1KG0B

Structure of the epstein-barr virus gp42 protein bound to the mhc class ii receptor hla-dr1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
188
structure length
188
Chain Sequence
TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Epstein-Barr virus gp42 protein bound to the MHC class II receptor HLA-DR1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
molecule keywords MHC class II Receptor HLA-DR1
total genus 39
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2001-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kg0B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1kg0B01
3MUZ1 2VR9A 2MOVA 4I18C 1AP2A 1J18A 2Q6WA 4GW1B 3SDDC 4P5TB 1SEQL 4WTWA 5C0IB 3FQTB 3JV4B 1CFQA 1CWVA 4E5XB 4HWBH 4JDVB 1FZJA 4IRSB 4UT6L 5IVXE 1U0QA 1ZLUK 3D2UB 4NN7C 4QGYA 4LCWD 1I1RA 4IIQA 4S1QH 4D8PA 1FL3B 5IB2A 4BH7B 3VMNA 1G7LB 8CGTA 1NAKH 5DR5H 2OK0L 3LEXA 4JRYB 3OHXA 2EC8A 1I7RA 1A21A 5EUOB 4D0DB 4PRPA 3INUL 4OCXL 4O5LH 2A9MH 5I1HL 1EEYB 3P4MA 5IOPB 2Z93B 4XPHH 4X7SH 1CGTA 2C4XA 5B21A 1BBJB 4Y0GA 4F57L 4YDKL 5F9OL 5T3ZE 2F54E 1P5UA 1LDPL 2BNQE 4NO0D 5T3ZL 5ALCH 4XP1H 2Y06H 3DRQB 4O02L 1I7RB 3O3AB 3V5HB 1U8QA 4U6YA 1LD9A 3R06A 4J1UB 3MBEA 1XF1A 4ODVH 1UXSA 1OCWH 3VXUB 1B4JH 1EEYA 4JFZH 5HHMB 4BQCA 5J0BA 5GRJH 2XY1A 4AENB 4PJHE 4P9MH 5E99H 1QPXA 1KLFA 3OR6A 1LEIB 2V5YA 1NQBA 2D7PA 4G7YL 3DVGB 5FF6B 4DUWA 1MHCB 2DDQH 2V9RA 4MQXD 1T7WA 4AH2A 1UXSB 2DMCA 4XWOD 4ZQKA 4PGBB 2A83A 1QA9B 2N56A 3OXRB 1F42A 2R29L 4MQSB 4QNPE 4I9WE 4ESKA 2JELL 1IGJA 2JB6B 2DLGA 3FQNB 4FQXA 3QA3B 2ICEA 4HAFA 1C16A 2R0KL 2PXYA 2P7TB 1CE1H 3ARTA 3CX2A 4OUUA 3QO0A 3NCYP 1C7TA 1MHCA 1A1MA 3QUYD 3VMPA 2JB5L 3SBWC 3AS1A 1NCCH 3JZ7A 3MLWH 1BBDH 4WCYH 5D5MB 5IEKB 4OCRH 1CXEA 1QA9A 1PDKA 2YSSB 1JTOA 3CDFA 2EDDA 1MCWM 4PJGB 2X9WA 1GIGH 3DX8B 5JHLL 1YMMA 1EFQA 3FB5A 1C16B 4JE4B 4MXQC 3JUYA 2CDFB 4D2NA 4MDIA 1IAKB 4UI2A 5CS7A 2X4QA 3EZJB 3QDJD 5H35A 2VIRA 2OJZH 4I3GA 3TVMB 5SV3A 4RRPA 4O5LL 3I2CL 4G9DB 4NQCA 3RWIB 2JKXA 4JCMA 2APWA 1PJ9A 4LCCC 4K3HA 3L5IA 3IDIB 5E1HB 3B8YA 4NQDD 1XGUA 2PO6D 3TIEA 1FN4B 1RIHH 1AE6L 1D6VH 2PTVA 1WCQA 5F3HA 1HHHB 3C6LA 4KRPD 2RGSA 3GSNH 2VIRB 3LQAH 2D31B 1VFAB 3CPLA 3UPRB 2NX5E 1ZK9A 2ADJA 1SBBA 2CO6B 1DUYB 1P5VA 2G5BB 4F9PC 4PP2B 1MRFL 3OKOB 3TYFA 4E42A 5CIPA 1CE6B 1S5IL 3WDIA 4KTDH 4ZSOE 1CL7H 4Y5VB 1GGBH 5CHNB 2F19L 4KKLD 4OUOA 3BJLA 1L0YA 2Q87A 1JVKA 4BUHA 3BI9X 1Y0LB 2JE8A 2XFXB 4HK0A 4HKZB 1TJHL 4OZHE 1DN0A 3KDMB 1VFAA 5HI5C 1B0RB 1MJ7H 4HPOH 3UBXI 1A6WH 4LRNL 1DUYA 4XPHL 4LEOA 3WLBA 5ICZA 1U8NA 1EEZA 5F93C 1CL7I 5LJYH 2A0LC 2RFXB 1BM3H 2YK1L 5E9DA 3U9UB 1XR9B 3KPMA 3JTSB 1Q0XH 2QSVA 1C5CL 2MHAA 1EX0A 1Y0LA 3O2DA 3ZYOA 5BXFA 3L3JB 1R5WA 3IF1B 2H26B 3VWJC 4Z18A 2VDKL 1JNHA 4Y2DC 2ENYA 4KQ3L 4M7ZB 5L7XL 2H32B 3O4OC 4X0KB 2R4RH 1OAYL 3ZKXB 4ZTOH 4YXHL 2FBJH 4J3SA 3D1MC 5HD8D 1A02N 4F7TB 4GW4A 5GPRA 3U1SL 1EERB 1T66D 3MLYH 3RY4A 4K3JH 4WU7A 2VO5A 3IF1A 4NRZA 4QOKE 3BZDA 3LD8B 4XCFL 1BZ9A 1OP5H 4YC2B 1KELH 1OQOA 1J5OL 3Q1SL 5GGSA 3PQYE 2DI8A 5ALBH 1U8OA 3TJEL 4MJ4A 1M7DA 4JR9H 1HQ4B 3DUUA 2IQ9L 2ZUTA 4G6AC 4C4KO 2W65A 4D9RD 5DO2C 2WWMD 4OLZH 1Z9MA 3MBXL 3RWFB 4HGWA 1T7VA 3WUWG 1FIGH 3KPRD 3OAZH 4P3WA 2OBGA 2M2DA 5BZWB 1KN4H 1T1YB 4F37F 2VDLH 3IU4L 4MJIE 4A6YA 4KK5D 3EYVA 3E8UH 1R3JA 4CN1A 4OF3A 3WS6A 5GGSB 5E8OA 2HFGL 3LDBB 5I15L 4XHJC 3G9VA 4AQOA 2EXYC 4KDTC 3B6SA 2P5WB 2XI9A 1KJ2B 4JO3H 4O2EA 1JHLH 1MWAH 2OZ4H 4G6FD 4PJEF 4GSDH 4FZEL 2W9DL 3T09A 3MGTB 4XPFL 4K8RH 5F1IB 1DVFD 3QEUA 4OB5L 4FXGA 2VLRB 3EFDH 1N3NA 3WNNA 2GK2A 3T3ME 4I0PA 4KAQH 4KZDH 1H5BC 4Y19B 4PLOB 4YHOL 4L4TB 1CGXA 4M7LL 3FQRA 3MR9B 4DW2L 3GO1L 5ENWA 4JKLA 3HCVA 4MA3B 1TVHB 4R7DA 1T1XA 5I8CB 1H3TA 3GSUB 4MZ2A 3STLB 3JTTB 4JJ5A 3MRHA 3L3DA 3CUPB 5DS8B 4X6BB 8FABB 5SWQB 4AYFA 4DGVH 2AK1L 3BKCL 3UPCA 5F7DB 1X5LA 1QRKA 4WUUA 4Q6IB 4L4TA 3C08H 2GJ6B 5FGBA 3WHXA 1E27B 3O6KH 1N6QH 1EJ6A 5DHXB 4JPKH 3KXFA 3MTRA 5J13B 2L7UA 2XTJC 1MRCH 4MD5B 1N7ML 1F00I 1PFCA 2PYEE 3IKCB 4NO5B 4ISVA 1D5XB 1UC6A 2DMBA 2ZUQC 3LKSB 1P7QA 1E4XI 4TQEH 3RIFK 3G6DL 1XIWD 5C8JB 5KS9F 2O26U 3U2SB 1I1FB 5IVXB 4UTBH 3BPCB 3FO0H 3CFKA 1Y6NR 5EBLB 4ELKA 1JYVA 1JNNL 2VSCA 1HHGA 3WKMH 2D7TL 2GITA 5F6IC 4DGVL 1GH7A 3NA9H 3NABL 5CJ8A 3JWOH 3BT2H 3ARYA 4YHNA 1JV5A 3TT1L 4ACPA 1ZTXL 2ESVD 4HWZA 4RBPK 3T3PE 3U2SA 5ADOH 2IANB 4L4VB 2AK4E 4YHYC 4CN4A 1MFCH 4C4KT 5B8CC 5CEYB 5JMOC 3MLXH 4Y5YA 2KUTA 4KAQL 4JM2C 1K4CB 4MD0B 1MVFA 3G04B 3VFPB 4ELME 2VZOA 4PJXF 3ARSA 5E1AA 5EIVA 5LBSH 4NQXB 2GJZB 3FN3A 3QUZA 3CFCH 4O2FA 1EHNA 3FMGH 2EH8H 1L7TH 4KKCC 5E95B 3HI1A 4HIHB 3MA7A 3VD9A 2NY1B 4YGVA 4HEME 5T3XL 1MCPL 3GJFB 4ZO6A 4E41A 2IANA 4L4VA 5CILL 1HH9A 1NBYB 1KT2A 1XIWA 2FHCA 1P4IH 4AMKH 1KIQA 5C0DB 2IWGA 4Q9RL 1TMCB 1CI5A 3E8UL 4Q9QL 1AI1H 4LP5A 1MAKA 1YZZA 3BVNB 9CGTA 2VLKD 1AGDA 3FRUA 1IQDB 1YEIH 1TZGH 4BSWA 4NJ9H 3ROOB 3VRJB 1MHPH 4PJ5E 4P5MA 2R2CA 1E4WL 5DRXA 1TPXB 5EORL 1P84K 1S9KC 2WIIA 4Z8FL 3L6FB 2WUBH 2CRIA 4D3CL 5HHVH 3ARPA 4PRIE 4N0FA 5TDNA 4DZ8B 4NQCE 4DKDC 3DMMB 3Q0HA 2VZ1A 2GCYA 4LPCA 4GKOA 4UTAL 5D7JA 