1KG0B

Structure of the epstein-barr virus gp42 protein bound to the mhc class ii receptor hla-dr1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
188
structure length
188
Chain Sequence
TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords MHC class II Receptor HLA-DR1
publication title Structure of the Epstein-Barr virus gp42 protein bound to the MHC class II receptor HLA-DR1.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2001-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kg0B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1kg0B01
3ZO0A 4QRQA 4XWOD 3GMOB 4NC0B 3KPOB 4KWUA 3FOMA 4HWBH 2MKWA 4Z0BH 3WEXA 1HHGA 2RBLA 3GMMA 2DI7A 3SKUD 3LEVL 5IK3A 3MYZA 2KQNA 4I77L 1NCWL 3BO8A 1F90L 2IFGA 4JRXA 1EDQA 4KV5E 2VABB 4EN3C 4EDWH 1HYRC 2A1WL 4E41D 2XKSA 2YBRA 2HFGL 4D0CB 1DBKL 5DA4A 1G9NC 3KYNB 2EIBA 4XCFH 4LU5H 2X44D 3IU3A 3RX5A 2K7QA 3ZTNH 1PY9A 1MJUH 4L4JA 5BV7C 4CMMB 1CBVH 5DJ6B 3SDYH 4EVNA 2GFBB 1NSNH 2EO1A 5SV4A 4XWGH 1RUML 1BHGA 1XF5B 4PJXE 3UXFA 3MGOA 3HC4L 3TBWB 1ND0A 3OR7A 1X5AA 5B4MC 3K2UH 4RCAA 3SQOH 2D03L 1S7TB 3QIBC 2NY2D 3K8MA 1EXUA 1WZMA 4Q9RH 3QWQB 1JWUB 5E99L 1MVFA 4LLDB 5CD3A 4RNRB 3EYOA 4M5YL 4OLUL 5IM7B 1U3HA 1MLCA 1HYSC 2R0KL 1OPGL 3MJ9A 4O51A 1OF2B 1K85A 4U1MA 4ODXA 4ZOEA 5F7KC 2Z93B 1T1YA 1JZ3A 4FRWA 1NCDH 4OM0H 1T22A 2AXFB 2BY3A 2J8UA 2AK1L 4HDIA 1OP5H 4U1IA 3BZ4B 3SJVE 4YDJA 2I60H 1HOCA 4IDJL 4LPXA 4F9PC 1N59A 4U7MA 1OAUH 1G7HB 1DQDH 1M7XA 1V8HA 3N06B 3OJDA 4XPAH 4MA3A 3QJHB 4PB9L 4NM8L 1JN6B 3FB8A 4MJ2A 4ZAKB 4CU7A 4NQSA 4UUJB 1FQ9C 4LSQL 3VW3H 1XIWA 1QFWL 3F6IA 2M1KA 4HFWA 1KUMA 1MFCH 3JV0A 4HHAB 4O9HH 5E0QA 2HVJB 2XN9A 2DJ4A 3WN5A 3MRIA 4QHLA 2HLFC 4YDVA 4F7EA 3GMLB 5K59F 3CSYB 2NXZC 1I1YA 4A2MA 2MMXA 1IKNA 3PDOB 3MRMA 3NCYS 4ODBD 3PWLB 4YQXH 5TDPA 4IDLA 3V0VB 1VFMA 1PKQA 3KPNA 3RWGA 4CJ1A 5IESL 3R0MA 1OAZL 4I4WB 3RI5K 1CG9B 1I1CA 3GRWL 3BRGC 3GRWA 5EBWA 5J56B 5F44A 1GCFA 2XZQH 2FIRT 1XF3B 3QFJA 1F2QA 3OX8B 5C2BL 4UDTA 2Y72A 4ELMF 5EO9A 1CU4H 2X4OA 2APXA 5IROC 4LLQA 3ARFB 4RMRA 4PRBA 4ELKB 4AIOA 3CDGA 4AEHH 3C60A 3UPAA 3RWJB 4CMHB 4GRWE 5SX5H 2WBJA 2IALB 4FXKA 4JFYB 3HMWH 5ANME 3WE6A 2Q8AH 2NW3A 1MRCL 4PTTA 2A74B 3SE4C 2VDKH 4BFEA 1BAFH 5GGTL 4KJYB 3SDCD 2D31A 5AG9A 5KSVB 2BSTB 4QXTA 5HHPA 1TVDA 3WIHH 1AR1C 4YXKH 3ARVA 5I8KH 1TZGH 4BFGA 1M1SA 2CPCA 1IVLA 4FQXA 4P48A 2BHZA 4K3EL 1M6OA 4HIIA 3VH8G 4UOJA 2JTDA 4Y2DB 4WU5A 5J7CC 2Q76A 4PGJA 4LIQL 4ZUVA 4OCRH 2J4WL 4DGVL 3AREC 1E27B 5KJRH 1NEZG 1R5VB 1LMKA 1O7SA 3QCTL 3TM6A 4XBGB 3ZDYF 1HHHB 2EDTA 4YAQB 3TF7C 3BIKA 3MFFA 4U1LB 3SEPA 3MV7B 1ZWIA 5IHUH 4KRPD 4MA1C 1N0XL 4TRPL 3O9WC 3X14B 3G5ZA 5J9PB 4NCDA 4JVPA 3MLSH 4GUPA 5FK9A 4Y4KD 2FO1A 3MOBH 4OZIF 3O6LH 1B4RA 2X4NA 4LRNL 4NZRL 1T1WA 5IFAL 3MR9B 4MS8C 1ZSDA 3C6LD 1Q1JL 4I48A 3L5WA 1P4IH 3HUJF 3MLVL 5HYSA 1XGUB 4ZUSA 5IV2A 1XCQA 5IMOA 5DK3A 1QFPA 3LD8B 5DWUL 3P11L 3LKRB 5EU6E 5IT2H 3MUGB 2CIIA 2UWEB 2FLRT 4YHMH 1P2CA 2BVQB 1S78D 3KDMA 3K3QA 1J10A 4UV7H 1ZEAH 1NPUA 5F88A 4NM4H 4X6EA 2NY4C 2Q7YA 3FFCB 3C09B 5JMOC 3RVUC 1BOGB 1K8DB 5C6WH 2ATPA 4PY8J 5TE4H 3V9FA 2R0ZL 25C8L 3FHQA 2P4AB 4PJCF 2AK4A 2R29L 4HCRA 4YHPB 2XQBH 2AI0H 4XWOC 3QI9D 2LAGB 4EXPX 4JY4B 4OCXL 4F37K 4DK3A 4OGYH 4PRIE 3WEXB 4OCYL 5EU6D 1QFOA 2VYRE 1KPVA 2B4CH 5F1NB 5IK3B 5J6GA 3JTSA 5FEBA 3OAUL 1LK3H 4QHUA 1ES0A 2YD8A 5HTSA 3GJFB 1C5BL 2PCPB 4PLJD 5EC1A 3RWCA 2YBRB 4WY7H 3SCMB 1OAYH 4L8DB 1E6OL 5FUOL 2F5BL 2C1PA 2YPLB 3UAJD 2GUOA 4LAJH 3IU3B 4NZDA 3CMOL 2FX8L 5DJAA 4F7CA 4I9WE 4AL8L 3D0LA 2NY0B 1NBVL 3KVQA 4MZ3A 4FFZL 4LSTL 4X7SH 1P7QA 1VDGA 4PRID 4PPTA 4EVNB 3JVGC 1KJVA 5T3ZH 4G6ML 3VXQA 4UMGA 2B1AL 3WSQH 4L9LB 1SQ2N 5CP3H 5GGVY 5FCUL 3OR7B 1TCMA 5D2LA 4MSWA 4XP6L 4WGWB 3IDXL 1U9KA 4JREB 4UB0H 2NY2C 1IFHH 3A6OA 2FECL 5AUMA 3TJHC 4JO4L 5E8DH 2ADFL 3L3JA 3U0TA 1EXUB 2BHYA 1AQKL 1ADQL 5J6HB 2GTWA 3TPUA 5T5FL 1ADQA 2EXYC 3K1DA 4I9WD 5B39G 5I0DA 1VFAA 1QFWM 4P9MH 1U95B 4QRUB 1MLCB 3HI1A 1MFNA 5DC9B 5F96H 5C9JA 4O51B 1S9YA 5CSGA 1O5DT 2DIAA 4HK0A 4I0PB 4A6YL 3TO2A 2X1PA 3PABB 2OSLA 4IRZL 5EFIA 5FUZL 1T22B 4TSBL 4OF7A 4BA8A 1A6VH 2VLJB 1I4FA 4XNUH 4XXDA 4U1IB 3JWDH 1U91B 3TVMD 2NY3D 4NUJB 3LRGA 4YDJB 1KN2H 3HC3L 3B4NA 3F58H 4HWEL 4LQFH 4GKNB 2P5EB 4YO0A 4XNQA 4K2UH 3GI8L 4HLZH 1SM3H 1MFBL 5C0JA 2BXYA 3OKDA 1HSAA 1QSFB 2AJVH 2I07A 3EBAA 3GSQB 4NQSB 5KN5A 3QXUA 2RJMA 3EOYG 5T1LB 1FO0A 1I7ZA 1E4WH 3K4AA 2P48B 3ME0A 3OPZL 5J12C 3L3KB 5EUOA 1LHZA 4HFWB 2DQTH 4EDXB 3U46B 5ACZA 2XN9B 3GO1H 3WN5B 2VXVH 3D48R 1WC7B 3WYRA 3RZCD 4ONGH 1YMMA 4M43H 1R5IA 2F19H 3UTSB 5M7QA 1BQHG 4BQ6A 3HE7B 2JCCE 3WFDH 4L3CA 1T2QH 5GGQH 2FD6L 1PKQB 3RWGB 1C08A 1AP2B 3BP4A 1IZJA 5AYUH 4UT9H 5L88L 5EBWB 5LGKA 5HI4D 3QFJB 3IT8D 3KPRE 2EC9T 5IB2B 1XGQA 5L7XL 5EO9B 5GGRA 5DURD 3ARUA 4LLQB 3GSNH 2R4SH 4JFFE 3ARPA 4WW1B 5I18L 1AQDA 1MAJA 3ET9F 2Q7NA 3PJSB 3C60B 5FYKH 4L8SB 2R56L 2WBJB 1YNLL 1BIHA 2AQ1A 5I0ZA 4QTHA 2NW3B 4POZD 1PQZA 5E2VH 3SDCC 2QJDA 3PHQA 4KZDL 4N0FA 1W0WA 5HSFA 4CL7A 3KPQA 3OKOA 4PRNA 3UTPE 5L8KB 1TJHH 3OAZH 2H3NA 3KPRD 4HWZA 1SYSA 4AIZA 3QH3A 