3QXUA

Free structure of an anti-methotrexate cdr1-3 graft vhh antibody
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDKGKNTVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Anti-Methotrexate CDR1-3 Graft
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
source organism Lama glama
total genus 29
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxuA00
1QFWI 3DRQA 3QG7H 2BOCB 4ELMF 1OAKL 3DHMA 1QVOB 3NIGE 1NGZA 1A6WL 4KDVA 1YC7A 1FVEB 3NH7H 2DQHH 1DBAL 1MRDH 1FIGL 2NY2C 1K85A 1FRGL 5M95B 4XMPL 5I1JH 4CADA 4LSSH 3L5XL 1KCKA 3MNVB 5GIRB 1RUAH 1CQYA 1HQRB 4HPOH 2W9EL 3Q6FB 1TPXC 1I7TB 2ATKA 5IM7B 1V8HA 3PWUA 2Z93A 4X8JB 4HWEH 1KCRL 4RGNE 3C08L 5FO8B 3TGXA 5T5NG 2F8XC 15C8L 1AGCA 2FIKA 2HKFH 3KGRA 1JGUH 1C5DA 2D4DA 1RHHA 4HUUA 2VXQL 1IT9L 1QFWM 3RNQA 1R6VA 4R4ND 4FG6D 4XNZB 1FNGB 1YYMH 1AP2A 1NGQH 3BPNB 1UXWB 2FGWL 4PRHE 3FT2B 3ZKQD 5L88L 2QQKL 3IGAB 4MGXA 2AJVH 3HG1B 5SX4H 2QQLL 3G5YA 5C0BE 2OTPA 5C0JA 4HIXH 1BZ9A 2BOBA 4EI5D 2E7BA 1XR8B 4PJEA 4KKLD 4NPYB 1J10A 3BHBA 4I48A 1BFSA 4ZUWB 1UZ8B 2HFTA 2ICEB 2MQ0A 2ADGB 5F71A 2IALA 1HHIA 5E08L 5I8OL 5JW5A 1FH5H 1DLHA 4OD1H 1BQSA 1ZLWH 3RDTB 2QQQA 5DQ9A 4N9OB 2AQ2A 5D1XC 1NBZA 2DN7A 4WDIB 3NIDF 4K55A 2FL5A 2GITA 3W0WE 5ETUB 3DO7B 3ZKND 4NT6A 4XRCA 2R56L 3R06B 3C6SA 2Z4QB 3DX7A 3IDJB 2AJ3A 4F7CA 3WSQH 1HI6B 3D0VB 3TA3B 4ETQA 1J0KA 2CDFB 2VZSA 4OCNC 5I8EA 1A7OH 3VJ6A 2NY3D 3U4BL 4YXLL 5DC0A 1CFTB 1A3LH 1YJDH 2D7MA 1HSBB 4KTEH 5E4EB 2HH0H 4JVPA 1N6QL 3R8QA 2HFGH 3TO4D 2B2XH 1XF4A 4P2OA 1U8KA 1CYGA 3GJEA 1DSFL 1P4BL 3CXDH 3JWOL 2OL3L 1RVFH 3FZUC 4I18B 1SM3L 2OS7A 3EYVA 1WJ3A 3QPQD 3EZJB 2NY5C 2IAMC 3D85A 4G42A 1XGRA 4MD5A 4DN4L 1PZ5A 5EFIA 1S8DA 3TH2T 2UWEA 5CMAB 2G9HA 3D6GA 3MV7D 1IGFL 3BZEB 3NIFE 3VXQB 3V0AC 4EQ2A 4G9DA 3MMEB 5C0BB 2BCKA 4GQ9L 3ARBC 4NRXB 4P4KD 1CGWA 2P24A 1TDQA 5C7XL 2V5TA 3BKJL 1BIHA 1NLBL 4TVPL 1GC1L 2OMNA 4YHPB 3SY0B 1F3DJ 4TRPL 2E7LA 1WISA 2DD8L 3T0XA 4LBEA 4TUJB 3HRZA 2O61A 4Z8FH 2LVCA 5EBLA 1VEMA 4TYUA 4HH9B 3EO0A 3HTLX 5KTEL 2I5YL 4I0PD 3QUMA 5I6XB 4MNQD 4ZOBA 2C3VB 1D7FA 4H5SB 1JNJA 4HIIB 2Z91B 4F80A 4JPVH 2C3WA 4L4VA 3EDKA 2VXSL 2J7LA 2X9YA 3W9EA 3MROB 4PJEE 5L2KA 2CIIB 3D25B 1MVUB 3FFDA 1F90H 3FFCD 1P4LB 2EC9T 3CZFA 3S3SA 3MREA 1MOEA 3QIUC 5KSAB 3QXUA 3B9KB 2VITA 5GRJH 3KPTA 2EDBA 4XC1H 1JFQL 4NO5B 1U8NB 5CSGA 3BPLC 3RWDB 5CJXA 4KK8C 4PRAA 4ZG1A 5GRZA 1N5YH 1YNKL 3KR3H 1GIGH 3HI5H 5H35A 2DL9A 1NGZB 3I9GL 1QOKA 4M1DH 4JE4B 4H8WL 1LO2L 1W0YT 3LKOB 1G9MH 1JGLL 3GIZL 3V6OC 3WHE0 4G6KH 3JV6B 2COQA 4CADB 3QDMB 1AO7A 2BSSB 3BIBX 5MEQB 1U93A 2N56A 3MFFA 3P73A 4QXTB 4WCYH 2NY1B 1TNMA 2VAAA 3TO2B 3RY6A 3X11A 4YZFE 4F58H 3V5HA 2ATKB 3HC3H 5J13C 2BVQB 3E8UL 3TC9A 4ZTOH 4LCYA 2HRPH 4NKOB 4P4RB 5DRWB 3C87A 2P47B 5E94B 2FIKB 3QYCA 5DSCA 1N26A 1RHHB 4GW4A 4HUUB 4HXBH 4XP4L 3DYOA 4JFZH 4P23C 3RNQB 1BJ1J 1RZFH 2RAMA 3B5GA 2NY2D 3ALPA 2NCMA 2NR6C 2O5ZL 3KPNB 1T2XA 2UWEE 1SEQH 3KYOA 1S7WB 3MNZA 5C8JA 3CX2A 1G7MA 5EBWA 2O5XH 1ZLSH 3O0RH 3G5YB 1AGEA 4OZIB 1S9VA 1EIBA 3SGKA 1BZ9B 2J88L 2VR9A 2R4SL 3WFBH 4L9DA 2WNGA 1N7MH 3L7EA 4MDJA 3MRRB 3BHBB 2XQYK 1X5GA 3NIGF 5JMRA 4Y0GA 2OZ4H 1WZ1H 4NBZB 5EOQL 3OHXA 3MBEA 1LD9B 3IETA 5DR5L 3SDCA 1HHIB 3PP4H 4YO0A 5DS8A 1X5LA 3MJ8B 5JW5B 1DLHB 2NLJA 1BVKA 2PO6A 3ARQA 3MRCB 4M48L 5DQ9B 1R5IA 1BHGA 1QNZL 5GGSA 3DTXA 1NBZB 3IU3B 3C5JB 1F11B 5D7JC 3HKFA 1SBBA 1DQMH 4FQCH 2GITB 5C0CB 2ADIB 2ZUQB 3U1SH 4L4VE 4NT6B 3LKQA 5JZ7C 3C6SB 2RR3A 5L2KE 3QWQB 3U30C 4MJIB 1CE1H 1CS6A 5ADOH 4ETQB 1FBIL 5CLWA 4FABH 4L4TA 2D03H 4QO1A 3H9SD 1GGCH 4WU7A 4NP4H 2KPNA 2JKXA 3SE9H 2DWEA 1L0XA 1AD9A 3BVNA 1W0WA 4S1RL 5HGBB 4CJ0A 1NANH 3GKWL 4MXVE 5FV1L 2Q3AA 4Q2ZB 3SDDC 4RAVB 3V52L 4JFXB 3IVKA 4YC2B 3G6DH 2VLME 1CU4H 1GH7A 1NEUA 5D1XD 5D7KE 3BO8A 1I9IH 3KPSD 3D1MC 3BEVA 4P2OB 5GS1A 3W2DL 5BS0A 3GJEB 4RZCA 2VDQL 5JIHA 1KJ3H 3S36H 3QO1A 3EYVB 1AO7E 3BAEH 3WS6C 3U0WL 4O2CA 3SGJA 3GI8H 3OKDA 1OM3H 3RTQA 4G42B 3V4VL 4TVPE 4MD5B 1T80A 4NWUH 5ALCL 2NXZB 1JV5B 3V8CA 5L8KB 1HHKA 3N9GH 5GGRY 2BCKB 3REVA 1MREL 3IF1B 4YAQA 2LABA 3U48A 1IM9A 2B1AH 1IAMA 3HFMH 1ZT1A 2EDYA 4WFGE 2EE6A 3FZUD 4KTDL 2CLZB 1JGVL 1MHPL 5DHVH 4CNIB 5CLTA 3GRWL 2FEEL 3HRZB 4M1GL 35C8H 1UYWL 5I1LA 3IDXH 4UT7L 3EO0B 3THML 1H15A 5L9DL 2IAMD 3UTZB 4NO0B 1MRCH 4W68A 5JO5A 4IRSB 2E9JA 2R2BB 1LNUA 4FXKA 1K4DA 3SOBL 1B4JH 1FG9C 2C3GA 2DTMH 5DMYA 3EYFA 4QRPA 2EXWC 1NQBA 4JFHE 4ZO6A 2IMNA 2LU3A 3WDJA 3ARBD 5K9JL 3B5TA 4M93C 5T1LA 2DM7A 3RAJL 1IE5A 3WNNA 1HOCB 1AXSB 4HWBH 4YQXL 1IGJA 4HGKC 4NRYA 3ARVA 3DX9A 3RUGA 1M4KA 2D3VA 4NM4H 3D69B 4EZMA 2H2PC 3ZTJH 2VITB 3A6CH 2FATH 2OL3B 2X4NA 3HE7C 4UV7L 3QIBC 4R97C 4PRAB 5EOCJ 3N1FC 1IGIH 1OB1A 3OAZH 1A02N 3GSQA 4JFQB 1BQHB 4OB5L 4NQCD 2VDOH 5IB5B 5I73B 3A6BH 3D18B 3V5DA 3W5NA 3NIFF 4L4TE 5JHLL 4FNLH 4JHWH 1P53A 2DBLL 1KXVC 2PR4H 3H7LA 4OBRA 4NC0B 4Y5XA 4OF3A 1RUPH 3TT3L 2DQUH 1U93B 4FQXC 5I1KL 1E27A 3QIUD 4WW2A 4Z7WA 5F7LB 2VAAB 3S4SG 3X11B 3MRJB 3HPJA 2H41A 4LKXA 5ELIA 4Z7NE 4RGMB 1ZGLB 3HNVL 4FQQB 5BS0E 2AQ3A 3DSFL 1IBGH 3T1FA 2EDWA 3EOTH 