3QXUA

Free structure of an anti-methotrexate cdr1-3 graft vhh antibody
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
b'QVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDKGKNTVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Methotrexate CDR1-3 Graft
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 29
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxuA00
3QWOB 2M8XA 1UACH 3EJJX 4HHAB 1EAPA 3NFNA 2CIKB 3CSYA 3NAAH 4WY7H 2C7UB 5SWQA 5J3HD 1MAKA 4HWEL 5JO5B 1BEYL 4QXWA 1AD9B 2A83A 5MERA 5ICXB 4DFIA 3MRMA 3BI9X 3HB3C 1YY9D 1R3KA 5B8CB 1ZHBA 3WS3B 1NFDE 1IVLA 3QUKB 3LH2H 5HTSA 5EO1B 4JFFA 5T5FH 1B4JL 1CGSL 2PXYC 4HC1H 1A14H 1MRCL 1E4KA 3CFIC 4IIQA 4NBXB 3RZCA 4K2UL 4KPHH 3OXRA 5EU5B 4P59L 4X5LA 1G0YR 3T1FB 4OD2A 1JVKA 3S34L 4KZDL 1KG0B 5D1XD 2DI8A 4WV1A 3VFMA 2WAHA 3BP7B 4RZCA 5CD3A 4ZS7H 4FABL 2QR0B 3WIIH 4XMLL 2RJMA 3OKMA 4JR9L 4NDMB 2FSEA 5IOPA 5ANME 5HYJB 2EEDA 1YECH 4YHLL 4MB4A 5DUPH 5D1ZB 1KIRA 2GTWB 5TFSL 1ZHNA 3DYPA 5HHOD 4ODSH 4LSSH 4XPBL 3GZKA 2Q8BL 2I5YL 1A1MA 3SDAB 1N59B 3CDFA 3WFCH 4X6DA 4YPGA 1F00I 1FNAA 4YO0A 3KLAB 4PJEA 3ARZA 4S11A 1JPSL 4LCWE 4PY8J 3FZUD 1WICA 4CMHB 3GSVB 5FM5O 1DANT 4LOUC 3A6CL 4WUUE 1F6LL 1CFVH 4EI5D 3ULUE 4L4VD 1N4XL 2FO4A 3RNKB 2PTUA 4NN7B 2A9NL 3NN8B 1AO7E 3UTQA 4WFGE 3CGTA 2C1PA 2WM0A 1QBBA 1AGFB 4N0UB 4U6TA 4JPKH 4TPRH 2FB4L 3LS5L 4JB9L 5E08L 4QRSB 1NCNA 1J8HD 3H6JA 4YXHL 1E4WH 2P42B 5C0GA 5DEZA 1I8LC 1BX2A 2XQBH 3DSFL 1YEJH 1I9IH 1TJIL 1JF1B 1IL1B 3WXWH 4CL7A 1DL7L 2HRPL 1YY8B 4EDXA 1EXUB 4L3CA 4GRWF 4PYGA 5DJYA 4EKXA 4MJ2A 1IQWL 4NZTH 3MJ9L 2PYFA 3TYFA 4L1HA 2GFBB 3SDXB 1KCSL 5EC2B 7FABH 4JRYD 1BZ9A 2ZZUT 1QBLH 3C5ZB 1XMWA 2DQCH 4NFBA 1QBMH 3SGKA 1VDGA 1AGDA 3BQUD 3P9MB 1ZXQA 3MJ7A 5EA0L 3FQWB 3RI5K 1MEXH 1A47A 4RDQG 2Q76B 1AKJB 5IR1B 5DJCA 3BFOA 4MJ5A 2XY1A 3M17B 3OGCB 4Y7MA 1PSKL 2VLLB 1R3HB 4RMTA 4WUUB 4J23A 3W11D 3SGEH 4BSVA 3PG2A 2ZOKB 3WSQH 1JBJA 4YBLB 1RZ7L 3EZJB 4FOMA 1H5BB 4UT9H 1HINL 1JN6B 3OX8A 3OKLA 4NZUL 5KAQG 4U31A 1CT8A 1KYOJ 1RUPH 2VE6A 4G43B 4FMKA 4OJFL 5AWNH 4UT6H 3WDHA 5B39A 4KY1H 1RU9H 4JY5H 3WJJC 2XOTA 3OKNA 1BIHA 1I7TB 1T1ZB 4MWFA 2J3SA 4OFIA 3VFNA 3K1DA 4J4PD 1MJ7H 2B2XL 2EDXA 2BMKB 3RNQA 3DUUA 4U1GC 4K3JL 5FHAH 4CN4A 4OGXH 4PJBF 3MV7E 1MFCL 1LEKB 1NGXB 4JGUA 3T77A 4AEIL 4G8GA 2BCKA 4S1DC 2I24N 4PLKD 3NCYP 3KS0J 5DEGA 3O6FB 1ZVSA 2PTVA 3JTSA 4AEFA 2DQDL 1F3DH 43C9A 3FKUS 2OR7A 4G8EB 5DJ6B 3ZKXB 3VXUE 1T0MA 5KVDL 1UXWA 4JRYE 3MRBA 2V5RA 3UC0H 1WFUA 2ZSVB 4OQTL 2R0WH 3VXPA 1NKRA 5J12C 5BZDB 3ARGA 3H7BB 2OJEB 4X5WA 2XZQL 1KV3A 3IAPA 2BK8A 3SKOA 5HHOB 2X41A 3HUJE 5F1SA 2G5RA 3SDDD 1G9ML 1UWEH 2BSED 2P8MB 3ZTJH 4E9LA 3VFUA 2DM3A 2ADIA 1GGIH 1W72B 5GJSH 3CSPA 1P7KB 4XBEH 3CU7A 5JR1H 5L9DL 4CUCA 3VE0A 1C12A 1N26A 1KXQE 4X7SH 4L4VB 5FHBH 1MCPH 3R06A 4HFUH 4FN0A 5F7HA 1LHZA 4K7PY 1BFVH 3ZHLA 4TUKH 1P9MA 2R8SH 4P3DA 3HAEH 4NQVB 1KNOA 4NYLA 1ZV5A 1U0QA 4QHNA 3QDGD 4NRYA 1GAFH 2O5XH 3BH9B 1J8HB 4G7YL 3IDGA 5DVOA 1JNLL 2AV7B 4LSDA 5ACLA 1BQHG 3MFFA 3NA4A 3LZFL 5A2KH 4P99A 2HP4A 1Z0NA 4HZAA 2OQJA 5I74C 3EKCA 5HSFA 1NEZB 5BXFB 5C0JA 1XF2B 1TJHL 1VGKB 1U8IB 4ZYKB 3QUYB 2D7QA 5T1DH 3CZJA 1Q72L 3K0WA 4BKLA 2MCPH 4EXKA 3FRUA 1VEOA 2UWEB 1MRFL 1GC1L 2FH6A 4JFQA 2NY0D 4JRYB 3FO9B 4P46B 1F42A 2QL1A 5D70L 1YNKL 5D5MB 5CWSB 3UYRL 4KJYB 1MHHA 1ZLWH 3U0WH 4TULL 3STBA 3BQUB 2FX9L 4KXZI 2BXYA 3HUJB 4FP8L 4L3AA 2R4SL 3FTGA 3WXVL 1EFXA 3EBAA 3GMOA 4GAJH 3MTRA 4KHXH 4UQ3A 5F7WC 4ZNCD 1D5ZA 3MRKA 4QRTB 4XPGL 3ARRA 4N0YH 2IWGA 4QKXB 4CU7A 3TT1H 1ROWA 1XF3A 4JY4A 3G9VA 2VXQH 4S1QH 1LO3L 2HVJB 4XBGB 1CDBA 2GY5A 1U8OA 3WN5B 1ZT1B 4FQIH 4LAJH 1JYNA 2HH0H 3LHPH 4NQED 1OAUL 4XAKE 5J1SC 3QDGE 2H45A 5J6GB 1UB6A 2R1WA 3FQUB 1PD6A 1XGTA 1ZTXL 2DLTA 5C0ND 5INCB 3BP5A 3LKSB 1LO0H 4HIXH 3QI9C 3QG7H 3MLYH 4L4TE 3QIWA 4EQ3A 5E1AA 4DKAA 5JPNA 2AV1B 5FCUH 2FL5A 3B2UD 4J3SA 4Y4HA 5CBAA 3HPJB 4AH2B 1IGTB 3IETA 4JFYA 4WI5A 2X4UB 2R9HC 4HMDA 2NY6B 3CFEB 4YNYA 5JW3L 1LP9E 5JXAH 3NFPB 1F58L 1M6OA 2V2XA 5I0DA 4JAMA 3T2PA 5T3XD 2HG5A 5D2NA 2E7LC 5IW6B 1ZT7B 3SDDB 3AM8A 5FYKH 1Z9OA 4XX1E 5DJAB 5CD5D 1TZHB 4MNQA 1FZJA 1JWUB 4Z7WB 2H41A 4UINH 2PW1B 4OTXH 2X9WA 4NP4H 2IPTL 3UBXA 1NAMH 2F19H 4BQCA 5C2BH 5C0FB 1BD2E 4HIEB 3UPCA 2R0LL 4NRXB 2X70A 3S6CA 5KTEL 1S7VB 1I7ZB 1TCMA 3L7EA 3QCTL 4WI6A 1WK0A 1L7TL 1CU4L 4NQEE 1RQ5A 4ODTL 1KELH 4OLZL 1IAKA 3BZDA 1D5XB 5DA4A 2XNAA 4I9WD 4C59B 3G9AB 4DCQA 3VFSB 5I9QB 4B0MM 2HA1A 4R7DB 5EIIB 1NBVH 1MJ8L 3LQZA 5AZEH 3F6LA 1OQOA 3PHSA 5I8OH 5BO1L 1NCDL 1V7ML 1ODAA 5J11C 3QXUA 4TOYH 4UTAH 3H9HA 4MAYC 5I1HL 1EDQA 2CR6A 5KW9L 4UQ2A 4WCYL 1IM3A 2DMKA 5EWIH 3CMGA 4HIHA 2WIMA 4APQC 5HGAB 1QSZA 4HUNB 4KKCD 3LEYH 2J1KA 3LIZH 3GKZA 1KLGA 2W9DH 1TMCB 3LB6C 4B53A 2YPVL 4PJHA 4K8RH 1XIWC 5HI4C 1U9KA 4PJIA 1EEZB 4OZFA 4M5YL 2IMMA 4JG0L 4JO1L 3ARFC 3KYKL 4L3EA 4WGVB 1I1FA 4CRPA 2AXFB 3EYUH 3RVTD 3ETBF 4NQEB 4WU7A 3P2TA 4HULB 4JPVL 1XF5A 3OBAA 2PKDA 4ZUUB 2GJ6D 3L5WA 4MLSA 5I1KL 1FV1A 4ZTOH 4KQ4H 2P46B 3E3QE 4Y5XC 1NMAH 5C0EB 3WDJA 1SY6H 2SEBB 4GW5B 3V2AR 3WLBB 