2CUHA 2CLZA 2SEBA 2V5TA 2VOTA 5TE4L 3C2AH 3L3DA 5F1IA 3ULVH 1C8PA 1FC2D 5GGRB 3NTCH 4HCRH 4G7VH 1YEFL 2EE9A 1CE1H 3D39D 3V5KB 4TQEH 3CLEH 3VXSA 3ZKXC 2ZJSH 3ZDZE 4LEOA 4QRUB 4NGHH 4RISL 3SQOL 3UBXI 3W0WA 1MHHB 1WLHA 4ORGB 4LVNB 4JZNB 3O6MH 2VLME 4Z95L 3AXLB 2OL3B 3BFOA 2YA0A 2ZCLH 3VXOA 4AL8H 1MCHA 4XAKD 5CIPA 1C7TA 1AGBB 4HLZG 2R2EA 5IBUB 3HR5A 2BVOA 1R0AH 3CD4A 3R1GL 3MRQB 2BOBA 1L9MA 4Y89A 4HS6B 3T0EA 3KJ4B 3F7PC 3VGAB 3CK0L 3WKML 2YPKB 1LO3L 2VISA 1RVFH 4Q2ZA 1DLFL 4XRCA 2FD6H 1PKQE 1FZJA 3UJTH 5DJ2B 4PJ9B 1FH5L 4R90H 2VWEC 1FG2A 5L2KD 4MNHA 3SOBH 3TN0A 1BD2E 5JA8B 3KLHD 3RAJH 4K3JL 2P5WE 2CIKB 5GGSY 2ZG1A 2R56L 5CAYB 3O45A 1CR9H 3D85B 5E2TL 3QDAA 4F7EB 1N0XL 1CLCA 5EU6A 3SDAB 2D7TL 4JKPH 5GRJL 4Z5RA 1T7WA 3BW9B 1CDYA 4M6AA 5GXBB 3QULA 1RD6A 1QSEA 5DI8B 1QOKA 3B9AA 3EJJX 3M8OL 3VFMB 5F8QC 5IW1A 2O5YL 4K7PH 3ROLB 4R97C 2VMFA 3IT8D 3LH2H 3Q6FA 4RGNB 4EXPX 3QIUA 5HGAB 3NH7H 5FM8A 1DP0A 4P9HH 5DRZB 1DQDL 4MJ4A 2XN9B 1BZ7B 2LFGA 1JMXA 5ID0B 1SYSB 2Q76B 2FBOJ 4OZ4B 4AIZB 4HQQH 3ZE2F 5C09D 1CXEA 1BX2B 3LKNA 2QADC 4HUNB 4LARL 4EDXA 3PNWB 2VITA 3QHZL 1FNEA 5I2IA 5DQDH 1FL5A 1N2RA 2W91A 4GKSB 3ILQD 3WLWC 3MXWH 3GMLA 4IDLA 1GL4B 4JDTL 1INEL 2EEDA 5F1SA 2D4FA 5IFAL 1YNTA 5GS3A 1BFTA 1NGZB 2DKUA 1KJVB 3F12B 5T3ZE 1QSFA 1WTLA 5B38A 4PJXF 3OGOE 3OKOB 1VGKB 1Q9OB 5GJSL 3VWKC 1MCQA 12E8H 1QYGL 4C4KT 4PJDA 3FB6A 2X10A 3AUVA 3X13B 5C0EB 4J3OC 2P5WD 2FATL 1A6UH 2R2HB 4N0RA 3OGCA 5CEYB 3RTQC 4D9LL 2DTMH 2IPTH 1DQML 5GS0D 1CDIA 1RHHA 1HSBA 1W0VB 1U8NB 4HUMB 5C0IA 3OWEA 4H25A 4IEFB 3C08H 4ISVB 4PD4J 1XGQB 3BUTA 1Z3GL 1BVLA 3RUGB 4HXBL 4LSSL 4M1DH 4IRSA 1Z9SA 4EXKA 3KDMA 4K3GA 3RZCB 1MAML 3RY6A 1I7ZB 4F9LA 5TJWK 4Y5YA 3SCMB 5BVJA 3KLAA 4MAUL 1W0YT 4DGVL 3QA3B 2DLFL 3O6FC 4V2BA 1JNNL 2DI7A 3ARSA 5EIIB 3ZT6A 4WO4A 5E8OA 5C0CA 1X5GA 2R9HD 4CJ1A 2BRRL 3TPUA 4Y4FB 3QXWA 2MHAA 5CFHA 3IFPB 4YX2L 4UOW0 3BDXA 3I75A 3I6GA 1NAMA 1IFHH 3JVGA 3KWWA 3OJDB 4ONHA 3WJLC 1UXSB 1MI5B 5KTEH 5TQ0L 1OAXH 4NQEE 4G3YH 1TMCB 2PW2B 1BJ8A 2DBJA 3WIFB 4NT6A 2DQCH 2R39A 3O9WA 3VWJB 2VDKL 4X6CE 2XZQH 3SKJH 1RUKL 4LPYA 5KVDL 3CMGA 4YHIA 2R2BB 3RA7H 5MERB 3IDJB 1WWAX 1ITBB 4UDUA 1IC4H 5T3ZD 1NLBL 2VR5A 4KVNH 4DK3A 1IM9B 5SV4A 2XG5A 1KLUB 4PBXA 5ILTL 2FHFA 4LPVA 2F53B 1A14H 1CU4L 2AGJH 3L5JA 1G7MA 4NUGH 4PRBA 4X6FA 4JM4H 4PYGA 5IGXH 1IT9H 3RVTD 2AEPL 3SE3A 4M1GL 4LCUB 4O02H 3TH3T 5JIHA 2DM3A 1OARH 1L7TH 3C09B 5DJCA 3GIVA 2YMXH 3O2DL 4U1GC 3V4UH 3UTQA 2FDBP 3QEGL 4GO6B 5IVXA 1YEGL 3MRFA 3WUZA 2VH5H 4NKIL 4MA3A 5E2JA 2BDNH 2F5BL 3N85H 4NKOB 4YFEA 1YEHL 4EVNB 4HUUA 5EZIL 4JAMA 3U79A 1U8MB 1P4IL 2X4SA 3UC0L 1NJ9A 1T1ZA 1FV1A 1H5BC 2BCKB 1FLRL 2JJTA 4KJQD 4YHYB 3PIQB 4EOWH 4J3XA 1QFOA 5EOQH 4HT1H 3J8F7 5DQ9B 4TSAL 4U0RC 4U6VH 2DYPB 4P2RD 1CLZL 2H2SC 4LVHB 1GZQB 1UM5L 2R0WL 3MNZA 3FB8B 3NFNA 1R3JA 4P46B 5HHOB 1IKFH 2R4SH 1GPOH 3B3IA 4HIEA 2W0PA 5E9DE 3VXUB 2JIXB 2VLKB 1ZHNB 2EH8H 2HMIC 4BUHA 1P5VA 1KXQE 4GXUN 4ZPVB 1NFDF 2H32A 3K74B 2ED8A 4N8VA 1J1PH 1TCMA 4X7SH 1A3RL 1L0YA 4I0PD 1EXUB 1XCQB 1RPQA 2AXJA 1JK8B 2AJYL 3MPCA 3HPLB 1SM3L 4P59L 2MMXA 3F6LA 1NCCH 6FABL 3PWUA 4P2OA 4OF7A 1A2YA 1QR1B 4FZ8L 5BV7L 1IAIH 3FQWA 3LQMA 1WBZB 1FCGA 1IQDB 3D3VA 1WT5A 3CFCH 4JPKH 4RBPH 1OTUC 5FM5O 2EDFA 2KZ1B 1RZJH 5KOVC 2ICES 3IJHB 3WJJC 1OLLA 4OCSL 