4KV5F

Scfv gc1009 in complex with tgf-beta1.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
LETVLTQSPGTLSLSPGERATLSCRASQSLGSSYLAWYQQKPGQAPRLLIYGASSRAPGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYADSPITFGQGTRLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a pan-specific antagonist antibody complexed to different isoforms of TGF beta reveal structural plasticity of antibody-antigen interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Transforming growth factor beta-1
total genus 21
structure length 110
sequence length 110
chains with identical sequence I, K, L
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kv5F00
2C9AA 1RZ8A 2VN4A 1AGFB 3WHE0 4Z7WA 2FYYB 3HS0A 4B5EA 1JYWA 2VXTL 2F53A 2XWJA 1IC7H 5ID1B 3QZWG 5D93C 3UJIL 3UZEA 3OXRA 5SWSE 2ZUWA 3ARFB 3I6KB 5I1AA 3QRGL 1I3RB 5MHSE 2EXWD 3QO1A 3S37H 2FGWH 4JANB 1KCSL 5ABDE 3A6BH 3DYMA 1ZHBB 1RZKC 4DZ8B 3GB7A 4Z7UF 5C0CA 5I30L 4JANA 4XP9H 2H26B 3O11A 4MB4A 4X7FC 3M07A 1FNFA 5CILH 1F6AA 2EE9A 1T89C 5EBLB 5I1GH 5D2NA 4R0LA 1CXIA 2FX8H 4IMKC 3GMPA 2H2SD 4ODVH 2XKNA 4E42A 4BKLA 4LLDB 2RBLA 1WQVT 3RZCB 5IB4A 4QWWC 5CEYB 3GBLA 1O5DT 2DQHH 4JREB 3VFGH 5DS8B 1CICB 3ZTNH 3AU1B 4YQXH 3OAYH 2EKJA 3FZUC 4BFIB 1MI5B 3LQAC 1OTTC 4P46D 5SWSA 2MKWA 3ZTJH 1YMME 2P5EE 4ZS6D 4OM0L 3LD8C 1AXSB 3F7RA 1GGYA 2NY5H 3B9KB 1WLHA 2MHAA 2G75A 3KS0H 1IILE 5IVNA 2ORBH 3TJHC 4OT1L 4B50A 1U8QA 1FP5A 1IKNC 4Z7VE 1B88A 1TFHA 2BERA 5L7XH 4OB5L 3O6FB 2R39A 2XQBH 3TF7C 3HZYA 3CZFA 2XKNB 4E42B 2R1XB 1A9EA 1JGVH 5EZJB 5HHVH 1RZJC 2X1OA 3KPOA 4PV9B 3VFTB 2UV3A 4L8DA 4IDJH 1GC1C 1M6OA 2PO6C 4NKDA 1KLGA 4G6ML 5EUOA 3EFDH 4NZTL 5T1DL 1EFXB 4XNYL 4X80H 4LLVB 3EYOB 5EPMA 3AXLB 1N2RB 1OGAA 1FIGH 4N0RA 5HHME 1KGCE 1KCUL 1MIEL 5L2KB 2A9ML 3BPCA 1XF5A 1MFCH 1ORQA 1YJDL 5C0IB 3D25B 4L5FL 3T8XA 4MAUH 2NW3A 3D39E 5MENB 2XZQL 3VGFA 4LNRA 1MFNA 2RR3A 4JFFB 3GMRB 4Z7WB 3DOSA 4UINL 4OSUH 1CFQB 5I8OH 3VXQA 3AAZB 4NZUH 5KVEH 5EORH 4HHAA 4J4PC 3MCKB 4NUJA 4HKZB 1AY1H 2J8UB 1I9RH 4UOJA 1S5IH 1FGNH 5DYOB 3WE6A 5HJ3A 1CBVL 3X13A 5IMMB 1TJIH 5EUOE 1BFOB 3MO1B 2J2ZA 4NNXB 3AS2A 3DETD 3NIDE 3X3GH 3DXAE 5KANG 4LGSB 2CLVA 4P23D 3H9SD 1IC1A 4XVTH 3OGCB 1QRND 3OJDB 4M5ZH 3TN0D 3EJJX 2EECA 4JAMA 5HSFA 3CK0L 3JUYA 2DL9A 1T0NB 4LSDA 4S2SA 4X7TA 5T1LA 4ELMB 5ACMA 1HSBA 1R3HA 1U93B 4XP4L 1TJGL 2BVYA 1D7FA 5DQDH 1G6RB 1KIUA 5HI4C 2HFGL 5FUCE 1U95A 3BKMH 4J4PD 2JELH 4RDQF 2PXYC 4XC3L 4XBPB 4GH7B 5E0QA 2Y07L 1S5HB 4C59B 4PPTA 3MLUL 3IAQA 5CEZD 1DBKL 3K46A 5IQ9B 3NA9H 3GIVB 3SJVD 3ARGB 1MH5A 3VCLB 3OAUL 3DBXA 4JG1H 3HRZA 4KZDL 3QUKB 1EMTH 4YBLB 3U0WL 4CKVX 1R5WB 2ICCA 1A3RH 3V6OC 5EUKA 2NR6C 4PR5B 3BP4A 2A6IB 4ZO8A 4PJDB 3V4PL 4LKXA 5IESH 5ETUA 4KMLB 2YEZB 4IEFB 5I19H 4MJ5B 4P2CG 1A1MA 1J1PH 5DRZA 4M6AA 3IU4L 1T20B 4UAOC 4XBGA 1CFTB 1I1FA 2WINB 2AEWA 4OI8A 5B39A 5AUMB 1FYHB 3PHQB 1CU4H 1WCQA 2BSTA 5L88H 5IKCB 5HGAB 3QXDA 3RTQD 1OTUD 4BH8B 3RGVA 4OZ4A 5E4EB 4D0DA 4FXKB 3SDDC 3T4YA 3UX9B 3V0WH 3WL9A 3KXFD 1I1RA 2JIXD 3HNSH 3K81A 4QNPE 2BCKA 2DTML 3PXHA 1MEXH 3V5HA 2R9HD 4EVNB 4OZIF 4XCEB 3ZE2E 1MFAH 1ZWIA 1MFEL 4NQDE 5JIIA 4KROB 4YE4L 3LSOA 3KWWB 4GUPB 1JPSL 3DECA 3MROA 2IQ9H 2EDBA 2PETA 1NDGA 1XZ0A 2HT4D 4XI5D 1LILA 4MA8L 1WVZA 4PJHE 4RAVB 3TO4A 1H3PH 5FDWA 2ZUTA 3O45A 3WS3B 4Z7QF 4CMMB 4Z9KB 5GS1C 3O3DB 5FYKU 3QG6A 4GW1A 2APWA 3MREB 3A6CH 2E8ZA 4LF3B 3IGAB 3OWEA 3MRQA 1NDMA 4ISVB 4U4BA 4FZ8L 3LS5L 5KZCD 3I3DA 3WEXB 3QRGH 4P49A 1U8HA 4UU9A 5DUBB 1KJ2L 4FFVD 4UQ2A 3IS0X 3T1FA 1CZ8H 1YEHH 2EDQA 5CHNA 4HUUB 5IHBA 3S35L 2NYYC 5T3ZH 2VH5L 1JNLL 2XTJB 5L8LB 3MV8A 1EH9A 5BVJA 4MD5B 2X1QA 4XP9L 3BDYH 5DJZA 4DFIA 5E95B 5IWLA 4ETQB 4LCCB 2AJZB 4GT7A 4YBQC 1A6PA 2QQQA 3HZVB 2E3VA 3IJHA 3VD7A 4Q97A 1GGUA 2V7NA 2C3XA 4O2FA 3MXVH 4MD5A 5CJXC 2FX8L 1SM3L 4HWBH 4L8BB 4XBGB 4E41D 1D5IH 4EQ3A 1G9NL 3RPIA 5JIKA 4EBQL 2DD8L 3L7FB 5D1XC 2DKMA 4MB5A 3MRMB 1M05B 2R4SH 4X4YA 1YEJL 4R3SA 2CDGA 1KN2L 3O3UN 2CO7B 3T0EA 2FWOB 1UT9A 3MFFB 3VXPA 4JO4L 5C7XH 3CH1A 1DQLL 4MVBD 1I1AA 4J7RA 4F7TB 3L95B 4OJFL 3WNOA 4HD9A 1IM3B 5EIQA 1A47A 1YQVH 3VI3F 4JRWA 1Y6NR 3IETA 4X7SL 3WFBL 1I1CA 3EZJB 2H3NA 1C7TA 1JHKL 1CXKA 1AE6H 1MFBL 1C5CH 2EC9U 3OKMA 5L0QB 3MV7D 2NZ9D 5C07A 4PYGA 1LDPH 1RFDL 1E4KA 5K9JH 2FGZA 4IDJL 5CAYB 4LDEB 2DM3A 3JV4A 3OR7B 4M61A 3ZYZA 2X89D 4JB9H 1KJMB 1JP5A 3GSVB 4G6MH 3T08A 2AABL 5JXED 3U6RB 1EA9C 2GW5A 4H8WC 3HB3D 2RAMA 5TE7H 4X9IA 3JVGC 1ZTXL 4KY1H 4HDIB 4Z78A 3Q6GL 1CG9A 1FV1B 4JCLA 5HJ3B 4HWEH 4JM4H 4L5FH 4QY8B 4OCLC 1OAZL 4QTIH 1KG0B 5H8DA 1G7LA 5IK3A 1AXTH 5I74C 1QFHA 5FA4B 1KIQB 3VXRB 1N6QL 1BX2B 4Y19A 4M7JH 4JFHD 3HLAB 3NZ8B 4OLYL 5JIPA 4WUUB 3BP4B 3MRKA 3U0PA 1R5WA 3L3KB 3RWCB 3MYJB 2NX5B 1XF2A 3OHXA 1MELA 3ALXA 5EO1A 4OLWL 3GIVA 3PL6D 4PJ8C 3CSYA 4I4WA 1VACA 3BFOA 1AR1D 5AYUL 4GG8B 3CFDA 3OKKB 4GLRI 4XVTL 3EOTH 1G0XA 5ISZA 3R8QA 2QHLA 4DVRH 1NGYA 1R3KA 2W92A 2WUCL 4NO2B 5FA3A 2NCMA 3S4SA 1DBMH 5IWLC 4G6KL 2GT9A 2CK2A 2ZCLL 3TP4A 3VWKC 2I60L 1EEZB 1HXMB 5IUSA 2D7MA 1F3JA 1QSFA 2VQUA 4FZEH 4N68A 1ZGLA 4WV1C 2CLVB 2BOBA 4FFZH 3HLAA 3MV8D 2ERJC 3JWDL 