2BX5A 5JNYB 3JZ7A 4PGEB 5BS0A 5BZWB 4X4XA 2NLJB 4PJCE 3ARED 3FHQA 3BXNB 5LG1A 4IMKC 5I30H 1MWAH 4HG4J 4GBXD 4CVXB 4YDLC 5EO9A 5CFHA 3PXHA 1JZ4A 4RNRA 1M05A 5DK2B 1BVKB 2R56L 3AY4C 3O2DL 1A6ZA 1UCTA 3K4ZA 4I0KA 1CK0H 3VG0L 3MXWL 4LSTH 4WDIA 5HHNB 4DVBB 1C08B 4EXPX 1SEQH 1MRDH 1UQSB 4P23C 5C9JA 2YN3A 4IDLA 4OCXL 3VXRA 3MRRB 3F62A 3D3VD 3EYVA 3H9SA 4XVJL 4L8SC 1PYWA 3DPBA 1MF2H 2ZUQB 3JVGA 4N0FA 4JJHA 2A77H 4NNXB 4K3GA 2F5AH 1XGUA 3OHXB 5F3BB 3ZE1E 4LCCC 4QO1A 4NM8H 3QJHA 1A6UL 4TUOA 5IMOA 2EDBA 1LEIB 4XNUH 2XRAH 4JKKA 4XXDB 3NPSC 1ONQB 1XF4B 2GJ6E 4OGAC 5GRJL 1T1YA 3CDGA 3WUZA 3J7HA 3INUL 1ZHLA 2W07A 3QHFH 3NMEA 3QRGH 4WVRA 4DVRH 3C6SA 1HHJA 2F9BT 3DX8A 4WFFD 4Z78B 5KJRH 3EJYD 1AR1D 1J0IA 4CVZB 5I8CB 1H3XA 3ZDZE 4MX7A 4NO3A 4M00A 5DHYB 3UPRB 1VHPA 2W1NA 4LU5H 2EDQA 5ESQB 2BVQB 3HCVA 4IHOA 2W9LA 5C6TL 4UT7L 4Y16D 4NNYB 4UI2A 3CH1B 1IT9H 1A5FL 4GQ9H 1C1EL 3WFEH 1EO8H 1MLCA 4U3XA 1HQ4A 4LIQL 1FN4B 4UV4L 3VGFA 1V8HA 3MYZA 4FTVD 3KDMA 1S3KH 2C3VA 2C3HA 4RFOH 1IGYA 2DBLL 1GZQB 3EO1B 3WL9B 3ZL4L 2YXFA 1OP5K 1AH1A 2UYLB 3D3VE 4O5LL 4JQVC 3X3FL 3BGFC 1CFQB 3VXMD 1ZLUK 3S3JA 1TFHA 2VL5A 4NQXA 5HPOA 1HZHL 5C07D 3X14A 3EOAA 3B9DA 1NDGA 1OTUD 4Z0BH 4N9GB 4AQ1B 5ICZA 3L7FA 1T21B 4R4BB 3DX9A 3GBMH 4HBCH 2JB5H 4JGJA 1EEQA 2NW2B 1IGMH 1FHGA 4L9LA 3KAAA 4XP5L 5ITFA 4JN1L 4M93C 3NZHH 4RWYH 4MJID 3BPLB 5LBSH 1YPZE 5EORL 3JUZA 1PZ5A 2R23A 1LE9B 4PJ8C 1NFIA 2YN5A 4GAGL 4HWEH 3C09C 1MNUH 2Z8RA 1F2XK 1BEYH 3AREB 4C4KT 5IQ7H 5KSVA 4NQSA 1E4JA 2AS5M 4M7KL 3IDJA 3MLPA 1I85A 2FD6L 2H8PA 2G75B 2IF7A 4PRNB 1MFEL 3WNNA 4P5KB 4I5BB 1D5IL 1CD1A 4L5FL 4L8DA 3MRGB 1IILE 1B4JH 3U46B 2FJFB 1CGSH 5DQJB 3ZE2E 2I07B 2EDWA 2GAZA 3SGEI 1MRCH 4FQJL 4K2UH 5AD0A 3DUHA 4YEEA 3QWRD 3C60D 4P59H 5HI3C 1BJ1J 5GRZA 2EDOA 4FTVE 4PTUB 1YMMA 5B3NA 2HJFB 3S34H 4KZDH 3D3VB 4M8VA 3RJDA 2MTPA 1WFOA 5GS1C 4FABH 1LMKA 4XMLH 3KPNB 5DF0A 3VG9C 5E00B 3RKPA 1VFAA 1OB1B 2ESVA 4JR9H 1RUAL 1EPFA 2Y6SC 5F7EL 3IKKA 3RY6C 1I3VA 1TCRA 3TO2B 3GI8L 5F9WC 3OJDB 5C07E 4L8CA 2YD8A 3N06B 4YHLH 2CRZA 1X7QA 5E2TL 5TFSH 3CFDA 1A7NL 4XPBH 2Q8BH 4MXQC 5DHVB 3BX7C 4JO3H 3BGMB 4HFWA 4RISL 3EOTL 1JPSH 1QSVA 2VKXA 1YPZB 4LDOB 2BDNL 3T3PF 3A6CH 4MJIE 5D7SL 1N4XH 1PJ9A 2UUDK 1J1PL 2OX5A 3X3GL 1OGTA 2A9NH 4UV7L 4BQBA 3SO3B 1Q9WB 5C6WH 1JV5B 2VQ1B 4HW6A 2DWEB 2CO6B 4ORGB 5JHDB 1JYVA 3HI1B 2FB4H 3LS5H 5E08H 3QQ9C 3I9GL 3HTLX 4YXHH 1OL0A 1OTTD 1VADA 3TIDB 1GC1C 1ORQA 2ZCLL 4PJXE 5EC1B 3VA2C 4UB0L 1UZ6F 4FQ2L 1IGJB 3O9WA 2R39A 2FYYA 1A6AB 1TJIH 4PFEA 4OUUA 4PBWD 1DVFD 1DL7H 2HRPH 1J5OL 2A74B 1KTKE 4NO2A 1NC2D 2XIDA 4FTVB 3VXTB 1DBBL 3KPRE 4UIKH 3ARPA 4JFXB 2VABB 3MJ9H 1HHKB 1IEBB 2F54D 1MY7A 3CAFA 4NKQB 1Z5LA 2WIIA 5A40E 2R0ZL 1SBBA 1KCSH 3BDXA 3VXMB 4IM8A 1CICC 3CFCH 1T1WB 5FYJL 3Q6FB 3R8QA 3PV6A 4XPAL 3RVVC 3WEXB 2ZP0T 2CDFB 1OCWL 2OTWA 4GG6F 3A6OA 2OSLA 4TTDD 4UOJA 4QTHA 1JZ8A 5HYSB 5EA0H 2F74B 5BW7A 4S0SD 2Y72A 1RK1A 1EZVY 3LDBB 2HWZL 4LF3B 1CDHA 3FONB 3RUGA 1IGFL 4MJIB 2KH2B 3HR6A 2OI9C 3GFUA 1FSKB 1MCCA 1RZ7H 5F88B 5GXBB 3BRGC 3T0XA 2FZ3A 4NZUH 2FECL 1S9KC 3VWKD 2C3WA 4ZS6C 1IKNC 2EC9U 4G9DB 4I4WA 3FOMA 4M6NL 3AS2A 4LMQE 4TQEL 2VISB 4YGAB 3TC9A 3V52H 3JV6B 3L3GB 1VA9A 2VUYA 2ICWA 2FJGA 3BP4B 4K3JH 5E0QA 1NUGA 2JB6B 4JFPA 4YAQB 5FFLA 1MFCH 2X40A 5DYOA 5IG7A 2X89D 4AEIH 1OQXA 5F9OL 2X44D 4KJWC 3C60B 4LRNH 3U82B 2DQDH 3D25B 3PIQB 1JNHA 1R24A 2F58L 4XNZC 5I66B 3H3BC 4ZUVA 1AJ7L 3GB7A 5KVDH 1L4IA 1JHKL 5T1LD 2H32H 4OQTH 1BP3B 5DRZA 3KYOB 1BJ8A 3VFWA 4N8VA 5LWYL 2VAAA 2XZQH 5F21B 3UAJC 2VNCA 3DETD 5JPMA 5E2UL 1G9MH 4D0CA 1EJ6A 4RSVA 4PG9A 2CH8A 4MDJB 1WZMA 2A2QT 1CGTA 3PWJA 4H26B 4GJTB 4G9FD 1RZFL 2EDTA 5C7XH 5EBMA 1Q0YL 1HNFA 1I1RA 3V4PL 2XQYG 3NH7L 3MOAL 1CFNA 4EI6A 4KRMB 1FIEA 1MCWM 2DL9A 3T4YA 1T3FA 2CLRA 2FGZA 2W59A 3AUVA 3C8DA 1JNLH 3QUZB 3BPOC 3MRNA 4ZFFB 1A6PA 3I3BA 2ITCA 2QTEA 3VFVB 2J88L 1DVFB 3UJIL 3RWHB 3MLZL 4LARL 1NC2B 2PXYD 5J06A 5L8LB 3V5DA 4F3FA 3S7GA 4RWHA 1Q72H 2F54B 3RDTC 5EBLB 4XAWL 1OF2B 4LKCB 3CH8A 1MRFH 3P73A 1GC1H 1GPOL 4HKBB 2YZ8A 3WCYA 5D70H 1YNKH 3IU3A 3QCUL 3MNVB 4R0LA 1QA9B 3UYRH 1N3NA 3ECBA 7CGTA 4TULH 4JZOB 4MA3A 5L7XL 2FX9H 4FP8H 5B4MD 1PEWA 3WXVH 5DQDL 4KI5C 4GMSL 3TBVB 1AXSB 3ZKSD 2WQRA 4LSQL 4XPGH 4JM2F 3HE6A 2Q8AL 1F8TL 5L0QC 1FGNH 4G9FE 1IRAY 5J4MA 3IFOB 3RP1A 4LOUD 2EYTA 3SE3A 4MD5A 2J8UF 1YC7A 3NABL 4PTTB 5TDOA 1L6ZA 3VWKB 3PABA 4GG6B 1UJ3A 4P2OC 4YLQT 5FA4B 4I2XE 4NWUH 3EYOB 4XNMB 5HVFB 3ZDXF 3KYMB 4E0RA 1UB5B 3RIFK 5FGRA 1XR8B 1ZTXH 4MA7L 3VD9A 4L29A 1OSZA 3O8XA 4HUVB 3RGVA 5IFJB 5TH2A 3RVWC 2GTZA 4Y88A 5LAXB 1YEDB 4LNVA 3BAEL 4L9DA 2ZPKL 3VU2A 2DWDA 3QWOA 2HJKB 2H2PC 2YD2A 3B3IB 2LAAA 2CIKA 2C7UA 5FOBB 4ENED 4MD4B 5JO5A 1NCBL 5DT1L 5JW3H 2Q7YA 3WO4C 1NFDF 4F9PA 4HLZG 5T1LB 3MC0A 1AD9A 4FFZL 1F58H 4MS8C 4ODXB 4N5EC 4WHYH 1AQKL 4GRLC 1M71B 5EZOH 1FQ9C 4NC1C 2DLFL 1H3UA 5J8OA 1RURL 3QJFB 3STZB 3I6LD 2BRRL 4FQXB 4ZO6A 3QUKA 3T4AB 3O3AB 1QLFA 2C5DC 1U8NB 1RUMH 4KRNA 5GRYA 3MR9B 2C26A 4XWGL 1N5AB 2GSGA 1LE5A 3NIDE 5EU5A 3BSZL 4Y8DC 1G1YA 2O5ZL 3HS0B 3T1FA 4DKEL 3K46A 