4F33A 3S88H 1TZHA 3C9NA 3DLQR 2RCSH 1F5WA 1KULA 4GOSA 4GAJH 3V5DB 1U8NA 4JRYE 3WDHA 3AU1B 1M6OB 4Q6IC 1EHLH 4JFFD 1X44A 3F62A 3W0WA 3VWKD 3PL6A 3H6JA 1Y6MR 3LY6A 5MI0C 1FDLH 2IFFH 1A5FL 4NKOB 5IB3A 3IFPA 3TGXA 3BIKB 3MFFB 5EZIL 2DQHL 4JFQA 4UTBL 2BNQA 2FH8A 5JMRA 3LN4A 1W2KT 3RL2A 5FO8B 4NSKA 5J06A 4MDJB 4QOKB 3BKYH 3UTPD 2XIDA 5F6IB 4I5BB 1UCTA 5C0GA 2FGZA 3AAZA 5FK9B 4GUPB 5BZDA 4GRLA 1EGJA 4JM2F 1T1WB 3B43A 1ZSDB 3O6KL 2R2EA 4JDVA 3VWJA 4PG2A 1JYNA 4NQEE 3GIVA 3UZVB 1CGSH 5FYJU 5KSUA 5IV2B 5IMOB 1S9KC 4LPVA 5EPMB 2ZCHH 1YEKL 4XC3H 1DANU 3EOBA 1R3JB 2CIIB 1S78C 3QQ4B 3M17A 3RWEA 4HC1L 3U48A 3J8F7 4HX1A 4PJ8A 4PGCB 2YR3A 1DDHA 4FN0A 2VH5L 4KXZI 4X6EB 4JG1H 1A6WL 4XI5C 2ATPB 1F58H 5K93A 4NOBA 4YR6A 3VDCA 4GH7B 2N7BA 5AWNH 1DBML 1HILA 3MGAA 2AK4B 1CR9L 3QI9C 2A6DA 4UDUA 4NQED 3VXRE 1V7ML 2QR0A 4DVBA 3B6SA 3U9PH 4OZHB 3WS6C 5JA9A 4PJEA 4KUCF 1KPVB 1MI5E 4R8WH 5KVDH 3QG7H 3HC0B 3JTSB 5J6GB 3SDDD 4XNMA 4QHUB 1ES0B 4NP4H 5D1QA 1CFQA 4PLJC 3QCVH 3S37X 1A22B 1GGIL 1UM4H 4EN3A 3QCUL 1BBJA 1CLOH 1FL3A 3UAJC 1UM5H 3W11D 2DWDA 2AEPL 1UCBL 3VFPA 3LIZH 4XAWL 4S11A 2JE8A 2BHUA 3QXWA 3EYFB 5LGHH 4PJGB 3Q5OA 1X4YA 5AD0A 4N9OB 3QRFM 2R4RL 3VXRD 3BI9X 2A77L 1WISA 1L4IA 1VESA 5ADOL 4X6CE 4ODUB 4LCWA 5B38A 1D9KA 2R1YA 4KK9D 4ODTL 2F53E 2SEBB 1XT5A 3VXQB 3HAEB 1NCCL 1MI5D 4HKXA 4RDQF 3BOVA 3SY0A 1U8QA 4W4NA 5GGVH 8FABA 1ZT7B 4LPCA 2WK2A 1NFDA 4MCYA 1X5FA 2J88L 3ZYZA 4X6DE 4OTXH 1PEZA 2BOBA 2AEQH 1EO5A 5FM4A 1I9RL 4J3VA 3ORJA 3MJ7A 3MQIA 4HIXH 2GTWB 3T1FA 3PIQB 4C54A 2ZCKH 1FVEA 1QEWB 1IGYA 4O4YL 5JORA 1FPTL 3HI1B 1JRHI 3W39A 1UG9A 4ACPA 4YUEH 5C7XL 2F53D 3NN8A 4HK0B 2H26A 4Z7VB 5ALBL 4U1HA 3TO2B 1MREH 4L5FH 5D6CB 1DVFD 3N1QC 4A6YB 4ZTPL 1KT2B 2JJTA 3VFRB 3FQUB 5EFIB 1KNOB 2GW5A 5JOFB 4K71B 4NC1C 4IHOB 2NY3C 1LEIB 4ELMA 1GHFH 4BZ2H 1UJTA 4F9PA 4NWTL 5INCB 3T8XA 1K9TA 4NO0A 4S1QL 4YO0B 2VQ1A 1YN7A 2VAJA 2WIMA 3LN5A 4XNQB 5JUEH 4ZSOE 5DVKA 1FNHA 2E8ZA 1ZV5A 4WTZG 1N64L 2W38A 4WWKB 3OKDB 5C0JB 5HGHB 3AGVA 4MJIB 5ITBL 1MH5A 3JV5A 2Z31D 1I7ZB 2KDGA 1OARL 2XWJA 2W92A 5E7FA 3UYPA 2VL5B 2R1XA 5T1MA 3LKSB 3EYQC 5ACZB 4MQ7B 4H1LH 1KTDB 3SKJH 1ZGLA 5SWZB 4K55A 1HNGA 3L3HA 2VISB 1YMMB 3C5SA 2XFXB 1R5IB 1OSZB 1RJZA 3UYOD 2DJSA 1Q94B 2IQ9H 2EH8L 2AJXH 4KVNL 2Y06L 1B90A 3IS1X 3ZHDA 1YEFH 4IOIB 3UC0L 1OGAB 4HSQA 2UYLA 1YQVH 4UTAL 4M00A 1NC2B 4APQD 4OB5L 1GAFH 3LKPB 2O5YL 4BH8A 1N7MH 5HYIA 4K7PL 4MMXC 4K94C 3T3ME 1ZT4A 2GSGB 1VEOA 1T66D 3E6HA 3BUYA 4PJAF 4H8WL 4H25A 5ESVB 3LEXA 3WUWG 2AJYL 1LE9A 4G8FA 4RDQG 2YKLH 5B39A 4TPRH 1K4DB 2C4FU 1F3RB 1CT8A 1HHIB 2VZTA 3C5JA 4FTVE 1BF8A 4C4KT 5FF6A 1X4ZA 5EU4B 1AJ7L 4POZC 3MV8E 4JN1H 1PBYA 1YYMH 2ZUQC 1MCPH 1Z9LA 1PQZB 4HBCH 4JY6A 3SE4A 1FL5A 1MHPL 4M93C 2O61A 2Z4QB 4PRNB 5T1KD 1WWWX 3GSRB 1AE6L 5D9SA 5B21A 1SYSB 4AIZB 3B5GA 3QH3B 5AZ2H 1TZHB 4PJIE 4CDGC 5HGBA 1P1ZA 3DJ9A 4X0KA 5E2UH 1NAMA 1U8NB 4U1KA 5I1KL 1KCRH 3VWKC 4XMPL 2BNRE 4N9GB 2XG5A 2X4PA 2WSKA 1UACL 3W0WB 4U1JB 4WI6A 3HPJB 5LQBH 5ESQA 4MGXA 1OM3L 3HN3A 4FTVD 3AREA 3PL6B 1JNNL 5IGXL 1URLA 1KG0A 4JDZA 1MFEH 4ONHB 2YZ1A 3MV8D 5IB3B 4LHUA 2XPGB 3IFPB 1X5GA 4CKVX 1U8IB 2BNQB 5BVJB 2LU4A 5I15H 3HCVA 1FSKC 4NJAH 1NLBH 2EDNA 3O9WA 5GS2D 2DTMH 3MV9B 2V2WB 3CFKA 1P53A 4O2FA 3AAZB 1NUNB 5BZDB 2GQHA 4GRLB 2P47B 3FTGB 3MFGB 4NO5B 1FIGL 3CXHK 1BQHA 3PQYA 5LGJA 4QRSA 2BNRD 3ESVF 5C0RH 2OQJA 3VWJB 1PJ9A 5I1AA 2EH7H 5MEQB 3IRZA 3QEGH 1F45A 5F71A 4GSDL 2IG2L 2LU7A 4OLYL 4ZFZA 4FQCH 3M17B 3WS3A 5JTWA 1DDHB 1KBGL 2CKBA 3R1GL 2CGRL 3PV7A 4P2RA 4DFHA 4RGOH 4XVJL 4TQEL 5DSCB 4KKBD 1FVCA 2AAVA 4IEFB 3FONB 3IETB 1RUKL 2AP2A 2HKHL 5E8PA 4PLKD 1HILB 1UZ6E 4G7VH 2A6DB 2G75B 4UDUB 5DT1H 2DL9A 3P30L 3T0AA 4QF1A 4NNPH 1K2DB 2ZJSL 1MJ8L 3IKKA 3DROB 3SDDC 1WUNT 1RZFL 4PUBL 5CILL 1FZKA 3NFNA 5DHVH 5DUPL 5I17A 5D1QB 1CFQB 1F3DJ 3QNYA 1KF9B 5CEYB 4E41A 3FB5B 3W11C 4Q9QH 3VH8B 5TF0A 5K9JH 2CJUL 5CUSL 1AKJB 1M4KA 3MODL 5IBLD 4XVTH 2JJSC 3TFKC 4YIQB 1DANT 1NEZB 3TEUA 1A4KA 1IGIH 3S35H 3CFCL 4FQLH 2ED9A 4MLSA 5AD0B 1RUAL 1IGMH 2W9DL 1F3DH 4ZUUB 3I6KA 5E6YA 4YDLB 4LCWB 3TCLB 1S8DA 1D9KB 2R1YB 3V7MA 1QVOB 1KJ2A 4Q9BA 4HLJA 5FO7A 4MJ5A 2CLRA 3VFMA 3N1GC 1U8QB 3X3FL 2GT9B 5IHLB 5HJ3B 4K9EH 1QFUH 1NFDB 4BK5A 4FZEH 5C08E 4NQTA 1OAKH 2E9BA 1HCFX 2FHCA 4LLAA 1OSPH 3ZT5A 2BOBB 4KTDH 1N5YL 5CAYB 1FNGB 2CD0A 2W1NA 1RJYA 4KPHL 4DKFL 2VLKE 3GBMH 2E7HA 4LSVL 2OXGA 2IPKA 3C6SA 3AB0B 1HSBB 1FORL 1D5MA 2IPTH 3EHBD 2W0FA 1CXEA 3OXSB 5SWSE 4JQVC 1ZGLM 3ESUF 3IDYC 3O2WL 5E08L 4U31A 1DVFC 4YZFE 4PJXA 4XC1H 1NGZA 5EC2A 5FA3A 5FHBL 3NZHH 2FJHB 4G6AD 4JGUA 4OFKA 1TTGA 4POYA 3MRDB 4JFZL 1I3RB 4H88H 5E2TL 4YHNB 5C08D 1AO7D 2UZYB 4TVPL 4ELMB 3N1PC 4ZFOL 3O2DH 2BOCB 2HKFH 3O4LB 4HS6A 4K3JL 1KJMB 3EYVA 4S0TD 2VLKD 4RAUB 4RMQA 4XPFH 5DO2D 1A7RH 2VQ1B 3QJFA 1F6AA 3LN5B 1CGUA 3HB3D 2YD3A 3UPRA 3T4YB 1CS6A 3NZ8A 5SWSD 1MH5B 5TF1L 2Z31C 1RURL 3TJEH 4FG6D 5IVNA 1BX2A 4RAHA 4WDIA 1FRGH 4JANA 1EV2E 5EZOL 2NCMA 1FBIH 4WUUB 2OZ4A 1CLZL 3V8OA 4W6YB 3FHAA 3SJVA 1ZGLB 4RMVA 2J12B 1BQSA 5KSBF 2VDOL 3MRHA 4ZPVB 4C58B 1RJZB 3MCG1 2GI7A 1KIRB 