3QXUA

Free structure of an anti-methotrexate cdr1-3 graft vhh antibody
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDKGKNTVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords Anti-Methotrexate CDR1-3 Graft
total genus 29
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxuA00
1KCSL 4M5YH 4X6CF 3ARDB 1D5BB 3FO2B 2R1WA 2XZCL 4JFHE 4KKCD 4DEPC 3QXAB 3C5ZA 2PO6B 3VXTA 1N7MH 3U4EB 2AJVH 1Q0YH 1RK0B 2XA8L 3ZDYE 1ZS8B 3KYAA 1FNSH 5HY9A 3VXRA 1ZV5A 3DXAD 4YLQT 3I2CH 4PTUB 2C3HA 1NC4A 1JGEA 4P2QA 2VXTL 4BELD 4MMZC 4JFEB 2WBJD 2OP4H 2PW2A 4OB5L 4XMPH 4KRPD 4WJ5A 4N0RA 4R4ND 4WU7B 3BGAA 3S3SA 1QSFB 1T7ZA 4PB9L 1PKQA 3BQUD 2APBA 2Q87A 5JR1L 4L4VB 1UM4H 2J88L 3KS0H 1MRCH 4IOSD 3V0VB 4PJ8A 4PJIF 1ZMYA 3UEZA 3LH2H 3U0WH 3D0LA 5I8CA 4LNRA 2EH7H 3L5JA 1OAKH 3QEGH 2BSSA 3TN0B 3T0DA 4PGCA 1FVEA 5DEGA 3DMMA 3VG9B 5HYJA 1RULH 1IM3B 1I3GH 2EYRB 4O2EA 1S7RA 3MLSH 5ERWA 5EO9A 3OKOB 2IAMC 1EUUA 1W72L 3WD5L 3WFBH 3SQOL 3CFBB 1ACZA 5E2UL 5ADPH 4Z6AT 4AL8L 5EO1B 2ZKHL 4MXQC 1PSKH 2JELH 2VABA 4HKXB 2A1WH 2BK8A 2O5ZH 2AJYH 3MACH 3DVFA 3HI6H 1QLRA 3L3OB 3BAEL 4MX7A 3ARWA 2VDNL 3EOBB 2QQNH 4HX1B 4WTZA 1AD0A 3M17B 1T2QH 2F8OA 3TO2A 5I16A 1NMBL 4JDZA 5HTSA 4U6VL 4DFHA 3U46A 2FGWL 4FRWA 3QZWA 5HDBF 1OAXH 4DGIL 3MV01 4DVBB 3CVIL 3TF7C 5D7SL 1J0HA 1M6OA 2VWEE 4P46A 3MPCA 1GOFA 2VLRB 3GSQB 2CKNA 5HHOE 4NRZB 3SE9H 1IL1A 4CRPA 2CPCA 1MFEH 1WTLA 2XG5A 5DK2A 4JO1H 3KXFA 5GISH 1II4E 2R9HD 4JFDA 1OOAA 4TSBL 1LD9A 4NJ9L 4GKZA 4AM0A 4UOW0 4ZFGH 2W65B 2XA3A 1T0MA 5AYQA 3I6LE 1N6UA 2CLZA 5JNYB 3BZEA 3CCHB 4DKDC 1QR1A 3ARGD 3X3FH 1OGTB 2EDXA 1GOHA 1QP1A 3W9EA 3DGGB 1HIMH 1U92B 5BV7B 1J88A 3LKSA 4PRDA 4PG2A 1KLFA 5ALCL 2H9GB 1ZTXL 5LQBL 4HKZB 1JUFA 1DUZA 4RGNB 3MLWH 4KTDH 1U8IA 1NC2D 1JK8A 5EOTB 1TVHA 2Q76B 2VE6B 4LMQI 1IEAA 1KXQE 1QYGL 2V6HA 3DV6A 4Z7WF 3O81A 1DQLH 3UAJD 1VGKB 3VG9C 1T1YA 3PUCA 3TH2T 4I5BB 3FONB 1G1YA 1YEGL 4ZFFA 3MOAH 4AT6A 3WL9B 3NCCB 5M7QA 2E9JA 5GRJL 5DLMH 4HIIA 2NR6C 2BC4B 1MJJA 4QLRA 4QHMA 4NPYA 1P2CA 1WBYB 3QI9A 2OTPA 3TPUA 2ZCKH 4HMDA 1C7TA 4Y1AD 5I73B 4FFWD 5L8KB 2QEJA 4RMRA 2DQIH 4F9PA 2XTLA 4R4BA 1HQ4B 3WUWG 2CK0L 3QXUA 1A7QL 4X6DA 4NHUA 5D7JC 4HK3N 4Y4KB 1PY9A 4WI5A 1QR1B 1XGQB 1SJEA 4I48A 4XRCB 2PO6C 4ZO9A 1IAOA 1U8QA 1JF1B 1TJIL 5DZOA 4MCZB 1DBBH 3U4BL 2IG2H 4J3WA 3ARDC 2V17L 1LILA 5GJTH 3IDYC 4ZDHB 2VXTH 2V2TA 3IJHA 1H0DA 1RK1A 1WCBA 3O3EB 4WFFD 4P59L 5GHWH 1HHKA 3T65B 1YNTA 1KT2A 3IDMB 2HG5B 2AGJH 5IB2B 4E42B 3W5MA 4NZUL 3R1GL 4TSBH 5DD0H 1H3WM 2GTWA 3MRQB 5GS2H 5KW9L 1EO8H 4YPJA 5KSVB 4PP1C 4MXWH 4FNLL 1LGVA 2QBWA 3DO7A 5BQ7A 1FO0A 1WZMA 3MQIA 3GMRB 3G5VA 1G7MA 3HCVB 3L5IA 1FNHA 2NY2D 4JZNB 4H0IA 2GKIA 4U3HA 3MGOA 2J8UF 3P4NA 1NCAL 1DQDL 3NFNA 5E2UH 4H1LA 5ADPL 3VD7A 3ARBB 2BY0A 1V7NH 4LDOB 1FN4A 2CXGA 2CMRL 1P1ZA 2LAAA 4RAHA 3ZE2F 2F8VA 3CVHB 4B53A 3FT3B 4GAGL 4DZ8B 1YNLL 3NACL 1NGQL 4MDIB 3C6LA 1C12B 1DE4B 1WT5C 4LCYB 2QQNL 2NY7L 1V7MH 4G6MH 1MHHB 2HFEB 1R5IA 2P47B 4S0TD 3SDXE 1NAKH 3HMXA 3MA7A 1U8JB 3PQYA 1RAMA 2ESVD 1DFBH 3ESVF 4ODTH 2UYLB 2FATL 5D7SH 1AKJD 4YHZL 4KXZI 5EU7C 3RJDA 5E99L 4LPXA 3LPGA 3MLSL 3UX9B 3QI9C 3MJ8B 2DQIL 1PZ5B 4PTTA 2E5EA 1NGPL 2VDOL 2PW2B 5DFTA 4JFPA 3VFMA 4LLDA 4WHYG 3IETB 1FP5A 2YN5A 4G8GB 5E8EB 3P11H 3QFJE 1G6VK 5JOPE 4P2QB 3L5XL 5ENWA 4G3YL 5I1EL 3S4SB 2AJYL 2VLJE 3BP4B 4XCYA 1AXSB 5CINL 3L3JA 4NQUA 1G9MC 5I75C 1Y6NR 5FYKH 1M4KA 4ERSL 3VXUE 3TBYA 5CD5D 2QSVA 2NY0B 4GLRI 4DW2L 2UZIL 1B4JH 1QNZL 5GS0L 3DJ9A 3NCEB 1QD0A 4WIQA 4Z7VF 5CBAA 3PGFH 1IGIH 5I1CL 3N9GH 4WTWA 1FVCA 3FMGL 3RVWC 2FX9H 4JHAL 2CRYA 1RFDH 1PZ5A 2YSSB 5ITFB 4EUPG 2A38A 3WKNA 1EFQA 5D7KD 4IDJL 3LQAL 2F58L 4PJ7E 1S7SA 3PGCB 3WJLA 1JGDA 4G6FD 1UJ3C 2JB6B 1T7VA 3BDXA 5C0BE 3TFKC 2QJDA 2P49B 3GIVB 1GJIA 1N5AA 4WW1B 4YR6A 3DUUA 3PV6B 5IWLC 4HBCH 3O41B 4KKBC 3QAZC 1RIHL 2XQBL 3BE1L 4K7PY 1ZE3C 1MRDH 1OTUD 2CIIB 3PJSB 5CP7A 5FK9B 3BGMA 4ODWA 4XMPL 1A2YA 1A4KA 5E7BA 4X80L 1M05B 2AV1B 4KK5C 2BOBA 2DYPD 4ZMAT 3CUPA 1OHQA 3OKNA 1DLHB 3MV7D 1YA5A 4Z7NE 1NBQA 5F9AC 2J2ZA 3HNSL 4R2GD 2D31B 1FL6A 3IKCA 4J3XA 4F7MB 1MFAH 1YEKH 3TC9A 5C08A 3G5VB 4I4WA 4LKXB 3MJ7A 3FO0L 3D69A 4MVBD 3A6CH 1INQA 3BDYL 3MYJA 4JQVA 3L6FA 3VRJB 5HHOA 1IT9H 4EEEA 2C5DC 1QEWA 4I4WB 5IEKA 3UTOA 4N9GB 2NZIA 2MQ3A 5CINH 1MFEL 3HAEG 3JBG7 3PHOA 3RWCB 1MCHA 2F54D 3JTSB 3T65A 1NKOA 3CUPB 5B39B 1U8KB 1MCBA 2R0ZL 2WINB 4BKLB 1IAII 1K3ZA 1LEIB 4MAUL 4ZFGL 3QQ3A 1CDCA 1P69B 3HZYB 5TE4H 5HJ3A 5HYSA 1N64H 3OKKA 5K9KB 3PV6A 1KELH 4YHLH 1L9MA 5EPMB 3ULVH 4MA7H 3I75A 4QHLB 5KZCD 3UPRB 1N5AB 5B38A 3PABA 2WMPA 4HCRA 1S7SB 1HXMB 1TTUA 1RZJL 2ATPB 2WIIA 2X4NA 2BRRH 3QRGH 5BVJB 2EO1A 3MOBL 1D5ZB 3TT3H 3L3DA 2CR6A 1IEHA 2J6EL 4XNQB 5DSCA 4Y19E 2H2PC 3MLXH 2FEDC 2NTSP 3FQUB 3GM8A 2WBKA 1RIHH 1BFSA 2FCBA 3WUWB 4ZOAA 3MRIA 1GPOL 3DMMC 2XT1B 2X44D 5I8OL 1T1WA 1G9ML 2YK1H 4I0KA 4Z95L 5M95B 1IEAB 4OI8A 2PYFA 2PTTA 5CEXB 3BQUB 5HHVL 1QKZH 2HT3D 4GKNA 5ANMB 4LP4A 4PY7B 4TVPH 3VFPB 4KKNA 1J05B 4XCYB 1MIEL 1YEDA 2IPKA 3NIFE 3GRWH 1W0YT 1KTRL 2VL5A 3V5DA 1XEDA 3TWCL 