1AY1H 2IPTH 4OLEA 1KG0A 2DIJA 4JM2A 3RIAK 3QIBD 1KEGL 5GZOD 3BP7A 4GAYB 1QYGL 2QR0A 2R0LH 5FCSH 1PY9A 1HYRC 4U1NA 5KTEH 3JXAA 3IJYB 1AXIB 5HYJA 4WI8A 3QCTH 1L7TH 4NQDA 5DJ2B 5BRZE 1ITBB 1CU4H 2ATPB 3K80A 4ODTH 5D1ZA 2GTWA 4OLZH 2RBLA 4EUPB 4M4RA 4S2SB 3REVA 1Q9LB 1P5UA 4JZNA 4LDEB 4M3KB 3Q5YA 4H0HB 3CD4A 3KLAA 3NACL 1MJ8H 2PXYB 1F45A 1JRHH 1MJUL 3MROB 2AJUH 5BO1H 4X0KB 1WEJH 2B39A 4S1DD 1NCDH 5B39G 3GSVA 1V7MH 1P7QA 4PY7B 2JJSC 3IF1A 5I1HH 3NN8A 5KW9H 3HMWL 4WCYH 4NQCE 3OPZL 4ONHB 3B83A 2DQIL 4QRSA 5JDSA 1RFDH 2CKBL 1Y6KR 1ZLSH 5MP6L 4D9RD 2DB8A 5D7KD 1UYWL 3I6LE 3NFSL 5DC9B 3QEQE 3U4EA 3MRLB 1JF1A 1IL1A 1AIFA 4NC2B 2YPVH 3SKJL 3GIZL 2MKLC 5CSGA 4JKLA 5FF6B 1NLBH 2HLFC 2KL6A 4QRPD 4LFHG 1DQLL 3K2UL 3SDXA 4M5YH 4JG0H 2E9BA 4JO1H 1DANU 1RD6A 1TQBB 3KYKH 1GCFA 2WWKO 4RA3A 3C5ZA 5F6HJ 5IVZB 4HK3N 3MRCB 4JPVH 2QSVA 3OV6A 2D9CA 3FQWA 4PB9L 2DLEA 5E5MB 1AKJA 1AC0A 3FO0L 2BY3A 3OGCA 1P84K 2IALA 1H3VA 1X5KA 1OTSC 4WUUA 4X99B 4RQQA 1NGZA 3X13B 2J8UB 1N0LA 5E95B 4LLYB 1PKQB 2WBWB 4CGTA 4XRCB 1JN6A 5DJ8A 3GSOA 4ZD3L 4O4YL 5MI0C 2GCYA 5FXCH 1CBVL 1HI6B 4MAUL 2FBJL 5A1AA 1CGYA 4DUWA 4NKDB 3GHBL 4Q9QL 4LSUH 1T04B 1MCFA 1S7QB 2ADFL 5GS0C 4XNYL 3D5OF 2R56H 2R2BA 3O2DH 4YFDB 5CIPH 3VG0H 2AKRB 3MXWH 3S5LB 4Y4FD 4X6FA 3BN9C 1LEKA 4JANB 1NGXA 4OZGF 5D7KE 3GSXB 3QHTC 3MPCA 3UTSE 3FB7B 3AVEA 4KKLC 4OCXH 3T0WA 3SBWC 1BBJA 3P11L 5D1XA 4XVJH 3QIBB 4R26H 4PD4K 3IDMB 3R0NA 4NQTA 3EDEA 1VEMA 4X8XA 3DVNB 3DO7B 4LQFL 5AAWA 2ZSVA 1KFAL 1A6UH 4U7KA 5BZDA 3H7BA 1UZ8A 4ZUTB 2LQRA 5K93A 1ACYL 2BVOA 5A43C 3T2NL 3WHE0 3TV3L 4U1GB 3C8KA 2UZIL 1DQQB 3UTTB 1BGXL 5GRJH 1UFUA 3RL2B 1Y18A 3QI9D 4KK5C 3INUH 4XHJD 1P7KA 5ICYA 2H26B 4NFDA 4QXGL 1NBZB 4WHTB 3QUXC 5EG6C 4EI5A 3GSRA 4KHTL 4BFIB 4L4VA 1QFUH 4IRSC 3E2HB 3O3DB 3H9ZA 3BGAA 1LDPL 1TXKA 3GMQB 3BVNB 2M1KA 2R9HD 1HXYA 1G6RA 3RVXC 3I2CL 5C6TH 2P49B 5IFAH 3BH9A 1J8HA 3JV4A 4UT7H 4F57L 5KVFL 4MHHI 1UCBH 3NIFE 5J12B 4HPYL 4FXKB 1A5FH 1Y6MR 3MV7A 3WE6B 1OLZA 5D93C 2HTLC 4K3HA 5FK9A 3C6LC 1UJTA 4LIQH 4UV4H 1FO0B 3VJ6B 2VYRE 2DBLH 5HDBE 3GIVB 3ZL4H 4QRPB 2WSKA 3MNZB 5JMOC 2FNBA 1SJVA 4O5LH 3X3FH 3A6BL 2UWEA 1KIUA 1J12A 4DOHB 4JRYA 3FO9A 5EBWA 1XEDA 1H8SA 5J1AB 1HZHH 1DUZB 5D5MA 1X5FA 4KJYA 1KT2A 3JV5A 5H94A 1X9QA 3BQUA 1R3LA 4ZFOL 1MCKA 3HUJA 3P77B 4X5XA 5IBUB 4XNXH 1JI2A 1QPPA 1ZA3B 2J12B 4IBLT 2PN5A 3TNMB 1VEPA 1FNEA 3UBXG 4QHKJ 4JN1H 5F97E 5HHMD 4DK3A 4A6YL 1AHWA 5I74B 5EORH 1MCSA 2GKIA 3D39B 3L9RB 4O2FB 4GAGH 3FB5A 5GGUA 3GRWA 3DGGB 1E4XL 3OL2A 4M7KH 4XBGA 2OK0L 4MAYD 2Z93B 2FD6H 3VFTB 5E8EA 4DN3H 3RA7H 1DR9A 3DROB 1N5YL 3HI5L 1MFEH 1GHFL 3MGOB 5J6GA 1D5IH 3FQUA 4APQD 5C1MB 5INCA 4UAOC 2VZUA 4Y4FB 3SKMA 3DVGA 3OKYA 3AXLB 2VKWA 1JE6A 4FQJH 2E6QA 1H3PL 3LB6D 2AV1A 4PRPD 4MSWB 2XWTB 3QDJE 1LP9F 3HR5B 1XIWD 3HZYB 3QO1B 1IGTA 5HI4D 5AZ2L 4Z0XB 3WD5L 5KBNC 2A6KB 1QSEB 3CFEA 3SEPA 1FG2B 2ICWJ 1RUAH 4BQ8A 2D03L 5F7EH 3QXDB 1D6VL 3NFPA 3BD5A 5E03A 2R1YB 3ARFD 3GI8H 4I13B 2LE9A 2BFVL 4AEEA 1TZGL 4P2RE 1A7NH 5IW6A 4FXGB 5FGBA 4NOBA 1ZT7A 3SDDA 3O3EB 4ZMAT 3IDNA 5DJAA 3HNSH 3EOTH 1TZHA 4ZPVB 2OZ4L 4PRDB 1JWUA 3QI9B 4Z7WA 1MWAB 1YJDC 1OGAD 2BDNH 3TZVD 2E7CA 1K4CB 5HHME 4HK0A 3JWNC 4OFYD 5HHQB 5D7SH 1BLNB 3KLHC 1X4YA 2BY0A 2VZ1A 1J1PH 3X3GH 1U58B 4UV7H 4HIEA 3U2SB 3QFJE 1C5DA 5D7IE 1XZ0B 2VDPL 3I9GH 1I7ZA 3QDGA 2NW3B 3RJQB 4DW2L 3ZHKA 2CK0L 4HWBA 3BWUC 5CINH 3F7YB 2ZCLH 1CLOL 1KN4L 2KZ1B 4FQ2H 1D5XA 3PP4H 1YEIL 4L4TA 3EZ8A 3VXQB 4AIXA 2RR3A 1J5OH 4KROC 2D7TH 3GO1L 5JHLL 5EIIA 4W68A 1QO3B 1DBBH 4W6XB 4P23D 5C09E 1NPUA 2PF6A 3RWIB 2WMPA 2R0ZH 3U1SL 2FATL 4F9LC 1SMOA 5GSVB 1U95B 5FYJH 4JY6B 4XPAH 5DD5L 2B7DT 3P4OA 1OCWH 4BM7A 3P0VL 2WLYA 2BVPA 5HHXL 3VD5A 5IIEB 1S7UB 3FCTB 2B1AL 3GMPB 1F4WL 4RIRA 4YUEL 3QSKB 2HWZH 1OD7A 3DTXB 3R8BB 5AG9A 5CZVH 5EUOE 1T83C 3IGAA 4OGAD 5H37G 1H3GA 2V7NA 1OGAE 5KSAD 1DCLA 1CXFA 2QSQA 3GSNH 4L4JA 4I3GA 5L2KD 3LSOB 4TNWF 4X6EA 1A9BB 1TETL 5J11B 2L4OA 1KYOK 4XCYB 2WUBL 2EH8L 4MAYB 4WIQA 5D7IB 1X5LA 4UZGA 2AXFA 3I75B 4M6NH 1AP2A 4TQEH 1DQJA 4NQEA 3HZMA 4LRIA 1YEEL 5ABDE 5C8JB 4WI2A 4APQB 1HILB 4ZUUA 1HHHB 1QKZL 2XT1B 2E27L 5F9OH 3W9EB 1EIBA 1MFAL 4O51A 1QUNA 4PRPB 4D3CL 2SEBA 4GW5A 1XIWB 2JELL 3G08B 3OTTA 1F02I 5JNYA 5DUML 5CHNB 5HHPB 5BZWA 2F58H 3N1MC 4QTIH 2NLJA 1NAKL 1DN0B 3BXNA 3CC5B 3I50H 3NZ8A 1NGYB 5DJZB 3ARFB 3HC0A 5LWYH 4MYWB 5C3TA 2BSRB 5I19H 4PJAE 2VR5A 5DK2A 1BVKA 1JPST 5E2UH 3DIFA 1I9JH 5BVJB 3FFCD 32C2B 4JFHD 4HS8L 5I1GL 5HHNA 2ZCKH 4XP6L 1UXSB 1UQSA 5JW4Q 1OGAB 1K5NA 4TRPL 1RZFH 2VUOA 3CXHJ 4Y5XB 3S37X 4XMPL 4I1NB 3TO4C 5FAAA 3V4PH 1UA6L 3NH7H 2IQ9L 2C4FU 1VGEL 1XCQB 4KKAC 4QRQB 4V1DE 5L2KE 1R0AL 2G2RA 4PRIE 5EZLB 2AK1L 1KB9J 1K8IB 4MQXD 4NNXA 1RMFL 3OHXA 3RWEB 4PIRF 4YDLB 5D7LE 2XZAH 4R90L 2Y25A 1LEIA 4OLXL 4ZUWB 1RIHL 4XXDA 4JRXD 3SJVD 2J88H 2R4RL 1BFSA 4JREC 3UJIH 1ONQA 1XF4A 3MLZH 4LARH 3STLA 4DQOL 2F15A 4P23B 3ZDZF 1OWRM 5EIQA 1RHHB 5HVHC 5ID0B 5I1DB 5HI3D 3BMWA 4PJCA 2XWJA 4Z78A 2NCMA 1GPOH 4C56D 4ETQB 5L6YL 4GKZB 3IDIB 4CVZA 4LLDB 4L8SB 4H88L 3TA3D 3SKNA 3ZKMC 3QCUH 