4KY1L 5HHQA 4K7FB 2G5RA 5HDQH 4APQC 1ZLVH 3OKYA 1J8KA 2LVCA 1J05A 2OR8A 4NBZB 2ARWA 1B9ZA 4ZD3L 5F7EL 5E4IA 2XNAA 4BH8B 4G5ZL 2APFA 2Y36L 4B5EA 4D0DB 1T66C 1IMHC 4OQTL 3IFLL 1DN2A 2BSRB 3E6HB 5EO0A 4DJMA 2XXMB 3BP5B 4OF5A 2F5AL 5IEKA 1RUPL 4S1SL 1EEYA 1DJSA 1UH3A 3BUYB 4I2XE 4TUKH 2VQTA 3KYMB 4XNYL 1QBLH 4B53A 5C0CE 3LEXB 4LKCA 3EYUH 4G8FB 5B39B 4JKWA 4OZIB 3HTLX 5JOEA 3C5JB 3HRPA 3V4VL 4HKJB 1ZGLP 4LDEB 2OM5A 4AMKL 5B8CA 1DQJB 3O41B 4YJZL 5DYOA 1CZ8L 3ROLA 4PGDB 5DUML 3RGVD 4C83A 4LNVA 4WW2F 3RIFF 1IAII 3CCHA 1LEKA 3H42H 5AYQA 1D5ZB 5FGCB 1ZVSA 1DN0A 4AENA 4LVNB 5C0CD 4Q6IA 1OCWH 3NACH 5I73C 3ZE2E 3ZLQC 5ESQB 3O2VH 3X3GL 2YK1H 3BSZH 4J4PD 5FO9B 4PJCB 1CL7H 3LEYL 4GMSL 5ANMA 3NAAL 4JDZB 2W60B 3AY4A 4J3WA 4HFUL 4XPHL 3JTTB 4Q74A 3BN3B 3QEUA 4NUGL 2ADJA 2BRRL 3QXVA 1NCNA 2QL1A 3FN0H 5JPNB 4QEGA 2C4FT 1SY6L 4OF0A 2QSQA 3WHE1 2FX9H 3CFKB 4Z77B 3FRPA 4PG9B 4Y4KA 1SY6A 3QNXA 3OV6A 1EVTC 4K23L 5KS9E 3KHQA 4V1DD 3C6LA 1BQHB 4NRXB 1IGFH 3PQYB 4UBDD 3UTTE 4MQXD 4QRSB 5CIPH 1MLBB 3FMGL 5ID0A 1OP9A 3RPIB 4J3SA 5K9QI 1A7NH 2DQUL 2D7QA 3VXME 4QHKI 4ZNEE 5IG7A 2BFVH 5CEXB 3W5MA 1MIEL 3CZJA 1T7XA 3JWOC 5HGGS 3O6FB 4YHLH 4O58L 4Z7OE 3ARSA 5DVMA 1OP5K 4U4BA 2OP4H 2NY6D 1UWEL 4KKBC 1WIUA 3CVIH 4JQIH 4Z5RB 4WEBH 1FVCB 3WUWA 2M8XA 4TSCH 5KAQG 4M62H 1TPXC 4PLKC 1QSEE 5GRVK 4X99A 4BQ9A 3WXWH 5E8PB 3UTTD 5DHYB 1UWXH 4G9FE 5CWSA 3QI9A 3RVTC 1N8ZA 1NC4D 3P0VL 2ENSA 4XCCL 4LCYB 3BGAA 4C56B 3LCYA 2H6PB 5I1DB 2YA2A 3FB7A 3VXMD 5EU6A 3AXLA 4DKEH 1C5CL 2X70A 3OR6A 3QUZD 4NIKB 5E00A 1FZKB 1UWGH 1S5IL 4HAGA 3RY5A 5I17B 1KCSH 4C57C 5JHLH 2XWBA 2VR9A 1KLFA 2XQYG 4HJJL 3IDGB 5IBLC 4XP1H 5I76B 2FB4H 5EORH 2OTWA 1QSED 3FB6B 1U3YA 1A4KB 1IC4H 1AHWA 4G9FD 2PW1B 2WLZA 3WKMH 3LQAL 1C1EH 3HZKA 1MFAL 1TENA 4Z7QF 4PRIA 3F5WA 4XVUD 4KZEH 3ZKQD 1G9ML 4HS3A 5I71C 1BZQK 4M5ZH 5FGBA 4MJ5B 4BKLB 2CLRB 3VFMB 1ZLSL 5LWYH 4NN5B 1RZKC 1MHCA 2V17L 2AEIT 5SX5K 1HHKB 5ERWB 2HRPH 2OJEA 2BVOA 5IF0A 5CEZH 1E4KA 3ECBA 4RQQB 1UENA 4RFOL 1RJYB 3GHBH 3GMNB 3C6SB 3OMZA 4X7CC 4LL9A 5I1IL 3EHBC 4UT6H 4HIJA 1MNUH 3MRLA 2DQEL 4IMKA 1RU9L 3F8UB 2V5MA 4LCCB 1W72H 1Y6KR 4XVSH 5FA4A 1LO0H 2YD7A 4G6AC 3UP1A 5BS0E 1LO2L 1RIUH 1RZ8A 3BQUB 4ZTOL 3UO1H 4EOWH 1S9XA 3TVMA 1VGEL 2J6EL 4M7JL 4AG4H 2J6EA 1YJDL 4K3HA 2XTJE 4ZFOB 5DO2C 3EYVB 4DGIH 3HB3C 5I1JL 3QJFB 5T1DH 1F6AB 2GY7B 3SE3A 2CQVA 5E5UB 5GISL 1FFRA 2VSCA 5TFSH 4WJ5A 2Q3AA 1CDCA 2GCYB 3NZ8B 4FG6C 2DQCH 3GB7B 1GH7A 1WF5A 2PW2A 3CPLA 3DO7A 2QQLL 3KPSB 1J88A 4U1GC 5F6HJ 4NKDA 3SPVA 3Q6FB 4JANB 5BS0D 3HNVH 2NQCA 2CO7B 4IRSC 3O4OC 4Z95H 5CD5D 2R0WH 3RZCA 5E9DE 3SJVB 1RHHA 1NCTA 1MQKL 4P5MA 2CUIA 2XTJD 2VR4A 1PX4A 2AJUL 2BNUB 5HHQB 1CDGA 4KGLA 4GG8A 4FXLA 5CZVH 3RAJL 5D5ME 3RY4A 4G3YH 4KRLB 1KTRL 2PYEB 3JZ7A 1FFPB 4RWHA 1RZJC 2H8PB 4NKQB 4LDOB 2PXYB 2MKLC 1A02N 3LHPH 3PDDA 1EEYB 4GO6B 5E1AB 3BWAA 4GMTL 2VXQL 1P5VA 5IR1A 5E9DD 4PJ7E 4HKZB 4JM2B 3MLUH 3VMOA 1FC2D 4HWBL 1JGVH 4KKAD 2DQJH 3MJ8B 2JCCA 5HDBE 4UIKH 3C2AH 5I16B 4WRLA 2DYPB 3RTQB 5B8CB 3VI3F 3RGVC 4MA8L 5DYOB 1JZ7A 3GUTB 3RNQA 1JZ6A 4C83B 1MCWW 1WZKA 4L8BA 3KPRA 3I2CL 5D4QA 5DD3L 5GZND 3V52H 1D6VH 1LEKB 4W6XB 2QQQA 4M7LL 1FG9C 4XCFL 1QBAA 1ZVSB 3O11A 4MNGE 4AEEA 4JFFA 3ULSA 3VWKA 3FQXB 2AXGB 1CBVL 3SDYL 4GRWB 2NR6C 5BOPA 2FSEA 1T03H 1E28B 1NSNL 5ANMB 4ODWA 4P5TD 2ZNWA 1Z5LA 3FT2A 4KRPB 4C4KO 1IBGL 1AXSA 1HEZB 1CGYA 3ALXA 4U6XA 3K2UL 1CXIA 5D7JB 3SQOL 4IRJB 1KCUH 4Y4KB 1BOYA 3GSUB 2A1WH 5GS3A 2A0LD 2EDWA 1DBKH 3L3OA 4UBDC 4JRYA 4Y1AE 1M7IA 4MQXC 3C6LB 4Q9RL 4DN3H 2OI9C 1D5IL 4R97B 5ID0B 4JN2A 3C08H 3JUZA 1T1ZA 3WFBH 3KYKH 4UAOC 1T20B 1CDYA 2DN7A 4QXUH 4OSUH 4HUXB 4MDIA 1RUMH 1OT1A 2NY6C 3I6GB 1NCDL 4CVZB 4ZO9A 3HC4H 1KCVH 4QRTA 2Q20A 5C3TA 1MCEA 3WUWB 4F7MB 2NY1D 3A67L 4U6VH 2WQ8A 1OAUL 1JTTA 1JL8A 1DQDL 4Y1AD 4XPAL 1CD1A 4HPYH 4Y7MA 3CSBA 2MCG1 5ICXA 5CWSB 3NIDE 3P0YL 4NQEA 3VGAC 3NBNA 4P23D 3CFBA 1JK8A 3FL7A 4KDVA 3L3IA 3FB7B 4N0CD 4LEXH 3MJ9H 1HINH 1BZ9A 3AXLB 1DBAH 2R0KH 1OPGH 3S6CA 3QUZC 2HWZH 2X70B 1OHQA 2X4UA 3NIFF 1EFQA 4RISH 3FAXA 4XHQA 4O9HL 3FQTB 1FE8L 1NL0H 4OLVL 5JPMA 2Z8WC 1P9MA 4LLUB 1LD9A 2OTWB 4IDJH 1UXWA 3HPLB 2JJSA 5EBMA 2XKNA 1AHWB 2CUMA 3MLPA 3VXRA 1NUGA 1NLDH 4XVUC 1A6TA 1J86A 5JR1L 5EIQA 2XZQL 4N1CA 3DGGA 4N5UA 1MI5A 2FCBA 4JPWL 5EN2A 2EDBA 1CGTA 2FWOA 3WMSA 1GC1C 1CU4L 5IB1B 3MLZL 1MHCB 4AEHL 3AVEA 5F9DC 2OJEB 4R7NB 4Y5VA 5IF0B 3TV3H 5F1OB 3QRGL 4L8CB 5ILTL 1T3FA 2BX5A 5IFHH 3KWWA 5I8OH 3I75A 3RWDB 4BUHA 3HMWL 2Q8AL 5HYFA 2W9EH 4HIJB 1KPRB 2VDKL 3WFEH 4NQUA 3OAZK 1G6RA 1J8HB 2JB6A 4NQXA 2EO9A 3LDBB 4X6CA 1BAFL 4EEEA 5JIIA 1FNEB 5IESH 2BCKA 2F53A 4JQVA 1D5XA 3GRWH 2ORBL 5FA4B 1BVLA 1DVFA 2QHRH 5I8KL 1TZGL 1U93A 1BWMA 2PTTB 2E7MA 4NYLB 3QXTA 1RZ8B 5C2BH 2J8HA 1C16B 3SGKC 1RK0A 3TVMB 3LS4H 1RAMA 2E8YA 3MUZ1 3HLAB 2MNUA 4X6DA 4MAUH 2Y4SA 3PXHA 4P46B 2WV3A 5I1LA 3BZDA 4PJAB 1PYWA 4OF3A 1A7OH 2BMKA 4EQ3A 3IF1B 5D93B 5I75B 3TA3D 4P2OB 5IHUL 4WJ5B 1YUHA 1MRCH 4AEFA 3X12B 5J1AB 3DO7B 3BWUC 2QKIB 4CVWA 2Z31A 3UJJH 5GGTH 1VB9A 2GK0A 3SPVB 3MLSL 4ZG1A 1G7QB 4Q0XH 1S7VB 3MOBL 3QNZA 