1YPZF 4JO2H 4QF1A 4QXWA 3WKMH 2FLRT 1H3GA 2ICEA 2R4SL 1KIRA 4JQVC 4M48L 4AM0B 5C09A 1GC1L 1MIMH 3OKMB 4PLOB 4NN7B 2F54B 1OAZH 3CH8A 4TUKL 4QRUA 4M9OA 2DQJH 3GJFB 3MA7B 3TBWB 5L2KD 4KJYA 3ZDYF 5F3HB 5BZWB 4IDJH 1VPOL 3FB6A 4EVNA 4DVRL 3T1FB 1R3LB 4UNTA 3EO9H 3QZWB 1UJTA 4M6ML 4ORGB 1CXLA 3FT2B 5DWUL 3TGXA 4ERSH 5F3HA 1YMME 1JPTH 3RGVC 5IJKA 1AO7A 5CEZH 2EDFA 3GJFA 1IZJA 1L6ZA 2EIZB 5HI5D 1FORH 2L4OA 5CEYA 3OKMA 3QHFL 1S7TB 3Q3GB 2VITB 1TZHB 3BRFA 4BH8A 4TNWF 3U36A 3H42H 1UG9A 5E8NA 3WS3A 4GAGH 3CX5K 4IDLA 3FTGB 4I3SH 3AC0A 3GK8L 4JM2C 1QUNA 2P4AB 2YA1A 4MJID 1KEMH 4FQXD 5E2VH 3T1FA 3BSZL 4PV8A 1LQSR 3CH1B 3O3UN 2X10A 3KLAB 5I6XC 1ZT1A 5IB2A 3G5ZA 4EOWH 2C3VA 3VWKC 2KL6A 5DRZA 2PTTB 5CEXA 3JWOC 4FXLA 1K4DB 1ZVYA 1QFUH 2WUBL 5F1SA 3C2AL 4N0FB 4ZYKB 3MRIB 3LY6A 4MWFB 1FRGL 1RUAH 3WNKA 1C16A 1KCLA 1NJ9A 3D39E 4I48B 1DDHB 3RHWF 3EOTL 3BH9A 1OP9A 5DRNB 5BS0D 5DSCB 1NBZA 2DAVA 2VN7A 4G9FE 5DMYA 5JXED 3QXDA 4QHNB 2AJXH 3C5SB 5IVXA 1EVUA 5ECJE 3WFDH 2FIKA 5F7LB 1UC6A 1AHWB 3O3AB 4IHOB 1MHEA 2OL3B 4D9QE 3BQUA 3UYOD 1JCKA 1ZTXH 3VXTB 1UB6A 2YN3A 2BVEA 3C5ZB 5E8OB 2Y06L 1P7HL 3O2DA 3SOBH 2MOVA 4DN4L 4P3CH 2IFFL 3UYRH 2VR4A 2N56A 4XBEL 2HLAB 1KN4H 1NC4D 1P7QB 5K9KA 4AT6B 2VDNH 5B3JE 5IHBA 4X4YA 4URTB 4U1IA 3MV8A 4RGMC 4LPCA 5DVNA 5I6XB 1NDGA 1F42A 2A77L 2HTKC 5D7KE 1RFDL 3O45B 1OAQL 3I02A 3QDJB 2OJEB 4HEME 4JRYE 1RUPH 1MFCH 1TVHB 1AKJB 4RISH 1IC1A 3D3VE 3M07A 2VZ1A 3UXFA 4GRWE 1RZKH 1QR4A 3CDGB 1CLZH 2FJHB 1OM3H 1QNZH 4NFCA 1J8HA 3W9EB 4P2RB 4EDWL 2Z91A 4PFEA 5HHOB 1EBPA 4XPGL 5BCAA 5IBLD 3D69B 3BZEB 5J56B 4JDVA 3VDBA 1JWSB 4JY5H 1RZGB 4FQQA 1N59A 4PJCB 5DRWB 2OYPA 2Q7YB 1RZFL 3TJEH 4LPVA 4ZUSA 1K6QH 2YZ8A 5F89B 1GC1C 1OARL 2NXYB 1VA9A 3HUJA 5KANG 5D2LE 5EIQA 2XA8H 4JPKH 5LAXA 4PUBL 1RI8A 4OZHE 5FK9A 1E6JL 5CP7B 3T0XA 5DEFA 1CE1L 3MLWL 1TJHL 5IEKB 1EMTL 1OAZL 4NN7C 3O41A 1YJDH 4NZDA 4QCIA 1G9EA 4H5SA 3SKMA 1JWUA 3QCVL 3GIVA 1YEEL 4JDZB 4O9HL 3TYGH 4X9IA 1IBGL 2AS5M 3F7VB 3RVTD 3QUXA 4Z7QE 5JR1H 2BSED 3VI4E 5F8QC 4LPUA 2R69L 4BJLA 3MV7A 3B8SA 4RDQG 5KVDL 4M8QA 3DECA 1GYAA 1MJ8H 5LWYH 3RTQC 3UO1H 1G9NH 1T2JA 3DSFL 3BQUC 1T21A 3O8XD 1HI6A 5TGBB 5ID0A 4MAYD 3BZDA 3EYQD 3AVEA 2SEBB 4O2EB 3UAJC 1J10A 2F53D 5DMIL 4ZG1A 3OX8A 4R26L 3O6KH 5CBAB 3DMMB 3H9HA 3W0WB 1TPXB 4JY4A 5EFIA 4WW1A 1RMFL 4O5LL 4UT7H 1PG7L 4XXCC 2XFXA 1G0XA 1FZJA 3ARVA 1C7SA 3BPLB 4WHCA 1A3LH 1KEML 5E2VL 3ET9F 5DS8A 3FHAA 4GW4B 4Q2ZB 5HYIA 1RJZB 4IOFD 1NDMB 4RCAA 3VD9A 2J8UE 4IHOA 1C08B 4JB9H 3TT3L 4WU7A 3D3VA 3QEUB 3L3JB 4KU1A 3EO9L 4M6MH 2DYPB 3BP4A 1X5IA 2XICA 2OTUA 3ZE2E 1MWAL 3AS2A 4YDIL 3AREC 3IETA 4TSCL 2W0LA 3MLRL 2OTUB 3O8XC 5D6CB 5CCKL 4Q6YA 1XR8A 3PWVB 1I1RA 5GGTA 4MA7L 3H8NA 1FLTX 1G7PB 3U4AA 4W4NA 3LIZL 2DMCA 4NP4H 2VIRA 2PO6A 1M7DB 3KPQB 5JLZB 3L7EB 2G60H 1A6PA 1U58B 5HD8C 5JOFA 4JPWH 1FC2D 2CDGB 3NCJH 5DRZB 1NCWL 4Z7OF 5EFIB 1V3LA 1EHLH 2OX5A 1MRCL 2C3VB 3W0WA 2VQ1B 3NIGF 3IDNA 1A6WH 2EIDA 3EJZD 3SDDD 4HWBL 2EE9A 4MHHI 5DQ9A 5K9QG 4G5ZL 5JHLH 1BWMA 4KZEL 3O4LE 3HG1D 1XIWC 4JFPB 4KKLD 4E5XA 1BFVH 1IGYA 2KBGA 2Y5TA 4XCCH 4F7TA 3WD5H 3G5YA 4AY0A 3B4NA 1S5IH 2FECI 5E94B 4BH8B 1TZHA 3MV7B 5F7NC 4YHYB 1BQHB 1W72A 1JGLH 3JTTB 2CO7B 1GHFL 5KZCB 2UYLA 1LDPL 3O2VH 3WXVL 3P0GB 3PQYB 3BI9X 5IW1B 3BYYA 5J7CC 1MHHA 2HFEA 4OFIA 4ZXBD 1MIEH 1QBLH 4JGUA 3VWJD 1RJLA 2HJKB 1C12A 4MDIA 4MA1B 1N2RB 3OXSA 4DKFL 4NKOA 1SY6A 2NY6D 4XVTH 5T1MA 4MD5A 4J4PD 3E2HC 1OSZA 4IMKA 5LAXB 4KMTL 4E41A 5EORL 1JI2A 1Q9LA 2LTQC 3ARFD 1HHKB 3G6JF 4JQXC 1WFUA 2AQ3A 4CVWA 5FAAA 1D6VL 3TA3D 3MRMA 5CJQL 4ZDHA 3GKWL 1T04B 2QQKH 3GMMB 4NQDD 5B21A 2VMFA 5DRWA 1UJ3B 4JZNA 3UZEA 1MCPH 1RZGA 4HFWA 4PJIB 1NLBL 2VXVH 3CXDL 1SJEB 1YEHH 4XRCA 4LQ1A 5D7LD 4HUWA 4R7DB 5A16B 4OGYH 1BHGA 2R2HB 4X6DB 2C3WA 1HYSC 5C0JA 3NGBC 4I3GA 3P73A 1YEDB 4XH2A 3SGJC 2XPGB 5GRYA 1NAMB 1FG2B 2BDNL 1KT2B 3RWDB 1S5HB 1D5IH 5F9OH 3WDJA 3ARFB 3O3EA 4AQ1B 5C0DA 2H3NA 1CDUA 1S7XB 3KPLA 4Z7OE 3PP4L 3WIHA 4MAUH 2NY0C 3LEVL 4MCZA 1EHLL 4YE4H 1S8DB 1AY1H 2PCPB 4FQLH 4JFXA 4CMMA 4HUMB 4FQXA 1P7QA 5HHNA 4BFGA 4TUOB 4X5WA 3ULVL 2A2QT 4YHIA 4OF3A 5GZOC 5E8OA 5D8JL 3HPJA 1E4XL 1Q1JH 1QTYT 4OFYA 5CJOH 1CK0H 3UP1A 5FB8A 2X4NB 4LAQL 2ICWB 1MHPH 5IBUB 2VZTA 4ELMB 3K7UA 4XI5D 3PE9A 1YJDL 3IS1X 4OV5B 4JG1H 2BRRL 3AFLA 3C5SA 3QRGL 5IVXB 4KC3B 1ZGLA 1QSZA 5E6ID 3WE6B 5ICXB 3MJ9L 5HSFA 3CCHA 3LMJH 3HS0B 1OPGH 1T3FB 5DJ0B 4P9ML 2FYYB 3U6RA 3BJ91 1CFSA 5IWLA 1YN6A 1NUGA 1A21A 2ICWI 4JFEE 1LEIA 2Y5EA 4LSUL 2NW2B 1SYVB 4FFVC 4LLVA 3JTSA 1U8IB 4XB7A 3QG7H 3W2DL 1ZHKB 4LHUA 4OFYD 4R96B 3TVMB 3BKML 5ISZE 4DVBA 4JRXA 2FX8H 2R2HA 4UDUA 1WWWX 3X17A 3HE7C 1INQB 2P1YA 2AK1L 3CC5B 4OGYL 4QTHB 3BRGC 4JO2L 3I9GH 3WKML 1T0MB 2DI9A 4UZGA 3Q3GA 3RY6A 4XMKH 4XBPB 1FCCA 4QRSB 2XZAH 3OJDB 2MCG1 4MX7B 1J0JA 1YC7A 3HR5B 4AIXA 4HWBH 2DQDH 5HHPA 4MJ4A 4JFDB 1DUYA 4ZO7A 3OKNB 2HTLD 5F9OL 3EGSB 4BSWB 1A2YB 3ZKSD 5I1LA 1CLOL 5FHAH 2VL4A 4MJ6B 1INEL 1NFDF 4JN2B 2CMRH 2EYRA 3IDYB 3NIFF 2HMIC 5JIPA 5DEGB 4KJYB 1OP5K 2RFXA 1GRWA 2LQRA 2XKNB 4WWKA 5KSAC 3HUJF 3C2SA 