4KV5F

Scfv gc1009 in complex with tgf-beta1.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
LETVLTQSPGTLSLSPGERATLSCRASQSLGSSYLAWYQQKPGQAPRLLIYGASSRAPGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYADSPITFGQGTRLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Transforming growth factor beta-1
publication title Structures of a pan-specific antagonist antibody complexed to different isoforms of TGF beta reveal structural plasticity of antibody-antigen interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 110
sequence length 110
chains with identical sequence I, K, L
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kv5F00
3RVTC 1S5HB 4KMLB 4EVNB 3CNKA 4U31A 5IB3A 2LU7A 1T2JA 2Z92A 1WWAX 4FFYH 4DZ8B 1T89A 2DLTA 2I5YH 4O5LL 3VCLA 2JCCE 1JTTA 4LHUG 4XNQA 1S7SB 1NCWH 2WIMA 3MV9D 1T1WA 3ZHKA 2FYYB 4WGWB 1ZANH 4OGAD 4P2OD 4XHQA 5LGHH 3GBML 2D4DA 4JEGB 1QACA 2HJFB 4OLVH 4P2YA 2BX5A 4ELME 1FO0H 2MQ0A 3SQOL 2YD4A 2VKXA 5K9KA 2YPVL 2YPLD 3O4LE 4OV5A 4TTDC 1MJJA 1RUPH 5JDSA 3U82B 3GUTA 4PR5A 3UTQB 3RGVC 3PWLA 1P7QA 4HPOH 1EA9C 2Y06H 1NCUA 1MPAH 2Z8SA 3PDDA 1H3XA 4E41A 3SE4A 1U3HD 4S0TD 3FONB 5GGTH 4F7PB 5DT1L 5T5NF 4RFNB 1CDCA 2ARJA 3ULVE 5CJQL 5I73C 5DD5H 2YK1L 5GSRB 5ID1B 1XH3B 4XMLH 3SDDC 5GJTH 3VE0A 4MAYA 5F9OL 3WKML 3EDJA 4DN3L 4HS3B 4K2UL 5ECJE 1EFXD 2VDOL 4K23H 4PBXA 3RJQB 1GYAA 3U1SL 3X13A 4MJIA 3EBAA 2A1WH 4Y0GA 1JJUA 5DS8A 4KK9D 2LE9A 3ZDZF 1KCUH 2BOCA 3FMGL 4ZUSB 3GMLA 3ZE1F 4X7SH 2DLFH 3SPVA 1NAKH 3HMXA 4Z95H 2VDNL 2JE8A 3QIBC 3VFPB 1ERNA 3NFSH 1ZEAL 2X6MA 4XAWL 3BGMB 1WJ3A 2R56L 2M8XA 2VITB 2PO6B 3K1KC 2K7PA 3SKJL 2YXMA 3C60A 1N59B 3QQNA 3KLAB 5L0QC 1MIEH 4FQ1H 2LTQC 1H0DA 1KLFA 1BFSA 3RTQD 1FPTH 5E7FA 1DBBH 2EDXA 4HKJB 3R0NA 4GAGL 5E5RB 4WWKC 4ZAKB 1H3VA 1S7UB 2V9TA 4BSJA 3EO9L 1KN4H 5HJ3B 3W81A 3BPCA 2GJ6E 5T3XL 3VRJB 1IGFL 4CGTA 1EHXA 1D5ZA 4L4VA 2IH3B 5CZVL 3W39B 3AGVA 4LPXA 5KVFH 5I1DA 1ZA3A 1CGTA 5J12B 1S3KH 1SEQH 2GITB 3R06B 3CFJA 4F9PA 1NFIA 3P30L 2AK4B 5B21A 4UUJA 3BJLA 5CHNA 2JTDA 3KYAA 1MQ8A 3LKPB 4JG1L 1F02I 3MBEA 3OKLA 3RIFF 2YUZA 3QT2A 2NX5D 4I2XB 4P2CG 4PRAA 3STZA 4PJBA 3DIFB 3L5WB 1UB5A 1MCWW 3HC4L 4WHDA 2QQLH 5E7BA 4WUUE 1AO7E 1I3GL 3T1FB 3IFPA 2R2HA 3P0GB 4NQDA 3MO1B 3B5TA 5JHDB 4HIHA 1OW0C 4L4TA 1T2QL 6FABL 1VACB 3S9DB 1N4XH 2DMBA 3QWOA 3NA9H 4X9IA 4L8BB 3U79A 2OR9H 4M43H 3ZO0A 5HYSB 4ESKA 3I6KB 4JN1H 4OLZH 3IAGC 4HGKC 2NW2B 3D25A 1OWRM 1B4RA 3FQRA 3QISA 1MHPL 2XA8L 3GSQB 1LK2A 3TO2B 3ZDYE 3C5SB 1TVBA 1OGTB 2V9RA 3O81A 5DMGD 4LCWD 1F11A 2R2EB 2FZ3B 4LQFL 4PJDE 1D5BB 1XCTA 3D85A 4LNRB 4FQHA 2ESVA 1TZGL 3HI1B 2BMKA 2OTPA 4X7FC 1E0OB 3QEQE 1QFHA 1UYWL 1S7VB 4U0RC 4GKOA 4P59L 3LRSA 3NPZB 4YEFA 4M4PA 1C1EL 4FFZH 1RUKH 1DSFH 3DMMC 1XR9B 4G6JH 3BH9B 1KCRH 4RCAA 1CLCA 4G42A 3TC9A 4XWGL 3LPWA 5ESVB 4M48L 1I85A 1QTYT 1RZJL 1B9ZA 5FUOL 3FB6A 4KK8C 1IKFL 3WIFA 4NQXA 4KZEH 1LO4L 3ARFA 4MDIB 4MCYB 2C1OA 4OCWL 5F97E 1CIDA 4YE4L 5D9SB 2BSTB 5KSVA 5D5MF 2DQUL 5L88H 4LBEB 4BUHA 1H8OA 4ISVB 4UINL 3RUGF 4HBCL 4PGCB 5T3XD 3L3IB 2YA1A 2J8OA 3QUML 3LHPH 3QDMD 1B0RA 1C08A 3DI2B 3NGBC 4KI5F 4XPFL 2BJML 5MEOB 3RKDD 1Q9LA 3SE8L 2Q7NA 4OM1L 3MXWH 4QRUB 1A5FH 2HT3C 4MAUL 1YY8A 3ORJA 5MHSE 4X5XB 1NGXA 1Z3GH 3SGJA 1ZMYA 3QUKB 3JV5A 4WI3A 3B8YA 3C09B 4XC3L 3WD5H 1T0NA 2IBGA 1MH5A 3BMVA 1HYSC 1Z9MA 4YX2H 3MJ9L 3QZWB 3PQYA 1FBIH 5JW3L 1RZIA 3UP1A 1KC5L 5MP6L 2DAVA 3K2UL 5F1NA 3FB7A 8FABB 4JR9L 1XGQA 3T8XB 1F4YL 3SGKC 5AD0A 3IRZA 3W9EA 3PDOB 3H8NA 1YEEL 3HAEH 4MD0B 4Z7VE 1J10A 3Q0HA 1XGUA 4A2LA 3ZYIA 4JHBA 2AV7A 1LP9A 3U7WH 3AXLB 3QXAB 2RB8A 4Z7OF 4S10A 1YDPB 1X5AA 1NAML 4OGXL 1KJ2L 4A6YH 3VGBA 1QSEA 4L1DA 4WI5A 4EI6A 1HIML 4XZUB 5JXAH 5DWUH 1RD6A 1F58H 5DMKA 4N9OB 5CGTA 4KZDL 3AROA 1NDMB 4UB0L 1TLKA 3EO1B 1G7MA 4EUPA 3G04B 4G8IA 3NTCL 5GJSL 3QIWA 1ZLVK 4JN2A 2OTUB 4Y4FB 5EIVA 3QHFH 1LO2H 3U36A 4QTHB 5D6DC 1UXSB 2AK1H 2YEZB 2V7NB 1HXYA 2IFGA 1BVKA 1PEZA 3EJYD 1J12A 1CFSB 4KTEH 4UAOC 4Z7UA 1RHHB 1UXWA 3D0LB 1EIBA 2HG5B 5I8OH 4JJ5B 4S1DC 4TPRL 1CXEA 1EK3A 5KAQF 4P3DA 3WXWH 3VW3L 5E8PB 2YC1B 2CLZB 3HC0B 5L8KB 3T2PA 5D2LE 1HZHH 5IWLA 4LK4A 5HHOD 4RMQA 4YZFE 4HV8B 5LAXA 1G9MH 3H9SD 3LEYH 3ARDA 4O58L 2CLVB 5AUMB 3VI4F 3EOBA 4P99A 3PP4L 2VR9A 3CK0H 3KJ6L 2D7TH 3MRMA 1EHNA 4DVBA 1NC2D 3Q2CA 4X8XA 3WS3A 4FG6D 4R4FH 1NFDB 1IM9D 2PF6A 3RVVC 3HAEG 5E00B 5CGYD 3LD8C 1N5YL 2IJ0C 4HUWA 5JMRA 1F6LL 3BPNC 3QNXA 1H15A 2W9DH 3WLBB 4OZFA 5GRVL 4RMRA 2MCPL 2X4QB 5E1AA 4HAGA 3SQBA 1XT5A 2F58H 4EIZC 1VFBB 2VNCA 3B6SA 2HH0H 5AZEL 4P4KC 2XN9E 2YD9A 3DURB 4YO0A 5FA4A 4PJHF 3QSKB 1JUFA 3KPPA 3KPMB 3L9RB 3OPZH 1DR9A 1NKRA 5HYJE 4R96B 1T0MA 4H0HB 3SCMD 1FNLA 3WSQL 2J6EA 4JY5L 4D8PB 4PLNC 2KZWA 3P4LA 4KH2A 5C9JA 4U6HA 1A7RL 1OAUH 1SM3H 1R0AH 3CXHJ 4XXDB 5FYKH 1CFNA 3VFVA 1BFOB 1CGXA 1UWGL 5IHZB 4GG8A 2O93L 4NNXB 1BOGB 3JTTA 5IROA 5EG6C 4HS8H 2KPNA 1KEML 1PKQA 5F3HA 3QDJA 4ZS6D 3WYRA 5ICZA 1GZPB 1XF4A 3MBXL 3BZFA 2Q8AH 3PV7A 4GG6B 1TIUA 3QA3A 3MRDB 4LMQE 1A14H 4M93B 4QOKA 2P5EE 5JW4Q 4YXHL 2H2PC 2B0SL 2YBRA 2XZZA 3RBSA 1HNFA 5ERWB 4KY1H 4IOIB 2IADB 4N8VG 4NRXA 