3QXUA

Free structure of an anti-methotrexate cdr1-3 graft vhh antibody
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDKGKNTVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Methotrexate CDR1-3 Graft
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 29
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxuA00
4Y2DA 1DFBH 3NFSL 4RISH 1JZ2A 1N7ML 4OLUL 1F02I 1BVZA 1NLDH 1OLLA 1A1MB 3MRNA 2DLGA 2HH0H 4O02L 4RMQA 3B5TA 2F8OA 2GFBA 3ALPA 3LCYA 1E4XH 3JWDH 2A1WL 1HXYA 1C7SA 1KB5B 2HAZA 5GGSY 5GSVB 2X89D 3H9YA 2BVTA 1AO7A 1FYTD 4X7TA 1DBBH 4MAYB 4I9WD 4GXVL 3BIBX 2CQVA 5D7IB 1GGCH 3D2UA 2AEQH 4WFGE 5DXWA 4R2GC 2CLVB 4ORGA 5L2KE 1NFDB 5IEKB 1FYTE 5A3IC 4W4OC 1IM3B 1AGDA 1UKQA 2COQA 2ESVD 3EOAB 4IOSD 4RIRA 1ZA6B 4OJFL 4PJEF 1OGAD 1CFQA 4BKLB 2W59A 1YEGH 1P1ZA 3FO1B 4P4KD 5HYQB 4PRHD 4XB7A 5D1XC 3VE0A 2BNRD 3NFNA 1KCKA 4XH2A 2DLHA 4DW2H 5C1MB 3GSWA 4HIEA 5GGQL 4NWUL 3ESVF 5FKPB 2WBWB 3BEVB 1O7SA 1KTLB 4GKZA 4JHWH 1OAQH 4XXDB 3LZFL 3PWNA 5BV7L 3DIFA 3C87A 4KQ4H 1I7ZB 1MH5B 2A74A 3BP7A 3KYMB 3O6ML 4J6RH 5AYUH 3SGJC 2HMIC 3RQ3A 4GAYB 2FIKA 1F90L 5D1QB 4Q0XL 5CJ5A 3I50H 4PP2A 3BQUA 3VFUB 4W6WB 4Z78A 5CSZA 4HWBL 1Q9KB 2O5ZL 2J8UF 1K6QH 1U8HA 4O2EB 2C26A 1GCFA 3LN5B 2F54B 3GMNB 1SM3L 4HXAH 4YDKH 2GK0A 4E42A 4GRWB 4NQDB 3HRZA 4LNRA 3U30B 2Y6SD 4MD0B 5HJ3B 3MCKB 2XWTA 1FO0B 4NKMA 5TFSH 4YEFA 4JO1L 4XNZC 4JQIH 4K07A 2C3HA 1J0ZA 3A67L 1ED3A 4JPKL 3CCHB 5IV2A 2CLZA 4I2XE 2I60L 4QXGL 2ITDA 1N2RB 4HZLB 4F2MA 5I15H 1FC1A 3OKEB 3M8OH 3TN0A 5C92A 4JFEE 1IFHL 2FGZA 3HE6B 4NZRL 4TYUA 2VL4A 4OM1L 5GRVL 4AENA 2EXWD 3JWNC 5DJ0A 1MREL 5TH2B 2F5BH 2FB4L 4G9DA 3UAJD 1PLGL 1YEDA 4S1SL 4ZFOB 4UU9A 3QRFM 4H8WC 4YAQB 4Z7VE 4LDOB 3RU8L 1RZ8B 3MUGB 5TDOA 3RL2A 1XH3A 1U8MB 3OJDA 3WHXA 3S98A 2XZAH 1S3KL 2P49B 5K9JH 3WKML 5C71A 4NQUA 3LV3A 5CZVL 2Z31A 4OLVL 1M7DB 1DBKL 4JFFD 1PJ9A 4FZEH 1VEMA 4DVBA 3IDXL 4BFGA 1UT9A 3H3KA 4L3EB 3EO9L 4C56A 1GHFH 4JO4L 3U7AA 3GK8H 2VISB 1WQVT 4LCIL 3IKKA 2ILLA 5B38G 4IJ3C 5KVFH 4LLVB 4I0CC 4OZ4B 4LEOB 4K3DL 2KQMA 1WCQA 1A0QH 5C70A 1YECH 4XNUH 1IARB 2FO1A 4N8CL 4LSPL 3GMQB 3SE9H 1IMHC 5DEGB 1ZV5A 1YEJH 3VWKC 5IEHA 1T2XA 2NY2C 5I18L 5EZIL 3TO4D 3RVTC 3DGCR 3WN5A 3PWPE 4MXWL 1BIIB 1IGCL 5C2BL 4PBXA 4G8GA 1LK2A 3ALWA 2F5AH 4X4MA 1TTFA 3I6GA 1IEAA 3FFCA 2IAMD 3U0PA 3GMMB 1B6DA 1EERB 3O45A 1A3QA 2NXZD 3QCTH 2EDJA 4APQB 5C6TL 2CUMA 4FFVC 2Y25A 5KW9L 1T04A 4ZAKA 1PD6A 3ILQD 1DBMH 4WWKA 4UNUA 4OD3H 1OP5K 5J6GB 3L5HA 4NZJA 5BRZA 1P5UA 1IC7L 5B21A 4F57L 1XF5B 2ATKB 1T1WB 1YJDL 4ZUTA 4X6CB 5ANMA 2ICWJ 4IOFC 2OTWA 5ABDE 1CXHA 4HWZB 1MFNA 1T2QH 2HWZH 4EUPH 3DSNA 2YPLB 5E8DH 2APXA 1ZVHA 1EVUA 4JN2A 3QUYC 3SCMA 2UZYB 1SMAA 3S88H 5MENE 1G6VK 2P5WB 1UYWH 2J5LC 4OI8A 2E6JA 2NY4C 3BESR 1HILA 1A6WH 1P9MC 5D70H 1GZQA 4D9QD 4R2GB 3N06B 3EYUL 1A7NL 2XKNA 4FMFA 3PV6A 4L8DA 3T65A 1LEIB 4WW2A 2ZUWA 1D5MB 5E6IB 3DX6A 2RJMA 2AJZA 4N0UA 1G7JA 4ONGH 4YHIA 4X9IA 2VE6B 2AXHA 5D7SL 3NFPB 4WFFD 2A6IA 5A16A 1ZLWK 5BZWB 1DJSA 5IW1A 4YC2B 1F4YH 1F6LL 3S34L 3TVMD 1SJHA 1DQDL 1KIPA 2X4QB 5IVZA 4KJPD 3PGFH 1NGWB 1NUNB 5JXAL 4X6DE 7CGTA 4LHQB 1A02N 5I1HH 3MV9B 2NY0C 1VESA 2YMXL 2NY3C 4YXKH 2EH7H 3OXRA 1QR4A 1NGXA 4KZDH 1KPRB 1BZ7B 5EWIL 5EO1B 4JO2L 3OKNB 3GB7B 5MP6H 4F37F 3KPOA 4ZUVA 1KJ3H 5DC0A 3O6LL 1A3LH 3B2VH 1U2CA 3WE6B 3IETB 1J8HD 4OKVA 2DYPA 5IB1A 4CRPA 3JUYA 4PRPA 4M93C 4M62H 3QI9B 4KZEH 2EH8H 5ESAA 1YNKH 3HE7C 2WINA 2Z35A 1GVIA 4NM4H 2ARJA 2VR4A 3QXWA 1BEYH 4HJGA 5DEZA 4QXUL 1X9QA 2EYRA 2AEIT 4Y4FA 5D7IF 3S3JA 1N6QL 3DVGB 4M9PA 1NMBL 3GJEB 3GKWH 1Y6NR 5I1AA 1UZ6F 4XC3L 1RUAL 3DTXA 1NFDF 3QJFA 2AI0H 5I19H 2JB5L 3VXRB 1G7HB 4JM4L 1R3IH 3ZDZF 5IMMB 3ZE1E 1AGBA 5FYKL 1I8KA 1WZKA 1Q1JH 4H0GA 5DS8B 1G6RL 1KPVB 1GIGL 4A6YB 4RQQB 3LMJH 1MI5E 1JI1A 2VLJB 2W9DL 2CLRA 1MRDH 3UJJL 3LKOB 2WLYA 1T1ZB 3GSNL 2IC2A 1I1FB 2ZKHL 3SCMC 2H32B 2YD3A 4DGIL 4GRMB 1KELL 3BN3B 2DS4A 4HUWA 3MGTA 1UCBL 4XBGB 3WMSA 4IRJB 2ZOLB 4DK6A 4HH9A 4JVUA 3HC4H 2LFGA 2YUZA 3VRLE 3L3OA 2HLAB 2ARWA 4WW2C 2MHAA 5I1DB 3NA4A 2Y23A 