5KANG 3F7QA 4ODUB 1NLBL 5GGVY 2Q7YA 1N0XL 1CU4H 3BP4A 5EZLB 4KJWC 3MRDB 5DFVD 2NY5C 3HZKA 2HTKC 3W81A 3BQUB 1CFSB 2UVFA 4ZFOA 5DMYA 4XCCL 2IEPA 1E6OL 4LFHD 4QKXB 5EU5A 1CXHA 4P4KC 3N1FC 4H88H 2GIYA 3WSQL 4F7CB 4MAYA 4XGZB 3VXSA 1OPGL 1AP2B 5IBTL 3FO9A 4YHZH 2UUDK 2NY5L 1I7ZA 5HI3C 4YR6A 1NGYA 3S35X 2HKFL 5TDPB 2OTUB 2W92A 1IEBA 3NH7L 4MVBC 2DIAA 1P4LA 1G7JA 5DJZB 3BQUA 1T0MB 5IESH 1N26A 2Z8WC 1G7LA 3L7EB 1AJ7H 1CDUA 3K1KC 1WWAX 1GPOH 3VMOA 4MD4B 2ADGB 4LVOB 3BHBB 2VLKB 3MRRB 4OLVL 4L3AA 4U1KB 3H2WA 5HYSA 1CXLA 5DJZA 3FFDA 1C12B 2XQBL 2FB4L 3IDGB 3DTXB 5D1XB 2DOCA 4K7PY 3W0WA 2J8UF 4PJCA 2X4NA 3PQYA 3RVVC 1CFNA 2ICWA 3QG7H 5E2VH 1M7IB 1D6EA 3BGMA 2B4CL 2R23A 4K23L 3VXUA 1R5VA 2FX8H 3GMRA 4JFEA 2XPGB 4KXZI 4RZCA 1MCNA 2E7CA 2BNQA 4ZPTB 3RIAF 3WO4C 1GOGA 5BW7A 1B6DA 3N1MC 4NQEE 4N9GA 5EN2B 4LDEB 3HE7A 1R3HB 1FYHB 3C6LC 1MI5D 4D9LL 4I3SL 3C5ZD 3FO1B 4PJEA 2UWEB 1T21B 1NCNA 3M8OH 4X9GA 3B2UD 3MX0A 1A6UH 4Z7VE 3THML 2AV1A 2XPGA 1N6VA 4RZCB 4XC1L 5EA0H 3QYCA 1AC6A 1X4YA 3QG6A 3WEXA 1UJTA 3SDCD 5D7LA 4HG4K 4LLAA 4XBEL 4OLWH 3QULB 3MNZA 4HF5L 3P9WB 2QQNL 2V9TA 4QOKB 4UB0H 4ZG1A 2CK0H 4MA7H 2JJTC 1VENA 3PGFH 4TTDD 2ATPB 2NPLX 1AD9B 1OW0C 1V8HA 4N90D 1SBSH 4LCCB 5IEKA 1ND0A 3LPFA 4WW2C 2AV1B 3ARVA 2QV2A 4N1HB 4IOIB 5E94A 2BSSB 3DV4A 4AK1A 5I19H 3WLWD 2IGFH 3QXDA 3RIAK 1EGJL 2DN7A 4QXGL 4YK4C 3MO1B 1IGFL 1MCRA 2X1PA 2ZUSA 2FHBA 3PHOA 2ORBL 1IAKA 3BN9C 3MCKB 5F9JB 4PJIB 4TNVF 2XQBH 2B0SH 4K94C 2R2EA 5JR1L 1QSFD 3DROA 2BSSA 2LU3A 5HGHA 2DLFL 4G9DA 4NQCB 3VXME 1KULA 1U3HC 4OF7A 4XAWH 2I5YL 2E3VA 4R26L 1XGUB 3ZT5A 4Y19D 1OARL 3NFSH 4R0LC 3LHPH 2Y1VA 5MHSD 1DBJL 4NZTH 4PJAA 3V6ZA 1CG9A 1HHHA 5GGTL 2VXTH 2EDJA 4FQHB 3O4OB 4JVWA 4XI5D 5LQBL 3ZKXC 4EQ2A 5JW5A 1ZANH 3S88L 3DROB 5HGGS 3ULSA 4MQ7A 1S7RB 2NY0B 3BESR 4I8DA 2VKWA 4UQ3A 5CIPB 4JDTH 1YUHA 3D39E 5J9PB 3ISWA 4WEBH 5A40E 1IFHH 4JN1L 1CZ8H 5HYJE 3CLFH 4PTUA 3QEHA 5CEXB 1S9XA 1NDGA 4KVNH 3O2DH 4GKSA 4M48H 3SKNA 2HKHH 3IU3B 4OZ4A 4LEOB 1RAMA 4KZEH 3HE6A 3U6RB 1U8NB 5FYJU 1IZJA 5C0BB 2R0WL 1WZ1L 3MYJB 1U8LA 4L5FH 4OLUL 3RWDB 5E9DB 3VFSA 4QT5B 4UAOC 2ARJQ 1FL6B 2VLJB 4KHTH 2OP4L 5C09D 3EDEA 1DLHA 4MLIA 2OS7A 5F7EL 2EICA 3KS0J 3L3OA 4ZNEA 4R4ND 2Z91B 3SJVE 4KKNA 1QHOA 2H26A 4IMKC 4AIOA 4LVNB 4P0DA 5FHBL 1H9VA 3DNKA 4LLVB 5TH2B 3D0LA 32C2A 2DLTA 5GRZA 4K71B 4JVUA 1K8IB 2YKLH 4LCWA 5J1SC 5F1OB 1MFBH 4P2RB 3LH2L 3QBTB 3H9YA 3RUGF 5C0JA 1VB9A 3HAEH 3SPVB 4G42A 4DN4H 2Z91A 1UH2A 1AI1L 5IK3B 2JCCF 3T2NL 2H9GA 3BPLC 3CFJB 5KTEL 4TSCL 5IJKC 3VRIB 4OGAC 3KXFD 1Y6MR 1U8OB 3ARFD 2WMPA 1BFVH 4WO4B 4PB9H 1JJUA 5I73B 3RWFA 3FT2A 5D7LE 4TULL 2NY0D 4N0YL 3ZE2E 1EH9A 3QUXD 3JV6B 1J0HA 3OKKA 2BVEA 1A4JA 4KQ4H 3V4UL 2VC2H 3U7WL 5LBSL 2GJ6E 1G6RL 2Z9TA 4PJ9D 4Z7NE 1F11B 4U31A 1IBGL 1JIBA 1CFTB 2HLAB 1U8MB 2CD0A 2Z8RA 1EZVY 4XNXL 5E2UL 1KPUA 3WFHB 2G60L 3LAFA 4BKLA 1PYWB 4FS0A 5C6PB 1HYSD 2DQTH 1NFDF 1BAFH 3MRMA 3VXUE 4TUJB 5HDLA 2WW8A 5IMOB 2QHLA 4WW1B 4LNRB 3IFLL 1QQDA 3P0VL 3CH1B 1FSKB 4XNUH 4DFHA 3CFDB 5HY9B 3RGVA 5DEFB 4JPVH 4OFYD 4HMCA 3H9SB 5D1QD 5JQ6L 1BIHA 1ACYL 1FORH 1CLOL 5B8CA 2LVEA 4U0QB 3WNLA 2E6PA 4WFFE 1S8DA 2ZPKH 5IQ7L 5J7CC 3BZEA 3GBNL 4U3CA 1NSNL 3JTTA 4JJ5B 4QHNB 1QTYT 5EC2B 2VDQL 1MREL 2XZQH 4QYOB 2VDQH 4NDMB 4E41D 1QQDB 4MXVE 1JHKH 4IIQC 3P0YH 5K9KA 1WFTA 3X13B 5IF0B 2YEZB 3QEQE 3OKYA 4MQXC 4HUVB 3CXDH 4U1GB 3RVTC 2OR9L 4GAJH 1G7PB 3VA6A 2XNAB 3IKCA 3ZT6A 4F7EB 1CDJA 3MXWL 4OGXL 1ADQL 1V7NH 3RNKA 4AT6A 2NYYD 2DYPD 1CD1A 5FO8B 3EFFA 3M45A 4IRJB 3VFNB 2NLJB 3O9WB 4ZTPL 1QLRB 4NZUH 1CYGA 3GHEH 3ULVF 1GZPB 3KLSA 2XXCB 3NZ8A 3D3VB 1AR1C 2YPLA 4RQQA 2VXSL 2IAMD 3AAZA 4NO0A 4M7LH 1OT2A 4IJ3C 4PPTA 3AU1A 5EFIA 1JE6A 3O8XD 5AD0A 3IAGC 4LDOB 1IBGH 2W9LA 2PTTB 1G6RH 3B3IB 3RX5A 4W68A 1VFUA 2X4PB 4ODWA 2VE6B 3U7WH 3V7AG 4NFDA 1P53A 5IFAL 1TENA 3VWKB 3Q5OA 3O9WA 4X5WA 2BMKB 3AB0C 5HHNB 1KCRH 3VXRA 3CFEA 3GEWB 1AO7B 4LGPB 4PRIA 1JI2A 5KZCB 3JWOC 4IRSD 1UEMA 4YFLI 3HMXH 4RWYH 5ACLA 3O4LB 3H3KA 3G04A 3VXSD 1IQWL 3AS0A 1YEFL 4JKPL 4MAYC 1X6NA 4M1CC 4JRYD 4NQXA 3VGGA 3ARED 1RJLB 4J7RA 5I1GH 5EC1A 2DWEA 2GW5A 4NM4L 2HN7B 3D18A 4OQTH 3QFDB 4P2QD 2JJWA 3RGHA 3MXVH 3QHZL 3C87A 4DW2H 4I0CC 3RHWK 3QQ3B 5E6ID 3GI9H 4PLJC 3CZFA 1MOEA 4JFDB 1GJIA 2XT1B 3KPQB 2A6KA 2IANE 3BVNA 1JHKL 4L4VE 2HFEB 3PWJA 4GMTH 3LVEA 4KMQA 3UJTH 4PJ9B 1G9MC 1GYAA 1J8HB 3DX9B 3MJ9A 4NUJB 4IRJD 4JZJB 1OB1B 1MWAL 2OZ4L 1J1OL 1DDHB 1NDMB 2WLZA 5DEGB 3PWVA 3MGOB 1RQ5A 2ID5A 5K9OB 1U8IA 4KZEL 5ESVA 2IAMB 1X4ZA 4AIXA 3LOWA 4M9PA 3ABZA 1K9TA 4P3DB 2E27H 3IFLH 5CZKA 3TBSB 3OJVC 5TQ2H 1K6QH 2BHUA 1YY8B 4DAGH 5D7JB 5LCVH 4LRIA 2VAAA 5I17A 4HD9A 2XZAH 1BF2A 4XMKH 5GGQH 4Y16C 4APQB 2O61A 3WNPA 4K8RC 1L6XA 2LVCA 4I13B 4ORGB 5ESVB 3IVKB 1DE4A 4EUPG 3P30H 2R4SH 1IC7L 4K7PL 1FO0H 4LLDA 3VFRA 4BQ9A 2R2BA 4LCYA 4XVTH 1TZIB 4FFZH 4CVXA 4TUOA 4KFZC 2EZ0D 1FVEA 2DLEA 1GZQA 1ORQA 2P45B 4FXLA 3BXNB 3C60A 1YNTA 1CL7L 3QIBB 4TRPL 3GBML 1A14H 3KJ6L 5HXMA 1YECH 4QRPD 4X7TB 2DLFH 2LE9A 2BOBA 1J1PL 2WUCL 1CLZL 3MMEA 1UZ6E 4LPYA 3RY5A 3OBAA 2GY5A 3FRPG 4WUUE 1PAMA 5F3BA 2EE6A 