4KGLA 4NN7B 4UIMB 2JK5A 1EAPB 1WWWX 3C6SB 3F5WB 3D9AL 3QEGH 4JRXD 4Y8AA 5E0QA 4Y5YA 5EU4B 4OM0H 1AD0B 4RFEB 5F7EL 5LQBH 2YA0A 2VLRE 1OAXL 2R1WB 2WNGA 2R0ZL 3VFGH 3TYFB 5DRZA 3NCJH 4OCYH 4EBQH 3MV8B 2Y5TB 1IGYB 1U8PB 4Y5VA 4LPWA 2VH5H 3NIFE 2F5BL 1LD9B 1NMAL 1MI5D 4PUBH 1PSKL 4JY6B 1DL7L 3TNNA 3OR7A 4HWNA 1RUML 1P1ZA 3V6OA 2PNDA 3CU1A 4ONHA 3O3UN 1LO3L 5GS2H 4NQCE 1WZ1L 3VDBA 4GO6B 1ACYL 1A7QL 1QA9B 2VL5B 1FN4B 1FDLH 4MJ5B 1FFPA 2VQ1A 4FQXA 2CK0H 1AR2A 3MRIB 5DRXB 5DK2B 1B4JL 4LVHC 4RAHA 4N0UE 4OB5L 4Y89A 1QSFB 5C09E 5C07A 1P6AB 3BESR 4TUOB 3CFBA 3BPLC 5JA9A 3DSFH 1CCZA 2IQAA 1ND0A 3TCLA 2OMNA 3NCCB 4PG9A 2Z4QB 4ZNEA 4YDIH 1J1OH 2DD8H 1M7IB 5FK9A 5E6IA 2I9LA 4WO4D 5BOZG 4I18C 4N9GB 1CK0L 2C3VB 2H2SC 3LRGA 5H94B 4PYHA 1Z5LB 2WUCL 2P8MB 3TJEH 3MRRA 3MRCB 4FQ2H 3QCTL 3OSKA 4NHUB 1MJ8H 2Q6WB 1M4KA 1YNLH 1NCDL 4HJ0C 2AEPL 1RFDH 2XWBA 5I9QC 4LVOC 4P2RA 5JMOC 3MLZH 1BHGA 4XH2A 3MZTA 4G7VH 4FZ8H 2XICA 1AY1L 1C5BH 3CXHK 1NGWA 4LP5A 4U1SA 4PJXA 4U3CA 1K2DB 1NH6A 3WFCL 1S9VA 4GRLC 5E08L 4LDLB 3IFOB 1DVFD 3LSOA 1WC7A 4DKDC 2H32B 2ORBL 3IJSA 4AQOA 3TZVD 3TPKA 3F58L 3O9WD 1JWMB 4NUGL 5GRZA 2IANA 3GMQA 3BDYH 4D9LL 5FOBA 2NY2D 4LU5H 3DX9A 3OL2A 1MCIA 3QXDB 3RVTD 3FT4B 4K7PY 3VXUD 3C9NA 2Z91B 1C5DB 1AQKH 5DRWB 2H9GA 3V52L 3L3OA 5KOMC 1KJ3H 1YQ2A 2J88L 3VDAA 3W82A 5I6XC 3RL1B 4MNQA 4BQ6A 3BD5A 4JANB 3ARZA 3MUGB 5EPMA 1HSBA 5IW1A 3PIQA 4NCDA 4HLZG 1BQHG 4HK0A 2W60B 4P23C 2R4RL 1ADQH 3GSNL 4MX7B 4L4JA 4UQ2A 1JN6B 3QQ3A 3BXNA 3VDCA 2GJZB 5IB5A 3HS0B 3LCYA 1AXTH 2XPGB 4QHMA 4WY7L 5F9AC 4Y1AB 1B3JA 1E28A 5F7WC 2ZNWA 2HVJB 2JLLA 5ESQB 4L5FH 3MRFB 3SEPA 3DX7B 1N3NB 3PHQB 2G60H 2X4TA 2XI9A 4G6FD 1PG7W 4JHWL 5HHXH 3Q6FA 4J8RA 2HLFD 3HI6L 5I1KH 1RURH 4WTXA 3L7FA 5IG7B 2YA2A 4GRWB 1WAAF 2B1HL 1LDSA 4UOJA 1R5IB 1X5LA 3B9KA 3SDDD 3ALPA 5D7JA 1A6UL 4OLYL 3IDJB 3U4EB 4OZHB 1QHOA 1MFBH 1HQRB 5I18H 2HA1A 5FDYA 2Q20A 3OJVC 2OL3B 4HUUB 3FFCA 5EORH 3CU7A 2VTFA 1T20A 3HR5A 4QRPE 3PHSA 3F6IA 2PTUA 2Z8VC 1HKLL 4Z78A 3IJYA 4JAMA 4ZUUB 3QIBD 4ORGA 3NN8A 1BIHA 4TRPH 1X4YA 5FDWA 5CFHA 3OHXA 3I02B 3MLPA 4GXVL 1CQKA 1UJ3B 4XPTL 4D0BA 2ITCB 4WFEE 2F54A 5INDA 5H2BB 4YIQB 5C1MB 5DUMH 5GRYA 4P2QE 1YN7A 1BD2D 4FS0A 1FIGH 4JFEA 5EU7C 4ZFGL 4GLRI 4WWKD 2IG2H 4KKCC 4G6MH 4LLYB 4ODWB 4PJAB 5CIPB 1T66C 3V4PL 3PHOB 2JELH 4TUJB 1I3RB 5F7UA 3MGOB 3KPRB 4QCIA 5GS1A 1TMCB 3BP6B 3T65B 1N8ZA 3O45B 5E5UB 1KG0A 3GJEB 4X0KA 1FL3A 1L0YA 2E27H 2CR6A 1N0LA 4G3YH 3QWRD 1BF2A 1PZ5B 3Q1SL 4Z7WA 1HH6B 1DBJH 4EI5A 3K0WA 2BVQA 1IKNC 1ZT7B 5DJXB 4PV9A 1NBVL 4J3TA 3MFFA 4Y4KA 4O9HL 1MHHA 3HG1A 2NNAB 2OL3L 5A43C 4FABH 5HD8C 3D39B 3FO1A 2G9HA 4BFIA 4XP5L 3HUJF 5L9DH 4GOSA 2NY0C 4LF3A 1QKZH 5IMLA 3W0WA 1OT2A 5DJ0A 5D7IB 15C8L 1RU9H 4JO4H 1ZVSB 3JWDH 2N56A 5EZJB 1N0XH 2Q1EA 2YRPA 4XBEH 4X8JB 1NDGA 3HE6A 1JK8B 4JLRA 3WNPA 1VFMA 2BHUA 4JFZL 4LCUA 4PTUA 3OKNA 1CG9A 1NCNA 3TIEA 5EUKB 4EQ2A 3TT3L 5E8NA 1I8KA 2C4XA 4PLKC 2CO7B 4PY7B 3WUWB 2PR4L 4MA1B 2OX5A 3L3HB 2I25N 4U1IB 3LQAH 1AE6L 1W0YT 4JO2L 4XCNA 4KRMB 1SBSH 3OKDB 1AGEB 1QRND 1G7JB 4QXGL 5BS0E 4AH2A 1Z2KA 1B0GB 2VIRA 2XFXB 1KNOB 3DMMD 4HKXA 4P49A 1O7SA 4Y7MA 1Z0NA 4OLUL 3ARVA 2VAJA 2NZ9D 2FB4L 4EDWH 1I7RB 1BEYL 5F1KC 3H6JA 1V3KA 4XNMB 3THMH 1CLOL 4RNRA 1P7KB 4KK8D 2EEDA 3RNKA 2F5AL 4JM2B 1BVZA 2OZ4H 3S96B 4XBPB 1KLGB 3HRPA 5HHNA 4H5SB 5HPMA 4GW5B 2UYLB 4ODSH 5ITFA 1NEUA 4HX1B 3DHJA 1IAOA 1ZT4B 2GFBA 4Y19A 4UT7H 4LLAA 4DW2H 1UACH 3OMZA 4IRSA 4BQ8A 4CNIA 4JY4B 3V5DA 1BQLL 5HI5C 2CIIA 1WSST 2I27N 3EFDL 2HT3D 4PS4L 3NFPA 4L9LB 3QNYB 1OGAA 1WBXA 1SHMA 4BZ2L 1FVEA 3VFSB 3ARGC 2VDLL 4M7ZB 3GBLA 4W4NA 2CGRL 2E9WA 1Z6JT 4GW1A 4PB9H 2D4FA 2YD8A 3DXAE 4M7KH 1A6AB 4D0CA 2A74A 2AJSH 4WU5B 4MXQC 2BNQB 4HFWA 1MCJA 1ES0A 4PJBF 1U36A 4R4BB 1JZ8A 3GMMA 1TTFA 2AEIT 5B8CB 1DUZA 1U92A 2R29L 1KJVB 4I48A 1C12A 4V1DE 3LOWA 3TNMB 4ZD3H 3RWFB 3VXRA 1T7VA 3QUYC 5EC2B 1YYMH 2RCSH 2YHGA 4BFEA 1A3LL 4AIXA 2CLRA 3LY6A 2RFXB 1U95A 2PW1A 3UTSB 2Z8WC 2CRZA 1CD1A 3LEVH 4NT6B 2IAMA 1BZQK 5C0GB 4S1SL 2EIDA 5DHYA 3RU8H 5IFHL 1U91B 1NMBL 1XF5B 3KPRD 4NKDB 5HHPA 1UWEH 2EDLA 4F3FB 1U8JB 5BRZB 4FZEH 4M7LL 4JKPL 4QT5B 1VKXB 4TSBH 1INDL 3CFDA 2Q8BH 3EYFB 4BM7A 3TLRA 1KSRA 1HH9B 1GGCH 4X98A 1LE5A 3DUHA 2X1WL 5C7XL 3MRHA 2UVFA 3FFDB 3KVQA 2P8LB 2D7OA 3TVMA 1MCLA 3MFGB 1OLLA 2J4WL 1A22B 1IGCL 4F57L 4O2EB 5CSZA 2PKDA 1SYVA 1UG9A 2AXFB 4PY8I 3S3PA 2QR0B 4G9FA 3FO9A 4QHUB 5MEQB 3WHE0 1FNAA 4GUPB 3EZJB 4WV1A 3HZMB 4GBXC 3PP3K 2H6PB 4CMHC 2G2RB 3MRGA 4K94C 2F19L 5KSBE 5HVHC 4UQ3A 4X6CE 1FYTB 2EECA 1FL6A 1OF2B 2C4FU 1JNNH 2PETA 4J6RH 4PJ5D 2IMMA 2Q3AA 4X6DE 1AP2A 3FO0L 1A21A 1IBGH 4P4KD 4QHLB 5FYJL 2FHBA 1NL0L 4LLMB 4JHAH 1X44A 2RAMA 3JUYA 4Y4HC 2V17H 1Q9WA 2GUOB 2VLLA 3DARA 1C16B 4WNQB 4UDTA 5ANMA 3CPLB 4AENB 4Y88A 2FHFA 3EJZD 4PRHA 3UAJC 4HLJA 4OLXL 1BZ9A 2IQ9L 3D2UA 1PLGL 1X7QB 2PW2A 1DE4B 2P42B 4YHOL 4PJ8C 4JFFD 4KRLB 3LVEA 2R39A 4OV6F 1KCSH 5J1AB 4XNYL 1KPVB 2WBJA 4CUCA 4NQTA 1BBJA 2FSEB 3QO1B 1NANI 2HTLC 3BIKA 2H2PD 4KTDH 1LP9F 4G80A 3RY6C 3IAPA 1KCVH 3CZFB 1UCTA 4IIQB 3ZE0F 4HEPG 3ALWA 1KIRB 4NQEB 2EE6A 4MLIA 5IK3B 