3MFGB 3M17A 4R3SA 2NY2B 5ITBL 3PGCA 5D7JB 4Y0GA 4L4VA 1J1XH 4LLWB 4NQDA 5KSBB 3J7HA 3QUZD 1JE6A 5KG9A 3MRDB 1EHAA 1T80A 2NY5L 3V7MA 3S37L 1WBXB 3QCTH 5EO1A 1X5YA 3VD3A 4FXGB 4X5XB 4P5MA 1B0RB 3OKOA 1UWEL 3TM6A 1RUKL 3WHXB 4PJXA 2CLRA 5ANME 3SKJL 4PGCB 3ZKMD 1CGYA 2YA0A 5I66B 3TN0A 1OP5H 4NKDA 2FBJH 3V0VA 2BSTA 4BZ1L 1Q94B 4HSQA 4QRQA 2UWEE 5FM5O 2V5TA 1FL3A 4PGEA 3LVEA 4PRNB 5H94B 1KPUB 5C0BB 3RX7A 5J0BA 4R8WH 4DAGH 2X70B 4RGNC 1WFOA 4HC1A 5HHOD 4UV4L 4R2GC 5DJAB 5H2BB 1LHZA 4EI5B 3L3DB 3B6SB 3OHXB 4H8WC 3DTXB 3CU7A 5DJDB 1DSFL 3P9LA 5D96B 3ULVC 3OAZK 1M71A 3MUHL 1RJZA 3VG0L 1ZGLP 2XY1A 2ITDB 5DS8B 4U7SA 5L9DH 3PABB 5CZVH 4FTVD 1JL8A 2EDHA 4HS3A 1JZ4A 5T3ZH 3OX8B 4U6YB 2FO1A 3QDME 5T1LB 3U7WH 3C6LB 3HZYA 1VSCA 3MLRH 2FR4B 1QSFE 5DYOB 1JN6A 1HI6B 3TT1L 4CW1B 1S5IL 2DQFA 1T5WA 3UC0H 1ZLVH 4NHCL 1V3KA 1QZ1A 3MZTA 3LEVH 4ZFZB 3P4NB 4P57A 2Z93A 3QUXB 2MQCA 4MQXC 4U1KB 4XB8A 4X8JB 3NFPB 2NX5D 4K94C 5I1AA 5DHVA 1MQKH 3UTQB 1GIGH 2H8PA 1CXIA 1ZLWH 4HGWB 3MYJB 1BQLH 3GSNB 3DO7B 5DQDH 3LN9A 2DJUA 1T83C 1XGUA 3WLWD 2E9WA 4OT1L 3QDGB 2CSPA 3DSNA 4PRBB 5DD6A 2XZQH 3DRQA 2B20A 1JMXA 1BFVL 2HG5A 1J18A 3RUGB 3GGWA 4YX2H 4OGXH 2V2WA 4N1EA 4DFIA 3QR2A 4WI3A 5F1NB 3DXAE 3RY5A 1X9QA 5TF0A 1QBML 3TN0C 3BGMB 4ODWB 3UPAA 4Z7UE 2XTJE 3KPRE 4XPBH 4XNXL 1A6UH 5FDWB 3GIZH 2AV7A 4OIAA 1ZLUK 1WIPA 2X9XA 2FD6H 2DJ4A 2FBOJ 4YUEH 2EDYA 2JKXA 3BUYB 3CGTA 3VXQB 3PHQA 4LHUG 3S3PA 5CILH 1HQ4A 3MUGB 1JYNA 2RQ8A 4D94A 1WIUA 5IMOA 3WO3B 4FHBD 1PSKL 1A7QH 5CAYB 2AEQL 4JO3H 5JW4N 1AKJA 1I9RL 3ARDD 3CZFA 5E9DB 4AENA 4LCWE 5JXAH 4M9PA 2OZ4L 3VH8B 1P2CB 2HT2C 4NPYB 1NL0L 4TVSa 4LK4A 1JNHA 3MCLL 1T2QL 3DSFH 2IG2L 4IBLT 1XMWA 3LHPL 4R0LA 1JZ8A 1FE8H 3QHZH 2D0GA 4WW2A 3UDWC 1T89C 4XC1L 4ACPA 5FYLD 5SWQA 1NUNB 4Y19D 4U1HB 2CKBH 5D71H 5JUEL 3VJ6B 3CDYA 1QLEL 1BAFH 4NQVB 1Y0LA 2V2XB 2NLJA 1KB9J 4FQJL 2N7BA 3HPLA 3NH7H 3NMEA 4Y5VA 4LCIH 3ZDXE 4OBSA 4NN6B 1T1XB 4I77L 4WUKH 3T3PE 1NGYB 5IMLA 3DX9A 4GKSA 4NZJA 5J57B 1PJ9A 3CPLA 4OQ1A 1R5VA 5ENWB 3JV0A 5FYJE 3VFGH 5T5NG 2H2SC 4XCNB 2O5YH 5BOPA 4CMHB 2D7NA 4IRZH 1FIGL 4LBEB 4JPKL 3ULSA 3KPOA 1OB1B 1OPGL 3KJ4C 3BMWA 5TFSH 2AJUL 5D2LB 5KSUB 1I1FA 3CFJB 4IJ3C 2O5XH 2OL3L 3AS0A 3MRBB 4L4TD 1WITA 1E4JA 1A64A 5IMKB 4WHYH 2V9RA 4OUUB 3H3BC 3VGAB 4RA3A 3N06B 1UEMA 3QUYB 3FO9B 4LNVA 1U3YA 2O26U 4XP4L 1NGQH 3KXFE 3L3IA 1CFBA 4OM1H 2GCYA 1T03L 5GRUH 4Z7UF 3D25A 2BHYA 1ZT1B 3KLAA 2DQJL 4UAOB 3JUYA 4B7LA 1OAYL 1F8TH 5L7XH 3QP3A 4HIJB 3U46B 1T66C 3EJYD 1P1ZB 1X3DA 1S7WB 3T0EE 4LSDA 3G6JA 3S8WA 4RAVA 1AD0B 2Y72A 1JPTL 1P7KB 5DO2D 1UM6H 5CEYB 2D7TH 3L3OA 4Y1AA 5FO9A 3V52L 3H3PH 5DT1H 1O0VA 3BP7B 4IRJC 4L8SC 3IKKA 2OTWB 1G7HB 1RZ8A 3QIUB 1KCKA 5TQ2L 1I9JH 1SYSA 2XWBA 2DLFH 4EN3B 2E9BA 5H37G 3RU8L 5IIEA 4OD2B 4X4ZA 5D5MA 5JHDB 1J7VR 5E6YA 5BZWA 1XZ0A 1YPZB 4OLVH 4AQOA 5IVZA 2Y7QA 4R97C 1QHPA 1CBVL 3CSPA 3W5NA 1A02N 3MJ6A 4WW2C 3UDWA 4J2XA 3V0WL 3IJHB 3MCG1 4OT1H 3U2SB 3KLHD 1CIUA 1U91B 2I9TA 4XXCA 4BH7A 1ITBB 5JPMB 2QSCH 1YEIH 5CMAA 4ZFOB 4JVPA 1JF1A 3P9MB 4QRPA 1PKOA 3MOBH 4HC1H 4FQ2L 1XGQA 4Y5VC 3SJVB 3DROB 3HMXL 4CVZA 1Z9OA 6CGTA 2PYEA 3PF2A 1IQDB 4NNXB 4Y2DA 5EOQH 1ZT4B 1J05A 3AREA 2GSGB 3CDFA 3IYLW 5DJ6A 3U4EA 4GG6E 3MRHA 2PYFB 2NXZC 4RGOL 3BO8A 5HGHA 3VFOB 1MQKL 3L3GA 4O58L 5D1ZA 3KXFD 1KBGH 5HGGS 1WBYA 2R1WB 4ZOCA 4JG0L 2AXHA 3WNNA 5I18L 4F58L 1FL5B 2VLRD 1UKQA 3FO1A 4PGDB 3VXUD 4ZD3H 4L4TE 5EU5A 5FKAA 1XF5A 2E8ZA 3MLYH 4JFQA 4N9OB 1DQQB 5HHMD 4UB0H 3KNBA 4DK6A 3HE6A 3EYFA 5H37H 1VFUA 3RDTD 4G7YH 4FZ8L 5K59F 1A6ZB 3H9SE 2C4XA 3BIBX 3GSXA 2YPLA 1D5ZA 4NGHH 5I1IH 5D7JD 4UT6L 1MCLA 1U3HA 3MCKB 3SDXF 3ULUF 4Z7VB 4G8FA 3WFBL 4KJQC 5E6ZA 4RFNB 3H3PL 3CZJA 2DWEB 3TZVD 1HOCB 1IZKA 5FOBA 3UPRA 4EBQL 2DQTH 2R1YA 15C8L 5C0AB 1A5FH 4OV6F 3NH7L 1K5NB 1SJHA 1CL7I 4W4OC 3OKKB 4LU5L 1NFDB 3MUY1 1PD6A 4WHTA 3DLQR 1JPFA 4APQA 2W65A 1P4LA 3OL2A 3ZDZF 1DEDA 1WSST 4LLUA 5DVLA 4MAYC 5E2TL 5HYQB 3L1OH 1KC5L 3D85D 1I7TB 1A1NA 2WP3O 2GJZB 1VFBB 5IJKC 2H26B 4FXKA 1MCKA 1BIIA 5CS7A 3QZWG 2ZOLB 3QHFH 2UZIH 2VSCA 1QEWB 2NNAA 3O0RL 3IFOA 3H42L 5K33A 1D9KB 5JUEH 4I9WD 2I27N 3OB0H 4RWYL 2GK2A 3VXPB 4PYHA 5GGSY 5I16B 1A7BA 2KZ1B 2RCSH 2EKSA 5D72L 2FX9L 4PLKC 5HPMA 5JDSA 3GSRA 1AGBA 4WU5A 4X4XB 43CAB 4Z0XA 3C5ZD 2P8LB 5F9WC 2Q8BH 4LKCA 5IW6B 4OTXH 2G5RA 4I18C 4OFDA 2F58H 2CIIA 3PJSA 4YHOL 4DUXA 5L2JB 1IM9D 1UFUA 1TZIB 4ZFOL 5ERWB 3MXWH 2C3XA 1KLUB 3C5JA 5E6IB 2GAZB 9CGTA 1VACA 1HSBB 2ZOKB 3V8OA 4L8CB 1UH2A 3MREB 3O6LL 3C9NB 4I2XB 1I9EA 1ZHNB 3MOAL 2IF7A 4PJ9C 4O51B 4Y4FA 5CWSB 1AGDA 3GJEA 1QSFA 3F62A 3D2UB 1ZA6A 5J6GB 5D5MF 4HG4J 2EEBA 5CHNA 3DURA 3DX6B 3MRGA 3S5LB 4OD1H 2ZCKL 3SGKA 12E8L 4M1DL 3UJIH 3RWFB 5HHQB 1JGEB 3BT2L 1MCDA 2PETA 3IDUA 4U7MA 3ORJA 3WIHH 2YPVH 5A2JH 1ZLSH 4G6JL 3GBML 4LVHC 2HVJA 4ONFL 4ZUWA 1N4XH 4S1SL 5JMRA 3IT8D 2BSRA 3OXRA 4FTVE 2VQTA 3C87A 4WHDA 1TXKA 4R90H 1HDMB 4L3EE 4NQSB 1KLGB 5FYKU 1U8PB 2ZCHL 3B9KA 3VFGL 1T0NB 5TH2A 4G8GA 5E8EA 5GHWL 2KQMA 3VXOA 3PDOA 4KVNL 5C0RH 5FFLA 1ADQL 2A9NL 5E2WL 4Z0BL 1IM9B 2BVQB 1MSPA 