3I3DA 3RX7A 1L9MA 5DK0B 1ND0A 3BPLC 3C5ZA 1EEZB 3LEXB 4MJIA 1JWUA 4BH8A 4TTDD 4ZNEE 1GC1C 5L8JB 1N3NB 4M9OA 1MAML 3F12B 4O00A 1BD2E 1H8OA 3BHBB 1LO2H 4GRWF 3P0VL 1A6TB 1Y0LA 3TJHD 1R3JB 5GRVK 3MACL 3IXTB 1HYRC 1CQKA 2R0WH 5HYJA 3UPRA 4H26A 3UDWA 1V8HA 1AR2A 2RFXB 4XVSL 1EFQA 3K2UL 5M94B 3TZVC 1S7RB 4R97B 2OYPA 3VWKB 4L5FH 4CMHC 2FBOJ 3ZKQD 3QEUB 2A0LC 3VH8G 4FABH 2X89A 2IMMA 1FNLA 3PGCB 1FYTA 3WUZA 4PRDB 4P5KB 4PG2C 1BM3L 4HLJA 3EDKA 5C0FA 4Y4FC 1TJHH 5C0JB 2AK4D 3MRQA 3T8XA 3C09B 5JLZA 5K59E 3ZLQC 4P9ML 4B53A 3P9LB 5HGHB 3T2QA 1WEJH 4Y0GA 3DMMB 4JKKA 4P48A 3RBSA 3KYOB 3MBED 2DIBA 1MIML 3KGRA 5DJ2A 5E00A 1QSFE 2PETA 1SMOA 1D5XB 1DFBL 4U0QB 2ESVA 4WW1B 4QRPD 1EHLH 1NLDL 1URLA 5D2NE 2D31A 1QKZL 1OGAA 5TDPA 4KHTH 3JWDL 4P4KA 3R06A 4KROD 5CWSA 2BNRA 6FABH 1DLFH 1A7RH 5JHDE 2VDPL 4L9LC 4LKCA 3UTPE 4LVOC 1VDGA 4XCYA 4LCYB 1FFOA 3IJSA 2EZ0C 1WBXA 2EDKA 1GGCL 5J13C 3NH7H 5F7YC 3V6OE 4NJ9H 4DAGH 2CKBH 3C6SB 3TO2B 3L6FB 3ARPA 3ORJA 2XWJB 5ID0A 3J8F7 9CGTA 4XWOD 5FAAA 3U0TB 1IQWH 1W0YT 2FX9L 3LRHA 1ZT7A 4GLRH 5IJVB 1ZS8B 3GKZA 1TVHB 4U7MA 3DURA 1YEIL 4M8QA 3VD7A 3HI6L 4KKLD 2YD9A 1AXSA 3NIFE 4I0KA 4LARL 4YHLH 5F7NC 2H6PB 5BXFB 1T6VN 1RZIA 4QXTB 4DW2L 1OVZA 1B4JL 5F89B 2AVGA 2DICA 4GKSA 5EU6E 5E4IA 5FO9B 4MCYA 4JHWL 4PJDB 3T0ED 3SDDB 1C7TA 4I48B 3TC9A 5KZCB 3JTSB 2C9AA 1ZA3A 5I76B 5DUML 4J6RL 5AYUL 2AJXL 4PLOB 4PR5B 5D7KD 4X6CF 3I50L 3X3FL 1T22A 1W0VA 4XPHL 5KSVA 3FQXA 4AT6A 5F7LB 4EI5C 4CVUA 3ULUL 2YSSA 4GUPA 2AXGA 4N8VG 2ADGB 3CMOL 1SYSB 1K6QL 3JV0A 1DE4A 3VI4F 4NRYB 5D7LD 4YDKL 1KT2B 1FFQA 1I3GL 1RV6X 4YE4H 5L6YH 2NY1D 3GDBA 1OAUL 2J88H 3B4NA 4Z7UB 3QJHB 2H41A 5TFSL 4JPVL 5E8EA 3SKUD 2IPUK 4JQIL 5CEZD 4U6XA 5LQBH 1U91B 1P4LB 4L3CA 5C08B 3GNML 1I8IB 2Q86A 4M1GL 4GMSH 2BOBA 1U8LB 4LNVA 4PJGE 3QQNA 5L2JA 4JFFA 2MQCA 3Q5OA 2F58L 1AE6L 4G6KH 1EFXD 1GOHA 2WP3O 1NPUA 3VXQB 3SDYH 3CDGB 5I1KH 4ZOCA 1FFRA 2NW2B 5F3BA 2EYTA 3QUKB 4CL7A 4G6MH 3PGDB 4JZNB 4F7EA 3W9DA 3QNYB 2Q3ZA 4ZUUB 4J8RA 1FAIH 3ZTNH 2Y06H 4M7KL 5DTFB 5TDNA 4OGXH 2XZAL 4RRPG 5A40E 2NZ9D 1LNUA 2V17L 3MGAA 4QTIH 3NOIA 5K9JL 4KRPD 4WO4D 4IIQC 1YQVH 2IGFL 3BPLB 1H8NA 4NQXA 3K0WA 15C8L 4W68A 4X6EB 2A38A 3TO4A 3I75B 4NHUB 2VQUA 2Y6SC 3WS6A 3EO0A 4S1QH 5TQ0H 3FOLB 3BIKB 3QUZB 4RAHA 4PG9A 2IAMA 3F5WA 4UTBH 4U3HA 3SGKC 4P4RB 4FXGB 4K7PY 4LMQE 1F4WL 5C07B 3FT4B 5KVFL 3MRBA 3G6JB 1NC4B 1A0QL 3RVXD 5DURB 5DJDA 4PJEE 1CFTB 5F9OH 1YECL 4XNUL 2EXWC 1QR1B 4OIIL 5J12C 4H1LG 3D87B 3MROB 1MCWW 4QGYA 1DZBA 5F96H 4LCWE 3BAEH 1YEJL 3IRZA 3QDMB 1I9JH 3MLVH 4MLIA 3JV5A 3OXSA 3O8XD 2MKLC 2E27L 2BVQA 5ECJE 1X6NA 3VWJD 4XCCH 4PREB 1P6AB 1JFQH 1RZKC 4XCEA 2FDBP 4D0DA 3TEUA 4JCMA 5T1MB 3GUTA 1MY5A 1AGCA 1YN7B 1CI5A 5E2VH 1JWSA 1U41A 5J9PA 2DQFA 1BPVA 5F6IB 1W72B 5B3NA 2XN9E 1UENA 5IHZA 2QR0B 5EFIB 3BJ91 3GGWB 2P44B 3FB5B 4NC1E 4UV7H 5AEAA 3IAPA 1LO5A 3DXAE 3PP3K 2FBJL 1DBML 3H9SD 2FHBA 4PJAE 1ORSB 1HEZB 4HLZG 2AXFB 5ACZA 2YD2A 3EGSA 2EDXA 3TVMA 1YDPA 3MJ9A 1T2QL 5JW4R 3UPAA 1UCTA 5KSAB 1NL0H 2AGJL 4L9LB 1LHZA 2EIEA 5B39A 4LVOB 1NUFA 2CGRH 5IB3A 25C8L 4PGEB 4ZYKB 3IXAB 1S7WB 1RJYA 1J8KA 5C86A 1CGSL 5D70L 4G6FB 3RRQA 5GGVY 1T1YA 3O0RH 1CDGA 2JCCB 2PW1B 4AL8H 4OZFG 1J8HA 1MIEL 4RMTA 1MQKH 5ILTL 1RZGB 2MWCA 3LSOB 4ONGL 3QFJE 4K3EH 3B5GA 3GJFA 3OKOA 2JLLA 2VDOL 1AKJB 1BMGA 4HUMB 4RAUA 2B4CL 3DVNA 2WUCL 1JNJA 4JREC 4PTTB 3WHE0 3QYCA 2WAHA 3PNWB 2WLZA 3BP6A 2NXZC 1XGQA 2A77H 1MI5A 3DRTB 4NCDA 4O58H 3PGFL 1XZ0A 3ILQC 2X2YA 3V5HB 1RZFH 3WS3A 1UJ3A 5I1HL 2E6PA 4CVZA 2WNGA 2H2SD 2NW3B 4KZDL 4AIXA 4MQ7A 2Z4QA 1S8DB 4OFKA 3IDGA 1I7RA 4NNXB 2EDOA 2NLJB 5DD0H 3CFCH 1KJ3L 1XGRA 1A3LL 3B2VL 1REIA 3ARBD 1N5YH 3FO9B 1XCTB 1R3KA 1TJGL 4CJ1A 1NAMA 5CGYD 1HXMA 1EEQA 1OTSC 4BYHA 5FB8A 4KZEL 2EH8L 2FH6A 1YNKL 4QRTA 1PY9A 1MF2L 4PJIA 1INQA 5I66B 3KLSA 4ZNEA 1IAOB 2MNUA 1H5BA 4ERSL 4OLWH 5J1AB 3EHBD 3I6KB 1UACH 4DGVH 1OF2A 5BS0E 4M7LH 5HI4D 3MLRH 3GKWL 4TSCH 5BQ7A 5I1IH 5HI3D 2DMKA 4P2OD 5JPNB 2EKJA 5I19L 1N0XH 4KXZH 3SO3B 5DUBB 1QHPA 1CGXA 1TXKA 3Q1SL 2BX5A 1Q1JL 3VFPB 