2PO6D 3OAZH 4PJ5D 3ULSB 1V05A 1CLYL 5ESQA 2DJUA 5L7XH 2BVQA 1P6FA 3HPLB 5HGGS 4NNYA 5E6IC 1C5CL 1BJMA 4FZ8L 4GMSH 4HDIB 4ZNEE 1JRHI 2B1HH 4YPJA 4MXQD 3NPSB 4LSQH 4PLOB 1CGXA 4QHUB 4BSJA 1IFHL 1EEUA 2Q8AH 2BY1A 5KSAB 1RUQL 4P9HL 3EO1A 1GZQA 3WL9A 4LCYA 5I16B 5L2KB 1MCWW 2MHAB 3SPVB 4LCUB 1X5IA 3NABH 2ADGB 4PV8B 5I8EA 4M1DH 3MV8D 4Q2ZA 1BQUA 3DUSB 1I7RB 3CFKB 2P47B 3MV9D 5I1AB 1DDHA 4N9GA 1FZOB 3QQ9D 5BJTB 2XXMB 4Z7VB 3LPGA 2WZPD 4MA7H 2GJ6A 2GK0A 3RPKA 5JMRA 3SJVE 1MI5E 4LBEB 3BAEH 5C0AD 3PJSB 3BKYL 1LE9A 4FG6D 2HFEA 1EA9C 4E42A 2J4WH 1NCBH 3AREA 5DT1H 4LMQI 4C56E 3BGFB 4FFZH 1X5YA 1AQKH 2NY4C 4GBXA 1C16B 1CICD 1HXMB 1S9XA 2X4SB 4U3CA 5E2VL 3QZWB 3ZE2F 3MBXH 2G75A 2DLFH 1LD9A 1FVDA 1RURH 4I5BA 1JZ6A 2BRRH 5F7YC 2F53E 3MRGA 4MLIA 4YXLL 2FJFA 3FFCB 1M7DB 5DQJA 3N1QC 4OZIE 5DHXB 5CJ8A 5J1TC 4XWGH 5EUKB 3CX2A 1UKTA 1AGCB 5D6CA 3BSZH 4M93B 1BZ7B 4NN5C 3OR7A 4PTUA 4DKEH 2BP3A 2D7MA 1DEDA 3D3VA 4NNPL 1KEGH 5A2FA 4PJ8B 3O4LD 1OWWA 1QYGH 2XPGA 3C09B 2X4NB 3KPNA 4OIIL 4WO4D 5E00A 3V6OC 1OB1A 2AJ3A 5IVXF 3VRIA 4Q9CA 3NTCL 2YKLL 4ZS6D 2DOCA 4G6FD 2UVEA 3IT8D 5EH1A 5E2JA 3TO2A 2A1WL 1X3DA 5EU4B 2F5BL 1RAMA 4QHMB 4JRXB 4PJFE 1T22B 3W9DB 4PLNC 2VDOH 3BGMA 3NACH 1GGCL 5CZXC 1MJUH 1YPZA 4ZUSB 4KJWD 4MD0A 2LVEA 1XGYL 3HI6L 5IJKC 2GI7A 2DKUA 4PJGF 3H0TA 1EEYB 1QSFD 4J12A 5GS1B 2AI0H 3HMWH 1JV5A 4PJ5B 2VQ1A 2Z92A 4X6CB 5IF0B 3OPZH 3VG9B 2DWEA 2FEDD 5D2LF 3O6LL 2DQIH 3QXAB 4NOFA 3BT2L 4JFFE 3ZHDA 3OAYK 2CKBH 4Y16A 5F9WB 1FH5L 1S9VB 3TIDA 3VRJA 5EC1A 5MP6H 3FJTA 3O2VL 1UYWH 1EFQA 3NFSH 5GS3A 2DTSA 1A6AA 1T66C 1I3RA 2A74A 4WRLA 3GIZH 4WWKC 1R3IL 3P40A 4OCWL 4FTVA 5ACZA 4M43H 2X2YA 1KLUB 2WBJC 1FVCB 3LRSB 4N8VG 1DQLH 3U0PB 4H1LH 2P24B 5E4EC 5T3ZL 1LNUB 4XC3L 2OL3B 3CUPB 4N8CL 1T1WA 1TITA 3AS3A 3L6FB 3Q6FA 4NUGH 3MV8B 5C07A 2CDFA 4OZHB 4JFOB 3MV9B 3K7UA 1KTDB 4MA1C 4X6DE 2KQNA 1MLBB 5HYSA 5GS2H 4PJFB 1FNSL 4PB9H 1KB5B 1I3GL 3DGCR 3L95B 4YHIA 3AC0A 3OKKB 1V7NL 2XN9D 2KDGA 3FO0H 4LF3A 3FONA 4QF1B 1U3HC 1N2RB 5M94B 3WHE1 4MJIA 5C0AB 3TBWB 4PJ7E 3SE4A 4HIJB 3SQOH 4QGTA 3EGSB 5F88A 3BPNC 3U36A 3V4UL 4ZD3H 2XQYK 4O4YH 3RDTD 2RIKA 3QQ3B 5BMFL 1CBVH 2Y06H 1VPOH 2W0FA 4IMLB 4MAUH 3WUWB 2BNRD 2J5LC 1S8DB 1CICB 1H3TA 2DMCA 3GHBH 4Q9QH 4FFYH 4XP1L 1NCAH 2VISA 3OG6B 3JV6A 4PJXA 3L3GA 4XNYH 4LNRA 1KJVB 1DBKL 2VDLL 4Y2OA 4RX4D 6CGTA 3BP4A 2VZSA 4K7PH 1T03H 1XAUA 4X98A 4I0PC 4KI5D 1QLRB 5ESAA 1FC2D 1EBPA 3C60A 1YYML 1M7IA 4LK4A 3VFRB 3P11H 5DJ0B 2OI9B 2CGRL 2DYPB 2PETA 3O4LB 5LGJB 2W65B 3SY0B 2NY7L 4Z95L 5I66A 4X83A 4O58L 1FRGL 3RTQC 4LQFH 4G6FB 4P2OD 3KYOA 1KFAH 3WIFB 1ACYH 4LVHC 4E41D 3WNMA 3T2NH 3RAJL 3TV3H 3FQNB 3UZVB 2UZIH 3BEVA 3P4NB 2CDEB 35C8L 2DQHL 4U2YA 3MLSL 3QA3A 4H26A 5IBLC 3RVWD 3S4SG 4TVPD 4QXGH 4IIQC 2OP4L 5IW3A 5IKCB 3RZCC 2PTTB 4A2MA 1KXTB 2H2PD 4BK5A 1QSFB 1LDPH 2KQMA 4HV8A 1ZWIB 1RJCA 4XNZB 1NL0L 1FNHA 3L3JB 1P2CB 3BW9B 2BNRE 1G7IB 1RZJH 3I2CH 2FLBT 4MS8D 1RZ8B 4C83B 4F57H 4LEOB 4MA8L 4GRLD 3B9KC 4F8QA 5KVFH 4HPYH 1PEZA 5J0BA 5F7DB 4Z6AT 4ZFFA 5DJXA 4DAGL 3IDYC 4F80A 1DVFA 1OW0A 1JPFB 4D9QD 5FUCC 1CL7H 5ISZB 1MVUB 2XA3A 1NCCL 1GOFA 1K2DB 5I1IL 3LN9A 2L0DA 3O45A 2F54A 5FKPB 4G6AD 4QRUB 2I25N 3A6BH 4RMUA 4LKCA 1T0NB 1BOGB 4KK8D 1CGWA 3WFHB 3TBTB 2FO1A 3BP6B 5EN2A 1QA9A 1HCFX 2HFFB 3UYOD 1YN7A 4FFWD 4RDQF 3LEXA 3PHOB 1U8HB 3BPOB 5GIRA 4W4OA 3MRJB 4E41E 3TBVA 2XN9B 1ZT4B 4EN3A 4A6YH 3HRZB 1A21A 1U8QA 4WJ5B 5KAQF 1EVTC 3SOBH 4TVPE 1K6QL 2DQGL 3IFOA 1P69B 1JZ3A 3FO1B 2CLZA 3RDTB 1E4XH 2NY3D 4JJ5B 4PTTA 4HWZB 4TUJA 3VWKA 1D5BB 2UVFA 2BNRB 4GXUM 2Y5TB 3G04B 3EYOA 4XNMA 1N5YH 3HI5H 4TSCL 4XVUC 5ALBH 4JG1L 1GHFH 1N8ZB 1UB5A 4G42B 2AP2A 4ZDHB 2IG2L 2VLJD 5C0DB 4HUVA 5IFJA 1H3PH 1DBJL 3TJEL 3UDWA 4D9QE 1DTUA 5LAXA 4NJ9L 5HY9A 3MJ8A 3ULVE 5DC4B 5GZNC 3DMMD 4U6XB 5AZ2H 5L0QB 2OJZH 3B3IA 3WD5H 2HLFD 1AGEB 4MD4A 3LKRB 3V0VB 2D03H 2EEBA 4GXVH 2DQTL 5T1LA 5B3JF 3PXJA 4P2OB 5D1QC 4O02L 2BFVH 4GUPB 1FPTL 4YE4H 5E8NB 2XTLA 5FV1L 2XA8L 4CU8A 3O3AA 5TF0A 2BC4A 1CTOA 3WNPA 2NXYC 3MR9A 4G9FA 1N5AA 1TVHB 1QFHA 1B3JA 2QQNH 4ALAL 4PGJA 2BRQA 3HS0A 5JW4R 5CIPB 4M6OL 4I2XA 3FB6A 3WO4B 1FNFA 4LSRL 5CEZD 2VDPH 4DW2H 3P0GB 3JUYA 4GRLB 2CK0H 2ATPA 4K3DH 1KN4H 3RWCB 5L88L 2IPKB 4EUPA 1MCNA 5GS0D 1YEIH 1Q9LA 4RFEB 3G5YB 1H15B 3KWWB 4BH7B 3GO1H 5JHLH 3KNBB 3REWA 3MROA 5KVEL 3GJEB 3RPIA 4X7FC 3MO1B 1INDL 2VB5A 4H8WL 4NHCL 4QGYA 3DECA 3R4DA 2ED7A 2CR3A 1VFUA 4KKLD 4PY7A 3U1SH 1HKLL 2FATH 1E27A 1CR9H 4LL9A 1J05B 1IAIL 4GO6B 5GJTL 5EPMB 5DD5H 1B6DA 3LEVL 4P9HC 5D2NE 5HGBB 5KN5B 3JBG7 5HHXH 1P9MC 3BPCA 2FRGP 5ITBL 2EIBA 4X9GA 2B1AH 4MNQE 1CFBA 1F4WH 3PP3H 4YUEH 43CAA 4GS7C 2V9RA 3F7VB 3LV3B 5DURD 4MCYB 2W0LA 5FECA 2X4PB 4RMVA 3IJSB 3CVHA 1BZQK 4OCYL 1IC1A 5FF6A 4U1MA 4NKOB 3I3EA 4S0TD 3VH8B 2NXZC 1TETH 2NY3B 1XR9B 1EZVX 2EH8H 3DBXB 4IRSD 1QRNE 4M5ZL 1Z9LA 2YOCA 1JPGB 3FT2A 1MPAL 1F90L 5BRZA 4PR5A 5IVZA 4CJ0A 4JVUA 4C55A 4HLZH 2WW8A 3UCRA 1YEEH 2DJSA 5CEZE 1U36A 2FGWH 2YD5A 3MRCA 3RVXD 1I1AD 3ZO0A 4HJJL 2X1PA 3PGCB 3WFDH 1QKZH 4GW4B 2VLJB 2E27H 3FOLA 5CILL 3NAAL 4KVCL 