4HXAL 5C07D 4S1QL 4IRJD 3QWRA 1DBKH 1D9KD 1Z9MA 3GJEA 3Q5YA 3I84A 4JG1L 1EMTL 5TGBB 2EDDA 3U0WH 4KJPC 5ICZA 3QNYA 5TDOA 2DMBA 4PV8B 3WIHH 4HHAB 3D6GA 3HPJB 1SJEA 2AI0H 4PRDA 2VC2H 3DV4A 2E9JA 1LE9B 4F8QA 2WBKA 4NPYA 1XF4A 4ZG1A 1NJ9A 2GY5A 4JKMA 4JFFA 4NGHH 2G60L 2VXQH 2DQDL 2PYED 4Z0XB 4CW1B 5AD0A 1HHHB 1CICC 3TBWB 4EZMA 4RIRB 1INEL 1UJ3B 1AFVH 4ODSH 1U8MB 4FXLA 2O26U 2FHFA 1K2DB 4EN3A 3AXLA 2CDEB 2BY2A 4HS3B 4J6RL 4N0CD 3B9KC 3V0WL 3HNSL 5DFVC 1CXHA 1JFQH 5IMOA 1UZ6E 4PP2B 5HGHA 3VE0A 1OPGL 5EO9A 3ZHDA 3MOAH 1JHLH 3RWGB 5J6GA 3OZ9H 1AC6A 5CCKH 2IH1B 3DMMA 4TPRH 1JE6A 1XGYH 3FQXA 5DWUL 1KFAH 3F7VA 3TM6A 4MS8D 1CD9B 5D7LD 2I07B 5CFHA 3IAGC 1AO7E 1WV7T 5E2TH 2BHUA 1CD0A 1W0VB 2EZ0D 4XWOD 4ELKB 2XNAA 3H7BA 4YHOL 5MEOB 4YFLF 4FZ8H 2FEDC 2DYPB 4TVSa 5C0JA 1T80A 3P77A 1R3JB 3WMSA 4G6JL 3S35H 1BAFL 3CFJB 5B38G 3QG7H 2JJSC 5F6IB 1RK0A 4NQTA 5C0FB 1L9NA 1FZKB 3FQUB 3PWVA 3BDYL 1I8KA 3HE6C 3B43A 1U8HB 2AJYH 5I1HH 4HH9B 4MHHG 4DN4L 1S7QB 1XF3A 3DO3A 4GKOA 2VJXA 3LDBC 1VGEL 3RVVD 4W4OA 3UTPD 3T65A 2NZ9C 1W2KT 4DUVA 1AO7A 5JHDA 4KI1A 4GRWE 2FATL 2Y72A 4HBCH 4O9HL 3C6LD 3PHSA 3FO9B 4ZUWA 1U2CA 3D3VB 4QHUB 4XVUD 5GIRB 2YHGA 4QGYA 4X7EC 3MRLA 4FS0A 2B5IC 1YN6B 4FQQB 3ARWA 1A7PH 5SWQB 2NY3C 4I2XA 3LN9A 5I76A 3VRLE 1HH9A 3MJ6A 4PLOB 4PGDB 4DKFL 3QHZL 5T33L 5E24E 2UZIL 4N0UA 1S7QA 1INDL 2Z91A 2V9RA 2A2QT 3ARBA 3RX8A 2VQ1A 5F7NC 2XWBA 4AQOA 2ZUYA 4XZUA 2XICA 3VD9A 3AROA 2HRLA 5B39B 5MEND 3UO1H 3I6LE 5ESVB 4XPHH 3CX2A 5ERWA 3U4EA 3BX7C 5JHDE 4AENB 4XPGH 4IDLA 5FHBH 1WWCA 4JPVL 4NOBA 3FO1A 5C86A 2YC1B 3T0AA 1HHJB 3P4NB 3WIIH 3FRPG 3VU2A 3DX7B 4N5UA 1A4KA 4FFVC 2WUBL 3LPGA 3AS0A 4MCYB 3QCTL 4XRCA 4F8TA 2BFVH 3NBNA 1ZGLP 4J3SA 4ZMAT 1M7DB 1O7SA 4KK5C 4KC3B 4NYLA 3KPSD 2VDPH 4K23H 1N6QH 1VFMA 2ENSA 1J12A 3ZDXE 2LAGB 3ZE0F 3RWGA 1M7DA 3UYPA 1EAPA 1TZIA 5F6HI 2YUVA 4L8CB 2MKLC 2VDRL 4Y4KC 2GAZB 5IBLC 1BIIA 3F6LA 4M9OA 1QSEB 4UBDC 1KPUA 4Q6IB 5FHAH 2NY2C 3T0ED 4PJ7E 1BFTA 1UM6L 4Q6YA 2IBZY 3MPCA 3RI5K 1MY5A 4JN1L 3EO0B 4U2YA 3MJ9L 1ZGLM 3PWPE 1OSPH 4EUPH 3KPMA 1MUJA 3IDJB 4JY4A 1BFOA 4LGRB 4D0CB 4G6KH 3U1SL 1J87A 1MCCA 3KPQB 2ZCLH 3W9EB 4G6AC 5TE4H 3TZVC 4HKZA 4JQXC 2L0DA 2HRPL 3MR9B 2OXHA 3B9AA 1YC7A 3RQ3A 4XBEH 3W0WD 3QQ3A 2UVFA 3CLFH 4HT1H 1RK0B 5C0EB 4GAGL 4N0YL 5GS1A 2DICA 4HV8B 4GFTB 5EU6A 5F89B 4HKJB 3LN5A 2BOBB 1YECL 1RHHA 3WIHL 3LEYH 1NCCH 3SDXA 3RWFB 4APQD 4M9PA 5C0BB 4KK9C 3JWOH 1HQRA 3D85D 4AT6A 1FCCA 1BJ1J 3X12B 1MF2H 2VXQL 3TBYA 1I8MB 2AJSH 2OTUB 2DM7A 1KTRL 1R3KB 4KZEL 3QPQD 1KCLA 5EA0H 3FTGA 2DQCL 4TULL 1INEH 1M6OB 4PV9A 4ZO6A 1EVUA 1WZMA 3PWNB 2MQ0A 2FGWL 3A6BL 4LCCC 4PLJC 4XT1C 4WV1A 1MSPA 3MLPA 3FQNB 2EIBA 4YHNA 2A83B 5J12C 3ARSA 5F3HB 3ZZ1A 3A0OA 5F9JA 1A64A 5FOJA 3PV7A 3OZ9L 2HTKD 2VAJA 3UJJH 2YPLD 3VDCA 3RIFK 5SWSB 1QP1A 4YHPA 5I1EL 4H5SA 4KAQL 1FFPB 5I1KH 5CGMA 1FYTB 4KHXL 1MCJA 5C0RL 5CZKA 5D2LE 4EXKA 3MFGB 3OG4B 3BAEH 1JV5A 1P4IL 3O6KH 4IRZH 5E8OB 2NY5L 3AREC 1LE9A 4CADB 3ULUC 1PEZA 2YK1H 3MUY1 3UTZB 2MCPL 5CJ8A 5FO8B 1MHCB 2X4OA 1QTYT 5GGSY 3ISWA 5GS0D 2Q87A 1ZHBA 5F1NA 4UIKH 1K2DA 3HHRB 5E6ZA 4XNXL 3DGCR 2FLRT 3BGAA 4M02A 1G7JB 3FN9A 2BRQA 4XGZA 2E27L 4HUWB 4YGAB 3V7AE 4N1CA 1EZVY 4ZAKD 3VD5A 3K4DA 4G3YL 5C9JA 1CLOL 2CXKA 3WSQH 2F15A 4PD4K 1MFCL 5FO9A 4L4TB 4KGJA 5EOCL 2WAHA 3QJFA 5B22A 3V6FB 4NC1C 1G6RH 2Q8BH 4HSQA 2EDXA 3WXWH 2CDEA 2ARWA 4U1JB 5HY9B 4YHZH 4UINH 1FL5A 5F72S 1O7VA 1A6WH 2X4PB 5T3XD 3L5XH 2X1WL 3QNXB 4R2GB 3IJYB 3LQAL 3GJFB 5F1IA 1B0RB 3VWKB 4PRAA 5FYKH 4PTTA 2VXUL 3MRFB 1GIGL 3RIFF 1ZT4B 1S5IL 1G0DA 2XWTB 3IJYA 4O5LL 4FMKA 3MV8B 1JZ3A 2Z93A 1EFXD 3MSPA 4QO1A 1XF1A 3C5JA 2OYPA 1NC2D 5C0NC 4KDTA 3TO4C 4AY0A 4P2RD 1XIWB 5JPMB 2IFFL 1HCVA 5DMIH 3MJ7A 4HULB 3VA2C 1BQLL 3GUTB 1U8PA 4JQXA 1T21A 4CMHC 4PJAF 4ZAKA 1YPZE 5FYLE 3QIUB 4ZOBA 4KTDL 4XB7A 3B8SA 5IEHA 5IIEB 4JPWH 5HDBF 4LRIA 3RZWA 4U1KB 4NN7B 4JFDB 4XC3H 4ODUA 4RAUA 5FYKD 2Y07H 3UBXG 1N7MH 4RAVA 4ONGL 4G8FB 3RWJA 2HG5A 1T7XA 1VFOA 1BX2A 2BSSA 4LRNH 5HVWA 1H3UA 3VFUB 3C5ZB 4M6ML 4XAKE 1IQWH 4WW2F 1CLYH 5EN2B 3DO7B 4QKXB 2FJFA 2HJFB 2LVEA 4WHYH 1B9ZA 4ONFL 2RJMA 5FO8A 3PIQB 4R7DA 3HZKB 4U6HB 1NMCB 4Z8FH 1J8HA 4QXUL 2Z4QB 3R06A 3J7HA 5FHAL 3SBWC 1UM6H 2ADJA 1S9YA 2NX5A 4NO3B 4M7LL 1J1PL 2D4FA 2ARJA 1XF2B 1KJ2B 3IU4H 3MUZ1 4PJ8B 3MRKB 2DS4A 2CKNA 2NY0B 2WINA 3ULVH 3QNXA 3NFSL 3O4LA 1FZJB 1UM4L 1M05A 2EIZB 1X5LA 5JZ7C 5HHOB 4KRPC 2EC9T 5F7UA 2JCCB 3EYVA 4PJGE 1JMXA 4POYA 2F5BH 1TCRA 4OZGE 3VXUD 2YPLE 1BIIB 3PXJA 1U8IA 3QEQA 4PY8J 2FJHA 3JWOC 1RD6A 4UV7H 5D6DA 4JHAL 4MAYD 4PG2A 1MLCA 1EAPB 1Q0YL 1WWAX 2LU3A 4WV1B 2YN3A 5FV1L 4P2OC 1IARB 2C1OA 1G7MA 2VZOA 1BVLA 1MLBA 3W5MA 5HVHB 3S98A 1S5HA 4MXVE 5IR1A 1F90H 1MRDH 3R0NA 1MCQA 1X4ZA 2OK0H 4MQSB 3DNKA 4DCQA 1I8MA 4J4PA 1IGFL 3DI2B 3P4NA 3H3KA 5H35A 2VISA 5C08B 3QPQC 1SEQH 4YR6A 3UYRH 3QWQB 3AGVA 2X09A 3UTTA 3IS1X 3SE3A 4AH2A 4CAGA 4WI3A 4ODWB 2B0SH 1RU9H 3DXAD 1A22B 1KJ2H 4Z7VF 3OGOE 4K94H 4UT6L 4WHTB 1QFWI 5DRXA 5GSVA 5D7JC 2ITDA 5AG8A 5D93B 3I50H 2NXZC 1H3TA 4PUBH 4RMQA 3VFOB 4LARH 1HHGA 1LO3H 3KLHC 2Y6SD 4KI5F 2FBJH 1AHWC 4Q9BA 