3QXUA

Free structure of an anti-methotrexate cdr1-3 graft vhh antibody
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDKGKNTVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords Anti-Methotrexate CDR1-3 Graft
total genus 29
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxuA00
4NQXB 2BJMH 4LPYA 5JOPE 4KI1A 4H1LG 4DGIL 4C58B 1AJ7H 2F19H 1F3DJ 3QCVH 4YPGA 3ET9F 5EC2A 4AG4L 1XR9B 3OSKA 1NFIA 4HUNB 4UQ3A 2FL5B 5IVOA 4UILL 3O9WC 2B2XH 2I60H 3LMJH 4M03A 3NIDF 5DA0B 4N0FB 3WS3B 4XB7A 3T2NH 2CK2A 4LPXA 1I1AD 3B9KC 3BEWA 3CX5K 1JNLL 4LU5L 5I15H 3KR3L 1PD6A 4XPAL 3QULB 1VFAA 2F54B 1T0NA 4Q97A 5IJKC 1CL7I 3V0VA 3T3MF 1KELH 1ZSDB 2OQJB 1Y0LB 3OB8A 3ARYA 2FX9L 5F7DB 4G8GA 2CLRA 3RWDA 1G7MA 1OF2A 1IGFH 2ITDA 1KLGB 2APFA 1DN2A 4U0RC 4HGWA 5DEZA 3T0EE 4Q9BA 4JO1L 3CIQA 3VI3F 4H20L 3PDGA 2B1AH 3BE1H 4DWHA 2AABH 2KQNA 2X4RA 3TYFB 2BDNL 1MY7A 3I75B 3P77B 4HLZH 1A3LL 1HK6A 2Q6WB 2DQGH 1BEYH 4Q9CA 2YD7A 1V3LA 1V7NH 2XICA 5J11B 4XZUB 4Q6IB 4P2RE 1NFDA 3ME0A 1KFAH 3DVGA 4ZDHB 1CBVL 2L7JA 2Y07H 5E94A 3QDGA 5J6GA 2Q7YB 1CDGA 3OKEB 3MACL 4OLUH 1PGRB 2EH8L 4WIQA 4PGBB 1IC7L 4OFDA 4BZYA 1XGPA 3G5ZB 1S7XA 3UTSD 1X5IA 2EXYD 4APQB 3QUMH 3X13A 4DVBA 4JHAH 4JREC 4NKOA 4NZRL 5I19L 1T1ZB 3EGSB 2P8PA 5FUCE 4HULB 1S9YA 2NY0C 1BQHA 3U79A 5BS0E 2H1PH 1J0HA 4LKXB 5AWNH 3R0NA 1Z9MA 1PVHA 3D9AH 2BC4A 5GJTH 4BQ8A 1KCSH 4AL8H 3BQUD 3LSOB 4UU9A 1ZT7B 4YHOH 3HI5H 5F8RC 2FEEL 2YC1B 4UBDD 4P9HL 1OLLA 1MFBL 1CVRA 1N0LA 1S7XB 4HBCL 3QJHA 4U3CA 3P40A 3AS3A 2VLMD 4DKFH 32C2A 3WFHB 4Y5YC 1JGLH 2P44B 3EOBA 3VGAC 5FYJL 2G2RA 3RX5A 2AGJL 5D1QD 2CD0A 4PJBA 3VFRA 1OW0A 1HDMA 2FO4B 5IM7A 4UV4H 1W72L 4XX1G 3M1BB 4XP4L 2XZCH 3QNXA 3T0AA 3FCTA 1YC8A 4FZ8L 3O3BB 5DJ6A 2PO6A 4OCYH 1YDPA 2PN5A 3EHBC 5F93C 4LNRA 4YHML 1LE9B 1CGVA 1LEKB 1OTUC 5DLML 1CE1H 4WFFD 3U7YH 2OJEB 4MCZB 5KZCB 4CVWA 3SO3C 4N0CC 5ESVB 2QQLL 3S37L 1D3CA 2YK1H 3GRWA 1P9MA 3PDOB 4M4PA 4QT5B 5CP7B 5JTWA 1MFNA 2ITDB 4P2QD 1HEZA 5F6IB 1G7MB 1OF2B 4G7VL 3D69B 4R9HA 3IRZA 1EJOH 4EI5A 1U3ZA 2GUOB 3TT3H 4D8PA 3VE0B 4UTBL 4ZYKA 3JXAA 1Z9OA 4LSPL 1AO7A 2DB8A 5GGRY 5F6IC 1ZEAH 1F6LL 2F58L 4LPUA 2VOTA 3FQUB 4LSQH 5DVKA 4RDQG 1FFNA 3BT2L 3I9GH 2ADFH 2P5WB 5I1EH 4Y88A 1K4DA 4WFFE 1XGUB 3RZCB 2EO9A 1IEBB 3QHZL 3RIFF 3EO0B 2FJFB 5E2TL 4BQCA 5C3TA 1R3KB 2UUDH 3UDWC 5KANG 3OX8A 3NPSC 5TF0A 3PWLA 2J88L 3NACL 3RGVD 2FIKB 3GM8A 5IMOA 3WNKA 2CLZA 3DARA 1EX0A 4YUEH 1JK8B 4ZFZA 4JFXA 3KJ4B 4YAQB 4NQSA 4PJCB 4PTUB 2X42A 3WIIL 1CFQA 5IR1B 2AI0H 3VWJD 4RFNB 4OLEA 1BWWA 2WWKT 2HN7A 3I84A 3C87A 4HIJB 1I7ZA 2R29L 3IF1B 4ZAKD 2FRGP 4GAFB 4MDIA 4FQXD 1URLA 3HS0B 5I30L 4GAYB 2VZSA 3BSZL 5L7XH 2QHRL 2Q86B 1HQRA 2ZSVB 3U4AA 4D9RD 1OGAE 2ZJSH 3PWLB 5T3XE 3OKEA 3FHAA 1BBDH 3C08L 1U8NA 1AIFA 5J3HC 3WE6B 4Z5RB 2UYLB 4PJ7E 4ELKB 2EKSB 3HC4L 5FUCC 4MMZC 4MAYB 5HPMA 4ZFZB 3MBEB 1FZJA 2HAZA 1JWMB 5IK3A 4O2CB 3AU1A 3ZKMD 3MFGB 2IWGA 2E8YA 1U3JA 2EECA 3TCLB 1HYSC 2VDNH 3LQAC 4X98B 4LSPH 5C7XL 5I0DA 5IVNA 1IAOA 3GNML 3TYFA 1BF8A 4XAWH 5DJ2A 5HVWA 3UX9B 4FP8H 3U7WH 3I2CH 3S35X 5K9KB 2PR4L 2GT9B 2DIBA 4HUMB 3LD8C 3UPAA 1MCWW 3SJVD 2Q20A 2XTJE 1EEUA 2CLRB 4O58L 1UM4L 1A4KA 3NFPA 4D94A 3F12B 2QQLH 1QFWM 2O5YL 4OF7A 4U6HB 1J86A 3PDOA 2QBWA 3WHXB 5KZCD 3BPNC 3FQNA 4L8SC 3QRFM 3KYMA 4M7KH 5IJVA 4RQQB 5DZOA 1JFQH 4Y1AA 2V5TA 3NFPB 3B5TA 4N0FA 5FYJE 3WS3A 3CAFA 2CDEB 4Q58C 4WW2B 2IG2L 4X7TB 2N4IA 2GT9A 1KPUB 4LKCA 3FQXA 5K9KA 4Y16D 1XF1A 1BGXH 4Z8FL 5ESVA 4P59H 4ACPA 2OL3H 4KRLB 1HOCA 3ULVH 3P30L 1U42A 4G8FA 4PY8I 5D7JD 2CGRH 4QYOA 4V2BA 3PIQA 5ERWB 1KCUL 4JVWA 3EJZD 2PYEE 2IFFH 1YPZA 1GCFA 4YK4B 1SBBA 4OB5H 5ALCH 4NT6B 3WLBA 2F8XC 3GK8H 4JM2F 4O2CA 4DKEH 3ZYOA 2EYRA 2Z31D 3OKNA 2VSDA 3DI2B 4BUGA 4Q2ZA 3P2TA 4OZFB 1KBGH 1X5XA 2Y72A 4Z7WA 3F62A 2AJZA 3RNKB 3BHBB 3O11B 5I73C 2WNGA 4UOW0 2Q76A 2WLYA 4NQEB 4HH8A 5A43C 15C8L 4ZO8A 1KTDA 4PJHE 1FIGL 1C1EH 2MCPL 2FH6A 1AR1C 4XH2B 4N1EA 4ZTOH 5IW1A 2EDXA 3MLWL 2YPLA 4ZMAT 5F71A 3CCHB 5D72H 2HJKB 1UM6H 5EU4B 3EYQC 5MERB 3LN5B 4Z7VE 4OQ1A 3S88L 4LRNH 4R0LC 3SOBL 5LWYH 3KR3H 5I66A 5I15L 5BS0D 4P23A 5EU6D 4N0UA 1W2KT 4NKIH 4NNPL 5FDYA 5JR1L 3IDYB 2PW1B 5CIPA 1KOAA 4YDVB 1BD2D 5D2NB 5IBLC 3T8XA 1BQUA 3UTTA 3WV0A 1Q0YH 3ZKMC 2X09A 5JIKA 3RBGA 1UACL 2C3WA 1V7MH 3T2PA 2ERJB 2XKUA 5EH1A 4A2LA 2H32H 3PL6A 4MXWH 1ZAGA 1QFUH 1MCFA 1FFOB 3BWAB 1IZKA 3Q1SL 4HJ0D 1BOGB 4QYOB 3WNOA 1LDSA 3VGDA 1R3HA 4Z7UB 4RMVA 1WSST 5EOQH 4YO0A 3IFLL 5I71B 1KCVL 4LKCB 5J7CC 4Y19A 3VFOA 4BKLB 4QRUB 3WNMA 1PEWA 2VLJD 1FHGA 2A83B 5EBWB 5F7DA 4NBYB 4BM7A 1ZHLB 5I74B 4L9LB 5ALBH 5D70L 4Y1AB 1EAPA 5HHVL 3OKKA 1KGCD 5AD0B 4AIZA 5D70H 1VEMA 3QAZB 3G6JA 1NL0L 3CPLB 1WBXA 1SY6A 5CGTA 4P2OD 3E8UH 1BJ1H 2FX7H 3VW3L 1FIEA 1RZ8A 1D5IH 5JQHC 2FL5A 4LCCA 3EOAB 4BKLA 1QRNA 4P46B 2JCCA 1MJUH 2GY7B 4X4ME 2XA8H 1LE9A 2F54A 5CMAB 5D1QB 2EDDA 4WV1C 1JTOA 2Y06L 2UUDK 1J1PL 4LHQB 5ACZB 1J18A 3UJIL 2CJUL 1MFCH 4MJID 2GW5A 4QTHA 4LVOC 2L0DA 4R26H 4RSVA 4CMHB 4F33A 2YD6A 1FZOB 4UDUA 3LDBC 4FXGA 5I17A 1YN6A 4XNYH 2ZOKA 1QR4A 4WWKA 4NQXA 4F15C 