4C4KT 2ZG3A 4KK8D 5D7LD 4D9QD 4K2UH 3GRWA 5E2UL 2ESVD 2C26A 4JZOA 5CBAA 5T3ZE 5DC9B 4XBGB 5CUSH 3IDUA 2A6DB 4PJEF 3BMWA 1EO7A 2RQ8A 4ELKA 1FV1A 4PP2B 5DJ8B 1RZJL 4ZUVB 4P99A 1QBML 3VXRA 4TULH 3P9LA 5ITFB 3NPZB 5LAXA 3KYOB 5E8NB 2XNAA 4FQ1H 3MNZB 2CKNA 4F37K 1JMXA 4PREA 2D31B 2VWEE 4X4YA 1M71B 3GZKA 5JXAH 1YEEH 1TZGL 3VDAA 1RIVL 5E00A 4P59H 3K8MA 5FB8A 2BP3A 5CZVL 1A6ZB 3ULUL 4GAFB 4XPAL 2EDRA 2XWTA 1WUNT 3FO9A 5I1IH 5IB2A 3SDCB 3MBEB 4UILH 3IETB 3ZTJG 1PKQA 3QFJA 4YO0B 1OTTC 2RFXA 4P23D 1T89C 2P4AB 2PYFA 3IDGB 5DQJA 1G0YR 1R5IB 1Q72L 5GGSB 4DGVH 4WNQA 4LAQH 3WMSA 3HNTL 3AY4A 2BVPB 1P5VA 2Q8BL 2A6JA 2F53B 3MLRH 2ITCA 3TYFB 3LKQB 4OCXH 3RPKA 4YZFF 4LEOB 4XNZC 1IKFH 5CILL 4QRPE 2AKRA 4WU5B 2X40A 2V7NA 3BSZH 4G6FD 2Q20A 5EOCL 4X6CE 4JY4A 4GW5A 3UC0H 3ZLQC 3KS0H 2F54D 1YEHH 3RUGE 1NAKL 3LS4L 3NCFB 1CXEA 1U6AH 1AD9B 2FB4H 3LIZH 1W0WB 5C0IA 3LPGA 1IEHA 1DANU 4JFDA 1UXSB 3GMLB 1FL5A 4G6AC 1CDGA 5D96B 2UWEF 3K8LA 3MX0A 4J23A 2DRUA 4ZS6C 3S35L 4U05A 3U0PA 3KJ6H 5GS1B 1Q0YH 3C6LA 3RDTC 4WHDA 2K7QA 1D9KA 5MI0B 4AEEA 5JZ7D 3ET9F 4RZCB 2F5AH 4D9LH 5JPNB 1X7QB 2P8MA 1LHZA 5B22A 2I27N 2VZTA 3L3GB 5FKAB 5HHVH 5JR1H 1S9WA 3ZE0F 4F15C 3OKDB 4Z7WE 3RTQB 4WI9A 4M7LT 3V4PL 4Y2OA 1CIDA 5DT1H 1CDUA 3B8SA 5JOPD 4OJFH 4P3DB 4OCWL 1PG7W 1AY1H 5DMJB 4WV1B 4YAQB 4QRRD 5E4EC 1FO0L 3KXFB 1IM9B 4OCSL 1EEZA 1K8DA 1SBSL 1G6RH 5IB4A 1NMBH 1O7VA 3K46A 1MF2H 2P5ED 3WNPA 5JLZB 3PWPD 3I75A 2D7TL 3BDBA 43C9A 3F8UB 4RGNC 5MHSE 3IAQA 4MXVF 3LH2H 5AZEL 5JO5B 4G6MH 2ARWA 1YPZA 2OCFD 1MH5B 3QEUB 4DCQA 2OM5A 3TJEL 1J0JA 4M9OA 3GK8L 1J5OH 4XNUH 1A6TA 1FC1A 1I1AB 5BV7C 4CL7A 4IIQB 5TE7L 5I8KL 4XMLL 1PKQE 3QFJE 3ARFA 3P4OA 3KPMB 1IGJB 1W0VB 1INEL 2GFBA 1J87A 2QR0A 4LFHD 1WT5C 3CDGA 3MLZH 5A2JH 3ARDD 3HPLA 3MJ9A 2ZP0T 3V95A 2X4NB 4LP4A 1Q0XH 3ZSSA 4LHQB 4EN3B 4TSBH 3GSQB 3QHZH 4LIQL 1JRHH 3TVMA 4U0QB 2AABL 5DK3A 3V5DB 1F4WH 4TOYH 2DQJL 5FYKL 1X9QA 5K9KA 1DL7H 2EXWD 4R7DB 3JTTB 1YNLH 1QO3A 4P5TA 3LQZA 3OJDB 4K94L 1HKFA 2KH2B 4UTBL 4J3UA 4JFDE 1RK0A 1E27B 5AAWA 1DR9A 3KG5A 2OSLB 1JF1A 4UAOC 2H2PD 1A4KA 3HPJB 1XGUA 1B6DA 4Q0XH 2FECL 4RFEA 3HE7D 3QXVA 3GEWB 3RP1A 4CJ1A 2NY7L 5KSAC 3QIBD 2E7HA 3D2UB 3MODH 5DO2C 1KXTB 4JZOB 4BFIB 4C57C 3DETC 5GS0H 1FGVL 2CPCA 3CX5J 4X98A 2D0FA 3WDHA 5C2UB 4Y5YC 1MCHA 4ELKB 1KB9K 1QQDA 3FT3A 5JW4N 4NO2A 2JE8A 5BW7A 3MJ7A 5DD1H 3VXRB 4XHJD 3BRFA 1BF2A 4L8SA 2ZCHH 3P9LB 5LAXB 4WTZA 4DKDC 2XNAB 3HC4H 5FCUH 1FCGA 1QSEA 2K7PA 4PREB 5D93B 4FQXD 4Z0XA 4D0CB 4EUPH 1KULA 1KOAA 1T6VN 4LCWD 4F7PA 2CIKA 5AUMA 4G9FE 4WJ5B 4JFEB 4U2YA 2NY6B 2XN9A 5F9JA 5FYLL 5IBUB 3ARYA 2NY1C 4XC3L 2UUDH 4XXCA 4EVNA 1MHHA 4O51B 4B0MM 1YEIL 5D6CA 5I74C 2RFXB 1QRNA 4ODUB 2I25N 2GW5A 5DQJB 4NQUA 2FX8H 1YPZE 3SKUD 2E3VA 2YWZA 3C9NA 3ZHKA 2V2WA 2G5RA 4MSWA 4XPGL 4HG4K 3DRTA 2A6JB 1HWHB 3BYYA 2ITCB 4U1IA 3S88L 3NTCL 5HGDA 4Z7NF 4LLYB 1AKJD 1EMTH 2AKRB 3F7QA 3RX8A 3D3VB 1AGBB 4L1HA 4NC1C 4MNHA 1TQCB 1G0XA 4GW5B 4JQIL 5C0GB 4RISL 2CSPA 5E8EB 1E6JH 3RWCB 4UNUA 5LWYL 4QGTA 3GSWB 1SMOA 2IBZX 4LQFL 1L4IA 4GMSL 1Q38A 3ULSA 4G8IB 4RBPK 1BEYH 1VADB 2EEBA 1OTTD 3BJ91 1XT5A 4JO2L 5L2JA 5J56B 2E7CA 5CP3H 4PP1C 6CGTA 1FYHB 1KJ2L 4YUEH 2NW2A 4OT1L 3VE0A 5HPMA 4RMWA 3PWVA 3ILQC 1D9KB 2WP3T 1YEJH 1VACA 1RZIB 5EDXA 3MYJA 2DI8A 1CBVH 2W60A 2P8MB 4KUCD 1RUKL 4N0CC 3WIFB 3GSVA 3HG1D 2GUOA 3QG7L 5EORL 5C3LD 4EUPG 4UDTA 4IOFC 4CVXA 3T65A 5CJOH 3PWLB 4HK3J 3X14A 2YPKA 3NH7L 3U36B 3LPFA 2DQHL 1MRDL 2I07A 4G6AD 5I1DB 1TIUA 4F7MA 4Z76A 5I1JL 5EZJA 4ZS6D 2FLBT 4LSSL 4WGVB 3O41A 1I85A 1RUAL 2LAAA 4HIEA 2VL4A 4YC2C 1EEZB 3RDTD 3SKMB 4HPOL 3DJ9A 2AXJA 2PW1A 4L3CA 2BRRH 4P2OC 4HW6A 1LO5B 1O7SA 3RUGF 2AJZA 4MA3B 4HWEL 1A8JH 1LP9E 3I75B 1I3RB 4NNPH 2CXKA 2HJFA 2HKFL 4MX7B 3TA3D 5I1HH 1YPZB 3STLA 1JGUL 4G5ZH 3BUYB 5IMOA 2XN9E 3QDGA 1U3HA 4HC1H 2MHAB 4JRXE 4PV8A 1G7JB 3GMQB 3L95B 3N1GC 4HWUA 1YYML 3OR6B 1NGQL 3FT4A 3OR7B 3B3IB 1KPUA 3QHTC 1CLZH 1CDCA 1QRNE 2AJVL 2GFBB 1KJ2A 1UH4A 2QR0B 3MO1A 5F96H 5HBBA 3CDGB 4PY8I 5FYKE 1LE5A 1ZVSA 4MNGB 3VXPA 3ABZA 2YPLA 4HIXL 5JA8B 3KLHC 3UROR 1BX2A 4WW2F 4Z7WF 4GRWB 2W0PA 5E4IA 3M1BB 2E7LC 4RGND 4XCYA 4ZOAA 4F57H 2ZUYA 5JQ6H 2X9WA 3GM8A 5DLMH 4K71B 4U7KA 1NPUA 1FH5L 1NKRA 4OD1L 4CN6A 2X89D 3P30H 5K9KB 5CEZE 3FB7B 4PBXA 3VI4E 1CCZA 1J7VR 1QO3B 1M7IB 3HUJA 4PRHD 32C2A 1OLZA 2F58H 3SGDI 1IVLA 2YKLH 3WSQL 3EIFA 1FO0B 1OD7A 5C0BD 3UTSA 1JF1B 4S1DD 4X80H 1A4KB 1XGUB 4OAWA 1A7OL 5EPMA 3TIEA 2BMKB 3MV8B 3OAUH 4YFLI 5CEXA 3K1DA 2DAVA 5TDOA 1A3LL 4X98B 1YJDL 1XF3A 4KTEL 2HH0L 3TBYB 1UH2A 4D94A 5CJXC 3K2UH 2HFGL 4HV8A 2B2XL 4PJFA 3D39E 4GSDH 4UBDC 4HCRA 4QRTA 1F13A 2BJMH 1FNSH 3KLSA 3T0AA 1BZQK 4GAYB 1S9XB 4I9WE 1PJ9A 1QSEB 3CXDL 1E4XL 4YHZH 5DEGA 1RVFL 1VGKB 2DQTL 3CK0H 5ANMA 5EC1A 3QDJB 4YXHH 3MXVH 1J9CT 4PTTA 3QQ3A 1N3NA 2NY4C 2ZUUA 3MGOA 2EZ0C 2R1XB 5KSAD 4FRWA 3RY6C 5DO2D 5IV2B 4X0KB 3MCLH 3CLFH 3DETD 1ZT4B 5HXMA 1QR1A 4WO4A 4XMKH 4LSUH 2OP4H 1AR1D 4LCUA 4KUZH 1YQ2A 4M61A 2AJXH 4R0LA 5F7DA 1XF1A 2V2WB 2R0KH 1CFSA 4PJ7A 3QDGE 1UM6L 4ODXA 3LQAH 4U1IB 3RWJA 1QRKA 4X4MA 