5KVDH 2AJXL 5D7KE 5FUZL 3M1BB 2BCKB 2OLDA 2FIRT 4JRYE 4HWBL 2VXSL 1D5IL 1CGSL 3L7FA 5B39G 5E6IA 4WW1B 4F2MB 5DUPH 3TVMA 5SWQA 5D7JD 3IT8D 1BD2B 3P4MA 1VEPA 5KBNC 2A83A 3O45B 5AUMA 1JZ8A 1BOGB 2YOCA 3EGSA 3TCLA 4WIQA 5MEQA 3O3EB 4QRUB 3SDYH 2VO5A 1U8JB 4R4FL 3CGTA 2N7BA 1OLLA 3WS6C 4F15C 5FGCB 2C7UB 4QXGH 3ULUF 1RJZA 1RK1A 1T7WA 4P5TA 3FQTA 4H25B 1JGLH 1EAJA 1K4CA 4NKDB 3QP3A 1L9MA 3BKCH 3LD8B 3P9MA 4MAYA 4BH8A 3QUKA 5BO1L 1WBZB 5EOQH 2WWKT 3MX0A 3C09C 4NBYB 3QO0A 3TNNA 3OX8A 1BBJB 3WS3A 1EO5A 5TQ0L 1OWRM 3FONA 1XCTA 1S3KL 2DB8A 5SX4H 3ZE0E 3P77B 4V2CB 3EDDA 2EO9A 2E27H 2F9BT 1FVCB 1MCPH 4LQFH 4BSWB 1ZTXH 2XNAB 3H7BB 3LEVH 4G3YH 2BRRL 1MIML 1Q94B 4KY1L 3OKNA 3Q6GH 4C56D 2B2XL 1S7TB 5EC1B 4PJCB 5FECB 4JFXB 4Z7UE 4C56E 1U8NB 3BSZL 4MQXC 1K85A 3D3VE 1I7RB 3BD4A 5FIEA 5IT2L 4CVXA 4ZYKA 4P2QE 4WU7A 1X5KA 1CL7I 3KAAA 1PEWA 2PW1A 4CDGC 3SE8L 3LQAH 1R3LB 5D7KD 3EO0A 4L29B 2VAAB 4F7PA 1DQQB 2PF6A 3ARGD 3FOMA 1D5MB 2J5LC 4M6NL 3NFPA 4MJ5A 4OIBA 4OLWH 2DI9A 3RVTD 4HJJH 3VFNB 1IM9D 2IANE 4PJIA 1ULVA 4Z7OF 1JHTA 3U83A 3HZMB 1TPXB 5KVGL 1J5OL 1Z9LA 5AYUH 1A6VL 3PDGA 2LQRA 3SKNB 1R24B 1B6DA 4NM8H 2VLRA 1F3DH 2W9DH 1BVKA 1KTDA 3HC4L 1X4XA 4TVPH 3ZKQD 3GRWA 1A3QA 3KYMA 4OKVB 3RNKA 5I73C 5KW9L 5D6DC 3KVQA 1FG9C 4LEXH 5D2NC 3ARTA 3O8XA 1NLDL 4WFED 4Z5RB 2JJVA 3W11C 4P2QA 3Q2CA 1NMAH 2DQEH 4JPWL 3CPLB 5DJAA 2XZAH 1EFXA 3WFEH 2OJZL 2IGFH 3SQOL 1RIUH 2OZ4H 4UIMB 5D7SH 1L6XA 3VWJA 3RAJH 1A9EB 2X4RA 4PLKD 3QI9D 3U9UB 4MA1B 5ITFB 4M93C 4NP4H 4HWZA 4Y5XA 1UXWB 4EI5D 2YUZA 4EKXA 1I9IL 1W0WB 3FO0L 2IANA 3H9SB 4ELMF 5IF0A 3ZTJG 2EDRA 2NY6B 3MV9A 5E2UH 5ESVA 5FFLA 1G0YR 5DJ2A 2VC2L 1NBZB 4KKCC 2A77L 3A6OA 3FMGL 1N2RA 1L7TL 4LSVL 2APTA 2EIEA 4WTZG 5F70A 2NY3B 2HKHL 4TQEL 4ZQKA 1MREL 3BN3B 3DX9B 3MCKA 4NUJB 4OZHA 4PB9L 1FL6A 2VLRD 4KH2A 1UM4H 4EIZC 5C09E 3CDGB 4P2QB 5DO2D 4G42B 4P5KB 1S9WA 4JQVC 1GL4B 3RZCA 1YNKH 3QDGA 4Y8DC 3PV6A 5IVXE 1V05A 2P8LA 1NCDH 4Y4FC 5L2JA 5EO1B 3RKDC 1ADQA 2Q6WA 4C55A 1VADB 4MJ6A 4FRWA 2E7MA 4UV7L 3C2SA 4OCYL 5I9QB 3PJSA 3MRHB 2CO6B 1HI6B 5CBAB 1A1NB 4U3CA 1VSCA 3MC0A 3MJ8A 1NCUA 1XGYL 2DLHA 2YRPA 4YEFA 1MI5A 1QO3A 1KG0A 1GZQB 3KR3H 1RUQL 1KCVH 3NAAH 3B9KD 1I8KB 3KS0J 2R0ZL 4R26L 4XMPL 3HZYB 4Z78B 2NY0D 1LNUB 5C0BE 4POZD 5IFJB 5E9DE 1UYWH 2GTWA 3I6GA 3U6RA 2X05A 3QDGE 1P53A 1HIML 3GSNH 5IVXA 1OAUL 4HX1B 2FECL 2Y5EA 2DL2A 2G5BA 1H3GA 5DK0A 1KCSH 5CKAA 5KSUA 1UQSB 5CLWA 3QG7L 1NFDE 3GJEB 4HX1A 1Y0LB 2R2BA 3VRLF 4PRIB 4MLSA 4P3DA 3H3PH 4NKOB 4WUUE 4E5XA 4HEME 5I1HL 1QBLL 3F7VB 4F3FA 4FP8L 4K7PX 5FUZH 4W68A 3HNTL 2E7LA 3CFEB 3KG5A 4PJ5D 5HI5D 3NCJH 3UTTD 3PE9A 3HC3H 3RA7L 5AWNL 4F7TA 3NGBB 5ESQB 3VFGL 4HBCL 4BUGA 3ZYJA 3HE7C 4YQXL 4L3EA 1F11B 5D1ZD 4HIJB 4WTZA 4R4FH 1XGTB 3N50A 3QO1B 5T3XL 1MAJA 1UJ3A 2JTDA 4OKDA 4DKFH 3SGDI 2V9TA 1JGLL 5I1DA 1DZBA 2P1YA 3DROB 1JF6A 3HG1D 3B3IB 4J3XA 3O41B 4PJAB 2CK0H 5JA9A 4WUUA 1S9WB 3UBXA 5IHZA 3CDGA 5IG7A 3VGHA 1JGVL 3NIGF 3HI5H 4AEIL 3QQNA 4XPHL 1OP5K 3GMLB 4NJ9H 4RWHA 4JKPH 1DTUA 1W72A 4I77H 4X80L 1R5IB 4G6AD 1HOCB 4LQFL 1FIGL 1A1OA 4RBPH 4YHMH 5JW5B 1CDCA 4MQTB 4AM0A 3KPLA 2A9MH 2B2XH 2IANB 3RWHB 1SHMA 1QBMH 4I3SL 3QCTH 2RHEA 3ZT7A 4OQ1A 4XNZB 4JHWH 4FFWD 5IT2H 1QFWL 3QISA 4GMSL 5JNYB 5FYLH 3RP1A 4U3XA 2BNQD 1QD0A 3OF6D 3CAFA 3B2UD 1NSNH 2D9QB 4FFYH 3PP3K 4U1GB 3CC5A 4JM2C 1FZOB 1P2CB 5EORL 3DGGA 4WHCA 4PGJA 4L9LC 3CFDB 1AY1L 2P44B 3OKKA 2GCYA 4WTXA 2Y5TA 1FFNB 1FGNL 1CBVH 4NRZB 4O02L 1I1AC 4KRPD 4MCZB 4PRBB 5C2UB 1TJIL 4NN5B 2Z0BA 1N64L 5HHXL 4M1CC 2E5EA 4TSCH 4UTBH 5J1TC 4TTDD 2NXYB 3BPOB 3THML 3IXAA 4DOHB 3PDOA 1VFUA 3X3GL 3QUXB 3VFMA 3ALPA 4HUNB 1UM5L 4ZPVB 4DTGH 3D1MC 1CXFA 1J88A 2G9HB 5DMYA 5IB1B 5KW9H 2F53D 2UUDK 1DL7H 3OB0K 3U1SH 1ZLVH 5JXEA 1IGYB 1NC2A 5C8JB 3IDMB 1DQQA 4MMXC 4ZO9A 2X89A 3WLWC 4YPGB 2AERT 1CDYA 3NFNA 2VLKB 4MNQE 3IJHB 3VMOA 4B53A 5CBEA 3QUXA 1YDPB 5HI5C 3HRZB 5BVJB 1JNJA 4P99A 5HVHC 2X1PA 1ZT1B 4Z76B 4N0YH 1UWXH 4ODXA 3FT3A 4A6YH 3C5ZC 1OCWH 3PIQA 3OKNB 3AFLA 1D5ZA 1OQOA 5E2UL 3MBEA 3O81A 2NYYD 5EN2A 4XNMA 2HN7B 1YEDA 3VJ6A 4S10A 4M8QB 5GJSH 2LU4A 2VDML 4S2SB 1MQ8A 2ATPB 3TO4D 1KXTB 5EA0L 5DRNA 5KS9E 3ZL4H 1EGJH 3V4UH 2Q3AA 3PNWA 3RWHA 4ORGA 4I0PC 4HIIB 4NQCD 1MHPL 1NCTA 5JW5A 3F65A 3L3HB 4MNQA 5KSVA 2CLZA 5F7WC 4YFDB 5EZLA 1ZT7B 4ZPTA 4O51A 5D1QD 1U8LB 5I8CB 1FFQA 1BF8A 4YC2B 1EHLH 1FYTE 5JMOC 3DX6A 4JY5L 4G5ZL 1BM3L 4HBQA 1BQHA 4JPIB 3U7WH 4YEEA 3OKYA 1N5AA 4GS7B 2XZCH 3F12A 4NQEA 4JJ5B 4F37K 4NFBA 1KLUB 2Y25A 1HK6A 3G5XB 1F02I 1I3GL 3DROA 4PJ5B 1QQDB 2BNRB 5I1KL 4KHXH 3TVMB 4H20L 3WN5C 1JNHB 4XH2B 1E4XH 1TVBB 1P4IH 3A6CL 4QRTA 3HUJE 3E6HB 4IRZL 3ARBC 3P73B 5JPNA 4HUXA 3B5GA 4UU9B 3F7PC 1UXSB 3TWCH 4ZNCD 2D31B 1NKOA 3VXRD 1CZ8L 3D39A 3IGAA 2W59A 4TUKL 1I8LA 1EUTA 1B6UA 3KJ4C 5FAAA 5E9DB 2C3VA 2JCCF 1QBLH 4S1DD 4HPOH 4OF5A 2YA2A 2NXYD 3KDMB 4P2YA 3NCJL 2DD8H 3DURB 3EYUL 4MXWL 4OZFH 1ZWIB 15C8L 1OARL 5AWNH 1CLOH 2PXYD 4PJ7B 3WSQL 4TNVF 2GTZB 4HUKB 1IBGL 4XMKH 1KGCD 1ZS8B 1A6UH 2UY7A 1KN2H 3RWEA 4H1LA 5BOZG 1KTKE 1PZUB 4R2GD 3QFJB 1X5JA 3WXWL 1BFVL 2VKWA 5EZOH 5IVZB 5EC2B 1FZMB 1QRNE 