4L3AA 4KJPC 1E27A 3H3PH 4UDUB 1TENA 5E5UB 1DUYB 3F7VB 1YYLH 3SPVB 3WNLA 4GG8B 4GBXA 5CJ8A 3OGCA 1MHPH 1P4IL 5BW7A 4X4XA 3MRRB 5F44A 2LE9A 5IB5A 4QHNB 4PJDF 3KPNB 3HC4L 1YEHH 4P2RB 2V5MA 4QRRD 1A7BA 4ZTOL 1TCRA 2DQDH 4R4FL 1N64H 3EOTH 3RTQD 3CPLA 5JOPE 2DM2A 1W8NA 3G04A 1JP5A 3RPIA 1M7IA 3QBTB 1QSFA 3ZYZA 5JA9A 4S1DD 1ONQB 3FO2B 1AHWB 5D2NA 2AK4A 2DTSA 4HK0B 1TZGH 3KJ6H 4MCZA 3GBNH 3QWRA 4Z7UF 5JNYA 1DQTA 3V6BR 4G8FA 3O6FD 2R0WL 3VRJB 1JL8A 3RWCB 1R0AH 4M6AA 5K9KA 4U7SA 3QXAB 4K7FA 4LGPB 1IGJB 4JG0H 2APVA 4PRNA 4TULL 5GRUH 5J12B 2VLLB 2JJVA 2X4SA 1HKLH 4LLQB 5IBTH 4EDXB 4HW6A 4AMKH 2E7LC 3HAEA 1R5IA 4HS8H 4L5FL 1JZ3A 1BZ9B 3MUZ1 1QVOA 4FABL 3IS1X 3WEXA 5T3ZE 4JR9H 4X99A 3UTOA 2QADC 3FFDA 3BD5A 32C2A 3E0GA 4L4VB 4POZC 1JMZA 4PGJA 1TJHL 4O5LL 5HHME 5JW5B 1N26A 1IM9B 1FYHB 3VFVB 1QSVA 4Y5XB 5AWNH 1KC5H 1OM3H 5CD3A 3EJYD 3LKQA 4AJ0A 5LGKA 3ZYOA 4TTDC 3TH4T 2YRLA 1TETH 4NO3A 3QPXH 2VDKH 3BWAB 4XMLH 4OUUB 1XGTB 3U2SA 5E9DD 5AUMB 4FXKB 4M7LT 1ZHBA 4U1IB 1S9WA 4CW1B 2EKSA 3VXSE 3FQTA 4CVXA 4KHTL 1YNTB 5E4EB 5L7XH 3RIAF 2LVEA 4TPRH 4GG6B 2HJKB 4DOHB 1UZ6E 3RY6C 1UVQA 2R1XA 4XPGL 1I85A 2IG2H 4WHCA 6FABL 4MYWB 2JJSA 2JIXB 3TBYB 4OIBA 4NGHH 3G6JF 5DT1H 5I1CL 4K8RH 3WDHA 1J87A 4JO3H 4U2YA 2CUIA 3QQ4A 4NJ9L 4DAGL 2A73B 1CDUA 1HH9A 4Q6IA 4FQXD 3QEQE 4M61A 4EN3C 2F8XC 3D39B 3UZVB 2D2OA 3MJ8A 1FG2A 1IC1A 1CDYA 1RUQH 1HSBA 3CSGA 5D6CA 4R90H 2J4WH 1HHJB 5D7LA 2G60L 4PJGA 3QXUA 2MKWA 4YHLL 4HG4J 2WBJB 4XI5D 2OTUB 3RA7H 4ELKB 5MEOA 3MBEC 2N7BA 5JXEA 3KR3H 1PZ5B 3LDBB 3IJHA 1K4DB 5I1GL 4YQXH 2HVKA 2R0LH 4NQTA 3RAJH 3MRDB 1BHGA 1XT5A 3B9KB 4N9GB 4WFHE 1HHHB 2ZUQC 1FZMB 2VLKB 5E8PB 2SEBA 3EZJB 1N5AB 2ZUXA 3KPTA 3J7HA 4FP8L 1PQZB 1CDCA 5IFHH 2R23B 5FOJA 1FFNA 4I4WB 2X7LA 1SYVA 1EXUB 4PJ7F 1QTYT 3X13B 3MV01 3W5MA 2J12B 1U3YA 4LSTL 3MODL 4OCLC 3I6LD 4HJJH 4CADB 4TOYH 3MRCA 4N68A 3LB6C 3UTTB 1UB5B 5L6YL 3L3KA 2FJFA 3KYAA 2J88L 1XIWD 5J11C 4HKZB 3K2MC 1A14H 2P43B 4JFHD 4RGOH 5FKAB 4XWOC 3TIEA 4RBPK 4M4PA 3N9GH 4WO4A 1CYGA 2EDFA 3DWTA 4HGWA 4K2UH 5I2IA 4R4ND 4GMSL 4KKLC 2CPCA 2LAGB 2XOTA 3B3IA 3TCLA 5KSUA 1RJZB 3RNKA 4YK4B 3MV8B 4ONHA 4G6KL 1Z6JT 5JOEA 2X4TA 4ZPVB 3SDYL 3PHQB 3WFHB 3TFKC 3ARED 2H3NB 3U4EB 5CEXB 3SBWA 3T0EC 5FFLA 4DQOH 4OLZH 2CRMA 4MDJB 2CR6A 4EI6A 3OX8A 1FAIL 5DJXA 1QBLH 2Y06L 1H3PH 3ZTNL 3OKMB 3VXMB 4OGXL 1WT5A 5IK3B 4GT7A 3L1OL 5GS2D 3RIFK 3U36B 43C9B 3MFGB 2R29L 4QTIL 4BQBA 4L3EE 4OZHF 2YXFA 5FUCE 3K4DA 5CJXC 5HPMB 4Y1AE 4LPYA 2HRPH 4OCNC 3PP4L 4ZDHB 1N0LA 1Y6KR 5SWZD 3A6CH 3VWJA 2E7HA 2DLFH 2VKXA 1C08B 1M05A 1H9VA 2X4RB 5B8CA 3FOMB 3BX7C 3IFLH 3RWEB 2NY1C 1HZHH 4PJAA 1ZSDB 3Q3GB 4Q7DA 2LAAA 4S1QL 1B0RA 4XGZA 4Y5VA 4MD4A 5TQ0L 3RUGE 1IAKB 5BV7B 2W0LA 1CFNB 1FGVH 3VW3L 3OAYK 2VDML 2DN7A 3H2WA 4UB0H 4UTBL 5H2BA 1EUTA 4Z76B 1JZ8A 4NKQB 1QRNE 3TNMB 1HHIA 3FMGH 2FZ3A 2XQYK 1LE5A 2Q3AA 2A6KB 4H0IA 3ZKXC 2YD7A 4BK4A 4JVPA 3C08L 5FK9B 3KXFE 5EU7E 3GSUA 4ZO8A 5GRXG 1WGOA 5DQDL 5FV2A 1I9JL 3MLVL 4N0CD 1XF2B 3BT2L 3ETBF 5DD3H 3BZFB 3DI3B 5E5MA 4QHLA 4WI2A 4WV1C 4XCCL 3VXPA 1ITBB 1JFQL 2QADB 2RBLA 4U1LA 2DQTH 2DLIA 2GSIA 4WU7A 4F58H 3QFJA 5HVHB 3CXDL 5IJKA 1E4KA 5HHOB 1JPST 1UXWA 5E2VL 5I8CA 1AFVH 1F2QA 1LILA 3V0AC 2NZ9C 4P46B 2E3VA 4MNQB 4BH7B 2LV4A 4M6MH 4KRPC 4WO4C 4WUKL 2LU3A 5ETUB 4AIOA 2V7HB 4ODXA 2OSLA 3BYYA 3MA9H 3NN8B 5D5MA 2IADA 3ULSA 2DQCH 3LEVH 3AS3A 1LEKA 1NAML 5IMOA 3UJIH 2X5PA 2D03L 3JVGA 1ZGLM 3KPRE 3Q5YA 1CF8H 4TSAH 4TSBH 3IDIB 3VGFA 5GS3A 1P6FA 4YUEL 1VADB 1PKOA 4HIXH 3L3JA 1NANH 4KV5F 4UUJB 3QUXD 5FIEA 1ZT4A 2I9TA 4Q9BA 1LO3H 3U9PH 2X1XR 3MFFB 3OR6B 5F7HA 3OJVC 2CGRL 2F53E 1S9VB 3GI8H 3SOBH 3RPKA 1D6VL 1EHAA 1V3MA 2J8OA 2Y7QB 2I9LA 4QCIA 3IKCB 4Y8DC 4GH7B 3ILPA 3O8XC 3G5YA 2A83B 3QQ3B 3VXUE 5EO9A 3ARBA 4L8CB 1YUHB 4UOJA 4E5XA 4EN3B 5F1NB 5AD0B 2HTLC 1LEGB 3DYPA 2NTFA 1ZLUH 1A2YB 4KWUA 5D93C 1S5IH 4KAQL 2BOCB 1XGUB 2YA0A 2PO6B 4XP1H 1RIVH 2ZCLH 1RIUH 4HV8A 4PJHE 1Q0XH 4JFDD 1N4XH 5GS0H 5FECA 3PQYD 5T3ZH 2YEZB 4FTVD 2A77L 2K3TA 4O58L 5KG9A 2X09A 4KTYA 4AEHL 4HZAA 