2DDQH 4KDTA 5DHVH 3AB0C 4KTEL 2DRUA 1AQDA 2D03L 2E6QA 4MD4A 5DSCA 1KJMA 1QFUH 5FYJE 3HUJA 3AC0A 4Y19A 1MQKH 3TNNB 2XWTA 3MRLB 1DDHA 4GKZA 3FQTB 1WBXA 1JRHL 3JV6A 5EFIB 3ROOB 4C83A 2CLRA 5SWQA 4OCXL 3CDFA 3L7FA 2VKXA 1NQBA 5D93C 3OXRB 5EUOB 3T1FB 4BFBD 1RUAL 5FO9B 2WUCH 1HSAA 4NM4L 1XH3B 5EBLA 5DD0H 4MHHI 4UOJA 4NJ9H 1CXLA 2ZUSA 4CRPA 1PW3A 1NGXB 4W6WB 1JTTA 4GMSH 1K6QL 4FMFA 4JRYE 3TA3D 4PUBH 4Y5VC 5C8JA 4P5TB 4MNQE 4NYLB 1BPVA 1G7PA 1KNOA 3TCLA 3WEXB 1BJ1J 4JCLA 3QDHA 2UY6A 2N4IA 2E7LC 3OKDA 5B4MC 4LMQE 1OL0A 5BZDB 1AR1C 1T4KA 3OR7B 4J3SA 4FQHB 4R0LC 4M61B 1WVZA 3FT2A 3TBTA 3QFJB 1NMBL 5J6HA 1Q9KA 1SJHB 4KPHL 4UT6L 5ICZA 3C5JB 3QISA 3QPXH 3CZJA 2CMRH 2LVEA 3HE6B 5GSVA 3KG5A 5LAXA 4AT6A 1IGTB 5D70H 5IHUH 2NX5A 3GHBH 3E8UH 4RDQF 1BQHA 1NSNH 2NY3C 4DCQB 4KI5E 4GRMA 4EQ3A 1HIML 4QRRE 3VW3H 4NO2A 1A6WL 1OQOA 4FZEH 1AI1L 4QXUH 3O8XC 1XIWC 5FYJD 3TPKA 3B9KB 3OAYK 5JHDA 2CIIB 1ITCA 5FGBA 1K5NA 4HG4K 4PJ8D 1VPOH 1LE5B 4F15C 3MV9B 4Z7UE 1INDH 4G8EA 2NY4C 1X6NA 3NPSB 4LAJH 4ODWB 3O4LD 3T2PA 1UYWH 8CGTA 4I18A 1DVFC 2ADGB 2BVYA 4IOSD 3EIFA 1VENA 2WQRA 1ZT1B 2QQNH 1HYSD 2IAMA 2C7UB 5DJZA 3MRMB 1FL3B 4G6MH 4OV6F 1TZGL 3RWGB 3TO2B 2G2RA 1AFVH 5TQ2L 4BZ1L 2EXYD 1OWRM 5DS8B 5ITFA 3IDUA 1EGJA 3I6KA 4JRYD 4L3EB 5IB3B 4DKEL 5KZCB 2FHCA 2YN5A 2A74A 3TP4A 4MXWL 1H8OA 1G7QB 3O2WH 2FL5A 2AJZA 2B0SL 2OTPA 5ID1A 1MAJA 1Q94B 4TNWF 3MA9L 3BPCB 3EOTH 3MTRA 1R3IL 3C9NA 5I17B 1RUPH 4G6KL 2NMSA 4NZJA 3NIFF 5E99H 3DX9B 2O5XH 3V0WH 1U92B 1OLZA 1YN6B 5J13B 4E0RB 2AEIT 3M1BA 4PRNB 2HJFB 4M6NH 5IEKA 5ANMB 4OZGF 4L9LA 3MOBH 4ZOBA 1P5UA 4XP6H 4RA3A 2JCCA 3MCKB 1KN2L 4NSKB 2AABH 1U8KA 1G6RL 5ICYA 4KI5D 3SDXE 1QBAA 2AQ2A 3SGJA 5D1ZD 4JFEA 5D8JH 3CUPA 2Z93A 3GNML 4BKLA 2DJUA 5FKPA 5FV1L 4F57H 1FIGH 4FP8L 1CDHA 1TVDA 1UT9A 4PJ5E 4ERSH 2VDML 1F3JA 1T21B 2RHEA 2PCPB 5BVPH 1ZGLA 3VH8A 5C0AB 3OKMB 2H2PD 4G8FB 1XEDA 3KAAA 4R26L 5BV7B 1ZVHA 5EZJB 4GG6E 1KPVA 1YPZF 4KJYB 1VDGA 5I1HL 4GW1B 1RUML 4NHUB 2VL5B 3THML 4PGDA 4Z6AT 4ELMF 1LO5B 4XCEB 5D7IE 2HJLB 4YHMH 3TIEB 2E8ZA 1P7QB 1LK3L 3HTLX 4F9PC 2M2DA 4X6DF 4Z7OE 1DQQA 4YE4H 1VEOA 2IH1B 3K81A 1J5OL 4ZTOH 2NPLX 5E00B 1DBAL 4YDKL 4XVTH 3OKEB 3P3YA 2NYYC 4MD0A 5JXEA 2VLRA 3BZFA 5GJTH 4RQQA 1AO7D 1JNHA 1DFBH 1MHCB 2VDPH 1MEXH 4XNZC 1IEAA 4ZFGH 3D2UA 2BX5A 3MA7A 4R9HA 4NRZA 1NCDH 4XMPH 4RMTA 1U3JA 1B6DA 5TPWH 2P8MA 4DUVA 2XNAA 4LSRH 3QO0A 1N8ZB 3PWPD 4QHMB 3TESA 5D5ME 1D6EB 4N9GB 1SJXA 2RGSA 4AMKH 1UA6L 5FYLD 3FTGA 3DYMA 4M7KL 5K9JH 1X9QA 2BP3A 1Q0YL 1BBDL 3NCYS 1M71B 4PY7B 1I8MA 3ILPA 1EBAA 3V6OC 1CF8H 2GCYB 2BSSB 3ARVA 3O41B 2AV7B 4FFYL 5E8PA 5E5UB 4PJAE 1U8HA 4KZEL 3FB5B 5EN2B 3V7MA 4X99A 5C07A 1I1AA 5FO7A 4UOW1 2YOCA 1XF2B 3GB7A 4P3CH 3MLXH 3DRQB 4S1RH 3P9LA 1I3GL 5DVOA 3TT3L 2R0LL 4PY8I 3U4AA 2KL6A 1ADQA 3HZVA 1CFQB 3P9MB 3PP3K 2OYPA 1P7KA 3OSKA 1EEYB 2YPVH 3QWRA 3B8YA 3H9HB 4L3CA 2JE8A 5BRZD 3KR3L 5SX4I 4WNQA 2QADD 2R1YB 4ZPTA 5DR5L 4XBGA 3MLTA 1Z0MA 5E6ID 4GRWB 2Q7YA 3GJEA 1ZEAL 3WLWD 1NCUA 1RURL 3WXWH 3A6OA 3HMWH 3ULUL 3F58H 3LB6C 4KTDH 5C2BL 2DD8L 5EORH 5C08D 4RRPG 4TRPH 4BA8A 2AI0H 1FQ9C 4KC3B 5E94B 3VWKD 3MR9B 2NY0C 1RK0A 2VDLH 3NN8A 5FYJU 1EEZB 1KLGB 2B4CL 2V17H 3BO8A 1LQSR 3MROA 4X0KA 3LDBB 5MI0C 2BNQE 4YHOL 4DGYL 1TETL 3RTQD 3MRKA 5I9QC 5JLZB 4NC0B 1QFPA 3QCTL 3UJIH 4IIQC 