5ADOL 4XCNA 4Z7VB 3EFFB 3VFNB 1G6RL 4GOSA 4JPVL 4F57L 3GSXA 4OCMC 4KV5E 4N0UB 3TFKD 1TTGA 4JY4B 3WS6C 4NKDB 4KVCL 4AEEA 1NUNB 3QXDA 3T3PF 3L3OA 4L8DB 3QT2A 1BHGA 4Y1AD 4ETQA 3FB8A 3HE7B 1CXLA 1DVFB 1KENL 4N1CA 5EU4A 3MUJA 1YECH 1B6UA 3WN5B 1DVFA 2EC9T 2NR6C 4GAYA 3GSOA 4QXUH 3MV9E 3ZDYF 1OSPH 3IAGC 3QISA 1X5AA 3KS0J 3U9UA 5CLWA 4OFYA 3S98A 3ARDC 3JWOL 1RUPL 1QSZA 3T4YB 5A16B 5DMIH 2EH7L 4NWTH 4NQCD 4JY6B 1QYGH 3DRQA 1KJ2A 2IAMA 5ICZA 4AJ0A 5EZJA 4G6FD 1RZFL 4PJBE 3V4VH 4J6RH 1RURL 4GAJL 1MEXL 3D0VB 4EBQL 1SVZA 4UUJA 5E5UB 1QFWI 3GM0A 4X5WA 5CMAA 3IDMA 5D1QA 2VXSH 3ARPA 3HRPA 2YEZA 3FMGL 5IEHB 3MRKA 3LDBB 3IU3B 4IDLA 1BGXL 3N1PC 5C08A 4YGAB 4Z8FH 2UZYB 4X7SL 2IQ9L 1A6VL 5F88A 1XR8B 4AQOA 1B0GA 4L8CB 4RZCB 4WTXA 4YR6A 1KPRA 4JRYA 2NXZD 4KPHL 5JW4R 1QFPA 2ITCB 5EUKA 3HE6C 1LP9E 2QADB 4YPJA 3PNWA 4FQLL 4XP5L 3QXTA 5EBGA 5C0GB 3EOAA 1N59B 3UJJL 2QHRH 3BPNB 3GBLA 1RUMH 4P2OC 5ITBL 4AIOA 2Y5TB 2VR5A 1WFOA 4KKNA 5KJRL 1VENA 1A1OB 4JFFA 4XXCC 2X4UA 3NCJL 5HHNA 1KGCE 5GSVB 2ZOLB 1G7JB 4HDIB 4UMGA 2P49B 4ZQKB 4PG9A 4Z7UA 1LO5A 3MLTB 5F3BA 4Y4HB 1BQLL 1LNUA 1I1AB 5E6ID 4XAWL 3U7WL 2GJJA 1J1XL 3WIHA 5I1AA 2R15A 5T3ZD 1S7QA 3TNMA 3WJJA 1OAUH 4YPGB 5IVZB 4R4ND 1WK0A 3EOYG 3BIBX 3EZ8A 1EVUA 3L7FA 1HKLH 2J6EH 1QNZL 4NHUA 5E1AB 4BQ6A 1T2XA 1UJ3B 5HI4C 1DBAH 1R3HB 3BESR 4KHTH 3T8XB 4OV6F 4Y19D 5E2TH 2WBJA 2QKIA 2DQIH 5GJSL 1V05A 7FABL 1XIWA 4OLWL 5SWSB 1XF2A 3Q5OA 2FR4A 3ULUE 4PG2C 1BM3L 2ADJA 3DUSA 1MIMH 1P9MC 1KEMH 4HUWB 2LABA 3B3IB 4O2FA 2WINA 4KJWC 2YPLB 3QHTC 4PJDB 3WO4B 5IW1B 2KL6A 3TVMC 1ZLUH 4XH2A 1U3HA 4M5ZH 4U1LB 4QLRA 3BSZH 4UT6H 1VADA 1O7VA 1J88A 4MA8H 2BK8A 3HI1A 1ZLVH 2H45A 4U1HB 3WL9A 4ZNCD 1D9KB 1IM9D 2VMFA 2DQEL 1ZLWK 1G7IA 4Z7WB 3GB7B 3MRGB 2HRLA 5C6TL 3QDME 5T5FH 3ROLA 3MODH 3BP4B 2B39A 3ESVF 1EK3A 2DTML 3ZE2F 3RI5F 5JW4M 2NNAB 5C0AD 1RJZB 4P0DA 2MQ3A 2J88H 2H6PA 3PHSA 5HYQA 1QRNE 4JFEE 1B4JL 2R4SL 4YZFE 3IAQA 4UNTA 3G5YB 1FAIL 5ESAB 5CD5C 3FHQA 4UZGA 4ELMB 3N0PB 3BP5B 3VCLB 5FDWB 1A9BA 1CR9H 1XGUA 1B88A 4F3FB 4X4ZA 1S7WB 2WP3T 1UZ6E 3UTSA 3C5ZB 2P5WA 4LSQL 4V1DD 3EO9H 3NCYS 2D3VA 4RIRB 4KK5D 5KSBF 3BT2H 1ZEAL 3I9GL 4G43B 2Q6WA 2P48B 3KS0H 4PJEE 5I1KH 1SJHB 3N85H 4I77H 4Y5YB 4CU7A 1HI6A 3TO4A 3EO1B 2ICES 3Q0HA 1CLOL 2E7MA 4X6FA 1NAKL 4JEGB 2JKXA 1YMMB 1MRFL 1KUMA 1I7UA 5D7KD 1ULVA 3VH8B 5IGXH 4DKFL 3KYMB 5IJVB 3BQUA 3SJVA 3IKCA 3O6FB 3D39D 2IPKB 1F3JB 5I9QB 4E41A 3JTTB 1I8MB 2I26N 5ICXB 1T66D 3RHWF 3IS1X 4Z7WF 1BQSA 4E5XA 2MQCA 4DFHA 3QUXD 4EUPG 5SX5H 2CDEA 1T1WA 25C8H 2FYYA 2UY6A 3C6LC 4LL9A 4OV5B 4OZGB 1YEDB 4YQXL 1RZIA 3B9AA 1A14H 3MV7A 2F53D 3V0VB 4NUGH 1NH6A 4BH7A 1DBBH 3L3IA 3KPQA 4H8WL 3ALWA 2X05A 3CFDB 4JZOB 1QLEL 1VACA 2ZG1A 4S1DC 3ARBB 1WFNA 4YC2B 5HHPB 1H5BA 3DJ9A 2ESVE 2IGFL 4JFDA 4MXQD 1X6LA 3QXAB 9CGTA 3CDFA 4BSWA 5BJTA 5E8PB 2HJFA 1QOKA 1B0WA 1S9VA 3B83A 5EC2B 4BJLA 1S7WA 3CXHK 4Y4KA 3E2HB 1OT2A 1L7TH 2FBOJ 3TZVA 4L4TB 3QO0A 3WKNA 4AQ1B 5IESH 4EJ1C 1YY8B 4NHCL 1RFDL 3IDGB 1CBVH 3ESUF 4FNLH 4X98A 1BBJB 1FYTD 2BVUA 2DLEA 1AXTH 5BZDB 1IGMH 5CJXA 4OF0A 2GJ6D 5T1MB 3QDMB 2HT4D 5DURB 5CJQL 3S96B 4R90H 2NZ9C 4KK5C 2JB6A 5GGRA 2P5ED 1W72B 1HKFA 4HIJA 4P9ML 5J9PA 2HLFC 2V7HB 3K1DA 2BVOB 3RY5A 5SX4I 1TLKA 2ADIA 3DYPA 3QJFB 1TZIB 5D2LF 3D9AL 2MPAL 4OSUH 3GKWH 5I1JL 4MJ6B 5JQ6L 2R8SH 3SKOA 3RPIB 4M6NH 4NKOB 1RUAL 2FATL 3AAZB 1CGYA 1QSEB 3ILPA 4YHIA 5JW4N 3QIWB 3VRLF 1CQKA 1JUFB 5CEXB 1MFEL 1ZHKB 2WINB 1EXUA 3GSWB 1D5BB 3GIZL 1NDGA 4XRCA 5IB2B 3QG7H 4U33A 3EO0A 4PRHD 2OSLA 3VH8G 3ZSTA 2BFVL 5GS1A 3FO9B 5EZLA 3RGVA 4GO6B 5JXAL 4LSRH 2VDMH 4Z18A 1I4FB 3WFCH 2EDLA 3O2WH 2OL3A 2BVQA 3VXSD 2I5YH 4X5XB 1SEBA 3OPZL 4JQIH 1MFCL 3BE1L 2R69L 4NZJA 3KJ6L 2CJUH 2VDPH 1FRGL 2B1AL 4OD3H 1MCBA 3VFVA 2I07B 2Y06H 1D5BA 4NO2A 5C0DA 5ILTL 5FK9A 4BELD 1L6XA 3ARRA 2IADB 1G0XA 4JAMB 4XCCH 4ZO7A 3ULVF 2LTQB 5GHWH 2FX7L 3VW3H 1KELL 5LQBH 3CJJA 2CDGB 2P5WE 2FX9H 1JPST 5FO7A 1ZSDA 5J06A 1AD9A 3OJVC 5L2KA 1AFVH 1ZGLP 2HLFD 4LNVA 4UI2A 1NBVH 4Z9KB 1WWWX 2LQRA 2W60A 2XWBB 4Z6AT 2R1WB 4K07A 4K3JL 1NSNL 5I8EB 4X4MA 4HWEL 4WGVB 2O5ZL 1NBVL 1LO4H 2BHUA 5HYSA 2YPKA 1HHIA 4MD0B 3K8KA 3SDXF 3PF2A 4MNQE 1KXTB 3PGCB 3SDCC 3D1MC 4PUBL 4ONHA 3I3DA 4PLNC 2YD4A 1A0QH 3GHEH 3LEYH 3P0YH 2XT1B 1TCRB 2OK0H 1BBJA 4OFKA 1INQB 3OHXB 1FRGH 3IJSA 3S7GA 3QHFL 1SYSB 1YDPB 1T20B 4QRPE 3MA9H 4BFGA 2BOCB 3BFOA 1J0YA 4KTEL 5TE6L 2AXHA 3KJ6H 3RBSA 3SCMA 5T1LD 1IQDB 4PJBB 4QXGH 1R3LA 2ED8A 1U8LA 1U95B 1ZT7A 5IMLA 3MJ6A 5DQ9B 4BSWB 5C2BH 4JFDB 3D3VA 5C9KA 1UWXK 4NKIL 1K3IA 4S1RL 1R3IL 2ARJQ 32C2B 2HT2D 1FNFA 4M6ML 5TDOB 5K93A 3HZKA 4LHUG 1LO0H 2A38A 4YBQD 2D4DA 4KJPD 2BVTA 3SOBH 4U1MA 4YXLH 5BCAA 2P5EB 3DYMA 3WXVL 4Y4HD 5A2FA 4XHQA 1UM6L 2OXGA 4OF6A 3QDJE 1T89C 2DBLH 3BGFB 5C6PB 3FTGA 3HA0A 3SO5A 2X4SA 3BRGC 1VEOA 2GFBA 3MV9D 5TE7L 3QHFH 4NKDA 5EU6A 4PJXE 1UXSB 3A6OA 1S7SB 4C56B 5EBMA 5ILTH 3DYOA 3GSXB 1IQWH 1L9MA 2PXYC 1K4CA 1NEZB 3MRIA 3VFGH 4HEME 1NFDB 1Y18B 1JZ7A 4Q6IA 2JTDA 4OLVH 1KEGH 1KBGL 1A64A 4P2RB 5DR5L 1OGTA 1FBIL 5CEYA 4LASH 3DMMB 2VE6A 2C3XA 