3MXVH 1BFVH 1CU4H 5BMFL 1B0WA 2N1KA 3UMTA 3OG6B 2O5ZL 4KPHH 1BVLB 3UZQA 4I3RH 3KR3L 4DQOH 4JDTL 4O02H 3TN0A 5C71A 3VRLF 1UKTA 5D70L 2P5WA 4Z7UF 5I8EB 2YPLE 5DJYA 2CKBA 5D7LB 4MJ6B 4OFPA 3NFNB 5DFWH 4IS6B 1MAML 4NM4L 2FD6H 3FT3B 1I3UA 3GDBA 3QDGB 5DTFA 1NC4A 4NP4L 1GH7A 4RISL 1IM3B 4P46C 3KPSB 5HHQA 4XCYB 4Y2DD 1W72L 1CICA 5JO5B 1Q1JH 2Z31A 1FNSH 3B8SA 4ELMA 4C56D 5I66B 4MD4A 2CKNA 3IXAB 3R4DA 3O4LA 3CVHH 1OB1B 3U6RA 3RRQA 3CDFA 5TJWK 2Q86B 1SBBA 1HN1A 5HHMB 5TH2B 3C5ZA 5FYJD 3PWUB 4P5KB 2BFVH 3FOLB 4K8RC 3WS6A 1F90L 1FFOA 2EDHA 2NY1B 2XQYK 1LEIB 3JVGA 1HEZB 3VGEA 1VENA 1V3MA 5CILH 1RZFH 1X5GA 1I9IH 4YC2B 3UYRH 2EIZB 1K4DA 1YEKL 1JGUH 4YFLF 5J9PB 1EAJA 1VHPA 4JQIH 1UQSA 2A6IA 5FO9A 2EDKA 4DKEL 5FEBA 4HJ0D 1FZOB 3P3YA 1YECH 4IMLA 1OCWH 3NPSC 4NPYA 4NZTH 2GK2A 2DQGH 3BGFC 5D2NB 12E8H 5K9JH 4WW1A 2X70B 4GKSB 1SEBA 1X5ZA 5EOQH 5JQ6H 1IAIL 2B7DT 3GI9H 4OCRL 4L3AA 2YD1A 4KKNA 2AJUH 5B3JF 3RWCB 4YGAB 2Y1VA 2YD3A 3MLVL 3QFJD 2ZSVA 1MFCH 5EO1B 1JZ5A 2X4OA 3RWDA 1FYTD 3GMNB 2NZIA 4I3SL 1EPFA 1UZ6F 3U0TB 2NX5E 2PYEE 3CDGA 3MZGB 2A9NL 5DD0L 2OLDA 4YAQB 2L7UA 1KTRL 1BBDL 3BIAX 5LCVH 3GFUA 3TBWB 1YEDA 4P23D 3ZT5A 4QRRB 1G0DA 3GK8H 4K3EL 4PFEA 2ZPKL 3UTQA 3ZSSA 1JCKA 4BFGA 1XF3B 4HWEL 3DVFA 4OUUA 3VXNB 3FONA 4YHYB 4F7PA 3KLHD 1GGIH 3IAQA 1IGIL 1HNGA 4OAWA 2NY6C 2O5YH 1N7MH 1CBVL 3N1FC 2NR6D 3QIUB 3RL2B 1B6DA 4PRPD 1CGSH 5ID1A 1J8HE 5IT2H 3GGWA 1LO5B 2UZXB 2Y6SD 3QHZL 4LCWE 3FL7A 1S9YB 1S9XA 2E7LA 1JPTH 3I75B 4YHMH 2FWOA 4YK4C 3VXTA 4MJ2A 5IVNA 2FBJL 3IXTA 3UTZB 1AKJD 5ISZD 4ZPVB 3BAEL 3RI5K 3FN0H 2D3VA 3UYOD 3L7EB 4NRZB 3DUSB 3DV4B 4PJDA 2VITA 1NEZB 1CFVL 4N0YH 3MQIA 4BKLA 1BPVA 1NGYA 5DEFB 3KLAA 5FKPB 4KDTA 5JUEH 4M1GH 4U05A 3RUGB 1KLUB 2VLKB 4BQBA 3GHBL 4TUKH 2HAZA 4ZS7L 2D31A 4GS7C 5I1AB 5KVEL 4ACPA 4HKJA 1KT2B 3L3DA 4N0FB 2KDGA 2IH3A 5F72S 5GHWH 4RZCA 5HSFA 5T3XE 2YZ1A 4JZOA 4WI8A 3RVWC 2WIIB 1QYGH 1Q0YL 4KKCD 4XNZC 2GITA 3R06A 1T66D 3QDME 3X3GL 4CVXB 4DEPB 4U1LB 4NC1C 5SWQB 1WCBB 4KJQD 1T1XB 4DGIH 5I30H 1FVCA 1R3IH 3N50A 5BQ7B 5KVGH 1JYWA 4I2XA 3RWJA 3BWAB 3DIFA 2X7LB 4FQLH 4X9BA 3L5WA 1ZOXA 1T2XA 4G6AC 2H26B 3LKSA 3E6FB 3UCRA 1T80A 2UZIH 5JHDA 2NY1D 3TBVA 4HQQL 5J4MA 3RAJH 1KB5A 5ENWA 3T3PE 4FTVD 5HD8D 5FKAB 2M1KA 5HYSA 2ITDA 2N7AA 2X9YA 3I6KA 2EIEA 1JPSL 1U9KA 2NY0D 3VXMD 2DQEL 4JPVL 3MYJB 1E4KC 1QHPA 1HILA 2OK0L 3TO2A 3FZUC 2ADFL 3C5SA 4P57A 2F8VA 3FOMB 4CVWA 1MCRA 3EGSB 1G7PB 1CVSC 1Q94B 3W2DL 2DQFA 2AI0L 1GGBL 1TTUA 2L4OA 1D6EA 3UEZA 1QZ1A 4PB0L 3X11A 5MI0B 1CF8L 1S7VA 2ARJQ 4PLKD 32C2A 4EOWH 1PJ9A 5KS9A 1YC8A 4L29B 1Z9LA 4NNYB 1MRCL 3VFOA 1XR9A 3T0EC 3ZDXF 3UTOA 4K3GA 3SOBH 2AK4E 2X89A 2C3GA 4OCNC 4MD5A 1REIA 4OIIH 5C08D 4ZOAA 4IJ3C 4XVJH 5KSAC 3OAZH 2A6JA 3HPLB 2EDBA 1UGNA 5DJZA 1U8NB 1H8NA 3WFBL 3NZ8A 2WV3A 1JHLL 3BIBX 2HJKB 3T0WA 3T0VA 4ZSOB 5HHOE 1CXIA 1XZ0B 2VR4A 1BAFH 5HDQH 3H9SE 1G9MC 4DVRH 4ZTOL 1FNEB 3L3IA 4LPCA 4P9HH 2QQKL 3U0PB 5T1MB 1EGJL 5MEOA 4HCRL 2ENSA 4PJHB 1DUYB 5D1ZB 4KHTL 5C0AD 3ZKSD 4JPWL 1JF1A 1AGCB 5IUSA 5HGDB 3D3VB 4O5LH 1U8OB 2VE6A 2EE9A 2NTFB 5D2LA 3H7BB 4K94L 2CO6B 5JXEA 3QUKA 5HI5D 5CJ8A 3IDNA 5D1XB 2JJWA 3UDWA 5KTEL 5JIIA 1KPUB 4I0PC 5KVMC 3QZWA 3ARGD 4OFKA 2C26A 2YPVH 2VO5A 1RIHL 2PTTB 3DI3B 5J3HD 4NJ9L 3TA3A 2FECL 5L2KB 4Z7WF 1AQDA 1BGXL 1QBLH 2P7TA 3ARBA 2BNRD 4JGJA 1I7ZA 3PDOA 4QF1A 4Y5XC 3IDYC 5GRUL 1OP5H 4DUVA 3DWTA 3WNMA 2XA3A 3QXAA 5CJQH 1NGPL 1JRHI 5SV3A 2M2DA 2W9EH 3IB4A 2AAVA 3MOAL 4J3VA 4DN3H 4K2UH 1YNKL 4Q0XL 2VDOH 4CU6A 1NDMA 3U1SH 1G0XA 1ZLUH 3G08B 3NCYS 2AW2A 4MQ7A 4ZXBA 1A6VL 2OI9C 2OTUA 4NKOA 4PV8A 3QUZB 1WFOA 2ZOKB 3FMGH 4JRXE 1UXSA 3C8DA 2V7NA 5KANG 4Y16B 1I7TB 2LAGB 2YXFA 3VWKC 1ZEAH 1Q9OA 1JBJA 4F9PC 3TYGL 1LEKB 3OR6B 3PWNA 4G8GD 3UJTH 2R56H 1CFSA 2NXZB 3SKJH 3WJLC 4JJ5A 4ZFOL 3GSOB 4NSKA 4PRNB 3QH3A 4WHYH 1CDGA 4MA8H 3IGAA 2LABA 2UUDH 2CLZA 4JDVB 1MI5E 4HT1L 3C6LC 4R97B 5EA0L 2VLRA 4GAGH 4QXTB 3EO9H 2DIJA 5AUMA 4OGZA 1IAKA 1IGFH 1U8HA 4XVUC 1FO0L 5CKGA 3O0RH 5I75C 1NFDA 3IFLL 3P30H 4R4NC 4HPOL 4NOBA 2Y06L 3WLBA 2CPCA 4PJCE 2ERJB 4GBXD 4Z7NF 4JG1H 5GGTL 1VFBA 4XNXH 5T33L 3A0OA 2W07A 2YMXL 3CC5A 5I16B 5F6HJ 2DQTL 4JZJC 1FSKB 3HC4H 4R96A 1HYRC 5DR5L 2V5SA 5IQ9B 1I3GH 3BVNB 4L3ED 5GJTL 4XXCC 4NM8L 4G7YH 4UNTA 5C0CB 1Q38A 4K8RL 4Y4HD 3RGVB 3DGCR 1T2QH 3DBXB 4XXDA 3T0BA 5IW6B 1BFOA 2P47B 4MGXA 3ZLQC 3QI9B 3SDCB 4NNXA 3FQUA 4GAFB 3DX6A 5HDOA 3UAJD 1NAKL 4RMWA 4OZIE 2IBZX 1GZPA 1I85C 2ZUVA 4PJ9D 1MHPH 1I9JL 3IDMB 3S5LB 4WHYG 4GG6A 4G9DA 4PJ8D 2FJFA 2IALB 2VLJB 5EZOH 5HI4C 4HIJB 1MIEL 4LQFH 1GGUA 5IB1B 5ERWA 2D7QA 2HTLD 2IADA 2VABB 3QG6A 2WM0A 4E42A 4N1EA 3BHBB 1EAPA 3C6SA 3F5WA 1UYWH 1KN4L 5FGBA 3BQUB 4OJFL 4RFEA 2I9TB 2GAZA 1ULVA 1PFCA 4Y8DC 3WUZA 4CADA 5EUOE 2ZUQB 3D3VD 5E5MB 5L0QB 3S35L 3TYFA 1J0IA 1HOCA 1SEQL 4XWGH 5CZXC 1Y0LB 3MV8A 1IGYA 1RZJH 1S7TA 3STLA 1DDHA 1H3UA 3I6GB 2IPUG 1WF5A 1IKFH 2BDNH 5GZOD 4OD1L 5GSVB 4PJIE 4XB7A 4OCWH 4S1RL 4W4OA 5K9QI 2DYPB 3QUXC 2VKWA 4W68A 4NQVA 1IAII 1T21A 2QQLL 2DQUH 4J3XA 4AG4L 3V0WL 4U1MA 4UINH 5L2KD 1QA9A 1FN4A 1CFBA 2W0KA 2JIXA 3T4AA 1UH4A 4LVNC 3MRIA 5DRXA 