4RFEA 4D0BB 4P2OA 5FUOH 1WFNA 1ZHKA 5C0RH 1FSKB 3M17A 4QY8A 1AJ7L 2ZUQB 5DD0L 1QZ1A 3PQYE 3VCLB 1N5YL 4X7EC 2QTEA 4LDLB 4GG6F 2X42A 4XXCA 5IJKC 4OZIE 2FIRT 4IOIA 4L8SC 1JN6B 1ZT1B 2V6HA 4X7SL 4NDMA 4KY1L 3SDAB 5I73C 4PY7B 1MAKA 3T2NH 3FN0L 4OLWL 4ZODA 4M7LL 5JW3H 1LGVA 3T2OA 5BZDB 3MLRL 3OPZH 2H8PB 2UZIL 3N1GC 4TSCL 1NBVH 3RTQA 1U8QB 1JNHA 4D9RE 4RGNC 4XP9H 1L0XA 2DKMA 1GGIL 5J3HC 1W8OA 2VLMD 1XF4A 2XZCH 3QDGB 3FTGA 4YH6A 5FYJD 2GUOB 4E41B 2VITB 4TN9A 3QDJB 4XVJH 4Y2OA 3O3AB 3H3PL 2NX5B 5GIRA 5I1LB 1F3JA 2BXYA 3AAZB 4PTUA 2ZOKB 1YYLL 4K23H 5JORB 3O6FA 2FSEB 4FQCH 3BMVA 1EAPB 1MHPL 3IF1B 4EZMA 1P2CA 1F6AB 2VLME 3LN4B 5T5NG 1KIRB 5I17B 3HUJB 1L0YA 3QA3B 1NBQA 1EO7A 1GGYA 3QISA 2DAVA 1N64L 4XRCA 3ARFD 2C3XA 2EO9A 1DUZA 4PJXF 1FNEB 1OOAA 4M7ZB 1WBYA 1UH3A 4X9BA 1MWAH 3EOBB 5JQ6L 4U6VL 4JZOA 5KVGH 1FE8L 5ICXB 3D3VD 1NCUA 2MFNA 1G7MB 3WJLC 4GRWH 2EE9A 3KAAA 4NSKB 3PUCA 4DUVA 1FO0H 5DMIH 1HSAA 1HQRB 1TZGL 4G3YL 4A2MA 3BE1H 3HS0A 3UBXG 4P3CL 2V5TA 2EEAA 1DLHB 3GMRB 4RCAA 5HI3C 5C0IA 1NGZA 4CNIA 2I07B 5HGDA 5BVPH 4HUUA 5KS9B 1R0AL 2FEDD 3ULVE 4C58B 5CSBA 5GRUL 4MJ2A 1JWMB 2VUOA 5E9DA 3QIBD 1SBSH 1HKLL 4AMKL 4JN1H 1CICB 1XFPA 3DX9B 4EOWL 2GTZB 4G8EB 4YHPA 5ENWA 1YEFH 2XTJE 4PJ8D 3RZCD 2IBZX 4KU1A 1HYSC 3VD5A 3TPKA 2EO1A 4O2FA 1CLYL 5CEZL 4OV5A 1MFAH 1QSED 1U3HD 5AWNL 1KC5L 1JGVL 3RTQC 2HKFH 3RVVD 4HPOH 3IS0X 4FQXA 2FX7H 1G6RB 5AZEL 4HS6B 4W81A 4NIKB 4G7YH 1T5WA 3DBXB 1Z3GH 35C8H 5CKAA 2ZG2A 1NUGA 3THMH 2VDKL 2IFFH 3AXLA 5DMKA 5E1AA 4CKVX 4S1DC 1HK6A 5HYFA 3ISWA 5EBMB 2Z92B 4GS7B 1LMKA 2BCKB 4MJ5A 4RMRA 1ZHNA 4Y5YB 1QSEE 4F7PB 3INUH 4HHAB 1QEWA 3O6FC 3RWJB 3KVQA 1Q0YH 5CIPA 1F58H 1RSFA 4V2CB 3GSOA 2HT2D 1MLBB 2UY6A 4QHMA 2DTMH 3GJFK 1CTOA 2OQJB 2R1WA 5A43C 5D7JB 2DWDA 1RU9L 5EORH 1BLNB 5C3TA 3MRNB 3RVUC 4JZJA 4NGHL 5DQJB 4Z0BH 5DT1L 2GFBB 1NMAL 4K8RL 3W0WE 4KJYB 4JO3L 3MXWH 4RWYH 4P5MA 4NQCB 1X5GA 2OL3A 5DD1H 3RDTA 1T4KA 3T04D 4L29A 1BVLA 1CU4H 4NO5A 3EJZD 4DJMA 3QDAA 1MHCA 3IU3A 1JYNA 1RUQL 1JPGB 5D93B 3LEYL 4R90L 4W6XB 4NN6C 3MTRA 4DKFH 1FVCA 3D2UB 2BVUA 4ZUWA 4YHZH 4ORGB 2D7QA 3EJYC 3CLFH 4LRNH 4QRUB 5LXGH 3RGVB 4ZSOE 3KYNA 4P5TC 1Q72L 3D69A 1KNOA 3EW3B 4RIRB 3KNBB 4YQXL 1LO0H 3KJ4C 1RHHA 5CS7A 4L4TD 3C5SA 3V5DA 1CFQB 2Z93A 1P1ZB 3L5WA 3P73A 4QEGA 3OKDB 1X3DA 3B6SA 1AGEA 4XH2B 5LGHL 3P4NB 5T33L 4XP4L 4LLAA 3K4AA 3AREA 1TCMA 3SKNB 1LE9A 5C08E 3PWNB 1KXQE 5EOTA 3DIFB 4TOYL 3T2PA 1OGTA 5I73B 1QA9A 3BP7B 2A74B 4PJ9B 3G08A 3O2DH 1OAZH 5BMFH 2FIKB 2P8PA 3BRFA 3V6FB 1F11A 3RUGA 2X1PA 4PP2B 3H0TA 4Z78B 5CSZB 3RNQA 4Z7OF 5IROC 1U8HB 1V7NH 4K2UL 4Z8FH 4RGNB 4L1HA 5SWZA 2XXCB 4P3DA 4LU5H 3QIWA 3H9HA 2GK0B 2V2XA 1AC6A 5CBEA 1KCSH 3HRZB 4LNRB 5EO0B 5EC2B 3FAWA 4XI5C 5H37G 1PG7L 2PYFA 4KVCH 2IPKA 1ED3B 1CIUA 1JHLL 3NGBC 3RVWD 4IDLA 4F2MB 3TN0B 3NCJH 5M7QA 4OLZL 5DC4B 4UINH 3X11A 4AENB 2FR4A 1AQDB 1INDL 2YRZA 4KMLB 1C5DB 4G9FD 4UDTA 2PYED 3CAFA 1CXKA 1ES0A 3TA3D 4ALAH 2EDWA 4AY0A 3X12A 1G7PA 1UQSA 1YEDB 1J1OH 2HRPL 4UU9B 5F88B 1TTUA 1AP2B 1VGEH 5T1DL 5J7CC 3MBXH 2DLFL 3AUVA 3OJDB 4UOW1 4XP5L 4Z7WB 2HP4A 3L7FA 4X5LA 3IFLL 3WHXB 5CKGA 1HZHL 3HZKA 1XIWC 1ZGLA 1ORQB 3VMNA 1HDMA 1XAUA 4OF0A 5B4MD 3ZE2F 1E4WL 2W65A 4LSQH 1FGVL 2Z31B 5HVWA 1A7PH 5FHBL 4R4NC 3F7RA 4ODTL 5CD5D 2PTTA 5ISZD 3FMGL 4Y19B 5IVXE 3CU1A 3RI5F 4DVBB 4I0PC 1A5FH 4KC3B 1JRHL 3NCMA 4JEGB 4ENED 2ZCHL 2DIAA 4PB9H 4JFOB 5D2LE 1NEZA 3T0AA 1Q9WA 3AREC 3CDCA 3QG6A 1F13A 4HH8A 3P0YL 5DD3L 4WU5A 2IQAB 4PRBA 1A6AB 1AXTL 4ODWB 3VXUA 3NMEA 5ISZE 1Q38A 1JPTL 3CFEA 4GAJL 3QUXA 1ZLSH 3QQ9C 4F58L 2DQTL 4LFHD 5I16A 4MA1B 3HG1D 1CZ8H 2XACC 1NGPH 3HUJF 4BQ6A 4KKCD 1YY8A 5IQ7H 1JMXA 4M6ML 3QUMA 4FFWD 3P4OB 2EICA 4RFNC 3V52H 4J3OC 3GZKA 5B3JE 3WN5B 1R6VA 1U9KA 4PJ7E 2AV1B 4IS6A 5CFHA 4G8GB 1LK2B 3FO0H 3VFGL 4G80A 2XFXA 3UEZA 3I6GB 1IEAB 4KQ3H 3U0PB 3SKJL 2DB8A 1KJ2H 3KLDA 5J56B 2X10A 4YLQT 3O45B 1UWEH 3GMLB 4BQCA 3CIQA 4MNGE 3PQYA 1JYVA 4FTVA 1T04B 4G6JH 4ZAKB 3LH2L 4MJ6A 4GRLD 4P9HC 1FL5A 3U9PL 1EUUA 4LIQL 1MPAH 1WC7B 5KS9F 5CP7A 5D1ZA 3S4SG 