5CD5C 4PS4H 3TIEA 2YEZB 3RZCB 3IDNB 1P4IL 2VDQL 4EKXA 4Y5YB 1ZHLB 4L9DA 1AI1H 1E4XI 5IT2L 1MHHA 2P24A 4N8CH 1TVHA 3IJSA 3ULVE 3ILPB 4G6FB 4GG8B 3QCTH 2VDLH 4YHML 4ZSOA 3TYGL 3FQWB 1I7RB 3L5XH 4APQA 4NWUH 3SKNA 3VMNA 1U36A 2ZPKH 3X11A 4UV7L 5DMKA 4Z0XB 3B9EA 3DVGA 2VSDA 3EZJB 1T0MB 4RIRB 1DE4B 1VERA 5TE4L 4QO1A 5DURB 3MRGA 3ARDD 4O2CA 3RX7A 5IJKC 4Y16B 3BWAB 4LRNH 5DQJA 5IFAH 3MTRA 5IR1B 2AI0L 3VRJA 4P57A 4KKAC 2XACC 3MLVH 4OGYL 3LKQA 2PETA 1BM3H 4NOFA 1MJJA 3QDJE 2B4CL 3ULVD 4RMUA 1LK3L 4EQ2A 3KR3H 3OF6D 3RA7H 1ZMYA 5T1KA 2ID5A 2Q86A 5GZNC 5MENE 1I1AB 4L8BB 3V4UL 4WY7L 1OAYL 1GOFA 3GBLA 4L3EE 3DECA 2CXKA 2EE9A 3DVFA 4FZ8L 3CXDL 3M1BA 2G9HA 4KKLD 3OTTA 1V3JA 5JNYA 4HCRH 3ULSB 3BH9A 25C8H 2KH2B 1H15A 4U3CA 4FTVA 4X7SL 3MA9H 3ZT7A 2R23B 1TLKA 4P5TC 2FSEB 2A6JA 5HI5D 3QG6A 5HGAA 5T3ZL 3MV8A 4LLWB 2ZCLL 4ODWB 3QULA 3QDJD 1Z5LB 5DRNB 2F8OA 1AXSB 3HHRB 4FABL 1DBJL 4M8QA 1ZHKA 3RVVD 2YUZA 3B3IB 1EH9A 4OD1L 2A0LC 4UB0L 2HMID 4PJDE 4L3ED 4PJIA 2AXHA 5E8DL 1B3JA 3GSOA 4R4BA 1N6VA 4JRYB 2F5BH 4UQ2A 3OBAA 4XPGL 2BNRA 4ZFFB 3QO1A 4QT5A 3V7AG 3KPLB 4P9ML 1EJOL 3CMOH 3OAYH 2FX8H 4JN2B 3TZVD 5MEPA 4HWNA 1VSCA 5F96L 3E2HC 1MRDH 3H3BC 4J3XA 4KK8D 5JO5B 1KLGA 3O3AA 4MDIB 5F9WC 3ZE1F 1RY7B 3PWPB 1VEMA 1A6VL 3B8SA 2NY1C 4F7PA 3JWDL 1X6LA 1KN2L 4PJ7F 1JHKH 5L2KE 3VD9A 2F8XC 5D7IF 2DJUA 2RHEA 3F58L 3MNVA 2ADFH 5HDBF 5ICXB 1ED3A 1AQKH 4K2UL 4NQEB 1ADQH 3T0EE 1VFBB 5HYJD 3P9LA 1SM3L 4N0CC 3CFBB 1JK8B 2AJVL 4PGBB 3VFOB 1CQKA 1U2CA 4ZQKB 3D25B 1BZ9B 2DL2A 2FX7L 3LQZB 3PP4H 4J12A 1PGRB 2ERJB 4PJBF 1YJDC 2Z8RA 2ZSWB 4NHUA 1WTLA 5DJCA 1HH9B 3GO1L 1E4JA 2VXVL 4FFVD 4IRZH 2E7LC 4O2EA 4BJLA 3LH2H 2DLTA 2EE6A 1KACB 1I9EA 1BECA 2F19L 5L2KD 4U1SA 5J4MA 1B2WH 3D0VA 1UXWB 1NEUA 4MXWH 2E6PA 4NQCE 2WLYA 5GGQL 1MUJB 1JCKA 2QSCH 4KQ3H 5JW4N 5AYUL 1FC1A 4UT9L 1T04A 2LE9A 1MI5B 2JIXB 1BJMA 1P4LB 1UKQA 1FO0H 4I0CC 1PSKL 1QRNB 4TNVK 1X5ZA 3BKML 5EIIA 2VC2L 5J8OA 2XA3A 3GSNL 3HI6L 3UBXB 2R4SL 5DVLA 1LDPH 1CK0L 2DLGA 1UA6H 4Z7WE 1NCAH 3FT3B 4Y5VB 5L2JA 4HULB 4JHBA 1YY9D 3HZMA 4IMLB 3V8CA 5C0EA 1ZHNA 3REVA 3KWWB 1BWWA 4MD5A 1A2YB 1BVKA 5BVPH 4XRCA 1QRKA 2EDEA 4KFZC 1NBZA 4O5LH 3MBEC 5KSBB 2W65A 1AGFA 4TUOB 3VRIA 1NGPH 4P59H 2APVA 3NVQA 4KMLB 4X6CB 4PRHE 1QD0A 5HHVH 1D5XB 1TJHL 4ZUTA 1ZLWH 1BVLB 2CMRL 5E24E 3RX8A 5L88H 1U93B 4K7PY 2VIRB 2IPUK 3W2DL 2RCSL 3HZYA 3DSFH 1F2XK 4GAJL 2GKIA 4N68A 3D2UA 5L7XH 3VFWB 4HUVA 5C08A 1EHLL 2HFTA 2DF3A 3S96A 1N3NA 2O5XH 1T83A 3RWFA 3HI5H 5IP4A 1R5WB 3MO1A 3IJYB 1NGYA 2VLKA 1PYWB 1FDLL 2CIKB 4YPJA 1VFUA 2IFFL 2R56H 2HT3D 3U30C 1YNLH 2VNCA 1QR4A 2DICA 3H3PH 3TA3C 1CICC 1BFVH 1KJ3L 1YMHA 5SWSA 2BVPA 4PRHD 12E8H 2F9BT 3BKYL 1M7DB 2GK0B 3KJ4C 5DGRA 3S37H 5IB5B 4CW1A 4GG6E 1WAAF 1XGPB 3JSSA 4MNQB 4MB5A 4F2MB 1UVQA 4DEPC 4YDKH 5MERA 5DVNA 4YWGH 5TQ2L 3ZE0E 3IXAA 4CADA 3EAKA 3U4BH 3PDGA 4R0LA 4PRAA 2ZCHL 4JFDE 4XC3L 1VKXA 4YHKH 2P24B 4I13B 4PTUB 1MAMH 2VWEE 2BC4A 2K7PA 1A7PH 3CDYA 3ARBA 5EZIH 3ARGB 5DMKB 3TESA 2DLIA 3I85A 5E56A 4P4KD 4N0YH 4JG1L 2R69L 1F58L 3ARDC 3S5LG 3EO1A 5AWNL 3MRGB 4O2CB 3IGAA 2Q8BL 4OV5B 3A6BH 3N50A 5DQJB 4KTEH 3VRJB 5ICZB 4ISVA 3IFOA 5I9QC 1RSFA 5EA0H 3SO3C 1J11A 3ULVC 2QHLA 3LKQB 4JFDD 4KKCD 3I3BA 2G60L 4R8WL 5KVDL 3QG7L 1YEKH 4OZFG 5IFJA 4KKNA 4GBXC 1JJUA 1BGXH 4NP4L 3RGVA 3QCVL 5T1KB 4HGWA 1UM4L 2Q86B 4OZGE 5JQHC 4FQIL 1CLOL 3IVKB 4HIHA 2Z92A 3CSGA 5LBSH 3GJEA 1UM5L 1A1NA 3O3BA 2JF1A 4Y2OA 1OLLA 1KN4H 5EOQL 3C8DA 4KKLC 3ULUE 3EFDH 4I2XA 3GI9H 4R2GB 3LIZL 2VQUA 2G9HB 1EBPA 1FFOB 5C0CA 5IB4B 5LGHL 3VXSE 3BUTA 2IH1B 1LDSA 4NDMA 2YUXA 1H15B 3BW9B 1CFVL 3BPNB 3D6GA 4J4PA 5HI5C 2K3TA 5C2UB 2A6JB 4EJ1C 5DEFA 1X5IA 4YXLH 1BVZA 1H3WM 5FYKE 1UB6B 1JZ8A 4NN7B 1YN6A 1CXFA 3RVVC 5GS1C 2IADA 4RMWA 2HMIC 3IJHA 2MPAH 4CVXB 4JFXA 2X1OA 3OQ3B 4PJIB 4OTXL 4OGAD 3BZFA 3GSVA 4R4BB 1IQWH 3ULUD 4UQ2B 4MAYB 3RPKA 2BNRB 4HIXL 3QO1B 1MJ7H 2FHBA 1WIPA 3VXSD 2XI9A 5GZOD 2FL5B 5MEPB 5BV7H 2EEDA 1Q9OA 3SKMA 4N0RA 2R4RH 4KK8C 1MWAA 4YUEL 3KJ6L 3PP3H 4KAQL 1UEMA 1ZTXH 4L5FL 3I02A 5FYKD 3O3AB 4XTRD 4GQ9L 4HXAH 4NHCH 5JA8B 1U8PB 4GLRI 3RWIA 1UGNA 2DMKA 3P4MA 3STZB 1GHFL 1Z3GH 2HG5B 3QT2A 3QAZB 1GGTA 2J88H 3Q3GB 5KS9A 5IJVB 5INDA 1ZA3A 3UTTA 4GAYA 4RMTA 1FYTB 1NC4A 3FOLA 3MZGB 3ROOB 3SN6N 4PIRF 1AGEB 4ZNEA 3MGTB 3VFVA 3VXMA 3B2UD 3OJ2C 4TTDC 5D96B 1U8KA 2EKSB 4MYWB 1H8SA 3L1OH 3QUZA 3EGSB 4PB0H 4HV8A 4OD2A 3VFTB 5DJCB 4FFVC 4ZTPH 2Z35A 5F9JB 4X7TB 3SKJL 4FOMA 1K3ZA 3F65A 1QSEA 2DM7A 4U1SB 1A9EB 3DXAB 2DKMA 3D0VB 2IQ9L 4WO4D 3T0BA 1ZLVK 2WUCL 4G9FA 1FNSH 1LGVA 1YEFL 32C2B 3DURB 5BW7C 4S1QH 1I8IA 1YQVL 2HJFA 4WW2C 1EZVX 4OF8A 2RAMA 4A2LA 1GAFL 1KENH 2E9IA 1N64H 1N7ML 2X09A 4HJ0C 1YEJL 3QA3A 3DX8A 4R96A 5EIIB 4JFEB 1X5JA 1OARH 3WLBA 2BVTA 3VXTA 3GSNB 5C0DA 15C8H 1YY9C 4PV9B 3CLFH 5JDJA 5C0EB 1ZHNB 1YNKL 4GXUN 3CFJA 1QLEH 1TTFA 4JN1L 1NBZB 3IDMB 4KI5E 1NFIB 2W65B 1AGFB 1MCPL 1K5NB 1IM3B 4K8RH 4HBCL 4U7SA 5CFHA 2FGWL 4UI2A 4WV1A 3V6OC 3QP3A 4FMFA 5EUKA 3A0OA 5C09E 1P4BH 1RFDL 2GYSA 3QDME 1AIFB 1EHNA 3QUYD 1JGUH 4W4OA 5AZ2L 4CJ0A 1WLHA 4K7PH 4I8DA 3EW3B 2IBZY 