4KK9C 4PTTB 4RWYH 5DD3H 4GH7B 3DX7A 1H3UA 2CKBL 3T2NL 1T83A 2XYCA 5E95B 2NW3A 4C58B 2WUCH 1LMKA 4Q74A 2NX5B 2FGZA 1CICA 2EH8L 4TSAH 4WNQA 3VFWB 1BX2B 1PY4A 4NN5B 4UIKH 1SY6H 5DJ2B 2UWEF 2CXKA 3GMOA 4YAQB 1AI1L 1AGCA 2VWEC 4PUBH 3OJ2C 2VKXA 3BWUC 3WFHA 4AH2A 4MDJB 4MXVE 3E1F1 4ODSH 5C3TA 5HDOA 2BERA 1WWAX 4RGOH 2X4OB 4KAQH 4P2RE 4X6DE 4Y5XC 4PRPA 5J3HD 4FN0A 1K8DB 5TE6L 3NAAL 2P24A 3BH8B 1QSED 1YNLH 5D7IF 4M7ZC 1W72H 3ARBA 5E8DL 1SM3L 4WWKC 3AB0B 3GSWB 4MNQB 3MGOB 1ZSDB 2Z9TA 2DN7A 4DOHB 1MCWM 2IH1A 3LD8C 5DURD 3VXMD 1NCCL 3GMRA 2FBJL 2FNBA 3Q5TA 1YMHA 3MLVH 4Y4FC 3CVHL 1KB9K 4KZDH 3LKPA 2PKDA 4MLSA 1U8HB 3V6BR 4FQ1L 1LEGB 3TNMA 2NXZD 4NQCE 2Q6WB 1FLRL 4KK8C 4LFHD 4NGHL 5D1XC 1YDPA 4CVUA 2CDEA 4W6YB 2ADIA 3KYOB 4JHWH 4IRSC 4M93B 2B5IC 3NCFB 3LN5A 1F3RB 3WDHA 1OQOA 4K3EH 5MEND 4FQPA 5GGTH 4Q6IC 4F33B 1OY3B 2PTVA 5JPNB 2ZSVB 3P4OB 1IGML 4MB5A 5GS1B 5IFJB 3ULUH 4XNXH 4R9HA 4NO3B 1CT8B 4P4KD 3KDMB 4YXKL 4HAFA 4OTXL 2FD6L 4GG6A 3LB6D 4HEPG 1KJVA 3E8UL 1JPSH 2R9HC 4DGYL 3SKNB 4JM4L 2F5AL 5DMKA 5CCKH 1AR2A 2R2BA 1LE5B 5EU6E 4UV7H 3LSOB 3N9GL 1ZKAA 1EAPA 1NEZA 3QFJA 1P6AB 2OJZH 1NFIB 2W60A 1E4KA 4HIIB 4JPWL 2BFVH 2MMXA 5C0AD 2VB5A 4G9FB 4KK5D 4A2MA 4H26B 2GW5A 2V7HA 5GIRA 1EV2E 4X6DF 3TNNB 4Y16D 2J3SA 3Q5YA 3QIWB 3FJTA 2X41A 4APQD 1FZOB 4EI6A 3DV6B 4ZUTB 4JFFE 3MRNB 4G8EA 1JK8B 4JQIL 1KPRA 1HHGB 1HH9A 1QRNB 4MVBC 3V5HA 5B4MC 1LO5A 4ODBD 5FA4A 2QV2A 2PUQT 3VGBA 4LEXL 4PV9A 5BRZD 2DQTL 2DD8L 1CFNA 1OGTA 2A0LD 1AR1C 2I24N 1KIPA 4Z7WA 4DK3A 4GJTB 2RR3A 2XQYG 2BMKA 3CAFA 4JZJA 1H5BA 3NFSL 4O2CB 1KCUH 1MAKA 1WQVT 4GKZB 2EDQA 3ROOB 1P4BL 3GSNL 4GRWB 3BDYH 3Q6FB 4KVNH 5DK3A 5HGDB 1Y6MR 3T4AB 3D9AH 2BCKA 4IMKC 3ZSTA 3BT2H 4P4RA 2VLRA 3BN9C 3OKDB 3LN4A 5I2IA 5J8OA 1QA9A 5I76B 4UT7L 2WP3T 4IOIA 5ALBL 2WZPD 5MP6H 1WK0A 3MV8E 4KXZH 2QKIB 4P23B 3WFCH 2ZUXA 2UY6A 5DXWA 1FFNA 4OLWH 4NO0D 1VADB 3O6ML 3PWNB 1JYWA 2O93L 2AJ3B 3OF6D 3QHZL 1N64L 1B0GA 4JKPH 3NPZB 2CIKA 4JFDD 4OZHB 1BLNB 5D7IA 1ZA3B 2IPTH 2YD6A 5T5NF 3U7YH 1D5IL 1L0QA 2ZUQB 2OQJB 2ATKB 4KTEH 3PDGA 5EU6A 3CFKB 3NIDF 1CR9H 4WUUE 1GOGA 2ZWLT 4DKEH 4AG4H 2I5YL 5D1ZC 2QSQA 4YZFF 5TQ0L 4QY8B 2HFFA 1OCWL 1LE9A 2ZG1A 2NY3D 4ZTOH 4PBXA 1JYVA 1FVEB 1JHKH 5KOVC 4PJGB 4ISVB 1SEQH 3N1MC 4TULL 1ZLWK 5IHLB 4PJ8B 3DYPA 5D72H 3KVQA 4NO0A 1MFAL 2VXSL 4WFGD 3ZE1F 4L8DA 3R0MA 4S1RL 5C7XH 2Q7NA 4ISVA 5DA0B 1KOAA 4QXTB 3T77B 3AY4A 3S36H 2CKBA 5KOMC 3DNKA 4HKBB 1GIGL 5HVHB 1TQCB 3K81A 1A1OA 1BMGA 3F7PC 4JFFA 4F7CA 4NZRL 4DJMA 1Q72L 5I17B 3BYTA 5F1IA 3O4LD 1HZHH 4MQSB 1NEUA 3WN5B 3ZYZA 2BXZA 5BMFH 2BVPA 3QA3A 3ZL4H 4PGBB 4L29A 5CZKA 4DCQA 2P8MB 4G3YH 5I1EH 5E0QA 3U0WL 1OAYH 3VFVB 3HNTH 2W92A 3E6HB 1A47A 5DHYB 4PREB 5IKCB 2QKIA 1KG0B 1RU9H 5KSBF 4PG9A 4XWGH 3OR7A 2ZUVA 4UOW1 5A2IH 5DFVD 2R56H 5GSVA 3W2DH 2A6JB 4PR5A 5ID1B 5EORH 4YEEA 3L5HA 2DQCH 4NRXA 4YK4B 2MKWA 2PW1B 4O00A 2W9EL 3A67H 3MRLB 2C3GA 2UUDH 2BNUB 1FFQA 3BD5A 1N8ZB 1YEJH 2V5MA 2I07B 3T4AA 1ZGLM 5HGDA 5FYKD 2XWJA 5GQBA 2M2DA 2AP2A 2UVFA 4O5LH 3VFTB 4Z77A 3SO3C 1I4FB 4KK8D 3H9SD 1T20B 3PIQB 5FGRA 1GVIA 3EBAA 2BMKB 2D4DA 2XZZA 3QSKB 3SDCB 1BWWA 4N0UB 4BFIB 3AU1A 4UU9A 3HC0A 4IRJA 4PGJA 1KJ3H 3G08B 4F8QA 4UBDC 2YEZA 3MO1A 3TLRA 4TSCH 1DEEB 5DHVH 3RIFF 2X4TB 1AP2A 5ESAB 3F65A 5EU3B 3CSYB 3OSKA 1I8MA 1MRDL 2ZUUA 5CIPB 1U93B 4YE4L 3V0AC 4AIZA 3KPMA 5IT2H 4ZSOB 2G60L 4P4KA 3V4VH 1SY6L 3I6KB 3KPSE 2EDDA 3L3HB 3UTPD 5EBMB 3GIZL 4H1LG 4U4BA 2EIBA 1WEJL 3BVNB 1N0XL 1XF2B 4ODVL 1JRHL 2KZWA 2VDQL 2BNRD 4XMLH 4TRPL 2IANE 4HH9A 1EO8L 1A1MB 5GGUB 1LNUA 5C0EA 1G6RB 1VDGA 4LEXH 3S97C 3HG1B 3V8CA 4MXWL 4ZAKA 1FZMB 3Q0HA 5HYEA 1EIBA 4OD3L 1T66D 1D5MB 1Z5LB 4I0PD 3RWJB 5JXAL 3ULUL 1Q8MA 3UZQA 1UH4A 3EFFB 5IQ7L 5F3BB 3TZVB 3ZKXB 5HGBA 5FO8A 5FYKE 3WIIL 4NQDE 3T2PA 4AEHL 2W9EH 3A67L 5H35A 1T22B 1TJGL 2G5BB 3RVWD 3WS6A 5IG7A 3DI2B 4HCRH 4PRPD 5C0EB 4UQ3B 4N8VA 4M7JL 5DC9B 5C9JB 1V7ML 3OGCB 3K4AA 2CRIA 5IB4B 4KUZH 3W11D 1NUDA 3MROB 2AABH 4XVJL 4JFYA 2MTPA 2VLKB 2IADA 4KJQD 1FNAA 1FPTH 3JSSA 4NT6A 5E99H 3B43A 3HNVL 1F3DJ 2ADGA 4OLVL 4P4KB 3QDAA 3E8UH 3CFEA 5EULV 3QH3A 1FYTA 3FFCB 1WVZA 5J6HA 2ZPKL 1I3VA 4Y1AE 2RB8A 2P24B 5IVXE 4DKEL 4G6KL 5DVMA 3ZO0A 1SQ2N 2JCCB 4PYGA 3QG6B 2NR6D 3M8OH 3OG6B 2H32B 3ZE0F 1OGAE 2ZCHH 3QDMD 4GXVH 1AGCB 3X11A 1I1AC 4LARL 3B3IA 2X1PA 4BUGA 2EDBA 4AEIL 1RZIB 1MUJA 3IDJB 3EYUL 1FBIH 3M1BB 5TE7H 4DZBB 1W0WA 3JWOH 2DS4A 2NY4B 1WEJH 2BVYA 1QSVA 3ARYA 5DD3L 5C07D 1YY8A 2A83B 1QFPA 4POYA 3SQBA 4XNMB 3B5TA 2H6PB 3T04D 3FOLB 3VFSB 1YUHA 4HWBA 3R0NA 3G04B 4WO4A 2XXCB 4XXDB 4KTDL 5CFHA 1MY5A 3VXOB 1MLCA 4IRSA 2APWA 4N5EC 4OFPA 4NRXB 4QWWD 3MACL 3RZCB 2JK5B 5KN5A 2V5SA 1TCRA 3K0WA 3SJVE 3ZTNH 2EDOA 4MJIE 1W0VA 2G2RB 4LCWD 2VKWA 4KAQL 2GK0A 4QOKA 1LO3L 4DOHE 1PG7X 1BEYH 5CLWA 5IB3B 5C0GA 3D5OF 5MENB 1K4CB 4U6VH 3U1SL 4MZ2A 1FYTB 2P5WB 3DARA 4F7EB 3OXRB 1A7RL 5CJXC 1VGEL 1TNMA 3BOVA 4XCFL 1NMCC 2E9IA 2Y06H 2BJMH 3K80A 2Z8SA 5L88H 2PXYB 1GZQB 3SE3C 3DVIA 2DRUA 4U0QB 1I1YB 4FQCH 5EC1A 3QWOB 4RGNE 1FFOA 1RIUL 2E6PA 4L3EA 4F7CB 4LSRH 1A0QH 