3EFFA 4IOIA 4L5FH 2CLZB 4LCWE 2I9LA 2XQBH 1MY5A 2SEBB 3L3DB 5F1IB 2XWJA 2NXZC 3RZWA 3ZYZA 1EMTH 4R3SA 2EDNA 1S5HA 4PJ7F 4N5EC 1A22B 2LU3A 4FQLL 3VXSB 4LEOB 4HWNA 2WBJD 3NAAL 3O6FD 2DF3A 3GKWL 5ISZE 3W0WB 4L4VE 1BF2A 1JGLL 1M7DA 1QPPA 2X1OA 4LSPH 4HKBA 2UUDH 4OZHA 1VHPA 2Q3ZA 3D39A 4YXHH 2IWGA 2YD2A 4HUWB 5EU7C 3T2NL 3V6ZA 4TULL 3VXOB 5FHBH 4OLZH 5CIPB 3X3GL 5DWUL 2AEWA 2R2EB 3HC4H 3HR5B 3H9SE 3MGOA 3MLVH 4WUKH 1Z2KA 4NN7B 3C2AL 3MUJA 3ULVL 4P4KC 3U48A 2ICEA 2DLGA 5CJQL 4KRLB 3T0EB 3NTCL 3L7EA 4HCRL 4FXKA 3HCVA 3RJDA 3ZSTA 4I4WA 1CE1L 1KB5H 1KOAA 4TQEL 3MV8E 2ZJSL 2VISB 4Q2ZB 4XRCB 1ZA6A 4GLRH 4NGHL 4ZS7L 5FIEA 1FZJB 4BYHA 1CD8A 2XPGA 4DEPB 1FG2B 3TJHC 4MNHB 2J5LC 2IQAA 4QXGH 1JPTH 2OK0L 3O6ML 3TN0B 2D7QA 3LSOA 4ACPA 2ZCLL 2WMPA 1Z0NA 2IADA 4O9HL 4TSCH 3NIDF 5CZKA 5H8DA 1PQZA 1BAFL 5KS9B 3O45B 2G9HA 1R0AL 3QQNA 4RFNC 5EU6B 1ED3A 4Z5RB 3UJJL 3QDME 5BCAA 5L2KA 3G6DH 5DEGA 4EN3C 3QULB 3HNSH 1TENA 1QSEB 3G9AB 3EBAA 3U30C 2J8HA 4HWZA 3P30L 4XCYB 1ZMYA 5IW1B 1CK0H 2ADIA 1RVFL 4L4VD 4NZUH 3Q6FB 3UJTL 3QIUB 5E08H 4RNRA 4R90L 2Y4SA 4ALAL 3CLFH 2KQMA 2XRAH 4LSUH 1UJ3A 3DPBA 4OLUH 4Z7WF 5I1KL 1FDLH 3H9SD 4RMVA 1A1MB 4M8VA 2DICA 2H2SD 1BEYH 1IGFH 4OCWH 4KK9C 3T08A 1CR9L 3F7VA 3RWHA 4RWYL 3LKNB 3JWDC 4KGLA 2BRQA 2PTTA 4JKPL 4EDXB 2VITB 3FO1A 1FNEB 5I2IB 1FL5B 1JRHI 1N2RB 3MV8D 5HYQA 2HMID 4P23C 3GMLB 4HX1A 1DQJA 5C09A 1YNTB 1F6LL 1WZKA 5C0BE 1N6QH 2D3VA 1CIUA 1QSFB 5B38B 1QLEH 3LH2L 2YKLL 3NH7L 3WD5H 4PJDB 3FB6B 4P9HL 2CUIA 2VXUH 1T20A 4WWID 5E2UL 1VGEH 3OGCB 1QFWL 4HQQL 4M48H 2CDFA 5BQ7A 1P6AB 3QDMD 2VXQH 1OTUD 1HSBB 1RHHB 2ERJB 5HYFA 3MRPA 3MJ8A 5CINL 2XZZA 1TZHA 5C0IB 4H25B 1GH7A 5DLMH 3MSPA 3A67L 2OI9C 4X9HA 3HFMH 4HV8A 1BVLB 1F58L 1CDGA 2APFA 4IRSB 3MXWL 2PTUA 3KDMB 3HMXA 4XP1H 3KHOA 3UO1H 1IAKA 3WO4B 4AQ1B 4Y5YB 5BVJB 1WV7T 4YXKH 4PJFA 3KLAB 4NZDA 4WO4B 12E8L 1KLFA 1K4DA 1RULH 1AY1H 4M03A 2GJ6E 2Z0BA 3DYPA 5E8OB 2C1OA 5C0CB 3TPUB 1A8JH 2C4XA 2MHAB 3HAEA 3I75B 4HC1A 3I6GB 5HVWA 1NAMB 3KWWB 1A6UL 4ONHB 1MCDA 1V3KA 2DTML 5JHLH 1S5IH 4NT6B 3O9WB 5EB9A 3U36A 3WL9A 4MAYC 2FB4L 3C08L 3BIAX 3ALPA 4YHIB 2AQ3A 35C8H 4M1DL 1OGTA 2DIJA 4G8GE 2H45A 5C0BD 4A6YA 4UDUB 3DVGA 1VEMA 1MF2H 3GIZH 5J11C 1A4KA 3KJ6H 3QBTB 3U0TA 1G84A 2HKHH 5EDXA 5I1GL 4H8WH 1AR1D 2B1AL 1G7MB 4PRBB 4X6FB 4HSQA 3EOAA 3ZTJG 4QNPE 5KTEL 5DJCB 1YZZA 3GIVB 3MV01 4G8IA 1OAXL 3PQYA 4G3YL 1KCSH 3UTQB 2WM0A 4WI4A 3WUWG 5KN5A 3H42H 2NY3D 3MRFB 4M8QA 5IVXB 1EGJL 3SKJL 1I8IA 2QLVB 4MA3B 1XIWD 1XGUA 1J10A 3PHOA 3NZHH 1IC4L 4KVNL 2D0HA 4HUUB 4PBVC 4JAMB 1QACA 2ZKHL 4MDIA 2X4SB 1NJ9B 2NY4D 1T1ZB 1FV1B 1MCWW 2AGJL 3L1OH 1DVFD 4JM4L 5IGXL 4K94H 5FGCB 4O02L 1IRAY 4OF0A 4PJBF 1OARL 3IDMA 2IQ9H 2YMXL 1JP5A 3LS5H 3V4UL 1A6VL 3MNZB 2VLLA 3NFNB 1R3JB 1W8NA 2OS7A 1OGAE 5T33H 3B3IB 5FV2A 4YXLL 4HIEB 3FRUB 4G8GD 4RBPK 1YEIH 4G9DA 1K3ZA 2VH5L 1JGEA 4OLXH 5F1KC 1CQKA 4LDOB 1AE6H 2BDNL 3N85L 4P2RA 3I9GH 3ISWA 2H32B 4N8VB 1Z9LA 3LZFH 4FN0A 1HHKA 4NP4H 2YS4A 4OFDA 2HRPH 4XMKH 4BQCA 4NWTH 4WCYH 4WW1A 5HDBF 1IBGH 4D0BA 3PWUB 4P2OB 1A2YB 3MRCA 1FVEA 1ZOXA 5FOJA 3FQWB 3STBA 4R7DB 1OAQH 3L5WA 3VGGA 4LNRA 3D3VB 3H3PH 4I0PA 3BKCH 5F9DC 2WINB 1IKFL 1GPOL 1F3RB 1RHFA 43C9A 5L8KB 2DS4A 2EH8L 3P4NA 5K9KA 1PG7W 3CDGA 1AQDB 3HNTH 3NZ8A 4MD4B 5DSCB 1KJMB 5IVOA 3H0TA 