4WWKB 3UTOA 5CBEB 2OR7A 2NNAA 3GHBH 3B6SA 4P23C 1ND0B 2A74B 1SYSA 1GRWA 1JHKH 1OQXA 1TTGA 4PLJD 3MRDB 1C5CL 1YPZB 1AI1L 2D03L 2APVA 1F58L 1PBYA 1WITA 5KSAB 4BFEA 3HI5L 4AEIH 2OXGA 1CF8H 2DQIL 5E99L 3NCBB 4F7EA 3C09B 3VFMB 4MWFA 3T8XB 2YA0A 5F1KC 3X17A 2IPKA 1H0DA 3D3VD 3WLWD 3BPCB 1VERA 4W6YB 4YHML 1GC1H 1JI2A 4BH7B 2F19H 1C1EL 1H5BA 1R6VA 4UDUA 1IGJB 4I3SH 3OJ2C 4PIRF 3DO7A 2C3GA 5EU7E 5F6IC 1X6NA 1OAZH 2VR4A 1WUNT 1AXTL 4ONGH 5MENE 2DI7A 3ZHLA 3KPRD 5IOPA 1T0NA 3V6BR 4TTDC 1IGTB 2MNUA 4OIIH 3LDBB 5CSGA 4IMLA 3SDXB 3MLWH 4G6FD 1FYTD 1C8PA 3G5VB 5SWZB 5I1LB 1CDJA 5IF0B 1OGTA 5DJXA 3MLYL 1G1YA 3BGMA 3VGAC 1WCBB 5B38A 4M43L 1AKJD 4IRSB 1N64H 4JM2D 3BEVA 2DYPD 3QDJE 2KZWA 2FEEI 2X7LB 4KROC 4U33A 1ONQB 1DVFA 5DYOA 3BZEB 4NQXB 4GXUN 4M3KB 3U46B 4PJHA 4HK3N 2YD5A 4F7CA 3ULVL 2YR3A 4KROD 4BQCA 4DVRL 1R5VA 1KB9K 3VXQB 5DDHB 5DMGC 4G9FE 3E3QC 1BLNA 5BRZA 4L4JA 5MENA 4NQVA 2PTUA 5I1DB 1IRAY 5D7LE 4HWNA 1BVKB 1KTDB 5J56B 2DN7A 5HYQA 5F1IB 4FZEL 3SKNA 5C0CD 1FO0B 2EDHA 5TJWK 3JWDH 4HXAH 5EOCJ 1XR9B 2YD4A 1JGDB 4OD2A 4HIJA 4RRPG 3QEHA 2B1HH 4X7DC 4DGYH 3RX7A 3MV8E 5IROA 5KTEH 1MCWM 4HS6B 5F7FA 3V8OA 3QDJA 1V3MA 1C7SA 4UB0H 3V95A 4NJAL 4D94A 2IG2H 3I6KA 5CJBA 3MUGA 3B8YA 1F4YH 4LSUH 2EXWC 3RVXC 3BXNB 1C5DA 4JFYB 5BRZD 2W07A 3G08B 4PJBF 2DQDH 1MY7A 1G7JA 4CVXB 2LAAA 4TRPL 2VE6A 5T3ZE 2A73B 3RY6A 4PRIA 2DIBA 2VABB 4WU5A 1RZIB 3S9DB 3ZL4L 1AFVL 1A6TA 2G75B 3V4UL 1CIDA 4OFDA 3GGWB 3DUHA 2H9GA 1JN6A 3ULVC 1V8HA 4O2CB 3DUUA 3I50L 1ITCA 3DWTA 1XGRB 5IVXB 1LO3L 2HFFA 1D9KB 2FBJL 1QYGL 4RSVA 5IW6A 1PAMA 2AJXH 3VD4A 3P9LB 3RGVD 5DS8A 2DRUA 2NY3D 4G5ZH 4AL8H 4CADA 4Q7DA 3FN0H 2E6JA 1OPGH 4OGAC 2JJUA 5I6XB 4HKBB 2GJ6B 4G43A 3U7WL 5DI8B 43C9B 3ZSTA 1JHLL 2ZUQB 4ODVL 5C07E 4OBSA 1REIA 5J6HB 1RY7B 1FFPA 4BQ8A 4FQ2H 4XB8A 2Q3ZA 3H0TA 3BQUA 1YC8A 2GK2A 5DQ9A 2HYMA 4JFPB 3MA7A 3IJSA 1D5XB 4H25A 1IEAA 5E6IC 3TPUB 3L5WA 4NIKB 3G6AA 4OM0H 2NXYC 4DKEH 2WQRA 5DMKA 3HR5A 5IMLA 3F7YB 4XNUL 2XA3A 4YNYA 5E8PA 4UNVA 5BMFL 4QF1B 4YPJA 3VG9B 4JDVA 5ILTL 3PQYA 5FB8B 3UXFA 4NBZB 4GQ9H 5DD3H 3LPFA 4YDLC 1U58A 2MMXA 2FYYA 4PREB 5L7XL 1QA9B 2CKBB 1QNZL 4HZLA 3G04B 1I4FA 3G5ZB 3LKPA 4KKBC 3L5WB 4GG6B 1NGZA 1VENA 4HXBL 1LHZA 1AKJB 2JKXA 5MERA 2OTUA 3ARBD 1A9BB 5AZ2L 4XWOC 4LFHG 1IM9B 4Z7WE 1MCPL 1EHNA 1RVFL 5ISZD 4KK6C 4Q9QL 1OVZA 2BRRH 5CP3H 5IHLB 5CP7A 4MS8C 4X0KA 3H9SA 3X14B 2GK0A 4A2LA 5C0DB 3MGOB 4XMKL 5GPRA 2AJUH 2QSVA 3PL6A 5DTFB 8FABA 6FABH 5ISZE 1CDHA 4S1RH 4NNYA 5CS7A 2XZQH 3PQYE 5GGRA 4OF0A 4OSUL 3QULB 4YUEH 3BD5A 3WJJA 2G2RA 3LKSB 4PJGB 3MRCA 3HG1E 5KVEL 4JVUA 3QHZH 2YN5A 2X5PA 4XCNB 4ZSOA 2H6PA 3QIBA 2AKRA 4WI8A 3QI9B 1T1ZB 4JFYA 4EDXA 2N4IA 3ARED 3BP6B 2DQIH 1RV6X 5E99H 2VXVL 3GK8H 1U42A 3RZCD 1XH3B 5FHBL 2O61A 2W9DL 5HI4D 5DEFB 3MV01 5IB3A 5GXBB 5F9OL 1GC1L 1IEAB 2ARJQ 1CLCA 4EN3B 3K7UA 5IB2A 1NLDH 1TJGH 4WWKD 1A2YA 1NMAL 1CGTA 2HFGH 1R3LA 3EJYD 2BFVL 1X4YA 3RGVC 3SQOH 3HG1A 4IIQB 4NO3A 4Q2ZA 1FFRA 2C4FU 1MCDA 4HKBA 4Z7VB 4BUHA 4E41E 2W1NA 1YMHB 2MJWA 3MLXL 5FGRA 4S0SD 3MRRA 2YBRB 3E3QE 4HMCA 4ODHH 2D7NA 1KIRA 1KT2A 3DSFH 4GRWH 1B4RA 5E94B 1KXVC 4NC1E 3X11A 2BNUA 2FJFB 1S7RA 2CRIA 5IESL 1LEKB 2WMPA 5T5NG 3MNZB 5E9DD 5EBMB 1D6VH 3FO1B 1L7TH 1F6LL 1ZVHA 5TDNA 4Y5YC 2HKHH 3NCYP 1MREH 3MGOA 5CJQL 4JN1H 4EUPG 3MJ9H 5BXFB 2K3TA 1FVDB 4YXLL 1DBBL 1QEWA 2KZ1B 4C56B 3VXOA 4M1CD 2EDWA 2VUYA 3WJLA 2GT9B 2V5MA 1KPVA 3LQZA 2VQ1B 4YC2C 2Y06L 2OI9C 3ZKXB 4OZHF 1LK3H 2HJKA 1CFSB 5DD1H 1Q9KA 4ONHA 3QIWD 1AKJA 1JZ4A 2I24N 4BSVB 3TJEH 2ZKHL 3WUWB 1Q9LB 2DTMH 4N9OB 1IGJA 3B9DA 3L3DA 1FAIL 3CFBB 3MRLB 2JIXB 3CLFL 4PY8I 3DXAA 1MFEH 5ADOL 4YE4H 5K93A 3BZFA 3MGTA 3CVHL 3S96A 1KJ3L 3MYJA 2VMFA 4OV5A 3NAAL 4OV6F 4F7EB 4UOW1 2P46B 2EDFA 2BDNL 5DLML 4R26H 4WFEE 1AO7B 2YS4A 5BJTA 2XACC 2NY1B 3D85A 4LSUL 1JMZA 3JWOL 3V5KB 5C0GA 3F5WB 3ARRA 5E8EA 3BEWA 5DQJA 2NW2B 5CINL 1UYWL 4N8VB 3GMQB 4UBDD 2GSIA 2VDKL 5CD3B 2OTPA 4NHUA 1CQYA 4IJ3C 4FQHB 3BZEA 1E6OL 4TULH 1OAUH 4JFQA 4NRXB 2HT3C 5BVPL 2P5WA 5EOTB 1NCBH 2VH5H 3L3GB 3CIQA 1FZMA 3OR6B 3IVKB 1JI1A 3C2AL 4FG6C 5L8KB 1QYGH 3BIKA 3I85A 2AJVH 5FUOL 3QNZB 5H35B 3WFCL 1K9TA 3FN0L 2ILLA 5FYJE 4OUUA 1MVUB 2C1PA 5CLTA 5D1ZC 1MAML 1YYML 1DLHA 3VW3L 3TIEB 5J11B 5EBWB 1UJTA 2R4SL 4G9FD 3H6JA 2UWEB 1LEGB 1C5DB 3GJFK 5E1AB 4EEEA 1TNMA 3D5OF 1DQLH 1P9MC 4PJDE 4KV5F 4TSAH 1PG7H 1NEZG 3O6KL 4P23B 4OJFH 2FR4A 5D5ME 1CVRA 2P45B 4JZJB 4BELD 5E8NA 1G9EA 1TJHH 3ARFC 5ILTH 2D0GA 2IADA 3MRJB 1AE6L 3O6LH 2O93L 3NTCH 4M7KL 4NN6C 1GCFA 1NFKA 3U36A 5GS3A 2FZ3A 1RFDH 1U8MA 1GGTA 3HPLB 2HH0H 4JR9H 4U6YB 1UKQA 1SEBB 1JPTH 5HGGS 1FNGB 3KPSE 4JKPL 4H8WL 4R4ND 3U9PL 3FB5B 5AAMA 2AABH 5C0AA 1B0GB 1TQBC 5TE7L 4H0IA 1WJ3A 3STLA 4HIHB 3QHTC 4WW2C 1M1SA 2BC4B 2PO6B 5CWSB 1F2QA 1P4BH 1NFIB 5IROC 4GG6F 6FABL 1G6RL 4OFVA 4JHWL 5FKPA 2FBOJ 1N0XH 2EKSA 2WP3O 1AH1A 3VFUA 3FCTB 4GO6B 5FOBA 5FYLL 2IAND 2WWMD 2P43B 1MVUA 2C1PB 4O4YL 5IMKA 3V2AR 4YUEL 4AT6B 5BJTB 4HIIA 4M8VA 3L5XL 4KK8D 1GZPA 4U1NA 3NN8A 4M1DL 1CTOA 4P9ML 1OSZB 4OV5B 4C58B 1KJVA 4YGVB 1GIGH 5E4IA 3BZFB 3MGTB 3LN5B 2JJWA 1T7YA 5KSBF 2AW2A 