4OKVB 1N4XL 4XPFH 2BJMH 3NA9L 2AERT 3SE8H 4P46D 2OR9L 4M43L 3HE7D 5GGRY 5HI3C 1QSFA 4HHAA 3WN5C 4F2MB 3C87A 3IKCA 3V6FA 1BLNB 3F7PC 2H3NB 1F97A 4ZOEA 4KROC 3C2AH 2ZCHH 4HIEA 4JJHA 4L8SC 4XC3H 5EU6B 1HK6A 2QV2A 3LS4H 2Z4QA 1ZHKA 1A02N 3T77B 2OMBA 5C2BL 5J11C 1M7IA 3CSYB 3RDTC 4EN3C 2EYTB 5IBTH 3QXUA 1KC5H 4G43A 2WQRA 4K8RD 3K2UH 3UTTD 2Y23A 3VG0L 1Q0XH 2BRQA 1A6PA 5H94A 1Z5LA 4WI4A 3VFMB 3WEXB 1F4YH 3F7VA 1HXMB 3MRCA 3EZ8A 1DN0A 1YEEH 3CVIH 4Q2ZB 1CFTB 4FFZL 5D1QC 1RUKL 1W8NA 4RRPA 3K2MC 1KCRL 5DQ9B 4OGXH 1NAMH 1TETL 3DRQA 3BISA 4Q97A 3MLTA 4S11A 1ZLWH 2Y7QB 5IV2A 4DGVL 1T03L 1HIMH 4MSWB 5ETUA 1PBYA 3AY4C 3IFOA 5E70A 5HVFB 1FNGB 5D72L 2HKHL 4M62H 5FGCB 4KZDH 1BD2E 4HH9A 1D9KD 1VFOA 4ZTPL 4GW4B 3G5VB 3VXSB 1EXUB 5GJSH 2ADJB 2AJZA 2AGJL 3O4OB 3QXDA 1DANU 3ZTNL 4R90L 1G6RB 3BPOB 3FAXA 4DCQB 4Z6AT 2Z91A 5HPOA 3LHPL 3WJJC 5GRJL 3ZKNC 2Z92B 4Q9RL 3VCLB 3SJVD 3HNSH 3VW3H 1T1WB 1Z3GL 3QPQC 4LRIA 4MX7A 1JN6A 3HUJB 4ORZC 3WD5L 4JFDD 1TENA 5C0CD 3EDFA 4LEOA 4O58H 4Y1AA 4M1CC 1QR1B 1F00I 4XAKD 3MRFA 4H1LB 1FBIL 1WIUA 3KJ6H 5K9KB 2B5IB 4OF7A 1MJJB 5HBBA 4YH6A 3DVNB 3GUTB 1N5YH 2R0LL 4YDLC 3PWLB 1OT1A 3JWDC 4JFPA 4PRID 2NY6D 1K8DA 4IRZL 2B4CL 1JZ7A 5ABDE 43C9A 1FZJA 3MYZA 3VXQB 1QOKA 4OLWH 3MCKA 2ARJB 1F6FB 5J6HA 4CJ1A 2VDPL 5BV7B 1SVCP 3AREC 4MAYB 5JXAL 3GMPA 5IEKA 2XTJD 1KPRB 5DWUL 5FUZH 1F58L 1HQRA 4IOSD 4CMMB 3BQUD 4ELMF 3X13B 1JZ6A 4HUUA 3LQAC 3B5GA 1FAKT 3IU4L 3RY5A 1DP0A 5C92A 1UWGH 1MUJA 3RI5F 5DS8B 2BOCB 1HHGA 3GMLB 2AK1L 5C6TL 3DROB 2IC2A 3LH2L 2GHWB 4LPUA 1I1YA 5DJ2A 3KPTA 1WVZA 2PXYC 1NFKA 3ULVF 4YDKH 3C60B 2VR5A 4YXLL 2DYPD 4KMTL 2ZKHH 3H9YA 3P0YL 1C7TA 2DS4A 2B0SH 5D96B 1A4KA 5KBNC 3K4ZA 4TOYL 2HFEA 4NC2B 4OGYH 4KVNL 1GOGA 1SMOA 4LCIH 4PJAA 2X40A 3LEYL 4WFHD 4M3KB 5C6WH 3D9AH 4TUJA 1P5VA 3BPCB 5F7EH 1D5ZB 3BP6A 1F8TH 4L4VB 1QFWI 2HJLB 3RVWD 4C57C 3CX5K 4OZGE 3GJEA 4FQXC 1OAXH 3U7YH 5IBLD 1RJZB 1ROWA 5IJKC 3U4BL 5I1DB 3IRPX 2AXHA 1ORSA 4LSPH 5HGGS 5FO8A 1PZ5A 1NFIB 5BW7A 3GRWA 3AM8C 4UUJB 4GRWE 1ZT7A 3AU1A 5CHNB 1NLDH 3UPRB 2F5BH 4BK5A 5BV7L 3MBEB 1NMAH 1PSKH 1FH5H 1N5AA 2LFGA 4PRAB 3STZB 1DL7H 4PJBB 5D7SL 3WNOA 3ULUH 1T83C 3OPZL 4CKVX 1RUMH 4YBLB 3QQ4B 4PRBA 1LO3H 2XV6B 1ACYH 2R2HB 4NQDB 3LD8B 4HIHB 1WBYB 1R0AL 4LNVA 1XR8A 5D7IA 1SJXA 2F9BT 3HMXL 4HUMB 4MZ2A 5FYKL 3SE9L 1BREA 1PGRB 1ZVSA 3QWOB 4AT6A 3CFCL 1RJLA 4HMDA 4X8JA 2FGWL 1OWWA 1V05A 5CAYB 4UT6H 5DJAA 5GISL 3FZUD 1MCWM 5F7DB 2Q8AL 4F7CA 1LK2B 3PL6A 4D9QD 3RPKA 1TVBB 2E5EA 1A14L 3H9ZA 3O2DA 3TO4C 2CDEA 1HHIA 4U1IA 4FQHB 2ESVB 3UBXI 1CK0H 4V1DA 1CXLA 3J7HA 1AGEA 4KV5E 3KPRE 4M61B 5C0RL 2WUCH 3FQNB 2AV1A 1G7JA 2P48B 3QEGL 1B0GA 4KRPB 2OTWB 2XFXA 3QCTH 4U1KA 35C8L 3LRSB 3T0ED 5LQBL 1AHWA 4PJEE 1RVFL 1C7SA 1NCDH 2AEPH 5TE4H 2GYSA 2BZDA 4XNMA 4G42B 1OPGL 4EBQL 3AUVA 5E2VL 4JM2A 1VESA 3WFCH 5F9WC 3S96A 5D93B 3FB6B 3UJJH 2YD6A 3MNZB 3ROLB 3VGAC 3WIFB 4PJDF 3ARFB 4J12A 2C1OB 2UYLA 3G5ZA 5GGUA 3HI5L 3IETA 3MX0A 3WO4B 3F58H 4H20L 1TQCC 1E27B 2NQCA 1R3LB 1OTSD 3E3QC 1FJ1A 1M6OA 4WUKL 4JY4A 1P7QD 3V52H 4I5BB 4ZUTB 2J88H 4E41D 1B0RB 1C08B 4APQA 3MACL 1X9QA 1D5MA 1I8LC 1EDQA 3QNYA 4PJ5E 9CGTA 1NGXB 3M07A 1U8MA 1ED3A 2R4RH 3GSNH 4DAGL 8CGTA 3DSFL 3E8UL 4MAYD 4XT1C 1EX0A 1CGWA 3OXSA 1AO7D 4WUUD 1JWSB 4WY7H 1MH5B 4M3JA 2BNQA 2EC9U 1J1OL 4MJID 5KSBA 4HZLA 3RX8A 3PQYB 3V79C 1RZIB 4FQQA 4R4BA 5F1NB 2A77H 2E9BA 3FB7B 4MS8C 4X6DA 5EO0A 1U2CA 5B8CA 5FYKD 4YNYA 3TJEL 4FQ2L 3BPLB 1MJ8L 3HI6H 4JFFE 3SGEH 2W38A 1CD0A 1XGUB 3SO3B 2VAAA 2COQA 3MLZL 4G7VL 4XCCL 3GHEL 4LCCB 4XRCA 3UTSA 1C5BL 1K4CB 1A6UH 2H32H 4NT6A 4OLYH 2R23A 3BKJH 4AMKH 4EI6B 2DOCA 1RZ7L 1XF5A 2AKRA 4S1QL 3V4VL 2X4SA 4L4VD 2BNUB 2R1XB 1G7MB 4EUPB 4F3FA 4U1NA 5E4IA 2Y36H 4QT5A 1GVIA 5IVXA 3QIWB 4ONFH 2Z9TA 4JN2B 5GGRA 3KJ4B 4LVOB 3U36B 3VWKD 1HXYB 1TVHB 3D5OF 5J6GB 4GXVH 4RGMC 4XPTH 5EZIL 1BVKB 2VJXA 4Z7UB 5KS9F 1ZAGA 3R1GH 1UXWB 4Z0BL 3WIIL 1NUDA 1OOAA 4Y4KC 1EEQA 1TVDA 5TPWL 2GKIA 2CDFB 3OKOA 1CN4A 1AXTL 4AEFA 3MV9A 4L4TD 3ARDB 1G7HA 4K07A 4R2GD 3QCVH 5GS2D 3U9UA 3EOBB 3BUYB 2EIBA 2R4SH 4L5FL 4Q6IC 2H6PA 4L8CA 4R7DB 5EB9A 2G2RA 4DVBB 2G60L 3WS3B 4R4ND 3UPCA 4JO1L 1MSPA 4L3CA 1OF2A 4GRWH 4OFIA 4C56E 1X6NA 1JGVL 1G7QA 5HHXL 1H15B 4DGYL 4KMQA 2YPLA 4ODUB 4OZFB 5I1KL 4U33A 5GRXG 4LLMA 4XWOC 1AFVL 3WFZA 3B6SB 4NN5B 3FT2A 3K80A 5FA4B 4YO0B 5FYJE 3KPPB 3PNWB 1X5HA 2ZCLL 3D85D 2C3XA 4LHQB 2OL3H 1U3HA 3G5XA 4FOMA 1T7XA 5D2LF 3KPLB 2GY7B 4WNQA 4YZFF 3T08A 4I1NB 4XP5H 5C9JB 5I18L 3VGFA 5BRZE 4U6HB 1X7QA 3BE1H 3EOYG 5T1KA 3RZWA 15C8H 1CFNB 2DQDL 3VFVB 2XYCA 3FRPG 1DBAH 1BZ7A 5JW4R 1EFXA 4GG8B 1KGCD 3JTTB 5F3HB 2BHZA 4CN1A 1XF4B 5HI4D 3MC0A 5SWSB 2MFNA 5DUML 2F53D 5CIPH 2YBRB 1NBYB 2APXA 2QJDA 1AE6H 4X7TB 4HMCA 1FIGL 4IIQA 3MV7B 4F9LC 2IG2L 4UU9B 4RX4A 4NRXB 2JK5B 4G6ML 1JGDA 5DURD 4QXGH 3K74B 4NQEA 4QGTA 3LMJH 3CH1A 2J5LB 4IRSC 3QFJE 3RTQA 3G6DL 3O11B 3Q48A 4OLUH 1FYTE 2E27L 5CZXD 1BEYH 4RDQG 5DRZB 4QGYA 3HRZB 2F5AH 5I74B 3VWJA 4LLUA 1A7PH 4N0CC 4P5TC 5E8EB 4Y5VB 1A0QL 2IBBA 3QUXD 2J6EL 4MJ6A 2QADB 3TNNB 3OR7B 5FV2A 1S7QA 4ENEC 5JPNB 1P1ZB 4B7IA 3CIQA 2EH8L 