5IQ9A 3IDYC 4Y19B 1J1PL 4X7SL 2XWTB 3FT3A 5K33A 4RMQA 1DDHB 2R1WA 4GKZB 1I9JL 1WBXB 5HHVH 2DBLH 3JV6B 1YDPA 3SGKC 1IAIL 2CLRB 4C83B 2DLTA 1T80A 1BJ1H 3LEVL 5HYJB 5SWQB 4OUUA 1NAKH 3L7FB 5C0NC 3VMPA 1OGAD 3QEUA 4WEBH 3WIHH 4JPKL 1BQHG 5IESH 1HSAB 1RZJL 1Q1JL 3V6OE 5EBLB 4O2CA 1DBJH 1W72H 2HG5A 4PB0H 5A16A 3ULUF 2APTA 5HVGB 1MSPA 2NY5H 4NN6C 5C8JB 2A9MH 3G5ZA 5D1QC 1G7PB 1KNOB 1QRNE 3TCLB 5FGRA 3ZTJH 3MZTA 4AH2A 2FWOA 3WFEH 5DDHA 3U4EA 3K3QA 2D0GA 3OKDB 3V6FA 1DSFL 2GITA 2ZUXA 1T4KB 5JZ7C 2XICA 2FYYA 5B3JF 4F37K 3FT2B 3TBTB 2W0LA 3TA3A 5J6HB 1Q9KB 2PKDA 5IQ7H 5ICZB 5K9QI 1KBGH 2RAMA 5GSVB 4AT6B 5LAXB 4LHJB 1PLGH 4OM1H 2WUCL 2NYYD 2NX5B 1BQHB 2VAAB 3ZE2E 1J0YA 4GRMB 4NJ9L 3LPFA 4TN9A 3MRBA 4NO2B 4F7MA 5KANI 5F9WC 1MCLA 4GQ9H 4PJEA 4EBQL 4PUBL 5JHDB 4WHYG 4I77H 4FQ1H 1K5NB 4Q0XL 1EJ6A 1X5IA 1A6ZA 2DQIH 4YR6A 5HI5C 4B7IA 1QVOA 4G8EB 5EC1A 5JDSA 1YEKH 4I18B 5ETUA 3Q1SH 2PETA 3QPXL 5TE6H 5DJZB 3OKKA 1LEIA 4PJ8A 3ULVF 3GRWH 1H15A 2G2RB 3TBWA 5D70L 5IHUL 2NR6C 3GHBL 3ARTA 3E8UL 3O4LA 3V8CA 1A7RH 1NSNL 1T7ZA 5EZOH 5ITFB 4GXUM 3I6KB 2DIBA 5SV3A 3ZTNH 4MA1B 3VW3L 3EYSH 1BOYA 2HYMA 2A74B 1JPSH 3PWVA 4QXUL 5FFLA 2FL5B 4WWKC 3BPOC 2AJZB 5ID1B 1A6AA 3UTTE 4OGYH 2W1NA 4BH8A 2V9RA 1A7BA 3C9NB 1VPOL 5CEZE 5JQHC 1C1EH 4X7TA 4JRYA 5IV2A 1UB6A 3M1BB 5F8RC 5IEKB 1UH4A 4FTVD 1SEBA 4L9LB 3SGEH 3EZ8A 2L0DA 1J8HE 2X4OA 2CO7B 2QQNL 1NCWH 5I1EL 3MRIA 5T5FH 2JCCB 5IF0A 1U8KB 4YC2B 4G6ML 2VZSA 5EU7E 5ICYB 1AFVL 3WIIL 4FQIH 3VFSA 2X9WA 1AC0A 3RHWK 5KSVA 2VXVH 4JFEB 3N06B 5CJ8A 5D1XC 3H3BC 1NKOA 3CUPB 1ES0A 2Z93B 4XPGH 4NC2B 3O2WL 4BKLB 3LB6D 5FKPB 4HK0A 4NWUH 3EOTL 3ZDYF 1RUPL 4NRXA 1L0QA 5E99L 2NY0D 3TZVC 5D1ZA 4R7NA 2A1WL 1F3JB 2DKMA 3GSQA 1ZANH 4M6NL 1U3YA 1ZGLB 2QHRH 4H1LH 3VH8B 3A6CL 3MOBL 4WU5A 3G5VA 4R96A 5J3HC 3TVMC 1YECL 5DRWA 4I3SH 4J8RA 1KPVB 3CSPA 2KPNA 2XY1A 3BRFA 4PYHA 3IFNH 1KJ2A 2NXZD 4PGDB 3B2VL 3ZO0A 4WI8A 3MGTA 4PRID 3CZFA 4MVBC 5D8JL 1UH3A 1OD7A 4N5ED 4TUJA 2JK5A 3UTTD 4JM2F 2XTJC 1QEWA 2J8UE 5CEZD 4PBWD 2J7LA 2E7MA 5F7FA 4M02A 1FIGL 4X9IA 3UMTA 1MIMH 4ERSL 3MLZH 1J8HD 4LRIC 1DQQB 3MX0A 5BVPL 4LLMA 5KVGH 1SBBA 1PY4A 4U6XA 4NUJA 2HRLA 5HGBA 4Q74A 3KYOA 4UMGA 3QH3A 3Q5TA 3ZDXF 4XH2A 3U83A 4OUOA 4MD0B 2VLRB 3BZFB 5DJ0A 4P4KD 1W2KT 1QTYT 4RQQB 1JYNA 3LEYL 1JNHB 2JJWA 1IEAB 3D2UB 4O58H 3MA7B 4NRZB 1MPAH 5F7YC 2P8MB 4YHML 2XNAB 3JXAA 3QNXA 3QO0B 5MEOA 4JN2A 5E24E 5I1IL 1NFDE 1AO7A 4KGJA 1I1RA 1MRDH 3TJHD 4DJMA 3BE1H 3LIZH 3C6LC 1X5LA 4LSVH 4YE4L 3LKSA 4XC3H 4MD5A 2NCMA 3RWIA 4ZTOL 4PJHF 3PWPA 5JQ6H 1I8MB 3ILPB 3NA4A 4XVTL 3MZGB 1RFDH 5E8PB 1U8HB 1NBVH 3WS3A 5GJTL 4EN3D 2RBLA 4X99B 1DFBL 1WWWX 5C07B 1I1AB 2VDPL 5FO7B 4ZFGL 1CI5A 4MJIE 3GB7B 4IRZH 1QFWI 1NCDL 4N1CA 1WAAF 5TPWL 5IWLC 1L9NA 4AEFA 3P9LB 4LSQH 1MJ8H 5A2JH 3DWTA 1V3JA 5J8OA 5IBTL 3HPJA 4ZO6A 4B53A 2OLDA 1CLOH 5D7IA 5DYOA 5IROC 3QEHA 3HZVB 4AMKL 2YD7A 3HKFA 4RMWA 4GSDH 5LJYH 1J8KA 1P7KB 4QHKI 5K9JL 2VZUA 5E95B 2O93L 2V5MA 1QFWM 4L3CB 4BH7A 3FHAA 4WNQB 4XXCC 3V0AC 1I7TA 4ZPTB 1S9KC 4XBGB 2X1WL 3MLTB 1OTSC 4N9OB 5SWZD 2Q7YB 3GJEB 4P23D 3S34H 5GS0L 5JR1H 4P3CL 3NBNA 1S7VA 2FH6A 5BRZA 2LTQC 4S1RL 1YMHA 4X6EA 4EKXA 4XP9L 2EDLA 1EAPA 3EGSA 1RK0B 3NN8B 1GXEA 5E6IA 3MROB 4Q6IC 1FFNA 3OBAA 3K4AA 2YPVL 3MRKB 2UUDK 5C08A 4U1KA 4AYFA 2IGFH 5EBWA 