2DICA 3TO4C 1JNLL 1ZT7B 3ZO0A 5HHXH 3V4PH 2AQ1A 4MD4A 1C5CH 3K74B 3LKNA 2W07A 5B3JE 3HPLB 3OTTA 1L0XA 4Z95L 1S7UB 5FB8A 3CDYA 2IGFL 2Q76A 4OZHF 1U93B 1OL0A 2R56H 4WJ5B 5JUEL 2BOBB 5F7YC 2HFFB 5KSBF 4PJCB 3PQYB 1WUNT 2RIKA 3ES6B 1KV3A 4RMQA 1DUZB 1KGCD 4I0KA 4OI8A 3P40A 4RDQG 4JKWA 1Z9SA 4HKBB 1F97A 3M07A 5MEOB 3DX6A 1UA6H 1U36A 4C55A 1UQSA 3IFOB 1DQML 1DBMH 2A6DB 15C8H 5DZNA 3FCTB 2X2YA 1GHFH 3QI9B 5ITFB 35C8L 1H15A 3RNQB 1FYTB 1AQKL 3ELAT 3NMEA 4MYWB 4XPTL 5ANME 4ZPVA 1X5ZA 2F15A 1FDLL 2PW2A 5HGAB 4Y2OA 2WWMC 3W9DB 5MERA 2EXWD 3SDAC 2Y6SC 4PJBA 4WEBL 5DJ2A 1QSZA 3O3BA 4M5ZL 5HYJB 3DV6B 3QI9A 4JANA 4YK4B 3WNKA 5GS0C 4R7NA 1CGSL 1FYTA 3F7VA 4JM2F 4QRPB 4CL7A 4PJ8D 2OSLA 5SWSD 1LE5A 3G6JB 5DVLA 1MELA 2HRLA 4Z7WA 5DZLA 2ERJC 4MGXA 2VQUA 4U6HB 2CK0L 4HDIA 4MA7L 1OLLA 2QQNH 2ITCA 1R0AH 3OR7B 4WUKH 1C5BH 5JTWA 1PG7H 4NGHL 4M00A 5B4MC 2H1PL 1LO2L 1V3KA 3JXAA 3RL2A 3LEYH 2F58L 4OV6F 1LO2H 4P2RE 5TFSL 5DUMH 2A6IA 2J5LB 4IMKA 3D69B 1RZ7H 5B39B 4HAGA 3CLEL 4Y4KA 4JFFA 5IROC 3T2QA 1YEEL 4PLNC 5C0CE 3RUGA 4PJBF 5E08H 4O4YH 5DFVC 4JFQB 5DMIH 2IFGA 3KNBA 3T3MF 2EDQA 5AZEH 4OGYH 1VGEH 3IXAB 2HT2D 4U1MB 4P4KD 1I8LA 2A6IB 2FGWL 3DXAD 4PJAB 5D7IA 1VHPA 2MCPH 2OL3A 3IDMA 4UB0L 5T5NG 4PRDB 1UWGL 1AQKH 2CKBB 5KOMC 3T0EE 4Q9BA 5FUCC 1A47A 2VISB 4OCWH 1OLZA 1HKLL 4HCRL 2X10A 4H1LA 5JORA 2NR6C 3DIFB 4HHAB 2Q20A 4JO4H 3SGJC 1AQDB 3GGWA 1P6AB 4WWKA 2CK2A 3DETC 3BGAA 1T89C 5T33H 3LV3B 4PJGE 2LU7A 1NGPL 4NNXB 3VXNB 1JPGB 2Y9RT 4X7CC 3T0EA 4XBPB 1MCWW 3WCYA 3B9VA 2NY4B 5I73C 1ORSA 3KXFE 1W0VA 2D9CA 4E0RA 3P30L 1TTFA 4PJDA 4GKZB 5JUEH 3ARDA 1T7XA 2DYPB 4YXKH 4QRPE 3TA3D 2DQCH 3GMQB 4NJ9L 4XBGA 3ALPA 1JBJA 3LV3A 2G9HA 2YMXL 4MB4A 2JCCB 2NY5H 3BO8A 1XT5A 1WT5A 3VXMB 4KHXL 1LO4L 5CBEB 4MDJA 1JUFA 2AK4A 4Q74A 2KZ1B 32C2B 1CF8L 1J1PH 5DYOA 4YXLL 3QUZD 1S5HB 1YMME 4P2RA 4OD1H 1UWEH 3QXTA 4LHUD 4U1JA 1F4AA 3L9RA 3VGDA 3KPLB 4U1NA 2Y5EA 5D1ZB 4LBEB 1NAML 1XGRB 2DJSA 2DQUL 4KJPD 1U6AL 1AGEA 2FHFA 5KVGL 3B2UC 3VRIA 5KAQG 3MRFA 4P9HC 2R2HA 4NYLB 3BE1H 3X14B 2R4SL 1KTLA 4FQLH 3WD5L 4DK3A 1Q9KA 2Z31A 3AREC 2FL5A 4JM4H 3A6OA 5KBNC 5I1AB 2IH3A 3P73A 4K9EL 4N5UA 4U1JB 5F88A 2HKFH 1QFWL 1D9KC 3MLZH 5KJRH 3LPWA 3MLUH 3PWUB 1HILA 4NWTH 1FAIH 1OPGH 1OY3B 1IGML 3WIFA 3ARBA 5GISH 4JFYB 1RK0B 2Z31B 5B38G 3IDNA 3L3KA 3DOSA 4M62L 3QUMH 3WBDA 5TE7L 2HLFD 3FO0L 3CH8A 1FNSH 4KJYA 3MRJA 3QCTH 5HBBA 2R0ZH 5BZDA 3MRMB 1U2HA 4Y4KC 2C1PB 5IROA 3RIFF 4N0CC 5IMOA 4ZUTA 1I3RA 4GKNB 5I2IA 1RK0A 2VMFA 4QY8A 3ZE1F 1NBVL 1YN7A 1G84A 4NJAH 3PWNA 1IAMA 1U3HD 3KLDA 4JQXA 3S3JA 2DQJL 1ZOXA 2LAAA 4F2MA 3O6KL 3RZCB 3NCBB 1X5AA 1MFCL 2I60L 2XWJA 3RWHA 3WIHH 1RZKH 4OM1H 1TVDA 4FQ1L 1SJEA 3UTQA 1ITCA 5I1GL 4P5KB 1EBAA 4NM4H 3RP1A 4KI5C 1ZSDA 2JIXA 3GSWA 5TJWK 5FYKL 3UZQA 2YD2A 1INEL 4WWKC 3UTSB 2LTQB 2HVKB 4BQ8A 5FM4A 2FH8A 4JPWL 5HHPA 1FRGH 2YD5A 5KS9E 3SDCC 3VD3A 2P47B 2BRQA 3HMXL 4OZFH 5C07E 1NBVH 3RNKB 3U0PA 3RTQB 4EDWH 4IRJA 3VFNA 4LIQH 4OF5A 1EJOL 4GSDL 4MMXC 1CK0L 4N0UB 3WE6B 2YPLB 4RQQB 4QRQB 5CSBA 2VQ1B 3QPQD 3MV8E 3AAZB 1R5IB 2VTFA 5FA3B 2CIKA 1MJ8H 4RMRA 4S1SL 3U4BH 4XMPH 1R3LB 1RZIB 3DX7A 3I6GA 1NANI 5C0AA 4XCEB 5M7QA 2X89A 3O0RH 4ONHA 1XGPA 5FYKH 2BMKA 5C0RL 4P2OD 5D9SB 3IB4A 1BZQK 5LXGH 1FIGL 4K07A 4RFEA 4M7JH 4QRSA 3LEVH 2RR3A 1R5IA 4UILL 5C07D 1HXYA 1JZ8A 3O2VL 3O6FA 2Y23A 4MSWB 3RX7A 3W5NA 4YPJA 5D5ME 1GOFA 2HA1A 2QR0A 1Y18A 3AROA 4LHUB 4OD3L 5D4QA 2OR9H 2VR4A 5E7BA 3SJVB 2VN4A 3EOYG 3ULVL 2IPKB 1JPFB 5JW4Q 4U7SA 5KVGH 3UTOA 3BRGC 3MLYL 4LF3A 5GRVK 2AJUL 2GTWA 4MNGE 2Q86A 1AIFA 4J8RB 4TULH 3SDAB 1FC2D 4TTDC 4OZFB 3T2OA 2ZPKL 5FV1L 1J88A 1UYWH 1XF4A 3T08A 4M62H 2HFEA 3RVWC 3PWJB 3QCVL 1A6VL 5EU7C 3K3QA 3WIIL 4NWUH 1KN4L 3OKLB 1N4XL 1EUTA 1NGWA 3LH2H 5DMKA 3KLHC 1JYXA 3TT3L 3BZ4A 3PWVB 1J8KA 5HYQA 1U8IB 3LKRB 5C0CB 2YKLL 3HAEG 2ICWI 1NC2B 2BVQA 3VGHA 5SWZA 2BVPA 1NLDL 4EN3B 3NFNB 1DQJB 2QTEA 1ZT4B 5IVXF 5EIIA 4YBQD 3WHE1 4BQ6A 3MV11 5HGDA 1U8PA 5EOTA 1QYGH 4NCDA 5F21B 2O61B 3GJEA 4GS7B 5DC0A 4R97C 3B83A 4XH2B 4RAHA 2H32H 4L5FL 5F89A 1UEYA 3C2SA 4HCRH 2GAZA 4PGEB 3OJDA 5TE7H 3IJYA 5FHAL 4YJZL 2OI9B 2BVPB 4YXLH 1JPTH 3I84A 3F5WA 5CJQH 1KBGL 1MY7A 4CVXB 5LAXB 1P7HL 3SJVD 3C5JB 1JWMB 1L0QA 3OX8A 4FFYL 5HTSA 3QEGL 3IJHA 7FABH 4HXBH 3X3GL 3QI9C 3BP6B 5L8JB 5F1NB 5C0FB 1FO0A 5I18H 4WDIB 1W72L 4UV4H 5M95B 1T2QH 4GW5B 4JM4L 3OXSB 5CJOL 1ZWIB 2YA0A 4HIEA 1FG2A 1G9MH 2SEBA 5EU6E 5I1CH 1ZT7A 4P57B 1JGDB 4IHOB 1JWMA 3NZHH 1D5BB 3SCMB 2AXHA 4D8PB 4L4TD 3TLRA 4EXKA 1DBJH 2V5TA 4KHTL 3QH3B 3MREA 5C09A 4FFVC 1S7TB 2CLRA 3EOAB 5CP3A 4QRUB 4CJ0A 4HIIA 1FNAA 5JDSA 5CP7A 3DYMA 3LEYL 1OGTA 4J3OC 4I1NB 5D71L 4ZAKD 4PRPB 3GIVB 3OXSA 3BGFB 5DJXB 4OCRL 4L8BA 2IJ0C 5HI5D 1NCCL 3QIWA 2C3XA 2VDKH 3A67H 1FVDA 4P57A 3SGEH 4YX2L 4N8CL 2A0LD 4I5BA 3UJIL 1HHKB 3K8LA 4B5EA 1ZT1B 2UZIH 3KYAA 3TC9A 4IRSC 1FV1A 3MRIB 1JZ4A 4H25B 4N8VB 2OJEA 5CP7B 2CIIA 1JN6B 1OP3K 3MODL 4CVUA 3SO3B 5BVJB 3MRGA 5I0DA 3QZWG 5F9WC 1XF2B 4M1CD 1FIEA 3G08B 5LGJA 4P5TD 2X70B 4LLUA 3RVXC 2X1QA 3WXVH 3PHSA 4PP1D 2MWCA 1U3YA 3VFWA 1HSAB 4KI5F 5FM5M 2KZWA 