4FABL 3O6MH 1BX2A 2GTZA 2NX5A 4XCYA 4YPJA 5BVJA 1IQWL 4I4WB 3TV3L 5JO5A 4OD2A 1QKZL 2VQ1B 3CAFA 4IRJC 5E8OA 3EFDH 5JORA 1KFAH 3MTRA 4X7DC 5HI3D 1OB1A 1IC5L 4PRPE 3OGCA 4HIXL 1N0XL 4X6BA 3RVXC 2Q86A 3I3BA 4BZ2H 2B1AL 2CMRL 4NUJA 3VG9C 4KROD 2VDLH 1QSED 4M7JL 5EBMA 1U3YA 2CGRH 3CFBB 3FOLA 2FO1A 4PJFE 1VEPA 1ND0B 3TCLB 4PG9B 1HEZA 3FAWA 3PE9A 3AMLA 3VXPB 5ISZE 4EN3D 1TPXC 1VPOH 1OTUC 5FK9B 5E6IB 3QIWD 4OCLC 4XVSL 1UKSA 2E6PA 5J56B 4LCWA 2DQJH 5J9PA 2APVA 1DQTA 3R8BB 5CP7A 4YHIA 3MRRB 4HWBA 2BVYA 3H9HA 1GGTA 4Z77A 3L5XL 5C8JB 1PG7H 1VFAA 3OX8B 2XWBB 5BJTA 5IBUB 4R7NA 4P2RB 4OD3H 3TVMC 2P5ED 1NGWB 4AIOA 5JQHC 3T0XA 5B4MC 3RX7A 3C5JA 1S9VB 2OZ4L 5F7KC 1GZQA 1TCMA 2DL2A 3K81A 3LSOB 1WC7B 1NMBH 1J87A 1HHJB 3B83A 3RIAK 3QDGE 3RWCA 5EU7E 4GG6F 3IJSB 1CLYL 1A4JA 1XCQA 2FH6A 3KPSE 1RIVL 4M7LH 2IANB 5CJXA 5FOBB 1INDH 4NFBA 3DX9B 4UT7L 4ZYKA 1FC1A 3KAAA 1U42A 5E2TL 3MREA 3L5IA 1NUNB 5C7XH 4CAGA 2ATPA 2GEEA 4OGAC 4P2OC 4YAQA 2UWEA 4RWHA 4XP1H 7FABL 3ZE1E 2ICEB 5SWZD 4NBYB 1DQJA 2CRMA 3TBWA 5ACLA 2J4WH 3QDMA 4F57H 1X5KA 2VERN 2A73A 2B8OT 3VMOA 4PBVC 3D0VA 4PB9L 25C8L 4UQ2B 3QQ3B 3BXNB 5I1GL 3TPUB 4JE4B 4M1CD 4HSQA 3JV6B 1MCSA 4FTVE 5HY9A 2AJSL 3O6LL 4QHMB 2C9AA 3VXNA 4F7EA 2AEWA 3KHQA 4LSVL 1EJOL 3DECA 4NFCA 3VD9A 1L0XA 1WT5A 1PAMA 3VXME 2EDTA 4JZNA 2R0WL 3OKKA 4GQ9L 5T1LB 2KUTA 1FORH 2X4TB 1NMCB 3QIUA 3ETBF 5IM7A 3BOVA 1KF9B 3QDJD 3MA7A 5IIEA 3GSRB 4J8RB 1XGTA 1NCAH 4ZD3L 3FO0H 5D2NE 1NL0H 3L7FB 1AJ7L 2J1KA 4NN6B 4QOKD 1WZMA 5E4EC 2VXSH 4KJPD 2OSLA 3DO7B 3B9KB 1XGPA 3ARED 1QLRA 5D7JB 2J2ZA 3LEVL 3QAZB 4OCXL 4KK9C 3W11D 1T6WA 3SDAB 4OLXH 5DA4A 1MVFA 2IQ9H 1PLGH 4M8VA 1OP5K 1T20B 3QUYB 2ZOLB 4TSBL 4YHOH 3VMPA 4C55A 5JIPA 5C08E 4F8TA 2X1XR 4ORGB 4M9OA 5FDWB 1KLUA 3PGFL 2VLKA 3G5YA 3OHXB 4XNYH 1P7HL 2DQIL 1A9BA 2PXYD 2FJGA 4X9HA 4GH7B 2F54B 4N0FA 3S34H 1XIWC 1U6AH 5INDB 4NZUH 2QADD 4XNUL 4GFTB 4D0DA 1C8PA 4P9HC 5C0NC 5H8DA 4JFEB 3N06B 3QJHA 4CVXA 1VERA 4PP2A 4U1LA 1MFEL 4OI8A 3MJ7A 5C0AE 4UNUA 1A8JH 2FDBP 3OXRA 3LKNB 4FQXD 1CICC 5BQ7A 2Z31C 3ECBB 5GS1B 1I1AC 1KG0B 3BWAA 4X0KB 5HHOA 2X7LA 3H9SA 5GRWA 1M71A 2O5ZH 2Q7YA 4JGMA 5C07D 3KR3H 1JNNL 4JDTH 4J6RL 4Z7WB 2V2TA 5JPMA 1NC2A 2LQRA 2ICES 3QUMA 1IBGL 3M8OL 3WS6C 4JHAL 4PV9B 3RNQA 5J13C 1WIOA 2V17L 1ZTXH 3MFFB 4GMSL 5JW4M 1QBMH 1MHHB 3ILPA 3IT8D 1BP3B 2R2BA 5A2KH 5J1SC 5FKAA 4RGND 5IGXH 4NP4H 2BNRE 4RISH 4XCEA 2XKSA 3FO1B 4BFIB 2G9HB 5HVHB 4LHUB 5TFSH 3FQTA 4KWUA 4LF3B 4CL7A 3SCMA 5D5ME 3W0WB 5DJ0B 3DGGA 2WBWB 2RIKA 3RUGE 3O8XC 3MJ9A 3BFOA 2IPUK 1H3GA 1Q94A 1NDGB 3VFUA 3HE6B 4JLRB 4KI5E 4LCUB 4WTZA 3OKNB 1OTTC 1F90H 4WW2F 4J3WA 3TO4D 1SJVA 4DFIA 5SX4H 4L29A 5E8NB 3TF7C 1I8KB 2QHLA 3KHOA 1FG2A 2EO9A 4PYGA 5C6PB 1KCVL 4U7SA 1YEKH 2MMXA 1KJ2A 4KKAD 4F58H 4XCNB 1DEEB 4G8GE 3ZL4L 4X99A 4AH2B 4IMKC 1G7LA 2VIRB 2DKUA 1T7YA 3GIVB 3MXVL 1BFVL 5D4QA 4HKXB 3HPLA 4JKWA 4DKEH 5FFLA 1CU4L 4MNQD 3QFDB 4MQXC 2DM2A 4WFED 5EBWA 1U8NA 2OS7A 3AS0A 3P2TA 5B38G 4JRXA 4ZO9A 2HTKC 4O02L 1MCKA 4RNRB 4P2QD 3RNKB 3V4UH 1FNEA 1A2YA 1IAIH 4OCRH 3U0PA 4G8FA 5T1MA 3QCUL 5HHNB 1SY6A 3OTTA 1DUYA 5D1ZA 5GGQL 5ITFB 1UVQA 1AGCA 4RMVA 5HGDA 1IAOB 2NTFA 3MODH 1MI5A 4RFNC 2GFBB 3H7BA 1TITA 3NCFB 4CNIB 1CQYA 1Q1JL 4GRMB 3QULA 4I3SH 3V5DB 1FQ9C 2A9NH 3TEUA 2VSDA 2H45A 1BBDH 3NFPB 2HT2D 4PTTA 2EDNA 3S8WA 5ITBL 2E7LC 1OGAB 1WBXB 4C83A 3QRFM 5F7LB 2PTTA 3CFKA 4PJCA 3WHE1 4GW1B 3T2NL 4K3EH 2P49B 1CWVA 5FAAA 4D0CB 4TNVK 4C54A 4BYHA 2A74B 4H26A 3FFCD 4XBGA 4M5ZL 2PO6C 4S2SB 4MS8D 1EBPA 4CU7A 3L1OL 3FQXB 2FR4A 4XP4H 1G9NH 3VI4E 2WQ8A 1DUZB 1NKOA 4WO4A 2W1NA 1HHKA 1U92B 5J89A 1C12B 1IGJA 3QHZH 3PXHA 3F8UB 1YECL 3NIGF 1OCWL 3TIDB 3WXVH 2DIAA 4ZAKC 5T5NG 2CLRB 4H25A 3P40A 1U95B 4N1CA 2FBJH 2PW1B 4OZIA 1P53A 3MLXL 1CD1B 3QUZA 5EOQL 2IAMB 4MXVE 1KJMB 2EDEA 5CZKA 5J12C 3V7MA 2DJ4A 2XT1B 4OF3A 5DHYB 3OR6A 2V2XB 3D3VE 4HG4K 5HHPB 4JVPA 3EJYC 3PWPD 1DVFA 5CBAA 3CFDB 1E4XH 1DBKL 1DCLA 3GJFA 4JREC 1LE5B 3TZVA 3BO8A 2NW3B 3H3BC 4JDVA 3WL9B 2O5XL 4EI5D 3GHBH 2MTPA 4ZS7H 1NLBH 2C7UB 3VXUA 1XAUA 4Y4KD 1KBGL 3HG1D 1IC7L 5L2KE 5CSZB 2J3SA 1SYVB 4XB8A 1GRWA 1E6JH 4G9FB 4TQEL 4BH8A 3GK8L 1Q0YH 4MMZC 3FO9B 3X3GH 4N1HB 2RR3A 5CGYC 2VSCA 1MNUL 3RZCB 4YGVB 4WV1B 3NH7H 4URTB 1N7ML 2DLGA 3MRGB 4OBSA 5GGVY 1UM5L 5F21B 4HZAA 5IQ9A 3W5NA 1CGSL 1FL6B 3BVNA 5IT2L 1NCBH 5MERA 4XWOD 4MHHI 4CVUA 1AP2B 4HWZA 3GSXA 3RGVA 4RSVA 3U0WH 1PQZA 4HQQH 3DO3A 1U8LA 4G8EA 4ZDHA 4YHML 3UTTE 5IW6A 2VLLB 1A1OB 1KB9J 1WZLA 5F6HI 1HI6A 3FN0L 2Y07H 2HLAA 2VZSA 1JPSH 4JPVH 4PRHB 3S36H 3SDDA 5IR1A 2X1OA 4FQIL 3D2UB 3S5LA 3JBG7 4ZS6C 5GRVK 2OK0H 3LQZA 2ADFH 4HIJA 5KSBF 3ARYA 2VRAA 3EOTH 5L2JA 4M1GL 1ORQA 1GGBH 1MLBB 4EXKA 4X6DF 3VFNB 1TTGA 2WBJB 2VABA 4TUKL 4PB0H 1L4IA 3QIBA 1CF8H 1N2RA 2E6JA 3BIKB 2CSPA 2I9TA 2VOTA 4KJYA 4NO0B 1QEWA 1MWAA 1MRCH 5GHWL 4M8QB 4G80B 4Y19D 2W91A 1P4LA 1Y0LA 4IRSD 4MLSA 1IL1A 1D7FA 4P3WA 5DMJB 4AEEA 1RJYA 2WWMC 1R3IL 4JFYA 3C09C 5AYQA 3SJVE 3HN3A 3ILQC 5DI8A 2ATKB 2FX8H 4FQLL 4NKIH 3GKWH 3WFBH 3HZKA 3ESVF 3KDMB 4OCSL 5IVXF 1JHLH 3TBYB 5M7QA 4ODXA 3CFEA 4JFDE 4N0CD 4P5TD 4JPKH 5C0CE 