3EFFB 4IOIB 3VI3F 3VWKA 1IE5A 2I9LB 3UP1A 5JOEA 2YK1H 3MLSH 2XWJB 5CGTA 3RPKA 2AKRA 3OJMB 2HFGH 3BN9C 4R3SB 1S5HB 1PSKL 2RQ8A 3WXWL 4TUOA 3RTQA 5GSRA 2JTDA 1UFUA 3HMWL 4B5EA 8FABA 5KJRH 3F58L 3MRDA 5EORL 4JQVC 2APVA 4HJGA 2Q1EA 4HZAA 2HWZL 1HH6A 1M7DB 2VDLL 2QL1A 4XPBL 2JJSC 4HKBB 2DAVA 3V9FA 4OZHB 1HILA 3D39B 5DFWH 1D3CA 5FYKE 3BRDA 5ALBL 2FEDC 1GHFH 3V6ZB 2DB8A 3MGOB 3O6FA 3UJIL 3FFDA 5JTWA 1U8QB 4MAYD 4CMMA 3B8SA 2ICEB 5D9SA 1EMTL 1P84J 4U6HA 3L7EB 4FXKB 3HCVB 3SDDC 3PWLA 3MLUH 1K8IA 5ALCH 2K7QA 3ZKNC 1SYVA 1ZA6B 3HI6H 4HFUL 2A9NH 2VR9A 2OR9H 4HH8A 2XPGB 3UDWC 1O0VA 3UYPA 1TNMA 3FN0H 3P0GB 2IQAB 2BK8A 2K3TA 3NIFE 3LSOB 4YXHL 1PDKA 4G42A 1X7QA 5FHBL 4OLZL 4OZGE 3CVHA 1PQZB 1YNLH 1B0RA 1DTUA 2G9HB 1N6UA 4PJCF 4R8WL 1ED3B 5MEQA 1T7YA 3SO5A 5L2KB 1U2CA 5DEGB 5I74B 1NFKA 2Q8BH 3S97C 5F96L 1KB5L 4HWZB 4LIQE 3VFTA 3QT2A 2ADIB 3K4ZA 4CVXA 1BM3H 3S8WA 4U2ZA 3CC5A 3CXHJ 5HGHA 4RNRB 4JKKA 2APWA 5FYKD 5JPNA 5EU3A 4QXGL 1YUHA 1JPTL 3KYNA 1ZGLM 1UJ3B 4PD4K 2EE3A 4YHNA 2FECL 3W5MA 4L4VA 4TSCL 4UILH 2ZUQB 2AV1A 1YMME 1WK0A 2CO6B 2X4UA 3F7VB 1H5BA 3RWHB 5MEPB 4MA7H 3FO1B 1YPZE 2V2TA 4P49A 1HHHA 2BXYA 5HYQB 4PP1C 2WP3O 3X11A 3H9SA 1IAII 3QDGE 4HX1B 1DQJB 3QIUC 1CK0L 4RAVA 1F4WH 5C09B 4JJ5A 1E4XH 4ELME 1YJDL 4NRYB 2DN7A 4DAGL 1F4HA 5CSBA 5E08L 1GIGH 5DEFA 1T20B 3MV8A 3CLFL 2XRAL 4LSUL 3BHBA 5F7NC 1J1OL 3VGEA 2OJEA 3HRZB 4OLUL 4X6DE 4OI7A 1FDLL 2YHGA 3SEPA 3WCYA 2CDFB 2YC1B 5BQ7B 1BEYL 1IGFL 4OCWL 2C4FT 3BWUC 1E4KC 3MRPB 4RGMB 3MJ8B 4MLIA 1KUMA 3MV7D 1TZHB 1F11A 2GFBA 3L6FB 1EHXA 3VXRD 4D0DA 2HJKA 1R5WA 3E2HC 4HV8B 4LK4A 3ZKQD 1UWXK 2P5WB 4F37F 5F3BA 1KT2A 4P57A 2BHYA 1IAKB 3QDMA 5E0QA 4PJFB 1QLEL 1RZKH 3WJJA 4X80H 3WD5L 1K4DB 4XCFH 4RGOL 2C1OB 2VXUL 3UYRH 3QDJE 3HAEB 2FGWL 3CAFA 3WFDH 1XR9A 5GS2H 1URLA 1YMMD 1HDMA 5C0ND 4M48L 1JF6A 2JB6A 1L6ZA 5AUMA 1KTKE 1X5KA 1FSKB 4JGMA 2BC4A 3U36B 3WL9B 4EDWH 1HCVA 3LD8B 3HFML 5DUMH 1PAMA 3L95A 1OGTB 3ULUC 5ITBH 3IS1X 4OQTA 3S98A 4XP1L 3SY0A 4A6YB 2XXCB 3I3EA 5D1QD 3DVGB 3IXTA 3CDYA 3UO1L 1YEJH 3W9DA 1JI1A 1A4KB 5BZWA 1NMCC 3U0TB 4YBLB 2AW2A 2QQLH 5DMIH 1UCBH 2B4CC 5JZ7D 1RULL 1AY1L 4MCZA 3KPSE 1IC7H 5FYJL 4YHLH 3EOAB 4Y5VA 5C0BA 4QGYA 1JCKA 1TJIL 3GJFA 1X5JA 4ZUSA 4G8IB 1E6OH 2C3WA 3Q6GL 2E7LA 1ND0A 4KKLC 1S5IL 4OFIA 5KN5B 4M8QB 4R0LA 2X4TA 3CGTA 2NNAA 3DI2B 2F5AH 4JN1L 1I8IB 3MQIA 4LQFL 2C5DC 4PLJD 1D6VH 1XGUB 3DV6A 2CQVA 3PHOB 4JPIA 4HIXH 4YK4B 3DROA 1U8LA 1MF2L 3GIZL 5HI5D 1CLYL 2IFFH 4MDIB 2HLAA 2HKHL 1ZHKA 4Y4HC 3QDJD 1YC7A 2MKLC 1RUQH 1J12A 1OM3H 1DEEA 2G75A 3BKMH 3DURA 5I0DA 1XIWA 4BFEA 2P8PA 1UEYA 2YD8A 3IDMB 1HINL 1F45A 4HS3A 1XF3A 1BECA 1AHWC 1OCWH 1KCSL 1PX3A 5CZXC 5F97E 1QP1A 3FO2A 1KIUA 1WISA 4XHQA 2VLLB 2NR6D 4QXWA 4OIBA 3ULVC 5HVFB 4Y16C 3H42L 1FNAA 1T1YA 1DVFA 5B3NA 5T3XH 4G9DB 5MHSE 3KXFE 1JGEB 4P3DA 4YO0A 2YZ8A 4JY6A 4TTDC 1NL0H 4WWKD 3NZHL 5E6ZA 4P2RB 2EDWA 5DFVC 3VDAA 2XTJE 4PB9H 4PJ7E 4JFHE 5DJXA 3T77A 1HHKB 4LBEA 2FX9H 1WBYA 2WAHA 4G8GA 3JV0A 1J11A 4WW1B 4LRNH 3L1OL 5I1LA 4JKMA 4N0UA 5IMKA 4D0BB 4K94L 3MRCB 1FVEB 4FS0A 1BFOA 3HHRB 1EJOH 4PRAA 2BSRA 5FUOL 4J1UA 2X40A 3L5WB 3S35H 4LNRB 3LS5L 4I0PB 3QJHA 1KJ2L 4NQXA 3MUGA 4ZG1A 1N7ML 3GMOA 2EEAA 1WIPA 3B5TA 1IEBA 5D1XD 43C9B 4J23A 3P4NB 5K9KB 3CDGB 4B0MM 1AE6L 3LKRA 1J0IA 4LPUA 3I9GL 2E7CA 