1YEGH 3BQUC 2NW3A 1RZ7L 5T33L 5CBAA 1T66C 3A6CH 4YDLC 3MJGX 2F5BL 2B20A 4JO4L 4LKCB 4LVHB 1EBPA 2F58H 4ODTH 4KTEH 4Z7UB 3LQZA 5JZ7D 4ODTL 3G08A 1HWGB 1KCUL 2DF3A 2C1OB 3NCYS 5LGJB 2VZTA 3OXRA 4RDQF 1HKFA 5ACMA 1IGFH 3VFOA 2NYYC 4AEFA 4HPYH 5D96B 2X4OA 4MA1B 3ARDC 1HOCA 4RISH 4FMKA 4KKBD 4NKOB 4R2GC 1RUPH 4HUWA 1T3FB 3L7FA 1DQDH 4RAUB 4WI6A 5AZEL 4ZXBD 5EWIH 2BSRA 3MODH 5EOCJ 1OTTD 5LGHH 3ZHDA 2B39A 2FBOJ 1OAUL 2C4FU 2BHZA 4I4WA 2KDGA 3HZYB 5ICYB 5HHXL 3CCHB 2PKDA 4I18A 4X80H 4XPTH 2EEAA 1GC1L 1RVFH 5DUML 1H8NA 5GGUB 1T3FA 4WI8A 3BPOB 2CLZB 2ED9A 5CEZD 3L3GA 4MNGA 1TCRB 4L8SA 2G2RB 3HUJE 2C3HA 3X11A 4OBSA 1MH5A 2QSCH 1RK1B 1KPVA 3T4AA 3CCHA 4XP6H 3TV3H 3JVGA 2DJ4A 1XGQA 4R8WH 4JFDE 1E4XH 2F8OA 1AC0A 3KPPA 3DGGB 5TGBB 3OKEB 4X7SL 3HZMA 1D5MA 2D0GA 4MNGB 3X11B 2FX8L 3IAQA 1ZLVH 3NH7H 1K3ZA 3KLAB 5FYJL 4PJCF 1UZ8B 3DURA 3ECBB 3TYFB 5C08A 1YC7A 4QHMA 5AAMA 2LV4A 1XGQB 1MCLA 4DAGL 1ZA6A 2UZYB 3O4LE 2ZOKB 2BVYA 2NY6B 3SN6N 2V17H 4WTXA 3UMTA 2FJGB 3CX5J 4XP4H 4GKZA 2K9UA 1YYLL 5IP4A 3RWJA 1JPTL 1DN0B 2ZG2A 2MQCA 2P8MA 5AWNL 5CZVL 2NY6C 4FQIH 1ZVYA 5ANMB 3RKDD 4OLVH 1K5NB 1HINH 4H20H 5L2JB 2XQYG 4PJ7A 4EI5B 3EJZC 3EO0B 1R6VA 1QP1A 2IAND 4L4VD 1U58B 1H3PH 4UINH 4AY0A 1A14L 3GB7A 3VXMA 1CVSC 3RVTD 1UWXH 3EO1B 1CICC 3C5ZB 3E1F1 4QXWA 3HC4L 2FLRT 4WFGD 4U1HA 3BYTA 3VXPB 2YPKB 3KPNA 5KS9A 1NC4D 1D5IL 1NLDH 5BXFB 3KGRA 1MCOL 5DHYA 3S5LG 3PABA 1FFNB 1R3IH 3SGKC 1J7VR 3G6AB 1JPST 3S96A 5GRXG 2N4IA 4X0KA 4U1NB 3QNXB 2YUZA 4WNQA 4UU9A 1G9EA 5LCVL 3BMVA 4HUKB 2YA1A 3MRNA 3SDDB 3BRFA 2HT3C 4NZDA 1OAQH 3C5ZA 3P0GB 4X6EA 2CRMA 2QADC 3MSPA 1NGXA 3K2UL 4W81A 3WFCL 4F7TA 4LAJH 2Y36H 3FOLA 2D2OA 3QCVH 1LILA 2XKSA 1CD8A 1T7YA 3HTLX 2X9XA 1QKZH 3SDCA 2IH3B 2APFA 3LN4B 5DZOA 1N0LA 3V5KB 2F53A 1LK2B 1GGCH 4YZFE 2ZKHL 3V0AC 5DEZA 4IDLA 1M6OB 3KYKH 3ARBB 1TQCB 3HRPA 4ZFGH 3RVVD 3QDMD 1NGXB 1CLYH 5HJ3A 4LEXH 4BSJA 3RZCC 3U0WH 4MCYA 4NKDA 1KXTB 1O5DT 1J86A 4NQCD 1ZV5A 4XXCA 4J4PA 4Y1AA 4ZYKA 3MLXL 5IFHL 4F7PB 5DUBB 2NY3B 3IS0X 3QNYB 5JLZA 5DRWB 1LK2A 3GI9L 1JZ3A 1A1NA 4Y16A 4AM0B 4OQTL 2QQQA 4GUPA 2YRLA 4NHUB 5JOPE 3CGTA 5J12B 4HWUA 3WIIH 3QQ9C 2OCFD 1ZVSA 2V2WB 1BX2A 4ERSL 5IIEB 3NA9L 3MGTA 4Q9RH 3C09B 1Q9WA 3VFVA 1RJZB 3Q3GA 4Q9QH 1YC8A 4U6XB 3VI4E 3RWHB 1G7HB 4JPIA 5T5FH 5MENB 1QD0A 1RPQA 5IJKA 5DT1L 2NW2B 5T1MB 3GUTB 2P42B 4IDJL 3SDDD 2X4UA 1HWHB 1UJ3C 1NSNH 4PV8B 2HVKA 4QTIL 1U9KA 1VEPA 3VGEA 4B53A 5H94A 3VFMB 3ZDXE 5MENA 3O2VH 3JWDH 1R24B 1J10A 1WAAF 5F7WC 1I8MA 4K3DL 1XGTB 1EFXA 4MA8L 1KN2H 2OTPA 1UZ6F 2X4UB 1KB9K 2FR4B 2D7TH 5HVHB 2A6JB 4ELMF 3WKML 4NBXB 1PW3A 5D2NA 1KTDB 4TOYL 2K7PA 5CD3B 5TF0A 1QHPA 1X3DA 4LSUH 1RZIA 3H9HA 2YD9A 2EDTA 4NJAL 3KYMA 3U30C 4ONHB 2DQJH 4MCZB 4FFVD 4WGWB 2YD8A 1I8MB 4U1LA 3EFDL 1EFXB 1SY6A 4PY7A 5FUOH 1AXIB 4NPYA 5DQ9B 1VSCA 2EKSA 2BC4B 4YPGA 4M6NH 5JXAH 4QRSB 1ED3B 4JY6B 1W8NA 1MRCL 1GVIA 5J1AA 1BHGA 1M05A 4YHIA 3STZA 3T1FA 1MQKL 3HPJB 4HQQL 3MOAH 2R0ZL 4LK4A 1UVQB 5ISZA 3RY6C 2QKIA 4DVBA 4JHWH 1XF3A 1EAPA 2EDBA 5LWYL 1YN6A 4D9QD 2HYMA 2JF1A 4PJ5A 3VG9B 2OM5A 4PY7B 3MRLA 4L8CB 2VXUH 1X5GA 3DUSB 4MD0A 3RPIB 5TPWL 1KN2L 2CUIA 4RGMB 5J1AB 4G6KL 2J5LC 1LDSA 2IBBA 3QJHA 2XRAL 3BYYA 1MLCA 3HPJA 1BAFL 4R96B 2IF7A 4Q0XH 3TIDA 2I60H 3ZKQD 5FYJE 1QFWH 2Y25A 3VH8B 2KQNA 4BSVA 2C5DC 1B2WL 1MCOH 3ROLA 3S4SG 1JRHH 4K7FB 4KZDL 4DN3H 3DUSA 3QIUB 4KQ4L 1RJYA 4YHYB 1H3XA 1KXQE 3QEQD 4N0YH 1IAIM 2PTUA 1JZ6A 4QRRB 5J11B 3IJSB 1XGYH 5H8DA 1UWEL 1FNSL 2N7BA 2YRZA 3O9WC 3UPAA 3SE9L 3P2TA 4JN2A 2BVQB 4FP8H 1YYLH 3O2DL 1NBZA 3ARWA 5GS0D 3WN5C 2FO4A 1RJYB 2PYFB 2VDLL 3BSZH 3NTCL 3SE8H 3ULVD 1LO5A 5K59F 2DQIH 4P49A 4UOW1 4YUEH 4JZOA 2R1WB 4NM8L 4XH2A 2GK0A 4ONFH 4CW1A 4M43L 3TWCH 3P77B 2AAVA 5FYJH 4RA0C 2PYEB 4XPBH 5A3IC 4KUCF 5GGVL 5CJXA 1AFVL 3E3QC 5CSZA 5BRZE 1BQUA 2JJSA 3SCMC 3ET9F 1A6WL 1KELL 3BP5A 3VGFA 1A6ZB 3F5WB 3AMLA 1RURH 2CDEB 4P2YA 2NY1D 3TJHD 2DI7A 4LKXA 3EDFA 5ID0B 5IM7A 2BNUA 5FHBH 4J3XA 2V5SA 1YJDL 3CSYB 4JZOB 1T89A 1NAMH 3TNMA 4WWKD 5JHDE 3D85D 1S9YB 2YXFA 3H0TB 4ZUWB 2Q8BL 4AIZA 3P77A 1XH3A 1P9MC 3OHXB 4RNRA 4LLQA 1MUJB 2PYEA 4UMGA 2EKJA 3MGAA 4L3EA 4ONGH 1IEBB 1QKZL 4M48L 4Z0XA 3GMMB 4ZTOL 3SY0A 4V1DA 5E00B 3ZDZF 3CLFL 4F8QA 1JI1A 2BNUB 4JRXA 4JVPA 1AKJA 5TDOA 2AVGA 4KRMB 3G6JE 1KJVB 2VLJD 2FDBP 5C09B 4DN4L 3VXQB 4OGYL 5DI8A 3U36A 2BVTA 2YD6A 1DBKH 1WT5C 4Z6AT 3T65A 5L2KA 3S97C 4L3EB 3CFIC 1MJUL 4P4KB 5DD0L 5CWSA 1EDQA 3IGAA 4JHAL 1CFQB 4Y5YC 1FZJB 2I9TB 1EEQA 2FNBA 4Z7QF 1DQQA 3QUZC 3OKDB 3BGFC 1D5ZB 4P48A 1BPVA 2BY2A 2H6PA 1IVLA 4QLRA 2EDYA 1EIBA 4R4BB 4UT9L 4HZLA 4MHHG 4H20L 1HINL 1BD2A 3FKUS 4X98A 3B9AA 5CZXC 2QQKH 4EJ1C 2PYED 3N85H 3C60C 3W9EB 1DQQB 2V2TB 3KAAA 4LCUB 1EO8H 1ROWA 3T2PA 5JMRA 2Z8VC 1IGJB 2JB6A 3FQNA 4IS6A 1A22B 3FQXA 3HE7B 3GMLA 1NFKA 4KI1A 1NH6A 4QNPF 1F02I 2VSDA 4Z5RB 3ARBC 3FT4A 4GAYB 4NKMB 1RFDH 2UWEA 2XN9D 5FKAB 3SGDH 5IV2A 3MBEB 2R29H 4Y4HA 5C08D 4BUGA 5C0BD 1RFDL 1AY1L 1B90A 1KEML 3LB6C 1BVKB 4NP4H 3W9EA 1MCSA 4R3SA 1IL1A 3C5SB 1B0GB 1ZS8B 4ALAH 5T1LA 1UKSA 3FZUC 2UZIL 1FDLH 4YX2H 1F4XL 3QRGL 2J3SA 4QOKA 