3R8BB 1J0YA 4NHCL 3LPGA 1BFVL 5ANMB 3WIIH 2OTWB 1NSNL 2NY7L 4FQPA 4ODHL 4D0CB 3QIUC 4N0CC 1KCLA 3KLHD 4JQXC 3L3HB 4NUJA 4WUUB 3EDFA 3OAUL 4YBLC 3ULVH 3FONA 2XXMB 3TLRA 3UZEA 1DQQA 4NFCA 5DFVD 1MRCL 3V0VB 1ZANH 1S5IL 3REWA 1HILB 4Y16D 1KENH 12E8H 1R5VA 1RIUL 3HR5B 1X44A 2X9WA 3U83A 2BP3A 4OM0H 1WWAX 2XKNB 3PV6B 4L8DB 5ICZB 1YQ2A 3IFNL 5T3ZL 4P5TB 1V3KA 2AJZB 4N0UB 1AI1H 4OZHE 1G7JB 1F00I 1RUMH 4QWWD 4YX2L 3ZKSD 4LSVH 4WTZG 3VG9C 4ZFFA 5FUOL 2A6IB 3GSRA 4RDQF 2OP4H 5EBWA 5IW1B 4LBEA 5GGSA 2GJ6D 1SJHB 1DCLA 5C0DA 2I27N 5TPWH 5DK2B 1KIPB 3HI1B 2DBLL 2P4AB 5IVZB 4UIMA 3JZ7A 5JUEL 3KPLA 1NMCC 2ZNXA 3E8UH 3OXRB 3WUWA 5DWUL 5C0AD 5BJTA 3IRPX 1ZVSA 3U0WL 3PJSA 2GJ6E 4FQQB 3T2NL 4K3GA 2VNCA 4KTDH 4OKVB 2DYPB 5IB1B 1OWRM 1T3FA 1RZ7H 3OPZL 4PRPB 1ZKAA 5ESAB 2VOTA 1BGXH 5CILH 2WINB 1NBVL 2Z35B 3ARFA 4KK6C 1MQ8A 3UXFA 5J8OA 4XP9L 5FCUL 4HJGB 2ZP0T 3D3VA 1V7MH 2R2HA 2EYRB 2XZCL 1I1AD 2KKQA 3OAZH 4JM2C 4JHZA 2IWGA 2YN3A 4V2BA 2P5EE 5EU3B 1M6OA 3ARRA 4M6OL 5IG7A 3MOBH 5I1AB 3PL6A 5E1HB 3DROA 3NGBB 3FT3A 2P24B 5FGBA 3QJFB 4FQCL 3ZL4H 1RK0A 1AGBB 1RJLB 5T1KD 3QO0B 1F3RB 2VN4A 4EIGB 3FHQA 1OQXA 1CWVA 4DZBA 5C0BB 4FQHA 3QIBA 3K80A 2DQGL 1GPOH 1IRAY 3BN9C 1C1EL 5I1JL 4HUWB 3MGTB 4KV5E 4X7CC 3S96A 4PJ8A 1A6ZB 3OV6A 4YWGL 3RZCA 5KVGL 5EOQH 1RURH 3ARTA 3BI9X 5BOZG 3O3BA 3L3OB 3BKCH 1MCPH 1QP1A 5DMIL 1CG9B 1HHKB 1PG7W 1QSZA 3DHMA 4LVHC 1WCBB 1QSEA 1U3HA 4WRLA 1EHXA 1GGTA 3ALXA 3C5ZB 4JLRB 1JWUB 3JWOH 3K46A 4X80H 5F1OB 5ITBH 5BVJA 1MCJA 4JG1L 4F33B 4P23A 4I0PB 2OL3L 3U6RA 1KFAH 1FH5H 3ZDXE 4L4JA 4UQ3A 4P2QD 4KI5F 2XA8L 2VXTL 1YMHA 5IIEB 3PWUB 4KDWA 4IHOA 3ARGD 4JN1L 3SDCD 1L7TH 1PKQE 2FATH 4H26B 1YEFL 1EVTC 1IGTA 1YZZA 4DVRH 1RI8A 1WWWX 4TNVK 3HC3L 1ZLVK 2OCFD 1A4JA 1IQDA 4Q2ZA 4MA8H 4P2QE 1UWXH 1DDHA 1KJVB 4Y4HD 1SEQH 1I4FB 3JUZA 3P77B 3CXHK 2HFEA 1MFAL 1I7UA 4DGYH 2O93L 5L2KB 3VFNB 2R0KL 4U33A 4WEMB 2BNQE 2FX7L 4OSUH 4WVRA 1QFHA 1FYTB 4ZSOA 2LU7A 4G7YL 1U8PA 4R0LC 1KSRA 5C0FB 2IFFL 4PY8I 3O9WA 3HZVA 3MRQB 3T8XB 4XMKH 5D71H 3MJGX 4QRSA 2FEEL 4Q9QH 2X4NB 4PRIE 4MMZC 1VACA 4YDJB 5DRWA 5HSFA 3INUL 4N9OB 4UT6H 5J89A 5DJ2B 5GGTH 1F58L 1NJ9A 4N0RA 5E00B 1G7IA 1TJIL 2DTML 5IHUH 1UADC 5TE7L 4PYGA 5EORL 3NCCB 4HF5L 1ZHLA 2H2PD 3O2VL 2AJVL 5TDPB 4Z0BL 3ULUF 1S7UA 3QIBC 3ES6A 4P4KB 3R06B 4RWYL 3QIUB 5I30H 1EBPA 1T89A 1P7QD 1NCTA 5DD1L 3LKRA 4X6FA 4PJ8C 1FN4A 1CU4L 1NKOA 2YD5A 5T3XE 3RGHA 1BQSA 3VXNA 4M6NL 1H3WM 1IGFH 1JRHI 1FFOB 3STBA 1SY6A 3IJSB 4TVPE 4DKFL 2YUWA 3NA9L 3RVVC 4LRNL 2V2WA 2VDRL 2NTSP 5ID0B 2EDYA 1WFTA 2GITA 5ERWA 1ZT7B 2YUVA 4PJXE 3Q6FB 3LS5L 3PWLB 4I2XB 4M8QB 3VG9B 1FZOA 1KG0A 3MCG1 4ZOAA 1BOGB 2QJDA 5AZ2L 2B5IB 1RZIB 8CGTA 4H25A 2D7MA 1IZKA 3X17A 4YDLB 4YXHH 1NMCB 1KN2H 4LLDA 2W0FA 5CJBA 1YEKL 4GKSB 1A7QL 4LPWA 4FQJL 1I3RA 1QBAA 5T1LA 4NC0B 4Z7VB 5GGTA 4QOKD 4ELME 2L7UA 3O2WL 1S7VB 2QSTA 3MO1A 4HBQA 2EDHA 3IAQA 1ZLUK 3O2DL 2C1PA 4FFZH 3DECA 5IWLA 5DSCB 1TVDA 1FRGL 3SDXE 1W0VB 4BSVA 4G9FA 3U46B 3FQXB 4AT6B 2FD6L 4GUPB 1NANI 3EJZC 2AXGB 3TA3A 4YIQA 3IGAA 1IGYA 1DE4B 1G9NH 1UKSA 1EEYA 4HSQA 3T77A 1JF1A 1KCSL 3SE8H 1KCVH 3WXVH 5IVXA 5FDWB 2FCBA 2XPGB 4AQOA 2VWEE 4U6XB 3GMPB 4DTGH 4F15B 2WIIA 4L3CB 2OM5A 4JKPH 2G2RA 4NNPL 1MFDH 2W60A 3ME0A 1NGYB 4HULB 2BOBB 2D9CA 4HS3A 1MCOH 1H8SA 5L2JB 5ISZA 4LSSH 1FQ9C 3QUML 2V5RA 4U1MA 4ETQA 5IB4B 1EAJA 1X7QB 4HDIB 3TPUA 3V6ZB 4WHTB 2O61B 3WNNA 4N1HB 2ICEA 5B38A 5F3BB 5MHSD 2EYTB 2P8MA 4ISVA 5C0CD 4UILH 5MEPA 1KXTB 4KKBC 2YD1A 4F7EB 4GAFB 3LIZL 1WZLA 1DL7H 3W9DB 4J8RB 2F74A 2QSCL 2G9HA 4HIJA 5L0QB 5TDNB 2MCPL 2PCPA 2HFFA 1S7XA 2IPTL 1G9MH 5TF0A 1LNUB 3C8DA 3MLWL 3H7BA 3NIGE 4KDVA 4LSQL 3DYOA 3IJYA 1R5WA 4XPAH 3NAAL 1A7PL 1GXEA 4MNGA 1IBGH 4HKBB 2EDQA 4HFWB 5D1QD 3QAZC 4CU6A 5HHXH 4NO0B 3WJJC 4ESKA 3EO0B 1A5FL 5DJ6A 3L95B 4PB9L 2CDFA 4PG9B 2IAMB 4PLKC 5JPMB 3FCTB 3RVWC 4MNQE 4NQDD 3U7YH 1NDGA 4ZXBB 4NZDA 3P3YA 1OSPH 2EDBA 1DR9A 1BFOB 1ZLSL 3QCVH 3UPCA 5DJDB 4OQTA 4ZTPH 3OG6B 3C5JB 4Y88A 1NFIA 4RAVA 3T3PF 5MENB 3L5XL 1T20A 3KS0H 1NGPL 4ZFZA 3EYOA 