1J11A 1MFAH 2FJHA 2N7AA 3MXVH 4D3CH 3PWUB 2JELH 4LLYA 1L9NA 1QHPA 3I3DA 5DUMH 3VGAC 5DMIH 2WLZA 4Z7NE 1EUUA 1NAKH 4YJZL 2D4FA 3KLSA 1HI6A 4NQCA 1Q8MA 1SJEB 5J57B 1U42A 4J8RB 5T5FL 5GRVK 1T7VA 2J6EA 2G60L 1ZVHA 1T04A 3GMRB 3L3OB 1NEZG 2AXGA 5D72L 5HGDB 2EXYC 5IW1B 1XH3B 2AKRA 1II4E 3S5LA 2EIEA 2I9LB 3DXAD 2MKWA 4HS8H 5I1GH 4XP6H 4JANA 4OQ1A 3GSXA 4ZFGL 5IJVB 2O5YH 1R3JB 3FB7A 3QIWC 1BAFL 4ORZC 3LN4A 1TENA 3QIBA 1VGEH 1YECL 1R0AH 2GIYA 2AK1H 3OKDB 3RRQA 2CLVA 1RMFH 4Y2DD 3DVNA 2Y23A 1O5DT 1DQML 1CD0A 2XG4A 4J3XA 4R90H 4U1KB 1RIHH 2QKIB 5IB2B 2R4RH 1E28B 5FYKU 3RL2A 3R0MA 4DQOH 4W70A 3D69B 1U2CA 3EO0B 2H26A 1FNLA 1NBZA 4JDZB 1MCQA 3Q0HA 4KGJA 5DD3L 3RWGA 4U1LB 2XKNB 4TPRL 5L6YH 3O3DA 2N7BA 1E4WL 5HYQB 4H88H 3NIFF 1BQHB 2N1KA 3FL7A 3KPMB 2H9GA 1JGEB 2N4IA 3GMQA 3BVNA 2XQBL 1YEJL 4YFLI 4HH8A 4XI5C 4RGMC 3WV0A 1WAAF 2NX5D 2VLRD 4RBPK 1ZA6A 4FXKA 3TN0D 1C5CH 2PYED 4FZ8H 1A22B 3WE6A 5HDBF 5DURB 4LLVB 1VERA 3VXRE 1PG7X 3DXAE 4N0RA 1FO0A 1F6AB 3H9SE 5IMKB 7FABL 1RUQH 1RULL 3GIVA 3MNZA 2DQCL 2MWCA 5E94A 2A73B 3PWNA 3QUXB 2H3NA 3SE9L 3KLHD 4IRSB 1YNTA 3ZYZA 4M03A 5J1AA 1D9KD 1DUZA 3BHBA 3CFJB 4WI7A 1I1AB 3G5ZA 4YHKL 3QR2A 2QADC 1ZA3A 3TNMA 3WSQL 1CGUA 2BVTA 5D93B 4Y5YC 1S9YB 1F4HA 3LPWA 3C6LB 1HEZB 4KROD 5FYLL 3G6JF 3BKYH 3Q5TA 4WW2F 3KVQA 4HX1B 5FO9B 4YDIL 3ULVH 3DRQA 4UT6L 4KY1L 3L9RA 3DO3A 4JY5L 1DN2A 4WHCA 4O2FA 5E8DL 5DXWA 1GGUA 4ZO7A 3DGGA 2R2EB 2APXA 3PL6D 1QACA 5F70A 1SEBB 3G5VB 1YEHH 3AB0C 4LHUD 3D18B 2Z93A 1QVOB 5FHAL 2XY2A 3VFTA 1Q9KA 1Q9OB 5E2VH 3IXAB 1KTLB 3QEUA 3V6FB 3U4BL 1KTRL 1TQCC 2NX5E 5C0IA 1U92A 4YXLH 4Y4FA 4DUVA 5FM4A 3DXAB 5HDQL 5C71A 1A3LL 1YYLL 1YDPA 4F2MA 3UXFA 3HFMH 1Z3GL 4MSWA 3LCYA 3HR5A 1JUFB 1RZIA 2AJSL 3K1KC 3OJMB 1UWXK 3RHWK 4OIIH 5EOCJ 5AEAA 4N90E 1W0WA 4X4YB 3NTCH 2YKLH 4IOIA 1UWEL 2R1YA 4MXVE 5AYUL 5B22A 2F5BH 3WKML 3N1GC 1C7TA 4XBEL 5MEND 3X12B 4AY0A 5KSBE 2DLGA 5DO2C 5IB1B 1CFSB 2EYSB 4OCSL 4UAOB 1UGNA 3QDAA 1GGCH 4GRMA 4H5SB 1MCPL 4PRDA 4TYUA 2E9JA 2ED9A 4KDVA 3TJHC 2V2TB 1DP0A 1K4CA 1T7XA 3T0EE 5HHQA 1XGYH 2P5WD 3HI6H 1WSST 2EXWC 1GL4B 5EZJB 2O5XL 1U58A 4WW2A 5IB5A 2DQFA 4PGDA 3EO9L 4QRRD 4YFLF 4KI1A 4IJ3C 3WFZA 3JVGC 1NCUA 4IDJL 1XZ0A 3BT2H 5DDHA 4N9OB 2VLRB 3S88L 4OD1L 1SBSL 3PWPE 1FH5H 1ES0A 1X44A 1F4XL 2CUHA 2PYEB 3O2VH 1JTTA 1A6TB 1K4DB 4EVNB 2CDGA 1CG9B 1YMME 4F7TB 1NMCC 1R3IH 3E0GA 5GGVL 5DRXB 2V9QA 1QOKA 1WBZA 5IM7A 4S1RL 3ZDYE 3QNZA 1KCVL 3TVMD 2Z35B 3U0WL 3IU4L 2HT4C 5T3ZH 3TO4D 3L5XL 4Q9RL 2GUOB 4XC3H 5GSVA 2D4DA 1U95A 1S7TB 1ED3B 2GT9B 2FHBA 4KKAD 4N8CH 4JY6A 3O11B 2COQA 2YK1L 2OM5A 5CKAA 2JE8A 4Z7OE 2EDDA 1ZLVK 1WT5C 1WZLA 4YHPA 3TCLA 5EUOF 5IIEA 1S7UA 3FT4B 4N0YL 1I3GH 3GMPA 3K8MA 1MHPL 1CL7I 1V7NH 3VXSD 1U3YA 3DV4A 5KANI 3DTXA 4J3OC 4JO4L 4KROB 5J9PB 1R5IB 1JNJA 2VXQL 1A1NA 3MRQB 1BWWA 4YHML 4Q6IC 1ZGLP 4M8QA 5J6HB 3VWJD 2JKXA 3LSOA 3X17A 1FLRL 3V4UH 4IS6B 5BMFH 5JQHC 2X4OA 2P48B 3QFJA 4XCYA 5MEQA 1MCBA 3SDCA 4LHUB 3K3QA 4MAYA 2YD4A 5D7IA 4QRRE 2NY2D 5H2BB 2EDFA 3I75A 4XP1H 2PUQT 2IBZX 4M1GL 3U7AA 4XPFH 2VDLH 1DBKH 4APQA 5FCUL 1EHXA 1UH4A 1MHCB 3ZMRA 5IUSA 1OAYH 4F58L 1CE6A 4JVWA 2D0GA 2G5BB 5I1LA 4X8JA 1YYMH 4PRPA 1WCBB 2PW2A 4OZFH 4XXCC 3P3YA 1ZE3C 1XIWA 2D7NA 2EIZA 5EU6D 3U9PL 5HHPA 4PJAF 3P30L 2XKSA 1DSFH 3AMLA 3CC5A 4O58H 1FRGH 1A9EA 3G6DL 3EYFB 5DEFA 1D5MB 4LKXB 1PQZA 3BZEB 2LAGB 3K2MC 4I48B 2HLAA 1EAJA 3ARUA 5MENB 3RUGE 3RAJH 3GKWH 5BVJA 3ULUL 4OTXL 4CU6A 5EUOA 32C2A 1M7XA 35C8H 4R2GD 4OKDA 3VXSE 4NO5B 1NAML 2F19L 3MLSH 3TIEB 4F8TA 5C2BL 1OGAA 4P3CL 1G7LB 3TZVA 2JTDA 4FHBD 5F7MC 4OFYA 3UJTH 1WBYB 3D9AL 2P5WB 5IMMB 5IESL 5DMKB 4WI9A 2BOCB 4QRQA 5EZLA 4ELME 1NL0H 5DK3A 4QY8B 2RFXB 2L7UA 3M1BA 4H8WC 2P7TA 1CE1H 4IMKA 4PREB 4MA8H 2NY4D 1NBVL 1MOEA 4KJPD 4W81A 5I8OL 2NTFB 4ZUWA 4OCLC 2JF1A 3Q48A 1ADQA 1YNLL 1I7UA 1FJ1A 4UTAL 3C5SA 3EOBB 1NCCH 2AXJA 3C8HA 4P23A 5I1IH 2ZCHH 3LD8B 3TVMB 5H37H 1RHHA 5ID0A 2XWBA 3MRPB 2D0HA 3MCLL 5TDNB 3TO4B 3VW3H 3FN0L 5EU6E 4GKZA 3IDIA 5T1KA 3TM6A 4RMSA 4N1HB 4RRPA 4L8SA 4LGRB 2IFFL 3VCLA 1F3DJ 3MLXH 5HI5C 3ARDC 4PJAA 4POUB 3IAGC 4M6AA 2Z4QA 4BSWB 3FQXB 4NJAL 5DRNA 3GMMB 1GVIA 1EK3A 3O9WC 4JREB 4NGHL 3UTZA 4QHUA 3HE7D 3VXNB 3IVKB 5KSAA 1QLEL 1B0WA 2DQGH 1KGCD 1KJMB 3C2SA 5L2KA 4V1DA 2MHAA 4PRIA 4LCUA 3SPVA 5HVHB 2ADGA 1G6RL 2JIXD 4ODWB 5AG8A 1W8NA 2AQ2A 4TSCH 4WFHE 4HGKC 1AGBB 1FBIL 1ULVA 1RPQA 4LLQB 4EIGB 3EFDL 1NMAL 5DVKA 4H1LB 4AQOA 4Y8AA 2IG2H 3MMEB 2EDYA 5BW7C 2YD3A 3TF7C 4K55A 3TJEH 4Y0GA 4HS3B 3U83A 2FX7L 2JCCB 4XB8A 4F37K 5FYLE 2ZUWA 5IV2B 3W5MA 3PJSA 1AC6A 2O26U 4WWKD 3DYMA 4MVBC 5CMAA 3Q2CA 5GSRA 4YDJA 3MBEA 1HQRB 2GJZB 2VZOA 4PRHD 2DQUL 3OR6B 4XPHH 2WBJD 4MDIB 5F9AC 1DQTA 4PG2C 4AG4L 4D0BA 1KCLA 3LKPB 1I8KA 4PLJC 4ZO9A 5ILTL 5I15L 3ILPB 4JQVA 5IB3A 3ARBC 4XP4L 1CK0L 1I8MB 1C16A 1HXMA 2X4SA 1A3QA 1S7XA 4OZIF 1FPTH 3HNVL 4NT6A 4BZ2H 1MRDL 3OB0H 5F96L 1J1OL 1CQYA 1RZGB 1UKQA 2O61A 3FFCA 1M7DA 5GGSB 5I1JL 3PNWA 3Q6GL 1G7HB 5EUKA 3BJ91 4S10A 3CSGA 3GRWL 1U8MA 2CXGA 4NRZB 5JORB 1BZ7A 3UX9B 4ALAH 5J89A 3RWDB 4LCIL 2YRZA 5HDLA 4Z7UE 