3H0TB 5IQ9B 4TUKL 5TE7H 1HHIA 3CSBA 3FT3B 4DW2L 3WHXA 3TZVD 2HRPL 1X5XA 4U3XA 1KN4H 2CGRL 2R1WB 3KPTA 3S88H 4WCYL 1XZ0A 4HK3J 1T0PB 3QCVH 1YDPB 2E9BA 5GRUH 3JWOH 5IJVA 5J3HD 4HUXA 3TVMD 1LNUA 4OUUB 1NC2D 5DZOA 3ZHDA 5F7EH 3QEUB 4M62H 3QQ3B 5FYKU 3H3PL 4KMTH 3P2TA 4I13B 2GTZA 3BKCL 5E4EB 1QSZA 5MHSD 3KXFD 4O2CB 3NIDE 5F71A 2HG5B 2B20A 3EO9H 5A16B 4Z0BH 4MVBD 5EBGA 3DBXA 1OWWA 3N1GC 2YD9A 2XTJD 2MTPA 2CUMA 3HNTL 4JM2C 1TQCC 3EYFA 3G5ZB 1OGAA 1JE6A 4UV7H 4AH2B 2FWOB 5DDHB 4P9HC 3U4EB 1L4IA 3V6FB 1SY6H 3K46A 2GITB 4L4JA 5JIKA 1AJ7H 2FYYB 3W81A 2DBLL 5J12C 3TA3B 1T2QL 3LCYA 1NAKL 1A5FL 1LP9F 1PEWA 3S9DB 2YUWA 4HKZA 5DMGC 3I6LE 1QHOA 4F9PA 5IESL 5HDQH 3PWNA 4LSTL 1NANI 3DRTA 5CSZA 1R5IA 5CZVH 1DBJL 1HQRA 1W72L 1RQ5A 4PB0L 3MRBB 2LABA 2Y5TA 4F7MB 4PJEB 1U3HC 2DQTL 2NY5L 5IM7A 1WWCA 3VXTA 1CL7L 1WQVT 5HYSA 3R0NA 2QQKH 3WFEL 5LWYL 4YR6B 1DJSA 1QVOB 5A2KH 1HI6A 5DMJB 1PG7H 5EC1B 1RJZA 5JDSB 3C6LD 1GGIH 2G5BA 1ZLVH 2A6KA 2ARJQ 5ETUB 1U2HA 4ZDHA 4K2UH 3X17A 5IQ7L 1SBSL 1YNKH 1KBGL 3OKKB 1LEIB 3FJTA 2I27N 4PJ8B 2Z31C 2L7UA 1BOGA 4U49A 1H15B 3TBWB 3HG1E 2HAZA 3FN3A 3O4LB 3IDXL 4O5LH 2A6JA 2ZNWA 2EDHA 1ZLWK 5IB4A 1M7XA 3W39A 3PWVB 4GQ9L 2WLYA 4GT7A 1A6AB 4I77L 3V6OA 4JRXD 4FQ1L 5I16A 1J0ZA 5JMOC 3NOIA 4BH8B 3CFEA 1I4FB 4TSBH 1FO0H 2J6EH 3S36H 2XWBA 3RFZC 2NZ9C 2VLJE 4X7TB 2AP2A 4JRYB 1UB6B 1YEKL 5FUCC 4F7TA 5IV2B 1SEBB 4JHBA 1RIHL 4YEEA 5C7XL 3LRGA 1ODAA 2E7BA 2X4OB 3LVEA 4X7FC 4PG2C 1UM4L 1JGUH 3MRIB 5IF0B 4XP5L 5TE6L 5I73C 1I8LC 4E42A 4I1NB 1ZT4A 1CBVH 3GRWL 4X4XA 1Q72L 3QUMH 1FLTX 1T2JA 2F19L 3VFSB 3S3SA 3F7QA 1OTSD 5KSVB 4JFZL 5EZOL 1RU9H 4FTVA 2OR8A 2QBWA 1CGSH 3EYSL 4P4RA 1F4XL 1H3TA 1JPSL 1ES0B 3BPNB 4HK0B 1T0NA 4OGYL 5TH2A 4FXGA 5DMKA 4H5SA 3GMQA 2P43B 4IMKC 4GMTH 5D1ZB 4F8QA 1C1EL 4R7NB 1H3GA 4I48A 2LU7A 1QBBA 3GSQB 3TFKC 1TFHA 4KJPC 2GSGA 4F3FA 2UWEA 2EDRA 4NQDE 4WU5B 3G5VB 4R96B 1NCWL 5DRWB 5D2NC 2DJ4A 3QUYC 5TF1H 3SGJC 4J8RB 1VB9A 4PJXA 2XACC 4E5XA 4FQIL 5L88H 1KJ2B 3DHMA 2VXVL 3BN9D 3MGTB 3CZFB 1FC1A 4NC1C 2ZWLT 2JK5B 4TUJB 3WNNA 4W6YB 1QEWB 1HQ4A 5CBAA 4OV5B 1IQWH 4IIQA 3O4OB 4HS8H 1JFQL 1YN7A 4NWUL 1WFOA 3KPRE 4NJAL 2GIYA 3CJJA 3FFCE 4WUUD 1WCBA 1IGMH 5HGGS 5GS1C 1JZ5A 2XYCA 4JFFD 5SX5H 1ZANL 4PRIA 4LHUG 2BY2A 4LLMB 2QHRL 4U6XB 3UTTA 3GI8L 4NUJB 5HGBB 3U46A 3ZKXB 4MXVF 3KYOB 4M7LH 1FYHB 2FEDD 1ZVSA 3QH3B 2QSCH 4LP4A 4OD3L 4DK6A 1VSCA 4XH2B 2VYRE 2N7BA 4HPYH 1GZPA 1QA9A 1KJ3H 2FR4A 2H9GA 3ZKMC 1J8HA 5DJ0B 3NCEB 3AMKA 3DOSA 4EUPH 1A0QH 1PFCA 3SDDD 2FECI 2OP4L 4KHTH 4OAWA 3SDXB 1BBJA 3ZKND 3EYVA 4JO1H 3QNXB 5MEOB 4OIAA 2DMKA 3V5KA 4JN2B 1MIML 3DXAE 3MCLH 4P4KA 1ACYH 4NNPH 5GGQH 3RKDC 1AO7B 5B39A 2DQHH 1TITA 3KHQA 5D7KE 5DQJA 3LKSB 4KTYA 5GIRA 3WDJA 3SGDH 4MD5B 4AENA 4ELKA 4RIRA 3RWIB 5HDBE 4ONOA 4PJ5B 3PWPB 1RZJC 5DRNA 1DLHA 7CGTA 1X5HA 4Q58C 3MREA 4KROC 4GRLC 3WS3B 3VRIA 1MCCA 2YD1A 1T22A 3JSSA 1II4E 3NPZB 4NQCE 1LHZA 1X5YA 3T0DA 3RJQB 5KSAC 2WW8A 1N0LA 3Q2CA 4FFZH 1MPAL 2XQYG 1UC6A 4YHZH 3FZUC 2O26U 4H26A 3CFKA 3HPJB 1I1FA 3FOMA 4EN3A 4LIQH 4LASL 5D7IB 3X12A 3BE1L 3BGMA 3QEHB 4LSVL 1ZSDA 4XC3L 4OCLC 1ZKAA 3IKCA 4BH7B 4R97B 4NFDA 4U6YA 5JQ6L 1EPFA 3O3BA 1NCTA 1I7TB 4NQVA 1RFDL 1NBVL 3SKUD 4YDIH 3RP1A 3C6SA 5EU4A 4XAWL 4PP1D 1CXIA 4R2GD 3REVA 3N1FC 3K2MC 3T4AA 4IRZL 3ULUE 1S7VB 