1KXQE 1NSNH 2OTUB 3I75A 1BPVA 1NC2B 4LF3A 3F5WB 4OKVB 3QQ9D 1VESA 4QTHB 1G7LB 3WS6A 5C9JB 1LD9A 1JPTL 3IFOA 4YDJB 5IESL 2AV7A 1AY1L 1SVCP 5GRVL 1OTTC 1RJZA 2DAVA 4KGJA 4DGYL 4XVJH 2O61B 3WEXA 1P84K 4LLDB 3T4AA 1FNEA 2IQAA 2OL3L 4IOFC 4CU6A 5GGVL 4H26B 2NY0D 4KWUA 5JHDA 1BREA 2YA1A 1NCDL 1AP2A 4OGYH 1M71A 4PY7B 5A1AA 4WI6A 5JPNB 2NW3A 5HGDB 1S9WB 5JW3H 3KGRA 4LVHC 5FA4B 1EVTC 2EKJA 2B4CC 2C9AA 4U3HA 4EEEA 1A8JH 4P57A 5E6YA 4XVTL 2BRQA 1NFDF 4XCEB 3WFCL 5JXEA 3TP4A 4JO3H 43C9B 3GZKA 3NFNA 1ZLUK 4GBXD 1WT5C 4JZJC 4XBEL 1DFBH 1INEL 1TENA 4JLRB 3U82B 3QI9A 5A40E 3LRSB 2VQ1A 1QBLH 5D1QC 2Z4QA 4GKZB 3EW3B 1H9VA 4N8PA 1GAFL 2BCKB 1RMFH 1T04A 5KSUA 4KRNA 1S3KH 1XIWB 3C8KB 4IMLA 2OI9C 4PBWD 1YEKL 3X14B 1FFPA 3C5SA 1W0WB 5C0IA 5I1GH 5MHSE 1V5JA 4NDMB 3QUYA 4FXLA 4UV7L 1C5BH 3LKSB 4FXKB 3MUHL 3OR6B 2DM3A 5DJYB 4MDJA 2A9ML 4MAYD 4ZAKC 5FAAA 1FVEA 2AK4D 1B0RB 4WI7A 4WVRA 1GRWA 2XWTA 4X4XA 4P2OA 3TBVB 3HNSL 4Z78B 2FGWL 2VQ1B 4BUHA 5MERA 3VD3A 5ENWA 1INDL 4PP2B 3GBNL 1A2YB 2NY4C 5I1CL 1FGVL 3MR9B 5FF6B 4WTZG 1BF2A 3RQ3A 1KCLA 4TVPE 2Z9TA 4QNPE 1FCCA 4FTVA 1P2CA 1ORSA 1U6AL 3STBA 5CHNA 1QSFA 2ZUTA 2ESVB 1A7OL 2K7PA 4NPYB 1T7XA 5LAXB 2GSIA 2XZAL 2FECI 1FH5H 5EU7E 1FFRA 3QP3A 3BMVA 1X5JA 1QZ1A 1PX3A 4JE4B 5C2UB 2FHBA 3UO1L 5AZ2H 4TSCH 5JHDB 4M8VA 2P8LA 4WCYH 3L3GA 5F7FA 3H42L 3RIAK 1LP9B 1HSBA 1KIQA 4GBXC 4TVPD 5HGHA 5DD6A 4NWUH 4UT7H 2WIMA 1BAFH 5TPWL 2OI9B 4LRIA 1H15A 4MJ2A 3D0VA 1A7QL 5JUEL 1A7QH 2ICCA 1PY9A 3MRCB 4GW1B 5F7LB 5CKAA 2MKLC 4FQQA 1NBYB 3QEQD 1WV7T 2P47B 3SKMA 1U3HC 4F7EB 2XNAA 3K4ZA 1EHLH 1YNKH 5IFJA 1P4IH 2VJXA 4U1KB 4WJ5B 3VWJC 5E8DL 1UH3A 2AP2A 2J8HA 5HYSG 3VRLE 3VRIB 4Y0GA 5D93C 1Z9LA 3LOWA 2Z0BA 4D0BB 2QTEA 1EJOL 4RQQA 3KPMA 2R1XB 1FH5L 4U3XA 4DOHB 1H0DB 2ATKA 1C12B 4K7FB 2YUVA 1UENA 1EGJH 2R1XA 5CGYD 3BZ4B 4GG6F 4GXUM 1UADC 4JFFD 1A2YA 1A3RH 2BP3A 5FA3A 5DRXB 2P1YA 3UC0L 3OKLA 5D7JC 1WGOA 1O5DT 5ICYA 3MFFA 4M5ZL 1KB9J 4NN5C 5FO8A 3IVKA 5DD5L 1WTLA 2P7TA 4IRJA 5BMFL 4WTWA 1U41A 3SGJA 4Y2DD 3RWJB 4MQ7A 1YYLH 1G9MH 2GK2A 5IBUG 3MJ8A 1JPFA 3CFJA 4OFPA 5C09E 4GRLA 4GMTH 3RHWK 1YNLH 5C0BA 1U8MB 4K9EC 3MROA 5BS0A 3LQMA 1W0WA 2FD6L 5D1ZB 1BFOA 4LLUB 4GMSL 1TDQA 4FN0A 3TO4C 4K3EL 2DQIL 3OG4B 4Y4FC 1KJ2H 3VXRE 2DQJH 4IMLB 4WI5A 3E6HA 1JWMA 1D6VL 5IK3B 3L95B 3P4OB 3AGVA 1KJMB 3BGMA 5JO5B 4MAYC 3GSRB 4WO4C 5E5MA 4MCYB 4ELKA 3S4SB 3IT8D 4ONFH 3VD5A 4JLRA 1FZMA 3SDCD 1CXIA 3HZYB 4GAJH 3SGEI 4ZS6C 5F7HA 4XXDA 5DHVA 1I85C 1UC6A 4JM2B 2ZG2A 3C6LA 3NFSH 1JV5A 1JPSH 1RURH 4B0MM 4HKBA 1ZLSL 5L0QC 5DMKB 3LB6D 1INEH 3ZT7A 1OAYL 1AC0A 1M6OB 4J3UA 5CZXC 1JVKA 3RZCD 4QXTB 3TBYB 4KMQA 1RUPH 1OP9A 3G6JF 1JGDB 3CFCH 1JHLL 5TQ2L 2WZPD 3U4EA 3ILQC 1UKTA 2XTJB 2A73B 3BISA 4PTUA 2H3NA 1A3QA 5GIRB 3SPVB 1RZ7H 4ZFOL 3ULVE 1AKJB 1IQWL 3ABZA 4X4YA 3E1F1 4Q9RL 2JIXB 2WWKO 5I1GL 2BSED 2QSCH 4KPHH 3DETD 4Y19B 1SJXA 5TE7H 3B2VL 1YEKH 3QWRD 4Y2OA 1XF4B 2EH8H 3MJ9A 4OCWL 1MWAA 1RU9H 1T3FA 2YR3A 3N9GH 4NO3B 2OYPA 1ADQH 2MHAB 2P4AB 5F1SA 4YBQC 4RDQF 3MRLB 3QB7C 2YXMA 4F57H 2VXQH 3VFSB 1NMCB 1OP5H 3S6CA 4TTDC 2CK0L 3FT2A 1K8IB 1U2HA 3BDYL 4KC3B 1NGYA 1RQ5A 3PP4L 2HH0L 1P6AB 4S1RH 1HE7A 2PYED 1A3LH 3OKOB 4MJIA 4EUPB 4TSBL 3NFNB 5F8QC 4K94C 3IXAB 4HAFA 3UP1A 2BY0A 4NWTL 2IBZX 5TE6H 1EO7A 1Q94A 3CU1A 3O6KH 2PUQT 4JCMA 4D3CH 2RCSL 5JPMB 1GGIH 3F7QA 1A1NA 4C83A 1I1YB 4JHZA 4WENB 1I3RA 8FABA 1NL0H 1F4XL 4TNWK 5IVXA 4EBQH 3VXOA 1C5CH 1X5ZA 1CLCA 1DVFD 5IP4A 1MAKA 1XF3B 2NYYD 1LO0L 1D5XA 3H2WA 2XA3A 1WBZA 2PTVA 4LVHB 2B2XL 2I60L 4IHOA 4V1DA 3O41B 1IQDA 1IGJA 5DI8B 4LPVA 3SCMB 3MX0A 1DEEB 4AMKH 2VKWA 1GGYA 4PRAB 1NMCC 3VFGL 5BVJB 4OD1L 1YPZB 3RKDC 5I1IL 3D39A 3DBXA 3UTTD 1T21A 3RTQB 1T5WB 4I0PB 5T33H 2R0LH 5I1DA 4TNVF 5GXBB 3BWUC 2FEDD 3E2HC 5BV7H 3MV9B 1F6AA 4KK6C 3U83A 1FFQA 2BSRB 1ZT4B 4M43L 3MV7D 1CIDA 3MXWL 2EDQA 4W81A 5F1NB 2D7QA 2Q8BH 1KULA 4P4KA 2NXYC 2IPTL 2VWEE 3ARBC 4RGMC 4RAUA 3HE7D 1S9YB 4W4NA 4GRMA 4NRYB 4ENEC 3O3EB 4OAWB 1F4AA 4JPIB 4FZEL 4O9HH 4K71B 1T1WB 2FYYB 5HI5D 1MFEH 5L8LB 1CFSB 4P5TA 5AYQA 5E4EB 5EO9B 3GRWL 5D9SA 2NY2D 3QZWA 4RGNC 5D2LE 4PRDA 5E9DB 3H3PH 2FWOB 3IFPA 3QPXH 4G8IA 1AI1H 4N0YL 3DO7A 4RFOL 2HTLD 3DROB 3DVGB 3SCMC 5D1XB 4XC3L 1E0OB 1HI6B 4WTZA 5F7UA 1WWAX 5TH2B 3E3QC 5LXGL 3MOAL 5F1IB 3OHXA 5DFWH 5EU5B 3ULUL 1IAIM 4YDKL 5BVPL 5IT2L 2BNRD 3T0EA 1Q9KA 2PETA 1XZ0A 2DL9A 4PJIE 4OB5L 5ALCL 5GGQH 2X4RB 4ELMA 5H94B 1GGBL 5KTEH 3R06B 1OGAB 1ITCA 1N64H 5JMRA 1S7VA 2UWEB 1T03L 3FB5B 2ILLA 3PP4H 2CGRL 5HY9B 3JV4B 3MGAA 3IXTB 1SMOA 4XCFH 1HWHB 4ZPTA 1RFDH 4J7RA 4PRHB 4NHCH 3DHJA 2ADGB 1CTNA 1EO5A 1QSEA 2DQHH 3OF6A 2R2EA 1JWSB 4MX7B 2RIKA 2AJUH 4CN1A 1HHJA 3ARGB 1KNOB 5BV7L 2RHEA 3Q6FA 5D71L 5LGJB 1AKJA 4HFWB 3PG2A 2R0LL 1I3RB 4HC1H 8FABB 5T33L 3AM8C 1ONQA 1LQSR 4PRHA 1RVFL 3EYVB 4EN3A 2BVOA 3TO2B 4MVBC 5HBBA 5JXED 3HZVB 5I1JH 3QPQC 1QLEH 3KPPA 4OI7A 1VHPA 1U8JA 1K5NB 3O8XA 3PWPE 3BIAX 4PGEA 1TITA 1YMHA 3LQAH 1KN2H 3QEHB 2PTTB 1HINL 2A74A 4FQCH 1X7QA 5DHYA 3RL2A 4TRPH 2FR4B 2Y7QA 4G9FA 3T0WA 2NZIA 1FL5B 1IILE 1NANH 2HTLC 