5F7LB 3HLAA 4M6OH 5SV3A 5HYSG 5LKNA 1NGWA 3HRPA 4R3SB 1HH9B 4LSRH 3SDAD 2FX8L 4KFZC 2NY4B 5DVMA 1OARL 1KCRL 2Y5EA 1WCQA 3ALWA 3WKNA 4QHMA 5C0CD 3IJHB 4MZ3A 3ZT6A 4I18C 3SJVA 4DVRL 1T22A 3W9DA 2AK4D 4K9EL 3WS6A 4JZJC 1MHEB 4I0PD 4ZUSA 5KVEH 4PJDE 1INDH 3VDBA 4H8WH 2Q7NA 2FHFA 4NN5B 3MRHB 1HKLH 4C56A 1WIOA 4GKOA 2A6IA 1XGPA 1AD0B 3KLDA 1IAIH 5GJTH 2OBGA 2X9XA 3TA3A 3ALXA 2PO6A 3LEVH 4X6CA 4G8IA 5IF0A 1IT9L 5KSUB 4JLRB 3QXAA 3RY6A 1V3JA 1NUDA 3RTQD 2VO5A 5DGRA 2ZG1A 1YN6A 2F53A 2Z91B 1S9VA 5ECJE 2HVKA 5DJDB 5GGRB 5KVGL 2W60B 4S1SL 3HE7B 3L3IA 4LPUA 3T3MF 4BQ9A 3HG1B 3GHEL 4Z7UB 5IBLD 1IC7H 4WHDA 3U0PA 5HYJE 2P24A 2JIXB 4X6DF 1LNUA 4QEGA 4M5ZH 5JIPA 2OL3A 3CUPA 4PJEF 1MPAH 1F90H 4HWBL 3L6FA 2IBGA 3C9NA 3O3BA 3MV8A 2WINB 4OZHA 4JFOA 3MV9A 1IQDB 1MLBA 2K9UA 4HJJH 4PJFA 3B9KD 1KB5A 2K7QA 3L95A 5E9DB 5CCKH 3K81A 3OKKA 2DJ4A 5CILH 4KVCH 1TNNA 4PJDB 1NDMB 1EO5A 4QF1A 1MNUL 1EUTA 1N2RA 3B6SB 5IQ7L 1P6AB 2R2HB 2C3XA 5C0AA 1KULA 5JOPD 4WWKB 4Z7QE 4HIJA 3VXOA 1EERB 1OAXL 4ZFOB 4JHZA 4DK6A 5A3IC 5KS9B 3HE6C 1GXEA 4Z77B 5F71A 4PRHB 2WBJB 1B9ZA 3G5XA 4N0UE 3A0OA 3BEWB 3QQ3A 5GRUL 4YIQB 4IMLA 5E4EB 2YBRB 3WUWA 4NN6C 3SE3C 4MNGB 4WW1B 5DA0B 1CZ8L 4A6YB 1SM3H 3ZE0F 2FEEL 2G60H 1Q1JL 4HKZA 4B41A 1JWSA 4DN4H 3AAZA 1G7QB 1G9NL 5IEHA 2FIKB 5D72H 3D87B 3IDXH 4MA1B 3HZVB 4TSBL 3O6FD 5D7JC 2MCG1 4O2EB 3W39A 2V5YA 3OKOA 5I76A 4ZFGH 3CXHK 4YR6A 3RWJB 3RGVC 3SDXE 4LLMA 4UNVA 1U3HB 1BAFH 5DJ0A 5LGJA 5HXMA 3BPNB 1KB9K 4GT7A 2W65A 2XICA 4QOKD 3SY0A 4WO4A 4YBQC 4ERSL 5E8PA 5C92A 3MGTB 1MFBH 5ENWB 3UMTA 1IKNA 1DQMH 2J5LB 4JO3L 2NMSA 4F9PC 4J3VA 3GSUA 5JIKA 3S36H 4P5MA 5C08B 4CDHA 5I2IB 4GKSB 3NCFB 5C0CB 2F8VA 3FQNA 3DX7B 2AK4B 5CSBA 3P4NA 5DZNA 4MMXC 4WU5B 3MZTA 2CDEA 4JFZL 4PJ7A 4I0PB 3TBSA 4X7CC 2BHUA 2ID5A 5ID1B 3V95A 2X4RA 2EE3A 5DD3H 5GZND 4U1JB 1F3JB 2QQQA 3U0TA 1QSFA 4U6YA 4JM2C 4YDVA 3FHAA 3GK8L 1EAPB 2VLKD 1P2CA 3CSYB 4FFVC 5SWQB 3BW9A 1G7IA 1HN1A 1A0QH 1UADC 3RTQB 5EU3B 2DD8H 5D1QD 5GRWA 4M7LL 4UIKL 1WWCA 3QUYD 2RB8A 3MRMB 4GXUN 1EGJA 3ORJA 3PUCA 4L8BA 4LVNC 2DI7A 5KOVC 2NXYD 1RULH 1MVUA 4P46D 5EOQL 2UV3A 3CFCL 4HUXA 4IIQB 5FKPA 4QRUA 1DEEB 4LGSB 3RZCB 3SE9H 4AYFA 3L3HB 3WFHA 2AEPL 2EEAA 3LKNA 4NCDA 5F93C 3TBTA 1N6UA 3CJJA 3VFMB 5HHOE 1AXTL 1FORH 3OKMB 4YHKH 4AM0A 1U8HA 3B9KB 2FSEB 4YK4C 5IOPB 4BK4A 3WHXA 3UBXI 3TP4A 3MRJA 4OGZA 2XN9A 1ZT4A 3IDYB 1KIRB 4L4VE 1ZHNB 4ZQKB 5FYLH 4MQTB 4WJ5A 3FQTA 4YDIH 3UROR 3VRLE 1A1MB 3FQRA 4YPGB 3S96A 3QRFM 5E8DH 5BQ7A 2MOVA 5CJXA 3V52L 3FO1A 3RDTA 4JJ5A 4HWZA 1J8HE 4EUPG 2BNRA 4LLWB 1CVRA 2Y5TA 3G04A 3ZYIA 2FO4B 1GRWA 3U4BH 3QG6A 4G42A 5JOEA 1JL8A 4RX4A 3MA7A 3CK0H 4GOSA 1BPVA 4LRNL 3ULVF 5HDQH 1T4KB 2J8HA 1A3LH 1YYLH 5FGCB 5C0DA 1FL6B 4WFED 3ZKNC 1BX2B 1Z3GH 2NY6D 1TVDA 2UWEE 2IEPA 5D6DC 1GYAA 2NR6C 5HYFA 4G6KL 2I26N 1JYXA 2RCSL 4RMWA 4U6XA 5K9JH 5D5ME 2AJSH 1AGEA 2XACC 4HGWA 5DJYB 2NXZD 4QOKB 1J0JA 4LAQL 3V0VA 5J3HC 2IH3B 4BELD 1N0XL 4P2OA 1O0VA 3FFDA 5AYUH 3VFGL 2IAMA 3WKMH 2VWEE 4GRWE 1BZ9B 3MCKA 5E8NA 4E41A 1W0YT 4UNUA 2R15A 4OCMC 1YY9C 5C7XL 4KJQC 4M7ZC 4OCSH 4CADA 3MJ7B 3EHBC 1HHGB 1TVHA 2R1XA 5DJCB 2KPNA 4MJ5B 5JXED 2G9HA 4OCRL 4AIZA 3SCMC 1TDQA 3EO9H 1YQ2A 4BSVB 5D1XC 2K3TA 1BVZA 1XGRB 2VLKB 5DVLA 4IDJH 1QEWB 3OX8B 2BSSB 3OKLB 5CBEB 5MEOB 3ZKXC 5F7FA 3S88H 4OD1H 4GRLA 1SBSH 1F4XH 5D1QB 4F7CB 1P7HL 2X1WL 2IPKA 5T33H 1LO5B 2DM7A 4RFEA 3G5YA 4MWFB 5IWLA 5GGVH 3KNBA 1KENL 1Z6JT 3RNQB 3DUUB 2NXYB 3QPXL 4S1RH 4CMMA 3M45A 4IRJA 2GQHA 3MO1A 4K8RC 1PZUB 5IBTL 1KCVH 4Y19D 1HOCB 5DZOA 3MRDA 1FP5A 3QIWD 2BCKB 1T6WA 3IU4H 4X7TA 3L5XH 4Q9RH 5CJQH 4EI5C 3A67L 1Q94B 1CFTA 4PJBE 4P2QD 1J05A 1ZVSB 5EPMA 3HMXA 1U93A 3S5LG 3JTSB 2YK1H 5HGBA 3O6ML 5KN5A 4GRWB 43C9B 1GGBH 1T1XA 5T1MB 4C54A 1X5XA 1T0MB 4GFTB 4K7FA 4HUWB 4Z7WE 3MRBB 3F7VA 1MHPH 1FGNL 3LV3A 4XCCL 3VXPB 4MCYA 4YGVB 4X5WB 2DQEL 2X4PA 3GJFB 4JO4H 3CCHB 3SKOB 1X4XA 5ADPL 3MZGB 4YHMH 4JPIB 5M7QA 4Q74A 3VH8A 5TGBB 4NWUL 1CVSC 4DKDC 1FLRH 3BO8B 4DFHA 4OF7A 1F6FB 2X4TA 2JJSA 3VE0B 1XR9A 3DBXA 5JW5A 1C12B 2BVYA 1JPGA 2YZ1A 2NYYC 3TYGL 3S35X 2XTJC 2ZG3A 3V0AC 1VENA 4M1GH 4IEFB 4CJ1A 1KNOB 4NYLB 1QP1A 5F9DC 3PGCA 5E7FA 1INQA 2ZUYA 1DFBH 4ONGL 4GS7B 3EAKA 4F58H 3IDGB 2CKNA 3CPLB 5DC0A 3GJFK 4OUOA 4Z7NF 5I18L 1FYHB 2YWYA 4KC3B 5KVMC 5DQ9A 3DMMA 1J8KA 5DMGC 4Y19E 1AHWC 5EZOL 3U9PH 1BFTA 4WI4A 4PJBB 5C0JB 2I60L 5F6HI 2NXZB 2Z9TA 3P30H 2CPCA 1WWWX 4PJHF 3KPSD 5K59E 2VDKL 3G6DH 1GSMA 2OTUB 1MVFA 1RUML 1T5XB 5TQ0L 3H7LA 1LQSR 1EMTL 2NZ9C 3GMRA 4PJIF 3L3OA 4R7NB 5IW1A 1G7MB 1HYSD 3ULUH 1AY1L 1CXLA 1JGDA 5HPMB 4KV5E 3HC4L 3U48A 4P3CH 3OZ9L 5HGHA 5IJVA 3GMOB 3D9AH 1T20B 3LRHA 1UH3A 1D6EB 4UQ3B 2LU4A 4PLKC 5IESH 3CFBA 4HGMA 1QRNA 4K9EC 4UDTB 3VGAB 1KPVB 4ODUA 1F11B 4Q7DA 1NGQL 1ZVYA 3BJLA 5IBUG 3ZYJA 1JZ5A 5TF1L 1QG3A 3E6FB 2LV4A 1JRHL 1U8OB 4U1KA 4L3ED 2AJUL 3BZ4A 1WEJL 1N6VA 2ICCA 4FQQA 1LO2H 1HDMA 1E28A 2YPKA 1YNLH 1LK3H 5F8QC 5JUEL 3S98A 3BP5B 3RU8L 3D69A 3EO0A 4ZODA 4P3WA 4Y19B 5F44A 1I9RL 4JDZA 3QIWB 4XP9L 4FQHB 4U1LA 3SBWA 2XKNA 3MCLH 4UMGA 4C58B 5JPNB 3FN0H 