5BRZB 4XVJH 5CP3H 3DXAD 1BP3B 4JG1H 4LSQL 1MJ8L 1YMHB 4X6EB 1EO7A 2QADB 3U82B 5D7KD 1A1OA 1BZQK 1EAPB 3EGSB 1GC1H 4OLEA 5SWZA 3WS6C 1CLOL 5E6IB 5AYUH 4Z76A 5EWIH 3H9YA 2K7PA 4P23A 2XY2A 3BZ4A 4GSDL 3EYQC 4DWHA 1FFNB 1OD9A 3OAUH 5CHNA 2R0KH 1YYLL 5C08B 4QWWC 1LE9A 1NFDA 1E4JA 4L29A 5DJ6A 3VG0H 4U1KB 5EBWB 3OMZA 3IU3A 3VWKB 3RWDA 4PJDF 3CVIH 4OZ4A 3ULSA 2AKRB 4NQCD 4G5ZH 1LEGA 2UYLA 4TUOB 2O5ZH 3RTQB 4BFIA 5GSRB 4AEHH 5JR1L 5I1JL 8FABB 5IW6A 2E9WA 2Z8VC 3MRDB 4OZFH 2MSPA 4UV4H 1UJTA 4HJGB 3V95A 1HH6B 3AM8C 1JPST 4NDMA 2OTWA 1S78C 4D94A 1HILB 1HKLL 4WW2F 3KVQA 2HTLC 3OKOA 4Q7DA 3KNBA 3BGFB 2WBJB 1CGXA 3O6FB 1MWAH 1MFCH 2IGFL 3FFDB 3FMGH 3TF7C 4UT9H 2YK1L 3MLSL 3QHFH 4CMMB 3BIBX 3ULVE 4DTGH 5D9SB 4DN4H 2HFGL 4XBEH 4U6HB 3ULUD 7FABL 1KCRH 2WNGA 3PWLB 1K8IB 4LMQI 5DVNA 1SYVB 3RI5F 2I5YH 5E5RB 4MAYA 4WFFE 1HHJA 4X4MA 1I7ZA 2IBZX 4WGWB 4WI9A 2CR6A 1UG9A 4C55A 3VXME 4P5MA 1PX4A 2A77H 1FGVH 5JW4N 4G42B 1X7QB 3ELAT 1GHFL 3IU4L 3RWJA 4OLWH 1RMFH 3C8DA 3CVHB 4OCYH 4OBRA 1B0RB 1G0YR 2WBKA 4CW1A 4KKLD 3S37X 2KH2B 5MEQB 3LS4H 4ZD3H 2QR0A 3D69B 3JV4A 1WEJH 2F15A 4LKCA 3VFTB 3MLUL 1IC5H 5L6YL 5ALCL 1KYOJ 4CVXB 3MNVA 3ARGC 3OTTA 2EYTA 3ARRA 4R4NC 2A9NL 4POUB 1BF8A 3KPPA 4Y4HD 2OR9L 4FA8A 3CC5B 5HGHB 1WCQA 3MGAA 3ZDYE 1NC4D 5JPNB 5EOCJ 5EU3B 1YUHB 3KYNB 1WICA 5I1CL 2J88H 4YHNB 3O6KL 2CKBH 4L4VB 5KBNC 4U6TA 5J57B 5CZXD 1YNLL 2H3NA 2AV1B 3ULVD 1AC6A 2X4UB 1FIEA 1H5BB 1A3QA 1KCVH 3UTZA 1ETZA 4Y16D 1K2DA 4ZODA 4NCDA 5IB2A 2V2TB 2RB8A 1YA5A 2OQJA 1TZIA 3X11B 3H9SB 5DJ8A 4TTDD 4U0RB 1NBYA 5DFVD 4L9DA 4RAVB 4JJ5B 4WFFD 1BM3L 3N0PB 5D72L 2RCSH 1NMAH 3U4BH 1KPUA 1HH9A 5DEFB 3CU7A 3MV8B 3BHBB 4UTBH 2QKIA 2OJEB 3CNKA 3V4PH 5TDPA 3MJ9L 4I5BA 4Y1AE 2WIMA 4QXTA 5HD8C 4C58B 2DI8A 1F11B 2GFBB 4D0DB 4MA7L 1N4XH 2HJKB 3ZDXE 5KSBF 3I50H 1R5WB 1XCTA 3PF2A 4OZGA 5C71A 5F3BB 1KT2B 4P57B 5CS7A 1RZ8A 5HGDA 5JXAH 3QDMB 4HGMA 2EIBA 3S6CA 3L5HA 2W65A 1E4XL 1ZV5A 4RFEA 1J0JA 3MV7A 4PJGA 3VXRA 3QUXC 2YD4A 5T5NG 4MZ3A 5LCVL 2PR4H 1XR9B 1HDMB 2NY2C 4HIJA 3HUJF 1FVDA 1CL7I 3ARDC 1A7OH 2JB6B 3LKPA 5AUMB 5DD5H 1RK1A 4HBQA 5CILL 2BC4B 1DANT 4PJHE 3DMMC 2HTKC 2X41A 3MOAH 3SGKA 3L95B 1H0DA 3BYTA 1IAOA 5FCUH 3IFLL 2EC9T 4JM2D 3SY0B 3BKYH 1KXVC 1RZIA 5D93B 3W9DB 3IXTB 3ZT5A 2EDBA 2BNRD 1YPZA 5BZWB 1KC5H 2FLRT 3UPAA 4YDJA 1RZKL 1Q9WA 1WAAE 1U8JA 2ADFL 3VD9A 1H3PH 1BQSA 4NPYA 3UYRL 5F3HA 4MCZB 4LQ1A 5DGRA 4NM8H 4ELMA 5FUCE 4Y5VB 5C0BB 3QIBC 4Y1AD 3E6HA 4FQJH 3GJFB 5D1QA 4ZUSB 4KQ4H 2R9HC 3FQTA 5DMGD 4KVCH 1ND0B 1FPTH 5IW3A 5BW7C 2FZ3A 4O2EA 4HPOH 4R0LB 4X6DA 2X4TB 4EDWL 2NNAB 4OT1H 5EUOA 5DUML 4OFKA 1GGUA 4PJIF 1H8NA 1U3HD 3DV6B 5I71C 4JPIB 1JYXA 1OAYL 3DROB 3WFBH 1U8LB 1S7XA 4J2XA 5I76A 1YEJL 3AY4C 4GQPH 1CXKA 2HLAB 2QQLL 2NY3B 1ZHKB 3AGVA 4RAHA 1MCJA 4EI6A 3BH8A 1DEEB 2G75B 4Z8FH 3DURB 5DRXA 1NBQA 3JBG7 3G08A 1IC7L 4YHLL 1EFXD 1XIWB 1M7IA 3FOLA 3F65A 2P8PB 5IMOA 4FXLA 3M07A 3GZKA 5A1AA 1E6OL 2Z31D 4HS3B 4NBZB 1XF3B 2EYSA 3GM8A 4WFED 3FO2B 2NY4B 5DFTA 3UPRA 2DWEA 3QDJA 5D2NE 3RY4A 3H8NA 1T1YB 1DVFB 1UH2A 2F5AL 1R3LA 3UBXG 4P3DB 2IC2A 4YO0B 4LFHG 3QXTA 4JY6B 3ARZA 4NO3A 4HIXL 4NC1E 4DVBA 4XPFH 4PTUA 5TFSH 5DJXB 3HC3H 3T77B 1IEHA 2IFFL 4LBEB 2NZ9D 1WBYB 2NY6D 3LPGA 1OM3L 4G8GB 4OQ1A 3BKML 5L2JA 3C8HA 4N0UB 5IMKB 4MS8C 3IFOA 3A0OA 5T1DH 