4TUOB 5EOTA 3K4AA 3DRTB 4NO2A 4M1GH 3BYYA 3ZMRA 5EO0A 3THMH 2P5ED 2VXVH 4EVNA 3EOTL 3RNQB 3GMQA 5K59E 1BQLH 3GEWB 4YHLH 5C6PB 1ZHKB 4ODXB 5IV2A 2A6JB 4DTGL 5MEPB 5IP4A 4M62H 1P84K 4M3JA 3G6DL 4UV4L 1UCTA 3IDGB 1KPRA 1HQ4A 4XMLH 2XXMB 3PHQA 5D96C 3C6LC 3QQ4A 1FVDA 4IRSD 2DM2A 4JDZA 4MDJB 4X5WB 5D8JH 4JFOB 2Q76A 1N7ML 4QHNA 5DEZA 1UWEL 3GBNL 3HCVA 4S1QH 1JBJA 1WT5A 3MUHL 4M6MH 4FHBD 5IB1A 1NGPH 5ETUB 4CL7A 3GSWB 1Q9LA 1ND0A 1AR2A 4ODHL 3QUML 4ORZC 4A6YL 3O6MH 2UWEF 5EZLB 3ZO0A 1J1XH 5EUKB 5GSRA 4NO0A 3T0VA 4BYHA 5SWSD 4X4XA 2AI0L 3H7LA 3G6JE 4NFCA 4ORGB 3CX5K 4HF5H 3PGDB 4QCIA 4EDXB 5MHSD 3TIDA 2BXZA 3DLQR 3DVGA 4OCWH 1Q72L 5HBBA 1FAKT 4YXLH 3GDBA 3EDFA 1EGJL 3W81A 2QKIA 5JHLH 2QBWA 2VNCA 3TBVA 4HUVA 3GSUB 1J0ZA 3LMJH 3SKOB 4AMKH 1LK3L 12E8L 5DD1L 3I9GL 3I75A 4J6RH 2E9WA 1QFOA 3ARQA 4ZFOA 1FAIH 1BM3H 5K9QG 3MZTA 3VXUE 3L3GA 3OR6A 3X14A 3DYOA 1UGNA 5KS9F 3W2DL 3CVHB 1I7UB 3QI9A 4GLRH 4XWGL 3T2NH 1BJMA 2CDGB 5FYKE 1MJJA 5DWUH 2I5YL 5DFVD 1KFAL 3CVHH 4OGZA 4UNUA 1F90L 3AM8C 4MZ3A 1U3HA 2X4QA 2X70A 5CZVL 4XVSH 4PGDA 4H20H 1QSZA 2HMID 3SQBA 1S9VB 4HZLB 3BJ91 4WGVB 1I75A 3GSRB 1WC7A 1JTTA 1RU9L 3BP6A 3WLBA 4CU8A 4K94L 5BVPH 3S97C 1CL7L 4YNYB 5E8PB 5EU4B 4R7NB 1H3WM 1BQHB 4JPIA 4M4RA 1BAFH 4Y2DC 5CHNB 4K3DL 1EBPA 5MP6H 4MJIE 2YXMA 1NLBH 3S3JA 5CP3A 5TH2A 5DUML 2AJVL 3TH3T 5GGVY 3CMOH 4DN4H 5DJ8B 1OD9A 1T2XA 4AZ8A 2CR3A 4WFFD 5T3XE 4ZUSA 3VXTB 2GJ6E 1DUYA 1RUPH 2AXHA 1CGSH 3FOLA 3TT3L 3JTTA 5C0FA 1NBQA 3VXOB 5EDXA 4HLZH 3W39A 3QCUL 3CFEA 4NZDA 3GMOB 1FN4A 2IC2A 4Y4HC 1IBGH 4M5YH 2FB4H 5HVFB 3ZDZE 1A02N 2XG5A 2CIKA 1AJ7L 5ALBL 5GS1B 5T1KA 5E4EC 3SDYL 2FEEL 4C83A 4CN1A 3GMMA 4O2CA 4TSAL 4ELKA 3ECBA 5KSUB 3BH9B 4DAGL 5INDB 3CSBA 3TLRA 3MA7B 4C4KT 1H8NA 4J3VA 5T33H 3GM8A 3RGVB 1CICA 3BKCL 3HA0A 1EIBA 4M7KH 5IKCA 3M17A 3BP5A 3ZT5A 5BO1H 1IAII 5FV2A 5A3IC 1YNTB 3KPMB 5GHWH 5EZIL 2GJ6A 4G43B 1CGUA 2VL4A 3PP3H 3UO1L 1CFTA 4U7KA 4MX7B 1N6UA 4JDVB 3PABA 3RWDA 1U3YA 1A6AB 1S3KH 4H8WH 1N4XH 4NT6B 4G8EB 5EUOF 4HS6A 1ZA3A 1J8HE 4ZFGL 5IB3B 2YSSA 4HFUL 5HPOA 3WJJC 4IS6A 4EOWH 4LMQE 2DQUL 4X6DF 3BPNB 3GGWA 1XH3A 4H88L 1FL3A 4WDIB 4Y8AA 3QJHA 4IIQC 1VADA 2DMKA 4MJ6B 1WBXA 4KQ4L 1T3FA 5L2JB 4PJ5E 4GXUM 2F74B 3MRGA 4NNPH 2YKLH 3PGDA 4WEBL 1OWWA 5JXEC 2MTPA 4KXZI 3C60B 2OBGA 2AV1A 4HIXH 5EU6D 4P5MB 5GGUB 5ACZB 1T1YB 5FO7A 3BVNB 1BEYH 4JPKL 1DFBH 2IALA 2YPLA 3T0XA 3LV3B 2QADB 3MMEA 2VDRH 3CZJA 3GSNA 1CR9H 3OKLA 1YEKH 4OLXH 4OD3H 4PJEE 4QRSB 4ZNEA 3W9DB 3J8F7 4QXTA 3QDGD 2EDJA 2AXFA 4GW4A 3PL6B 4LIQH 4FXGB 5GGVH 5KSBE 4RMVA 3Q6FB 3KYAA 5DJDA 4YHLL 4NM8L 2DJSA 2VLJE 3E6FB 3IDYC 4HWZB 2YPKB 4M62L 2DQTL 1DLFL 3V6OE 5ENWB 3G6DH 4UV4H 4LEXL 1C08B 2LU7A 5DDHA 5B21A 1X5IA 4XMLL 2AEQH 1SQ2N 1Y18B 4N0UB 2J6EA 3QUZD 1ZHKA 5TE4L 4IJ3B 4NQDD 4ZUUB 4WCYL 3UTTE 2IALB 2YPLB 3AAZA 5D8JL 2BXYA 3G5ZA 3N9GL 4GG6A 3PWLA 5GGUA 4I2XB 1SY6L 4K2UH 4G6FB 3BRGC 5EO0B 4XCYA 3QFJE 3RAJL 1VA9A 3AM8A 1KB5L 3QUMB 1V7NL 4OAWB 2MOVA 4LBEB 4S11A 3LRHA 1OTUC 1AC0A 1EZVX 4HGMA 3IRZA 5DO2C 1K3ZA 3ILQC 4ZNEE 4JLRB 2IPKB 1I9IH 1XF5B 4NJAH 5JW4M 3PV6B 2BP3A 3KPNB 4PJ9B 1QUNA 5JHDB 3MLSH 4U1NB 1WTLA 3T2QA 5KSBA 3LCYA 1F4YL 4HF5L 4LLVA 4Y19B 4LSVH 5IOPB 5FOBB 5A16A 3QWOB 1ZA3B 1JGEB 3ME0A 1T1WA 1KN4L 2AK1H 2AJSL 4KKCD 2JJTC 4NCC2 5FGBC 1A6AA 4LVNB 3WKMH 4MB3A 5JHLL 1WEJL 3D0VB 3BHBA 2R1WA 1LP9F 3VMPA 1YNTA 3V0VA 4RDQG 3E6FA 3RDTD 4ZFZB 12E8H 4G8GA 3QFJA 1NCDL 2KKQA 5L2KD 3EBAA 2L4OA 1UACL 2HT4C 3GKZA 4YDKH 3U9UA 3EO1B 1XGRA 5FECA 1SEBA 3B9VA 1JIBA 1YNLH 4AL8L 1Z5LB 3U7AA 1MQKH 4PJ7A 4HG4K 3MV11 4OCMC 4KI5E 4UIMA 1OD7A 5FM5M 3RGHA 3W2DH 4BSWA 1JZ6A 3RUGA 3CU1A 4FQ2L 1NFDB 2CIKB 5JIHA 4OZFB 1RUQH 2AV1B 1PJ9A 3AB0B 4XCFH 2IPUG 2R0ZH 4XMPH 3AMKA 1X5FA 5CZVH 3PWUB 5C0RH 4AEHL 3BAEL 1GH7A 4BFBD 1JF1A 5EO9B 1FJ1A 4ZFFB 2YK1L 2FX9H 1HIMH 4NO5A 1WK0A 3WN5B 4DZ8A 5FM5O 5HHPA 3HI6L 3MRMA 3N1FC 4ZXBD 4BQBA 5EU7C 3TIEA 1MHHA 4UOW0 1D5BB 5FF6A 2VSCA 3PABB 3PGFH 3RWDB 2PCPA 1NLBL 4LCWE 5DUMH 2P8LB 3I2CL 2APBA 2K9UA 4TYUA 3RUGE 3SDXE 1CS6A 5CIPB 1LO5A 4GAYA 3QDGB 1OAXL 3HNTH 3D39D 1RUPL 1QLEH 3QCVL 3DV4B 4AG4H 4XPAH 5HPMA 3HC3L 3CXHK 4MXQD 3F12B 1K8IA 3QCUH 1SJEB 3KNBB 5JW3L 3TV3L 4ZQKB 4W81A 1DDHA 4J1UB 3ULVE 1A14H 1NAMB 1V3JA 1U8LA 5I8CA 2PO6D 5JPNB 2AK4E 3CMGA 1KIPB 1XCQB 5C70A 2APXA 1DQJA 1TVBA 4YHZL 3CX5J 5H94B 4WFHD 1A6WL 2XKSA 3QXWA 2P24B 1F3JB 1QSFB 4YK4B 4I1NB 4ODWA 1XAUA 5FYKL 3IF1A 1YEGH 5DC0A 4P59L 2XYCA 3TA3B 2Q1EA 4UILL 4LL9A 4GOSA 1FNHA 3GBML 5IGXL 2A6DB 1RZFL 4GUPA 3GSUA 1E4XI 5GHWL 3RU8H 1YEDB 3VJ6B 2R29H 2R23A 3VXRE 1L7IL 2V5RA 3FB6A 4XTRC 1LP9A 3HE6B 5ISZB 3GK8L 4KVCH 1TVDA 5DMIL 4OCXL 4UDUB 4TUJA 5BW7C 3P73A 3DVGB 8CGTA 3QDME 5KG9A 2RFXA 3Q5TA 4CN4A 1BVLB 1MLBB 2B39A 5M7QA 3L3HA 4ESKA 1IGML 3SDCD 5GISH 5F3BB 5F9OH 5BV7C 5MEQB 3WS6A 2DQUH 2AK4A 3TT1L 3F58H 1BOGA 4HJGA 1YPZF 3G5XA 1QBML 5E2VH 4LU5L 4MQ7A 3ZDYE 1WIOA 5D6CA 1BFSA 2DWEA 5LJYH 3CCHB 3MV7A 1QFWH 4GRMA 4QRPA 1N5AB 3AC0A 4NNPL 4MJ2A 1JWSA 2QEJA 3FO2B 1JK8B 4XC1L 2PKDA 1NSNL 3M1BA 3FOMB 4PGCA 5HDOA 2ZUUA 3CDFA 2NY2B 3BWUC 5A40E 1FDLH 5J11C 2GY7B 4CVZB 