5HHVH 5TDPB 1RFDL 2ENYA 5HYQA 4P2QB 1ZLSL 2IFFH 2GY7B 2WWMC 5T3XE 3IETB 4JFYB 4M1CC 3KPSE 1JNNL 4DKFH 1MCOL 1MJJB 3ESVF 1J7VR 1UEMA 5I1CL 2OS7A 1NUFA 5E5UB 1MCDA 2Z31C 4NJAH 5FUZH 5LQBL 5E70A 1NLBL 1UVQB 4JAMB 1HSBA 4NGHH 2HG5B 5DO2D 2YMXL 3BKMH 3D0VB 4DWHA 1QLEH 4ESKA 1LILA 4Z76A 3TJHD 1IAII 1T7ZA 2A73A 1G6RH 2EXWD 5AYQA 4IRSA 2HRLA 2ZUSA 1QBAA 2CRIA 4OZ4B 2YD1A 5FYJU 8FABB 2NY0C 3CFJA 1T7WA 4KK9C 4I9WE 1FBIH 1FFPB 3OB8A 3EFDH 1I1AA 2P8LA 4RGMB 2AEIT 1YMHA 5INDB 2AABL 3TPKA 1ZEAL 2CSPA 5DFVD 1BBDL 3ZSSA 3U6RB 1IGIL 1S9YA 2DS4A 2FX7H 1IAKB 1HEZA 4PUBL 2A0LD 5FO9A 3P0YH 1U91A 2DQUH 3LQZB 3H42L 4LSUL 4ZOEA 4AG4H 2FWOA 4U49A 5ILTH 5I15H 3AU1A 2XYCA 1G7PB 3KPSB 4M9PA 4XP4H 3D18A 1QVOA 1TTGA 1Q9OA 3IAQA 1KTLA 3NCEB 4EJ1C 3KPPA 3H9HB 4GMTL 2XG5A 3HNVH 4QXTA 2AAVA 1J1OH 5F96H 4OT1L 4QHKI 5EIVA 5IB4B 4HIHB 3DXAA 5I1JH 1ZKAA 3Q6GH 5C0NC 2QADB 3JV0A 1HIML 4R26L 3T0AA 4Y5YB 2APWA 3GRWH 4HIIB 1KLGB 1I8IB 1E6JL 3OJVC 4QT5A 4LCIH 1XGQA 3EJZC 5IQ9B 2Y9RT 1JUFA 1NLDL 4PJHB 4MXVF 3ZT7A 1F5WA 1U8PA 4AT6B 1P4LA 4QYOB 4Y2DA 5IHZA 3IFPB 4HJGB 5KSBF 2FX8H 3AB0B 4Y5VC 2Z8WC 1OARH 1V3MA 3B4NA 3MRIA 4OZFB 2HTKD 1KCRH 3TBYA 4UUJB 3LAFA 1FAIL 5E2WH 4L3EB 4IOSD 5E8OA 5T5NG 1TQCB 4WU7B 3P9LB 4K9EH 1CFSA 2EYSA 1ZGLB 3MREA 1QFUL 4H5SA 2H2SC 5B38B 3SGDH 2ADJB 4GLRH 5CD5C 5DMYA 2V2TA 4N0CC 1T5WA 3TT3L 5JHDD 3GUTA 4OBSA 2ICWI 5CLTA 5DUBA 4HQQL 5IFAL 3QCVL 1K85A 1UCBL 4J1UA 3L3DA 2YSSA 2DKSA 4EOWL 4KDWA 5TE6L 2NX5A 3DWTA 3TN0A 2PYEA 2EKSB 5FM5M 1A6TA 5FV2A 3QXWA 4POZD 4EVNA 4M7JH 1EHLL 5KVGH 4F7TA 4S1SH 5DRXA 3E3QC 5IHUH 1A7PH 1CDUA 3GHEH 4XPTL 4WDIB 2Z35A 3UEZA 1UG9A 5C9JB 1DJSA 1OHQA 2GUOA 3KPOB 3BDYL 4HWBH 2GT9A 4XNXL 1X6NA 1D9KA 3NIGF 1B2WH 3C2AL 2H6PA 1PYWB 4IJ3B 5GGQL 4N0FB 1S78C 5KSBA 3FT4A 1G1CA 4HUUA 3QJHB 4TUOB 4WFFE 4OF0A 5IMOB 15C8L 3VFPB 3T0EA 4PGCB 5J9PA 1R5IA 1NMCB 2AQ3A 1OAXH 3MRQA 1FC1A 4PBVC 2Y36L 1T1YB 4DN3L 3RA7L 3PV7A 5J6HA 5JHDE 1HNGA 2AJVL 4P4KC 4IS6A 1ZHLB 3PL6A 1IAOB 5GRUH 2MSPA 4FQCL 4LHUA 3C6SB 1CZ8H 1Z9MA 3WLWC 1Q1JH 3PWPA 3V7AG 1G9NH 4RAVA 4MX7B 3ARDD 2ITDA 3ESUF 1MCLA 4TSBH 3CVHL 1CF8L 1MHCA 3V6ZA 1G9MC 3HCVB 1OP3K 2EH7H 2CXKA 5IEKB 2DDQH 2G5BA 2R69L 1IKFL 2VDRL 4RRPG 2MQCA 4F7MB 3VXME 1MLCB 1T83A 5M95B 3D85A 4Q6IB 5C70A 1VKXB 5J7CC 4ERSH 1IGYB 1HWGB 3RUGF 1NH6A 3EYFA 4LKXA 4Y1AD 1QFWM 4I48A 4XH2B 3HNSL 5SWZD 5FA3B 5C0BD 3V4VH 4GBXC 2VL5B 2IADB 5MENA 4KK6D 3X14B 1Y6NR 2CIIB 2YD6A 5JQ6L 3VGEA 1S7SA 4JFZH 3DX9B 3I6GB 3U9UB 4CDGC 3DNKA 4ELMF 2R0KL 1WBYA 2P5WA 5ITFB 5LXGL 2DBJA 4KH2A 3QUZD 3RL1A 2CRYA 5CINL 4QRRA 2IAND 3F65A 3GK8H 4ZXBA 3PP4L 4PLJD 3GMNB 2RFXA 4JDVA 2CK2A 4IOFC 3ARBD 4OBRA 3SN6N 5KSVB 4NQSB 2D7TL 4JHAL 1URLA 3QUMA 5HYEA 4M7LH 3MCG1 2NTFA 2H8PB 5SX5K 3FMGL 3F58L 2VQUA 1KLFA 2W0KA 2ARJB 3VA6A 2O93L 3T0DA 1CD1B 1GIGL 5EOQH 3EOBA 5KANG 1X5HA 4WNQB 1RIVL 3IKCA 3TVMA 3T8XB 3QZWG 2VXSL 3MQIA 3N85L 4GQPH 3JWDH 5TDNA 3TO4A 2AEPH 1JK8A 1H8NA 3UPAA 4BZ1L 4HCRA 4K94L 1AXTH 1P4BL 4U33A 4Y1AE 5CZVL 5SWZE 2D9QB 5C0BE 4P4RA 4Q58C 3CNKA 1TCRB 1R5VA 4Y16C 3GSNL 3VXSA 1QR1B 4L8CB 3OF6D 1OP5H 3BN3B 1GJIA 3CFDB 1G9EA 3M8OL 1SQ2N 1ZLUH 1EJOL 1KJ2B 3VGBA 4HFWB 4R96A 3VWJA 3PWLB 4ELMA 4YHYC 5GRXG 3WJLA 3Q1SL 5DR5L 5ESVA 2JJTA 4CAGA 2YPLD 5ETUB 1OGTB 3MUY1 4LLQA 5ALCL 3ARDB 1Y0LA 5CGMA 3L1OL 3F8UB 1KPRA 3HKFA 2YS4A 3RVUD 5MHSD 1E6OL 3QT2A 2F54E 1VADB 1ORQB 4HS3A 4QTIL 5EU7C 1HHIB 3O9WB 1KIPA 3S97C 1WFNA 2D2OA 4URTB 5IV2A 3I50L 3VGHA 4G6KH 1WC7B 2RCSH 4KUCF 1HSAB 2GJZA 4P0DA 5EU6A 3SE4C 3OR6A 2BOBA 4WWID 5I19L 1UZ6E 2X10A 4LAQH 5F89A 3ILPA 3WMSA 4FQXD 1N0XH 1I8MA 1I9JL 4Y1AB 2WIIB 2VIRB 3VFGH 2C9AA 1T2XA 3X11A 4WGWB 5SWZB 1MH5B 5C0BB 4L1DA 2ZCKL 3BIKB 4OLYL 5JOFA 4PBXA 1RZGA 2OTWB 5J56B 4OLWL 4Z5RB 5GGSA 4DZBB 4KQ3L 1UC6A 1G7HA 2VR4A 4GKNA 5JORA 4NRZA 4GG6E 1JTOA 3RWDA 1LEGA 3GNML 4OCRH 4WENB 3KHOA 2XZAL 2C1OB 2FIRT 2IANB 3HB3D 2E8ZA 3MGAA 1HH9A 2GSIB 3ARBB 1DLHB 1AQDA 1TLKA 5EFIB 1TIUA 3PGFL 3KPQB 4KKBC 2HN7B 4JCLA 4WUKL 4I4WB 3BISA 4JN2A 4KRPC 3IJHA 4OF8A 4U0QB 1EBAA 3ILQC 5D7JD 1KENH 2QHLA 5MHSE 2UUDH 3QPXH 3B9AA 3WUWG 5IBTH 1EH9A 1WZ1L 4JFPB 1B4RA 5DYOB 4GG8B 4WTZA 3V7MA 3QWQB 3A67H 2WUCH 4NHUB 4YC2C 3BKJL 1SJXA 3FAWA 2P1YA 5DK0A 3KJ4C 3O6MH 2B1HL 2J8OA 5KSUA 4JLRA 5K9QG 3GB7B 5DRZB 4XCCH 3KYNA 3QAZC 3WFBH 5DFTA 2DQEH 4FNLH 4I18B 5GGRA 3H9YA 5H8DA 1T89C 1U8JB 5ADPH 3HE7A 4JZJB 1OW0C 4O9HH 3S4SA 4OF3A 1IARB 2QQLL 4Z7UA 4M1DL 1TJGL 3NA9H 5D4QA 1B0RB 2FH8A 1CTNA 2JIXA 3B8YA 3C08L 4P48A 5EBMB 5E1HB 3TYGH 4JM2D 2YPLB 1SYVB 1CFNB 2W92A 1IQDA 2AJXH 1T3FB 4I0CC 4ONGH 4HHAA 4BFGA 1MREL 3QQ4B 4PJDA 2J4WL 1NDMA 1RIUL 3MRNB 5I18H 4AL8L 3B6SA 2WNGA 4R4FL 1JFQL 4EN3C 2ITCB 2P5ED 4WWKA 1U41A 1FYTD 5KS9A 3RI5F 5ICXA 4Z77A 3C87A 3MBXL 4D9LL 2WBJA 2I60H 3V5DB 5CGTA 3BEWA 4F3FB 5B8CA 3WS3A 1P7QD 1VSCA 2YBRA 2VDKH 4U3HA 3ROOB 4M48L 2PR4H 3UO1L 4WW1A 5EO1A 5TQ0H 3O0RL 3P73B 5DLML 1EMTH 3KR3H 4X4ME 4XMKL 4UBDC 4Q6YA 1BHGA 1W8OA 3IU3B 4LVEA 3SDXF 3HZVA 1N3NB 3ECBB 3MLTB 1QFPA 4MA3B 4U1HB 4Z8FH 3HC4H 1JJUA 3ARWA 3BIBX 1C8PA 5H35B 3K8KA 3OZ9H 