3HZYB 5ID1A 1ZHBA 5E2UL 1JTOA 3D2UB 3EJYD 5FYLL 2B4CC 1FV1A 4LGSB 3SGKA 1N3NB 5DR5H 2F74B 4XPTL 3Q1SH 3IAQA 5LQBL 2I26N 3PWJA 4J2XA 2HT3C 3BZEB 4ZXBD 1GOGA 2P8PA 1OD7A 4LEOA 1MFEL 1W0VA 4GW5A 3S8WA 1HXMB 5F7HA 5GS0D 4KI5D 2YXMA 5CZKA 1AJ7H 2VAAA 2HT4D 5F72S 4XT1C 3K8LA 1EMTH 3L6FA 5I15L 3T2NH 5SWSB 4I18B 1OTSD 2NX5E 4NJAL 3VG0H 5C09D 2DTML 2P8LB 1BP3B 4JAMA 5HPMA 3QDMD 4UQ3B 5BS0A 4PJ9B 2AVGA 5IHZA 1AE6H 1C7SA 3IB4A 1VCAA 1ACZA 5C0RL 1UQSA 1Y0LB 35C8L 3P73B 3V79C 1PVHA 5FV1L 3QEGL 5C6TH 3V0WH 5K9OA 4R0LB 1QHPA 3RZWA 4PRAB 1OM3H 5A43C 3HE6B 2PYFA 4IOFD 5IGXH 2BC4B 1A0QL 3CIQA 4OF6A 3ARBB 4JB9H 2CLVA 4P4KC 2WIIA 3PWNB 3SDXE 2NX5D 2EEBA 3DX6B 4YH6A 5BJTB 5IW3A 5EZJA 3H9SD 3V0AC 3BXNB 4H0IA 1FZMB 2I5YL 4NN6C 5D1ZD 1UWXK 3EO1B 1NAKL 4LLVB 1KPUA 5FECB 3UJIH 4HEPG 3CU7A 4GT7A 4F3FA 5E9DA 2GITB 5DT1L 4D2NA 3IFOB 4NNPL 3P0GB 3DI2B 2UUDK 4KKCC 3PWUA 4JY5H 2VWEC 3JWDC 4KROD 1T1XA 5E6ID 4ZUWA 2IMNA 1F02I 1ULVA 1KTLB 5D5MA 5IFJB 1LP9E 2CKBH 1IGTA 3NOIA 4X9FA 3MCKA 3WBDA 4HGWB 2ZUXA 1JI1A 3MNZA 3R1GH 4Q9QL 3VGGA 3MLTB 5K9JL 3GJEB 1HWHB 4TQEH 1N26A 4YHYC 3G6JE 4XVTL 1U0QA 4I2XB 4Y19D 1IGIL 5EU5A 3H0TB 5FXCH 4FQLL 1RUKH 2ICES 2AQ2A 4P5KB 4PJ7A 5DEGB 1AH1A 5BMFH 4NDMB 5CGMA 3A6CH 3DBXA 2EYTB 1IGML 3QZWA 3TBVA 3NA4A 4OFPA 3PE9A 1UC6A 4XMLH 4P5TA 5KSAD 3E1F1 4HMCA 1YEEH 4UT7L 2ZJSH 1MJ8H 3DNKA 4QCIA 1TJIH 4U0RB 1IAKA 4XXCC 4K9EL 1MHEA 1CTNA 5E70A 1TMCB 3IJHB 4YDIL 1OAKL 3BP6A 4OGAC 1WEJH 2ICEA 5CHNA 4GS7B 1WVZA 3O3DA 2DI9A 5SX4I 3ABZA 3GDBA 3ULUC 3BD3A 1MCWM 1JWSB 4MNGA 3BKJH 3GBML 4NKMB 3K4DA 5GZOC 4GQPH 5GGSA 4JLRA 1EJ6A 3CFCH 2IPTL 3D3VE 5T3XE 3NH7H 3EOAA 1ACYL 9CGTA 3B5TA 3VFGH 2LABA 1U8OB 4JPKL 1VPOH 4HUUB 3I02B 3S4SG 2J8UF 3CGTA 3ZHLA 3B9DA 2Y9RT 5DUBA 2ARJQ 2EE3A 4NNXA 3RU8H 4H88L 3X3FH 3P4MB 4M7KH 4R7DA 5F7DA 1NDGA 2I9LA 4W68A 2HKFL 4Y1AA 4AH2A 4XB8A 5INDB 5JLZB 4LF3A 3UZQA 4XCNB 4KPHH 4PJ5E 1NC4B 4P23A 5DK0A 1BMGA 3RUGE 2X7LB 1MCSA 3B2UC 3ARRA 4OZFA 4X5XA 3FO9B 2AKRA 2VMFA 3DUUA 4DKDC 1XF2A 3OKLA 4JZJB 1J0KA 1FRGL 2NXYC 5DHXB 4HV8B 4OD2B 4HIEB 3TBSA 2F54B 3PGDB 5F1KC 5DD6A 5TDNB 1IQDB 1HDMB 2E7LA 1PZ5B 4Y5XB 3U79A 3KPMA 4OFYD 2DD8H 2I24N 3EUUA 3QUXC 1AGCA 4WO4C 1WTGT 4MVBD 5H35A 1CD9B 4K3JH 1WWAX 4PJ5D 4HZLB 5GIRA 2HJFB 3OZ9H 3D39E 3BFOA 5IQ9A 3D5OF 3FFDA 2UZIH 2AQ3A 3E0GA 1XGYL 3QA3B 3C5ZD 4YHIB 3MRQB 4QRRB 2APTA 5BXFA 2YN3A 5HY9A 5ADPH 2X89D 4XH2B 4TUKL 3WLBB 2OZ4H 2R0LH 4URTB 2DDQL 4PJHE 4OAWB 1CLZH 3T3PE 1T80A 1CWVA 3O8XA 2H9GA 3CFJB 1EUTA 3G5YB 4G8GE 1OP3H 5DLML 3GNMH 2OK0H 5F3BB 3V5HA 1S7RA 1BJ8A 5CBEA 3T04D 1CIUA 3CU1A 1YY8B 4WV1B 4YBHA 3LV3A 5EUKB 3D39D 3QUYC 3EZ8A 3QEQE 3O3EA 2HN7B 3H42L 2Z9TA 3SDAD 1CVSC 1YPZE 1NANI 4P49A 4X7FC 4F58H 1ZHBB 2KQMA 3EJYC 5ID1B 3EJJX 4PRPE 4OQTH 5DJDA 4ZO6A 1KTKE 1FV1B 1XF1A 1OCWL 3DUHA 3IRPX 3NACL 2DM2A 2IAMD 2KZ1B 5D2NC 3O2VL 4ZXBC 2YK1L 3BSZL 2P49B 4GXUM 3WL9A 1CL7L 1OTUD 1XCTB 1G7JB 4I0KA 5GS0C 4KI5C 4G8GD 1DQQA 4TSAH 2HT4C 4GW5B 1SYVA 3ZYIA 3TA3A 5D72H 2VB5A 4P2QE 4WHCA 1OTSC 2ILLA 5J13C 5HHOB 4XP4H 3CC5B 3PWVB 2YPVL 1J0JA 4OV6F 3VGHA 4B50A 2VDPH 3VJ6A 1DUZA 1HCVA 3UJTH 5DUMH 1LNUB 3QEQD 3U36A 2FX9L 4Z7UE 2I9TA 2VDRH 5CLTA 5IHZB 5B3JF 3U6RA 1DFBH 1JGEB 2MQ0A 4PRPD 3GHEH 1FFNA 1NGQH 1IGFL 4ZPTA 5BOZG 3FZUD 1UQSB 5IOPA 4CDHA 2QADB 2WMPA 1A7NL 2XTJB 3AC0A 2DLFH 4GRWH 4NO3B 4IOFC 5IBUG 1Q0YL 2BFVL 1IT9L 3H7BA 3X3GH 1PZUB 1H5BC 2PYFB 3J7HA 4MXVE 1ZK9A 4PJFE 3HS0A 3FO0L 4GMSH 5IVXE 4P2QD 2CLVB 2OP4L 3DRQA 2C1OA 4JQIL 3REWB 5D1ZC 4WEBL 2BRRH 4TSCL 2R2HA 4M62L 3E8UH 3N1MC 4QHNA 4OKVA 1SY6H 5B4MD 1J5OH 4HPOH 2ARJA 4N0UB 3WXWL 3OKNB 3RDTD 5TDOA 4JRWA 4QNPE 4F3FB 3DMMD 3QIBD 1R0AL 3JV4A 4Y4FB 2CSPA 3NCJL 3BESR 4KROC 3UTZA 5E6IC 2PO6C 3S36L 2DQUH 1H3TA 4G9DA 3L9RA 4DKEL 1DCLA 3OF6A 1MIEH 3TBYB 3JXAA 1UWGL 5JHLL 1KCSL 4O58H 5F89A 3GMQA 1IGTB 4LLMA 5GXBB 1Q9LA 1QA9A 1L0XA 1UZ8A 4JDTH 2ATKB 4XP1L 5I6XB 5IW6A 2FB4L 4RAVB 4ZS6D 5EORL 1T89C 5I1EH 5GRXG 4RGMB 5EU5B 5M95B 1IC4L 4FQ2L 2J2ZA 3HZVA 1CLYL 2VITA 4GRMA 4LGPB 4PJ7B 4HG4J 3TNNA 5D7IB 2HFFB 3WKML 2NLJA 3DBXB 1C1EL 5HVWA 3WFCH 3TBVB 2A83A 4EIZC 5KSAC 4M1DH 2YA1A 1FVDB 1ORQB 4KZEL 3QDJA 5JHDE 1WBZA 1JF1A 5D1XD 4XAKE 1P84J 1S9VA 4QCIB 4XGZA 5D2LF 3CH8A 5EZLA 1B0RA 4LGRB 1IAKB 5LWYL 3MNWA 4YBQD 5EBLB 2PTUA 4NNYB 4PD4J 5MENA 4QXWA 5GS1A 5DQ9A 4PJBB 4L3EA 1A7BA 5CEZL 3WFZA 1IAIH 4HJJH 4BZ1L 3EO0B 1T5XA 4OBSA 2VLRE 5E4EC 4OIIH 3GHBL 4MB4A 4MNGB 4RX4A 5DJ8A 2HLFD 5L6YH 4UT6L 3TZVA 5H94A 1MNUL 5SV3A 1EFXB 5FYKU 4OUUB 2FBJL 5HYSG 4X6BB 4M61A 3CNKA 3EOAB 3LQAH 4XVSL 1W72L 2RR3A 2G2RA 5DD1H 5DJ0A 4KDTA 3L7FB 1EERB 4XAKD 1AY1H 1RIUL 2WZPD 3TN0D 5J11B 3S5LB 4LPWA 4DUXA 3MZTA 4NNXB 3UO1L 4EOWL 2J5LB 2NY5H 5DMIH 1CGWA 2AXJA 2D0HA 1HWGB 4PJDA 4QHKJ 2EYRB 5TQ0H 4AG4L 4CN4A 1NDGB 4HXBH 3BPOB 5A2LH 4AH2B 4OZ4A 4DGIL 4MZ2A 4LF3B 3HNTL 5T1DL 4OLXL 4P23B 2VE6B 1KLUB 5TFSL 5I1IH 4OZFB 1W8OA 3G6DL 5CGTA 2DQCL 3KXFA 1A6ZA 2FHFA 1UFUA 3OKLB 5KW9L 5EUOF 4RA0C 2LTQB 5GQBA 4Z7NE 2E27H 3TBSB 2QTEA 1P69B 1JZ5A 1TVBA 5DD6B 3SQBA 4P99A 2R0WL 4L1DA 4ZTOH 3WXVH 3BYYA 2X10A 2HVKB 3BYTA 