4WWKA 1BFOB 3U7AA 4PRAB 2BSRB 3WMSA 4J1UB 15C8H 4YIQA 3GHEH 4YHPA 3QJHB 4M3KB 4NQXB 4M93C 3MUGB 3P0VL 3GMOB 3VGFA 3QZWG 1CGTA 1DE4A 4OF8A 1DUZA 1IEBB 3O2DA 3V7AG 2V5SA 2DKSA 3LHPH 1CGUA 2JCCF 3U9UA 4G9FE 3ALXA 3LKRB 1MIEH 2FJGA 2OR7A 1MI5E 1HHIB 1MHPL 2WSKA 4N8CH 3WHXB 4CADA 3W2DH 4KJPD 4XHJC 4QHUA 5D1XA 1XZ0B 4XPAH 5TDOA 2UZXB 5CEZL 5IJVB 4HUXB 4ZOCA 1EJOL 4ODVH 1LNUB 4E0RA 3QUYD 1M6OA 1B4JH 5L7XH 1EZVY 2UZIH 3TZVA 3U0PA 2GTZB 2FBJH 1U93A 3QCUL 5E2WH 4U1LA 1JPFA 2ICCA 3DBXB 3MNWA 4PJCE 1ZVYA 3TVMA 3QRFM 1NC2A 5HYSG 1YJDC 2FJHA 3EYFB 1OGAB 4CBPA 5TE7L 3KLDA 5SWSE 3KXFA 3RX7A 4PY8J 1JJUA 1KN4L 5I1DA 5KVFL 3S88L 3B43A 2ZCHH 5E8EB 5E5MA 4PLKC 4PJ7A 3TO4C 4Q9BA 1LDSA 3DETC 1ZLVK 4HUVA 5F7EL 4M62L 2PCPA 4HKZB 1WGOA 4IHOA 1F90H 4KMTL 5GGRY 1RIUL 1OAUH 3A6BH 3ZKMD 1KEML 3PWNB 4LRIA 3DRTB 5CSZB 1R5IB 4OIIH 1HQRB 4HKJA 4G9FD 1Q8MA 4Z0BL 2Y5TB 1A47A 3WV0A 4GW1A 5DD1L 5I8EA 2IFGA 5D7LE 3MCG1 2VSCA 5IM7B 1KGCE 4AZ8A 1WFUA 5JPMA 3VXTB 3CH1A 3ZL4H 5HYSB 2X4PA 1FZKA 5MP6H 1SY6L 1HI6B 3RKDD 2BJMH 1RJZB 3EO1A 1AJ7L 3U2SA 2G5BB 4XNZB 2A6KB 5HHOE 4KK5C 4ZDHB 1CFNA 4I8DA 4HD9A 3BN3B 1X3DA 1ZHBA 5IHLB 4L8BA 4LGSB 2D7OA 1BOGB 1X4XA 3INUH 5HDLA 4KROD 3CH8A 4GRLD 4Y0GA 3C6LA 2A6JB 5EBMA 5CZVL 5IB4B 1XAUA 3W39B 3O3AA 5DEZA 5KSAD 2Y7QA 5SWSD 2CSPA 5I16B 3JWDL 3QWOA 5JUEH 3FZUD 3D0LA 4X4YA 3LKOA 4LNVA 1A9EA 1PG7L 2XWBB 4LHQB 2YEZA 4F7TB 3P11H 2Q6WA 4HLJA 1I1CA 5JA9A 4JB9H 1G9MH 4KUZH 4ZFFA 5CD3A 4K2UL 2WWKO 5IWLA 1YNKL 3K7UA 4LPXA 3MJ6A 4JRXA 4PGBA 4GXVH 4E42B 2EYRA 1ZT4B 2X44D 4S1SH 4X4XB 3HLAA 3PGCA 1T89C 3GMMA 3PDOB 3F7YA 4ZOAA 5IROA 3S5LA 2Z8SA 4O5LL 3WXVH 2VDNH 5D7LD 2KZWA 4FTVB 1KGCD 1H3UA 3TIDA 1C5DA 1YEEH 4P4RB 4Z7WA 2V6HA 5F9OH 1IL1A 4HMEA 4XXCA 1T0NB 3Q0HA 5F6HJ 3GSNH 2CJUH 5TH2B 2FX7H 4FXGB 3GBNH 2EE6A 5DMKB 4H5SB 2YPLE 4TSBL 3GMQB 1B4RA 1FO0L 2J6EL 4HKXA 2OZ4H 4I48B 4YDLC 1J86A 1XGYL 2GSGB 3FHQA 4WHTA 4F3FB 3EYQD 2UWEB 3NMEA 4LPWA 3GSRA 2Z35A 2OTUA 3TC9A 1JGUL 4QWWD 1NCNA 4U3HA 1CBVL 1EH9A 2YSSA 4PJXB 2NY0B 3QUML 4E5XB 3L9RA 3SE9H 1RU9L 3S37L 4Q6IA 5MI0B 2YXFA 5DA4A 5JW5A 1CGSL 2X4QA 2JLLA 1AR2A 3ME0A 5I9QB 1HQ4B 3EUUA 5CBAB 1WFNA 4BQ9A 1XT5A 3CSYA 3QFJE 2YUXA 2IBZY 2YWZA 1NDMA 1YN7B 5E2VH 3KYKH 2LAGB 4OFYD 1WCBB 2NXZB 2CRMA 4GMTL 4K94C 4PRIB 1S78D 2M8XA 4F7CA 3UTTB 2N1KA 3U46B 2HTLD 4WW2C 1ZVSB 1P4BH 4JQVA 1IJ9A 2W9LA 1MCOH 5AD0A 4WUUA 2J4WL 1GZPB 1QA9B 4KY1H 4IDJH 2FR4B 2H2PC 4TNWK 4UB0H 5L88L 2H9GB 1J8HB 2JJSA 4JFFA 4ODTH 5IBUG 4OZHF 1G6RA 5C6TH 3BP7A 1MREL 4OAWB 1DBBL 4PS4L 1BBJB 3DV4A 1V7MH 4ODHH 2YPLD 3G04A 4ZUTA 2JKXA 4Y4KC 3EYVB 5CUSH 1T83C 4E9LA 1IGML 4P4KB 5B39B 4UINH 4NZTH 4KWUA 2VZOA 4KI1A 5DQJB 3SDDA 2DQDH 4QF1B 3ARWA 5GIRB 3VD4A 4L3EE 4M7LL 4AENB 4ELKB 4RIRB 3OZ9H 2WANA 3E3QC 2J2ZA 5DRNB 1DLHB 3SQBA 3MREB 3UDWA 4HUWA 5FYKL 2J5LB 3JWNC 2VRAA 3VRIB 3DO7A 1A0QL 4RMRA 1P6FA 1T22B 4HXAH 1UQSA 1JGVL 4EQ2A 5ANME 4KHTL 1SHMA 4NKDA 2YA2A 5HHME 3ARGD 4RFNB 3LPWA 2MKWA 4HIHA 4R4ND 1VFBA 4H26B 1U6AH 3CFKB 1I1FB 1ZHLA 3FOMB 3MCLL 1ACYL 4NNPL 5GGQL 4EN3B 4UTAH 5L8LB 3X12B 3BGMB 1WZ1H 5BS0E 3U30B 3T8XA 1ZSDB 3ES6A 4MHHG 3IKCB 5CD5C 3DUHA 4U6YB 2ZG3A 1E4XI 3O3BB 1JNLH 2QJDA 1A1NA 4PR5A 2FH8A 1BVKA 4NQVB 4Y8DC 5E1HB 1FHGA 2HFTA 1LDPH 3PHSA 3R8BB 3C6SB 5EU4B 1OTTC 1LO4H 2NY5C 5KS9A 3REVB 3QFDA 4UIKH