2I07A 3GJFK 3TN0B 2GTWA 4OQTA 2VZ1A 4ZTOH 3LN4A 5FM5M 1CDBA 4XAKE 2QQKH 2V5YA 3RAJL 1TQBB 4KJWC 3VH8A 5M95B 1NEZG 2P5WB 4K7PL 4HKBA 4OKVA 4OTXH 4FP8H 4ENED 3KLDA 4HCRH 3S7GA 4KHTH 4JPWH 4ALAL 5DTFB 1NC4B 4K94H 4W6YB 4OSUH 1U3JA 2EH7L 4PRIE 1BLNA 2H3NA 1TJHL 1OSZA 4IRJD 5EU6A 4AEIL 1IT9L 4ELMB 3VXRD 3RX5A 4HUVA 1OW0A 1FVDA 1Y18A 4MD4B 3QEUB 3C2SA 3RVXD 5KTEH 5CEXA 2Q76B 3O4LB 4QXWA 4WFFD 3SKMA 3JXAA 5ADPH 3CSYA 3U6RB 1CT8A 3OJDA 3P0VL 2YD5A 3L95A 4IBLT 2XTJE 1RIHH 3C5ZB 5F88A 5KN5B 3QHTC 2IAMD 4C4KO 4NJ9H 4Y4FC 1Y6MR 3PF2A 1MCPL 3VFMA 2H1PL 1BGXH 1FFOB 1DQDL 3ZYZA 2GK0B 3HAEB 5JW5A 1CFTA 5MEND 5GRUH 3K4AA 2MNUA 1K4DB 1RIUH 4GXUN 3VGHA 1FCGA 2ZUYA 4ODTL 1NGPH 4WJ5A 4LSSH 5DC9B 1WQVT 1KYOK 2QEJA 2P45B 4JG0L 1UQSB 2DBLL 4XVJL 3MOAH 4Q9BA 1F3RB 1YNKH 4Q0XH 3TVMD 1QRNA 4NPYB 4NO2A 4GW4A 3G5VA 1I7UB 3BP5A 2KBGA 3DMMA 5SX5H 5B4MD 4F8QA 3O9WC 2CKBL 2PUQT 4WFHE 3FRPA 1FFNA 4DVRL 1G6RA 4UTBH 2OP4H 1CGYA 2MSPA 1Z0MA 4HS6A 4JM4L 2DI9A 4KXZH 4HK3J 1JYNA 3TYGH 3RIAF 3S37L 2X4NA 3O6FB 4JRYA 4NC1E 4Q9QL 2ZSVB 3SKOA 4NCC2 2X4OB 3RWDB 1KENH 1V5JA 1X4ZA 5DD6A 1H3TA 3HUJA 2GJ6B 2X5PA 4HT1H 3CDGB 1RPQA 5EA0H 3UJIL 4C59B 3D69A 3ULUC 4EDXB 4NQUA 1QR1A 4JB9L 2FEEL 5E8DL 3L5JA 4H1LA 1HKFA 1YEDB 3FJTA 3UBXG 3BW9B 3IFLH 4NOFA 5FYJU 3DVNA 2CR3A 2YWZA 5C0FA 1QBLL 3WNLA 3L3JA 1AGDB 4FN0A 4OUUB 5T33H 2HLFC 4JDZA 2EYRA 3BEVA 3ZYOA 3VXQA 3EDEA 4OAWB 2YMXH 3IS0X 5I71B 5JLZA 1LE9A 4UNVA 4I0PB 2DQTH 4M93C 3TFKC 4TVPL 4QY8B 2W9EL 5DR5H 4NBZB 2AQ3A 4LLQA 3GGWB 4D9QE 4NM8H 1KPRA 3CCHB 3SGKA 4K8RH 1S7XB 4NN7C 2XXMB 4CMMA 2G5BB 1JE6A 1S9XB 3OQ3B 1JF5A 1IGML 1OL0A 2OR7A 3N1PC 2FWOB 4ZG1A 3VXTB 1I1FB 3LDBB 3IXTB 4YR6B 1M7DA 3E2HB 1LILA 1FGVL 5GIRA 2V5MA 3DROA 4I3GA 1KACB 3T0EE 1YUHB 2A6KB 1UA6L 3UJTL 4PJDB 1KIPA 1F2QA 1I9JH 3HPJA 4BKLB 1NGYB 3WO3B 4KK6C 4HXBH 4POYA 1NCCL 3SDYL 4MA8L 3QEQB 3KXFA 4X4MA 1L7IL 2QL1A 5D6DA 3GMOB 5HHVH 1MY5A 4PJEA 1XIWD 2D31B 4FQJL 3BD3A 1ZV5A 2IBZY 3SY0A 1P9MC 2YKLH 3L3DB 3OJ2C 4JKLA 4OJFH 1DLHB 2P5WD 3ZHLA 4N90D 4RFOL 2HJLA 5D6CA 3RJDA 3ES6B 5F8QC 1RJZA 4RZCB 5C0ND 4JZOB 3O0RL 5KJRL 2I24N 3S35H 1WFTA 4DKFH 4E41E 1CICD 2BVEA 2Z31D 4OT1L 1I1AD 2P8PA 1FVCB 3C6LB 4XNXL 3UPRA 4OD1H 1IC4L 4WHCA 4LHJB 4HJJL 3RWJB 2PYED 4S1RH 2LVEA 4IHOA 1I1CA 3QQ4A 2ICWJ 4ZMAT 4AG4H 4O2FA 2DLEA 3V0WH 1OP3H 5I75B 3LKSB 1EO5A 3NCEB 4WVRA 4MJIE 4G7YL 4U7KA 1MIMH 1WBYA 3TBVB 3LKRA 1TZIA 4XMKL 1YMMD 2HT4C 2OJZH 2HFTA 4JCMA 2UWEF 1KB5B 4Z9KB 5ENWB 2D9QB 2NMSA 4XPAL 5FYKE 2CDGA 2ITDB 1L0QA 1UEMA 3KYKL 1HILB 5F7DA 1J8HD 3O8XD 1ZVYA 4TVPD 1SMAA 4P57B 5EZOL 1BMGA 3EAKA 5ICYB 1YZZA 5C2BH 1T1YB 4HUXB 4QKXB 5I17B 2DQFB 2R9HD 1OTTD 1D6EB 3VG0H 1WGOA 2QTEA 4M61A 5D8JL 4B50A 4ETYA 4JFFA 2XKNB 3FQNA 4L4VE 5DMIL 3DVIA 3X11B 3N85H 2OTWA 32C2B 1LDPH 3BUTA 3T3PF 3TBTA 5AAWA 5KS9B 1E6OL 3EOAA 2ADGA 4NBXB 3K3QA 3VFOB 1YQVL 2DTSA 2HVKA 2IFFL 4BSVA 2NZ9C 4MD5B 4NZDA 1TETH 2DICA 3MMEB 5HGHA 2JJVA 4DGVH 1T03H 4MQXD 3MNZA 3ROLA 2BDNL 2A6JB 4LGRB 5D72H 2HKHH 5AYUL 4MCZB 2NY7H 5DJZB 2HTKD 3QPXH 3NZ8B 4ZTPH 2AP2A 5E94A 1E27A 1QBAA 2VDML 1R3LA 2AGJH 4L4TE 3ZTNH 1JZ3A 4R90H 5EO9A 4PLJC 5DMYA 4BUGA 5HDBF 4I5BA 4ZUTA 3ARWA 2R8SH 1ITBB 1D6VL 5GRJH 3T3ME 1RZ8A 4FXKB 3N1MC 4Q9RH 1JF1B 3IYLW 1T3FB 4BK4A 2VE6B 3QB7C 4CW1A 4YBQD 5D2LB 2BXYA 3LEXA 4Q74A 1ZHNA 3C2AL 2ZCHL 3IDNB 2VISB 3B2VH 3LS4L 2O61B 1YJDH 3QG7L 1JWSA 3MRKA 5CUSL 5IBTL 4GT7A 4C56A 2MHAB 4HH8A 3EFFA 1Q0XL 1A7NL 3TA3B 2R0LH 1AQDB 2P7TB 2ZSWA 3ARBB 4IOFC 4TNVF 2EXWD 2XN9B 1I7ZB 1F42A 4QF1B 5F89A 2BXZA 2PO6D 1UJ3C 3CVIL 3O3AA 4IRZH 2B4CH 3CH8A 1KGCE 5HYJB 4LSRH 4XPHL 1MHEB 5IHUH 1E4WL 2WWKO 3WHXB 4LCCA 3RDTB 1K4CA 2VDPH 4TULH 2OYPA 1MF2H 4M6OL 5C0BA 1JI2A 2ENYA 4ZAKD 2F53E 1R5VA 4M62L 1XFPA 4ZUWA 3OAUL 1G6RH 2BNUA 2R1XA 1X5IA 1FL5A 3IU4H 3PWJA 4ZXBB 4MQ7B 1SYSA 4NKOB 4PV8B 2JJTC 3GIZH 5C6TH 2D0FA 4OBRA 1TVHA 2AK4D 5J6GA 3LH2H 1Q9OB 3O3EA 3PWNB 4RBPK 4GRLA 3X12B 1Z9SA 3QDHA 4POUB 4M02A 1K3ZA 4UV4L 4NSKB 4YXLH 4AZ8A 5B39A 3GSUA 1N26A 2Z0BA 1GXEA 4KMTH 3HNSL 2DQHL 3P0YH 3QH3B 3EHBC 5DJCA 2BRRH 3IGAB 5ELIA 4TOYH 3CUPA 4OQ1A 2CDFA 3FKUS 3I85A 4KVNH 2HRLA 5JHDD 4LSQL 1S78C 2QSCL 3LKQB 4D2NA 1I75A 2VLRB 1F4HA 3G6JE 5TE7L 3ZSTA 2CIKA 4UOW0 1IAKB 3BUYA 3ZYJA 1U8HB 4XPBL 4R7DA 3RPIB 3WKNA 2G75A 1ZK9A 3I3DA 1S7RA 3U4BH 4RMSA 3AB0B 5B38A 5EIQA 1BECA 3KYOA 5DQDH 1LP9E 4ODUA 4M7LT 1KUMA 3S37X 5BV7H 2Z35A 2W0FA 2A6DA 3LKOA 4NJAH 4OLWL 4WFGE 1QSEE 3CC5B 3PNWA 4NQCB 2VL4A 5D7SH 3Q5TA 4XCFL 4AIZA 4LIQL 3KPLA 2BY2A 3MCLL 1W72A 3FCTA 2CUIA 5FUZL 4LPVA 2ADIA 3AS3A 3P4NA 4YDLB 5HYEA 1YEJH 4N0UB 5HYIA 2FCBA 1JMXA 3EJZC 3HMXH 3SE9H 2X42A 2XWTA 2DMCA 5C09B 1FZMB 3CFCH 3QR2A 4XHJC 3FQUB 2X89D 3VD5A 3DX6B 2FGWH 4XTRC 4PJCF 4Z7UE 5GISH 2DKMA 5ISZA 2C1PB 2NLJB 4G9DB 4HFUH 4YDKL 2FJFB 5SWSA 2J8UE 1G7IA 2WZPD 1RQ5A 2ZKHL 2VZ3A 1NBYA 2AJXL 2VN4A 3NZHL 4X7TA 2VDQL 4ONGH 2V5TA 3MV7A 4UU9A 4OGYL 3QG6B 3ZT7A 3S4SG 4E42B 3PJSA 4LCIL 5C0RH 3NVQA 3V0AC 2XZQL 35C8H 2GAZB 1F8TL 3O11A 1RVFH 3U7YL 4CADB 2BVOA 1AGBA 3PG2A 4X4YA 3GBNL 4OZIF 4LSPL 4L9LC 1HOCB 4K71C 1OPGH 3RWGB 3HRZA 2WWMD 4FQPA 5E2VH 