5L2KA 3BGFC 5EIVA 4MVBC 4ESKA 2J6EH 3BVNA 4J8RA 1FP5A 3BEVA 3T0EA 3VGDA 5CZVL 3KLAB 4G3YL 1IAOA 5GIRB 1G7PB 3H9ZA 4DK6A 1TDQA 2HLAA 4OFIA 5DRWA 4X4YA 1WWBX 5IQ9B 2H32A 5L0QB 3FFDB 2VZUA 4LVHC 1U8JA 1QR1A 1TQBC 1BD2E 4Y88A 1JV5B 4OLZH 3LHPL 2EDRA 3FQNA 5DJZA 4WI8A 3GMRA 4MD4A 4X9HA 4WHTA 4XNXH 4LQ1A 5GGUA 1IL1B 5JIKA 4M1CD 3OXRB 1MCOH 4MS8D 3MLUL 3O8XB 4NRYB 1JGVL 1A6AB 1H9VA 1HHJA 2DQJL 5A2JH 5E8OA 4UIKL 3C2AL 4NQCA 1CE6A 1L6XA 4E42B 3V5HB 3AFLA 4AYFA 2FO4A 3ARWA 5C9KA 4X4XA 1JPFB 1CTOA 4IIQB 3RAJH 1PY4A 3LV3B 3QDGE 3SDAC 2ITCA 2VN4A 1NBYA 3O3EB 1G7MA 1D6VL 1NJ9B 2GIYA 3S7GA 3V5KA 4P4RA 3I3DA 4L4VE 1WBXA 3U7WH 5DJDB 1IKFH 2IAMC 3QIUB 4Z7WA 1I3GH 4NFDA 4EI5B 2V5RA 4GMTH 3INUH 2MHAA 1T03L 3BPCB 2GJZB 3LKOA 4G43A 2N7AA 1XGRA 1CE1L 43CAA 1HIML 5E1HB 4JO3L 5I8EA 4Z18A 2MQCA 1V3KA 5F9AC 4MA8H 4FQHA 3RL1B 1S3KH 3QDGD 4B7LA 3TBTB 3U36B 3OGCA 5EO1B 1KCUL 2I9TB 1VFOA 2H2PD 3I2CH 4L4VD 5DD3H 3FZUC 1UM6H 3OAYK 2ICWI 4GKZA 1FFNB 4M7LH 4ZAKD 4DN3L 3BPLC 2A2QT 4MXQC 5JDSB 2OTPA 3U4AA 1RZIA 1F13A 2B5IB 5CIPB 3C08L 3WFBL 2L4OA 4R26H 3VCLA 3KYKL 5LXGH 2YN5A 2VLLA 1IEAA 1D6EA 1A3RH 1QLRA 3RQ3A 5I19L 3QEHA 4QXUL 5IBTH 2ITDA 4OSUL 5GRZA 3ZKSD 1G7LA 5IIEA 1X3DA 1KCVL 4P4KA 3LN9A 1IBGH 2C1OB 4U2ZA 3I9GL 3DIFA 4FXGB 4FQJH 3F7YA 4U6VL 1OB1B 1K8IA 4QHNB 4LVOB 4OKVB 3RDTC 4GG6A 4XMKL 1JMZA 2EIZB 3DMMC 4HPYL 5MEOA 3TJHD 1KGCD 4KI1A 2VRAA 1D5IH 4PJEF 2NW2A 4FQ1H 2ZG1A 3UTZB 4LEXL 2EXYD 3MJ9L 1HINL 1NCBL 4JFDA 1CD0A 1DBAL 3WLWD 1JPGB 3T65A 3G5VA 2EDJA 3TO4B 2OR7A 4BH7A 3ARFD 3L9RB 1JNJA 2HWZL 3RWHB 2HTLD 1KB5A 4AM0A 3MJGX 3TP4A 4RISL 3DRTB 2PKDA 5F89B 3GMQB 3MRRA 1P7KA 1NL0L 3V6FB 3MYJA 4ZS6C 3RKDD 3ZKXB 2DM3A 5IW6B 2C7UA 1U8MA 1D7FA 2D7TL 5E2WH 3TH2T 4JFPA 3MV7E 4Z9KB 3A67H 2FEEI 1YEDB 5TH2A 1ZXQA 3MRJA 5BZWB 5CJBA 1NLDL 5D7LB 2NLJB 1TQCB 4ZOAA 5C0IA 3P0YH 2A83B 4OFVA 1IZKA 4OBRA 3WO4B 1F3JA 5D1XC 4RA3A 5EDXA 5FDWB 1U8LA 4Y2DD 4XGZB 4YBQC 3QXDB 1NFDF 2CDEB 3MNWB 3BD5A 3Q0HA 4XXCA 4OZGA 5MENB 4PP2B 5C8JA 4LCUA 1AD0A 1AGBB 1UB5B 1FE8H 4L3EB 4F7TA 1ZS8A 4X6FB 3TV3L 2MOVA 2UWEE 4OLVH 3MV7D 4TN9A 5IFHL 1T5XB 5I8OL 1WT5A 1HN1A 4ZS7L 3DVNA 5DJ8B 2ICWA 4MD0B 3VXSA 4D8PA 3L95B 4G7YH 3TZVB 3ZYJA 2W9EL 3FFCE 5H94B 3B5HA 3WFEL 1ZT1A 1ZLWK 4I1NB 1FGVL 1UJ3B 3BJLA 3G9AB 2AV7B 4M61B 5KANG 4LP5A 1Q72H 4FNLH 1CXLA 4NRZA 5FKAB 2EE2A 1J9CT 1GOHA 1W72B 4GKSB 5DJ0B 3TN0C 1U58A 2QHRL 5CBAA 5JR1H 4L4TE 4OGXH 1K3IA 2OMNA 4JPWH 3CFEA 2UVEA 5ELIA 5DD0H 3VXNA 2YSSB 4XBPA 1GYAA 3LS4L 3MLZH 3WHXB 3HR6A 4AZ8A 1UH2A 4MAUL 5JW4R 5IVZA 4PY7A 3QRGH 3STLB 5ILTH 4U7KA 1A7OL 5LAXA 1JPTL 3P9WB 3FFCD 2BSSA 3VRLF 5TE6H 1G6RH 2YPLE 3KXFB 2EYSA 1F97A 3UJJL 4YXHH 5F8RC 3HMXA 4H20H 3DYOA 2XYCA 1BZ7B 2ORBH 4Q0XL 3HR5B 4L4TD 3TT1H 1INQB 3B2VH 1NUDA 1RUQH 4RMSA 1IM9A 2O93L 3OG6B 4HF5H 4PS4L 1TVBB 1S7XA 3QPQD 4OQ1A 4XCEB 4UINL 1T6WA 5CINH 1M71A 3IDJB 4RGNB 5CJXC 1L7IL 1YC7A 2J8OA 3WIIH 2O26U 3BVNB 3FO1A 1IE5A 2FATL 3DX7A 1AI1L 3BEVB 4N8CL 2D3VA 3T0EB 2RQ8A 3DV4B 3QXAB 2VDLL 3DUSA 3L5XL 4NWUL 5C07B 3SCMD 2APBA 5H2BB 2ZPKL 5IMLB 2YPLD 5DDHA 1RHFA 3X13A 5DRWB 4X4YB 2H32B 5B38G 5LVEA 2CRZA 5E5MB 1QBBA 1QR1B 3KGRA 3B9KB 5T5NF 1H8OA 2NY0D 2D7NA 5J1TC 4QWWC 1XR8A 4C55A 3GMRB 4MD4B 4Y4HB 2WBWB 4WHTB 1GVIA 5H37G 4M1CC 1MCLA 1S5HA 2Y7QA 2CRIA 1WFTA 3FQRB 2YD5A 3VFUB 2P7TB 2VDQH 1R3HB 3WNKA 1CI5A 1HHJB 5E8OB 3ARZA 1BM3L 4NQCB 1CE6B 5EOTA 2VLJE 1T7ZA 1JHTA 1DR9A 3S4SB 3KR3L 2YUVA 3T4AA 1F4HA 1T0NA 3RA7L 3MUY1 3K4ZA 2E5EA 3TYGH 1EO8H 1P5UA 3PGFH 2WWMD 4G8EB 4UU9A 1J1OL 1CFTA 3QUYA 1AXTH 2P5EE 2P8MA 2BSED 3V5KB 1I7TB 5SWQA 2B1HH 4K07A 4Z8FL 1QSFE 1B0GA 4H0HB 4WU7A 4XI5D 5C71A 4HCRL 5C6PB 4FP8L 3K74B 3JV6B 4BQ8A 2HJLB 1EEZA 1JGLH 5C0FA 4I0PD 5DJXA 2LVEA 3P4LA 1KOAA 4ZXBA 3MA9L 2MHAB 3BIAX 4QRQB 1LK2A 3LKOB 4G43B 4MCZA 5F8QC 1XGRB 2VERN 3FOMB 3GMPA 5BRZE 1HHGB 2VLJD 43CAB 1ODAA 4M7ZB 1LEGA 3GMMB 3P9MA 4M1GH 3UTOA 5I8EB 3ZKNC 3I50H 2Y07H 3JUYA 3UTSE 3BO8B 5C09A 2Q87A 3MA7A 4JRXB 2H2PC 3OGCB 4UOW0 2P5ED 4NZTH 3V4UH 3U4EA 3L7EA 4ZAKC 3AM8C 1QSFD 3CZFA 3UTQA 2J7LA 4FZ8H 3CXDH 2OMBA 5T1LD 3PP3K 4WI5A 1MRDL 3VCLB 3E6FA 4HBQA 2Y5TA 1IEAB 5EBGA 5ALCH 1QLRB 3UYRH 1H5BA 5EB9A 5BRZD 2XN9D 3QEHB 1EZVY 2ZCLH 1T7VA 4UILH 1I8LC 2ED8A 3MGOB 5GRJL 2NX5A 4BSWA 3UTSD 5JQ6H 1ND0B 4HUWA 2PUQT 4FABH 1DBJH 4ODHH 3HE7D 1JHKL 4NC1E 4NN6B 1XZ0A 5GSRA 4ETYA 4OD1H 3U1SH 3U7AA 1KCLA 5MEOB 1ZA6A 5T5NG 3L5JA 4XPGH 5CD3B 3WLWC 3EYOB 4OLWL 1ZVHA 1EJOH 2EC8A 1U3HB 3ARFC 2HTLC 5E6IA 3T65B 3MACH 4R9HA 2GJ6E 3PP4L 1KB5B 4AM0B 1O7VA 4X80H 2VDNH 3ALPA 3C60D 2DWEA 3FN3A 4ZDHA 4CMHC 4U1MB 4ODXB 3SDXA 3MRRB 4LIQE 3RKDC 3BHBA 3QDAA 1R24A 2WBJD 1T1YB 4DZBA 3LH2L 5FGSA 3BJ91 1TNMA 4ZYKA 1K6QH 2J8UB 4HDIB 1DQMH 1U8MB 1WWCA 5F7FA 4JFPB 4FFYH 5JIPA 3ALWA 1HOCB 1B2WL 1N59B 1T89A 4MXWL 2DTSA 3MRJB 3MRKA 4QOKE 1J0ZA 3VI4E 3UPCA 3OJDB 4MA3B 4MB3A 2QSCL 5C0IB 4KQ3L 3FB8B 1FN4A 5KSAA 2VUYA 3NIGE 4Y2DC 2GJ6D 1FO0L 4KV5F 3DTXA 5GRUH 2FX7H 1LP9A 4LHUG 5T33H 1NQBA 1XIWB 1DL7H 3MSPA 3QISA 5IW1A 4OZGB 1LDPL 4OI7A 1AD0B 3SOBH 1UA6L 1WFNA 1NCAL 3MRIB 1EBAA 2GTZA 1LO4L 3G6JA 