4FFYL 1IQWH 1ZA6B 4TTDD 3KYKH 1E4KC 3BP6A 3QJHB 5KVMC 1OTSC 3H9SA 4GAYA 1KGCD 4C83A 3QPQD 2IANA 3BD4A 4RMSA 1YNKH 3FO0H 3IS0X 3PWLA 5E5MA 1BIHA 2W0FB 2HFGL 2GUOA 4I2XA 5D7IE 2G5BA 3NCYP 5DR5H 2GJ6E 5HGAA 4HK3J 5DJCB 4OCYL 3H7BA 4Y89A 5FO8B 4G6KH 2WBJB 1QFUL 1LO4H 1LO0H 3FZUC 1OTTC 2IBZX 2J1KA 1X5AA 3BN3B 2YZ1A 2HFFB 2P8PA 1S3KH 4BQBA 3LKRA 2BOCB 5D1QD 4EIZC 4TTGA 4X5LA 4UB0L 5EU6B 4GQPH 5IW6A 1UT9A 1XFPA 2P8LA 3H6JA 3QBTB 4HJ0D 4DGYH 2CIKB 4F15B 1OARH 5JDSB 2OS7A 5HPMB 2HKFH 2FIRT 4XWGL 3VMNA 3WXWH 5F7MC 4LHUD 4YEFA 3TCLA 5DUBB 2NY5C 2D9QB 3DPBA 4GXUN 5E8DH 4X8XA 3VFRA 4C56D 1T03H 5TDOA 4KHXL 3PQYE 2Q1EA 3QWRA 2NNAB 5INCB 1GHFH 2IFFH 4GBXD 2GI7A 4Z78A 5K9OA 4HK0B 5EBLA 3U9PL 5LGJA 4RAUB 4OF7A 3DETD 1LVEA 3FKUS 5T3XD 4O2FA 4G9DA 2HYMA 4WUUA 4B50A 1U93A 3X13B 1JIBA 4WFHE 3SKOA 3HTLX 2P5WD 3MLXL 4K07A 4UDTA 1CXHA 3RGVD 4WUUD 5BVPH 3TIEB 4G9DB 2AVGA 4JFED 4LLUB 3V79C 1J0KA 5IFAH 4A6YB 4JZJB 3RIFK 2QQLL 2ZCLH 4XCFH 4Z78B 4MA8L 5J89A 4L9LB 3SY0A 1E4XI 3TIDB 3LZFL 4JAMB 3N1GC 3BD3A 3AU1B 4N0CD 3VFRB 3DIFA 3ROLB 2EICA 3BEVB 1MFDL 3I6LD 4FFZH 4L9LA 4NP4L 2FJFA 1F3JB 2DWEA 3J8F7 2ERJB 3S88L 5FUZL 3RU8H 3QISA 1AIFB 3P11L 2NY4C 1TVBB 3IFPA 2VLME 1GGUA 1A9BA 3WMSA 1MCEA 1QRNA 4NNPL 2XWJB 3OF6A 3HN3A 1S9XA 3LHPH 2O61B 1N8ZA 4UOJA 1HH6B 1U2HA 1UZ8B 1XGYL 2V7HB 4DTGL 2VH5H 2VZSA 4Q6IA 1TCMA 4G9FA 4NZTL 2D0HA 1G1CA 5AZEL 4GW1A 1DQDH 3H7BB 4OCWH 4KDWA 3OWEA 2A6DA 4G8IB 5B38G 5C8JB 5EDXA 4LVEA 3IGAB 1XR9A 1EAPB 3VFVA 1JGVL 5ACZB 3L3GB 5C70A 1AY1L 1QFOA 3CLFL 4CU8A 4QYOA 2IANB 4Y2DC 4DCQB 1CFQB 2EYTB 1AH1A 1CFTA 4OD3H 2GSGA 1BBDL 4UIKL 1A6TA 3MNZB 1HCVA 1VESA 3T8XA 1MF2H 3MBXH 4L3EB 4NO2A 2R39A 3ME0A 3TJHD 4W6XB 3IJSA 5I18H 1FORL 1CR9L 1GZPB 5MI0C 4JFFB 4OLYH 5KJRH 4ELKA 1MI5E 5AWNL 4WDIB 5I1HL 3EOAB 4NOFA 3NZ8A 2XNAB 3EYQC 1D6VH 2ILLA 5IV2A 2ZUTA 3D1MC 5DD5L 4BSVB 3QUMB 3TYFA 3BE1H 3FB8A 4GLRH 3TVMD 3BWAB 1JHLH 3ARGC 4QOKD 5DEZA 1DBJH 5E5MB 5IVZB 5EZIH 1T7XA 1K8IB 5IF0A 1JNNL 3GRWL 4CGTA 2DWDA 3OR6B 5BVPL 4U1LB 2ICWJ 5MEOA 4DKAA 3DRTB 4M7KH 1E27B 1U3HC 4FP8L 4YXLL 2C7UB 3SCMD 4IRSD 4DUWA 4UINL 1U8HA 4OAWB 3CFKA 1M7IA 3TEUA 1HZHL 3GFUA 1MFDH 2PXYA 1OP3K 4D0BB 5BMFL 4MYWB 2FH8A 2FX8L 3TESA 3BHBA 1FFNB 3TBTB 1DQML 3DXAA 4QOKB 4G7VH 3GKWH 2BNRB 3MRJB 1EJOH 4ZQKB 1IEBB 4NCDA 3OAYH 4NWTH 4PRIB 3VRLF 5KN5B 1J0ZA 2CO6B 4U33A 4MJ2A 4AH2B 1QA9B 1NCWH 2A6IA 4HLJA 2YOCA 4H20L 5DMGC 3HFML 1X7QA 3DXAB 3G04A 1QFWM 3LCYA 2VUOA 1I7UB 4Z7UB 1Z0MA 2F8XC 3WLWC 1MWAB 5DQJB 4LASL 5KVFL 1I1FB 4XP5H 5D2LA 1Z9MA 5BXFB 5E1HB 1FJ1B 5C09E 2DKMA 1QG3A 4WENB 1LDPH 3B3IB 2NZ9D 4LCCC 1KGCE 1CE6A 4N0YL 3T3PF 4M03A 4XCNA 3V6FB 2V7NA 2VSDA 5IB4A 3ZLQC 3D18A 4I18A 1HIML 4O58H 3DI3B 4P2RD 4EQ3A 1CD0A 4BFEA 2B4CC 1ZWIB 1KPRB 2XN9E 4H25B 4DWHA 1BD2D 4HS6A 4M7LL 3ARBD 5C0NC 5C0CD 1MPAL 3O4OB 2I26N 2X4PA 4PD4K 5L88L 1R0AL 1JRHI 3L95B 1KUMA 1S7QB 5IT2L 4HIEA 5CJQH 1JGUL 1Y18B 2UWEB 2HLFC 2F53E 4ONHA 5HHQA 1KENH 3IFLL 3WIFB 3MROA 4EN3D 3DURB 2IPUK 3QFJB 4K8RD 1CICD 3BW9B 2R0KH 3MNZA 3WIHL 2AXGB 2OR7A 5FHBH 3O2DH 1J1OL 4HLZH 3NPSB 5F97E 2VRAA 5KS9B 5FCSH 4YNYB 3TCXA 1X5JA 3BW9A 3VXSE 3MUGA 1G9NC 1CGTA 4KDVA 3QJFA 1TQCC 4NBXB 4Q7DA 2EDEA 3WIFA 1DQMH 4G42A 5DGRA 2Z31B 2EDTA 3NCYS 1GGYA 4L5FL 1BVKA 1XCQA 5DJYB 3HI6L 4YHKL 3VGDA 5L2JA 3K4ZA 5TF1H 3Q6GH 1T7WA 1NANI 3LDBB 1CGXA 4AIZB 4ALAL 1G7QA 1DBAL 4TPRL 3GI8H 5DWUH 1GSMA 1CDYA 4ZAKB 2OK0L 3HB3D 2XXMB 1WF5A 4WV1C 1UB5B 3S37H 1KXTB 1QQDA 25C8H 1TVBA 3IFPB 3KGRA 4MQTB 5D7LE 1HILB 1RV6X 3WCYA 1CTNA 4GMTH 4JN1L 3ECBB 4LVNB 4OCYH 5DMJB 2ITCB 3QQ4B 3EO0B 1JHLL 1J12A 3LPWA 2V9QA 4N0UA 4BFIA 1YMHB 3TJEL 4WWID 4WO4C 5DHVB 4M6NH 3X3GL 1JTPA 4ZSOA 3SDXB 1IC7L 4LP5A 5CGMA 4KQ3H 3WJJC 5C86A 1Q38A 3EDDA 3BZFB 5HVFB 3SKOB 2IBBA 2NY3C 3CSYA 4JRYD 1P5UA 1OGAB 3BEWB 2VDOH 4PJEB 2Z4QA 3GJFH 3UTZA 5HDQH 3UTTA 4APQB 3VDAA 2P7TB 1FNEA 4M3JA 1NSNL 4PRIA 1RURL 1VERA 5KVGH 4NDMA 4LEOA 2R1YB 3P0VH 3SDCA 3GMPB 4HMCA 4BZ2L 3VG0H 1AFVL 4NUJA 4RX4A 35C8H 3HRZB 4HWZB 4JJHA 5DZNA 2GTZA 1HHHA 4AJ0A 2Y36H 1NCBH 2P45B 2QHRH 4M00A 5D1XA 1C1EL 4NC0B 2RBLA 1T6WA 3P9LB 1WZKA 1Z9SA 4H88L 1GGCL 1A6ZA 1E28A 2FLBT 2YD9A 5J1AB 1TTFA 4KI5F 3LKRB 4XWOD 5TH2B 4DQOH 4RIRA 1JMZA 2A73A 1RMFH 1Q9KA 3VFNA 3RNQA 3S35L 3GRWA 4YHKH 3S98A 4LHQB 4PREA 1XF1A 3STZB 3OPZL 2B4CL 3P4MB 4NO0B 4BSVA 5JW4R 1OTUC 3E0GA 5CKGA 5AUMA 3NZHH 5DJ6B 3PXHA 3OKEA 4QRPE 2CLRB 3O3DB 3BP6B 3QJHA 4ELKB 4NKMA 3O6FB 2EXWD 3RA7L 4P0DA 3OKLB 5TDPB 1B0RA 4XI5C 5EC1B 5F1IB 1HKLL 5IB5A 1CDJA 3KYMA 4HUUA 4MCYA 5CHNB 5LG1A 3U7WL 3O6FA 4NKMB 2ATKA 3BPNB 3MRDA 1ND0A 4OZHA 1DN2A 2DMKA 3GBNL 4BQ9A 1QACA 2X4RB 1IC7H 2MKLC 5ACZA 3IFLH 1S78D 5D7JA 5EBWB 2AJ3A 3P4MA 2M26A 2HFGH 2K7QA 3OG4B 4FQHB 4P99A 2ZOKA 1GGIL 5GS1C 1T0PB 5L2KA 2NY1B 3V7AG 3DVGA 3QQ9D 5BRZB 1U8OA 4JM2F 4LRNH 5I9QB 1JF6A 1AE6H 4WFHD 1DTUA 1TQBB 2MCPL 1UZ8A 4M93C 4PBWD 5CD3B 4ODXA 3THML 3RVXC 4PB9H 1E28B 1QKZL 3RBGA 5MEQA 2APXA 3U30B 3Q6FA 2ADFH 5D1XB 4HXAH 4PJBF 3TJHC 4WU5B 5HHPB 4QRRD 2EC9U 3GSVA 2A83A 2EDKA 3LH2L 3WO4B 1YQVL 2ZNXA 