4Y8DC 1NBYB 5HGHB 3KYMA 3SKJH 1AC0A 3QDMD 4FTVA 3HNSH 4U1LB 4Z8FL 3PL6A 2JIXA 2V2XA 5GS3A 3MOBH 2NY1D 4HEPG 4WY7H 3B9AA 1I1YA 4KKBC 4UDUB 3KJ4C 3ROLA 3NABH 2YPLE 3VGAC 3VWKB 3SGKC 2VDLH 3VFWB 5KVGH 5GRWA 3DGCR 3V7MA 4MA1B 4Q6IA 2OTUA 2P48B 3ULUF 1FG2B 1MCQA 5D1QA 2ZUWA 3AS3A 1F90L 2W65A 3SDCC 1EEUA 3MBEC 3P9MB 4ODTH 5HPMB 3PWVB 2PO6C 4H1LH 3H3BC 1VACB 7CGTA 4NKQB 5D9SA 2WM0A 3GI9H 1B6UA 1EBPA 4G8EA 5GRJL 4XC1L 1PVHA 2W60B 1FPTH 3DVIA 4H8WC 3QDHA 3ULVH 3WLWC 2Z8WC 1PY9A 2GUOB 3ME0A 3SJVB 3UTSE 1N5YL 3KPPA 3KR3L 4XCCH 3T65B 2XIDA 1GIGL 3M45A 3HI5L 3I2CH 2EDXA 1NEZA 4XPTH 3EAKA 4H0GA 4M1DL 5DWUH 2I07B 1MCWW 2L4OA 4OQTA 1YPZF 1G9ML 4FMFA 4F7MB 4G6KL 4PP1D 3VXMA 2IPUG 3F6LA 4J2XA 1KSRA 3O41B 1R5VB 2DM4A 3CC5A 3LEXB 2WWKT 1KTRL 2OR7A 4WCYL 3ILQD 4PJFE 1Q8MA 1ZEAH 4Z7UA 1S5HA 4F58L 1WWWX 2ERJC 3FN9A 3HC3L 4N0UA 4XCFH 2IG2H 5C0CD 4ZTOL 5GS1C 2HRPL 5MI0C 4N0CD 2FH8A 2V9TA 3LS5H 2A77L 4OV5B 4HJJH 4IOFD 1M7XA 2A73A 5A43C 2W0KA 4MJID 1OWRM 1EUUA 1N6UA 5F9OH 1MCRA 3I84A 3VMOA 4HXBL 4HLZH 2XTJB 4LCCB 4JFZL 1K3IA 3SGJC 3VRLE 1RZFL 1SYVA 3RTQC 2I9LA 1H0DA 5DA4A 2YK1H 4ZFFA 3GSUA 3QCTH 1SEQL 1DEDA 1OGAA 3BD3A 3FT4B 3LRSA 1U2CA 2O5XL 2VWEC 4TNVF 1IGTA 2EDHA 3QXWA 1X4YA 1ZLSL 3O0RL 1KJ2B 1T4KA 3VWJB 3MO1B 1F45A 3K0WA 3S7GA 3FQTB 3A67H 1LE5B 4YGAB 2J4WH 4NN5C 4PJ7E 4Y4KB 1BX2B 4P2OD 3WFBL 3QUZA 1FL3B 5DRNA 1N7ML 2XQYG 4X4ME 4MAUH 4H1LG 2OZ4L 1WZ1L 1Y0LA 3DVGA 4PR5B 4OF6A 5MEOA 5B39G 3SHSA 4LGPB 3PP4L 3OGOE 5HVWA 4EI6A 5GS2D 3QH3A 4NIKB 5FOJA 4M1CC 1T1WB 3D85D 4MXWH 2NQCA 2R1WA 1DQML 3HR5A 3HUJB 4FQCL 3U1SL 5HPOA 1DN0A 4XZUA 4I2XB 4L3EB 3TNNA 2EIZA 3VXTB 4B53A 1KPVB 4PJ5A 4KRLB 1OF2B 5FIEA 4HJ0C 2UZXB 2ADJB 2GSGA 4JPIA 4WWID 3CUPA 1CE1L 4HHAB 5ADOL 3KLHD 2H32H 2X5PA 4OAWB 4FABL 1JF5A 2D03L 3PWNA 5JIIA 1GGCL 1L0QA 4NP4L 5EPMB 3O3DA 3SE9L 1DBMH 2Z31B 3OB0K 1JYNA 2M2DA 4G6JH 5TDOB 1MI5A 4HIHA 1RFDH 4EDXB 1XF3B 4BZ1H 4KPHL 4BKLA 2A83A 3G6DL 2NY0B 4V1DE 3BW9A 4JKPH 2QHRH 3WE6A 5J6HA 1CU4L 1T83A 4NO0D 2JK5A 4QRTB 1I9IL 4M7LH 4PRDA 2BHUA 4E9LA 2A1WH 2YC1B 4XVJH 4F7EB 1I3UA 1ADQH 3X12B 4HLZG 1VA9A 4Q74A 2BVOA 2BDNH 5TGBA 5DEGB 5L2KD 1KJ3L 4PJAE 5ANMB 3S36L 3OKYA 5J11B 4OCYH 3BAEL 3QQ3B 1DP0A 2BK8A 4Y5XC 3MRGA 2HT3C 5GGSY 3GI8L 4XVUC 3VFSA 1RJYA 1MIEH 1OM3L 2X4RA 4WW2C 5EA0H 1MCIA 1XCQB 4OFPA 5K59E 3CU1A 3W39B 1G7LA 1NC4B 2JCCA 4X5XA 2YPVH 5TPWH 3VI4F 4UBDD 2Y7QA 4JHAH 3N9GL 5D7KD 5B38A 5ISZB 5F7DB 1DEEB 3G5VA 1MJJA 2E8YA 4RRPA 3L3HB 4KRMB 1CFSB 4RNRB 2AXFB 2B1AL 4R3SA 4APQB 2O26U 3HFML 3QIWA 2IBGA 3V0VA 2R0WH 1JI2A 1ITCA 3BYTA 3QCUH 1I9RH 4DEPC 4FTVB 1OPGH 5D72H 2V7HA 1AO7D 5ACMA 2NY4D 35C8L 1J05B 1QBAA 4ZDHB 3PL6B 2EZ0D 3IDXL 4L8DA 2WQ8A 1MRCL 3OKNB 1I1YB 4TVPD 3ROLB 3BP6A 4KVCH 2UV3A 3D9AL 5AD0A 1B4JL 3TN0B 3FONB 1DBBH 4HULB 4ZAKA 3CFEA 2DTML 3BZ4B 4LPTA 3MOAH 2OTUB 4RA0C 3L5IA 5DTFA 3MR9A 4I0KA 2W65B 5F88B 4YIQA 4BH7B 1L7TH 3MA7A 3I3BA 4HWBL 2XICA 4UIMA 1SEBB 3STZA 1EHNA 2H26A 4PJGB 1UQSA 2YBRA 4WFGD 4N8VG 3ALXA 1MWAA 4NM4L 4JGMA 1F4YH 1ZLUK 4OLZH 4G8EB 3A6CL 3UBXI 2FATL 4HUXA 5I1AB 3AY4C 3V0WH 1J1PH 3IJSA 1RJCA 1DVFB 2ZUVA 2DJ4A 5MEPA 4ZSOA 1FYTB 4JG0H 1IGIL 1SJHB 2ZNXA 3KS0J 2BNUB 3KPPB 2VDOL 4R4FH 3A6BL 3NFNA 4CMHB 5ESVA 1NEZB 4HEME 3OKLA 4FNLL 4JHWL 2PUQT 1UCBH 4M43H 2PR4L 3VXOB 2JB5H 1A14H 1NGWA 5TE4H 5I30H 4HUVA 4X7DC 4X9HA 3VXMB 1P6FA 1P84J 1MI5E 1F2XK 3DX6B 3MBED 1RUPL 3SDCD 3KAAA 1IZJA 2DQUL 2KZWA 3VD4A 2DLGA 2PO6D 2FDBP 2HVKB 4Z7UB 3EKCA 4G8GA 2GIYA 5DVLA 1AC6A 4N0UB 1RZJC 3C6LC 2F53D 1IBGL 4KQ4L 3EOTL 1D9KC 4PD4J 4PFEA 5LXGH 4K2UL 3LDBC 4K8RC 2XZQH 4X6BB 2DYPA 1SMAA 3RJQB 3C2AH 2FGZA 1UEMA 1EFXB 1QSZA 4S2SB 5CS7A 5CUSL 2FHCA 1T5WA 4L4TD 4D0DA 1Q9LA 4NFBA 1XIWA 5E2VL 1SYVB 1FP5A 1OTUC 1KCLA 3BFOA 4TULL 3TWCH 1IQDA 3GSUB 4MJ4A 4R7NA 1OGAB 4FQ1L 3ULUC 5EG6C 5I71B 3HE6A 5TH2A 3PWJA 3PJSA 5JXAL 5F7UA 1KIQA 1WTLA 3LRHA 1T4KB 1YEEL 3HUJF 5HYSA 1H9VA 2OXHA 4P59L 5T3XL 2IFFH 2X1PA 2WINB 1EPFA 1P2CA 1ZXQA 5BS0D 5DGRA 1H3WM 4QY8A 2NX5B 3RWIB 2BVTA 4KZEH 5I1IL 1RURH 4UILL 4Y4FA 2BXZA 4J3SA 3RTQD 4DGVL 1U0QA 3PGFH 1CD0A 2Y4SA 4FXGA 3T0EE 2OMBA 1O5DT 2R1WB 3ILPB 4LAQL 4NCDA 1UB5B 2EH7H 1I8MA 1T20B 3B8YA 2PW2B 5FM5M 4D0BA 4PJFF 4OIBA 3MLRL 3SDAB 4GT7A 3G6AA 3QWRA 4H20H 3EDFA 4OCXL 4LSPH 5D5MB 1IKFL 3LEYH 4PJ5B 2CDEA 5HYJA 2C4FU 2GSGB 3BSZL 3CUPB 4S10A 1NL0H 2YUXA 3UC0L 3KXFD 3ARFC 3PWNB 4NQXA 1IM9D 1YEHL 3E2HB 1T7XA 4QRQB 4NUGH 5T5FH 2CMRH 2XACC 5JUEH 4AK1A 1P7KA 2FB4L 3LIZL 4LSQH 3S5LG 1I7ZA 4MB3A 3VRLF 4HIHB 3G9AB 4ZSOE 3H7BA 4BKLB 1IFHH 3IDMA 3BW9B 5J6HB 1ETZB 2JK5B 4HBQA 5F1SA 3TVMC 2VL5B 3KJ6L 4K71C 3OX8B 1Q0YL 4DGIH 1H3UA 5TGBB 1FFNA 4QRPD 2WUCH 2VQ1A 2F5AL 4D9LL 3F7PC 4HJ0D 4PJ7F 1ZHNA 3C5ZA 4MJ2A 4P5TC 2OJEB 3UCRA 4GKSB 4Y19A 4U6VH 1F4AA 5C08A 3VCLB 3MRGB 5HHVL 5JR1L 3KPLA 5GJSH 3PG2A 5L6YH 4DUXA 5E2WH 3V2AR 5L0QC 2X9XA 5SWSA 3CH1A 2AXGB 2BSRA 3RIAF 4ISVA 2WBKA 3NZ8A 5KS9B 4KJYA 5EZOH 5DT1L 4G7VH 3CXHK 1J18A 5JOEA 4OJFL 2WP3O 4GBXA 4HKBA 2JCCB 1NH6A 1OAUH 4X5XB 4M3JA 4IJ3B 1AY1L 3LSOA 2GSIA 1F02I 2HWZH 5FDWA 3L5JA 4U2ZA 1WFUA 