2IAMD 3QCTH 4NN6C 1CXKA 3NVQA 3MRLA 5HDBF 5E1AA 4EI5D 1Z3GL 1GGCL 4LPTA 1DBKL 5F6HJ 5DO2D 4KQ3H 4GG6E 4E41E 2XZZA 5SWSD 43CAA 1TVHA 2XY2A 3RWFA 2VDKL 3DGGB 3PQYD 4S11A 1CS6A 3Q6GH 1EHNA 4GJTB 1J8HA 4FQPA 2X40A 3TBWB 1JHLH 2DIJA 2D7PA 4NUJA 2NY3C 4U6XB 2Q8AL 3VDBA 4X4YB 1V8HA 3CXDH 2YKLH 2QQKL 2K1MA 1F97A 4M3KB 2BOBA 3JWDL 4PG9B 5KVDL 2FJGA 3MOQA 5SX5K 4N68A 1ZMYA 3NCFB 5CEZH 1WT5A 4E5XB 2V7HA 5IIEB 4LP5A 2HH0H 3ARFD 1Q9WB 2YRPA 4J8RA 4HK3N 1HILB 3BKJL 4LDEB 4RFNC 3BKML 1WVZA 3O9WB 1LEKA 2VDLL 2IPUG 4JM2A 1RUQL 3BO8B 3MRQB 4M8QA 2VXTL 5IQ7H 5T1LA 3JUZA 5ISZD 5ADPH 2AK4E 5DEFA 2YUWA 2FNBA 4Z7OF 1R3JB 5E2UH 2WQ8A 4MA8L 3SKMB 1A9EB 1GXEA 2P42B 3GNMH 1PW3A 4KAQL 5D5MA 3CSGA 3MV7E 3N85L 4I77L 4NC1E 5DS8B 5DI8A 5BW7A 4PJXF 3F6LA 3GIVB 3QRGH 4PLOB 1QFWH 5IEHA 2W0LA 4IIQA 3VGAB 2EYTA 4H8WH 1IEAB 2H32A 2DQCH 3B43A 2FEEI 1A7BA 4MB3A 5J1TC 2DYPA 2O5YH 2V2TA 1QHOA 3QHZH 5I1EL 4QHNA 4O58H 1EJ6A 3FFCB 3BPOC 4I5BA 4WUUB 4DQOL 1UJ3C 5H35B 3C09C 1BBDL 1BVLB 1BD2A 2X1XR 4QHMB 2XPGB 3CSYB 1I1YA 4Q0XL 1WF5A 2GJZB 1YEDA 5FO8B 3IVKB 1SYVA 1GGTA 5EUOF 2A6JA 4HKZA 2P46B 4WCYL 2EEBA 3RUGB 4L4JA 5E2UL 4YNYB 1HHHB 2YA2A 4BZ2L 1P5VA 3I85A 4NIKB 3MYJA 3C09B 4CNIB 1DUYA 4PRNB 3WIIH 5D7KE 4X7CC 1WFUA 5MEQA 2D0FA 5A3IC 1RIUH 1FNGA 4ZUSA 3CU7A 4KY1L 1CGXA 3CK0L 2AQ3A 4QRSA 3GI9H 3RIFK 3H3KA 3QXDB 4PTTA 2C1OA 5FOJA 1A7NL 4LRIC 3VD7A 3ULUD 1E28A 2GTZA 2OP4H 1UYWH 3UTSB 2NY6C 4P3WA 1MJJA 5DGRA 3LKNA 3GBNH 3JTSB 4XVUC 2OXHA 5IB5A 4XPTL 3UTPE 2HFGH 1J9CT 1A7NH 4N5UA 3M17A 2CUHA 1ACYH 3I6GB 1P1ZA 1J5OL 3TJEL 3ULSB 4JZJB 3IDIA 1G1CA 4KKAD 4TSCL 3QUYD 4HEPG 7FABH 1A3RL 3FB7A 3DIFB 4YGVB 2NNAA 3SE3A 5FUOH 2AQ2A 5L2JB 1MI5A 2W9DH 1AKJD 2BY2A 2VAJA 4M9PA 4G6KL 5CSZA 4M93B 4M1GL 1NBQA 2EDYA 5GIRA 3SPVA 1FG2B 2H3NB 4GFTB 3KNBB 3NIFE 3P9LB 4UT9H 1AXSA 1WCQA 5J6HB 1G7JA 4HDIA 1KLGA 2DQDL 1UJTA 4IJ3B 1FGVH 5D7JA 1A1OA 3SDAC 4Z76B 1PY4A 1QSFB 5CHNB 3RWEA 1HXMB 3B9KD 1JYNA 3OAZH 2OZ4H 1QBLL 4HKJB 1N5AB 1KJVA 4YHOL 3T1FB 1QLFA 5JUEH 2LTQC 4G42B 4H1LH 4XMKL 1Q1JL 2YK1L 3QXUA 4GRLC 5DHVB 3ZHKA 2CPCA 3QUXA 3REWB 4CVUA 3GMNB 3JZ7A 2W92A 1OTTD 2CMRH 2XWTB 3ARFB 2EDKA 5B3JE 3TN0B 5D4QA 4UQ3B 4JO4H 1ZS8B 4JHAL 5FGBC 5HHOE 4XT1C 4QNPF 2QKIB 1UGNA 3OR6A 1J1XH 4WO4A 3TT3L 2XZCL 5CBAB 5D71H 1P4BL 3NZ8B 4PJEA 5IB1A 3EOTL 3EYSL 5JOPD 1OHQA 4X7SH 4HJGB 1I85A 4MSWB 3BKYH 4B41A 1OWWA 2CO6B 4S1QH 1LNUB 1VERA 4OCSH 4X83A 4ISVB 4PRPA 2PYFB 4Y4FB 4HMEA 2W0PA 4JFEB 5IOPA 1XGQB 1AR2A 2R2BB 4OZIA 5I2IA 4KQ4L 3HUJE 4WFGD 1MWAL 2EH7H 4K3DH 3D85D 1RVFH 1VSCA 1NUDA 2J5LC 3ECBB 4YNYA 1TETH 5C0GA 4D0BA 1BZ9A 2R39A 4XP4H 3LKPA 1AI1L 1F3RB 2M2DA 1XH3A 3ETBF 5MI0B 1PFCA 3AMLA 1UH4A 5ECJE 1FO0H 1B90A 1WAAE 2E27L 5D7IE 2PNDA 4QO1A 3ROOB 1GZPB 3BGAA 4A6YA 5IFJB 4KQ3L 1KIRB 3FMGH 3HMXA 4JY4A 3QIUD 3FFCA 3WXVH 3DV6B 3P9MA 2DJ4A 4QHNB 4XBGB 1UB6A 4O9HL 3PV7A 4HPOH 5D7LE 2FBJH 3QUZB 5JNYA 3ULVC 4FQCL 1NGXA 2E8ZA 5F6HI 3T2NL 1DFBL 4PRID 2Z35A 1U8QA 3PWPD 1IM3A 5D1ZC 3HI5L 4JPVH 3VWJB 2DQFA 5ALBL 3MJ7A 4C54A 1BLNA 2Z92A 1RZJL 3VFMA 1WIPA 3DRTA 3RVXD 1NEUA 1PSKH 2OTUA 2APWA 4JJ5A 3G08A 1S9XB 1E6OH 1T20A 3SKJL 3RDTC 3KPOB 2DWDB 2Z31C 4KJPC 3U48A 1PG7H 1YEJL 5A16A 3ZYIA 5EPMB 5LAXA 5E1HB 1UZ6F 2EDBA 5IHZB 3ARGD 3OZ9L 1Y18A 2AK1L 5D7LB 2F15A 1ZWIA 3IDJB 3RU8L 2FGZA 1ORSB 3CX2A 3EJYD 3X3GH 2M8XA 5D96B 1U91A 4HJJH 1IC4L 4BZ1L 4KKCC 5FB8B 4MXWL 4WW2A 2HT3C 1VGKA 1CD9B 4LLMB 2FIRT 2HYMA 5DRZA 5IIEA 1IVLA 5I73B 4ODVL 3ARXA 3KXFE 4HIIB 1PKOA 2IPTH 5JR1H 4M62L 3RL1A 3K0WA 5C2BL 1LK2B 5ID0A 2CUMA 2PCPA 4NNYA 3Q2CA 5IFHL 5KVEH 1UEMA 3FQRB 1A21A 1WICA 1TVHB 3MOAH 3B4NA 1E6JH 4H5SA 4YHZL 3O4LD 3DURA 4NO2B 5GRWA 5IT2H 1C08A 3V5KB 5DFVC 5EORH 3MA7A 1ZT1A 4RFOH 2BRRL 4JFYA 4JKKA 5IW6B 2W1NA 2RCSH 4OZIE 1C1EL 4MSWA 2M1KA 4N0YH 3GHEL 3LEYL 1R5VB 1N2RA 1AQKH 4X99A 4PUBH 2CO7B 4ZODA 2VQUA 4KGLA 2HFFA 1Q0XL 3ZE1E 4JFPB 3VFUA 3CX5J 3UTZA 1JWUA 5DC9B 3V6OA 5LKNA 1CVSC 1JCKA 2UV3A 4FFVD 4P4KC 4PJHF 1YNTA 4M7ZB 3E6FB 3RVXC 3VFPB 5CP3H 3TEUA 2DIAA 5C0AA 3FN3A 4WI8A 1SY6H 1DP0A 1QD0A 4H25A 1WTGT 1MHPH 3HLAB 3X3FH 3NAAL 3QQ3B 3DLQR 2EIDA 3MO1B 3CLEH 2MSPA 2OTWB 4JG1L 2C3VA 5IUSA 1NDMB 3GHBH 4P5TC 2XZQL 4KI5F 1GVIA 3LD8B 4YLQT 1NQBA 4Y16B 4NQVB 4NRZB 5I74C 4XB8A 1BJ8A 2AEPH 3RU8H 4OCWH 5HHMD 5HHOB 4PR5B 3MLWH 3K2UH 5D7JB 4Z76A 4DEPB 4WO4D 5IW3A 5MP6H 2EDRA 2MCPH 5KANI 2NQCA 2AJZB 4GLRI 1QFUL 4JGUA 3FRUB 1TTFA 1W72A 5IMKA 1I9IL 5HY9A 3OPZH 4WRLA 3SGEH 2FB4L 1RSFA 5T5NG 3ZYZA 1G84A 5MEPB 2AJSH 3MTRA 4HUUA 2Z91B 4ORGA 1ED3B 3RZWA 4AMKL 4HH9A 2ZUYA 4PRPD 3OX8B 5D2NE 5E6ZA 5CEZE 1WAAA 1H3GA 1OQOA 1VKXB 4PJ8A 4GG8A 2F53A 5GGTH 3LCYA 4PRIB 5D1XA 3QG7L 3NFSL 2Z8SA 4MNQB 4PB0L 5A3ID 3CH1A 4WHDA 3W2DL 1LO3H 2B1HL 5D5MF 4JHWL 4UINL 4ONFL 5EU6B 4ZTOL 4KHXH 3G5VA 2E27H 3QA3B 1WZ1L 3AM8A 4P59L 2V5SA 1HYSD 1S7TB 5TF1L 2LE9A 2A77L 3BP6B 2YPVH 2MPAH 4EN3C 5DJ8A 5E8EA 1H3PH 3BP7B 4S0TD 3ZL4L 4OT1H 1OVZA 1T22A 3QIUA 4F8TA 2J2ZA 2UZIL 4JQIL 2HJLB 3O8XC 3HC4H 5JIPA 3MBXL 5BO1L 1JNNL 3N50A 4HKZB 1FVCA 2OCFD 1NEZG 3ZKXB 1JZ3A 3P0VH 2A6IB 4FQ2H 