3TWCH 1OT2A 2Y36L 3WO4C 1F3JA 3I3BA 4P23A 5FGBC 4X6BB 2R1XB 1E6OL 3MRKA 3LD8B 3RVUC 2R4SH 4NDMB 1HWGB 2DQUH 3QEQE 2HA1A 4IOIB 5ISZA 5KBNC 43C9A 4IOFC 4WEBL 2P7TA 3O2DL 4C4KT 5I2IB 3UJIL 4UUJB 3QG6A 3V5HB 5HXMA 5I9QC 4MNGA 2Q20A 4RA0C 5HI4D 1SYVA 3S96B 4EI6B 1MCSA 3QUYA 1KTKE 1RIUH 2BHZA 4M7JH 3SDDC 4DVRH 3RP1A 4OUUA 5SX4I 5BJTA 4JCLA 1YN6B 1KPVA 1AJ7H 1D6EA 1EJOL 4CUCA 3HMWL 1PVHA 3VXME 4Y88A 3CX5J 5C0AA 3V0WH 4ALAH 1HSAB 4L8BB 2IADB 3CXHJ 5I8KL 3HNVH 3LRGA 2A9ML 3ECBA 2YD2A 3QXWA 1MCCA 1HHJA 2RGSA 1QSEE 3P2TA 1LO5B 2DLTA 5JW5B 3MCKA 2R8SL 1JRHH 3O6FC 4JN1H 3MRNA 4ZUUB 3UTSD 1LP9E 1G0DA 1F90L 4YDJB 3O2WH 3TNNA 5GGRB 1IGTA 2BOCA 3QHTC 4TUOA 5FECB 1MCQA 3KNBB 3KDMA 4S1DD 5IR1B 4H26A 5HVGB 3RGHA 1C5BH 1ACYL 1ZAGA 2DTMH 3F6LA 3W39B 5GS1A 4ZPTB 3AY4C 4G42B 4PGDA 1BJ1J 5D2NC 2W60B 3AAZA 3EW3B 1AQKH 4FZEH 5DI8A 3TA3A 4LVHB 4UQ2B 2O5XL 2OL3H 3VH8A 4PP2B 2GUOB 2BX5A 3ARFA 1ORQA 3LPFA 4MXVF 5E08H 3AUVA 3BDBA 1IT9L 4XVSH 1UM5L 4BYHA 1OWWA 4UNVA 3H9SB 4GAYB 4KGJA 5F21B 3RI5F 3V6OC 5DMKB 1HYSD 1YDPB 4KY1H 3D39D 1VPOH 2HJFA 4J8RB 3DWTA 3BVNA 1I9RH 1ONQB 5T1KD 5CD5C 3HB3C 1KCUL 4XTRC 3SJVA 1ZHLB 4KQ4L 4Z5RB 5E4EC 3ULVF 3NZHL 4PJ9B 4F2MA 5EUOE 5AAWA 4XNZC 5CEZL 1KENL 2YKLL 1DVFA 1ETZB 3QEQA 3REVB 3WLBB 2AV7B 4K3JH 2JJWA 3P9WB 3TO4C 1MCOL 3GMMA 2X6MA 3MRMB 3FQXB 5HI3C 1I8IB 1VFOA 4F80A 2LFGA 1I8MB 4GW5B 2GK0B 5C0CB 5ESAA 3GGWB 2CUHA 3GI9H 3RUGA 4EXKA 1FFRA 4FQ2H 4POZD 1N3NB 3I6GB 5FOJA 3HMXH 5IUSA 4FFWC 3QULB 3WFHB 1CN4A 2QQKL 1FCGA 4XMKL 4W70A 1DBBL 2XY2A 2XZCH 4HGWA 2CR3A 4M6NL 3X3GH 3QDMA 4WO4B 5D9SA 5KAQF 5I8KH 1YUHB 4WRLA 2NY0D 4X8JA 5I1AB 1NMAH 4PJCE 3VD5A 3C09B 1WZLA 1X5GA 3BESR 1YY8B 5JXEC 4H1LH 4LVNC 1P7KA 4Z7UA 1D9KC 1FSKC 3EYVB 4XPGH 4Q9BA 3SDYH 4MLIA 3G5YB 4NZUH 4J3VA 2YBRB 4N8CH 2QSCL 1YEIL 1CYGA 4P46C 1FNGB 2BNUA 2E7MA 4G8GD 4O4YH 3X11B 2GITA 2PW1A 1FO0H 1X4YA 3DVNA 3R8BB 1KIUA 1QLFA 2E6QA 4FFVD 2Q8BL 4MQ7A 4GRLC 3V7AE 3MUZ1 1Y6KR 2HT2D 4GRWF 3ARXA 1I7ZA 4Z8FH 1OTTD 1L7IL 1ES0B 4HQQL 5E2JA 1NLDH 2X4UA 3DV4A 1CE1H 2FDBP 1M7DA 5F70A 4Y19B 4P3CL 4F3FB 1ZOXA 5F1KC 3I84A 5E24E 2GY5A 4AIOA 1JFQH 3ZSSA 2XRAH 4RFNC 4KY1L 4LOUC 5H2BA 3V52H 4GS7C 4P5TB 5D93C 3QFDA 2C7UA 3VRLE 3QEQD 1IC4H 4NQEB 1OAQH 5J6GA 5I1GH 1RUQH 1JPGB 3SCMB 5MEOB 3HI5H 4NQCD 5EUOA 3SJVD 4G7YL 5CWSA 4ESKA 3QUXD 2VAAA 1MCOH 5DQDL 2YA2A 3MNVB 4P9MH 3FB8B 5EIIB 1CLZL 3HZKA 5DMIH 3O4OC 4WGWB 1HSBA 2XNAA 1VACB 3U9UB 4OGAD 1UWGH 5A3ID 3Q2CA 2HWZH 3HKFA 5SV3A 4MD0B 3C08L 4HUXA 3D0VB 5I30L 4EDXB 1A14L 1DSFH 4KI5D 4HFUL 2VTFA 4JKKA 4YDLC 4U1MB 3T8XB 1WBXA 3S35H 1CU4H 1QRNE 3QO0A 4NRYB 1TDQA 1MAML 2A6KA 4JDTL 2DTML 4JPIB 4PRIE 5CSBA 1XGTA 3HMWH 5BZDA 3F7VA 2EKSB 4I0CC 1XR9B 4R3SB 1UXSA 2UZXB 1S7UA 3BKCL 4JKPL 3CSGA 1R24B 3IVKA 3IDXL 1JWUB 1V7NL 8FABA 2JTDA 3BUYA 1HK6A 2HAZA 2HKFL 3L9RB 5E03A 3SGEH 2KDGA 3WXWL 2PXYD 3C2AH 4JO3L 3EDJA 4Q9QH 4XX1G 3BPCA 2R8SH 4JN2A 2ZOLA 4RBPK 5K93A 3TYGL 3LN4B 4IRJD 4OCLC 3KPMB 5IHUL 1QPXA 2VYRE 4P4RB 1EH9A 4KMLB 4U3XA 3RVUD 1JBJA 3A6OA 3D85A 2Z35A 5L8LB 3RBSA 4ZO8A 2EDLA 2P46B 1MJ8L 3VMOA 1VFAA 5I1JH 3K8KA 3GSRB 1DEEA 4Y16C 4PRBA 3QUYD 5GS0C 3QDGA 4YFDB 4QTHA 1U0QA 2P5ED 5D71L 3EJJX 3VXPA 5JIKA 3JWDL 1VKXA 1JFQL 2X4QA 4Q97A 1BAFL 4P5KA 3S36L 1DBMH 5J9PB 2R0WH 1IKNC 4E9LA 2FX7L 3TFKD 2F19L 3IFOB 4XHQA 1L4IA 1JGLL 1CFNB 4DN4H 3T2OA 2OBGA 4XCEB 3QIUD 3ABZA 3NACH 1BECA 5SWZD 5A40E 4K7PH 4Z77B 4JY6B 4ZFZA 5AEAA 1U3HB 1A1NB 2KKQA 2I07A 2OJEA 3FT4B 4X9GA 5DUML 1MY7A 4WUUB 4F9LC 4OLUL 5C6TH 1RZKC 3ARGB 2X89D 3SPVA 3VXNA 2UV3A 1P4IL 3FN3A 5GS0H 1JPST 5HI5C 4RISL 1NFDA 3ZKND 1WV7T 4NC1E 2OM5A 1YY9C 1S9YB 4X7SH 2OR8A 5IKCA 1NFIA 4U05A 4NFDA 4PJ5B 2DQGH 4IJ3B 5BV7L 1P6FA 4G8FB 5FHAL 4Z7VA 3KJ4B 2HVKB 2RAMA 2ICWA 4KKLC 4OZGF 1MAJA 4QHKI 3F8UB 2EC9T 3O9WD 4L29B 1B3JA 4G7VL 4HKJA 1AI1H 4HJJL 4JB9L 3EUUA 3MBEA 1EERB 2VJXA 1HN1A 2PYED 4Y2DB 4M5ZL 4X5WB 1A6WL 4LQFL 5IOPA 2Z92B 1BBDH 1NBZB 5EOCH 3EYFB 2YC1B 4FQXB 1DQQA 3GSUA 4V2BA 3BP5B 4S1QL 1S8DA 4XC3H 1DP0A 4HUVA 2HN7A 1WISA 1NCAH 4PGEB 2ZSVA 4M3KB 1G0YR 5DJ8A 3U83A 1MCFA 2WLZA 3VFOA 2VLJD 4K55A 4JKMA 4PJGA 2X89A 5C71A 4C83B 1AR1D 4QO1A 3ARZA 4XBGB 1WAAA 2LVCA 3MBED 3O2WL 2BNRE 4OD2A 4S0SD 4D3CH 5DTFA 1DL7L 5AZ2H 3O11A 5F72S 1XAUA 5KVDH 4HJ0C 4HUWB 4R7DA 4C56B 3BISA 4LAQH 3QIUA 2E7CA 4K71B 4TOYL 5E8NB 3ZTJH 3QDJD 2C1PB 5JO5B 4X4ME 5FO9B 5KSBA 4X6EA 2E8YA 3VH8G 4BH7B 2RIKA 5C09D 1JJUA 1OAUL 1AGEA 2VNCA 3F12B 5FYLE 1A14H 1K4CA 2XQBH 3ZTJG 4Y5YB 3BH8A 5HYJD 5BRZE 1BGXH 5C0IA 5CLTA 4X7TA 2IH3A 4KK6D 1UA6L 5GSRB 5BO1H 3NA4A 2X1WL 1XF3B 4OLUH 5C6TL 2VQUA 5JHDA 2KPNA 1QBMH 4PJ7B 1NCBL 5JIHA 3GSNH 2AI0H 4M61B 1U3ZA 3N1QC 3OKDA 4H0GA 1FLRH 2F74B 3VA2C 2XWBB 5E1AA 1BQUA 4DN3H 5KTEL 2W0PA 4BSWA 5DJ2A 4CU6A 2APTA 1BZ7A 4X7SL 3VFWA 4WNQB 4QRUB 1CD8A 2H6PA 1TTGA 1C8PA 5JQHC 2K3TA 4BQ8A 1ZHBA 4JRYA 2LVEA 5E94A 4FQIL 1S7WA 4HW6A 3QDGE 4QT5B 1X5XA 1MUJB 4K8RH 4MGXA 4LBEA 1FO0L 5D7LA 4UT6H 3QUXC 2VL5B 3JWDC 3PWPA 1CU4L 4ODHL 1R5VB 4L1HA 1N6VA 4DGIH 5TF1L 4Q9RH 2UVEA 5F7UA 5HPOA 4N0YH 2EZ0D 4X7EC 2JCCA 