1LEGB 3P4NA 5CUSL 5BQ7A 4GAYA 4WU5B 4S2SA 2J12B 2WINA 2QJDA 5C9JA 1EUUA 1ND0B 1NGZA 1A6UL 1BFSA 3THMH 1BVKA 3ZMRA 3LD8C 1IL1B 1ZGLM 3DV4B 4FABH 5IFJA 1DQMH 4AL8L 1Q0YL 2NX5B 5T1LB 2FSEA 2KL6A 2ICEB 1BLNA 4QXTA 4OLYL 2I26N 5BRZB 2DIBA 1UGNA 5CJXC 2JELH 2YOCA 3C8DA 1S9VB 3TCLB 3HG1D 4NP4L 2APXA 5BMFL 4ENED 4GBXC 2ADJB 3O3DB 5D7KE 4P9HH 3FQUB 1VFMA 1IC5H 1KPVB 4RMTA 4DEPB 3F7PC 2Q7NA 2H2SD 2ED7A 1OM3L 3HS0A 1BFOB 4G7YH 2JJVA 4N0CD 3KYOB 2BFVL 4ONGL 1I75A 4HK0B 4P9ML 4EOWH 5D70L 4U1IA 1F3DH 4QOKD 1E28B 3GBMH 1OGAD 1B0RA 1IGCL 1F6LL 5JO5B 2BDNL 15C8L 2J7LA 1UZ8A 5EA0L 1YECL 1EMTL 4LSRH 25C8L 1Z9OA 3IDIA 4F58H 3FJTA 4PRBA 5I8OH 1JK8B 1JFQL 1FN4A 1LDPH 1U3HB 4LPVA 4GQPH 4LVOC 4YHLL 3H42H 1RHFA 3WXVL 4Y5VC 4EQ3A 4LHUG 4Z8FH 1YEDA 2ATKB 4Y4FB 4JQVA 1E28A 4XPGL 2WLYA 2WWKT 4Z95H 2AJ3B 1JGLH 3EDDA 5F70A 4RAVA 1U8LB 1NAKL 3PDGA 1QSFB 1MJJA 4PRBB 5EO9B 3UBXB 3X12B 1FPTH 3O4LD 2H2PD 4F37K 2XXMB 4N8CH 2XTJB 1JZ5A 1OSZA 1Z5LA 5EH1A 3SEPA 2VNCA 3HI5L 3QT2A 5ITBH 5D7LD 3S96B 4MX7B 2ZUQB 1JGVL 5GS2H 4TRPH 3RWEA 3VRLF 1EO5A 4K3EL 2B5IB 1S7QA 5DJYB 3UAJD 1YJDH 4PY8I 1OW0A 4ONOA 2I07B 4FZ8H 1K4DB 4LOUC 5I16A 3MROB 4XCYB 2MFNA 4PYHA 2X9YA 3MXVL 2EIZA 2BCKB 4H0IA 4X6FB 1RU9L 4JGJA 5IW1A 3LRGA 4TPRL 1QLFA 1KEGL 5E5RB 1N2RA 3GRWH 3FB8B 4P2OB 4G6KH 4FTVE 3L3IA 4UILH 4YWGL 5FO9A 2EC9U 4GW4B 3OG4B 4XB8A 3QEGH 2H3NB 1X5KA 1SEBA 4U33A 1YPZA 5TQ0H 3SOBH 2HJKB 5CSGA 1TZHA 3CMOL 4XNYH 1HQRB 2WANA 2DD8H 4XRCB 2EIEA 1IQWH 5SWSA 1HI6A 1AXSA 5EU6A 2DQHL 5BJTB 5FECB 3T1WA 2AJXH 2J6EH 4PJFE 3V6FB 3MR9A 1ZVSB 4BKLB 1QYGL 1T1XB 1V7MH 1KLGB 5ADPH 3SDAD 1V3LA 2WUBL 2Y6SD 4PJ7F 3FB6B 2F53E 3RDTA 4BM7A 1IM9D 3HB3C 5JIPA 3EYQD 1HI6B 2YS4A 4HMEA 1FRGL 1A9BB 2FIRT 3ARGC 3TNNB 4KROB 1E4KC 4LQFL 3RGVB 2W91A 4F80A 3QXAA 1BQHB 1E27A 2ZSVA 3WS6C 3BT2L 2XRAH 3BKYH 3TZVA 3EGSB 3JWOL 2CLVA 1ADQH 3O41A 1KLGA 1BQLH 1RUKH 3OF6D 4JB9L 3VA2C 1T1ZB 5BV7L 1D9KA 4ZOAA 5CKAA 4OM1L 4M6MH 5C0NC 1G9NL 1F4WH 1NC2D 4G7VL 3PNWB 3WIHL 3MV9A 4KUZL 2ICCA 1SYVB 2ZSVB 4QTIH 5IVXA 4HQQH 3G6DH 2DTML 1MVUA 4LSPL 1RZJC 4WHYG 4Y5XA 2XNAA 1L7TL 5D7IF 3STLA 3NCCB 4TQEL 4BELD 4NN7B 2C3VA 2BRRH 3O11B 5EZOL 5FO8A 1T5XB 2AABL 4URTB 5CD3A 3QCTL 4OD3H 1JV5B 3F58H 5KN5A 3EJZD 5DK3A 3D3VA 2NY7H 1T1WA 3HE6D 1Q8MA 4TOYH 1ZHLA 3G5YB 2AK1H 4XHQA 3WNOA 3C08L 4MZ3A 1TTGA 3QXWA 3H9SD 5D1QB 5DQ9A 2UY7A 1BQLL 1RUKL 2AQ2A 3LKSA 4KMLB 1M05B 4YHIB 3STZB 4PG2C 1H3GA 5T1KB 4X6DB 3UTPD 3OB0H 3FQWB 3Q6FA 4NC1E 5ISZB 4R0LB 4HIHA 3HI1B 4HZAA 4WHTA 3BDBA 1I1FA 2NR6D 5IFHH 1N5YH 1T4KB 4RFOL 1KT2B 1HXMA 3KHQA 2Z4QB 2GSIA 4YHOH 3D85A 2AABH 2VJXA 5BOZG 1JHTB 2AJVH 4ZAKB 3RAJH 1GGCL 2HN7A 3WNMA 1HH6A 2DM3A 1F2QA 5L7XH 3DHMA 1OTSD 5C0AE 4XNYL 3D3VD 3DVIA 3P0VH 1VKXA 1PG7W 1EXUA 5ACZB 5E1AB 3T2NH 3QQNA 1S78D 1M1SA 5L2KD 4WWID 3MLUL 3TFKC 4DFIA 3IETA 3CK0L 2VLLB 4BFIA 3N9GH 4JR9L 3QQ4B 4QHKJ 2HMIC 5ALBL 4G9FA 5GS1A 5HI4C 2B4CC 4JJHA 4UNVA 3MRDA 1NBZB 1H8SA 5K9OA 1I4FA 5DK0A 1NCAH 1T20B 5FCUH 1DBAL 2RCSL 4PGDA 4NO3B 3UTTD 1T0PB 5EU5B 3HUJB 1JPSH 2J8UE 1T2XA 4MAYB 1E6JL 4I77L 1AGDB 3F7YA 2NX5D 4KC3B 4HJGB 4H8WC 4MJ2A 2F53D 4WTZA 3U46A 2VAAB 5I17B 4YHPB 4OFVA 5A2KH 1NGYB 1MWAB 1A6ZA 1C1EH 1A64A 5AUMA 5DRZB 3K4DA 5KTEH 2DD8L 1KCSH 2ZJSL 2VWEC 4LMQE 1VGKA 4WY7L 5FDWA 4ZDHB 2YD1A 4MNQD 4LSDA 4NQEA 1RUQL 3L7EA 4YQXH 1XH3B 1WK0A 4WV1C 2DI9A 5J06A 1BM3L 2YK1H 5C0IA 1CGUA 1D7FA 2VYRE 3IS1X 4I48A 1EO7A 3K4ZA 2BP3A 4ZO9A 3SY0B 5JOFB 3C2AL 3TBVB 1NAMA 4GXVL 5D2LF 4BZYA 1U92A 3M1BA 4LSQH 1S7VA 2C9AA 5FDWB 4Y2DA 1FL3A 1JYWA 3IDGA 1CCZA 2YBRA 4XP6L 3TV3L 4PJCE 3EOTH 5IMKA 3VWJD 2NTFB 1K2DA 5F7MC 1I9JH 3RZCD 3RA7H 2ICWB 1S5IH 5DQJA 4JG0L 4NHCL 2OTUA 3P4OB 4KK8D 4X4YB 5GZOC 2FBJL 2I5YH 2B0SL 2WWKO 2OR7A 3U0TA 1XCTA 2DQFB 1G7JB 2HKHL 3MV9E 3DXAE 4X5XA 3U9PH 3M1BB 5AG9A 5C0EA 1C5BL 3EYUL 1DBBL 3QWRD 2IMNA 1X6LA 1K2DB 1GGIL 4LSSH 3G5VA 1BECA 2CKBH 3ULUE 3ES6A 1LP9F 3HG1A 3BRDA 2YWYA 5DXWA 2AERT 5FV2A 3DRQA 5DQJB 1CDCA 1RIHL 4C57C 4MNQA 3BHBA 1ETZA 5FOBB 1FFPB 4X98B 3GSVA 4NKQB 3DX6B 5HHOA 3VXTB 1FLTX 4FRWA 5IMLA 3O45B 3K7UA 4OIIL 4XPGH 3RVWD 4ZFFA 1QSFE 5C0EB 1T04A 3VE0A 4XX1E 2Y7QB 5DGRA 4UBDD 1RZFH 3B9KA 5E6IB 4AENA 3W0WB 3VCLA 1H15B 2R69L 2LU4A 4R8WL 3NIDF 2YA2A 1F3RB 4P23A 3DVGA 2F19H 5EUOA 4QHKI 5T1DL 5CAYB 2V7NA 4OAWB 3QPQC 1UXWA 3GSVB 5HHQB 1FC1A 4XAWL 4PGBA 3HHRB 4M5YH 5IOPA 3U79A 4LVNC 4OFIA 5I1JH 3UC0H 2M26A 3LSOB 3OKNB 3TM6A 1HEZB 3BEVB 3HA0A 4XP1L 4S0TD 3EJJX 4XC3L 1OP5K 1KJMA 1LD9B 1W8OA 1T21A 3GMOB 1EGJH 2V7NB 4OAWA 2R0KH 5K93A 2NCMA 3FOMA 5I19L 3RFZC 4PJGA 5JIIA 1WWCA 2FEDC 4NQSA 3S5LB 4BK5A 3IDXH 3N06B 2ZOLA 3NIFE 4X5LA 1NMBH 4GG6E 2ARWA 3FTGA 2YC1A 4C59B 4OZGA 4JM2D 2FB4H 4OLYH 1EO8L 4PBVC 4HSQA 4ZUVA 3CDGA 1F5WA 1J12A 2WUCH 1NFIB 2VXQL 1NFDB 2CRZA 1VACB 3F6LA 1QO3A 5I76B 3ILPB 2X4RB 3QDMB 4O00A 2EC9T 1PG7L 3MV01 2OXGA 3WJJA 3FTGB 3EYQC 1CE1L 4OUUB 5I75B 4AEHH 3G5XA 3UTZA 1HZHL 3KYOA 3BIKA 3PHOB 3RUGE 5DD6B 2V2XB 2IPUG 1C08A 3DVNA 1FHGA 2XWTB 5D5MA 1KPRA 4CADB 2YSSA 4PRDA 3QAZC 1LP9A 2K7QA 1PBYA 1VERA 3IU3A 3VG0L 4OIIH 5DVKA 5C7XL 1CE6A 5AZ2H 5E8NA 