2A6IB 3ARRA 4JM2B 3WXWH 2VLKA 4Y2DA 1S7QB 4HKXA 3KPQA 1G6RL 1NMBL 5BW7C 5C6PB 4WUUA 5JA9A 4I77H 2NYYC 4OLVL 1OP9A 4KHTH 4L8SC 2KBGA 3VMNA 1MF2L 2YUVA 4F9PA 3WFCH 4KQ3H 1JPST 3SCMB 5CKGA 4CRPA 2HT3D 5ILTH 4L8DB 5I2IA 5ACZB 5HD8C 2FZ3B 3LH2L 4G6ML 5TF1H 4JQVA 4XB8A 2EYTB 3BKCH 3BXNA 3VFOA 3BKMH 1KF9B 5CEYB 5DZOA 1EZVY 1J5OL 1FFPA 1TVHB 1AJ7L 1I4FA 2KUTA 4XNUL 3CFEB 1AD0A 5F7KC 3D2UD 4XXCC 1V7MH 1U58A 3MR9B 1NMCB 5BVPH 3WFHA 3QQ9C 3RGVA 1F5WA 2RCSH 2ZJSH 3KPRB 4YIQB 3QT2A 1DUZB 4UIMB 1UQSB 2YBRB 4LPCA 1UVQA 4MXQC 4YE4H 5MERB 1QLFA 3VXRD 3MLZL 4HUXB 3LRGA 4NZJA 3GJFK 2GK0A 4BH8A 5DMKA 5K33A 1NCNA 2XV6B 1Q0XL 4Z7UF 2MTPA 4OGZA 4TSBL 1I3GH 3QHZL 1JRHL 4HT1H 3RVTC 4JFED 5K59F 5KSBA 1F4WL 4TOYL 1U3ZA 1ZVYA 1CD9B 5FKPB 2MQCA 2R15A 4NNYA 4DUVA 1TVDA 1DL7L 2VZVA 2LVEA 1K2DA 1NGWB 1YNLL 3X3GH 4HUVB 1RQ5A 3C8HA 1DCLA 1ED3B 1YEFL 3AMKA 1TQBB 1ZS8B 4QRUA 2ITDA 2VKWA 4MA1C 3WO3B 3RNKB 3C5SA 4OZFH 4G8GB 4IDLA 4J6RH 1D5ZA 4RBPH 1MEXH 4Q0XL 1MCFA 5ENWA 3WEXA 3FOLB 3C8KA 5DHVB 3ZYZA 1VSCA 1BBDH 3MODL 3H3PH 3L3KB 4M5YH 2EDEA 4HJGB 5GS0L 3D3VD 4Y19E 5C08E 1WCQA 3VG9B 4LLQA 3T0WA 1XIWB 3ZT5A 5DD1L 5GZNC 4K3JH 3FN3A 1IQDB 4XXDB 2ZCHL 5SWSE 3HMWH 1Y6MR 5DEZA 3ZE1E 3L5WA 3QUKA 3HC4L 5FCUL 1JPTH 1TCRA 4NDMB 4PGJA 3RI5F 4PBWD 3MRIB 3E6HA 4LCIH 2IMMA 1ZHBA 4NKDA 4OGAC 3CFBA 3GMOA 1RIHL 2GAZB 3MA9H 1I85C 2QKIA 4GG8A 2VLKE 3C6LD 5EO9A 1U91B 5SX5K 2AJYH 1D9KD 3LKRA 4WUUE 4K8RD 2YRLA 4U1HA 4OLEA 1SJEA 4L5FH 1ORSA 3JV4A 5AG8A 8FABA 2AK1H 4XNYH 5D2LB 5LJYH 2Y36H 2UVFA 4XVTH 1OTUD 4XNMA 1RZKH 2FX8L 4M7JH 1NCCH 3S37H 4GG6A 4OGYH 4N90D 1L9NA 2D2OA 1DQJB 2NZ9C 3L5HA 3NPSC 3ARZA 3ULUD 2XTJC 4D0BB 1U3HC 1GGIH 2CLVB 5K9QG 3GSXB 2CDEB 5HYJB 1EMTL 1NGYB 4GS7B 4FFVD 3EYQC 4QKXB 2P8PB 2FH6A 4NQXB 1KFAH 3EOAB 4OZHE 3ARPA 1RMFH 1NDMA 1E6JL 1MCCA 4QTIH 1DDHB 1VDGA 4R96A 4OZFG 5JW3H 5E2JA 5FM4A 3GNMH 3I6GA 4O2EA 1BEYL 5FGCB 3H7BB 3IDMB 2OQJB 3PGDA 4L3AA 4DQOH 3MZGB 5JIKA 1NCAH 4MCYA 3MLVH 5DEFA 3GMPA 2R23B 1GGBH 1GSMA 5KSBE 4YUEL 2JCCF 3WUWG 5J1SC 3E1F1 3IRZA 5EU5A 1YEJL 1BPVA 4JGUA 1FFNB 5E99L 3NA9L 4GUPB 5IW3A 1ZHNB 1QZ1A 2C7UA 2GHWB 2O93L 3ARFD 2X7LA 1D5MB 5CINH 4HWZB 5DRZA 3OKMB 2BX5A 5M94B 1XF2B 3IXAB 1IAOA 2WWMC 1RD6A 5CJOL 1JHTB 3HLAA 4KJYB 3ROOB 4XPFH 1IAIM 1IAIH 5E56A 4R90H 4GBXB 5IESH 4HKBB 1J1XH 3RQ3A 1NC2B 1QKZH 5FDWB 4I0PA 2NTFB 4MNQA 5IQ7H 1MLCA 3NCCB 4Y2DB 1UJ3A 1II4E 1WF5A 1KEMH 1PDKA 4ZUSB 3ECBA 4P5TD 3VU2A 3UZEA 2BRRL 1FFQA 4DK6A 3MV9A 3PQYA 2Y1VA 2G5BA 3P4LA 1CLCA 3FO1A 2NNAA 4YXKL 4NNPL 3O3UN 5I1HL 3TIDA 2VN7A 4G5ZL 3VFOB 2R69H 2WWKO 3HAEA 4HC1L 4Z78B 1JWMB 2N7AA 4UV4H 5B8CA 5LVEA 2DLEA 3MV8D 4U49A 4U6YB 1JHKH 1INQB 5FYJE 4C54A 2QQLH 3JWDC 2CLRA 3DOSA 4M8QA 4WO4C 1PLGH 5E8OA 4MHHI 1CLZL 3V6FA 2Y5TB 5GGTH 5MP6H 1NLDH 3OKOB 5F96L 3F7RA 4R0LC 3ZDXE 1QLFB 2JJSA 2NYYD 2YRPA 4GG6E 4NQEB 1R3KA 1YEDB 3I6LD 3UPAA 5D2NB 3SQOH 5CAYB 5IROA 1QSED 1WZMA 1GOFA 4UTAH 3MCG1 3SKOB 1JHLH 3HZVA 4F57L 4DVBB 3QDJD 5JQ6L 5DLML 1CXKA 4M6MH 3ZYIA 2YD5A 2XN9D 3PL6C 1H5BB 3P30L 2AW2A 4QXWA 4NNYB 5F7EL 3MGAA 1OL0A 3N06B 3G5ZA 1K2DB 2FYYB 2BVEA 3QQ9D 3ESVF 4RMUA 2Q1EA 3PABB 2F58L 2ZCLH 2HT4C 1YJDC 1CXIA 1QRND 1T2QH 5F3HB 2YKLL 5HDLA 4Q6IC 1MFEH 3C5SB 1XZ0B 3GHBH 4U1SA 1OSPH 4X80L 5FYKD 1W8OA 3DO3A 4PRPB 4JFOB 5D1QC 1G6RB 2J1KA 1MFBH 4UU9A 3GDBA 4PJBA 4XNQA 3WEXB 4HS3B 3GSNH 4RFNB 3C8KB 3IKCA 5K9OB 4U0RB 2C5DC 2X4OB 3OAUL 1S7VB 1F97A 4YHMH 4HBCH 4JANB 4XHQA 1DUYA 4QHNA 4BSWB 3CDFA 3K2UL 4GSDL 5ICZA 3TESA 1MCWM 2BJML 4HC1A 1FNSL 1H8NA 4YBQD 3P4NA 4GAJH 4CMHC 2DB8A 4JREC 3BPOC 2IADA 3MYZA 2HA1A 4KDWA 1WQVT 5BXFB 3DVNB 4YHZL 3CD4A 4P46B 3CK0L 3EYOB 2MWCA 4NKDB 4YXHL 3MXVL 3CFBB 3NFPA 4MNQE 1WZLA 2QKIB 3T77A 5EO9B 2YXMA 3M17A 5IHZA 3MCLL 3CLFL 1J8HB 3HMXA 3PDOB 3QRFM 3EJZC 8FABB 4DJMA 1N2RA 4LSUL 5GRVK 2LFGA 2OP4L 4Y88A 4I5BA 4KUZL 2AJXL 4XNMB 3SJVD 1CGUA 1BMGA 4N0FB 4UOJA 3OKEB 5H8DA 4WI8A 1ZGLM 2R0KL 2P44B 3LQAL 4M7KH 4WFEE 4Z7VE 4X4XA 2ZSVB 1VHPA 3B6SB 1EGJH 5EUOA 4OGAD 3SKJL 1G7PA 3MRLA 2ZG1A 3HNSL 4J8RB 4X99A 2P42B 1ZSDA 1VENA 3MOBL 4HDIB 3CIQA 5C0ND 4KU1A 4WY7L 2DLHA 5BOZG 1U8HA 3NABL 4R96B 4NN7B 3FQXA 2VDLL 4F7TB 5KVGL 4YPJA 3QUZC 3H42H 3INUH 1KNOA 4X9IA 5C3TA 2W59A 1KV3A 1ZHKB 3UTOA 5IP4A 3SKNA 3VFPB 3VXNB 3GMPB 2EE9A 2NZ9D 4ODTL 2WIMA 1T1YA 2XTJD 1T0NA 5HY9A 1ZHLA 1KG0A 3GMNA 5F97E 2E7MA 1VGEH 3QI9B 3GI9L 1X4ZA 4PLKC 4EUPB 1HXMA 3UX9B 3ULVL 1FPTL 1OGTA 3EYQD 5IUSA 3N1PC 1MUJA 4GAGH 4C56A 3G04B 1A2YB 3FQUA 1JPGB 4NUJB 1EH9A 5DRZB 2W0LA 2OI9B 4OZ4B 4Y16B 1JWSB 3ARGA 4XCCL 3RVUC 3LKPB 2YPLD 3I2CL 3R1GH 4Y4KD 4PJBE 4XPTL 5F6HJ 1XGPA 2P7TB 5DWUL 5C71A 1A7NH 4HGMA 2X4TB 1C12A 5ERWA 3SO3B 4HZLA 5C0FB 1MCSA 2YSSB 3X13B 3GUTB 1K9TA 4I3RL 4OLYH 2DQGH 4P2RB 4U6XB 1UJ3B 3TBTB 1ZEAL 3OB0H 3VGFA 1AGDB 4S11A 3O4LA 1T83C 3DV6B 4RFOH 4NC2B 2XY1A 4M7ZB 1NGXA 1ZA3A 3ECBB 4XCFL 1KCVH 1HHGB 4G80A 3AROA 1IKNA 3GSRA 1FVDB 3MV9B 3PQYB 1UKSA 2NNAB 3LS5L 3WLBA 2GTZA 4MQTB 4HJJL 3UTSD 3VA6A 2WWMD 3LKNB 5F9OL 4QRSA 4U33A 4MJ6B 2Q76B 4V2CB 5TE6L 2QLVB 2D7OA 3O6KH 3VD5A 1GCFA 2YK1L 4R4BB 