3G9VA 5FUCC 1NMCB 1PG7X 3EYQD 3PHOA 4QHLB 4YDVB 5KANI 4F7EB 1DLFH 5BVPL 5IBUB 1I1YB 4ZNCD 2ICWB 3VXSB 3B9VA 4O5LL 3MLWL 4QOKD 3MRMB 4IJ3B 1NGPL 5TDPB 1EX0A 1HQRA 4P59L 3KPNB 3N85H 4J3UA 4PJXF 5HHVL 4NRZB 1D5BA 3NA9H 4XX1G 1U58B 3V4PH 4I3SL 1Q9WA 2CK0L 4YK4B 4UDTB 3DSFL 4MHHI 1ZAGA 1PSKH 2WNGA 3LD8C 3H9HA 4DN4H 1JNHA 3VXNB 1Z6JT 3NTCL 4OZHE 1ZE3C 4XBPB 3TYFA 2X4OB 3BKMH 2VC2H 2O5XL 3HI6H 4PRBB 4LSUL 3HI5L 1I85C 3CDGB 4Z6AT 1NBQA 1CK0H 2X5PA 5HGDA 3O81A 1IRAY 1UADC 4L29A 2VZ3A 3C09C 3NPSB 3H3PL 4FXKB 1CDJA 5FB8A 2CDGA 3B83A 2BSSB 3WE6B 1WV7T 3VA6A 1BFVL 3D3VA 4XP9H 5DXWA 4PTTB 1S7UA 4ZOCA 12E8L 5DC4B 5J1SC 1VGKA 1MCRA 3P3YA 1XMWA 2AK4D 2D31B 4QXTB 5HHPB 4PJGE 2CMRH 3S37L 2FJFA 3QPQC 1JGDA 1IM9B 1DUYA 3MRBA 3W2DH 1R3LA 1S7XB 4FQXB 4YDKL 4YWGL 4M6OL 3O0RH 2QBWA 4HIIB 2F58H 2WQRA 3CK0H 4WU5B 5GPRA 2Q76B 1VADA 4QLRA 3U4BL 4ZUVB 4U3HA 3CX2A 1B4JL 2OL3A 4YHKL 1MAML 4PJ5A 5AAWA 3SCMC 1ROWA 3NCYP 1U3ZA 3DUSB 1A7PL 3RUGA 4TYUA 2QQNH 3QWRD 3QB7C 1GGBH 1ZWIB 5DDHB 1KJ3H 4N0YL 3C5ZA 2MTPA 2NY0C 2X89A 3G5ZB 1FZJA 1A1OA 2AJSH 1L0QA 4P9HH 1EGJL 1X7QA 3A6BL 4BELD 4LRIA 1XR8B 5FM5M 2X4NB 4KTEL 2Y7QB 4Z7VE 4L9LC 3P77A 4I48B 3L5WB 3D85D 5TQ2H 3WJJC 1MCKA 4P0DA 5HYSB 5EA0L 3BAEH 4ZUSB 4QYOA 4YEFA 2BY2A 1XCQB 4F15B 1T4KA 4JREC 3BDYH 4Q2ZA 1ITBB 1S7QA 4V2BA 2RFXA 1BGXL 1T0NB 2WWMC 4R4NC 1P2CB 3D39A 4N1HB 3KDMB 2J3SA 1I9IH 5LBSL 3SDAA 2P44B 4D9LH 2CDFA 1RZJH 2IF7A 4S10A 5F88B 2Q7YB 1KN4L 4WNQA 3EFDL 2R69H 3GI9L 4JQXC 3VG9B 1B0GB 4WU7B 4MJIE 4GRWF 4I0PC 4HW6A 4PJHA 4W70A 1JWMA 2IAMA 2Q8BH 4PV8A 3MROA 1LO3L 2N4IA 5DHVA 4G8GA 4MCZB 2EDQA 4MQTB 4YXLL 1LO5A 5SWZE 2G60H 4WHYG 5HVHB 2AGJH 4WHDA 4XNZB 3QEQA 1HQ4A 2MPAL 4NZUH 5C70A 5EC1B 4FQIH 5FOBA 1YPZA 3RWCB 1OGAE 1MEXL 3L7EB 1IQWL 4PRPA 1U42A 2C1PB 4WWKD 5CJQH 1DQLL 5EOQH 1DQTA 4LARH 3GZKA 4MJID 2GUOB 1MJ7L 3TFKD 1M05A 5DJAB 5BV7L 4F7CB 4ODSH 1J12A 1ETZA 3D0LB 3HRZA 1CFVH 1INDH 3E6FB 5IUSA 3WN5C 1P7QB 5JW5A 3WJLC 1ZTXL 3WDIA 5B3NA 4GW4A 1KJVB 4J6RL 4P2QA 3DV6A 5SWZD 1LE5A 4HXAL 4NHCL 4P3DA 3D9AL 3ZT6A 2NX5B 5GSVA 4BSWB 1IKNC 3VMPA 4HUWB 3HE7C 1JZ2A 2DLHA 4Z7UA 5D2LB 2VZOA 4MSWB 3WNMA 3DVIA 1Z3GL 4YGVA 3MCLH 1OGAD 4D94A 1HKFA 1NC2D 4HT1H 4GW1A 5AUMB 2DQIL 3PV6A 5DF0A 2ZUTA 3DMMA 3L3JB 5TPWL 3QIBA 4LASH 3U0TB 1JYVA 2XY2A 2EZ0D 3TPUB 2D9CA 3QHFL 1VFAB 2Z8VC 1AGDA 3PNWA 2PNDA 4LKXA 1BQUA 4J7RA 4OCWH 1MWAH 1MCJA 5C9JB 3R8BB 3C60C 1S9YB 3L1OL 4L8SC 5IVXA 3KJ6H 4PB0L 4KAQH 2ZSVA 4ZDHB 4ERSH 2XRAH 3LAFA 2WBJC 3P4OA 4X98A 3ZDZE 2OSLB 4GQ9H 4YBLB 1I4FB 4XXDB 3CH1A 3B8YA 1FNSL 1HXYA 3MV9E 5I1CL 1I8MA 1CD8A 1FN4B 1KENL 3LMJL 3UMTA 1HSAB 2I07B 4JKPH 5D1XA 4KHXH 5KN5B 2CR6A 3S35X 4DZ8A 3W0WD 1FO0B 2Z91A 3CVHA 5DQDH 3Q5TA 1KEMH 5EUOB 4E0RA 1AR2A 15C8L 2X4SA 1FZOA 3CLFL 1OP3K 4K3GA 2GTZB 4YPGA 5ESAA 1IEHA 3PHOB 3FRPG 4JPIA 2A6IA 2BNQD 3BH8A 1QLEL 2A9NH 2OYPA 5F6IC 2K9UA 4BYHA 4K8RL 4EUPG 3MV9D 2WUCH 5JXAL 2OCFD 4L3CB 1HQRB 4AIXA 3MREA 2JK5A 3BGMA 3FCTA 1C08B 3BP4B 3KPPA 5EH1A 1P4BL 4WFFE 5JHDA 3T0DA 3MLRH 1JGUL 4BSJA 3TN0A 5C3LD 1Q9WB 3VWJD 1RULH 1SEQH 5C86A 1YEJH 1GC1H 1XGQB 3H9HB 1JNHB 5GGRB 5DR5L 5I74B 3NGBB 3Q1SL 5IROA 4BM7A 2R2CA 1AQDB 2FBOJ 4WEUD 5HGDB 5AAMA 2VLRA 1CGXA 3ETBF 3F7QA 1N2RA 1YNKH 4LSPL 4YC2B 5FB8B 2CDGB 3PF2A 1IGJA 4HH9A 3D3VB 1EMTL 4QTHB 1VA9A 2HH0H 3T2NL 1JPSH 2JB5L 4BK4A 1S7UB 1RIVH 3IU4H 1FG2A 1JRHL 1NGWA 2A6KA 2FGWH 2GEEA 3ILQC 3PHQB 4N0FB 1BJ1J 1W0WB 4WFFD 4DCQA 3KPQB 3OKOB 1MY7A 4G42A 1RFDH 5D8JL 1QYGL 2H3NB 4HWZB 4F33B 1JGDB 3QYCA 4DTGL 3KPOA 3MRBB 1H0DA 1NAML 3C9NB 1EK3A 4GLRH 4ZMAT 1A14H 2C3VA 5FYLH 1NDMA 4JO2H 5C6TL 4XPTH 3V0WL 1VADB 4XP5H 1BJ1H 2VABA 2OL3B 5EU3A 4PJ5B 4BFIA 4D0CA 3MXVH 2Y1VA 1AKJD 2YUWA 2V9TA 4JB9L 3KYNA 4U6YA 4JFQB 4BQBA 4QGTA 1N0LA 3LN4B 3RL2B 3L5HA 4NSKB 2E6JA 3C5ZB 3KYOA 4CMMA 2KUTA 4TTGA 5K59E 5DJ6A 1JF5A 4MMZC 3U0PA 5C0GB 2KKQA 3UJIL 2GFBA 3EOTH 4LCWD 4WVRA 1FH5L 1GZPA 1XF5A 2R2EB 5D70H 5KVFH 4JDVB 4X8JA 2JCCF 3TBWA 3GIVB 4LSRH 2V7NA 35C8H 4QYOB 3GK8L 4JY5L 4RBPH 5KSUB 4KVCH 1T4KB 5ICYA 2BVUA 5FYJL 3UROR 4NGHL 3EOBB 1A0QH 1S7TA 3RWEB 2CKBL 4DUWA 4HX1B 3GKWL 4PJ8B 5K9QG 3O4LE 1BD2A 4RNRA 2UZXB 2OBGA 2E9WA 5IM7A 1F00I 4M03A 2I5YH 5IMKA 4YR6B 1NAKH 2QQKH 1BEYH 1OF2A 4RFNB 4PV8B 4UIMA 5BMFL 3A6CL 2Z93A 5E6ZA 4XMLL 4WUUE 4K71C 3RVTD 2AXFA 2QR0B 4DVBB 3B6SB 1LO5B 1WGOA 4GAGH 3UX9B 1YEEL 4HG4K 1K4CA 4PJEB 1TJIL 3LKNA 2D4FA 4PBWD 4XNMB 2Y5EA 1G7HA 5F6HI 3QDGA 1N6QH 4M3JA 3O4LD 3O3UN 1QO3A 1J0HA 1WEJL 3R8QA 1F8TL 4EN3B 5FOBB 1P84K 1BBJB 4L4VA 1JN6A 1FL3B 4WWKC 2B7DT 2DWDB 2R39A 4NKIL 4ZAKA 3BKJL 1SVCP 3SBWC 7FABH 3ZDYE 3VFPB 4PD4K 4HMDA 1A3LL 1M05B 3S34H 3DX9A 1ETZB 2NY7H 3BN9D 3NH7L 5BV7B 3RVXC 4HHAA 4WUUD 3VFGL 4JEGB 1VPOL 4F8QA 1KJ2L 5CZXD 5B38B 4GW4B 3EIFA 4P2QB 3DV6B 3JVGA 1LE5B 2ZG3A 3CSYA 4P3DB 4OZIE 4UT7H 4KMTL 1BF2A 1A1MA 3RU8L 4HKXB 3SY0B 1JNLH 4J1UA 3PDOA 4M7KL 3PWLA 4WFEE 8FABB 3HUJE 3V0VA 1CFBA 3AMKA 4MCYB 1AO7E 4YDIH 1BREA 2EZ0C 4F57L 5FM8A 3QIBB 3OX8A 3MJ7B 4S2SA 3T1FB 3MUJA 4ENED 1FVEB 5FGCE 1IGYB 3PNWB 4LKXB 4QRPE 5JORB 3VXUE 2VXTH 3MRPA 4ELKA 3W39B 1ACYH 