3DARA 5IQ7L 3OXSB 4OIAA 3RWHA 1RZJC 3HE6D 5E8OA 3PDDA 2BVQB 2L0DA 3V52L 1FDLH 4I3RH 3Q2CA 4Q9RH 2X44D 4XCEB 4R0LB 3ZE0F 4D0DB 1M4KA 5HI5D 4K94C 4PD4J 5CHNB 1AGCB 1SJVA 1MNUH 1NQBA 3BISA 1BJMA 4KQ3L 2QQKH 4Y16A 1WIUA 5FGSA 1TITA 1KJ2L 2W9LA 4RA0C 5IKCB 4NM8L 1LO5B 2X4PA 4Z7OE 5HDBF 4G6JL 1BVKA 5D96C 5CD5C 2GAZA 4UBDC 4YDVA 3DI2B 5GJSH 5ICYA 4X6DB 2IALA 3L3DA 2P7TA 3HC0A 1MPAL 4KMTH 5B3JF 4ENEC 2CIIB 1ULVA 5ACZB 5ALCH 3EGSB 2BXZA 3DV4A 4ONOA 5EC1A 3TBTA 2GJ6A 4OGAC 2X4OA 1UWGL 1I8MA 1IC4H 2W0PA 4TRPL 5TF1H 3ULVL 5B39B 3S35L 3ZHDA 1SJEA 2V9TA 3WSQH 1HKFA 5FGRA 4PGBA 4HKXA 1RJYB 1ZANL 3MRKA 1CTNA 1FNSL 1P53A 1ZXQA 4XCNA 5GJTH 4KKCC 2JK5A 2O5XH 2B8OT 3A0OA 4OM0L 4XC1L 1UEYA 4FQ1H 5EBLB 4F9PC 4KFZC 1MEXL 1T7VA 3GJFB 3MLYH 3WNKA 5E2UH 1Q94A 3AY4A 3CVHH 4QNPE 3DVNB 1Z0MA 1HI6B 2OP4L 3RFZC 3STLA 5EA0L 2J8UA 1KLUB 2C4XA 1I1AA 1HN1A 1VA9A 4IEFB 5TPWL 4EXPX 1XGQB 1MI5B 1XZ0B 4WHYG 4GRLC 1UJ3B 3OKKA 3MV7E 2KQNA 5DR5H 3E8UL 4PV8A 4R96A 5ESQA 2FEEI 4MQ7B 3IDGB 1I7RB 3V4PH 1MJUH 5T1KA 1I75A 4APQD 4U1SA 3KLHC 1W0WA 4KTDL 3IDYC 1NAMB 4MSWA 1HXMB 5GZOC 2LTQB 1RZ7L 3VFSB 4MQXC 4QYOA 3DX8A 4GFTB 4QRTB 1HQ4A 3C60C 3O4LE 5CILL 2HG5A 4LHUB 4M03A 5MEQB 2R4SL 1T21A 1GGBH 3H8NA 1BJ1J 5HDOA 1U3ZA 1H5BB 4H88H 4XNQA 1E6OL 1WF5A 5IW6A 1BD2B 1K8IA 4NZUH 2ID5A 1FJ1A 1Z0NA 2DF3A 1BX2B 3MOBL 4R3SA 4B5EA 1CGUA 5DJYA 2VZSA 5T3XH 2P5WD 4K8RC 1C16A 3MREA 3AU1B 4NUGH 4W70A 1IT9L 2BVOA 4R2GD 5DMJB 5EPMB 3TV3L 4TVPH 1WSST 3UTSD 4FQ2H 2B2XL 5A3ID 3ARUA 5E6ID 1VEPA 4P2QA 2X4UA 4M1DH 1CE1H 1E27B 2Y4SA 3ARGA 1GPOL 1LK3H 1UZ8A 3SDCA 4Y4KB 4GBXB 3OGCB 4V1DE 4GJTB 4JY4A 3UTSE 2VLRE 5IB5B 3VMPA 1OTTD 1XGPB 5L8KB 4GW4A 1RURL 3NFSH 1YMME 1N7MH 3VH8A 1DBJH 1XEDA 4MB5A 1ZLWH 4EDWH 4QLRA 3BKCL 3MV9D 1G7QA 4KMQA 4JCLA 2Y5TB 4O02H 4HIIA 1HINL 3B9EA 3CPLB 3QO1A 5KOMC 4WENB 3RPIB 3JWOL 1QSFB 2NMSA 4MDIB 3JBG7 1KFAL 5D2NB 2AK4B 2V2TA 3QI9D 5DMGC 3BDBA 4MCZB 3P9MA 4GXVH 4G7VL 2KBGA 3CGTA 3O3DA 3BO8B 2QLVB 5IF0A 1SY6L 2FATL 4YO0A 4EVNB 3S36H 3V7AG 5JHDB 4EUPG 1ODAA 4PRNB 3SY0A 4TUOB 1AD0B 4LGRB 3DHJA 5E7BA 4K55A 2R15A 3LD8B 4DUWA 1MVUA 1CD0A 4MLSA 3VXRD 2JB6A 5TQ2L 2YK1L 4KROB 4YHOL 4BFEA 1QVOB 1X5FA 4DGYL 2AS5M 1ZTXH 1RULH 1T5XA 3GSXB 3OGOE 3VFWA 3FFDB 1TDQA 3KPSE 2VLJD 5J57B 32C2B 2OI9C 4NWUH 4JPWL 4Z5RA 2JELL 1EIBA 5D71L 4PJ5E 2YA2A 3OKLB 4PBVC 1LD9A 4PGCA 2IH3A 3ARDB 2PW2A 4YGAB 1NBYA 2DI8A 1IC5L 2PF6A 5GGTL 2EYSB 3QWOA 2XT1B 3WIFA 3QHZH 4LCUA 1F90H 4NO3B 1SBBA 1AO7E 4IDJH 1S5HA 4JVWA 5EU6B 3VGAC 3U2SB 3BGMA 4HWBH 1HOCA 5DLMH 3FQTB 2HTKC 3ARGC 3IT8D 3CFJA 1B6UA 1V05A 4ELMA 2OBGA 5GS1C 1FL6B 1VENA 3C8HA 5I30L 3NCYP 1MLCA 3RWIA 5ELIA 3T08A 3SDXA 2B0SH 4LRIC 3VXOA 3BDXA 1J18A 5EOCJ 1FFPA 4GKNB 4ZOEA 3A67H 1XGYL 1PSKH 5FM4A 3MZTA 3L9RA 4Y4HC 5DVKA 4QOKA 3QT2A 2CXGA 1HH9B 3D25A 4Q6IB 4N8VA 4M61B 4JFQA 3WL9A 3CX5J 1FG2B 1U8IA 3MJ8B 1A1MA 3QCUL 3VDCA 4U0RC 1EZVY 5D6CB 2FB4H 3VWKD 3O6KL 5D7LB 1PLGH 2EDEA 4S1SH 5CZXD 4PJGB 1BWWA 5GSVA 4Z0XB 4BSWA 4BZ1H 4MB3A 5MEOB 2E9WA 3S5LG 4OCXL 4H1LH 4IMKA 1UM4H 5I71C 4M1CD 4YXHL 4HMDA 3TBVB 2HVKB 5D7IA 2XRAL 3WKMH 2QQLH 5IGXL 5CZVH 1VCAA 1UKTA 4OLVH 3MUHL 1NFDA 3VDAA 1DBKH 2SEBB 2Z91A 1IM3A 4FFZL 3EOAA 2KZ1B 3IDYB 3IDXH 2FWOB 3ZYIA 2HLFC 1EO5A 1U58A 1ZA6A 5C0CA 1WV7T 1SYVB 3EO9H 3C60B 5EZLB 1KB9K 2CDEA 4BKLA 3FO1A 4LCIH 3REVB 5HYQA 4RRPA 1QHOA 3MRCB 2QHLA 3L5JA 2WWKT 1K8DB 3L3KB 4K3DH 5J1SC 3OBAA 3QUYD 1IAIM 2O5YH 3VRIA 3BEVA 5F9JB 1KTLA 2DQIL 4JAMA 5FA4A 1M71B 2CDGA 4XXDA 3MOAL 2NY4D 4AK1A 3W39A 5I2IB 3CNKA 1MFDL 1I7ZA 1MH5A 3B3IB 1MCOL 5KSUB 4JGMA 4LSSL 4GAYA 5D1QA 3ARZA 4ONHB 5I18H 1RUKL 1I8LC 4PJEB 2DJUA 4WI3A 3RJDA 1IGCH 1TPXB 3ZE1F 2QKIB 1Q9KA 4I5BA 5JIKA 3WO4C 1XR8A 4O2EA 4LCWB 2J6EH 1H3VA 3GMNA 1AY1L 1W2KT 5GPRA 1DL7L 2CSPA 4NQDA 5D9SA 4IRZH 4M3KB 3H6JA 5GS0C 4FQIH 4MD0A 4H1LA 4EI6B 1JE6A 2HA1A 4ZG1A 3OX8B 4KK9D 5DJXB 4I18C 2AJYL 2VDLL 3WIHA 1S7SA 2NY3D 1G9ML 4YR6B 1IC7H 3OAZK 4HZLA 3U1SH 4OCRH 3SDDD 2XN9B 3VRLF 2HT3D 4C56E 5KZCD 4NZTL 4JFYB 3QXDA 4LL9A 4XPAL 2VB5A 3VWJB 5EU4B 1IBGL 