3TGXA 4M7ZC 3BSZL 1S7TB 5IHLB 3STLB 5E8EA 1DDHB 3ILQD 4PRDB 5SWZE 1NLDL 1R6VA 2QSTA 3TJHC 2E8YA 4KVCL 1FH5L 5DHVA 3T0DA 3ULUL 3HI5H 3KPOA 1EV2E 5JPNA 4H20H 4NQVB 3RA7L 1T21B 4JO3L 5A16A 4HDIB 1YMHA 4U1MB 3UO1L 1I1RA 3TA3D 4WUKH 5KANI 1YYLL 4KJWD 5EIIA 1FFQA 4I4WA 4PJ7E 1BM3L 4Y2DC 3VFWB 4O4YL 2JIXB 3T4AB 2EE2A 5EUOF 1IKNA 1U3ZA 3MACH 1MY7A 1PKQE 1QVOA 5I2IB 3BMWA 3QDJE 1KXVC 5SV4A 4QNPF 5GS3A 5E95B 4MJ4A 1RAMA 2D03H 4HHAB 4UT6L 1DQLL 1NPUA 4FTVA 1ZLVH 1JZ2A 3IKCB 3V6FB 3RWHB 4DAGH 1TCRB 3E8UH 2FEEI 4HIEB 4QOKE 1CZ8H 1ZHKB 2YN3A 1QD0A 3VXPA 3BZEA 4ZXBD 5E2WL 4D94A 4G43B 4Y4FD 1UZ6E 1QFPA 2IF7A 4OF8A 4RAVA 1DQQB 3C8HA 4DK6A 3F7VB 2P24A 3RQ3A 5CP3A 4MXWL 1DN0B 3UYPA 1MCDA 5C8JA 3RKPA 3OX8A 1MFAL 3PV6B 5TE4L 2VXUH 4XCCH 3GHEH 4TTGA 1Q9KB 3DRQB 1T4KA 1CDUA 1XEDA 3MLTB 3DSNA 5L6YH 5IV2B 5TQ0H 2E7HA 2MQCA 2DTML 3UJJL 5ETUB 4ERSL 4PGEA 1RZ7H 4M00A 4S1QH 1HHJA 4QRPB 3V4VH 2EYSB 4HH9B 4KQ4L 1EMTH 1NUGA 3EYOB 1UH3A 5F71A 1EEYB 1HDMB 3B5HA 2AJZB 4UIKL 5F7HA 5ALCH 5IVOA 2J12B 5FM5O 5LG1A 2IGFH 1YEIL 4HGWA 5EZIH 2ZJSL 3HKFA 3ME0A 4QEGA 3HC3L 3Q6GH 4Z0BH 5CJ5A 4XP9H 2ICEA 5C07E 3KPNA 3WIIH 1YPZE 4M6NH 1T22A 3RY4A 2BCKA 5TPWH 4ZNEE 3S97C 1Q72L 1BF8A 3TPUA 3ULUD 2LVCA 3JV6A 3SDXA 4LEOB 5EBLA 1B88A 1I8IA 5FHAL 3LN9A 4X80H 4RGNE 1B2WH 4WEBH 5ESAB 3KLHC 1Q8MA 3B9EA 4HC1A 5T1LA 2A77L 4DWHA 4K7FA 4JO1H 2FGZA 3ARGA 5T1DH 2NR6C 3GSRA 1JGVH 4WW2B 4DGYH 2Q87A 2K3TA 2APWA 4WCYL 2EO1A 5KOVC 4JFPB 1K8DB 5TF1L 2Y6SC 1QLFA 43C9B 1FZJB 1AFVH 3MLWL 5A2JH 4WEMB 3TFKD 1WCQA 2BNRA 3MCKB 4PJXE 2ZCLH 3DO7A 3MR9A 1JNLL 5J6HB 4KAQH 4ONOA 4HUNB 1JTOA 5F96L 4EUPH 3BKJL 4NZRL 3SKUD 4AMKL 3GMPB 5IEKB 3IDIA 1WTGT 3SDAA 5CLTA 2D7PA 3U9PH 1EHLL 3QUYA 2ZOLA 2Y36L 2DQDH 3JV4A 5DO2C 4ONFL 3N0PB 1OAZL 3ZKXB 1MUJB 3JUZA 3O2WL 4N0RA 1HHGB 3M1BA 3MV8D 4MNQE 3G9VA 1I1YB 5DJ2B 1CS6A 1OARL 5IOPA 3QRGL 5E24E 2FEDC 3VD4A 3R1GL 4KK6D 3WIHA 1XGYL 4Q6YA 4LQ1A 5GQBA 4G8GA 5E1HB 3FQWA 1IC1A 1MCNA 5T3ZL 2K1MA 1A4KB 2FL5A 5DD1L 1VGEL 3I6LD 4HWUA 2HKFH 5EC1B 2HFEB 4HXAH 4LPTA 3LKNA 3QCVL 2XY1A 3E3QE 3ECBA 4P48A 4KJQC 2R4SL 3G6DH 1K3IA 4ZPTA 1S8DA 4MNGE 1A6WH 4OZFH 2BVPA 4NO3B 4PREA 2RJMA 3GZKA 1QSFD 4S0SD 5EWIL 1CE1L 1PY9A 1ORSB 3WLWC 5FO8B 4QRQB 1ITCA 3J8F7 3AU1B 1A0QH 3E0GA 1EGJA 3TM6A 2NY1C 4GKZB 1H9VA 2J6EH 3KS0H 1N5AB 4I13B 3AC0A 2VDRL 2ZG2A 4MA3A 4GBXA 4PRBB 2EH8H 1DFBH 3NAAL 2XACC 5DEZA 1EJ6A 5I1CL 2YS4A 2MWCA 3FFCE 4LHUA 1IQWH 2BY1A 2HT4D 4LAJH 2N4IA 3TV3H 1GOFA 3B3IA 7CGTA 3BE1L 1XR8B 4L3EA 4AT6B 4BQ9A 5IESL 1DBAL 1IC5H 3NOIA 4Y4HA 4HIXH 1QG3A 3I9GL 1G9NC 1RJLB 3QXTA 1J0YA 2B1AH 2CMRH 5D2NC 3DXAB 4M7JH 1RJCA 2AXGA 1ZS8A 5DJAB 4K9EH 3UBXA 4RDQF 4F7CB 3PL6B 5DFTA 3VA6A 4X4ZA 4JFEE 2CDEB 2OXGA 1HHIB 4XVSH 4JKMA 1YEFL 1PKOA 1DEEA 1QRKA 4IDLA 4V1DB 2AV1B 5JIKA 3LMJL 4OZFG 3GIVA 4U1KB 3PWPE 1IJ9A 3L5XH 1AHWB 2XZAL 3QFDA 2A83A 3GRWL 4XP6L 1JYVA 1JPST 2ED7A 2XY2A 4PGBB 1FGNH 5AEAA 3RY6A 3KYMB 3MROA 2C3WA 2V2WA 4JPIA 5C0JA 1A7PL 4MHHG 1FHGA 4V2BA 3RWIA 4ZOCA 1IFHH 4ZFFB 3VGDA 1NBZA 3HG1E 2I26N 4Y1AD 5T3ZD 1GPOH 2YN5A 2YRLA 2XNAA 4NNPH 1JHKL 4ZFOA 3ELAT 3G5ZB 5GGUB 3IETB 1CLYH 3P9MA 4XPGL 4YHYC 1RIVH 4KV5F 4U3XA 3O6ML 4PLJD 4XI5D 5F7NC 1FJ1B 1M6OB 5E2TH 2VLMD 2FRGP 4GRMA 3V6ZB 4JFHD 2VWEC 4PJEF 5CSBA 2X4UA 4JQXC 3MRBA 4QTIL 7FABH 4APQB 2R2CA 1KFAL 4GAYA 4WI2A 1FO0A 1D5MB 2NY4B 2X9XA 2E9IA 2AEQH 1UM4H 3O2DL 1U8MB 1ED3B 2DJUA 5I1LA 3WNNA 5LGJA 25C8H 4P46A 4Z76A 4MWFB 4PJGE 5I1GH 3OXSB 5J3HC 3O6LH 4LSVH 1VPOL 4YBHA 1FV1A 1QP1A 5KSBB 1EJOH 4HZLB 4AJ0A 5LGKA 4S2SA 1UWXH 4FQQB 2R0WH 3FQXA 4GQ9H 4X6DB 2DQJL 4IOFD 5EO0B 2KQMA 4YNYB 4DK3A 5I0ZA 5DF0A 4LSTH 3TIDA 1F3DH 1PG7L 3BDXA 3SE3C 2LU4A 1AJ7H 2A9ML 2N7BA 2VAAB 4KI5C 1JGEA 3ET9F 4OD3L 4TSAL 3BP7A 4XRCB 1BJ1H 1CFQB 1IZJA 4JFXB 2R23B 1KJMA 4OCXH 3P9WB 4YHPB 3MCG1 3O2VL 4AM0A 4DEPC 2AKRB 2V2XA 2L0DA 2X4SB 1J0HA 2EXYC 4ODBD 1ZGLP 4U1NB 4U1GB 4Y19E 4Z8FL 5I1HL 3ULSB 5EOTA 5IVXB 1D5IH 3QP3A 5GGRB 1S7WA 2SEBA 2NW3A 3PGFH 3BRDA 3WL9A 4W70A 2DQIH 1CL7H 4HULB 3ZTJH 4HEME 4NDMA 5TDNA 1F5WA 4XP1L 2NY3B 1ZGLB 2C7UA 3MNVA 5F1IB 3EHBD 4XNUH 2WP3O 4AYFA 1A6ZB 5JTWA 5SX5K 2GW5A 1S78D 2ZCKH 3D39D 5DQJB 2WINA 3OKOB 3SJVA 4NWUL 1MFEH 4LAQL 3MV9B 2K9UA 1D5XB 1G7HB 4N68A 3U9UB 1FC2D 2DF3A 4P2OB 4YGVA 3RZCA 2HN7B 1KTDA 4JFDA 4L8CB 1RK0A 1CXKA 1N64L 1S9KC 1FORL 4LP4A 4AL8L 4L3CB 3WFDH 4NKMA 2R0KH 3VXRE 1RZGA 5FYKU 2DI8A 1G7QB 3H0TB 2APFA 1K5NB 2YPLB 4WFFE 1NCAL 5E9DA 3M8OH 4NZJA 5MI0C 1UENA 3KLSA 3FT2B 5IEHB 3ROOA 2VXSL 4GMSH 1NQBA 4KKLC 1A1OA 3CLFL 4P5MB 4PRIA 5IVZA 1U3HB 2H8PB 3G5XB 4QRTA 5CBEA 1QSZA 5MENE 5INCA 4WU7A 1PZUB 4BSWA 1CDHA 2G5RA 2IMNA 3BT2L 5T1KB 1MEXL 4PJ9C 4XHJD 3BH8A 2NCMA 1BZ7B 1EFXB 4DOHE 4XTRD 5E4EB 1KULA 5I8KL 3K8MA 4QHKJ 5HYQA 3CFIC 1MLBA 4W81A 3VFNA 4MA7H 3NABH 5C0IB 1J7VR 4JM2D 3EDDA 2PYFB 3EYVB 4N8CH 1A7BA 1FLTX 3S34L 3DX8A 4CN6A 5CJOH 1U6AL 4NZUL 4NO0A 5IQ7H 4ETQA 4M8QA 5F70A 1X4XA 3INUL 1CR9H 1NSNL 5DSCA 1MCQA 3HR6A 1A6TA 2NTSP 4JRWA 3ZL4H 4X6FA 1RK1B 1JGDB 2R1YB 4F15B 1J9CT 2MPAL 3AAZB 3CH1B 1XMWA 5FUCC 3RTQB 5EN2A 5D1XC 5M94B 5GZOC 2ATKA 1QNZH 3U48A 5LXGH 