2BVYA 1GSMA 5DGQA 3NN8B 4JPKH 2H26B 2ZSVB 4U1HB 1ZANH 3RWJA 2NYYD 2P45B 3ZL4L 2IALA 3IAPA 4PJCE 4JCLA 1A47A 4WFED 2A74A 2DD8L 3RFZC 2C4XA 4Z76A 3OGOE 4KJYA 5KSVA 3CH1B 3T8XB 4NO0B 3ZKMD 1KELH 2VR5A 2ADIA 4KRMB 1WCQA 1YN7B 4KTYA 4OZFH 3OZ9L 3VXPA 1MF2H 4QRPD 3VXUD 3SGEH 1KXQE 2VKWA 1BFTA 2UZIL 3VFSA 4Y2DA 1A64A 3SE9L 1XF4A 4DZ8B 1MPAL 5ADPL 3PL6C 2XWJB 2OZ4L 5F7LB 2R0LL 3NCMA 1HK6A 5L9DH 2XV6B 2Y6SC 2R1XB 2V2TA 1XGTA 1DEEA 5T1MB 5HHXH 3FAWA 4IRSD 3MV7A 4YPGB 5ESAB 4JPIB 3L3HB 3BH8B 4NC2B 3C5SB 4MA7H 4H0GA 2NXZB 3GNML 2OK0L 3VGFA 4X6CF 4YLQT 2Q6WA 5J9PA 5JOPE 3EFFA 3L3GA 2ZUSA 4GRLC 3BGMB 2MJWA 2UYLB 3FCTB 2AV1A 2D0GA 3KPPB 5C0NC 3MR9A 5KAQF 5JHDB 3IYLW 3VWJC 4NBYB 5F9OH 2P1YA 4F58L 1XGYH 5GJTH 4C56E 1ZT4B 4HKBA 3S3JA 5IQ7H 1EHAA 4X6DF 1GPOH 3LKRA 2YWZA 5DVOA 3FO2A 2UWEA 4H25B 2DDQH 2WP3T 3O6FD 3THML 1CGVA 5F7WC 3S3SA 1LE9B 2BVQA 2VLRB 1CT8B 5LCVH 4TSAL 5FF6B 1YYLH 1S7SA 3FFCA 5D72L 1BOGA 1K8DA 5DLMH 1IGJB 3C87A 4M9OA 5JOPD 1GGCL 3EO9L 1EEQA 4XP4L 2VDPL 4JY6B 4HMEA 3SDCA 1FL5B 3UJTL 3DETD 2O61B 4L4TA 2VDRL 5D9SB 1DFBL 4JY4A 3GHEL 1NGQL 1INEH 1H0DB 5HGBB 1P1ZB 4C56D 4X0KB 4V1DE 1NAMB 3QHZH 4U0QB 1QNZH 4U1KB 2C3VB 5F1NA 5A40E 1NDMB 4UV4H 2X4PB 1Z9MA 2DLFL 1QFWI 5D1QC 3GJFA 5JZ7D 3AREB 3Q6GL 5EU3B 2PCPA 4BFIB 1MCHA 1AC0A 2NR6D 3F7VA 1KFAL 3SCMA 3SKOA 1KG0B 1KCKA 4L8DA 2AW2A 2C3HA 4LHUB 3OB0H 2YPLA 3N9GH 3LRSA 4U6YB 1PLGL 4CRPA 4S1DD 2X4RA 4MA1B 2YPVH 3HCVB 3WNLA 3KYOB 3E8UL 3O9WB 2ZUYA 4X9BA 2IWGA 3OHXA 4HPOL 4J3TA 2MCPL 1J5OL 3U0PB 4YDLC 4O2FB 1D9KC 1II4E 3CSPA 2X9XA 1GZPB 5LGJB 3ZTJG 3RP1A 2H41A 4L9LA 4X8JB 4EUPA 2OQJB 2O5ZH 5I1AB 3WJJA 2V7NB 1Y6NR 5BO1H 5ICYB 1Q0YH 1IT9H 1PFCA 1QACA 4ZFZB 1EVUA 2APWA 4TVPE 3FO0H 3WS3B 4DAGH 3T3MF 3H7LA 2CKBB 4YGAB 4JDTL 3AB0C 4P2RB 5J6HA 5I1GH 1BD2B 3LZFH 1U95A 2NY4B 4QRUA 2UV3A 5I1EL 4F37F 5IMKB 4JQXA 4JR9H 2RB8A 4I0PA 4UIMB 3KPSE 3WFCL 3MUHL 2JJTC 5LKNA 3PABA 4M1DL 3P4NA 3UZEA 1R0AH 4QF1B 3NCJH 3V2AR 2V2XA 3BQUD 2VLJA 1C7TA 3ULVH 3VE0A 3MLYH 1U91A 1K4CB 3S36H 3WS6A 4NQDE 3T0VA 4NUJA 3T2PA 3HFMH 3LKNB 2UUDH 2EC9U 4TVPD 2LV4A 5AZEH 4PJIF 3NFNB 3QDGB 3QUML 1QO3B 4GKNA 3QNYB 2P5EA 2F8VA 3QUMA 4E41B 4FMKA 1IAIL 4L4VB 5E5RB 3QQNA 4OIIL 1B88A 1QSFA 1L6ZA 2PYEE 1NANH 3GSQA 5L6YL 2R8SH 5T1LA 3KPSD 1H3PH 3BN9C 2BRQA 4FQ2H 4WTXA 4JVWA 4YFLI 1CLYH 3DX9B 4LFHD 4DW2L 3L3KA 5KTEL 1VACA 1HH6A 3TCXA 5CZXC 3I6KB 3U46A 4EDXA 5DD1L 5BRZA 5DRZA 4MWFA 4QKXB 1S8DB 2YPKA 1WC7A 2RIKA 4S0SD 3WJLA 1AY1L 4LSSH 1KJ2B 5D71H 4NQDD 8CGTA 3SJVD 2HA1A 1F4XL 3HA0A 3UTSA 5FO7B 1DP0A 1A1MB 4J1UB 4CN1A 2NY5L 5DMIL 3EDDA 3HE7A 5TQ0L 4K8RC 3KLSA 4HXBL 1CXKA 1AP2A 2NY2B 2PYED 2HAZA 1PDKA 4BZ1H 4AY0A 4ENEC 1OOAA 3G04A 5IB2A 2IPKB 4S2SB 2PXYD 3JWNC 1A4JA 4BSVA 5F21B 1BQLL 3FT4A 1D5MB 5AG8A 1Q8MA 1SBSH 2W0FB 1JFQH 2W91A 4I3RH 2FBJH 1OW0C 3G08A 4U6HA 4WW1A 3MRPB 3PJSA 4H8WC 2NYYC 4L8SA 4PJXB 2E27L 2L7JA 1NGZB 5EC2B 5FA3B 4JM2D 3QUKA 3WXVL 1UZ6F 2DYPD 3RTQD 2B0SH 4HQQH 4Z76B 2EDFA 1LVEA 1GIGL 3ZKMC 1OQXA 4HS6B 5GGTA 1OGTA 2ADIB 4OD3H 5D7SL 3HNTH 4WCYH 4OLXH 3VXPB 2XQYK 4LNRA 3UPRB 2NMSA 3V5DA 4G8IA 4CU8A 2GJ6A 3G6DH 3AU1A 4LVNC 3VFSB 2VXUH 1XF4B 1RMFH 1X6NA 3RIFK 5KW9H 1BX2B 4OLZL 4WDIB 1U41A 4XNXL 5J12B 2K1MA 4NKOA 2V2TB 1XGTB 1DEEB 5HDLA 2DQGH 3MMEA 1MCOL 3WV0A 3MRHB 3GM8A 1JMXA 5FO8A 3RY6C 3CFDA 4MDJA 4KUCD 4QOKA 4Q6YA 2Q6WB 4HEME 4X5LA 2VUOA 4I5BA 5CJOH 5D7JD 3EFFB 3L3GB 4IRJD 1T2XA 3IAGC 2FECI 1QKZH 2AV1B 3TNMA 3BE1L 1J05B 4PYGA 2H32H 5FV2A 2XNAB 4ETQA 2JELH 4YNYA 4DKAA 5F97E 4K94L 5HYEA 3U7WL 1QG3A 3T77A 4HKBB 1IKFL 1UXSA 5EO0B 5EPMA 5IEKB 3O6FC 1I3GL 1R3JA 3FO2B 2AERT 3QQ4A 1MRFH 4LKCB 5DTFA 3MPCA 5I1HH 1QSZA 4PGCA 5CLWA 4V2CB 3INUL 1SJVA 1DEDA 4LVEA 1S7SB 1FGNH 2YOCA 4ZO7A 4WWID 2YS4A 3VGBA 2C5DC 4YZFF 5TE7H 3DETC 1S3KL 2HYMA 3SDCB 3ROLB 2EDXA 4L4TB 2YD6A 1WCBA 2GSIA 3CCHB 1UM6L 1E6JH 3BIBX 4OZHA 2CO6B 3ARYA 4I3GA 1DN0B 3LVEA 4ZFGH 4AENB 3HC0A 4Q6IB 5JZ7C 4R26L 5LXGL 5HPOA 1P6AB 2AJZA 2R2BA 1A3RL 5IBTL 4IBLT 3F7VB 5MI0B 2DQFA 3SKOB 3QWRA 1CE1H 4S1DC 2PN5A 2DOCA 3LRSB 3TIDA 4GXVH 1HIMH 4JO3H 2X4RB 3RGHA 3QEUB 2ADJB 4HGMA 4FQJL 3EYFA 3H8NA 1Z9OA 4PJGA 3OHXB 4AQ1B 4JGMA 1J8HE 1C12A 4ODUA 3QNXB 2SEBA 1BBDH 3HAEA 5A2KH 3D85A 4QY8A 4EUPB 4FQ1L 2WWKT 4NN5C 2IC2A 3NPZB 1ZLUH 1ZT7A 1F4AA 1RZ7H 5IG7B 5DA0B 1IAIM 1FLTX 5I19H 4MLIA 2ZUWA 4U49A 4PJAE 1OQOA 1MAKA 3PIQA 4KJPD 1QEWA 5E2WL 4PYHA 3I9GH 1KEGH 3Q48A 1IEBA 4RRPA 1J8HD 4LCCC 4X99B 4XMKH 4Z7VA 2Q1EA 5EOCJ 5D6CA 4A6YA 3MX0A 1KT2A 2VDMH 3QI9B 1N8ZB 2DIBA 3BQUC 3P4NB 3VFRA 3WNNA 3FQUA 2HJKA 1KNOA 5JOFA 2V2XB 4IHOA 1HZHH 1LEIA 1NCBH 5EU6B 3VE0B 3DYMA 2W0KA 4OCNC 3WD5H 1KB5H 4KGJA 3SDDA 2ZOKA 3AROA 1YECL 3OR6B 5INCA 4P46D 5E00B 2XWBB 5EOCH 3W9DA 3QUMB 4ZODA 1MIML 4IS6A 3T1WA 3PHSA 4WWKA 5HGHA 3BKCH 2D7TH 4P2OD 3ZE2F 4MJIA 3LRHA 3SBWA 3TT3H 4G7YL 4KK6D 4G6KL 3GFUA 1VACB 1HH6B 3HZKB 1Q72L 3BDXA 2VL5A 4FNLL 4X5WA 4AK1A 2X40A 4PRIB 3LKSA 3F5WB 5BRZB 4L1HA 5DRZB 4MWFB 4MQ7A 2YPKB 1KTDA 1I1FA 1XEDA 2ICWJ 5SWZA 2EDKA 4HS3B 4OGXL 2VISA 2XFXA 1OSZA 3D18A 4M6ML 5DD0L 1Q94A 3T09A 5KS9F 4JKMA 4IOIA