4HBCH 4RX4A 2F8VA 5HHMD 1CN4A 4NT6B 1CD9B 3F12B 5CP3H 4ORZC 4WVRA 2YPVL 5IHLB 3BIKB 4XZUA 4NNXA 3PDDA 1LE9B 4RGNC 4P59L 4X6CB 1UKTA 2GJ6D 4U3XA 1SJVA 1A4KB 2I27N 3D0LB 1QUNA 4UQ3B 4E0RB 2AJ3A 1MSPA 3ARDB 3ZDYF 4HWBL 2AXGA 3NFPB 4NT6A 5D2LA 2BY1A 3QFJA 4I2XA 1MJJB 5EO9A 1NLBH 2Y06L 3EAKA 3Q2CA 2IQAB 4L9LA 4G6ML 4XZUB 2IADB 3BO8B 2UWEE 4G5ZL 1AR2A 5DQDH 5D7IE 3UPRA 1E4KA 2B1HL 1A2YB 4P2OC 1S9WB 2C7UA 2AK4B 3KR3H 3B9KC 4DTGL 2G5BA 3TT3H 1CBVL 5KW9L 2NZ9C 4UQ2A 3NFPA 5D2LB 4FQQA 1SVCP 4M8VA 3OF6A 4NM8H 1MPAH 1FL6A 2VLJA 3MACH 5IBTH 1IEHA 1DBKL 2DQIL 2BVOA 1YEIL 5KSUA 3WDJA 1IKNA 2Z35A 2Q3ZA 1QOKA 5KG9A 3EO9L 4X9BA 1HN1A 1EHLL 4ZXBB 4PRHB 2BCKA 1OAXL 4X6FA 2R2HB 4NYLA 3S36H 6FABH 1DSFH 1M7DB 1EEZB 1BEYL 3F8UB 4YAQB 3EKCA 5FGCB 4CMMA 3U9UA 3FMGL 4HGWB 1MCPH 4C58B 3KPSD 1F8TH 3IAPA 4XVSL 4GMTL 2VLKE 4I77H 5DDHA 2Z35B 2PO6B 3FFCE 4J3WA 2IPTH 4C56D 2MKLC 2ADIB 3PG2A 1DBAH 2RCSH 5DK2B 3ZKMD 5KG9B 1R3JB 4XVTL 1P1ZB 3AFLA 1CLCA 4UUJA 3CH1A 5D7SH 2XIDA 4FFWD 4GRWF 3WUZA 3H9SA 2DBLH 1PX4A 5JNYA 2M1KA 1G9NC 4GXUM 3V6FA 2AJSL 4O2EB 5HDQH 4OTXH 3L1OL 5EIQA 3MRKA 1YA5A 4H1LH 2XN9A 1P1ZA 5HYEA 1WEJL 3RDTB 2AI0L 1FH5L 1S7XA 3KPTA 1WCBA 3C5ZC 1ZGLP 3QDGB 1U8MA 1TJIH 1BQHA 3R1GH 1IRAY 1FNFA 3SE9H 3MOAL 3AY4C 1PYWA 5EZOH 1KXVC 3MLSH 4HFUL 3F7RA 1IAII 4WI4A 2LFGA 1JWSA 2BNRD 3MRHB 5IFAH 3ARGB 5E8EA 3VXRD 4TVPL 4F9LC 1L7IH 4WW1A 1WBZA 4MXQD 5A1AA 1QFUL 4PJFB 5F7DA 2FCBA 2GFBB 4LL9A 5GS0L 5CCKH 3QO1B 2E6JA 1KJ3H 5B8CB 1WV7T 5JPNA 1B2WH 4MJIB 2GHWB 4NRYA 5JQHC 1HNGA 1MVUB 3V6OA 3BZEB 2BX5A 5GGRY 3FT3A 1IMHC 2P1YA 3B5TA 3TO4D 5I6XC 5MEPB 3I6KB 1UCTA 2C3VB 4X7EC 4FTVB 1BVLB 1WZLA 3OZ9H 3ZTJH 3CFEB 5JPNB 4V1DE 3HE7C 1I1YB 3ZKND 4L9LC 1UM4L 3CVHB 4CN6A 4QHLB 4ZAKC 3SDYH 3T8XB 4YO0A 3DX7B 3I6GB 4L3CB 2IH1B 3E2HB 5DS8A 1KB5B 5IBLD 1L7IL 3SDXA 5C0GB 2GUOB 1QSEA 4JG1H 5T1KA 1DR9A 4GRLB 1I9EA 1YNLL 3MYZA 4XAKD 5DT1H 4FZEH 3D18B 2PF6A 4JO3L 3HR5B 1P69B 1HXYB 4BK4A 2JJTA 3GSOB 3GKWL 3W11C 4HIJA 4OBRA 3ARBD 1FH5H 3GSRB 2VXSH 4JREB 3S3SA 2W60A 3LS5H 2XTJE 3VFPA 2OQJB 1JF6A 2PTTA 5EBWB 4NZUL 1P7QB 1IGMH 3SDXB 5EOQH 2DBJA 4Z7WF 4P5TC 1IC4L 4ZO7A 3RVXD 1WTLA 3D39B 4K3DH 5DHVH 1AO7A 3WLWC 2IQ9H 2X1XR 3PHQA 2MQ0A 2D3VA 5EBLA 4ELKB 1RU9H 4HS6A 5CGTA 5D1ZC 2FJFB 1UENA 4Y2DD 3GSOA 5IG7A 4XVJL 1XZ0A 4LQFH 2GT9B 3GHBL 3WD5H 1ZXQA 3O4LA 3BE1L 1MLBB 5GS0H 5F1SA 1AD0B 3V8OA 2VL5B 5GGRB 4K71C 5CZXD 1EA9C 5ELIA 3U1SH 4M1GL 2Z8SA 2W9DH 3S6CA 4YBLB 1CS6A 4ZS6C 5H37H 3Q48A 2AJXL 3PL6C 1UM6H 3OKLA 4HS6B 4AEEA 2BXYA 1ZHBA 2I9LA 5DRXB 5INCA 2W0KA 4X7FC 5B3JF 3WS3B 1KNOA 5DK0B 3ZT7A 4JFDA 1RHHA 4YDIL 3IRPX 1I3VA 5DRNB 2VL5A 1KIRB 5GGRA 3TN0D 3WO4B 3BX7C 4NO3A 3S7GA 3TBWA 1V05A 4LLDB 3VFRB 4M8QB 1FCGA 1TNMA 1Q0XL 3GFUA 4NBZB 4JN1H 4OLZL 4GRLD 1XIWB 5DA0B 1WIPA 5I75C 5D6DC 4JDTL 4TPRH 1A7NL 5DEGA 3UTSD 3S8WA 4MMZC 2X1WL 3BUYA 4FQLL 1SJXA 4OI7A 5IT2L 1JGEA 1LQSR 3BIAX 2A9NL 3TEUA 2IBZY 5DTFA 3HC4H 5I8OL 2HTLD 1UG9A 4X8XA 5GZNC 4F3FB 4FNLH 1OARH 1N59B 1LO3L 1EMTH 3DRTB 2FECL 5DA4A 3D39D 4RGOH 2YPLD 5F1NA 1II4E 1JZ7A 4PB9L 4ZS7H 5CEZL 4XP4L 4Y2DB 5DO2D 1CF8H 1JGEB 6FABL 1FZKA 3J8F7 2OMBA 3ZZ1A 1BGXL 4JGMA 4P46A 1DL7L 3MRBB 1QACA 3H7BB 5L9DH 4OZIB 1UQSB 2DQCL 5D6CB 5DMIL 3HNSH 4QXUL 4WENB 1JGUL 1ZHKA 3MV7E 1CBVH 2EE3A 3KWWA 5D1XA 2OJZL 4BH7A 1RUML 3OAUL 3QCUL 2MCG1 3MA9L 2QSTA 1WBXB 1JFQH 1ZE3C 1P4BH 3UZEA 1RY7B 4R26H 4F58L 4IRZH 5B38A 5IW6A 5DURB 5FB8B 2AV7A 3NIGF 4U0RC 5IB3A 5I74B 3A0OA 2JB5H 1T04B 5C86A 1MFAL 3ZKSD 4PJ5D 3B9KB 3O2WH 5E6IA 5EN2A 4R7NB 3MLWL 3H9ZA 3VGAB 3MBEC 2ZG1A 4YZFF 5C0BE 1AE6H 4QXGH 3D6GA 1KCLA 3BH9B 1IAIL 2XG5A 4J1UA 2BZDA 1UXWB 1CGSH 1M7XA 3IDXL 1MHEB 2WBJD 3SKJH 4Z7NF 4PRAA 4OQ1A 4HBCL 3FFDB 3WEXB 1DQDL 2Z92A 3OKNA 1P7KB 3SKJL 4KK5C 3BEVA 1HEZA 1FZMB 5GHWL 3RL2B 5DLML 3OR6B 2R39A 3MNZB 2XTJD 3ALXA 1Q72H 5FF6A 1D6EB 6CGTA 3P9MA 4EN3D 2R23B 4JFOA 1LK3H 4UT7H 1T6VN 1L9NA 5FGRA 2WP3T 3NFSL 1KB5L 3GMRB 5TFSH 1YQVH 4R4FL 1MFAH 5E94B 3PJSB 2DL9A 5HYJA 4NKOA 4LARH 1MIML 3RDTC 5LGKA 3ZKMC 1MIMH 1B4JL 5DFTA 4FQXB 5J6HB 1EGJA 4E9LA 3EBAA 5IB4A 4Z7WB 3LKPB 2WP3O 4D9LH 4FFWC 4ODXA 2ADFH 3VW3H 5DJ0A 4HULB 4XMLL 5E7FA 3WXWH 2XWBA 5F6HI 3IDMB 4PJIA 1RZFL 5ID1B 4W6WB 4WI2A 2A9ML 4GJTB 5DLMH 3HMWL 3INUH 1NCBL 1TIUA 2Z0BA 5I1HH 4QCIA 4JLRB 4K23H 3LY6A 2DDQL 3MUGB 1DP0A 1O0VA 1G1CA 2M8XA 3D69A 1CG9B 2YRPA 4QRRD 3IFPA 4WFHD 1GGIH 2X4TA 4G6FB 2XWTA 4LCCA 1ZEAL 4R90L 3TVMA 1UB6B 4L3ED 5J1TC 4G9FE 5FO7B 5C71A 2VLRD 2F74B 4I3RH 2NY3D 3GRWA 4YDJB 3QUXA 5IHZA 4GRWH 4HLZG 1MCFA 3F12A 3O6LH 4KU1A 3CSPA 5EZIH 4NN5C 2BHYA 3VI4F 4Z7OF 3M8OL 3IFPB 5TE6H 2A9NH 5CEXA 3EOTL 4WFFD 1I8LC 3GSXA 5DJ8B 5F96L 4YIQB 4EUPA 3DI2B 4DVRH 5J56B 3OKOA 2QLVB 2YPLE 3RWJB 4I0PD 3EYFB 3TBTA 5IHZB 5DD0H 4IOFD 4PJHF 3BPOC 1NCTA 4WWKB 4NQED 3KPRE 4ODHH 3P11L 4HH8A 1RUQH 2IADA 4GAGH 3VXNA 4WFED 4O9HH 1I9IH 4MWFB 4GMSH 1NL0L 3QJFA 5DJ8A 1UFUA 5CJQL 3I02B 2R1YB 4Q2ZA 5ICZB 3LB6D 2IFFL 3ZE1E 1I1CA 3WFDH 3FAXA 3QEQA 2BNRA 4UBDC 5I1LB 4JFXB 5M94B 1RZGB 4KKCD 4BJLA 5EU3B 4JQIL 2MHAB 5C0JB 5F7HA 4P3CL 4JRWA 3P3YA 4GO6B 4MWFA 3VWKD 