3KDMA 1OM3H 3TBYA 3GO1L 2X4RA 3I3EA 1TZHB 4JFQA 3VWJB 4XC1L 4LLUB 3TJHD 1MJ7L 1XGRA 2QHRH 1F6AA 4CBPA 1CI5A 2BNQD 3BGAA 2JCCA 3QCUH 1R3KA 1ZTXL 5GGQH 1QBML 1S7QB 4OUOA 4I0KA 1AGFA 3KYNA 5ANME 5IGXL 1BX2B 2X10A 2GTZB 3MRLA 2NX5B 4KKBD 1IVLA 3HE7C 3QNZB 5TFSL 5BVJB 4L8DB 4OD2B 2UY7A 1OQXA 3O6KL 5J1TC 3FRUB 3F62A 3MOQA 3QEUA 5E8OB 4OIAA 3L3GB 2Q76A 3PGCB 4WI6A 3VXOA 3BKCH 5I1EL 5JORB 2EKJA 3OGCB 1R24A 4X6BB 4YHLL 5ITBH 3UTSD 4NUJB 5KN5A 1IMHC 5EBMB 1OP3K 4JQVC 3T2NH 1INQB 2GK0A 3HAEA 4Y16C 2F8XC 1E4KA 3H2WA 4QWWD 4FHBD 4J4PC 5BRZD 4M5ZH 2NXZC 3MRQA 1JPGA 4F58L 3L1OH 4A6YA 3A6BL 4YUEL 4LCWB 1XF1A 3F65A 3SGEI 5CP7B 4EQ3A 4YHIB 1DN2A 3H9HB 1RSFA 3TCXA 4Z77B 4R97C 1QFWM 3P73B 5DJ6A 5JNYA 1VFAB 2IPTL 5BJTB 2AJ3A 1I7UA 4R7NB 1P84J 4MB5A 3T0EA 1D9KC 3GM8A 1CE6A 4L1HA 4PJFF 3MLXH 3PP3H 4PGJA 3V4UL 3C5JB 1LNUA 2P5WE 4O2CB 1GZQB 4N90E 5I1JL 1S9WA 3A67H 5EOCL 4LSUH 3T2OA 5HGBB 3SBWA 5KSAA 2ERJC 1A4JB 1XCQB 3O6FA 1DBML 2W65A 4ELKB 5A1AA 1JPFB 3MODL 1DBKH 1AD9B 4ZYKB 3DRTA 5DVLA 1FSKC 3QYCA 3MREB 1T1ZA 2O5XH 2GJ6A 1SJHA 2RHEA 1KOAA 2ATPB 2BSRB 2UWEB 4N8VA 3S4SA 4EDXA 2YD2A 2NY5H 1BOYA 1DQJB 1H5BB 1KBGH 3EYUL 1IC7H 3QDMB 2A73B 5K59E 3BW9A 3QI9C 4TQEH 1NJ9A 3D0VB 5B22A 3SDCC 3VRIB 1YMME 4HK3N 1MLCA 2HYMA 2KKQA 1AGDA 5HY9B 1UZ8A 4MB4A 4F7EB 5T1KD 1GC1C 1MNUH 5TDOA 4HWBL 5F6IC 4WUUA 1AO7A 4R0LC 3ZHDA 4G5ZL 4I0PA 4JZNB 3OKKB 4QY8A 4XP4L 5LWYH 1UM5H 1G9NL 1VSCA 5IM7B 3MA7B 4TVPE 5EFIA 1V8HA 5IIEB 2DWDA 4EXPX 1XGTB 3IF1A 3CCHA 4U0QB 3HCVB 1S7XA 4WENB 4D3CL 4PP1D 2G5BA 1P4BH 3WXVL 2XTJC 4LFHD 3BQUC 4Y5XA 2OSLB 1MRDH 4YDJA 1I1FA 5ALBL 4YR6A 4NQSA 1XGPB 1QLRB 2MOVA 2ZUQC 4RX4D 5IFAH 1YUHA 1ZHBB 2A6KA 4NQED 4FQIH 1UM6H 5DUPH 5DO2D 1T5WA 5GZNC 1GOHA 1E4XL 4ZO8A 4O00A 3QEQA 2GJJA 3HNVH 5ID0A 3G5YB 3P4OB 1ZSDA 4PG2A 1A9BB 3VWJD 3FN3A 2FEDD 3CSBA 3GMOA 3NBNA 1INEL 1NLBL 2FJGB 1UADC 3VWKA 1PG7X 1DLHA 3MOBL 1EUTA 1V7NH 5D7LD 4UI2A 3ES6A 4OLEA 3WJLA 5JDJA 3BP4A 4HAFA 3QDGD 4QYOA 3HLAA 4D0DB 1E6JL 4DN4L 1MOEA 5IBLC 3KPSD 1KCLA 3IVKB 1IQDA 3QJHB 4PP2B 4JREB 3H7LA 3MJ7B 1P84K 3OXRB 3C6LA 3NH7L 3OGOE 4OZ4A 3ARQA 1CLZL 5HHOB 4X5WB 4CDHA 5KW9L 3H9SB 3WLWD 1M71B 2AQ2A 4OCSH 1SQ2N 1T04A 2JJSC 3PGDA 5HHMD 2Q7YB 3WFHA 2VZUA 3BKYL 3V5KA 3N1GC 1NCBL 4NFDA 2V2TB 1YJDC 5JPMB 1NC2B 1O5DT 1EERB 3QUMB 5BOPA 1AIFB 1IM9B 3U0WL 3RNQB 5TGBA 5C9KA 2VDKH 4K7PH 4Z5RA 4KU1A 1RHFA 3G6AA 3ILPB 2R2BB 1D3CA 4H0GA 5DK3A 4ALAH 2Y07L 5DK0B 2ICWI 2CJUL 4JZJA 5DEGA 4XCEB 2EH7H 1ETZB 1TJHH 1BQHA 3W9DA 3S36L 3FQTB 2B4CC 3SDXF 2XG4A 4XXCA 1J88A 4Z0XB 3ZT6A 4AEIH 1IT9H 3SCMB 3DGGB 5ICYA 1F4WH 3FO2A 3EOTL 2FIRT 1T1YA 4HUXA 1ZT1A 2VZTA 3P0VH 5I17A 4ODHL 3CSPA 3VFUB 4HPYL 5CEZL 2APBA 5AAMA 4Z7VA 2XKNA 2EEAA 1MCPH 3O4OC 2H1PH 3K1DA 1DQDH 5F9JA 3BPOC 2JJUA 3GMRB 2QSQA 2X44D 3U2SB 1FG2B 3RHWK 2I60L 5FXCH 1V7ML 1NAMB 1KJ2B 1T89C 4ODTH 3GKZA 4LLDA 3MMEA 4G6KH 5DJDB 4X99B 2F53A 5DD3L 2X05A 2XQYG 4JG0H 4I2XE 1G7LB 2DBLH 4K3HA 2NXYB 4BFBD 1IGTA 3PABB 3AS2A 5DVKA 4E0RA 2EE3A 4MCZA 2FX8L 4NKIL 3GKWL 5EBWB 4JRXB 1X5JA 1L9NA 1IRAY 5FOJA 5JHDE 4JPKL 3ARXA 4QRRD 2CKBH 3N9GL 1GAFL 3EDKA 2B5IC 1A2YB 1OTSC 4JM4H 4G8FB 2ZP0T 4OTXL 4FP8L 1W0VA 4KTYA 3D18A 3S37H 4FXKA 5TDPA 1UVQB 3SE4C 4JFOA 1NGQL 4Q9QH 1T3FA 1YEGL 1MI5B 2XRAL 3QUXA 3QIUD 1ADQA 4OSUL 1MJUL 3K8KA 4OFVA 3G6JA 5FHBH 5FIEA 3QULB 5BV7C 2VISA 3S6CA 3REWA 3W5MA 2O61A 1JHTA 4FXGA 4MAYC 3UJIH 1VCAA 4WTWA 4JB9H 5E8DH 5ADPL 1VADB 4PTTB 4Z7QE 4C83B 5KZCB 2MHAA 3ULVH 5HVGB 1G0YR 3CFKB 3NIDE 4PJCB 5KS9E 2K7QA 3KPQA 3WN5A 4JHZA 2WBKA 3HFML 1JFQH 2XN9A 3X3FH 4H0IA 4H26B 3V7AE 4L8SA 4ZQKA 2CUMA 1R5WA 5I1IH 4XBGB 3OKMA 4R6UA 5HYJA 1MHEA 1RIUL 3C60C 3H42L 1KN2L 3WHXA 5JW4N 4RIRB 4TVPH 1OAKL 3L3KB 3RDTA 3MUJA 4H8WL 4EN3A 2FR4B 4LSSL 2VLKD 3JWOH 3U30B 5D96C 3F7YB 4WO4B 1RZKC 1HHKB 4F7MA 1DQMH 1IGJB 4KI5D 1B90A 4GSDL 1IGMH 4H25B 5D1QA 2YWYA 5CEZD 1JGLH 3RWEA 4OZIB 1SY6L 1FGVH 4UTBL 4YHNB 2OP4L 4YDVB 5JOPD 2BOBA 2EXYD 1UA6H 3O3DA 1EO7A 2J8UA 2P5EA 4B7LA 3AY4A 3X12A 2YUVA 1PYWA 3GM0A 3MBEC 1DVFB 5CBAB 1NCCH 3SDYH 5H37H 3GJFB 1KENL 5CEYA 4E5XA 3TZVB 3BO8B 4YBLC 3O9WB 1L7IH 1FZKA 3MLRL 3P4MB 1TJIL 2NY2B 3LKQA 4KFZC 4FQJH 4HGMA 5EUOB 1QQDA 5I0DA 3VXUB 3P9LA 3M17A 3WJJA 2ZUWA 4RFOH 4R2GC 3RPIA 3ARPA 4LLVA 5H35A 4MXVF 5KJRH 2R69L 4WEUD 4BH8B 1J5OL 5SWZA 5FCSH 3KS0J 3HNTL 4PJIB 3I84A 3QO0B 4OT1H 3GNMH 1IC4H 3OKEB 4HJJH 1BQSA 4NQCA 3LQMA 1MQKH 1AI1L 2X4PA 1KIQB 2DKSA 2OR8A 5CWSA 5F7MC 1TJGL 2GSGB 4PJ7A 4J1UA 2GI7A 2Z8RA 4K55A 3S3JA 5MERB 4LARL 3IFNH 1J05A 4LIQE 4HWZB 3GSXB 4W6WB 4XMKH 4BZ1H 4N0UA 1PQZB 1WFUA 4KKLD 1PY4A 1U8LB 4G6FB 4G8EB 4ZDHB 3VFTB 4KRPC 1KXTB 3MLUL 4JVUA 5C09A 1FZMA 3NA4A 2JB6A 2F8OA 3FB5A 5DUBB 4XPAH 1HI6B 3P11H 4RGOL 1VFUA 5I73B 4OFYD 1JYXA 1P69B 2HLAB 2DN7A 4UT9L 3BJ91 5FECB 3AREA 3SDDB 3KYKH 1EEZA 5IR1B 2NXYD 2C1PA 1SJEB 2NLJA 1VA9A 5F3BA 2VN7A 3LQZB 2D7MA 5D93C 5H37G 1UEYA 3KWWB 3ARFC 4HXBL 3DJ9A 5F1OB 5L2JB 3MRPA 1LWRA 1ORQB 1FLRL 3WO4C 3BN9C 5SX4I 4FFWD 1U58B 4I77L 5D8JH 5HHVL 1NUFA 2IEPA 5DMIH 4YHZH 3QIBB 2YKLL 1N2RB 3S3SA 5LVEA 1E6OH 4KJYB 2PXYA 1QEWB 1MWAB 5D1ZD 1NFDE