1T1XA 3E6FA 1CK0L 2WWKO 4LLVB 1PG7W 4G8EB 3CFDA 1GPOH 4X9BA 1CLOH 4ZUTA 1NMAL 1U58A 5IMMA 3L7EA 3FFCA 3O3BA 4M1CC 2MFNA 1KNOA 4KI5C 5KS9E 4UTBL 4OF0A 2ZPKH 3VXSB 1G7PA 1J5OL 1RPQA 1D5XB 4TVPL 1SM3H 1F5WA 2DL2A 4Y4HC 2A74A 3B9DA 1W8NA 5I8EA 5SX5K 3HC3H 2JJTC 3PNWB 4XPTL 5D96C 3OMZA 4J6RH 5KJRL 1QBLL 3WFEH 1UZ6F 5SWZE 3VI3F 1IAKB 4WO4D 4LSSL 2C4FT 2ZG3A 5ELIA 1NMCB 1DBML 4YHIB 2GY7B 5B38B 2GSIB 4RNRA 1NKRA 3MLTA 5JTWA 4XP4H 2XI9A 4Z95H 1NGXB 1JNNH 4NO3A 1KLUA 4MS8C 2AK1H 2LU7A 3LV3B 4OLWL 5JPNA 1KTLA 4Y4HD 5C6PB 3LN5B 1U8KA 1F8TL 3QPXL 4HPYL 4LKCB 3K2UH 5L7XL 1MI5B 4U1GB 2ADJB 1G6RA 3RAJL 4MB3A 1IC5H 1GGBL 5F1OB 1I3GL 3GBLA 4UV4H 4OQTL 4DKFH 3QG7L 1A5FL 5T1LD 3UBXA 2DBLH 3UPCA 4CADB 3AROA 2Q6WA 3VXQA 4EXPX 2I9LA 4Q9QL 1KCSH 4FQJH 1KJ2H 1JNLH 1UJ3A 3S34H 5MP6L 4LDLB 5DEFB 2DLGA 2XOTA 2D31A 4M8VA 1I1AB 3AXLB 5KSAB 4FXKB 4JO4H 2EKJA 3QIBB 1I7TA 2O5YL 4GRLA 2IPUG 2BOBB 2DQFB 4CW1A 4E41B 1AP2B 2VISB 4ELMF 1OSZB 5KS9F 2BVOB 3EO1A 3G6AB 3H3KA 2AK4A 5T1LA 3MO1B 3MMEB 3OJMB 1S9VA 5C08E 4JQXA 1K5NA 1SJHB 3HC0B 1FGNL 4XP1H 4I1NB 1RHHB 2H8PB 4QXUH 2VDLL 2DIJA 2AAVA 1HOCA 3RZWA 1RIVL 4KKAD 3WHE0 2FJHA 3AM8A 2NW3B 1BPVA 2Z93B 1I1AD 3H2WA 1BVLB 1BQHA 1URLA 5EOQL 3MRPB 3F5WA 2OR9L 1CVRA 5F7YC 2V5RA 4YHOH 2HMID 5I1KH 4HJGA 3QUKA 2BY3A 3TVMC 3O45A 2NY5H 5DYOA 1VEMA 4IIQC 1FVCB 5E08L 5M94B 4WY7L 2X7LA 3QEHA 2IJ0C 1FC1A 2OXHA 4CNIA 1KJMB 4FQIH 2H41A 4PRNA 1YZZA 2XKUA 4PRAB 1TVDA 3QUZC 3VXUB 3QQ9C 4JLRB 4F7PB 3ZKXC 1HDMA 1FL5A 1U6AH 5JOFB 1CFVL 3QNXA 3MODL 4NWUL 1MHEB 4EKXA 4X98A 4LF3B 1AXSA 1OTSD 1ZT4A 2AJZB 4CN6A 3H7LA 1A6VH 1TMCB 5E56A 1UQSA 3S5LA 3WBDA 3GMQB 4LSUH 1EO5A 5GGRY 2DQCL 2VDPH 3D2UA 5F44A 4MNGE 1C16B 5B8CA 3JUZA 4MWFA 4XAKD 1NDMA 5T5FL 4L4VD 4QRQB 2AABL 2MWCA 3AGVA 3C9NA 2G75A 1PYWB 2EE3A 4L8CA 1BOGA 3SDAD 3MV9D 4HIXH 5CZVL 2ARWA 4JY4B 2RFXB 2MNUA 3T0WA 3L3KB 3C5JB 2HRPH 2NCMA 4JHWL 4FABL 4QY8A 4PV8B 4CAGA 3CIQA 4POZC 3U82B 4FXGA 4X5XA 4RFOH 1IGIL 3G9VA 3MLZH 3FTGA 2YD3A 4F9PC 2VDLH 3EYOA 3OGOE 4ZPVA 1BOYA 3NGBB 1CD1A 3W9DA 4LLWA 1LEKA 4NSKB 4TUJB 1PAMA 4XBPA 4ZS7H 2EIZA 1FIGH 5LCVH 3BPOB 1H3XA 3SO3B 5JXEA 1I85C 1ORSB 4BZ1H 5I76A 3ALWA 2BNQB 5TDNB 4EVNB 4MJ6A 1BIIB 4P2OC 3GMLA 2LTQB 5I1LB 5KSBE 2H26A 3MV7E 5FCUH 4R8WL 4DAGL 4P2OB 2V9TA 3T0EB 3W82A 1IC4L 15C8H 4I13B 4PJFA 1JGUH 4G6AC 2FYYA 3RGVA 3RWHA 4OZGB 5DJ0A 4FQQB 4RRPA 4PS4H 4YBLB 3BPOC 1NAKL 3RDTA 3CFCH 1FGVL 3STBA 3GHBL 1F6LL 4CN1A 4EJ1C 4YHYC 4JRXE 1ZGLB 4G43B 3UTSE 2ESVB 4GFTB 4R4BB 1CZ8L 3QWRD 12E8H 4N1HB 2MPAH 3DX9B 2VDPL 4XPFH 5LVEA 4ELMA 3C08H 2HKHL 4NM4H 2DLHA 3PWJA 1RHFA 4BK4A 2NLJB 3LQZA 2DLFL 3TPUB 3I02B 1IGMH 3MGTA 5B8CC 3CXDH 3E3QE 5BS0B 2JLLA 4I8DA 4UNUA 1KXVC 3WL9A 4PJ8C 4OCSL 1FZKA 5TFSL 3AMKA 4ZFFB 4KKCC 1OGAD 4RMUA 1TENA 4I2XE 2CDFB 4JJ5B 4LLMA 4S2SB 2IFGA 1HEZA 3VGGA 1YC8A 1A7OH 4PJDE 5D1ZB 5ADOH 5E9DA 4XCCL 1E6JH 4MS8D 3MRHB 3RWDA 3O8XB 2ATPA 2I60L 5ALBH 2ZUQC 2BRQA 1BBJB 4BZYA 1SBSL 3O2VL 3RWEA 3WXVH 3NBNA 1U92A 4HJJH 3MOQA 2GIYA 4YXHL 5HHNB 4OGXL 3QXTA 3ILQD 5AD0B 1CT8A 4QRPB 4HT1H 1TNNA 2CLZB 3IF1B 4FTVB 3SO5A 2P5EE 1X5ZA 5A2LH 3RWHB 3GO1H 1H8OA 3VI4F 5AG8A 3UTPE 3JWDH 3KPLB 1S7XA 5SWZA 3QUZB 1Q9OA 4OZ4B 2PN5A 1TPXC 4LOUD 4BKLA 4PJXE 1BM3H 5A2FA 5F1NA 1N6QL 2QADD 2Y7QB 3CMOL 5CEZD 1OCWH 4K2UL 4N0CC 3IRZA 4GAFB 1KACB 4NO5A 2ADFL 3VW3H 3BJLA 2DI8A 2MHAA 3MJ9H 4FQCL 4XH2B 3OTTA 4NKOB 1IARB 1U41A 3QDGD 4MXQD 1JHTA 4HCRL 4GSDL 5TDNA 3I85A 1RSFA 3DMMD 1GH7A 4Y16A 3VRJA 2X5PA 1A8JH 3NFSH 5FYJU 1EJ6A 4Y4KD 2Y07L 1RZ8B 1G7HA 3B8YA 3BP7A 1HINH 4RX4D 5LBSL 2VITA 1P4IH 1CF8H 2R4RL 1A6UL 3EOBA 4PRHB 1X4XA 4HIHB 5B3NA 1X5HA 3OB8A 1QLRB 2DB8A 2NTFB 3OQ3B 3QFJD 2D03H 4QEGA 3RQ3A 1MWAH 4HKXA 2H1PL 1T5WB 1GGBH 5C92A 1J86A 4R7NB 5J4MA 3PWPE 4MD5B 2J5LC 1CI5A 2J8HA 5DRXB 5F93C 1ZLVK 4MDJA 3SDDA 4KPHL 1XH3A 2HJKA 3OPZH 4B5EA 2LU3A 4UTAH 4LSQH 5ABDE 4QXUL 5J06A 5E5UB 1KJ2L 3D0LB 2FHFA 4Y8AA 5I8CB 3X3FL 4UILH 2JB6A 3JWNC 4J3UA 2F54A 4PJEF 2PO6D 3JTTA 1ODAA 1DBKH 2ORBH 5DA4A 4JKLA 5KSUA 5DJDA 3N1PC 2WK2A 2F53B 1HHIB 2VLLB 5EC2A 3ZDZE 3GMQA 5CZXC 5HI4C 1DN0B 2XACC 1QLEH 2HH0L 4U1GC 3GSOB 2VQ1A 1KPUA 3OAZH 1NGYA 5HY9B 5IMLB 2P44B 2N7AA 1C08A 3RL1A 1Q94A 1IAMA 1Y0LB 2V2XA 5DLML 1OD9A 3BIKB 4L3CA 3TBVB 3RVXD 4RGMB 5E7FA 2XFXB 2R2EA 2E7LA 3KG5A 3HZVA 3ES6B 4PRAA 5EA0L 4ZUWB 1BREA 3PWVA 2B5IB 5D6CA 4WCYL 2AEPL 3B83A 4OZFG 5TJWK 5DVOA 3RWFA 1FFPB 4XNQA 4OIBA 2AXJA 2MQ0A 4L1DA 3D3VB 4XPTH 5FDYA 4YWGH 3GJEB 1AGDB 2AJSL 3QQNA 3MA9L 4Q2ZA 1NLBH 3HI1A 1IMHC 4Y4HB 3ZKMC 1LK3H 4LPWA 4ZAKD 3AB0C 2XKNA 4WWKB 3N0PB 1A7NH 1O5DT 2Y4SA 1YN7A 2GAZA 3H9HB 4M7ZB 3HC4H 3JV6A 5JQ6H 4LCYA 3G6AA 3QPQC 4ENED 5JW4M 5ID0B 3FT3A 2QL1A 3KAAA 1MCIA 2WINA 4HC1L 3VD4A 2VUYA 5DVKA 1RZJH 4N5UA 2V2WB 5DD1L 1IAIM 3H9ZA 3PHOB 3RWCA 2OLDA 3I50L 4JPVH 3OJDA 4NN5C 4PRHA 5DD6B 4PLJD 1XIWA 4JM2B 4N9GA 1CDBA 1IGCH 1DQJA 1XGUB 5I1JL 3SKMB 4M6AA 2H32H 4MZ3A 2DBLL 3RY6C 1OLZA 3HAEH 4UDUB 1G7IA 5EZOH 3T2NH 1E4XH 1DQJB 3S36X 4PJBB 4R96A 1HKLH 2I5YH 1B90A 4PIRF 4PY8J 4IS6A 1N0LA 5TQ0H 4D0DB 2ADJA 