4U2YA 4H0GA 4DW2H 1CDUA 4WWID 5C0CE 4K2UH 2CK0H 25C8L 4EDXB 1UM4H 3MNZA 3ZKSD 4GXUN 1KIPA 3BEVB 1NAMB 4LVNB 1YY9C 4O5LH 3EOTH 4RWHA 4HS6B 3SQOL 5GSRB 1MCOL 5GRUH 4Y5YA 1FV1B 3TPUB 2AI0L 3S9DB 3FKUS 4FP8L 4HS6A 3V5DB 4XCYB 3ZE2E 4Z77B 3RWGA 3P4MB 1QBBA 1BIIB 2W38A 3DVIA 4KTDH 4LLWA 1N6VA 4D0CB 4KV5F 2B4CH 3CD4A 5C07B 2MQ0A 4J3TA 1M7DB 3PGDB 3UYRH 4NM8H 3LZFL 4Z7WE 1FPTH 1ZVYA 3B2UC 4WI2A 2YZ1A 3TF7C 3ALXA 1YNKL 1HHIB 4IHOB 4V1DB 4PRBB 4QRQB 3EOBB 5FYJD 3V7AG 1D5XB 3MRQA 1A14L 1MFDL 4Z95L 4KRPC 5E0QA 5FHBH 3OF6D 2R4SH 1CD8A 2IBZY 4GSDL 3CUPB 1BAFL 3I3BA 1KB5A 2DM4A 4WFHE 3X11A 3ES6A 4JFOA 1G9NH 1JRHL 1A6ZB 2CR3A 2QR0A 3AS2A 1MPAH 4BA8A 4E9LA 1E4KC 1OSZB 3SO3B 3FQWA 4ZD3L 3V8OA 4APQD 4UT9L 2X1QA 4UTBH 2CSPA 3G04A 1CD1B 3IKCB 1EPFA 2YRLA 2ZPKL 3A6BL 2V7NB 1QA9B 4RMQA 2BNRA 2OS7A 3BH9B 3BOVA 5DK0A 1AGCB 4GG8B 5FYLE 4L8BA 1JRHI 2DQJL 2KUTA 4PGBA 4L3EB 2DMCA 3KJ4C 4GMSH 4OD2B 4G43A 1HXYA 4HWBA 3SE9L 3EUUA 1VGEL 3B5HA 2VLRB 4WEMB 1X9QA 4G8EB 4B7IA 5J4MA 2H9GA 3N1GC 4I2XA 1DL7H 5DDHB 5DJCB 1FZJB 4RISL 3CH1B 3DV4B 1FZKA 4JQVC 2H8PB 3HAEH 4PJXA 1UJ3A 2QADD 1BX2A 1SJEB 3PWUA 5BMFH 1EHXA 2MOVA 5M7QA 2VLME 1T7YA 3O9WD 3AS1A 1U93A 1XEDA 3GSUA 1G0DA 1MWAB 1T3FB 3QFDB 4NO3A 5DK0B 1AO7B 4HWBL 2H6PB 4HJ0C 4U49A 1NLDH 4E0RB 1QA9A 3P77A 1EGJL 3ULVD 5CGYC 3B2UD 4HT1L 5T3ZH 2NY2C 4EXKA 2JIXA 3A6BH 2AGJH 4U1NA 3TA3C 4ZNEE 1YEEH 4D9LL 4PJ7F 2I9TA 3SDXB 4RRPA 1S3KL 1BQLH 3INUL 3LEXA 4U1HA 1ZANH 2R9HD 4JFHE 2J7LA 5F7MC 4G8GB 5LGJA 2OX5A 2CLZB 2FDBP 3TIEA 2XKNB 3ARVA 5L8JB 4RA0C 3U30C 3CFKA 1JZ4A 1T1XB 4MB4A 2QL1A 4ODBD 2X89A 1MRCL 1SMAA 4LAQL 2PO6B 2A9MH 2IANA 3KPLB 4XVTH 4PB9L 3NABL 4KKCD 4DVRH 1HZHL 5D7IF 1DL7L 5TPWH 5C0NC 3R06A 1RHHA 3QDJB 3VXRD 3QRGL 2VABB 5SWSA 1XF2B 5F88B 2F58H 4ONGH 1CXHA 3HCVA 3UTZB 3VA6A 1KN4H 4FZ8H 4EZMA 3L3KA 3RUGE 2N56A 3V5DA 4M48L 4KTDL 3EDJA 3G6JE 1S5IH 5EIVA 5DT1H 3RWHB 4XVJL 2XZAH 5BOZG 4FQ1L 1JPFB 3CMOL 1NAMA 4HIHA 4LCYA 2AK4B 1I1AA 4DKDC 1EEZB 4WU7A 4HX1B 1B6DA 1CXFA 3TH4T 1LHZA 4TULL 2JK5A 4J6RL 3S37H 4ZPVA 4YJZL 4ZQKA 2NYYC 3QIBA 4P2QA 1MVUB 1MIML 4K8RL 3ZTJG 2GAZB 2YSSB 4Y16C 4G8GD 4HSQA 3OKMA 2P8PB 3HNSH 5I9QC 5HVGB 1TJHH 5E8EB 1Q9LB 1K2DA 1UZ8B 1YMMA 3FFCE 5L0QB 4M7LH 4G9DA 2EO1A 3Q6GL 4XNMA 2A77H 8CGTA 3G5VB 1RJLB 4R3SB 3LZFH 2BSRA 1VDGA 3C5ZA 5CCKL 5J6GB 4KKBD 1KTLA 1G9NC 3WLWC 4FQQB 2DBJA 5HHXH 1FZKB 1RMFL 4TUOB 2I25N 5KSBE 1H3TA 3G5YA 4P5TD 1RZFH 2OM5A 3V4VL 3ARDD 5EPMA 5IHZA 4HBCH 5EU3B 2YD5A 4O5LL 3L5IA 2VLRA 2D0GA 5HPOA 1JIBA 5GGTL 4J2XA 2CUIA 5SWZD 3ZZ1A 2VL5B 1MFAH 1XF5A 3GJFH 3B6SA 5CBEA 1BZQK 3C8HA 1GZPA 1WZLA 2V7NA 4XAKE 2F5AH 3BUYB 4U7KA 3WFEH 2KKQA 2F19L 1TQCC 3GB7A 1I9JH 2Z35B 3AB0B 3LSOA 5I19H 1DE4A 1FNLA 3T4YA 1IZJA 1MRDH 3WD5L 4EOWH 4XMLH 1MQKH 1DR9A 1YECL 3NCEB 2NTFB 4LVEA 2BMKB 2IALB 4U1LA 2EC8A 5E8OA 5JDSB 5I2IB 4WHTA 2OJZH 4YHPB 3Q3GA 1BVKA 4HG4J 1HHGA 2N1KA 1OLZA 4K71C 2DQHL 5AD0A 5C09A 1ND0B 4RNRB 4R0LA 3E8UL 1MEXH 3JVGC 4OLXL 2AK4A 1X5HA 3MRPB 2VAAA 3ARWA 3CVIL 2LV4A 3A6CL 5IEKA 5I16B 1XCTB 3C5JB 3RKDD 3U46A 1U8IB 1AFVL 5IB1B 1YPZE 4UIKH 5FYKH 3HNVL 5HJ3B 4LEXL 3AY4A 2VZOA 4YO0B 1ZOXA 5C07A 5JOFB 1KEGL 4J4PD 5FYLH 1K85A 1G7HB 1CN4A 3ZE1F 3GMOB 4AG4H 2VSCA 3PL6C 4FS0A 3H0TB 5A2JH 1NCAL 2ORBL 5GGSA 1RJYB 4QXUL 1QSFD 4M6AA 3QFJE 3L3HB 1ND0A 3QUXB 4NBXB 5ISZE 1G7HA 4KK9C 2RJMA 3ARBD 4DFIA 3QI9B 3HI6H 3DUUA 3FQRA 5EC1B 2PW1A 4LMQE 5CIPH 1ZVSB 2QV2A 5I16A 1G7QA 1ZS8A 4R97B 5INCB 2MMXA 4XPAH 4UIKL 5FYKL 2W65B 5KVEL 2YA0A 3O2WL 2HLAB 4CADB 2V6HA 3RWCA 1R3IH 1PLGL 4HQQL 4P57B 4L4TD 3GBML 1WQVT 3GSVB 2HJKA 5I71C 4QHKJ 3WYRA 5DA4A 3IFNH 4F7TA 4QRPD 1KPRB 1IC4H 3JV0A 4MQXC 3X3GL 3S97C 5HYJB 4L3CB 4HJJL 4BZ1H 3UJIH 3C6LB 5GRVK 2XTJD 4WHCA 4XBPA 4NQED 4LCUA 2B5IC 4YH6A 4YDJA 5JQ6H 2EDTA 4PRIA 2R8SL 3MA9L 5EBLB 4OQTH 1S9XA 3S3JA 1W8NA 3UAJD 2BNUB 1PSKL 4XWOC 5K33A 2FH8A 2RFXA 4JJHA 5T5NF 1N6QL 5JXAH 2CIIA 3PL6B 2O5ZH 3TBTB 4P48A 1NKOA 4J4PC 2CRMA 4QRTB 3D85A 1T83C 4X7DC 4WWKC 5IMKB 4X8JA 4Z0XA 2ZSWA 1K4CB 1NEZA 1ZK9A 4QEGA 4KVNH 5EZIH 3LPGA 5C07E 1HHHA 3LN4B 4L3AA 1QR1B 3JV5A 5KSAA 1QVOB 5EUOA 4M7JH 2VLKB 5I66B 3JWDC 1A4JA 1RK1A 5ICYB 1MOEA 3OKLB 3KYOB 1CT8A 3CDCA 2VNCA 1MHEB 4N90D 3EYFB 2GSGB 2PKDA 1GYAA 2BY1A 3HE6B 3HLAA 4PYGA 3ECBA 3UTPD 4XC1L 2EE2A 3SGKA 3DX6B 5DHVH 1NCWL 2GAZA 2Z93B 4O51B 5DC4B 4K3DL 2VLJE 1OARL 3ARDA 4MLSA 5CJQH 4L4VB 3TA3B 1D9KC 3GJFB 1ACZA 4LSTH 4JRWA 4FHBD 4ZO6A 3GK8L 4NNXB 1E27A 3O4LA 4PJ8C 2DRUA 1TFHA 2ZCHL 1T0PB 1BD2B 4QHMA 1WCBA 1Y6NR 2E9IA 2IAMC 3PGDA 4GKOA 2CH8A 3MV8D 3ZLQC 2X1WL 4XGZA 4RMUA 5C86A 4ODWB 3TYGH 3BKYL 1WWBX 2LFGA 4E42A 4GG6B 2H26B 5CBAA 4MXQC 4JPKH 3OB0K 4WO4B 2GI7A 1S5IL 1QACA 1QO3B 5K9OB 4WDIA 4QHUB 3CMGA 4JN1H 2VLRE 3O3DA 4LLVB 2F8OA 3FL7A 1U58A 2G75B 1RUAH 2FATH 3QIUC 4JR9H 4K7PY 3T04D 3RTQD 2IANB 3KPLA 4IOIA 4RX4A 3WUWG 1Q1JH 3HE6A 4NPYA 4P9MH 4PB9H 2ESVA 5SWQA 3GMMB 2Q86A 5CZVL 1FAIH 5B8CB 4R90L 3TNNB 5FCSH 2MFNA 1AH1A 3TWCH 3OXSB 4KFZC 3BP7A 5CEZD 1VGKB 4LLMA 2HT4C 1JPSL 4ZUVB 3WFBH 1UFUA 2C4FT 3IF1A 4K7PX 4OJFH 4XXCA 