4XCEA 2Z31D 3QCTL 5KSBF 4M8QB 3BIKA 1W72H 5E8OB 1VFOA 4QOKA 5EU4B 3R8BB 1N59B 1KIPA 3QNZA 4IJ3C 4YHLH 4HAGA 1RJLA 5JORB 3A67L 2J4WL 3SGDH 3O6FB 4LMQE 3WN5B 5IVZA 5CD3A 3CFJA 3MSPA 3QIWC 3GM0A 3P4MA 1A1NA 3UZVB 5EUOE 1VB9A 1C7TA 2AVGA 3GB7A 1OVZA 3ZSTA 4O4YL 2NY5H 2CRIA 3KPSE 3FB8A 3HN3A 1WZKA 4WI7A 3Q6GL 3C2SA 4MXWL 5F8RC 3V7AG 2JLLA 2IWGA 5HGAB 2ZPKH 1Q9WA 5H2BB 2YEZA 3HC0B 1V7NL 4WO4D 1N5AA 4NQDB 4HXAH 4ZAKC 1BGXH 3LY6A 4GJTB 1NC4D 3HZYB 5HI3D 4S1QH 1NMCC 2XQBH 5F89A 1MLBB 3VRJA 1TZIB 4APQD 3IKCB 3EDJA 5JIPA 3V52H 1DBML 1TTFA 2GJZA 3WL9A 4G6JL 1CGSH 4FTVD 1PKOA 4BZ1L 1WITA 1YMHA 2X41A 3PL6D 3QXDA 2JIXD 1AHWA 2QHRL 4JKPL 5IIEA 4WGWB 3MOQA 5MENB 3MNWA 2WQRA 4M7LL 4EOWH 2A1WL 3AS1A 5T1KA 2ZSWA 3QULA 1F42A 2IADB 2X4PA 4WEUD 2ENYA 2UY7A 4XVJL 3AVEA 3TN0D 1ADQL 3PHQB 1JZ6A 2BDNL 2HT4D 3MTRA 4R2GC 4GG6F 1KTDA 1WIPA 4OCYL 5D1QD 3EDDA 3UYPA 4U1JB 4G43B 2BNQA 5DHXB 5HVHB 3DPBA 3T77B 1RZGA 2E27H 2J6EA 3M17B 1MIEL 3CSYA 5J1AA 3O4LE 3W11C 3VFVA 1T7VA 4D3CH 3U46B 3GBMH 5IFAH 1JYVA 1BOGA 2L7JA 4YFDB 1PYWA 2AV7A 4IRZH 1JPSH 1KXQE 5E5UB 1FYTD 4HWNA 2YPVL 5TPWL 4JHAL 1HSAA 3QG6A 3KPOA 2YA1A 4UUJA 4JEGB 3FB5A 4E42B 5HGGS 1U8QA 2Y25A 3DURB 1XIWC 3BEWB 1MHPH 3SN6N 1DQDH 2EKSA 2R0WL 4IHOB 4M1GH 3QCUL 1I9RL 4CW1B 3VXMD 4QHMA 1OPGL 5D72L 4JRYA 4QOKE 3K81A 2XRAH 3HE6C 3LAFA 1ZSDB 1W2KT 1V05A 2UYLA 5D6DA 2P45B 4JFPA 4KVCL 3OGCA 3OXRA 3CVHH 3EJZD 1DBBL 4JKKA 1IMHC 1KNOB 2AEPH 3WKML 1OP5K 1EDQA 2OR8A 3MOAL 2CJUH 1CI5A 5IMLA 1KTLA 1A7QH 3SKNB 1EFXD 4OLXH 3I02B 4Y4FC 4WVRA 1L7TL 1T1YB 2HMIC 1KLGA 2IH3A 1T0NB 5I66B 3L6FA 3GMNB 1FLRH 1FDLH 4KAQH 2Q6WA 3CPLA 1F4YL 4WTWA 4OLZL 3HZMA 3LCYA 5D7LE 3V0WL 1OGAD 4X6FA 1J1PL 4D9QE 1TETH 3MLWH 4C56B 5HHPA 4FZEH 1LEIA 5ESAB 3W9DA 3LN5A 4QYOA 4QRRA 5J3HC 3HA0A 3ARGB 2P5WA 4V2BA 3BGAA 4LVOC 4R4FL 3FRUB 1S7TB 2PXYA 3DWTA 3F7VB 1UCBL 1XGPB 3QUZD 4M43L 4MQ7A 2NX5D 2JB5L 1M1SA 3IKKA 5TE4L 1VFBA 4DZ8B 3S98A 1ND0A 2EDKA 4I8DA 5FO7A 3SPVA 1WCBB 4LVHB 3HNVH 3HHRB 4KROC 1NGXB 3KYNA 3MJ6A 5JW4R 4G80B 2H1PH 4HKZB 3SDAD 1IGMH 1HH9A 1DE4B 4JCMA 1Q9KA 5LXGL 4PJ9A 1MRFH 2XZQL 2GTZB 4PJ5D 3V5KA 3C5ZC 3C2AL 2BSED 1KB5B 1TCMA 4AZ8A 4OCRH 2MQ3A 1BIIB 3FTGA 4PV9B 3VFMB 3X17A 3RY5A 1VESA 1MCPH 3ARDA 4J3XA 4R26H 3TWCL 1GXEA 1I8LA 1MI5D 3T4YB 1NMAH 4PJXB 1G9NC 5D7IA 5JDSB 3F5WA 1X5ZA 4QOKB 4OI8A 4GBXC 1KIPB 4LKCB 5KAQG 3VRIA 5CP7A 1RJLB 3QJHB 4Q97A 4H1LB 1S78C 2ED9A 2IFFL 4O2FA 1VEOA 1NGPH 5IVZB 3RPIA 4Y2DC 4OLWH 3LQMA 5I76A 5GSRA 5CD3B 4PJCA 4ELME 3CFJB 3WS3A 1KB9J 3OXSA 5HHOA 1KBGH 2EDNA 1C7SA 1K3ZA 1NFDB 4PJBF 4U1KB 1T0MA 4KZEL 1KIUA 1RURL 4F9PC 1UCTA 1EFQA 3H0TA 1MJ8H 1GHFH 1MY5A 3QZWG 4J12A 3FB8B 1C08B 2Z35A 3P40A 3BI9X 3PGFL 4NO3B 4JQVC 2RJMA 3U2SB 4F8TA 4PRIA 1YMMB 4H20L 2QSQA 5GZOC 4YJZL 4LSPL 3LEYL 4LL9A 1KELH 5SWZB 5IW1A 3NCJH 3UDWA 4N1EA 3RGVC 1NL0L 2F15A 3IFOA 2HRLA 3VRJB 2DLTA 2C3XA 5E8PA 2QBWA 3QIWD 4NUGL 2I60H 5T5FL 5JHDB 2CMRL 4DVRH 5JUEL 5JOPE 4AEIH 1MCEA 4LSQL 4LCWA 4KI5D 1LK2A 5GISH 5ICYA 1J1OH 4O58H 3NGBB 5GPRA 3S35H 1IFHL 4K7PH 4WHYH 5A16A 1AHWB 3BH8A 4FFZH 4WI5A 4QRRE 1FSKB 3GJFH 2EICA 2P5WE 3MNWB 3QFDA 2EC9U 3AAZB 3STBA 7FABH 4JY6A 3VGDA 2EEAA 2G2RB 4DGIL 4RA3A 5IQ9A 1U42A 2WUCL 1ZA6A 1J0YA 5IVNA 1NFKA 4KZDH 4JFYA 1FZKA 1JWUB 3VD3A 2EYSB 4U6VL 2BNQB 2WV3A 1CWVA 5GJSL 1RULH 1QVOA 3FCTB 4HS8H 5EUOF 4Z77B 5L6YL 1HILB 3P2TA 5E2WL 3VFVB 5J1TC 3IB4A 4R4NC 5EZOL 1BOGB 4G7VL 2AV7B 1KACB 1OAUL 3MNVA 4K7FB 5GIRA 5A3IC 4WI2A 4OM0H 1F8TH 4UUJB 2HWZL 3IFNH 1HQRA 3FB5B 4W4OA 3OJ2C 2PF6A 3WXWL 5ALBH 3Q6FA 1GYAA 1I7TA 2WUBH 4KMTL 3OJMB 4H0HB 2ICES 4R2GD 4I77L 4LLAA 5ADPH 4KHTL 4WI6A 4X8JA 4PJHB 5IBLD 4P0DA 4WEBH 4KQ3L 3WFCL 4U6HA 3TH3T 4JRYB 3CZJA 3T0VA 5HDBE 5ILTL 4ONHA 2NXYB 2H32B 3T08A 5DVOA 3W11D 3TLRA 4G8GD 3IS1X 5TF1L 3B2UC 3BKCL 5CFHA 2SEBB 3BKML 1FNGA 4YBLC 4Q9RH 4GH7B 3VA2C 5I8KH 1ZANH 3U7AA 1UXWA 3FT2A 1CGYA 2PYEA 5HHOE 4KC3B 4LFHG 3ZKNC 1V7ML 1UWGH 4N8VB 2DYPD 3IGAA 1CT8B 2FECI 5BVPL 3HG1A 4OBSA 2RCSL 2ZJSL 2IGFH 2R2HA 3LMJH 3L6FB 4LDEB 3GIVB 1XIWD 4NKMA 2IPTH 3QR2A 4YE4L 2CUMA 2Q6WB 1XR8A 1EXUB 3CVIH 1UT9A 4GRLB 4NPYA 5DFTA 2W07A 4ZUWA 3RZWA 2ICEA 5HHPB 2ADGA 2DJSA 5FUCE 4P5KB 5IHUH 3ZHLA 1I3GL 2ILLA 2H6PB 3SGEI 1Z9OA 3FQRA 4HT1L 5HYQB 3ALWA 1OQOA 3QUYA 4Q9QH 5I17B 5AYUH 3EFDH 4POYA 4WDIA 1MCJA 4K94H 4NNXA 1KN4H 1QTYT 4UTBH 5ETUA 4J1UB 3OSKA 4MZ3A 3X3GL 4XPBH 2H8PB 5CSZA 4LCWE 2Z4QA 3IDJA 1LQSR 3TA3A 2HMID 5E5RB 5GS0C 4JDTH 5IF0A 3SPVB 3WFZA 3NFSH 2CDFA 4J6RL 3WIHH 2NY7H 1MEXL 3RWEA 3QWRD 5EO1B 3I6KA 4PJ9B 1BBDL 3HR6A 3H3PL 1S3KH 5HYJD 4M5YL 3BGFB 4LHUG 1KYOK 3V5KB 3PV7A 2AI0H 3CFDB 1AFVH 2B4CH 3ULVF 3FTGB 3VD9A 5AEAA 3ZHDA 5C09B 2OI9C 3VXSB 3UBXG 5DI8B 3HMWL 3RL1B 1JPTL 4K7PX 5D7IB 4I18A 1WBXA 2XZZA 3PP3K 4LCIL 4DK3A 1MCBA 5DDHB 3HS0B 1F3JB 1U8PB 2F8OA 5EH1A 4XCNB 4I0PC 3MA9L 4P9MH 4O02H 4O2FB 4YGVB 5GRXG 2XKNB 3RPIB 3WNKA 5I76B 5CJQL 2ZZUT 2AJYL 4ZS7H 4PJCB 1UJ3C 3WS3B 5CMAA 3OXSB 3ZZ1A 2XY2A 1PQZB 1K8IB 3C5ZD 3BZEA 1T0MB 3VXQA 4L5FL 4Y19D 2AK1L 4XNYL 4NRXA 3RJDA 1WICA 2Y36L 4XVTL 4XPGH 1RZKL 1CG9B 1VEPA 