1R3JA 2FSEB 4PP1D 4M7KL 4HF5H 1QPPA 2B1AH 1KB5L 1RY7B 1P4LB 1FYHB 2CJUH 3LV3A 3MV8D 1NGWB 3MV8B 4U1IB 5LGHL 1U8QB 1FDLH 1AQKL 1JWSA 4FZEL 1N0XH 1J1XL 4U0RC 2UZYB 1T4KA 3SE8L 1CG9B 4J3SA 4XNUL 2Z91B 3WE6A 1J8HB 1N4XL 2CD0A 5JOEA 1R0AH 5IW3A 3WFZA 2YPKB 3IJYA 3HI1B 2HJLB 4O9HH 5GXBB 1BBJA 2ITDA 4K71C 2CLVA 4QKXB 5I1GL 3B5GA 1L7TL 1UWEH 4N1CA 1AHWA 3O3AA 2X40A 3DTXA 4CU7A 3KYNB 1T2XA 4QHNA 3QXDB 5E2TH 5IQ9A 2A74B 1IC5L 4OIIH 1FZKB 5C0BA 2XZAL 1P53A 5FKAB 5EU5B 1TJGH 3VXSA 1ZT7A 3O4LA 4LLQB 5F8RC 3LS5L 4TQEL 2B2XH 4JHAH 1UKSA 2VAJA 3PWJB 4FQXC 3MRFB 1QFWI 4Z7NF 2XPGA 3CK0H 1IQDA 4K8RL 4NNXA 3S4SA 1A3RH 3BKYH 4NJAL 1SJXA 5MEPB 4NKIL 4WWKD 4MJIA 4AMKH 4P5MB 4JM4H 5DRNA 3BH9B 1WAAF 5D7LB 3DROA 2OMNA 3VRIA 4Z76B 5KANI 1NJ9B 3ZHDA 5GGSA 4F8TA 2Q86A 2VR5A 5F6HI 5JPMA 1H8NA 4N0FA 4ZYKA 4OLYL 5IHUH 1KFAL 5EU6D 4H0HB 2HRLA 2W9DH 2DI7A 4P2OA 2X9YA 3IAPA 5ISZD 5GRWA 4MNQE 1WWCA 3SHSA 4NRZA 1J5OH 1R5IB 3R8QA 4LAJH 3G5ZB 1MVUB 3CH1A 1XH3B 5F7FA 5D5MB 5B3JF 2WWMC 3STLA 2EIEA 5DFWH 3FB6B 5DGQA 1ORSA 4K7PX 5I1KL 3WHE1 1OQXA 1SYSB 1ZXQA 5GSRA 3CVHA 4OCRH 5IFHH 3RNKB 2NY1D 3TBWA 5FHBL 4JRXD 3EGSA 4XNYL 3SE4A 5IW1A 2F19H 2R4RH 1FVDA 4X0KB 1V5JA 1IKNA 4GRWH 5EA0H 1NC2A 4HIHA 3NN8B 4NBYB 5GGTL 3HE7A 1FVDB 4X0KA 4ZPVB 3EYOB 3AM8C 2VDRH 4F7TB 5F7HA 3OKYA 5JORA 3BXNB 4Z76A 1FO0B 3RNKA 1U42A 2OXGA 4X4MA 4Y16B 1WIOA 2DKUA 3V4UH 2YUXA 2WQ8A 1KF9B 1S7RB 4XZUA 5FIEA 3RHWK 2A77H 3U48A 1NCDH 4NQTA 2MHAB 4K3DH 2R0LL 1T5XA 1SVCP 3V6ZA 3NABL 3ULVE 5ILTH 4ZNCD 3MLUL 4KMQA 3LEXB 1WCBB 1H0DB 1RK1B 2EXWC 4PGZA 1X5FA 1DBKL 3JV4A 5SWZB 4JGMA 2W07A 5CIPH 3WUWA 4M4RA 3MRBA 1PKQB 4X6FB 5CGYC 3CFJA 3RUGE 4RWHA 5I71B 2CK2A 1RZ7H 2YC1A 3LOWA 3ULSB 4F57L 5HDLA 4W68A 1CQKA 1PG7H 5IQ9B 4P3DB 1MJUL 3OZ9L 3RKDC 2ARJQ 4LHJB 1CL7L 3CJJA 1NC4B 1P7QD 1F4YH 3KYNA 4LF3A 3QEUA 4TVPD 4RZCA 2VXUH 4XC3L 3LZFH 4GW4A 5I71C 3IAGC 3IDGA 5IJVB 4O02L 3VJ6A 4L3AA 4TNVF 3DUSA 3KPPA 3PL6D 1T89A 1TJHH 4WW2B 5ACLA 4I3RL 3FQUA 1T4KB 5C0BD 2DM7A 4CNIB 3SGEI 2J4WL 3F7RA 4V1DD 5HJ3B 3FONA 4P48A 4LGPB 3VXNB 4LCWA 3ARRA 1P84J 3QCVH 4PLJC 2H3NB 3D48R 3IAQA 1CWVA 4OCRL 5I75B 5IFHL 3PXJA 4K9EH 5FKPB 3SCMC 4LARH 3F7YA 3ZT7A 1S5HA 1DUZB 2FHBA 1QVOB 3QIUC 1BVLA 5D93B 4GS7B 4L8SB 2YPKA 1U95A 3IJYB 1Z3GH 1HXYB 3MXVH 3I75B 4QHLA 5H8DA 1Z0NA 1CG9A 3RIAF 4U1JB 4P5KB 4P2QD 5J9PA 1E0OB 1JZ7A 5C08B 4CJ1A 1NGWA 3ZE1E 5FDWA 4F7MA 3PGDA 4U2ZA 4TNWK 1KIQA 2BVOA 4NQCA 1WT5A 1OF2A 3ZTNL 4GRLB 2NXYD 1Q9LB 4OGZA 5F89A 1IL1B 2A0LC 1EO7A 4IS6B 1UYWH 4NQCB 3GMLB 2Q7YA 3UYRL 5T1MB 3GI8L 4P46B 3QCUH 2DM4A 2HKHH 3K46A 3VGAC 2VDMH 3JV6B 3SEPA 4F37F 3ARBC 2NQCA 3CU1A 2BJML 1F97A 5FM5M 3D87B 4LKXA 4A2LA 2YWZA 3C09C 3K2MC 4Q0XL 4CADA 4BFBD 5IEHA 4N90D 5D2NE 3NFPA 5F9JB 4HX1A 1U95B 5DJZB 4TUJA 1LEKB 1W72B 1QVOA 2BP3A 4PG2C 5EIVA 1OW0A 4PJXF 5EBGA 2Y5TB 4J12A 1M05A 1B88A 2FGWH 3RRQA 4DTGH 4O02H 4ORZC 4KTEL 1NDGB 5DQ9B 5ALCH 1FFPA 4LCWB 3RFZC 3D0VA 5SWSD 4JQIH 3JVGA 3HHRB 3IDNB 3DUUB 5F7KC 3SE9L 2BSSB 3HZVB 4UTAL 3MLTB 1YMMA 4D9LL 1B2WL 3TO4B 3N85H 5JZ7D 3P30H 1TLKA 4Y4HA 3IDGB 3E3QC 5IJVA 1XGPB 3UYPA 1IAKA 4HT1L 3S6CA 1OSPH 2JJTA 3G5XA 4HF5L 4RMQA 2FIKB 5ITFA 1XR8B 1KB5H 1EZVX 4NQEA 4EI5A 1P4BH 4YFLI 5HYJE 1BFTA 4YHPB 3CX2A 1CLCA 3ELAT 2QR0B 3VFMB 1HHIA 1EGJL 2F53A 2VLLA 5CJOL 3SQOH 4M48H 5T3ZD 1PGRB 1HKFA 1ZS8A 4KMTH 4AL8H 2ZKHH 3ES6A 3R4DA 1RZ7L 4TQEH 1WUNT 2VDRL 4U0RB 3RWIA 1KCVH 1KNOB 2OZ4A 2DD8H 1DVFD 1I8LA 3DV4B 2WNGA 1ROWA 1XCTB 4YQXL 3BKJH 4XP9H 3V6ZB 1I7ZB 1G9NL 4OZHF 1T5XB 5DUMH 4UINH 4OD1L 4IMLA 1RZKL 4LIQE 4NKIH 3GSOA 4J7RA 3DVNB 1MFBL 3C6LD 1DE4A 1HE7A 3KJ6L 5DRXA 4JE4B 5TGBA 3GI9L 4K3GA 3LEYL 5KVEL 2BZDA 3WS3B 2MPAL 2YD8A 3MJ8A 3VU2A 4H1LB 1ERNA 4NKQB 5SV4A 5BV7C 5LXGL 3LS5H 4HZLA 3UCRA 4R90L 2R23B 1NC2B 4YJZL 2CK0H 3QDHA 1FPTL 4ONOA 1F4AA 1AO7B 4AEFA 5HHXH 4OZGE 3FT2A 4UMGA 2JIXD 3KPSB 2JB5L 4V1DA 3STLB 3UZVB 3SDDB 4OJFL 3MRQA 1MNUL 3GUTA 2CGRL 5CGYD 3C6LC 1UM5H 3RWGA 3IDMA 1FN4B 2VZVA 4ZUVA 4OLZH 3QIBA 4FMFA 2MCPH 4Y5YA 4LASH 5KVFH 1DUYB 1RIVH 5GRVK 1TETH 1HWHB 2DLEA 4PJ7F 3FAWA 2Q86B 4CDGC 2ICEB 4JDVB 2E3VA 5JHDD 4BUHA 4U1JA 2CH8A 4Z5RA 3VRIB 5HBBA 2VOTA 2GYSA 3WFDL 5K59E 4PJ5E 5GS3A 2HJFB 4EI5C 3KPNA 3TVMA 5EG6C 2R0LH 2WIMA 4XGZA 3CDGA 4M7LH 2J7LA 4PY7A 3VFPA 4NO5B 4KI1A 3C8KB 3MRFA 5E9DE 4MD4A 3QDJA 2B0SL 4YO0A 1Q9OB 3QUZA 4QHMB 4XBEH 4XAWH 4S2SA 1IJ9A 3N50A 4LLMB 2B1AL 2NY1C 2DQHH 4JFZL 3C60D 1I75A 1T3FA 3KPSD 2E7LC 1L9NA 1IAOB 3GSUB 5TPWL 5IR1A 4I5BA 3KPPB 5JDJA 1QBBA 5BS0A 3SE8H 1RJCA 5HYSG 1EXUB 4RNRB 2GSIA 1F4YL 3VFUA 3B2VH 4XNUH 4YXLH 2YRZA 4P2YA 5C2BH 3LQZB 4TNVK 3BPNC 1UB6B 4RQQA 4JANB 3QUMH 4QWWC 3VA6A 1F4WH 1JUFB 3GM0A 5FB8B 4RQQB 5L6YL 4HFUH 4JFFD 1HHJB 1MELA 5EOCJ 1MJJB 5I8EB 1EXUA 3K74B 1HSAA 2NY2C 3K4DA 1N7ML 3GDBA 1D5XA 5HYSB 1LP9F 4DEPB 2VERN 4M62H 1R5WB 4X6FA 4FOMA 1QRND 5C0AE 2FRGP 4PJFE 5C0DB 3NVQA 3OAYK 2CGRH 3G6JE 3UMTA 3KXFB 1K4DA 2J5LB 2VE6A 3CFDB 2WW8A 4KKAC 4MNGB 1FG2A 3F58L 1ADQA 3MNWB 1NAMA 3HE6C 3PGFL 3SE4C 4PJBA 4XZUB 4I77H 4WUKL 3LRHA 3P73B 1M6OB 4N8CL 4N90E 3PWPB