3DXAB 5HYSB 5B8CB 4PJIF 3P40A 4PJAB 2NY5C 1A6VL 1A6UL 4XGZB 1B0RB 4UOW0 1KOAA 2B7DT 5J6HB 3CZJA 4MAYC 2B1AL 3PHOA 4ZFOA 2BHZA 4YAQA 3DUUB 3MUGA 4F8TA 1U8MA 4NFBA 1YPZE 3EYUH 3U7YL 2DI7A 2F19L 4NC2B 3FB6B 1J05B 4ZTPL 4JANB 3FRPG 5CEYB 3TYFB 4ZS7H 4X4ME 5D7SH 1M7DA 3FFCE 1BP3B 3U9UB 3S34H 5E5MB 3SQOL 3CH1B 1DQDH 4Q9RL 3ZDYF 3MYJB 3F6IA 4U1LB 2GSIB 4JDTL 3QFJB 1KYOJ 2I25N 3HA0A 1UXWB 5BRZE 2VISA 3Q6GL 4OZFA 1NAKL 3F7YA 2FL5A 4XVUC 3HI5H 5L9DH 1VPOH 1ZEAH 4XBPA 2CR3A 4N90D 5K59F 4OZ4A 1Z9MA 3IDNB 4ODXB 4NBZB 1LO4L 2OSLB 1TFHA 3MLUL 3O6LH 4LOUC 1MRFH 1TQBB 5FYLE 5GJSL 5GISH 5BOPA 3VGAB 2IADB 2XA3A 1L0QA 3MV7A 5C9KA 2PUQT 4KUCF 1ZMYA 2AJ3B 4XAWH 2QSVA 3RL1A 4LHJB 3AS2A 3EFDH 4QXUH 5HHQA 3U30C 1IC4L 1AR1C 3L3JB 2I9TB 5TF1L 1N6QH 1F2XK 3QUZD 4S11A 3QH3A 1VSCA 3O4LA 4XC3H 5H94A 4BFIB 4I8DA 5IBUB 3SKOB 2I9LB 1CGYA 4QCIB 4JM4H 2E9JA 5C07D 5ADPL 4OFPA 3G5YB 1IL1A 4CU8A 3HE6C 1NC4D 5BS0B 5J6GA 5DURD 5TGBA 1G6RH 3WXWH 1E28A 3UYRH 3O11A 4CBPA 1XF5A 3DX7A 5HI5C 3EFFA 3MLYL 2EDTA 4U0RB 5DI8B 3UJJH 5F6HJ 2NTFB 1UGNA 3GSNH 3QRGL 3FHAA 2ZKHH 3QDMD 4X6CA 4CMMA 1JK8B 5I0DA 4DGIH 1NBZB 3QZWG 2OZ4A 1KELH 4HWZA 4F80A 4HV8B 5L8LB 4DZ8B 4OCWL 2RHEA 5FECB 1PG7X 2DDQH 2YPVH 3NIFF 2GK2A 4Z95H 5I71B 5KG9B 1CE6B 4RFEB 5DR5L 1ZHKB 3N1MC 1P7HL 4EEEA 3UTSA 2ED9A 1CLZH 3V4PL 1LEIA 1MJUL 4K9EH 4W4OA 3TT1H 1SEBB 4ZD3L 3P0VH 3EYFA 4IOIB 5BZWA 3CFBB 5LG1A 5HVGB 4XNXH 5D1XA 2IAND 4H8WH 1S9YB 1GGBL 2X4QA 3C6LC 3MLSH 5KSAD 3I02A 4NZUL 4XVSH 1CDIA 3MV9A 3WFZA 2VMFA 1MFBH 5E24E 2EZ0D 3FB8A 1KPRA 1BZ7A 3EZ8A 4NUGL 3OKNA 4G6FD 5C0GB 3SGJA 4TVPL 3VGGA 2IANE 3ZE0E 1SQ2N 3ZMRA 3D18A 3TESA 1CFSA 4FQ2L 3AVEA 4CGTA 4AM0A 3DNKA 5C8JB 3UO1L 5EN2B 3QP3A 4R4BA 3P4MA 4PJGF 3QI9A 1BM3H 1B9ZA 4ODVL 5F7WC 1CE1L 5EU7C 3HLAB 1QRKA 1F3JB 1PBYA 1LK3L 5E0QA 4HKJB 1AKJD 2CUHA 2OK0L 1MJJA 3G5XA 3SE3A 1BJ8A 1P2CB 2M26A 1UA6L 4MZ2A 1ZOXA 2WSKA 1CLOH 1MIMH 4MJIE 4U6YA 1A1NA 1JPFA 5SV3A 4K7PL 4I18B 4APQC 1CXLA 1RAMA 2FGWL 3GJEA 4XAKD 5HHMB 1DBJL 4EDWL 2VAAB 3MLPA 4PJ5A 3CSYA 2VYRE 1QKZH 3VXRA 1DUZB 5C9JB 4NWTH 1IGML 5FA3A 2AKRB 3WLWC 1G7LB 5IMMA 1WBYB 4HC1H 5HYJE 5D8JH 4MAUH 4JZOB 4LLYA 1NCDL 3GIVB 4IRSC 4EI5D 1R3HB 3LKOA 4UT9H 2VDPH 4J3VA 1HSAB 1FGNL 3VXSB 2YXMA 2H32A 3HS0B 3QXVA 4GRMA 4BQ8A 4X0KB 3GO1H 2ZOLA 4WHDA 3SHSA 1U93A 4HUUB 1EGJA 4M4RA 3GIZL 4LHUG 4OLYH 1IAIH 4OT1L 5LGJB 3S36L 4GXUM 3MJ7B 1NFKA 5E6IC 2FX9H 3MRJA 4ODBD 2DMBA 2YC1B 1YEIH 5DK0A 4FHBD 4I9WE 5DRNB 3HI6H 2AP2A 1EEZA 1A7OL 4YHPB 4LARH 5ENWB 4YC2C 1N3NA 1TVBB 3KLAB 3QEQB 1NCNA 1FVEB 1ZTXL 1RULL 1OTTC 5EU5B 2EIBA 3EJJX 3E1F1 1B4JH 2ESVE 4CAGA 1MAJA 1T0MA 4O2FB 3IXTA 4B7LA 4OV5B 1OGAE 5E08L 4JY5L 1BBDH 5KVMC 1P84K 4FQXB 1F3DH 2RFXA 5DUMH 4PRHE 4U6HB 5GGVL 5FM5O 2AJXH 3QHZL 1T5WB 2BNRE 2CK0L 4P2RD 4BUHA 3X3FH 2PR4H 3AXLB 4PGDA 4IDJL 1S7RA 2Z8SA 4XPHH 5E1AB 3V5KA 3WDIA 3ULUH 4KGJA 3VWKA 1CS6A 1JNLH 3QI9C 4HQQL 3CMOH 1RMFH 4HC1A 5DLML 1MWAB 2C7UB 3QEUA 4PJAF 2XI9A 4WNQA 3HB3C 4LVNB 4MHHG 1QEWB 3IYLW 3PGCA 4LP4A 4FFYH 1I3GH 5CIPB 1KGCD 2Q20A 5GRYA 1OAUH 4P5KA 3SE3C 5A2KH 1I1CA 2VZ1A 3WFBH 1D5ZB 1DSFL 3E2HB 2AJUL 2BC4B 5DRZA 2B0SL 4JPVH 1UEMA 3AMLA 4U1GC 4U1HA 5DYOA 1PSKL 1NDMB 3BYTA 1Y6MR 4XPBL 5HGHA 1X4XA 3GNMH 4M1GH 3DYMA 1NGQL 3KYOA 3F7PC 1DEEA 3N1FC 5HGAA 2V7NB 4HIHB 1Q9LB 1D5XA 3RDTB 2F58H 1AE6H 4WW1A 4L29B 1BVLB 4NO5B 3F65A 4HUKB 4W6YB 2BNUA 5I74B 1MHCB 3IU3B 3G5VA 3NVQA 2QV2A 1FVCB 2DJ4A 3OB8A 4ZUWB 4AIZA 4XMPH 4BZ1L 3L7EA 3IU4H 4ZUSA 2XV6B 4IRJC 5IQ9B 4M7KH 3BKJH 3KYNB 2ZZUT 1UM4L 3QUYA 4L4VD 1UC6A 3D69B 2C5DC 3O4OB 1HCVA 5DJAA 3D5OF 1IM9D 2V17H 3WIHL 1P9MA 3ZKMC 3WFEL 2QQLL 3UYOD 2IGFH 2A6DB 3C6SA 3L5WB 1M1SA 4TNVF 5DA4A 4LSRH 2XWJA 15C8H 5K93A 2NZIA 1AGEB 1H0DB 2VL5B 5FXCH 2GSGA 2ORBL 5IJVA 5HD8C 5FYLH 3VFMB 4JY6A 4Y1AB 1R24B 1BREA 1OGTB 2H6PA 4F7MA 4ZFOL 5BXFA 3G08B 3C6LB 1F4WH 4QRQA 4S2SA 3RJQB 4QXTA 2P8PB 4JFFE 1YN6B 2GY7B 3RUGB 1FL3A 3AM8C 4OF5A 3RWGB 3H0TB 1WK0A 4LAQL 2O5YL 3RNQB 4PJDA 4OIIH 5JIHA 4N0YH 3UROR 4I48A 4R97C 1S7QA 1KEML 2OR7A 3QHFL 5I76A 