3ARVA 3RWJA 1JMXA 4NDMA 3UDWC 3TLRA 5AAMA 3OSKA 3HE6B 4KUZL 3LQAL 1NGQH 4KRLB 2V7HB 5EOCH 2X05A 2AERT 2DM4A 3K8LA 3MGTA 3SDAA 2ENSA 1N59A 4NN6B 3ULUF 2VDOL 4MD5B 3LS4L 5TF1H 3UTTD 2J7LA 1OPGH 5I2IA 3K4AA 5C0CA 5I17B 2AK4A 2J8UE 4E0RB 4WU5A 5D7JB 1PKQE 1JI1A 4JGMA 3RNKA 4I0PA 5JUEH 3PGDB 5FYKD 3RU8H 3RX5A 2AEQL 3V5KB 2AI0L 4L29B 1I9RH 3ZDXE 4LCWD 4XP9H 2P5EE 3RGVB 4N0UA 1AGFA 5TH2B 2GTZB 1KCKA 2NR6D 1KEMH 2XZZA 3S3PA 1F3JA 1FIGL 4E5XB 3V0WL 2DWDB 1SJHB 2DQJL 2ZSWB 2OZ4A 4CBPA 2QQKL 3DX6B 5IT2L 2V5TA 1JNNH 1AO7D 4WFGD 1MCOH 1ZK9A 3RTQA 5EU3A 3HAEB 2Q7YB 5I1CH 1YY8A 1EXUA 3SGDI 5LQBH 4M43L 1IC4L 4GLRI 4BYHA 4NUJB 3CMOL 2IPUG 2WV3A 2GFBA 3MUGB 4KJQD 2YMXH 4LQ1A 5EC2A 5CEYB 1BQLL 1QLFB 4U2ZA 3EHBD 5JZ7C 4NUGL 3LKOB 2M2DA 3K74B 2C3GA 4AEHL 1DEEA 5C0RL 2GSGB 1LE5B 3P9MA 3ARSA 3L3HA 2X4QB 3SCMD 2Q76A 4JM2B 5IR1A 4PJ9C 4MXWH 3N1FC 1BQSA 3I02B 1KPUB 1ADQL 3M17A 3UTTE 2VLLA 1QNZL 1R3HA 1J9CT 4XGZB 2AABH 4QHLB 3S37L 3BKCL 4U1NB 3NCBB 3B9KA 2IBZY 3VRLF 1ZEAH 2ZOKA 5B4MC 3D39D 4NQDB 3SQOL 4I77H 1H5BA 4D2NA 1BBDH 3CXDL 1IGIH 3P4LA 4ZFZB 4ZQKA 4PUBH 3REVB 2Y06L 4G43A 1VPOL 2P5EB 4JZNB 5FYKE 1JGLH 4LVNB 1FYTB 1MFDH 4POYA 4K8RD 1I7TA 2KZWA 1T1ZA 3H42H 1CDJA 1NCAL 4FFYL 1N6QL 1QFOA 1P7QB 3MOBL 1SHMA 4AMKL 2BMKA 1T03L 4K7PL 4LLWA 5I1EL 1N64H 2DICA 2A6JB 2BNUB 4GMTH 4D9RE 3IF1B 1TQBC 1MCHA 3SE8L 1MCRA 2JK5B 2HYMA 4OT1H 1ZLWK 2UWEF 3O6FA 1T4KA 4YK4B 2WANA 1MY5A 1QTYT 1NFDB 4QRPE 4TN9A 5JDSB 3DV6B 1HIMH 1S5IL 5D5MF 1FL6A 5FB8B 1PLGL 1QSED 3MV7D 4G8EA 3UJJL 5DJ6A 1E6JH 3U4EB 3KJ6L 3HUJF 4DOHE 1AIFB 1RZKL 3PDOB 1NLDH 4UU9B 4XZUB 2OJEA 1S7RB 1UM4H 2FEEI 2ILLA 4QOKA 5HHOA 4ENEC 1A6VL 2IH3A 1JF6A 2LU3A 1INEL 1Q0XL 2P8MA 2NYYD 3VXUD 3N50A 2XTJD 1W72A 1FAIH 5ANMB 1KF9B 1MCIA 4K07A 2X1OA 2CUMA 3VH8G 1FFNB 3ELAT 3D39E 1FL3B 1HHGA 2V5SA 4ZOAA 4EDWH 4NQVA 2PNDA 2EDKA 5D96C 4LCWB 4N68A 3TT3H 4HT1L 3MODL 1RZJL 4HD9A 4HQQH 2IALB 3QCVH 5C2UB 5DMGD 4RQQB 1NGZB 2AV7A 1L0QA 3QIBC 5DSCB 5GZOC 1NAMB 1CWVA 4O2CB 1XGRA 2VLKA 4EOWH 1AO7B 1QEWA 2BHZA 2K1MA 3GSOB 5DJ8B 2BSSA 5CBEA 5TE6H 5MEOA 2GCYB 5D1QA 1NEZA 5BXFA 1CL7L 4F7CA 1XF2A 1VGKA 1U8IA 4ZYKA 2NZ9D 2DLIA 3QUYA 1U8LB 1LO5A 1EHLH 4NO0D 1QZ1A 4K94C 4FZEL 3SGJC 4M7ZB 2R2BB 2EE2A 4P46A 4XPTH 1QSEE 1HOCA 4X6FB 5CWSA 3IFLH 5GGTA 3BDYH 1H3WM 1Q94A 4V2CB 3SCMB 4Z7WF 4OLUL 1BBJB 3E2HC 5D1XB 4OZGE 4EUPH 3C2AH 3NVQA 1JYWA 4PV9B 3OWEA 5GGQH 5T1MA 2OR8A 3RX8A 1FNGB 4QRTA 1WISA 4ODVH 3MA9L 2XTJE 4HUWA 1NANH 4HPOL 1MAMH 3RZWA 4M62L 3PHQB 1EV2E 3SOBL 6FABL 2ZKHL 1UZ8B 4YGVA 15C8H 3GJFA 2BVOB 3CCHA 4YZFE 2HVJA 1EHNA 3WN5A 1ZT1A 4JEGB 2Y36H 3C8KB 4JPIA 5TGBA 2Q6WB 1Y18B 4HAGA 3BO8A 5GGSY 5ALBL 2AJVH 4ONOA 5ICYB 4J4PA 2E6PA 4RGOL 4FQCH 3TH2T 1S5HB 3RFZC 4EI5B 3GSRB 1OP9A 1BF8A 3LKSA 1HCVA 2ZUXA 2WWMD 3IYLW 2V9TA 25C8L 2ATKB 3R1GL 4M1CD 3H3KA 2ARWA 1HXYB 3HPJA 4AH2A 1G6RB 3CVHH 1CF8H 2D31B 2OMNA 4I8DA 4XAKD 2Z31D 3GM0A 3JV4B 2OJZL 4KU1A 2RQ8A 2R69H 1IKFH 2P4AB 1GZPB 2VDRH 3CPLA 2X4UA 3MV7B 3O6KL 1IJ9A 4L4TD 1CGVA 5K59F 2OL3L 3L5HA 4GXVL 5FK9B 1DBML 1EX0A 4OV6F 4OI7A 4PJBA 3CLFL 3U7WL 1I75A 4YE4L 4OZGB 2VXVL 2F8XC 3OXSB 3QULB 1P1ZB 2OTUA 4J3WA 4RAHA 1T5XA 1KB5L 5IROC 4KV5F 3VXUB 3D0LB 3SDYH 2XTJB 5EBWB 3QNXB 4GAFB 4KK9D 3ET9F 2PW1A 4R7NA 1G7MA 5JQ6H 1KT2B 2QQNL 5F1NB 4XWOC 5JLZB 5H94B 3UYPA 1LK2B 5HPMA 4R4NC 1R3LB 2AGJH 5HD8C 2BNQD 2EDJA 5HJ3B 2CMRL 4Y4FC 4X5XB 5C0FA 2R0KH 4NRXA 1T20A 4HF5L 4HZLB 1IM9D 4WEBL 1FNEB 1D6EA 3NPZB 4UIMB 4CW1B 5JXEA 1S7VA 2DLHA 2ZUTA 5LXGH 4UDTA 5GGRY 1H0DB 2J6EH 1AHWB 2M26A 4K3DL 1KPVA 1F11A 4ZAKC 3FB5B 4OFDA 5GGUB 1BD2D 2JJWA 3PE9A 3VFSA 3E6FA 5CP3A 5DI8B 1M1SA 4JHAH 4R7DA 3B5HA 5F1IB 5AUMB 5CEXB 3OKEB 3PF2A 5E8EB 3FB8B 1DZBA 4DUXA 2VH5H 4PRPE 5DWUL 2IQAB 3F58H 3FMGH 4NO0B 1OAKH 1GIGH 1MQ8A 1ETZB 1CR9L 1Z9SA 3SKMB 1RIVH 3F7RA 4Y19A 3DVGB 4XHJC 3RKDC 2VXSH 3N85H 4FQHA 3CDCA 3ZZ1A 3QEGH 3EJZD 5HGAA 5TDPA 4FQ1L 4P2QA 1JP5A 4WW2C 4BZ1H 4K94H 1P4BH 4TNVK 2YUWA 4KZEL 1MJJA 4P5TC 4C57C 2QBWA 1UH2A 4NSKB 3MLWH 4JFED 1UVQA 1DLFL 5CUSL 5EBGA 3WNOA 1EEZA 3M8OH 3VDAA 3CX5J 2BNQE 2H2SD 3D0VA 1EJOH 2PCPB 3IDNB 2GEEA 4N0CD 4I3SL 4HBQA 5DFWH 3TESA 2FGWL 1FAKT 5F6IC 1I1YB 5CGYC 3VMOA 4HK0B 3ZTNL 3Q1SH 4OZ4A 5DR5H 3DRTB 1A02N 8FABA 4ODHH 3WFDL 1IGCL 3S8WA 1FFPA 5ALCH 2HT2C 4M61B 4PJCF 1ZHKB 1EGJL 3V7AE 5C0EA 1FO0H 1C5DB 2UZYB 3BWAB 3L1OH 3MXVL 5INDA 2Z31B 3QDGB 5E99L 3WLBA 2ORBH 4Z9KB 3THML 1E6OH 4PGEA 5DMIL 3EYSH 3BDBA 5KG9B 3U6RA 1JF5A 1REIA 4LSPL 1BF2A 5D71H 4DEPC 4L4TB 3BD4A 4CVXA 1GOHA 3MRFB 1FDLL 3OAUL 4GH7B 3U30C 4AJ0A 1FZMB 1TPXC 1DBAL 5DVNA 1G7PA 3KPSA 3VMPA 3NBNA 3FAXA 1WZKA 1KUMA 3SDCC 4DVBA 1LP9B 1C08A 1KXVC 2NY0B 4OLYH 3W81A 1JMZA 3LQAC 2O5YL 3P4OB 4M6ML 4OLWH 1S78D 2BVPB 3MRRA 1E0OB 5IB4A 5EZIL 3ZE1F 4KQ3H 4JFEE 2BNQB 2IJ0C 12E8L 4PJ8D 1X5AA 4Y5YA 4RIRB 2QLVB 1KN2L 4HIIA 1I8IA 1IM9B 4QXUL 5F3BA 3GNMH 5IQ9A 4DTGL 2AJZB 2GYSA 3IGAB 2V7NB 4AT6A 4P4KD 5E56A 4QYOA 4HSQA 3IFPA 2DRUA 4HJGA 3NOIA 4M7LT 1BD2B 4X6EB 3B43A 4Z7VE 1CIUA 1G7JB 4YX2H 3WIHA 4UUJA 3WLWD 3PGFH 4WUKH 5TE7L 2AQ1A 1AP2B 1ND0B 1DQJB