3SDAB 1YEIH 4AM0B 1UWEL 1M7IB 3AREB 4OCSL 4K8RC 3BUTA 3LIZL 1FG2A 3MMEB 4JHBA 4NSKA 3WDIA 4YAQA 4PPTA 2J8UE 3GI8H 2AKRB 4X4XB 3I02B 5BXFB 1TNMA 2HVJB 4N9OB 3U6RA 4W6YB 2A6DB 2HWZH 4CVXA 4JJ5B 4NN7C 4CBPA 3KYKL 3WJJC 2F53B 2O26U 1L7TL 4PD4K 3LQZB 3HRZA 1I4FA 2FD6H 1FFPB 4ZG1A 1LEIA 2EDEA 3G5XA 3S8WA 2JJSA 1DBBL 1XIWC 4HUXA 3I02A 4CRPA 2AS5M 3GI9L 4ZOCA 4LFHD 1ZXQA 5DQJB 5FECB 2X1PA 1RIUL 4U1IB 4WUKL 5HHMB 4L8BB 1ONQB 3D48R 5B21A 4DCQB 3I50L 2PO6D 3OAYH 1U8HB 4PLKC 2DYPD 1WIOA 2BNRE 5DUBA 4FOMA 1EZVY 1JWSA 5IGXL 1CXEA 1QQDA 3D25A 3VXRB 4MDIB 4YHKL 1XFPA 3MCLL 2J8UA 1T1YA 1HQ4A 1YEEL 2VDOH 5INCA 3MLPA 4O4YH 4OZ4A 4PP1D 3L5JA 3AB0C 2SEBA 4P3DB 4XNQA 3RNKA 2IFGA 4S1SL 4JFOB 1P4IL 3LKQB 5TDPA 1MVUA 3NACH 5GPRA 4XNZB 4ESKA 1EHAA 2DQUH 3NOIA 4JZNA 5FUOL 3S96A 4Q0XH 4UBDC 4LHUD 1ZTXH 3CVHL 4HWNA 4JKLA 4R7DB 5ANMB 4MX7A 3BDBA 3P4MA 4NKQB 4C57C 1PKQA 4JQVA 5F7NC 5ITBH 3MLXH 1F58H 4PRBA 4QRQA 3V6BR 4F9PA 3SY0A 3KLHC 4ZNEA 2FJFA 6CGTA 5AZEL 1QNZH 5DS8A 1UM5H 5IW6A 4JFYB 2Y6SD 2ZNWA 3I6KB 4PD4J 4Z77A 5C0CB 3GMPB 1KYOJ 4P23D 1JJUA 1T80A 3GJFA 2X70A 3QNZB 3X17A 5FGSA 3TA3A 3FQUA 5FHAH 2WBWB 2X7LA 3LY6A 1RPQA 4OAWA 1R5IB 2HWZL 2E5EA 4L3ED 3MBEC 5LG1A 5CP3A 1KB5L 1MCJA 3C8DA 5HGBA 4GRMB 3BQUC 1S9KC 1U8KA 3RL1B 4EI5B 2VXSL 4JRXE 4N1HB 2DLGA 4S1DD 4D0DB 1G6RB 2DMKA 4RGMB 4YBHA 5KJRH 3IJHA 3LN9A 3OJMB 1S7TA 1NBZB 1ZLVK 2HT2C 1RUML 4NJAH 3EDKA 2F74A 1YPZF 2XV6B 3RWEB 3HB3D 5MI0C 2BOBB 5E24E 4U1MB 4LLQA 1QVOA 4AENB 2Q8AH 4U6VH 1L0QA 4M6OH 3NN8A 4XVSL 1LEGA 5MHSD 2VQTA 1T1ZA 3CFBA 2R4RH 2UVFA 1I7UB 3VH8A 3DGGA 1DBAL 4KHTL 2XWJB 3RWFB 3VXMB 4HIEA 5GJSH 5F1OB 1XF5B 5F1NA 4MYWB 3ARED 2XN9A 2J8UF 1U93B 3GSUB 2DI8A 4YHYC 3DRTB 3QCTL 4Y8DC 3ARGC 5F7YC 4K23H 1I1FB 1AE6L 1BECA 3UTQB 2IH1B 5FDWA 3BP5A 1AQDA 4ZDHA 3VCLA 3VXUD 4L9DA 5ISZB 3GSQB 4XP6H 4P2QE 3RY6C 2HT3D 4G8EA 4LEOA 4LPWA 3RVUD 5C0AE 4G8GE 1AIFB 4FMKA 2ESVD 3BKMH 4PY8J 5I75C 3WFZA 4P9HC 3DV6A 3WIHH 2NX5B 5DQDH 3TCXA 2F54D 1LWRA 3NCJH 4Y16A 4YFEA 3F8UB 5FO9B 2K3TA 5D96C 4PLKD 4NO5A 2H1PL 4PRNA 4TQEL 3UTOA 2Q7NA 4CNIA 1NLBL 5KVDH 1DQJA 2BDNH 4EN3B 5B8CC 1TVDA 1KIUA 1XF3A 2A9NH 4G7YH 1MQ8A 3QEGL 4P2QB 5IVXB 4TVPL 1J1PH 1DZBA 1DBJH 5K59F 1ZA6A 3MRHA 3PXHA 4IRSA 3IJHB 4KUZL 4NM4H 4UIMA 1JWUB 4HS3B 1KB5B 2FLRT 1EEYA 1PG7X 5DMYA 3QULA 1DBKH 3NPSB 5FEBA 4KI5C 4MA1C 1R5IA 3X12B 3QDHA 2NTSP 1A6WL 5GS3A 5GGSB 1HN1A 5EZIL 1FP5A 3WSQL 2EICA 1JPTH 2JJTA 2NY3B 4N90E 3F7PC 3H0TA 1YNTB 3JSSA 3OBAA 1RZKL 4LASL 2QQQA 1MF2L 1JNLH 4L29B 4LU5H 3RGVC 2WBJB 5B22A 4YDKH 1MCRA 1Y6KR 4G80B 1GJIA 2XQYK 2BNQB 2WUBL 1RZGB 1AHWA 3FQTB 1KN2L 1MLBA 1Q0XH 4I3SH 4X99B 3TH2T 3TBSA 4KRMB 1II4E 1KCVH 2PCPB 3OL2A 3BN3B 5EUOE 4CMMA 2FB4H 5K9JH 5KAQF 2ICEA 3JWOH 4PRDB 1H3XA 2MJWA 4OQTL 5HHQB 4JM2D 2EIZA 2JCCF 3BEVA 4NQCA 3BMWA 3N1MC 1MNUH 3PWJA 4Y5XB 2DD8H 1BZ7B 4G42A 1EA9C 5DJDB 2WK2A 1JNHB 3CLFL 5E70A 1M6OA 3B9KB 3ARUA 1DQQA 3DNKA 1J05A 4HKBB 3JVGA 3SKOB 2YMXH 4DGVL 1HXMA 1FL6A 1Q0YL 2KBGA 4RRPG 4A2MA 5DVLA 2QJDA 1T22B 4RGNE 1HNGA 1S7UA 3KPSA 2GY5A 4HQQH 1PLGH 2JB5L 4M5YH 3KPOA 2D31B 4FQJL 2WIIB 5HHOD 4YHLH 1WITA 3QCVL 4ELME 3FCTB 3S88H 5F9JB 2X41A 3M1BA 1QBMH 1XGTA 1VFMA 1Z2KA 2EZ0C 1T5WA 4Y19E 5CD5D 3V6FB 5F7KC 3VGFA 3TESA 2E7LC 2V2XA 1T5XB 1FZMB 4KTEH 5BRZE 2YEZB 2D9CA 2QQNH 4HK0A 3C9NB 4TUOA 1J87A 4L3EA 1GZQA 3QIWD 1D5IL 5EOCL 3LPFA 4R2GB 1JGVL 5EORL 4MD4B 2GJ6A 3SE8H 1YMHB 1S9VB 1RJLA 5F96L 3B9VA 1ETZA 4F9LA 1R0AH 1XH3B 2D4FA 1A5FH 3V6ZB 1GSMA 5FA3B 2AKRA 3SKNB 4HWEH 3REVB 1U2CA 4CVZB 1F4XH 1DUYB 4B50A 6FABL 2A0LD 3NMEA 3EGSA 2VZVA 4DUWA 1CDIA 3AC0A 2A6KA 3CVHA 1AGDB 4G9FD 2HTKC 4G6JL 5DTFB 4I8DA 3QIBB 5JDJA 3F7YB 4PJFB 1TTUA 4DUVA 4Z7OE 3H9YA 2VDRH 4ERSL 1E4WH 4IJ3C 2ED9A 2OJZL 3IDNB 1S8DB 1T89A 4XCCL 1QRKA 4ISVA 1DANU 5C09D 4NM4L 4OCXL 1NGPL 2VZTA 3O6KL 1EEZA 4NCC2 1ZA3B 5EA0L 5TDNB 3RY4A 1FLRH 3RX8A 1A02N 5FM5O 3GJEB 4G5ZH 3TH3T 3QEQE 4ZUWB 2PXYA 4MA3A 1UWGL 1V7ML 1I9JL 2ENSA 4TQEH 4QHUA 3MLYH 4J4PA 1N5YL 1QO3A 4EI6A 4WJ5A 4N9GB 5DWUH 3BDYH 2IFFL 4LBEA 4QGYA 4JY5L 4M1DH 3WIHL 3TN0C 3UJTL 3WBDA 2YD3A 3W11C 2B5IB 2VR4A 2EZ0D 4LGSB 5KVMC 4MQTB 4A6YL 1KT2B 2FBJL 2DN7A 3QZWB 4M8QB 1NCTA 3VRJB 1OAXH 3KPRE 4LLAA 2NZ9D 4GKNB 3O4LB 1I3UA 5F70A 1ADQL 2C1PB 3T65B 3WNLA 4H0IA 2ARJA 1YEFH 1MCCA 4YBLC 4PJ7A 4FQHB 4PJ9B 2GCYA 1YUHA 3SGKC 4XNZC 5ID0B 2YD8A 5DSCB 5EOTB 15C8H 3RA7H 2I9TB 3UZVB 1PYWA 1D9KA 4LCIH 4MA7H 4H1LA 2VXUL 4NQUA 3W81A 2GYSA 2P5WD 1P2CB 3H7LA 4Z7UE 2CKBA 4FTVB 4QRPA 4I3SL 4EVNA 4W70A 5EBWA 2WUBH 3K3QA 5FXCH 5JXEC 2FJHA 3L3DA 1U91B 4PJDA 3QFDA 3LKSA 1ZLSH 2GTWB 4OTXL 1AGFB 2EE6A 4FNLL 2CXKA 4JZJA 5I18H 4HGKC 3D18B 3HPLA 3P9LA 3PWUB 4OFYD 4N0RA 1ZHBB 1CLZH 1WBYB 3L5XH 2JLLA 4U7SA 2VL4A 4FFYL 3VXPA 1EZVX 1KJ2L 1X6NA 4HLJA 4K9EL 3R8QA 2DQFB 4K94H 1SM3H 1JFQL 3FN0L 4ONGL 3CFJB 3D3VD 2NMSA 3L7EB 1SHMA 1YNLL 4ZAKA 3DSNA 2P8MB 3LKNB 4P46C 1EO8H 1KPVB 2IPUK 3HG1B 5E6IA 4DVRL 1WC7A 2BCKA 1F4HA 2A0LC 4ODHH 3MLTA 3DX9A 4AY0A 5GS0L 4NQVA 3LEVH 4YWGH 4WFED 3VI4F 4HKXB 5I30H 3CK0H 3OJDA 5C0EA 2IBGA 4LIQL 2EEAA 