1NCCL 4M7JL 3S37L 4OGYL 3SY0A 4YHPA 4G3YL 4LDLB 1CD8A 1I3VA 1DQLH 4NZTH 4PRIB 4B7IA 1GGIL 4IMLB 5B8CC 4GBXD 4TUJA 4YHNA 4YLQT 2Y9RT 1QR4A 3AU1B 2WBJA 3HG1E 5AZ2H 2FX9H 3QAZB 2L7UA 1KFAL 2VLKD 4H5SA 4Y2DD 3IFPA 4HIIA 2Z91A 5E8PB 1RMFL 4WI4A 4WUUD 5BZDB 2GK2A 4QTIL 4OF5A 2FO4A 2JJSC 4ACPA 5DZNA 5I75C 3S34H 5E7BA 1OAYH 1LK2B 5JW3L 5ICYB 3GNML 2CIIA 5IROC 1L9MA 5E03A 1M6OA 4DQOL 4NHUB 1NCAL 1XFPA 2BZDA 3QFDB 5D71H 1CVRA 3MLVL 1GGBL 3B9KA 4JY6B 2VH5H 2XG4A 4L9LB 2EO1A 1P7QA 3TV3H 5GZOD 3BP4B 5BV7H 3UYOD 1U8NA 5F44A 1S9KC 4PJDB 1PG7X 2WK2A 3RWDA 1MCKA 3C09B 1FZKB 5F1OB 5EORH 3RGVD 2X44D 3IT8D 2RGSA 4D8PA 4ZD3L 5CINL 2X4QB 5C0EB 2PN5A 4BSVB 4BYHA 3HB3C 3ZL4H 4P9HH 4NQED 4XP5H 1GAFL 3LKOA 2I24N 1FLTX 3KVQA 3MRDA 5SX4I 5EIQA 3JV6A 4XPFL 5IKCB 1IAIL 3QDMA 4Q9BA 4R90L 4YDLC 4ZOEA 5IESL 4CN4A 2BY3A 1J1XL 3FHAA 2BSSA 5MEQA 4JJ5B 1QKZL 3H6JA 1JGEA 5E9DB 3V4UL 4QXTA 3TO2A 5IQ7L 5C92A 3PF2A 4OKDA 5EBMB 2BVQA 2YMXH 4NKOA 4TNWF 1KEML 4U1NA 4P4RA 5EIVA 1A3QA 4LPWA 5DRWA 5GSVB 1ES0B 4U6HB 5E94A 2GYSA 1SY6H 2DTSA 4JLRB 5CHNA 3ZDZE 4ONHB 1Z6JT 2ZOLB 4ZXBB 1QFOA 4WWKB 4UNTA 3IDYC 3AS0A 2R69L 4FHBD 4PJIA 3KPNA 1QPPA 2P43B 5D4QA 1S7WA 4UV4L 1QA9A 2PYEB 5A3ID 2AEIT 4Y1AB 4ORGB 5J89A 1JHKL 4IDJH 4DOHB 4O9HH 2APWA 1BQLH 3S8WA 1PLGL 4NZDA 4OZIA 4XVSL 2R2HB 5HDOA 3M8OH 5IMKB 4NKMB 3MFGB 5GGTL 5MP6L 1NLDL 2BNRA 3ZMRA 4ENED 3MRRA 3SQOL 2QQNH 3O3AB 4LLVB 4YDJA 4RAUA 1L6ZA 4UTAL 1LD9A 1JHLL 2ZUSA 3H2WA 2VLLB 4HUMB 3MJ8A 4ZUTA 3FQRB 3B2UD 1KJVB 3MRCA 4HUKB 2R29H 4M6ML 4JO4H 2KZ1B 4F33B 3TCLB 3QUYB 3IU3A 3L3OA 3C5JA 2I9TB 1F11A 4QHLA 3BP7A 4NNXB 2R2EA 5C0CA 2ADIA 3VH8G 4I4WB 1DBJH 4P2QB 2VZ3A 1UEYA 5FYJD 1J8HD 5CSZB 4MMXC 2ID5A 4OFYA 4KWUA 4UT9H 2ZCLL 4MJIA 1T2QL 5IF0B 4OF7A 1MFEL 1TFHA 5JNYB 3GHBL 4H88H 4QNPE 1OSPL 5D7IF 1P5UA 5HDBF 1MFBL 2DS4A 1AR2A 5C07B 3RWEB 3F7YB 3GSNL 3OG4B 5HGBA 4Q2ZA 5AYQA 4RAVA 3I6KB 5DVMA 1NDGA 3QJFA 4JFXA 2D7PA 3SDYH 2A6KB 4J4PA 4YHML 4HBCL 3DUSA 1ZVHA 1FFOA 4PJCF 2DLFH 3T2QA 3DUUA 1ZOXA 4M4RA 4PJ8A 3UJTH 5FK9A 2QADC 5CZXD 3AB0B 3GBNH 4UI2A 3ARGC 2BRQA 5GGVH 2LE9A 3ARUA 5EO0B 1QHOA 1E4XH 4GAJL 2YUZA 1ORQB 1WFTA 2N7BA 1A6AB 2DQTH 5E6IA 1WBXB 3QDME 5GS0D 4AT6B 2R8SH 4R9HA 4EJ1C 1JZ2A 2OXGA 2VYRE 4MCZB 5GGTA 5DK2A 5KJRH 4S1SH 4CU6A 2VABB 3B9DA 4WI3A 1JV5A 2APTA 5J4MA 3QI9D 3LQAC 1F00I 1A64A 1HN1A 5L7XH 1IKNC 1JN6B 1A0QH 1E4KA 3IF1A 5LCVH 2EDLA 3UTTA 1UM6H 4D2NA 1FORH 1PD6A 4M7KL 3BN9C 1OQXA 5EN2B 4BUHA 2CLZA 2UY6A 4TUKH 4NC1E 4CNIA 4YHNB 2AGJH 5EWIH 1EGJL 3E6FA 3K1KC 2WBJB 3U9UA 4EXPX 3O4OB 3WFDH 3UTZA 4PYGA 4NO0A 1GPOH 3BGMA 4OZFB 4HGWA 4OZIE 4IRSA 5I18H 2R2BA 3FB6A 1ACYH 2MCPH 3IFPB 2Q7NA 1BLNB 2HYMA 2MKWA 3MV11 3EGSA 4PY7A 1CGVA 2FO4B 3GSNA 2DIAA 3U0TB 3QRGH 3JVGA 5IEHA 3MV9D 3PQYD 3H42L 3INUL 3WUWB 3ULVC 3S3JA 1U3JA 1M6OB 4K23H 1QSFA 4QF1B 5HHMB 1KCUH 4RMRA 3V6ZB 1HOCA 1AXSA 1A9EA 4RQQB 5GS2H 1UM4H 3D69A 1P7QB 4WFED 2YUWA 4BZ2H 3Q48A 3ZYJA 5EIIA 4LP5A 5C0CE 2OL3A 1VGEL 3ETBF 3K74B 4PG9A 5F7YC 4Q6YA 3SQBA 3O3BB 1TNNA 4GAGL 4MMZC 4JFQA 1BQHA 4MJIE 1NUNB 2ENSA 3TBSB 4D8PB 2MMXA 5IB5A 1MAKA 3D18A 1DLFH 4PLOB 1YC8A 1MJUH 3K4DA 3CX5K 3R1GL 5CGMA 3MRDB 4NFDA 4KXZH 1A7NL 1X5FA 4RMQA 2BC4B 2IPUK 3H9ZA 1YQVH 1JGEB 5DD0H 1ZK9A 5C6WH 3NGBC 4OLYL 4KUCF 2DQGL 3MRJA 2EDDA 1AHWC 3QUMH 4OF0A 3SEPA 4JHZA 1ZGLA 4LRNH 4FQQA 1RI8A 4RFOL 3LPWA 4NFCA 2GT9B 4U1NB 4QXGH 1XR9B 1BP3B 1G84A 1KCVL 1NJ9B 2MCG1 1N0XH 1T0PB 2A77H 3F62A 3VDCA 2BY2A 4NQDD 5CHNB 1TVBB 4XBGA 4DFHA 1BJMA 1SHMA 2IH1A 3LD8C 2A6DA 4AM0A 3HB3D 2ICWB 5ID1A 2AV1A 1A6PA 4PP2A 5DJ8A 2ICCA 4ZUVA 1IJ9A 4PJIB 3J8F7 5C9JB 5ITFA 1I8KB 5E8NA 3O6KL 1QA9B 4CGTA 4RIRB 4OUUA 2D31A 1M71A 3QQNA 2AK4B 4MYWB 1UG9A 1W72L 1GGTA 1X4XA 1EO5A 5T1MB 3GHEH 3MV01 5D7SH 2BNRB 4YHLL 5B3JE 5DJ0A 1CLYH 1MVFA 1A6ZA 1G7QB 4RAUB 4YDJB 3ZE0E 1J0ZA 1XGTB 1AQKH 1EVTC 4JZJB 4PB0H 3JBG7 4LVNC 4LF3A 4ZUTB 5IWLA 3IDGA 4BSJA 2E9WA 4OQ1A 3L3OB 1I9JH 2NY5L 3WNOA 1WBZA 4QHLB 1IC7H 2NXYC 2BVPA 3BP7B 2R2EB 1OARH 2F53A 3PHOB 5D6DC 3TYFA 5BVJB 3ARWA 1ZLWK 4HLJA 4LEOA 2ZPKL 4X6DB 2EYRB 3BDYH 4X6EB 4WU5A 4HXAL 1BGXL 2YHGA 1QSFE 4S1QL 4OD2A 4HD9A 2DM2A 2XQBL 3ZDZF 4PB9H 5KVEH 3BH9A 1OP5H 3VFGH 3RIAK 3GGWA 4OD3L 1WC7B 1NDGB 3QJFB 1WFNA 1UXSA 2DIJA 4KPHH 3GMLA 1CGSL 1QYGH 3R0MA 3DUSB 1FFOB 5BCAA 3DUUB 4MHHG 4PJ8B 5FK9B 4ONFH 5GHWL 4H25B 3H8NA 1Y6NR 1HDMA 4C83B 2VKXA 4EOWL 4RMVA 1JK8B 2HTKD 2PXYC 4FQIH 4NQSB 5JPNA 1BREA 5E6IB 5BO1H 9CGTA 1BFOA 1REIA 1X7QA 3MV7B 2YD9A 3DROB 1W72A 3L3GA 5FKAA 3SE3A 1A3RH 2YZ1A 2VDMH 5FHBH 1EBAA 4OKVB 5DK2B 4BQ6A 2E27L 1VERA 3S97C 3QEQB 4D3CL 5KSVB 1MAMH 3GBML 4BK5A 5IFAL 4P3DA 5EU3A 4C56D 3MUY1 4IRZL 1JPSL 1D5BA 4N9GB 1IAKA 1YNTB 4WV1A 4GKNA 2QADD 4PJ9C 3UTTB 3KXFA 3IAPA 1EHXA 3ARGD 5GRYA 4NZUH 1D6EB 5F7NC 4U1MB 3ARDC 4QNPF 5JLZA 1DQDL 5I9QC 3E6FB 1I8LC 3U9UB 5IJVB 3VXUB 3BGMB 1HEZB 3FFCB 4HGWB 4C59B 2XRAL 1MH5A 2WSKA 3FB6B 3QEUA 3D9AH 4PGEA 4M6AA 3O4LD 1T2JA 3EGSB 4PY7B 5J06A 3GSNB 1KLFA 1I1AA 3CVHL 5IEHB 4IIQA 2AEPL 5T3ZH 2CJUL 1QSFB 4X9BA 1EAPB 1A4JB 1A7QL 2J8UB 3MRBB 3KPMA 1A9EB 1W0VA 