3VFOA 4RGMC 4PJ8A 1S7XB 1Z0MA 1HHKA 3TCXA 1DP0A 3QUXD 4JO2L 4LIQE 4Z8FL 1ZT1A 5EC2A 2HVJB 3DBXB 4LSTH 4WY7L 4TSCL 3SEPA 1F3DJ 1H3XA 3TJHD 2Z8VC 1L6ZA 5DRNB 3PP4L 2GTZA 1RUAL 5GGVL 1CDUA 4GBXB 4MD4B 4RQQB 3MUJA 3LPWA 1W72L 3FT4B 4V1DB 4F80A 2NY2D 3DGGB 3ARYA 4D0BA 1DLFH 1IGYA 2D7QA 2VDOH 2EC8A 2P7TB 3OKMB 5IBLD 2K1MA 3MBEB 3CH8A 4L8SB 5DD0L 5DHVH 5CIPH 4LHQB 1JYNA 4QRPE 2AEQL 1X3DA 2OP4H 1UB5A 1G7HB 1KJVB 3TJEL 1PYWB 4LPVA 3KPPB 1ZLUK 1EERB 3QO0B 1DQMH 3TGXA 2I9LA 1SY6H 4JHAH 2HFTA 5DRWA 3BT2L 1Q0YH 2CRZA 3IFLL 4MNGA 4K9EL 1S7XA 1WIPA 5FKPB 3QAZC 1L0XA 4UQ3B 3BO8A 1QHPA 2GITB 4I18C 3NIFF 4R90H 1SY6A 2C7UA 5DXWA 3FB6B 2PO6A 3MLSL 4QRTB 4LVHC 2OK0L 4RFEB 5JOPD 1FVEA 2KUTA 2EIZA 4URTB 1IGFH 1H3VA 3TA3A 2VDMH 1OF2A 1AIFB 1KN4H 2AK1L 5EIIB 2DLEA 3H42L 1JUFA 2VDKH 2H2PC 1SEQL 1TENA 1AD0A 4Y4HB 3U30B 1BD2A 1E6OH 2AK4B 4U6YA 1GXEA 3HPLA 1S7UB 5CP7B 4UT6H 2DQGL 3FB8B 4U31A 1F00I 1DQJB 4YBHA 1HYRC 5EULV 5IB5B 1DQDH 4KJYB 3C2AH 4RMTA 4LARL 1UACH 4MNGE 1DDHB 4X4ZA 3LB6C 4YDKL 1FZOA 1ZT7A 4ZPTB 4L3EB 5D1XA 3L3OA 3WFCH 5BZDB 4XX1G 2EEAA 4YXHL 2VXSH 1JF1B 2XZCL 3DARA 4WHTA 4XVUC 3NVQA 5IHZB 4QHLA 4JRXB 2CRMA 4YFEA 1LO5B 3P0YH 2ADGA 2DI8A 2DM4A 2FH6A 4R0LC 2E8YA 4DGVL 3KPLB 1T89A 5EBGA 3EJZC 3KWWA 3NH7H 5SWZD 4LASL 5FF6B 1NCNA 1F2XK 1EUUA 1PG7L 2D3VA 4OZGA 5LXGH 3IDXH 1D5ZB 4QXGL 4NO5B 1NUDA 3OJVC 1CGXA 2BC4A 3TWCL 3BIKB 4BZ1L 2IMNA 2Z93B 3H0TB 3HI6H 4K3HA 2YXFA 3GZKA 3REVA 3UBXB 1IAIL 2H1PL 2ICES 3B5TA 3TBSA 4X6DB 1ZT4A 5I0DA 2R1WB 2EE6A 4LAQH 5CUSH 5TQ0H 1S7WB 3ZE2F 1FE8H 2P42B 4JGJA 4U1LB 4I18A 5A2KH 1OAXH 5GZOC 4UDTA 4OD1H 5DFTA 3QIBC 4XHJD 3BEWB 3QWOA 1WAAF 4OCRH 2G9HA 5HHPB 1MIMH 1F8TH 2AQ3A 4F9LC 4Z18A 4QT5B 4U6TA 4FQCL 3QUXC 4WU5B 3HFMH 4OFYD 3BSZH 1A14L 1OP3K 2YWYA 3I02B 5GGSB 2WLYA 4U6XB 1BFVH 2VZ1A 4JZOA 3PWUA 4PJFA 1YJDC 5CJ5A 4XCYB 1RZJH 1DN0A 3DMMD 2AGJL 2YD3A 1WBYA 5E8DH 1UEMA 4JRYA 5HYJA 4XXDA 2NY7H 1DLHB 4M6NH 2EH7L 1UQSA 4JY6B 2M8XA 5DR5L 3TESA 2HLFC 4HJJL 3ULUD 4DEPC 2J7LA 4M1GL 4ODUB 5BCAA 1E6JH 1CF8L 4A2MA 1NGWA 5DGQA 5KVGH 1CFNB 3QIUC 1A6VH 3PQYD 1A7QL 1IC5H 4PRHE 4FXGA 4LVOC 1U36A 1M7IA 4I48B 1M7XA 1JV5B 1I9JL 1ZV5A 4TVPL 2PN5A 3VWJB 2HTKC 1IE5A 3X11B 4WJ5B 5DVMA 3F58L 1WFOA 3N1MC 2FD6H 5CD5D 1R5VB 4ZOEA 1PKQA 5TQ2H 3SCMA 2XZAL 1RAMA 3VGGA 2R4RL 3MJ8B 2HP4A 2IGFL 4PG9A 1PW3A 4NQXA 1ZHNA 1RIUL 2OZ4L 3SDAA 2DF3A 4HS8H 3FQRA 3EHBC 4F7MB 2OJEB 1U9KA 2N1KA 5K9OB 2J8HA 4U2ZA 3KYMB 4OIIL 1NGPL 4DN3H 4YAQA 4G9FB 1MUJB 2Z92B 5DC9B 3FQNA 4NP4L 1FDLL 4R2GC 3QUMH 5DA4A 4L1DA 4ZS7H 1OAKL 1WBXB 3FO0H 1ZXQA 1J1XL 2IEPA 1UXWA 4ETYA 4HC1H 4J8RA 4JO2H 5GS0H 1P7QB 3FHAA 4FN0A 4K55A 5HD8D 4WY7H 2OSLA 1T5XB 3FMGH 3PDDA 4DK3A 1WWWX 4LPWA 5DJ0B 4NQEE 5JTWA 3WUWA 4FQIH 2HAZA 5IQ7H 3IFPA 4OZFG 3FTGB 3QH3B 1E27A 5T5FL 5A2IH 1BZ7B 4ONHB 3EDKA 2IAMA 2VL5A 4RISL 4KFZC 4L8DB 4PB9H 5C9JB 4LAJH 5SWZE 2YZ8A 2DLIA 4P57A 4I0CC 1CK0L 2J4WH 1GOHA 2EEBA 4NZRH 4F9PA 1YNKL 5D71L 4PP1C 4U6XA 1OL0A 2GJ6D 1UH4A 3NCCB 5D5MB 2HVKA 2FIKA 2VZ3A 4E0RB 4PRHB 4Y5XB 3N85L 3PWJB 5DZNA 1SBBA 1P1ZB 3WXVH 4QOKA 2UWEE 1I7ZA 3VXMD 1C12A 1ZEAH 4OCYH 4PJIB 4UNTA 1S7RB 4GKSA 5JO5A 3VXNB 2B1HL 3L5JA 4NUGL 1IAKB 1CD8A 5KTEL 3LV3A 3QWRD 1FVCA 2V2TB 4UB0L 2I5YH 4N90E 4AEFA 8FABB 1HWHB 1CE6B 3KR3L 2GTWB 4BZ2H 4JG0L 4R90L 2IG2L 2ED8A 5BQ7B 5J0BA 1MCKA 2ZSVB 4WO4B 4PY7A 3RJQB 1URLA 2J88L 3HB3C 2EYTA 3SDXF 4X6DA 3GMPB 5HGBA 1TXKA 2DBLL 2VTFA 1QBAA 2GSGB 2L7UA 3H42H 4TRPH 3R0MA 4H1LB 5MERB 5EFIA 1NC4B 1FLTX 4W6XB 5KOMC 4Y4KD 1ZS8A 5TH2B 3GSNL 3KYOA 5INDA 3RL2A 5CBAA 3LRSB 1I8IA 4XXCC 2CUMA 5MP6L 1FO0L 1NMCC 3LQMA 4HZAA 4ODTH 5K9KA 3UDWA 3H3PL 3SJVB 5DVLA 5E7FA 1OB1A 1VKXB 1J0IA 3KXFE 1HNGA 3VRJA 4WU7B 4MVBC 3O2VH 2P5WD 2W65A 2ZCKH 4NHCH 3DX8A 4PB0H 5DMKB 2VRAA 3RA7H 3VXTA 2Z31B 1U8NA 1Y6KR 4QRPD 1NBVL 4X6DE 1D5XA 5ACLA 3P0YL 5ALCL 3TPKA 4M5YL 2F54D 3ZHKA 2FJGB 4WNQB 3ARFD 2VDQH 2BNRE 4I0PA 4LEOA 1DR9A 4H0GA 5LWYH 3D18B 2EYSB 5T1KB 4R7NA 4DKEL 1U8JA 1G6VK 4U1MA 3FAWA 3K3QA 2VZUA 4P4KC 2WZPD 4HV8A 4FTVA 3P4MB 2X4RB 3SGKC 4CU6A 5I2IB 4ZUSB 1KCKA 1OP5H 5BW7A 4F37F 4WNQA 4P9HC 3FRUB 3KPRB 1PD6A 2NXZB 1LDSA 3FHQA 1MFDH 3ZE1F 4FQXA 3BN9C 2BSRB 1Q0XH 4NJ9L 1FE8L 1BQUA 1QLFB 3BO8B 2NTFA 4I77L 4C57C 1ROWA 3CUPB 5GRJL 4FABL 1JZ5A 5EH1A 5I17B 5H2BA 1I7UA 1E4WH 1F13A 4GAJH 4ZFGH 3RI5F 1RVFH 5DJ6B 5HYSB 1OB1B 1VKXA 1OAQH 1YMMD 3C5SA 4LPXA 4DQOH 5D5MF 4QHKJ 7CGTA 2XY1A 4JREC 3FO9A 4ZUWB 3BJLA 1YMMB 1VEMA 1Q8MA 2AJUL 2FJHB 3RVVC 2XN9D 3IFOA 1TETL 1S78D 1S9VA 3LRSA 3HE6D 2E6QA 5JHDD 3SKOA 2YKLL 4OD2B 1RZJL 3MLTB 2XQYG 4JRYD 3ULSB 2FX7L 3RHWK 4LCWD 4FFYL 2DWDA 1BEYL 3OQ3B 4GBXA 4MD4A 5EU5A 1FZKA 3FQUA 3GSOA 4Y16C 2NY7L 5AD0B 3WFHB 2EYTB 3BISA 1CR9L 3IDGA 4O02H 1KB5B 3EOBB 1FG2A 3NA4A 4OLXL 1S9YB 4KMQA 1S7SB 2YD9A 5HHXH 1KELH 4UTBL 1FCGA 4GRLB 1I7RA 2WNGA 5MEPA 3C6SA 3L9RA 1HHKB 3UTTB 4G9DA 4OF7A 5HHOD 4LIQL 4PV8A 2XPGB 2HFEA 3UEZA 1H15A 3EFFA 1HILB 1YY9D 4X6FB 1LGVA 4K8RC 4S0TD 5C3TA 4P46B 3TN0A 4MGXA 4UT7H 4LSSH 3CSGA 5F7DB 3SE4A 4X6CE 4G8FA 2HA1A 2VABA 3R4DA 4TOYH 1QSVA 2DIJA 1XCTB 3FONB 5TQ2L 4WCYH 1MAKA 2GFBB 4P4KA 