5KSVB 3QQ3A 1IGYA 3QG6B 2GHWB 3MJ9L 1FE8L 1Q94B 4W68A 3H9SA 1JYWA 3RWCB 5HD8D 3DX8B 2ZCLL 4WFHD 2O61A 4KRPB 1MRFH 2AJVL 2VUYA 4D9QD 1E4XH 2R0KL 3RVVD 1SYVB 5C9JA 5F21B 4PY7A 3DUUB 3QXWA 1G7LA 3WXWL 4GLRH 5E99L 3U2SA 3SDDA 3UMTA 1CR9L 4M61A 5GS0D 1XZ0B 1FYTE 3FZUD 2JJSC 4OUUB 4LLDA 1Z0MA 2V2TB 1RJYA 3V4UH 5KN5A 4OM0L 2E3VA 4GBXA 4HFUL 4MGXA 1MI5E 3EAKA 2C7UB 1FV1A 1FC2D 1CICB 3THML 4L1HA 4KXZH 3P4LA 5SV4A 3NZ8A 4FFZH 1CE1L 3JV6A 3M07A 5DRWA 4Y89A 3E0GA 2ZJSL 2R2HB 1VGEH 1G1YA 4RGOH 1I7RA 5TDNA 5BOPA 5AZ2L 3TA3D 3PQYB 3QCUL 3QR2A 1N4XL 1P7QB 5DEFB 3NPZB 1I8IB 2NY7H 4LARL 3UO1H 3WO3B 4UV4L 2DM2A 2DICA 5EFIA 4R7NB 3CH8A 2VXTH 3UTTE 1K8DA 2DWEB 3QQ4B 1MELA 2F53E 4OQTA 1JGDA 4Y4HC 2VDLH 4C56E 3TBYA 3LIZH 1WEJL 4X7FC 4ZS7H 3L1OH 5FF6A 2YUXA 3GFUA 4TSAH 2HMIC 4O00A 3TC9A 4UT6L 2HRPL 5D93B 3RWIB 4OJFL 5DF0A 5D7LA 4ZUUB 4F2MA 3P4NA 4FFZL 3WCYA 3L5HA 1PBYA 2Y5EA 4OLWH 5HVHB 2YKLL 4FTVD 5IKCB 3B8SA 3ZT5A 1YQVH 4I0PA 5DD3H 1KLUB 4FXKA 3G9VA 5L2JA 1D6EB 4W6WB 4FABL 4RCAA 1EDQA 4DN3H 5HSFA 3FRPG 1A1MB 3TCLA 4PRPE 1FQ9C 2FZ3A 3DVNB 5E95B 1OM3L 3HAEA 1VFBB 2NXZC 3VXUA 3KPNA 3ZE0F 5FYJH 3ULSA 3D2UA 3QEUB 1JHTA 3DX7A 4R2GC 2X4OB 3MBEA 3KPPB 3UEZA 2GITA 2R0KH 4MAYA 3G9AB 4HV8B 5SX4H 3HC0A 4NQDA 1CFNB 5FKPA 2D31A 3LRSA 2B8OT 3IDYC 5D2NC 4WFGE 1OAZL 5D6CB 2YPLD 1D9KD 1DQTA 4PR5A 1CCZA 3MLZL 3IDXH 3U4BL 4LCCB 3BXNB 3VMOA 1J11A 4MHHG 4POYA 1PZ5B 2YPKB 5CEZL 1OCWH 1C12A 3JWDH 3GUTA 3U7YL 2DLHA 2EDJA 4WI9A 4UOJA 4OZIF 4PRHE 4JDVB 1MCWM 2W91A 1YQ2A 2A83A 1HHJB 1C5DA 3ARGA 4HC1L 5F72S 4LHUA 5TF1H 1BVLA 3D87B 4JQXA 5J12B 4MJIB 1W72H 4EUPA 2AJUL 4PJAB 3QPQD 1MLBB 1JTPA 1Z3GH 3HR6A 1MCIA 1AHWB 5AAMA 1JGLL 3JV6B 3RY6A 4RMSA 4ZSOB 2DYPB 2QSTA 3FB5A 3KDMB 1TJIH 4JHWH 1XCQB 4NGHH 1Q8MA 1QLRA 3OGCB 3VJ6A 4ZFGL 4OKVA 3ZTNH 1BEYL 1QSEE 1HHKB 5I18L 3C5ZD 1QLRB 4F80A 1GGBH 5KTEL 2XTLA 1J8HE 4RAHA 1NDGB 4XRCB 1PDKA 5IB2A 4EIZC 3LMJL 3W0WA 3TZVD 4AL8L 1DUZB 1NFKA 2E9BA 3F7VA 4JFZL 4K8RD 5T1LB 5EZLB 5IG7B 4D8PB 3VMPA 1CGTA 1IAKB 1QLFB 1GOFA 4IRSC 4PGCB 1YYML 2M26A 3CNKA 4ODSL 3QUKA 35C8H 4HS8H 2RAMA 4Q9QH 1CIUA 1JN6B 3H3BC 1DQJB 1MAJA 3KPSE 4QXTA 5HTSA 3GO1L 4KVCH 1IC7H 4QRRA 3R8BB 2YXFA 3IFNL 1RUKH 1KTDB 1ZWIB 3IDJA 4I48B 3WHE0 3QAZC 3QNYA 1GC1C 3CZFA 3TYGL 5D6CA 4QOKA 2Y07L 2D7NA 1DQLH 2ADIB 3QUMA 3MXVH 4YXHH 2X4NA 5T3XH 3ISWA 2BZDA 4OIAA 2D9QB 3G08B 1AHWC 5F9AC 3SE4C 4QXGL 1V7NL 4WGWB 5AAWA 4MNHA 4J1UA 3KPNB 4ZFOB 5D1ZD 5DJXA 5JIIA 2ICWB 3LH2L 2CIKA 1UVQB 2XI9A 4LLYA 3VXNB 3AROA 5IB3B 4G5ZL 1P7KA 5GRJL 4G9FB 2NXYD 5KAQG 3IDGA 1R24A 5SWZE 4F7MB 3VXOB 4XPHH 1UB6B 4M9OA 3GMLA 1TJGH 5CWSA 4WEUD 2ZZUT 1DEEA 3IETB 3BZFA 4TUKH 3RNQA 3SKUD 1R6VA 5KOMC 1RZIB 5FYLL 5HYSB 4KXZI 4M7JL 5J56B 3DOSA 2PYEB 2RQ8A 2R1WA 3BZDA 1A7RH 1N7ML 2EIEA 1KLFA 4YFLF 5HHVH 4BH8B 4BSVB 4YFDB 2HKFH 4XMPL 3ARBA 5L2KB 4RGND 4BSJA 1JHKH 5HGDA 4LHJB 2EXWD 2ZCKH 1OP5K 2X10A 1RK0B 4TOYL 1JGUL 2Y36H 4PJ9A 1XGQA 3HE6D 2Y6SC 2NW2A 2H2SC 3RPKA 1IT9L 3FO2B 5JIHA 4Y1AE 1DUZA 2IADA 2FX8L 4JFEA 2GKIA 1E4XI 3DECA 3H9HB 2E7LA 1MJ7L 3V79C 5J57B 5ICXA 2HVKA 2E7BA 1IEAA 4EXPX 1U36A 5DHXB 4R8WH 5AUMB 1MRDL 1T7VA 4EOWL 5TGBA 2VDPL 3VJ6B 3MRMA 4GUPB 1I3GH 4N8CL 4Y4FD 1YEJH 5I8OH 3PABB 5F44A 1F4WH 4OZHB 1NC2A 1F90L 3U0WL 4OD1H 4LLWB 1A0QL 2P43B 4TSBH 2JCCE 4F9LC 4MAUL 5HI5C 4EI6B 1ZE3C 2W9LA 2GEEA 1O0VA 4OGXH 2NW2B 3BO8A 2PXYB 4MA3B 4QTIH 1MCDA 4HPYL 5IBLD 1ORQB 3MRGA 4LSVL 5GGUA 2FWOA 3IFPB 4FFVC 4G8IB 3GIZH 5AUMA 3ZKQD 3QDMD 1FAKT 4IRSD 4J8RB 4POZC 2GFBB 3SCMD 1JUFA 2BSTA 2ATPB 4ODUB 3QUZD 2WUCH 1XMWA 4QY8B 2CLVB 1OP3K 4UNUA 5C71A 3LVEA 4R96A 3QYCA 4HWZA 1TJGL 4U6XA 1FIGH 3OJDB 4NRYA 3AFLA 2YD2A 5DRNA 3D5OF 1LMKA 3B3IA 4O2FB 4KJQD 4JFHD 1DDHA 5TE4H 3DTXA 3HC0B 3MOBL 1I3VA 3UXFA 2VISB 5HDQL 2JB6B 1CDBA 5C0FB 1KJMA 3BGMB 1KXVC 1NJ9B 2N7AA 4DZ8B 4OZHF 4MB5A 5CD3B 2CIKB 4G6ML 5CS7A 4LOUD 2ICWA 4F37F 3HAEB 3MV9A 2LAAA 3HRZB 3H8NA 3L7FB 4NHUB 2BXZA 3MROB 4OCRH 5I8KH 3MV11 2OBGA 2VLLA 5HI3D 4P5MA 4MVBD 2V9RA 4X6BB 3P0GB 1GC1H 2NY6B 4R6UA 1UVQA 3K4DA 1DCLA 1CFTB 3B9DA 4L5FL 1YMMD 4I48A 1DSFL 2X9XA 2Z4QB 4NN5B 1FFNB 4HXBH 4ZOAA 1OAQH 5IROC 1LO2L 5BS0B 4IRZH 2AXGA 5C0FA 1IGJB 1U8MA 3OMZA 2ZOLA 1P4LA 3QI9D 1AGFA 5GSVA 1NCBL 3PP3H 5F9OL 3UBXI 4K7PL 2EC9U 4XMLL 3WD5H 3QEQB 2Z8RA 5C1MB 3QUMB 4JZOA 4CW1A 2WSKA 4AT6B 2A9NL 3V0WL 1N6UA 3NH7L 2ZUVA 4CAGA 1YEGL 5HHOA 1B2WH 4HFWA 2EXWC 5DMJB 1VPOL 4R7NA 4X9FA 4HCRH 2BSSB 4YEFA 4POZD 3I6LD 3GDBA 3EFDL 5D8JH 4NQTA 4C83B 3MRJA 1A1NB 3UPRA 4YR6B 3QSKB 2XNAB 4Z7NF 1MFAL 1MJ8L 1OB1A 3KLHD 4E41B 3C6SA 3O4OC 3UCRA 4LCWA 1U58B 5CSGA 4H26A 5ID1B 1N59A 3HUJF 1AXTL 2COQA 5GGUB 4FA8A 4MHHI 3DXAE 5H94A 3S5LA 4JM2C 5CUSL 4NC2B 2H32B 4TVSa 3MZTA 1ZLWH 2WAHA 1XCQA 3ZDXE 1NAKH 1EERB 1M4KA 1HSBB 4XPGL 1CU4H 2HFFB 4HT1H 5T3ZL 4PJFE 5GZND 4QCIB 2OL3B 4XP1L 3UYOD 2D03H 3BPLB 3W0WB 4F3FA 4LF3B 2ZUUA 1LILA 4M61B 3PABA 4M7LL 1NGYB 2XG4A 5BW7C 3VG0H 4GQPH 4MNGB 3TJEH 3FFDB 3C08H 4NQCE 3QXVA 4PIRF 1KTRL 4K3GA 3HHRB 1L7IH 1LP9A 1P84J 5J3HD 5CEXA 1UB5A 5EO0B 1DQDL 3ROLB 3GKZA 3MCKA 