3DXAA 4OLXL 4IMKA 4NM8H 4FN0A 3BN9D 2VDPH 1OY3B 2FBOJ 5EIIB 3AM8A 1FLRL 1FDLL 4KAQL 2F53E 4PG9B 5D8JH 4EN3A 4Q9CA 1TETL 4CVZB 3MLWL 5KN5B 1CTOA 3U7WH 4FZEL 4QOKD 5FUCC 5DJ2B 3K3QA 2VMFA 3IJYB 3GBLA 5GGUB 1F2QA 2Q87A 2J5LC 3UDWC 3AREA 2CK0H 3QAZC 5IFJB 5IBTH 4XHJC 4R7DA 3JTTA 2EECA 3OJDA 2G75B 1GZQB 3ULVD 3F65A 4LSVH 1CLOH 4R8WH 5CBEB 4PJIF 1EX0A 2EDJA 5DK0A 2OSLA 2XA3A 4XI5C 4JPWH 2Y07H 4KJQD 4KQ4H 1OHQA 4GOSA 4N1CA 4OZIF 3D2UA 1IRAY 1KGCD 2H1PL 3AUVA 4BFIA 1YMMD 1IGML 1CE6B 3QNYB 2Z8VC 5JDJA 1MRFL 2IH1B 4NN6B 3RX5A 5SWZD 4YNYB 1PBYA 1TJHH 4AM0B 5DVKA 5ID1B 2AV1B 5CIPH 4OCRL 5E2VH 1TPXB 3TPKA 1MCPL 4MDIA 5A2KH 3RL2B 3CVHA 5C0AA 1LE9A 4R26L 4HK0B 4OUUB 4PRBB 4D0CA 3MCKB 1OT1A 1J0IA 1NMAL 2QEJA 4FP8H 4LARH 4WJ5A 4A6YH 4JFEA 5T3XH 3VGBA 4OZGA 3LVEA 4U1GB 3KXFE 5FOBA 2DF3A 5DJ0B 1E6OH 4NHCL 4W4OC 3QO0A 1ZGLP 5T1KD 1BJ1H 1NGPL 4OLWL 2NMSA 3QZWA 5DMIH 4ODWB 4O51A 3H9HA 1KBGL 1NCWH 3OB8A 4XGZA 4LF3B 4ODUA 4QT5B 1CDIA 1MJ8L 1GHFL 2BNQD 3TZVA 3L3JB 3QEHA 1T21A 1WBZB 2VDRH 1VPOH 5DJCB 2EE2A 3U4EA 3H9SB 1G6VK 2OJZH 3DBXA 3OQ3B 4B50A 2F8VA 4LLYA 5EZLA 3BPNC 2GJ6B 4KK6C 3D3VA 1WK0A 1AGBA 3SDXB 1MFNA 1KELL 1MPAH 3WFEH 4HMCA 3NCJL 5C0GA 1N4XH 2FR4B 4OD2B 2VXTH 5D1XB 1WLHA 5E8EA 3RWCA 2VNCA 4Z7QE 3BH9B 3GSWA 3RWHA 3GGWB 4WTXA 2I60L 4DVRL 4G8IA 2C4XA 1VADA 3G6JB 4AEIL 1HKLH 4JB9H 2EIDA 3VG0H 5GISL 1H3XA 3N85H 3P0YH 1J1OL 4O58L 1A1OA 4JRYD 4GXVH 2YD6A 1X5YA 5I0DA 4K7PL 4FFZL 2NXYD 2APXA 1HDMB 1X5AA 7FABL 1UB6B 1RZIA 3QUYC 4RAHA 3WBDA 4UT6H 1S7XB 2VQUA 2ZOKA 1BFOB 5B3JF 5FV2A 3O3EB 1W72B 3OL2A 4KZDL 3WIFA 2FD6H 3C8DA 4Z0BH 2GI7A 3TA3C 1RULL 4HS8L 3PWLA 3EFFA 3ZTNH 3U36A 4YBHA 2CDGA 3K2MC 4GRLD 4AIXA 5I1DA 1P9MA 5EU3B 2W0FB 1LEKB 1D5BB 4X83A 1IAKB 5HSFA 1ZE3C 4GKNB 3BT2H 2IANB 4X5WB 4OM0L 4K3HA 1F8TL 2IAMB 4NCC1 2JB6B 2P5WD 3BZFA 3IFNL 3SKMA 5ALBL 2FNBA 3VXRE 2PXYD 3CLEL 4KK5C 4OLVH 2WUBL 1LO5A 5ADPL 4MA3A 5BZWA 3LKSA 5EU6A 1I3RA 4WEBL 5DQDH 3WIIH 3AS2A 2IF7A 4MX7A 4I18C 1BD2A 3O81A 4JFEE 4P5MB 5DUPH 5DRXB 3BUYA 2HJLB 1IC4H 2C1PB 4PGEB 1Z9LA 4YHOH 1AJ7H 4MWFB 2MHAA 4YR6B 1G7JA 5TDPB 3GMQA 3L95A 3OR6A 4Q9RL 1ZANL 5FXCH 2OK0H 1U8IA 4K8RH 1I75A 3I85A 4EBQH 3OR7A 4PJ9D 3B3IA 1YN6A 4QWWC 1BVZA 1UWGL 2E6QA 3CFIC 3DXAB 2IGFL 4NQCB 5DYOB 3GJFA 1R24A 4S1DC 3LMJL 4MNGA 1RUMH 4MB4A 2IPTL 1T1XB 5A2FA 4RDQF 2A74B 3VXSD 3CVIL 2IEPA 3M1BA 5L8LB 5ABDE 1NBVH 3D5OF 1C16B 1BVLB 1R3JB 3RU8H 3D3VE 5IHUL 2KQNA 4Z7OF 1QP1A 4DGYH 3HI1A 5EZIH 1KT2B 2WBJC 3AREB 3WO4B 5I6XC 4OFDA 3FB7A 4Q9QL 5AYUL 3EFDL 3ZT6A 1M7IA 1S5IH 3AMLA 1Z5LB 3BPLB 1S7SB 4GW1B 1KN4L 1YEFH 4LAJH 5HHOD 1X5IA 4XPBL 2DWDA 5HHQA 2ESVB 4JVUA 5DK0B 1FO0A 4J3WA 4JDTL 1FE8H 1U8JB 1RJZB 3NFSL 1Z9SA 4ZPVA 3WIHL 2FJGA 5E95B 4LHUA 2CGRH 1IARB 1WGOA 2BMKA 3B9KC 3MV8A 2C1OA 2A38A 4PRID 3MRFB 1S3KL 3TBYA 4OFVA 1AR1C 2P49B 2AI0L 4KV5E 1AFVL 2B4CL 1YEGH 2N4IA 3UPCA 1EEQA 2DM3A 2JELH 4N90E 1CDYA 3O2DH 4MDIB 1OOAA 5EU7C 4GAYA 5F3BB 1S9XA 1B88A 1MQKH 1UA6H 2K1MA 3CVHB 4JKMA 5C0AB 3ULUE 1LE9B 2KDGA 2X70A 1ROWA 2AERT 4FQ2H 3NCYP 3MJ9H 2VXUH 4I0CC 1VGKA 3VFRB 2DQIH 3QDJA 3FRPA 1RIHH 4QGYA 5BRZB 5GGQH 4XI5D 3BD5A 4OZGB 3EZ8A 5IB1B 5DD5H 5FOBB 5EC2B 3QUXA 2H3NB 2R1XA 1VKXB 2PCPA 4X7TB 3GO1H 4P9ML 4O02L 3BDXA 1UENA 1RZKC 3QO0B 4HIJA 4KHXH 5IV2A 4X0KA 5HYIA 1IEBB 4ZS7L 3QZWB 1ZT4A 2GCYB 1JZ7A 3H9HB 1CIUA 1QFHA 5IT2H 4XGZB 4X7EC 3TM6A 3TZVB 3QEHB 1OCWH 1T21B 1BZ7B 2Z0BA 2F54B 3X3FH 3U4EB 5DVNA 1I9EA 3DBXB 4XH2A 1DQLL 1NBYA 4MQXC 4NZTL 5EZLB 5HGHA 5IVXA 1CFVH 4HF5H 4UQ2B 2HT2C 1BM3H 4YDKH 1WIOA 4U1LA 1RZ7H 1GOGA 4XBPB 5E5MB 1FZMB 5AZ2L 2GQHA 1T03H 2FX9L 1L7IH 5D7JB 1IC1A 4J7RA 4UDUA 5ESQB 3RWHB 3BKYH 4MNGE 4IRJA 1V5JA 3DNKA 3VWKA 3VFWA 5BQ7B 4GRWE 1O0VA 1UC6A 2NTSP 3S34L 1OAYL 3U30B 1RZ8B 2YWYA 1A1OB 1M7DA 3O6LH 1FG2A 2D9QB 4ZXBD 4GRMB 4JDZA 4OF8A 3P9MA 4WWKD 3ZE2E 5D71L 3UYRH 3QHFH 1FNAA 2VH5L 4XX1E 2ORBH 4M62H 3SDDB 5E99H 3NA9H 3TV3L 1IC5H 2ZOKB 4KK6D 5BV7L 2WW8A 1I7UA 2ZUQC 2PYED 4DWHA 5IHLB 2XWBB 2CR3A 3MXWH 2BHYA 1YECH 3EHBC 1PW3A 3ORJA 3SJVA 1CFBA 2DKUA 4Y4HA 2B39A 4PD4K 1CFQB 3EFFB 4DTGH 3ZL4L 4FQHA 2CDGB 4P9HL 4XP5L 2VISB 4JO3H 3VFUB 4WHTA 4E5XB 1MCNA 2RBLA 3MV8E 1MFAH 3RBGA 1CL7H 5CGTA 1SJVA 2P5EB 5HHNA 1S7RB 2CKBH 3PWPB 1N0LA 1R5VA 3LEXA 4F2MB 4J4PC 3BZFB 3RKDC 5JPMB 3E0GA 4LNRB 3HZKB 3QUYD 1T22A 4CMMB 4PJ8C 1OT2A 3I6LE 4HKJB 5CEZH 3EOBA 2YMXL 4CU8A 4MA8H 1QSEE 4P2QD 5BZWB 3LKSB 4Z7QF 3BRDA 5EU6B 4PG2A 4YXKH 4ZUUA 4UZGA 4OV5A 1SY6L 3QDJE 5E6IC 4LMQI 4F9LA 1BD2B 1A7BA 4LCCA 3AXLB 1F6AA 4HPYH 2YZ8A 1U8IB 1Z3GH 2NXZC 1YN6B 4JDVB 3FOMA 1ZLVK 4LIQE 4IDJL 3T0BA 1U8MA 2Y23A 4O9HL 1AXIB 1YY8B 1BQLL 4WTZG 3VWJA 3EBAA 3GJFB 1R24B 2YA2A 3FQTA 4KK5D 4L29B 1E4KC 3M8OL 1U8OB 5DJYB 43CAA 2M26A 4Y4KA 1TXKA 1HH6B 1J88A 4BQ9A 1FL3A 4PPTA 5IHBA 1PGRB 5GRVL 4N5UA 2QQNL 5INDA 3ES6A 5JXEA 4URTB 4PR5A 3HI1B 3BMVA 5IG7B 3DSNA 2YOCA 3DV4B 4NZRH 3B9VA 4CBPA 1T1WA 1JZ3A 2R29L 4JO4L 3SO5A 2ARJB 5F7EH 4UINH 4GLRH 4IRSC 4QEGA 4Y89A 3K4AA 3HE7B 4PLJC 2W91A 1WEJH 1DBJL 1XGQB 4QWWD 3EO9H 4R97B 2DWDB 4I2XA 5HHQB 4L3EA 2LTQB 3VXTA 