1HQ4B 2NY6C 4K2UL 1PY4A 1F4HA 4X7CC 2X4NB 4BM7A 4B0MM 3BWAB 1NBYA 3KYNB 4HKXA 4LPCA 3VFPA 1K4CB 3MLXH 1BZ7A 1HEZB 2QR0A 1U8IB 3QEQB 1MCHA 3U4AA 5CEXB 2DDQL 3KPSB 5F7YC 1FNSH 2GCYB 2RCSH 1OCWL 1O0VA 3T77B 3DSFL 4P3WA 4OQTA 2V5SA 1L0QA 2OSLB 3BYTA 4WFGE 5GS0L 4KVNH 1KF9B 4MD0B 1CGWA 3EUUA 1UG9A 2Q76B 2MQ3A 2HG5B 3KHOA 3SGDH 1XGQA 2PR4H 1J86A 4MWFB 5CJQH 2X4UA 4ZOAA 4Z7QE 3GJFA 1FORH 3G6JF 5BS0E 4JFEE 1NCWH 2BVPB 1J8HB 1I7TA 4RX4D 1MCBA 2Y06H 4U6HA 2NY4D 3SCMB 1ZK9A 4J2XA 3RPKA 4P2RA 4IRJC 4WENB 5TDOB 5CJOL 3FT2A 2WW8A 5HHQA 4HMDA 2PNDA 3U0TB 2O5ZH 4WJ5A 2IJ0C 2ZKHH 5DHXB 1EHLL 1GGCL 3I3EA 1HHGB 4L4TD 3WXVL 2X7LA 5JPMA 1EO7A 4NQUA 4NKIH 3BH8A 3IRPX 1WSST 1DQTA 2X40A 3VWKD 1RZGA 1ZKAA 1DVFC 4TUOA 3NABH 1T5WB 3LVEA 3BGMB 5E2WH 1B0GA 4NUGH 1T1XB 4L3AA 5DC4B 1OSZA 1KJ3H 4G8IA 5L9DL 2VR9A 4W4NA 3GSQA 1I3GH 4Y0GA 1S9XB 4EDWL 4OGYL 4F57L 1QPPA 4AEHH 5J7CC 2F54A 1E4XL 5GRYA 5HY9A 2X4SB 1NFDF 4JO3H 3SO3C 2CD0A 1NCAL 1N5YL 4GAFB 2FX9L 2ZWLT 4OLEA 2C3VB 3FFCD 4P2RE 2ICWI 5DVOA 5ESQA 5J6GB 2BHZA 4Q9CA 2FR4B 1YY9C 4DGIL 1G9MH 1FSKB 3G5YA 5E1AA 5FDYA 3OBAA 3U0PB 3MRFA 3NPSC 1ZVSA 1YQ2A 2X4TB 5E08L 4PJDF 1TCRB 5KSAA 3DV6A 1YA5A 1UXSA 4L4VE 2X4SA 1G7IA 1FL5B 1EVTC 3O2VL 5I9QC 2ZCKL 4PB0L 3IDNB 4XPAL 5IK3B 4XH2A 4M4PA 2BVEA 15C8H 3U48A 1OARH 2OTWB 3V6FA 4DUWA 1NBVH 1MHCA 4HW6A 2R0KH 3B2VL 2F53E 5FO9B 1QBBA 5JW3H 1A6UL 5DZLA 2ARJB 3RIAF 5A43C 2ED7A 1U3HD 5LQBH 4NO0D 5JA8B 4NPYB 1TQCC 4YHIA 1L4IA 2QQKL 5SV3A 1QACA 4R4BB 3B5HA 3CFBA 2P5WB 3QA3B 2AV7B 1FYTA 3GHBL 5IJVA 5E6ID 3JV4B 4LQ1A 3QDMB 2HJFA 4YWGH 2GIYA 5IW3A 3WEXA 4NWTH 1YEGL 3QDAA 3EIFA 1ADQH 1BGXH 3O6LL 3W11D 3JUZA 1AI1H 4MNQB 4CGTA 5IGXH 1RUMH 2D03H 1RZFH 3C8DA 3LIZL 3D85B 3LOWA 3DV6B 4OUUB 4L4VA 2NY1D 4LCUB 4XP1L 3VI3E 3SHSA 4U1KA 2ADGB 1MFDL 4PJ9A 2B1AH 4Y89A 2HH0L 4JR9L 4KVCL 2VLME 1JPTL 5JW4N 3K2UH 3LB6D 4OZIB 4KTEL 3VXSD 3QDHA 1RZGB 1BHGA 1E4WL 4GAJL 5F93C 1A7NL 3EOAB 4N5ED 3NCYS 1KBGH 2WBJB 1IGMH 5D1XB 3NACH 2AJ3A 2P5EA 4UUJB 4XVJL 3ILQD 1C1EH 3PWLB 3C87A 1TNNA 1CE1H 1FL6B 2PTVA 1G9NC 1P4BL 3KPTA 5E2VL 4N8VA 4Y2DB 3OKEB 1J8HD 1OM3H 3E6HA 4EUPA 3QIWB 1N0XL 4P5TC 4TSBL 2Y36H 4FQ1H 4P3CL 3ZDYF 5DZOA 1S9XA 4Z7VA 4OLVH 3S3SA 4O4YH 3QUZC 5GRVL 3VXMB 1JNNL 1AD0B 3FB7A 4Y4HA 4E9LA 1Q9OB 4PJAE 4M1DH 3VWKA 4P9MH 3MLYH 2JIXA 2R2EB 4M43H 4HUUA 3LKNA 4NRYB 5DUBA 1JPFA 1OGAE 3E8UH 4D2NA 1H15B 3BESR 1FV1A 1P4LB 2A6IA 3PP4H 4ZD3H 2O5YL 1VEOA 3MRQB 1KTLA 2X4NA 1YMHA 3MREA 4X8XA 1IAMA 3P11L 4LSSL 4D0CA 4RGOH 5DD0H 4XGZB 4NRZA 5BXFA 4KU1A 2H6PB 3HAEG 4N1EA 3RY4A 3VDAA 1BIHA 1NMBL 2C3WA 1K5NA 3SE3C 3MBXH 1UVQB 4F9PC 1G6RA 5F7DA 5ADPL 1MI5D 5IB2B 3JV6B 1UWEH 3GBNH 5DJCB 3DJ9A 1A4KB 2ZPKL 1MWAA 3CXDL 5E03A 2X4OB 3IKCA 2CR6A 4DGYL 4MJID 4NNYB 4JM2B 5GRWA 1KIRB 2EXYD 3BGFC 4RMRA 1NGXA 3O6ML 2FL5B 3BMVA 1S8DB 1SYVB 1F4XH 3BWAA 3HNVL 2HVJA 5GRXG 4IOIB 4KVNL 5C09D 4NN5C 4EXPX 5I71B 5EB9A 1RZ7H 4U0QB 4LLMA 5TDPB 2VLKA 4HCRL 4HAGA 4ZSOB 4X4YB 2FRGP 5JMRA 5IW1A 2DOCA 2VOTA 4JO1L 1FFOB 1MJUL 4OCWL 4LCWB 2FECI 5A3ID 1A1MB 1UH3A 3A67H 3QB7C 1HH9B 2DQGH 4AMKL 3ET9F 4PJDA 4X83A 4O2FB 1DQDL 3I9GH 5BZWB 3D48R 4CDHA 5JORA 1GGCH 5HD8C 2ZP0T 5TF0A 2F8XC 4Y5XC 4YXHH 3WFHA 1U3HC 3LKRA 5IEKB 1OGAB 2CDFB 2V7HB 4TUJB 3SKUD 2FCBA 5DVKA 3T2NL 1YY8A 1NAKL 2CLRB 3VWJC 1LP9B 3HE6A 4TNVK 2DWDB 4NWUL 5L9DH 3TYGH 3GSXA 3CJJA 5BS0D 1YY8B 4GS7C 2XRAL 5BRZE 4P2OD 1JRHI 4JAMB 2D0FA 5D7JA 5IVXF 3T0EE 2DJUA 4PREA 1W8NA 4XNUH 3C6LA 5LXGL 5JOPE 3QFDB 1JTPA 4ZTOL 5BMFH 3LEXA 1UKSA 5C08E 2BZDA 4KJQC 1N5YH 1T2QL 1SMAA 1GPOH 3MROB 3ESUF 5IM7B 5I16A 4GQ9L 4OFKA 5DD3L 4IRJA 6CGTA 4FQXD 5IMMA 1QNZH 4PGBB 2EDTA 3ORJA 3O0RL 1J05A 1K8DA 4R97C 4HXBH 4LAQL 1NC4A 1A7RH 3KPQA 1J7VR 3L6FB 5AZ2H 1PY9A 1MJ8H 3ZSSA 3G08A 4L3CA 2IH1A 3ILPA 5BV7L 1TMCB 3TT3H 3H2WA 5J9PB 2JB5L 4Q9QH 3CFJA 1F8TL 1RJLB 2FB4L 5CGTA 5HHMD 3HFML 4AIXA 4WI2A 1AJ7H 5ALBH 1IAKA 4S1RL 5C08A 3G6AB 2VIRA 4HGWB 4LKXB 4TNWK 3FKUS 3KYOB 1CLZH 2FJGA 3WNPA 1F11A 2XY2A 2AGJH 5EFIB 1GHFH 4YDIL 4NQSB 3FFDB 1UKTA 5I1AB 3D0LA 5F6HJ 2W0FB 5ID0A 4NQVB 4WWKC 2JB6B 2I27N 5BRZB 3TZVB 3VFWB 3ZLQC 5DR5H 1NJ9B 3N1QC 4MZ2A 4P5KA 1AGFA 4XP1H 5F8RC 4Y1AB 3AB0C 3P9LA 5EZIH 1RQ5A 3RRQA 3MODL 3O6FC 3OL2A 3ARXA 4HMEA 5IMOB 4P9HH 1P4LA 1A7QH 3L1OH 4Y4KA 1V5JA 5JLZA 4FQPA 1DVFB 5TGBA 2AXGB 2J6EL 2QL1A 4QWWD 4EOWL 1P1ZA 3NACL 4HQQL 5HHMB 4XPBL 2HT2D 1C5BH 3NOIA 4H88H 5J3HD 3I6GB 3MV9B 4Y16A 5A2FA 5ERWB 3U4EB 1X7QB 4KQ4H 4APQA 5HVGB 1OM3L 1DBJL 2BVQA 3MO1A 3GMNB 4HS8L 2CGRH 2N7AA 2XWBB 4U05A 2VLJB 4YBLC 1EGJA 4OLVL 1XGPB 3SGJA 1U92B 1ZHNB 2Z4QA 3R06B 4PRDB 5FA3B 2YD1A 1TCMA 5ICYB 4JPKH 1DFBL 1SBSL 3IFPB 3RNQA 1OAKH 3RVUD 4Y88A 4WUKL 5DT1H 1CFQA 3DHJA 3UTSE 4HS3A 1IGCL 1HI6A 3VXUA 3O8XB 4UUJA 4OD3L 1YN6A 4LNRB 5ANMB 3HMWH 1D6VL 1INQA 2Q6WB 4FQIL 5IQ7L 2F5AH 1DE4B 4ZD3L 1B3JA 3Q3GA 2Z92A 2O5YH 4RISH 2PYEE 1DBBH 1KNOA 2Z8RA 4Y4FA 3CXHJ 5E7BA 5M95B 4JN2A 1RZ8B 3EAKA 4GKZA 1A7BA 3BPLC 2H2PD 5D71H 1ZE3C 4JRYB 4HIEB 4Y19E 3SGKA 3U46A 3M45A 4ZSOE 3MBXL 2F8VA 1WISA 3PWVB 3N9GH 1TQCB 5ADPH 2PW1B 4ZXBA 1YEIL 4J8RB 3ARUA 4X6BB 1KB5H 1V7NH 3UTSA 