4MS8C 5BQ7B 4KZEL 4J3WA 3M8OL 4RMTA 3BXNA 2GSIB 1OAZH 5JOEA 2BC4B 1JF5A 1RK1B 4LKXA 4KJQC 1EMTL 3U9UB 3U4EB 3S35H 5J9PB 1U3HB 4M48H 2HFEB 1AGBA 2ZSWB 4X8JB 1HH9B 2AQ1A 4PP2A 2E6QA 1YN7B 4NDMA 3IAPA 1VFBA 3DUHA 4AEIH 1ITBB 1NCUA 3H6JA 1FVDA 1NC4D 4MNQD 4OIIL 1L7IL 4DQOH 1F45A 4LSUL 2C3GA 3H9ZA 3C60C 5IWLA 1CFNA 1MRCH 1YY8A 4PRAA 4UNVA 1DLFL 1G9MC 5FKAB 4LSUH 2GITB 5F9WB 4O02L 3RVTC 5GISL 4MJIE 1ZTXL 3CVHH 2DTSA 2ZOKB 2V2XB 4X6EA 3KXFA 2DQUL 1C5BL 1QRNB 4F2MB 2UWEF 1A1MA 7CGTA 1JPGA 1WEJH 4ZS7L 1ZGLB 1WBZB 3DMMC 4QOKB 5C0BB 3ZHLA 3ULUC 3ARSA 3CZFB 4KKLC 1VACB 1J8HD 1EMTH 4Y4HA 4YHKH 5F3BB 5B39G 5IKCA 3W5NA 3GSNB 1OWRM 4AIZB 1GAFH 3LS4H 4A6YB 1U8OB 3SDYH 1FE8H 4AENA 3LKOB 3BIKA 4LK4A 5EO1B 4JCLA 3BKJH 4XI5D 1N4XH 2VR9A 3Q6FB 4JFQB 2Y5TA 3CFEB 4PJ7B 3WFDH 3RP1A 1Y0LA 4WUUD 5BQ7A 3D6GA 4FQ2L 3MCKB 2E6PA 4OGAD 1I8MA 4XP9L 1CGUA 3BJLA 2J1KA 3UJJH 4N0UE 1J1OH 1OPGL 4I0PC 3BQUB 5BO1H 5EUKB 1P7QD 5FK9B 1S9WA 4L3EE 5DD1H 4UB0L 4I4WB 1NC4B 1AP2B 4X6CE 5J13B 1SM3L 4L8CA 3SDAD 3PGFH 4PLJD 1A6VH 3ZDZE 1LGVA 4F15B 2OR8A 3VFOB 4XP1H 5CEYB 2RGSA 4F7EA 2O93L 4R4BB 5FGBA 1OGTB 4Q74A 4G6AC 4XPGH 2OMBA 1AO7D 2ZPKH 3U2SB 2YOCA 2IQ9H 5JOFA 4UUJB 5CIPB 4YDVA 4GRLD 5D2NA 3V0AC 1GOHA 3GMRB 5DO2C 3VGBA 5ANME 3MRPA 1D5ZB 1G7PA 5F97E 3S5LB 2DLFH 2HVKB 2VC2H 4LHUB 1G9NL 1JRHH 3FTGB 4V2CB 1MUJB 1C5DB 2IF7A 3G6AA 2VZ3A 4ZSOE 1A47A 4URTB 5D8JL 4PJFA 2J3SA 1HHGB 3K8MA 5DR5H 2DQTH 3QIWA 1CI5A 4LIQE 5J1AB 1GPOL 2ARWA 4HS3A 5EBMB 3MV8A 1HQ4B 4D2NA 3DX9B 1O7SA 5FUZL 1MCEA 3MUGB 2KH2B 3HI1B 3L3JB 1GOGA 4UTAL 3QUML 1WC7B 1CICD 3VGEA 4IM8A 1KJVB 3ELAT 3HMXL 1S7RA 4HKJA 4YDIL 4S2SA 2CKBL 1OD9A 3PQYE 3L7EA 2PYEA 1NCDH 4HXBL 1ZT4A 5CSBA 2AXGB 1AXSB 4U1IA 3HZKB 4IRZL 2I9LB 5GGVH 5FO9A 3W0WE 5J6HA 4YX2H 3ZMRA 2NX5A 1T7WA 5FKAA 3O3AA 3LKRA 4XCFL 4YXKH 3RTQA 4JVPA 3VXPB 1AY1H 2FHCA 4Y5XC 1CLZL 1JHTB 3DX7B 4XNYL 1DJSA 1TMCB 5I8KL 3RVTD 1KG0B 4K2UL 1TCRA 2YD9A 5ADOH 1ZHBA 5D1ZA 4F7CB 4L4TA 1GGUA 5LGHL 4OBSA 4OCRL 2BY3A 3Q5YA 4WY7H 1P5UA 4PLJC 1D6EA 1T7ZA 5C0IB 3OKNB 3ZTJH 3X14A 1I1FA 5JORA 1S7QB 4X7TA 4OZFH 1DLHA 3VFTA 4MA7L 1MJJB 3RDTA 3BI9X 3QXAA 4TTGA 2BNQE 4HIXL 3PIQB 5ERWA 1T2JA 5E00B 4LOUC 2JCCB 5LBSL 1PYWB 3CFDA 1Q9LA 5DRXA 2OK0L 3WHXA 3P0YL 3HTLX 1JF6A 3MRNA 1YEFL 4KZDH 5HI3C 4CGTA 4G6JH 4WW2C 5I76A 3MV01 4YXLL 3ARZA 5DFVD 1JN6A 1L0XA 5IFHH 2DF3A 4IOFD 2ATPA 5EFIB 3T0VA 2NX5E 3HC3H 4XMPH 1IRAY 5HHQA 1F3JA 3T3PE 4M62H 1CDJA 3UROR 3SE4A 5JPNA 2J4WH 4HIHB 1I8IA 1M71B 4JFED 3RJQB 4NZTH 4GAGH 1UQSA 3OAUH 5DJ2B 2E7CA 2XOTA 2OMNA 1IAOB 4ZOEA 3S5LG 4APQC 1MHHA 3EO1A 4P5KB 5EOQL 2BJML 2QEJA 4LBEB 2ARJB 5DXWA 2XACC 3IFLH 5L2KE 1AJ7L 1T4KB 3VFVB 5K9OA 3CXHJ 3FO9A 4J3OC 3U0WH 5B3JF 1FFOA 3VFSA 2AAVA 5MP6L 1MCHA 5HVHC 5L9DL 4XGZB 4OCXH 3F5WA 5ID1A 4I2XE 1ZHKA 4ZTPL 1E6OL 1E4WL 5J11C 3MPCA 1IT9H 4QWWC 3GHBL 1R5WB 2MTPA 4L4VE 4NNPH 3V6OC 4YHIB 1JGUH 1NMBH 2Y36L 5IFAH 5T3XD 3MXVL 2Q3ZA 3DI3B 1K9TA 3MRHB 3V8CA 5DFTA 1S7SA 4C56A 1MIEL 2HN7B 2J4WL 2UYLA 2SEBB 4P3DA 4XNQB 2DKSA 1EXUB 3GSWA 4KK8D 4OF8A 3GSOB 4LDOB 3A67H 4Y2DA 3VDCA 5F96H 4BH8A 1HQRB 2ZSVA 4JDZA 5ESQA 5KVGH 2BSSA 3TBVA 2XQBL 1JV5B 1JYXA 4G9FE 1JP5A 5T3ZE 1LP9F 1QR1A 2J12B 1AQKL 4MQXD 5LGKA 3LAFA 2R9HC 3QJFA 2P8MA 5TDOA 1QUNA 4TPRH 3GKWL 5FECA 4P5MB 3EFFA 5K9JL 1WAAF 4OM1L 4J3XA 5BRZA 2X9YA 4XCNB 4WI4A 2VLLB 3DV4A 3LH2H 4PJ5A 1JK8A 3TZVB 4QRTA 2X4OA 3VXNA 5IB3A 3VMNA 5ACLA 3V6FA 3QFJB 4LLUA 1XGTB 1HXYB 4MNGE 4N8VB 3ZYJA 3KLSA 2RFXB 2BNQD 1IGML 1FG9C 4LSRL 2VISA 2XKSA 5T1KD 3MLVL 1CFBA 3I3EA 5LCVH 3C9NA 3DTXB 3STZB 1HOCB 5D1XC 1AC6A 3KPRD 3MJ8B 1FDLL 1X5LA 3QQNA 3RZCA 1KC5L 1W8OA 1CD1A 2PF6A 4LCUB 2C26A 1K4DB 3GSNH 3MUY1 4RAVB 3O8XD 1V3KA 2V17L 2FEDC 4HF5H 1QPPA 3MV7B 4N0CD 5HD8C 2OR9L 4KK6D 3U1SL 3MFFB 3PGCA 5JHLH 1DQQB 1PEZA 3AREA 1HNFA 4QRPB 4ALAH 4L4TE 4JDZB 5ESQB 4AM0A 1BFVL 3NZHL 3CPLA 1H5BB 2QSCL 4JFFB 4TVPH 2NY5C 4P49A 3QDGE 4OI8A 4XPBH 5C0RL 2NY5L 3QWRA 1MREH 1PG7L 1RZ7L 1IAKA 3ZKXC 3P3YA 3KLAB 4YBLB 2ITCA 4CMMB 2E9JA 1KJ3L 2BHYA 4RIRA 5EC1A 3PQYA 1NGWB 4JRXD 1XR8A 4OZHA 5E4IA 5I1LA 5DRWB 1NGZB 4NQDE 2PR4H 4MCZA 2D7TH 3LS5L 3V4PH 1NCCL 2JE8A 1AXIB 1XGYL 5HHXL 1QRND 3IDMB 4ZFGH 1CWVA 2FHFA 5E5RB 3NCBB 5IROA 3K2MC 3O3BA 1ZKAA 5EU5A 1LDPH 1CZ8H 5I1KL 1IBGH 3QJHB 1A6PA 1RZGA 1KIPB 3UTTB 3UTSE 1JMXA 3RGVB 2HFTA 3DRQB 1L0YA 1DBJL 5ESAA 1XCTA 4LDLB 5KOVC 3MCG1 1DN0B 2YZ8A 4UU9B 5KBNC 4G7YL 2P45B 3MYZA 1LK3L 5HYEA 3U0PB 4P23B 4C59B 5D7SH 1MWAH 1L9NA 3D2UD 4UB0H 1J1OL 1OPGH 5FGRA 3CCHA 3EDFA 3SGDI 3FO2A 3IU4L 2JELH 4YQXH 1A6UL 5DJ8B 1JMZA 3LHPL 5JDSA 1CGSL 3L1OL 5HGGS 3EYFA 4MD5B 4DCQA 1G7IB 2BMKA 2E9WA 1CDYA 5ITFB 3PHQB 3GMLB 4AZ8A 4HLZG 1CGWA 1JE6A 4Z78A 2X6MA 1E4KA 4P4KB 1UWXH 5EUOB 1FNSH 3LS4L 3V6ZA 1KPVA 4WUUE 2WP3O 1QFHA 4LLYB 1PQZA 3O2DL 3OKYA 2FIKA 2QADC 1AQDB 4HXAL 3S34L 3TVMB 4K23L 4J12A 2AXJA 3V5HB 2YN3A 1OM3H 3B6SB 5CBEB 3VXUB 4DN3L 5CWSB 4F58H 1CICC 1W0VA 5E4EC 3D39B 1DLFH 2ZP0T 1T5XA 5I1HH 5DVMA 2XRAL 5GISH 3LPWA 5ISZA 5BVJA 4M6OL 3T09A 4UOW1 2ENYA 2XRAH 2I9LA 2J6EA 5T1DL 1J12A 2CQVA