1KPVA 1QFUH 3JVGC 1OF2A 3WHXB 4UT9L 2ADJA 2R4RL 3ZKMC 4NSKB 4LSRH 4GXUM 4HHAA 1HIMH 3V8OA 1FAIH 1ZWIA 4H88L 1Q94B 1XF5B 4ZPVB 2FJGB 4YWGL 5F1NA 4LHUB 3IU4H 2VQTA 4HQQH 4W6WB 2Z31A 4OZGF 2C1OB 3W0WA 4PS4H 3JWOC 5BJTB 2AJSH 2FJHB 4EDXA 4FS0A 1SY6A 3SDYL 1ACZA 3UBXB 5SWQB 2WBJD 4LLMB 5AWNH 2DLFL 3SJVE 4ZQKB 5I16B 3NZHH 5FYLE 3UJTL 4QTHB 2IQ9H 5I73C 2YC1A 3GBNL 1ZMYA 2X70B 3O45A 5GGVL 4F7EA 3X12A 4PUBH 3BP5A 5HYFA 1PFCA 2VLJB 2R8SL 1F58H 5HHMD 3OF6A 3B4NA 3LN4B 1IQWH 3QUXB 2PCPB 3B9KD 2VLRB 3QXTA 4HIJB 1P7QD 1GC1C 5KJRL 4S1SL 3FAWA 4TSCH 1XCQA 4RGMC 5HJ3B 5DFVD 3W39A 1UZ6E 4KTYA 1NC4A 4DUWA 1AKJB 1G1CA 5L7XL 2ATPB 1KJMA 2UUDK 1A0QL 5ISZA 1DEEA 3QDAA 4C55A 4AENB 5JW4Q 2YD1A 1VFMA 5LCVL 2CRZA 3D0LB 4NN6C 3L3HA 4ZOCA 5IW6A 2XTJE 4RNRA 2AXFA 4IS6A 3WJJA 4APQA 3CCHA 1BFVH 1FORL 2Z8SA 1BQUA 4XH2B 5IVXB 3JWNC 4HUWA 4HS6B 4TUKL 1E28B 2AGJL 2ZWLT 4ALAH 5EWIL 1J05A 4ZDHA 1S9YB 2VZOA 3WFDL 1KB5H 2CXGA 5A40E 3REWB 1GPOL 2XXMB 3QNXA 3OKNA 4AH2B 5I18L 1JZ5A 1ACYL 1XGYH 4IRJB 2MCPL 4HCRH 4U1GC 1QFWH 1KPRB 4KV5F 3TN0A 3FONA 2XA8H 2CR6A 4KDTA 2PTTA 3QRGL 3BZ4A 5C86A 1UWXK 1M7DB 5KSUA 1T04B 3LHPH 3S96A 4OGXL 4JDZB 5F88A 4K23L 5IEKB 1KCUL 1QBBA 3BPCA 4BH7A 5FGBA 3ISWA 3BOVA 1B0GA 3T2OA 1SEBA 1B0WA 1JCKA 4PJGA 5IWLC 3BE1H 1UM4L 4IOIB 4MQXD 1AIFA 4BZ2L 5I1AA 1TJGH 3HUJE 2HVJB 1I7UB 1DVFA 3F58H 2HT2D 3N1MC 4I2XE 5EB9A 5I1GH 3JWDH 1BBJA 4L3EE 1FYTA 5FHAH 1SJHA 2AK4D 4RWYH 1F6LL 2BNUA 4IOSD 4Y4HB 4ODSH 4YDVB 1DLFL 4GKZB 5F9DC 2BNRD 1Z0NA 4AL8H 4FQHB 1MJUL 2G60H 4WHTB 3VXOA 5HHNB 1T7WA 4DAGH 4WIQA 3DX6A 3DYMA 4I3RH 4F15B 1YQVL 4ZO9A 4UOW1 5DD0L 4HZAA 5D96C 2XKSA 2HVKA 1BWMA 4PGCA 1T22B 3O8XA 1JPFB 4XAKD 2YXFA 3QUML 4NQVA 3EOBB 2HLAB 1KENH 1GOHA 4LRNL 4UMGA 1J86A 4QXGL 3EHBD 3DYPA 1N0XL 4ZUUB 1G7HB 5ANME 4X6BA 4OFYD 5DJ6B 4GRWF 3N1QC 1EFXA 4S2SA 1ULVA 1YEKH 4O5LH 3SE3C 5TE6H 5IVOA 1F6AB 1MHCA 3CU7A 1KEGH 1WBYB 3ZE2F 4K9EH 3FOMB 4AMKH 4RGNB 4J4PD 1U8MB 1SYSB 2E9BA 2H9GB 3TYGH 3RKDD 2DL2A 1LGVA 5TFSH 3MUJA 2CRMA 5ISZE 3GHEL 5D7SL 5DA0B 1EA9C 4PJ8D 5F6HI 4WV1C 43CAB 1OAQH 2ADFH 2WINA 1WVZA 3T4AB 5BV7B 1CLYL 1KLUB 1Y6KR 2NX5A 5INDB 3ES6B 4OQTH 3RWIA 4PRHB 5E6ID 4FTVE 1AQKL 3AC0A 4PB0L 5E1AA 4O4YH 3BISA 5F1IB 3VH8B 1EO8H 1KCSH 3K80A 3A6OA 3Q6GH 5LGHH 1I9JL 3MRQA 3ILPA 1GVIA 2F9BT 1IC7L 1UB5A 1S7UB 3RBSA 2VDKH 2NXZD 1T20A 3QEQD 2PW2A 4M00A 1OARL 1V7NH 3SDAA 3HCVB 2F5BH 5D5MA 1I1AC 3BDYL 4IIQC 4JRWA 3T3ME 2KKQA 1DQQA 2W9LA 3UTTD 3QPXH 1ZWIB 4ZFOL 3DGGB 3QISA 3O11B 4L8BB 2HG5B 4PJGE 5F1NB 1WSST 1P1ZA 4PB9L 4IMKC 4QRQA 5KVEL 1M05B 3VFGL 4DKAA 3W0WB 3AM8C 2CD0A 3Q3GB 2EO9A 1H3VA 4KJPC 1UFUA 1QYGL 1FYTE 5F7MC 4EN3C 2HFEB 4UAOB 1ETZA 4LHJB 3GSOB 3VXUD 4IRSD 5BOPA 2VL5A 4ONFL 2LU7A 2W1NA 4PLJD 3OX8A 1I7RA 2DOCA 4JGJA 3O45B 1JIBA 3AREC 3WO4C 4F3FA 3BP5B 4FQIL 5BO1L 1B2WH 3VXME 2OJEA 3JTSA 3ZKMD 4Y5YB 5HI4C 2K3TA 4GKSA 2HP4A 1AXTH 2ZCKL 1U3YA 1QSFD 3VCLA 1A3RL 3DRQB 5IVXF 1LK3H 4Z7UE 2VDML 5FHBL 2AXGA 1NCUA 4P3CH 4N0UE 5KS9A 4ZFGH 2OZ4A 1MAML 1A1MA 5B3NA 5KANI 3A0OA 1KJMB 1NEZG 4X4ZA 2D0HA 3EJJX 3MLYH 4Z6AT 4U4BA 2A6IA 4JM2A 5IW6B 4B5EA 3RWGA 3VMPA 6FABH 4IS6B 2QL1A 1S7QA 2FEDC 3CCHB 4NZUL 1K5NA 4P49A 4LSTH 3BWAA 5E6YA 4H0IA 1OGAE 4HUWB 3PWUB 4AEFA 1YZZA 4FFYH 3DLQR 2Z93B 5I74B 3SCMA 2ZNWA 5D93C 5ACZA 1AGCB 2FZ3A 1C5DB 4ZFOA 3QNXB 2EYTA 2NY6C 1K6QH 5CEYA 1TVHA 4Q7DA 2PTTB 3WKMH 1AP2B 2NX5E 4I3SH 4K3DH 5KSUB 1HZHL 3S96B 1U95A 5T3ZL 3VW3H 1Q9OA 3BPCB 3KPRA 2XOTA 3MBXH 1B0GB 1DUZA 1LWRA 3LN9A 4I13B 5C0JB 1IL1A 2XFXA 4NM8L 3TZVC 5MERA 1AIFB 2I26N 2BOBB 2VDPL 1OAXH 1IILE 4PJEB 3EW3B 4I48B 4XTRC 5D5ME 5D8JL 1BBJB 4OSUH 5T5NF 4PJ5E 5SV3A 3U7WL 4YPGA 2IALB 5I1EH 3B43A 1UZ6F 2XZCH 1TQCC 2N1KA 5I15H 4YEEA 5FKPA 2CK0L 4NJ9H 4QHKJ 4YX2L 5IBTL 3S4SA 2FL5B 1ED3A 4LSVL 4RX4D 3CH8A 1CLOL 4R8WL 4XRCB 3QB7C 3DX7B 1ZS8A 3C60A 2AJ3B 4F7CB 1RHFA 2C3HA 5EBGA 3RNKA 3OMZA 4PGCB 3O8XB 3E3QE 5E7FA 1H8SA 1A47A 4NQVB 4JPWL 1X6LA 2Y07L 3H9YA 5I8EB 3QCVH 1T7YA 3FOLA 3VJ6B 5DHVA 3ZT7A 2O5YH 3RVVC 3D87B 3L3KA 1NSNH 4X7SH 3LOWA 4HJGA 2GJ6D 2JJTA 1INDH 3SBWA 5A1AA 4AQOA 1TJHL 1A22B 2CO6B 3Q5OA 5LQBL 3U79A 5DJZA 1XF4B 2HFFA 4PBVC 1MHCB 1NCTA 4XXDA 4P57A 4L8CA 1MWAH 2R1YA 1U8KB 3T2PA 1HXYA 5KS9E 4NDMA 2B0SH 4MVBC 1NUDA 3MRIA 5CD5C 4ORZC 2JCCE 1P9MC 4FP8L 4LARL 4MQSB 3MRKA 3TCXA 3WNMA 4A6YL 4HWBA 2GAZA 4FFVC 3ZYOA 3D85B 4Z95H 1U91A 3BWUC 4BQCA 1E6OL 1KYOJ 1XGRB 1PZ5B 5EFIB 1S8DB 2UWEB 5DMIL 4KI5E 2G9HB 2IBBA 1AE6H 4YHKH 1GJIA 5E1AB 1NCWL 5D2LA 4G9DB 1KC5H 5GJTH 1FGNH 2PKDA 3MRQB 2E5EA 2P24B 2VDRL 1VPOL 5F6IB 3DX8A 1DQJA 4M6OH 2J2ZA 2DJUA 4M8VA 5KOMC 2CLVA 5B38G 2OJZL 3Q0HA 5TQ0H 3GSXA 4LBEB 4RRPG 3W81A 4AJ0A 3DI3B 1NGYA 2HN7A 2O61B 2P8PA 4Y5VA 1DQQB 5EBLB 1MPAL 3WFEL 2IAND 2EEDA 3KPRE 1N4XL 1MSPA 2VXTL 1CICA 3EOYG 1LO4H 3EOAA 3QUMB 2YS4A 1A6VH 5JOFA 4HFWA 1P1ZB 3ZDYE 2KQMA 1QD0A 3JUYA 1DDHA 4L4VB 3CNKA 3W9EB 1HKLL 5L2KB 4JB9L 3VG0L 3T0DA 3MLSH 2OQJA 3N85L 3P0YL 4PYHA 3FFDB 1FN4A 3CFKA 4GXVL 3O2WH 4LEXH 4X6CA 3CZFB 5CIPA 1NUGA 2R23A 3KLDA 2R9HC 3MREB 1I7RB 5KG9A 1C1EH 4EDWH 4F3FB 4KKNA