3CXDH 5ADOH 2YD8A 2YPVL 4OUOA 4NOFA 1Q9OA 4TN9A 4YAQB 3KLAB 1OTSC 4PJCA 4BZ2L 4ZUVB 3U82B 1RHFA 2BDNH 5C08D 5DLMH 2NTSP 1S7VB 5B8CC 3B2UC 5I1IH 5IJKA 4B7IA 4YZFF 4Y2DA 4YIQA 4I18B 2B7DT 5GS2D 5CINH 1CT8B 4GKNA 1UWXK 4JO1H 4OGAD 1JTOA 1AO7D 4NQED 3C60A 2X4TA 1CIUA 43CAA 2NLJB 3B4NA 3RL1B 1T83A 4RWYH 3MNVB 1WEJH 5E8NB 3OKDB 2NY4B 1M71A 4BKLB 5J12B 1H9VA 1IM3A 2VLRB 1NCBL 3VE0B 1R24A 3WO4C 3P9MB 4MAYB 3QFJD 1BJ8A 4XAWH 1FO0H 2VWEC 5I15H 2D31A 1FL3B 5I8KL 1ZLVK 3SBWA 4DUXA 3GO1H 3WBDA 5FUOH 3BZ4B 4NQCA 4HUXB 5L2KE 3BQUC 1RJCA 4MXVF 4JY6A 4PJCE 2CKBL 2F54B 3RVUC 2Q7NA 3BUYB 1MAMH 1YYMH 3VW3H 5F1NB 4N0FA 3V5DA 3T2OA 1QHOA 4E41B 3TYFB 4JFFE 3GNML 1X5XA 1UA6L 2XN9A 4P2OA 5I75C 1CYGA 4PRNA 2FLBT 4PJFB 3OAZH 4XCFL 1HYSC 4L3CB 4I0KA 2XRAH 5ESAB 4PTUA 2Y7QB 4Q9RH 1GGIH 1P7KB 3D39B 1ZAGA 1S7TA 5EC1A 5F9AC 2QLVB 1TJHL 1T2QH 4ZDHB 1GPOL 2AEPH 3SDCC 3O2DA 4OZGB 2FHBA 4P2RB 3SO3B 3LN4B 4HH8A 5E1HB 3DRQB 1FRGL 3G9AB 4K8RL 3NTCL 2ITDB 1NC4D 4KGLA 1RI8A 3E0GA 3IB4A 3O0RH 4EJ1C 4G8GD 2R0LH 3PGFL 2H3NB 1WZ1H 3U7YL 4MA7H 3I3BA 3O3DA 4OFPA 4DZBB 4FTVD 2CIIA 1Q0XL 3I2CH 4FMFA 3O8XD 3U9PH 4YDLB 4LDLB 5GRJH 4FABH 1MJ8L 5T1LD 2AAVA 4PRID 2Q8AL 3BKYH 5BV7H 2WQ8A 2Y23A 4Y2DD 2FWOA 2K7QA 3GI8H 4UQ2B 3T1FB 2VLJD 4P5TB 1DANT 3TV3H 1HE7A 5T1MB 4U49A 3K8LA 1HEZA 4O00A 2A9NH 3CSYB 3IDYB 4FXKA 4I4WB 2HJKB 2A0LC 4RFOH 3TBYB 1HH6B 4PRHD 3PG2A 2F58L 3MV9D 1LO0H 1CLZL 4FQJH 4POZC 2DBJA 2FX7H 5GS2H 3L3KA 3RWCA 3GSRA 4KKLC 4HCRA 1JUFB 1WZKA 3EO9L 2MQCA 3NFNB 4PP1D 3QPXL 4JRXA 4ZTPH 2QV2A 2ATPA 3TO4B 3BIAX 1FH5H 4YPGA 4NCDA 4GG6E 4P59H 3F62A 4EI6B 4UILH 4NZJA 3KXFB 5CGYD 3GBMH 3LN4A 3RU8L 3BOVA 4UQ3A 4DOHE 1MWAL 3F7QA 2CUHA 4OCXH 1Z9OA 2ZUSA 3L1OL 5ECJE 1KJ2A 3C6SB 3L9RB 4OI7A 2E7BA 1U0QA 5DRWB 1IEHA 3GKWH 2ICWB 4LLUA 2J6EH 3VG9C 1KC5H 1LWRA 4KTYA 4PTUB 3VRIA 3QXDB 1EJOH 5HYFA 1NAMH 1TVHA 1FG2B 3UROR 4OIAA 2H8PA 1MCSA 4AH2B 4JFDE 3TT1H 4PJ9D 4JM2A 2QQLL 4CVZA 4DW2H 2VSDA 1EV2E 2VISB 4XBPA 1I1FB 1PFCA 1DBJH 4ZOCA 4M8QA 4RFEA 5DJCA 3DUSA 4LKCB 5HDQH 1QVOB 1HKFA 2QKIB 1R3HB 4V1DD 2BSSB 4V1DA 3T0WA 2JJTA 3KPSA 2F8OA 4G8GE 3FT3B 4ERSH 1SBSH 3HAEA 1G7MB 4DWHA 2RB8A 3OTTA 3P4LA 1TVHB 3TNMA 2Z31D 3IXAB 3K4ZA 3BRFA 1N26A 4QRQA 4X6CB 3QI9C 4LSTL 3CH1B 4PLKC 4NO0B 5LG1A 2X9WA 5E56A 2OL3B 1CDIA 2KL6A 4G7YH 4KRPB 2NLJA 1QLFA 1U8KB 1T20A 2J8UA 5F9WC 1Q72H 3MJ7B 2HLFD 4NRYA 1MCLA 1GGBH 1X5AA 5F1SA 1JWSB 4JGUA 3TN0B 4X6FA 1T0PB 3LMJL 4I3RL 1RSFA 1ZSDB 4ZPVA 4H26A 2OP4L 3KLAA 4J3WA 2CIIB 3WNLA 1R0AH 4ETQA 1EJ6A 1WF5A 2PYFA 4HFWA 1S7SA 4QEGA 4AM0B 1YEIH 4NNXA 3O2DH 4QRRB 4X5XA 3BT2H 1GOGA 3IFLH 1HOCA 4PGEB 5E2WL 4RRPA 4CN6A 2YPVH 4XX1E 4XWGH 3K1DA 1IC4L 2A1WH 5FGCE 4JCMA 2H32H 2Z91B 3QJFB 1VB9A 3WHXB 4OLUL 3SCMD 2C5DC 5B4MD 5DSCA 1JK8A 1WT5C 4EDWH 4F57H 1K8IB 2J8UE 4XVSL 3RWJB 3VFTA 5JNYA 5KVMC 4FQQA 1NEZA 1MPAL 5I1IL 3UC0L 5C0BD 4CMMA 4HUWA 3GFUA 2P24A 3WIFA 4QHUA 1NCAH 4CNIB 4L4VB 4LCUA 4QHKI 1INQB 3EOYG 3Q48A 3BUYA 1T21B 1CL7H 2YUWA 4DGIH 5EPMB 4K3DH 1QSED 2KH2B 5I15L 2P8PA 4LPTA 5I8KH 3GMLA 2R23B 3U2SA 1PZ5A 1ORSB 2YD7A 4R4NC 3C5JB 3CMOL 1CICD 2Y7QA 1V7ML 4U6VL 4BFGA 2EE2A 3EJZD 4KDTC 4RGND 5IFJA 3INUH 1LEIB 3O6FA 1LNUA 4LLDA 1YYLL 3O4OC 2BVQB 4FTVB 1ACZA 2ZSVA 2EEDA 4PG2C 1FBIH 1LP9E 1UA6H 1PQZB 2W60B 4K7FA 4JZJC 4WI4A 4OLZL 1MHHB 3C5ZD 5LQBL 1EEYB 2DKUA 3ES6A 3NH7L 4LASH 4QNPF 4L3ED 4YO0B 3B9KA 5DJYA 1A1NA 4PBVC 3HI1B 3ZT6A 4Q9RL 1S7VA 2VZTA 5E2JA 4DAGH 3IDXL 4ZFFA 1I3RA 4JZJA 5JDSB 3EKCA 3BGFB 2AEPL 3W82A 2VE6B 1MNUL 1IAIM 5ESAA 1FNAA 1BGXL 1KYOK 5ID1A 4Z77B 4KKAD 5K33A 1IAIH 2H1PH 4KRLB 3RUGF 1U3JA 2MPAH 1E0OB 3LIZH 3JVGA 1WZ1L 3U7YH 4P3DB 5EBWA 5FGSA 4RX4A 4YIQB 1A7OL 2ESVE 4KUZH 2Z8WC 4KJWD 5IFAL 3RUGB 1E27B 1N4XL 4RFNB 1U3ZA 1LK2B 4OD1L 3TFKD 1RJYB 5F96H 3BKYL 4NQCB 4HFUH 5F9DC 3O4LD 4OCRL 2WLZA 4AIZA 3N0PB 2HT3D 1I1AD 4FQCH 1JL8A 4GRLD 4ZFZA 1B4JL 1T5WA 2A9NL 1C16B 4RFOL 2E6PA 4WEBH 3UTSD 3T2PA 3BPLB 5GZND 5EBLA 2BX5A 4HIXL 3FT2B 5E8DL 2GSIB 3EO9H 5CD3A 4FFWC 3U2SB 5ICYA 1JGEA 3LKQA 5DJAB 1I7TB 3MZGB 3DX9A 2SEBB 4Z7WF 1TTFA 2QSQA 2Q7YA 4UI2A 4PBXA 5CEZH 1YEKL 4PGBA 4Y4FB 4RZCB 3NIDF 3CSPA 1NBZA 1RUKL 4GJTB 5FXCH 1E4JA 1EFQA 1QR1A 1E6JL 3E8UL 1WIUA 5GZNC 3RTQA 4CNIA 1IC5L 3UDWC 4LSPL 2F53B 2XWJB 3C6LB 3JV0A 2DQTH 1I9JH 1TQBB 3VXUB 1N3NB 5I1JL 4PJIF 3EYOA 5JDJA 3QEUB 5GGQL 1EJOL 5GRUL 3QQ9C 2C4FT 1D6EA 4HIEA 2FD6L 4CJ1A 5A16B 4M93B 2CLRA 3KYNA 4GKZB 5EU3A 5EZJA 3TFKC 3QUYA 4BH7A 1KNOB 3WFZA 2NY5C 3T3MF 1RMFL 2JLLA 2Y1VA 2YPKA 1BZQK 4OKVA 3RNKB 4IOFC 3K74B 3QSKB 3WO4B 2C26A 4JLRA 4HKJA 2UYLB 5C9KA 3SDCB 2GJJA 4MCYA 5T1KD 5C0EA 3HNVH 2J5LB 4HC1L 1F4WL 5E94A 5AG9A 2YSSB 2SEBA 4Y4KB 2P8MB 5D70L 2I9TB 5HXMA 1YPZA 4NT6A 2DQFA 4DK6A 3WFDH 1PQZA 1RIVH 4K7FB 3TVMD 3C60D 3MCLL 1LO4H 1WFUA 3MA9H 3WKML 2YD6A 5IB4B 3OX8B 1CK0H 3MRGB 4HK0B 2J4WL 5HDLA 1M7IB 2VYRE 3GSOB 4NZRL 3CFKA 3D0LB 1SVZA 4AIOA 5D2NB 4Y16B 4RGNE 4X6CF 5D96B 1AGBB 4PJBA 4MNHB 4PJCF 1IMHC 3UZQA 2NPLX 3N85H 1RURH 2D7PA 3OR7A 4NDMB 1YNLL 2R69L 3BH9A 2BJMH 1MQKL 3O2DL 3SE4C 2O61B 2Z35A 3DURA 3JV6A 4IRJB 4BK5A 1U91A 1HWGB 1K4DB 4HLZG 2GAZA