2DQEL 4FFZL 4F7MB 1JNHB 2A77H 4P2QE 4X6EB 3NZHL 3STBA 4PRHA 4OZ4B 4LHJB 4Y19E 3PDOA 1IARB 5IT2H 1P7QD 3D3VE 1TQBC 1DEDA 5C0BA 1RURL 3LPGA 1E4WH 2OYPA 3GMPB 3QEQB 4LAQL 3RWDA 1N6UA 4YE4H 1NEZA 3HZVB 2F54B 4XPBL 4JO1L 4KJYB 5T1LD 1RMFH 4XMKL 2Y4SA 5GGQL 4G8EB 3CK0H 4JAMA 5GJSL 3AREB 3DSNA 2ADIA 2E7HA 4F7MA 4WEUD 2HVJA 3KLHD 1UADC 4EI5D 4Y4HD 1KB9J 1I9RH 1HQ4A 3DUUB 2HLAA 3O6MH 4GBXD 1K8IA 4KKAD 4NKDB 1JNNH 4HS8H 2B2XH 5IQ9B 5GZOD 3WFHA 3QUKA 5D7KD 2AJYH 4LFHG 1CU4L 1UACH 4F2MB 1G7MB 1NJ9A 4WV1B 2EECA 3H3PL 2X4SA 4ETQA 2VAJA 3MV7A 4LHQB 5IB1B 4G80A 3V5DB 2P5EE 5DRWA 3QHFH 3S4SA 2YUWA 4EBQL 4Z7VA 5GRUL 3AREA 3JVGC 3GJFH 3PL6D 4GUPB 4HKXB 2R8SL 4AQ1B 1OVZA 3W2DH 2V2WA 4YHKL 3QDJA 3PWLB 1S7XB 5F9WB 4DN3L 5IIEA 2HTKD 5HY9A 2HT4D 1G6RB 4WW2F 4M1DL 3VXSE 1BJ8A 4XWGH 4RFOH 1PVHA 1KJ2A 3VFUB 4XWOC 1VPOH 1AHWB 1MCBA 1F4HA 3MRJB 4G80B 3V5DA 3JBG7 4M7JL 1INQA 1G0DA 1H5BA 5D5MF 5LXGL 3GI8L 1FJ1B 2EE2A 1BOGA 4NRXB 4NWUL 3BN3B 2YUXA 2O5XH 4OLXL 5I2IB 1OWRM 3ZDZE 3MLRH 2NXYB 5K9KB 3H6JA 5ICXB 5JXED 1G6RA 2DLIA 2GY7B 3W0WE 4AMKL 3FQRB 5SWSE 3DMMD 3JV0A 2NZIA 5DMGD 4RWYL 2OTWA 1A0QL 2NY7L 3HCVB 2A74B 2AJZB 3FT3B 4PG9B 1BJMA 4X6CE 5EPMA 3WDHA 1NKOA 5E5MB 4ZNEE 2RHEA 5SWQA 3SGDI 3UTQB 1CD1B 2P5WE 5IB5B 3F65A 4P5KA 2B7DT 1ZA3A 4Q6IA 4CAGA 1A9EA 4NCC2 3KXFB 2A6JA 2V7HA 5AG8A 1N64H 1SY6L 1KTDA 2G75B 4QHLA 2DB8A 3BMWA 4GXUN 1Y18B 4LHUA 2VITA 3LKQA 5IR1B 3I50L 4ODWB 4LOUD 1QBML 4ZNCD 2EDRA 5F97E 2YXMA 3X13A 4N0UA 1QBMH 2EKSB 2VQ1A 3E2HC 3MCG1 3UO1H 4XNXH 1G7PA 2DBLL 4O2CA 1WBYB 2EO9A 3C6SA 4PS4L 3SKMB 4OZFA 5CCKL 5FKPA 4LDLB 4NQUA 4OB5H 1XF3B 4KROC 4YHKH 3IDYC 1RJLA 4K8RL 3GMNB 3T77A 3MNWA 3PWPA 4Z7QE 4M4PA 4OCMC 2LQRA 3V0WL 2HJFA 4XXCC 1T0NB 1N7MH 3PHQB 2NXYD 2XTLA 1RJCA 5IQ7H 2DTMH 4KK9D 5DWUL 5IG7B 3O6FB 4MSWA 3QJHB 3VI3F 1DSFL 1J05A 3D9AL 1K4CA 4JPWH 4M6OL 3QUML 3R1GL 2X7LB 4Z9KB 3ARXA 3WJLC 3B3IA 2GJZA 2P46B 3E6FA 4X5WB 3NCMA 2EDFA 3F6IA 3RWCB 3GMNA 3T77B 4X8JA 1ES0A 5FK9A 5F7UA 4JZNB 4U1SB 4PRIB 3AXLA 5KVEL 1MFBL 4NUJA 5FAAA 3SDXE 2AKRA 4OTXL 4QWWD 3EUUA 3TYGH 4OGAD 4OZHB 4B50A 2CGRL 4LAQH 1FFRA 3U7YH 1KC5L 2ZCLL 4PG2A 5IBUB 1MJ7L 4OKVA 1XF4B 5IJVB 1MQ8A 5TE4H 1S7WB 4XWGL 1NUDA 4P3DA 2EYRA 3TBWB 3CSBA 4FZ8L 4KV5E 3UAJC 2NMSA 4UIKL 1TFHA 2OMNA 1S7SB 3WJJC 4LLWA 2C26A 3OX8B 1F8TL 3V0VB 5DMKB 2GYSA 3G6JF 2WIIB 3U7AA 5HYQB 1Q94B 3AC0A 4FQPA 1FO0B 3WFDL 4KQ3H 4G6AD 2AJYL 2A6KB 1S7WA 5FYLD 3DWTA 3BDYH 2APTA 4NQDE 5TDNB 4DZ8A 4FMFA 3S35H 2WAHA 1I9RL 4XNMB 1FG2B 3BWUC 2FZ3A 1S7SA 4OJFH 2QQLH 4LLWB 1N59A 4WFGE 5IM7B 4U7KA 1ZHNA 3V0VA 1JNJA 1MPAL 3MACL 3MFGB 5EZLA 4OD2B 3OPZH 2XKUA 4MJ5A 2J6EA 2WIMA 3QIUD 4NO2A 1HE7A 1JRHI 5KZCD 3HZKB 3VGAC 3ARFC 3LIZL 4M7KL 2EXYD 4JO1H 4LLQB 2D7OA 1LVEA 1R3IL 4YE4L 3TBSA 1J5OH 4HIXH 4E5XA 1QFWI 3VXSB 3WMSA 4XCFH 1U41A 4YGAB 4ZFOL 5C3TA 4NZTL 4P46B 4AEHL 3GSNA 5DD1H 4Y4KD 3ZE0F 1F3JB 5F7NC 1YEJH 1ZHNB 4APQA 2O5YH 5ISZD 3HB3D 2RAMA 1K8DB 2NTSP 2VH5H 2YD3A 4H25A 5C0FA 3ULUF 5C07A 1GIGL 5JHLH 4QO1A 5KSBB 3LEXB 1HCFX 3QZWB 4PJBE 4MB5A 4XVUD 3T65B 1OAYH 2PN5A 5CZVH 5AWNH 4G8GD 1OSPL 1BBDL 5A2FA 5HD8C 4K94L 5FGSA 3HI5H 4GG8A 4IHOA 2HRPL 3NN8B 4WO4D 1W0WA 2QHRH 1ZLUH 4DKAA 2FGWH 1RULH 2NNAA 4H5SB 4XPAL 2YMXH 4X7TA 2FWOA 3C8KB 4D94A 3O3AA 3BZFA 3V5HA 4OCSH 4G8IA 3GIVA 3MJ9H 4JDZB 3CAFA 4NN6C 1U3JA 3MJ8A 3LQZB 4HPOL 1TTUA 3NGBC 1H3UA 4U05A 2C1OA 2XACC 3GM8A 3T0ED 1KSRA 1SMAA 5ERWB 5GGTH 3H42L 1DEEA 3QIWC 1HHKA 4HGKC 4HJJH 1N8ZB 12E8L 3BPNB 4PUBH 3MRIA 5DJ2B 3REVA 1CGVA 2UV3A 3QXVA 4NNYB 3U48A 2QSCL 3QUXC 3BZFB 2CQVA 4XHJD 3WFEH 4G8IB 1BFTA 4YDVA 3WFEL 3MRGB 4XP5H 2CRYA 1R3HA 4TUKL 3KG5A 2XZCL 3FHAA 4ZQKB 2RB8A 4D0BB 3G6JA 4UDUB 3HNTL 5D70H 3C5SA 4I4WB 4F33B 1KIPB 3I3EA 4GLRH 4CGTA 2AK4D 3VFWB 5EU4A 2MCPL 5ICYA 2ITCB 4NQVB 3I9GL 2NW3B 5DSCA 4M6AA 3MRCA 1HYSC 1LGVA 2P7TA 4G9FD 4U6VL 4M61B 2CXGA 1A1MB 4NQTA 2J4WH 3L5WA 3QFJE 1N5AB 1SYSA 3I2CH 2J4WL 4PD4K 5EZJA 2NXZD 2OXHA 1FAKT 1LO0H 1WLHA 1XAUA 5T3XD 3I3DA 3AY4A 5EOCL 3CLEH 3SBWA 3VFOB 2NX5A 3ESVF 1YDPA 1DJSA 3H8NA 5I6XB 4XMLH 2ZCHL 3WXWL 4JFFB 5FM5O 5BRZA 3VW3L 5JA9A 3DV6A 2UY6A 4M61A 1GRWA 3N85L 5C6WH 3HNTH 4MDIB 4QF1B 1I85C 2E5EA 3L5WB 4FABL 1A7RL 3KNBB 4IRJC 2X4QB 4Z0BH 5EZJB 4YEEA 1AGFB 3ZL4L 4BH8A 3VXOA 3MO1A 3ZTNL 2BY3A 1F2XK 2HTLC 4LSVH 3ULUD 1QR4A 3CC5A 5C08B 3TO2B 3HZYA 1S78C 4I18B 3QCUH 3RL1A 3ARZA 3LQMA 2CKBA 4U6TA 5K33A 1Q72L 1UWXK 2FJGA 3AS2A 4QF1A 4MS8C 1LWRA 5F3HB 1CR9L 5E5UB 1A7BA 1XR8B 3DIFA 1TITA 1AY1H 1KEMH 2WV3A 4EEEA 1MH5B 3VXOB 1AGCB 1INDL 1DFBH 1T2JA 4RWHA 1DTUA 5FYLE 4KI5D 4FFYH 4R97B 1RZJL 1FL5B 2CUHA 4E42B 5JHDD 2AQ3A 3JWNC 5DMGC 1T03H 4Y4KB 2FIKB 3UJIH 3QDGD 1IAIH 4K9EC 4HK3N 5BS0B 2GSGA 1JYNA 1S7RA 5E4IA 3C9NB 1IM3B 1YYML 4LU5L 5KVDH 3B9DA 3JSSA 5HDOA 4K94H 4JHZA 5J9PA 1QR1A 4KPHL 1U91A 2ATKA 5T1KD 1Q1JL 3UYPA 3IXAA 3PABB 4OFYA 3KJ6H 4U1GC 2HG5A 4PR5A 3W0WD 1KJ2H 4CU6A 1XFPA 4PRNA 4PTUB 2JLLA 2OL3B 1UH3A 4TVPD 4KDVA 1U8HB 3IDJB 2FIKA 4RAVB 5CBEA 2DWDA 3W11D 4MJ6B 3K81A 3RWGA 2AEIT 2B8OT 4HFWA 3IDUA 3K2MC 5JORB 4HIXL 1Y6KR 1QR1B 4Y16D 5I1LA 2MQ3A 5ANMA 3QRFM 3PWPE 2HJLA 3MBED 1NUGA 1GGTA 4BZ1H 1C5DA 4K7PX 1XGRA 4X7DC 4XBPA 1A3LH 5J89A 1M6OA 4JFFE 4YHMH 5DJ6B 2D7QA 3RZWA 1HHIB 4POYA 3BSZL 3SE8L 1I1AB 2QQLL 1ORSB 1DLFH 1FNHA 3IDYB 5GRYA 3CVIH 3W39A 4O51A 5DD5L 3UTSE 5I8KH 2VDRH 2FYYB 2E9JA 3QNYA 3CIQA 4QGTA 4WNQB 2X41A 4YLQT 4ZS6D 4AM0A 4HUXB 1N2RB 2NXYC 3PP3H 3SO3C 1H3WM 3WO3B 2VDNH 1A6TB 1MEXL 2H3NA 4UIMA 1DCLA 3DI3B 4O51B 3DBXA 5DUPL 4DGYL 3UROR 3TFKD 1XF5A 1JF1B 2O5ZL 3V5KA 5FUZH 3QHZH 2X4SB 4Z7UE 43C9B 2F53B 4GRMB 3OKKB 1AXSB 2RQ8A 4KDWA 3ALWA 2DQDL 1RD6A 1I7TB 4FXKA 5TPWH 3C6LD 2K1MA 2WBJA 2NW2A 3DSFL 1QEWB 1HSBB 3NTCH 4KY1H 4HT1H 3TH3T 3VFUA 1NMAL 5I1AA 4C54A 3EOBB 4FXGB 4S1SH 3GKWH 3RZCA 4M03A 5I0ZA 3HC3H 4R6UA 4Y19A 5CMAB 1G7QB 4Q58C 3RI5F 5J11C 1UM6L 4M6NL 2P8LA 5FUOL 1A5FL 1J0ZA 2PNDA 3T0BA 4MA3A 2FD6L 2KH2B 5DEFA 3R0NA 1PSKL 2FX9L 5IBUG 5J6GB 4A6YL 4WHYH 3BWAB 3CUPA 1I1AD 1PKQE 5D7JD 1UM4H 1JL8A 3GHBH 4NC0B 3KYMB 4LCIH 4QYOA 3PGDB 3VDCA 4ZUTB 4AEIL 3D2UD 2AGJL 1UCBL 3C8HA 4MB3A 3NABH 4QY8B 4CVZB 4OGXH 3HLAB 2YHGA 5IGXH 3FN9A 2P43B 5JW4M 1YEFH 3L95A 4JKPH 2V7HB 2HH0L 4RX4D 2EDHA 4JFPB 3LS5L 3RJDA 1CDBA 2XWJB 4XMPL 5FUCE 1BQSA 1GCFA 3QIBC 2PW1A 1N64L 2IBGA 3LN5B 4AT6B 1MHHB 4A6YH 3V2AR 4RFNC 1RZ8B 1PSKH 2NLJA 1RUAH 2FD6H 1OHQA 3MRLB 4ODBD 5EO1B 5C2BL 4RFEB 5I1IL 3OJMB 3ETBF 4LCWE 3NIDE 4PJ8B 1QRNB 4NQDB 3AU1B 3SGEI 3C60D 2YD4A 4R96A 1NGQH 5H2BA 4YHNB 5AD0B 2YN3A 4U49A 3SJVA 1FLRH 4BSVB 4HT1L 2A38A 2VE6A 3CD4A 3SOBL 2R1XA 4MHHI 3NPSB 4QRTA 3OQ3B 3PWPB 4Y5YB 3DSFH 3WE6A 4NWTL 5IGXL 2BNRE 2MPAH 1JHTA 1V7NL 1OTTC 3T0WA 3L1OH 3ARFA 3MXWH 3QUZB 1KG0A 1WJ3A 4O2FB 2AJSH 1ZGLA 2A73B 2ENSA 4JM2A 1CICB 4RMWA 1R3LA 1NFDE 1VPOL 4DKFH 5FM8A 1XGPB 1HH9B 4PYGA 3FONB 1YN6B 1IILE 4X8JB 3P0YL 2V9QA 2VC2L 2DQUH 3MOBL 3RDTD 1V7ML 4L8SC 4HUUA 4CNIB 2AKRB 1U8JA 1U95A 1KG0B 2CJUH 4JM2B 1QNZL 2YD7A 1IM9B 1UACL 5I8KL 2WBJC 5F7FA 2IPKA 4U2ZA 2OR8A 2HFGH 3OWEA 3CFBA 4G3YH 1MIEH 3CVIL 2JJUA 1D9KD 1CXFA 3CMOH 1MCQA 5AEAA 1NCWL 3ESUF 2NY2D 5TQ0L 4IJ3B 3RTQD 1I8IB 4HUUB 4CNIA 4HH9A 1OAKL 1U8JB 2NXZC 2DKSA 3WFBL 3HUJA 4EIGB 1DVFA 5KJRL 3WFZA 5DJCB 3H0TA 1Q94A 1CT8B 3GIZH 1BQHG 4LRNH 4QRRA 2AEPH 4P5TA 3OMZA 5DD3L 1T83A 4YHPA 2EEDA 3OJDB 3TVMD 3TO4B 3Q1SH 4Y5XC 2PR4H 3FO2B 3SKOB 1PLGH 3I6LD 1TCMA 4XNMA 3N1GC 2FO4B 2PYFA 4J3TA 3C5JA 5E00A 1KYOK 1NGPH 2YN5A 4G6MH 5K9QG 3ULVE 3UP1A 5TDOB 2EDNA 3QWOA 3UDWA 4KTDL 4MJ5B 1A1OA 5MP6L 3JWDC 1S3KL 1CT8A 2ZCKH 4YEFA 3UYRH 2BDNH 4ZMAT 3EHBD 5E2TH 1NC2A 4P4KA 1FGVL 5GSVA 3IGAB 1CICD 3BP5B 3NFNA 1GL4B 1UWGH 1WIOA 5FA4A 4OSUL 4ZOCA 4TUOB 1SM3L 2AXJA 1IEAB 2W0FB 3GSNB 5J8OA 4LKXB 3WUWB 2JJSC 3SCMA 2GI7A 3EO9H 1YNTB 5CJ5A 1LO4H 3CSYA 4PJDF 2YBRB 3OKDA 3HNVL 4LP4A 1CGYA 3QDJE 3TNMB 1MFDL 4LVHC 1OAQL 1QBBA 1LNUA 4AIZB 4RGND 4NOBA 3I75A 4OCNC 5AYQA 1H3VA 1R3KA 4ZUSB 3TCXA 3QIWB 2XA3A 4JDVA 1YEEH 4PJEE 1ZANL 3S88H 3EDKA 1NUNB 2WSKA 1WSST 3OB8A 3DVFA 3QB7C 2IG2L 4WEMB 2VZVA 4I5BB 3ZSSA 2OL3H 1I7UA 1KJVA 5F1KC 2NNAB 4H5SA 3FQXB 5I1DA 4Y89A 3GMLB 1JN6A 3U82B 3LKOB 3I75B 1A3RL 5GXBB 4GW5A 4D0DA 1MRFH 1QVOA 5FKAA 5IV2B 3BGMB 1ETZB 1NMCC 4Z0BL 5FOBA 4UZGA 4G43A 1W72A 1R0AL 1DUZA 5IMLB 2A83B 3PXHA 1ZLSL 4R3SB 2A1WH 2BNQB 4ZFZA 4WTZG 1MRDL 1BBJA 1CIUA 1RSFA 3CXHK 3VE0B 4X80L 1NBQA 1ZS8A 2P48B 2AXFB 5ESQB 5DJAA 1I7UB 4P59H 1IGYB 4S10A 3NIFF 4NSKB 2P44B 2PXYB 4P2QA 5DC4B 5CBAB 3B43A 4W4NA 3QO0B 1I3GL 4S2SB 5DJXA 4Q97A 1CFVL 3T0AA 2WINB 1DFBL 4HZLB 3EJYC 2QADD 1I3UA 5ILTH 4OF8A 4X99B 4ZFZB 3IFNH 3NACH 4J6RH 3ARQA 2PW2B 5HGAA 2NY4C 1JMZA 2GTZA 3VGBA 3BD5A 5MERB 5KVFL 3SE3A 5EU4B 3QULA 2X6MA 4PJBB 1BLNB 1D3CA 2CIIB 2MSPA 4QWWC 2B5IC 5ESAA 3VFTB 1FE8H 4OF0A 4OLWL 4D0CA 3IYLW 2QQKL 3GMOA 1AD9A 1S9VA 1DBML 2OSLB 3FOMB 1CGWA 3DJ9A 4X99A 3BFOA 5ALCL 3HN3A 4R4FH 1OT1A 3DPBA 4U6HA 1KB5H 1W0YT 1YDPB 4S1DD 3S5LA 5L88L 2ED8A 5F9OH 4YDKH 1FFOA 4LASH 4OZGB 3ARGD 5ESAB 3VFTA 5BQ7B 4L1DA 5BS0E 4OZGF 3C6LB 4PFEA 1ZKAA 5HPMA 3OAYK 5ILTL 5DVNA 5DVMA 3DX8A 1OTUC 2HWZH 3KPSB 1RUPL 4S1RL 4Z7UF 1KCVL 3Q6GL 3FB5B 3O3UN 4TTGA 4RISL 3RL1B 2X4OB 4GBXB 4F8TA 2AW2A 5CHNA 5E99L 4HPYL 1U3HA 2CDFA 3AMKA 4OV5B 3L7FB 2QSQA 4RAUA 5CD5C 1FFQA 4W4OC 2ZSWB 1C08B 3HZMB 4HKZA 1QSED 3TESA 2H8PB 3NAAL 1IGTB 4XBEH 5CGYC 1GHFL 1DANU 1OAZL 5IKCB 3QDME 5IEHB 1LP9B 2FLBT 3OB0K 1YEKH 1FL5A 2VRAA 3CX5K 2QADB 4MNHA 2BERA 2BJMH 4O02H 3HFML 1GXEA 1YEJL 1ZA6B 2J2ZA 1YEGL 1NPUA 4KJWD 5J12C 4OV5A 3SGJA 5IESL 1HNFA 2CLZA 4J6RL 2ZSWA 5BVPH 1OSZB 1Z5LB 1WF5A 2P8MB 2D31A 3MV8B 3SKNB 4HV8B 5IEHA 4PY8J 3HNSL 5I71C 1U58A 3DMMC 3MLVL 1JPGA 3GB7B 5L9DL 3EO1A 4NUGL 4ODSH 4MJ6A 3VFSB 3RWGB 4DOHE 4XCCH 4RFNB 4HFWB 4KJQC 2DYPA 4PJAE 5GGTA 2XFXA 2CPCA 4WIQA 1CIDA 3KDMA 1TLKA 1FFNA 2R9HD 2HJLB 3CZJA 3KLAA 5CEZH 3L5XL 4ZS7L 3WLBB 1WTGT 5TH2A 4LLMB 4OCLC 5D71H 3PV7A 4QHMB 1P2CB 3LCYA 2WZPD 3SDDA 2Q8BH 4FQQB 3O8XA 3ZHKA 1QLEL 1GPOL 1I1AA 5MEQA 1NEZG 2BOCB 3SPVA 3CU1A 1ZVHA 3ARRA 1REIA 1FO0L 1VEOA 4OT1H 1KTKE 2HJKA 5IK3A 3SDCB 4XVJH 5L6YH 4NBYB 5CFHA 4JO2H 5HDBF 1QPPA 4LLMA 3KPLA 5A2IH 5CEZE 2OX5A 1VADA 4YAQA 2WQRA 4WO4A 1BD2E 1BMGA 5D8JH 5FECA 4ONFL 3VXPA 1A7OL