3QIWB 4LFHG 3H9HB 3JTTB 1QRNB 1YPZA 1BIHA 2V2XB 3BUYB 5CZXC 2E27H 3MRHB 5TE6H 1T83C 4E0RB 3T0VA 3D39D 5MERB 4RZCA 3HE7A 3KXFB 3MRFB 2DMCA 4N0FA 2ADGA 3E3QE 1SYSA 4M1CC 3C09C 4YHNA 2J6EL 4NRYA 4GW1B 3QR2A 1A4KA 4IRZL 2HVJA 3DMMC 4FQIL 1FNFA 3NZ8A 3N0PB 5KJRH 4OFVA 3X11B 1E4JA 3FRUA 2K7PA 4D8PA 2FBJH 2FR4B 3C2SA 4UDTB 4MNHA 3B9VA 1I8IA 3U1SL 3X12B 2Q8BL 3ZTJH 3P30L 4OCRL 2DLEA 5I6XB 3PHSA 1G7PB 1JUFB 3B9KD 2VLKD 3CDGA 3WLBB 1DQMH 3L7FB 3PABA 4S1RL 5F3HB 4IRSB 1ZGLB 4TVSa 2NW2A 2AGJH 3HZYA 3QUKA 1OTSD 3PGDA 4JZNA 1HDMB 3AFLA 4PJBE 25C8H 3QNYA 3KPRB 4AEFA 1T03H 4ZUUA 3CLEL 1CGSH 4X98B 3MNZA 4JRYD 3UTTD 3VFTA 5DTFA 2PTTB 4BA8A 3CC5B 1HWHB 4JGUA 1MIEH 1KCRH 4LF3A 5ILTH 2F53B 5FM5M 3MRPB 4Z7QE 3HNVH 1F45A 1NEZB 4ZS7L 2VDOH 2VN7A 2YBRB 3QG6B 4FNLL 2ICCA 5KBNC 2B4CH 2PNDA 4WU5B 4D9QE 5F7FA 2WUCH 4X6EA 4JRYE 3VXUB 4NHUA 3MV8D 4RBPH 2D4DA 2OZ4L 5EULV 3KDMB 3OKYA 4KK9C 5FM8A 1XCQA 1YNLL 4BQ9A 1WZMA 4OD1L 1EO8L 5FYJU 2W9EL 2V9QA 4F9LC 4OV6F 2FLBT 3PIQA 3MYZA 4WFFE 1KTKE 3SDDC 4PJHB 4XZUB 2HT3C 3HI5L 4P4RA 5L9DL 1VPOL 1JIBA 1ZEAL 5C07A 1QFWM 3VXMD 4RNRB 1CFTA 3PXHA 3TZVA 1MRFL 1HIMH 2J2ZA 5ALBL 5GISL 3DO7B 1QR1A 1TJGH 4X8JB 1DN0B 3BPNB 3NABL 3QDMA 4XAWL 1MF2H 1VB9A 2ATPA 4PREA 3EFDL 1MHHB 4ERSH 3PQYB 4PG2A 1ACYL 4MJ6B 5T1MA 1YN7A 2ADFH 1S9XB 4U1GB 4B41A 1J8HE 4GMTL 4OZIB 3RWDA 5HYSG 5CLWA 5D1ZB 2GY5A 1W72A 4DUXA 3LAFA 1U36A 4JJ5A 3BH9B 5EFIA 2Z8RA 3GGWA 4UV4H 3V95A 1AQKH 2WIMA 3Q1SH 4NUJB 1I1YB 2XNAB 3FQUB 1ORSA 1RQ5A 3FONB 3OAYH 3WXWL 3UYRL 3GM8A 2D3VA 4XB8A 3REWB 4NQED 5GRWA 3MGOB 1P4IH 2IANA 1R5VB 2GT9B 4XBEL 1K3ZA 2VSCA 4FZ8L 5KSAA 1ADQA 2HRLA 2DDQL 3HKFA 2QADD 2YPVL 4L9LA 1CBVH 4C4KT 2N1KA 2BHUA 4POZD 4Z95L 4IMLA 5HHOD 4U3XA 4I77H 4ZTOH 4HCRA 2C1OA 4R4FH 2AERT 4HT1H 3SE4A 5F1KC 4KJWC 4U1KA 1MFEL 3GSRB 4PUBH 5EBWB 4LBEB 3EDJA 4PJIE 5GGSB 1L7IL 1OP3K 3HR6A 1CLZL 2JCCA 4KTEH 4K9EL 4JGJA 3TT1L 2ICWA 4S0TD 4UIMB 2DM7A 5KSBA 5CUSL 3WBDA 3LSOA 4WGVB 1CCZA 2M2DA 2AW2A 3OMZA 1WITA 3KPLB 5HGBA 2GIYA 5CZKA 1KJ2B 3QUZC 1GGUA 4KJQD 1AKJA 3GHBH 3NTCL 1B3JA 3WUWB 5AG9A 4XX1G 3KPMA 4PTTA 4XNXL 1ZVSB 3BP4B 4H8WL 3PNWA 1JCKA 2FJGB 2BVPB 3MLSL 5JHLH 5I9QB 3BZ4A 3V5HA 4OF8A 4TULH 1T3FB 5EB9A 5EZJA 1G9EA 1MFBL 3MLTB 2NW3A 2Z0BA 3ARFB 3GBLA 3MRIB 1S8DA 3BH8B 4M7JL 4U1NA 4NNXA 2NLJA 3ZDYE 4ZQKB 2OJZH 1X4YA 3AROA 5IBUG 3UBXA 4EN3D 1UM5L 1XCTA 3BDYL 4EI5A 2EE6A 2Y9RT 3M1BB 3NPZB 1PAMA 5IG7B 4O5LH 3PL6B 1MSPA 2OJEB 5F7DA 5F93C 4JFPA 2X9XA 5I66A 5F6IC 1DANU 1RK0B 2XTJB 5J1AA 4NKDB 1CLOL 2APBA 2ZJSL 3FAXA 3MLZL 3H9ZA 4DZBB 4KVNH 2AAVA 2AK4E 5DD5H 1MCBA 4YNYA 1T66D 4YFDB 3BRGC 1FCCA 1P69B 4NWTL 4WEUD 1KPUA 4CJ0A 4HC1L 4FG6C 3S96B 5D8JL 4PRHA 4MAUL 2C3VB 3VFPA 1KEGL 2VABA 3G5ZA 2WANA 1RZKH 3O3BB 5KSAC 4XPGH 4UDUA 2BSRA 4UT9L 1EHNA 1DUYA 4QRPE 4CVWA 3BW9A 4POYA 4QHUA 3OHXB 3SPVA 4GG8A 2MTPA 1QSEB 1U3HB 3RUGF 5I1CH 4WJ5A 3LB6D 3GO1L 3SE4C 3MSPA 2DRUA 3KPNA 1JGLH 1D5IL 4OLYL 1IAIL 2R0ZL 4XNYH 4KK8C 4P2RA 4DCQA 3NACL 4P23B 3U6RB 1YC8A 3K1DA 1NCCL 3LS4H 1YMHB 4IIQA 1G9NC 2Z8VC 4MXVE 2WM0A 3W0WB 3BP5A 2XZZA 5E2TH 5EUOE 1OAXL 2G60H 4LCCB 5E6ZA 3V0WH 3ZZ1A 3QDGD 1J9CT 2ITCB 1ONQA 3FO2A 4ZS6C 4E41D 1A4JB 5ADOL 3TFKD 1IQDB 3QDJD 2AV7B 2ZCKH 4Q2ZB 3S35X 2NX5D 5I1GH 2UZXB 3IFOB 2HFEB 1X5XA 2YD4A 3SGKA 3K81A 1L4IA 1AGFB 1I7UB 2ADJA 3BKML 1BBDL 3QXAA 3RHWK 1IGJA 4ZSOB 1I7TB 4PJFA 2PR4L 4FP8H 3O9WB 2VLLA 1DQJB 5LWYL 1JNLL 4QRSB 2BSTA 3BMWA 1BZ9A 1RMFL 3T0EE 3C8KB 4LSTH 3VJ6A 3MODH 4NBYB 4F7TA 4JDZB 2BJML 1JV5A 4FFYL 3OSKA 1NJ9B 4OD2A 1G7IB 3HCVA 3H7LA 5FF6A 3WFBL 4L4VA 5D7KE 3HPLA 2EXYD 3T09A 5DJ8A 5JW5A 1NUDA 4OGZA 5D72H 1ZHLB 4Y5XA 2HN7A 3VFVA 3WFCH 1S7UB 2BRQA 3ES6B 4PYHA 5D7LE 3SO3C 3UTQA 3LKRB 4X6FB 2WWMD 4OUUA 1U8KA 1XGTA 1A9EB 4XWGH 5CEZE 4MWFB 4FXKA 4JPIA 4CW1A 5C0EA 2HJKA 4R9HA 2BMKB 2D7TL 3VGDA 2AJSH 5F9WB 4XMPL 2O26U 3E6HA 3IU4L 2V2WB 3VXTA 2VO5A 5DDHA 3EBAA 3BKJL 4PJHF 3L1OH 3BD3A 1SJXA 3MUY1 5JDSA 4YFEA 1FHGA 2R29H 1JGDB 1OW0C 2VXUH 1SVZA 4U31A 1K5NA 1KG0B 5FYKD 5INDB 2PXYC 2Q76B 3V8CA 4KRNA 3PP4H 1PEWA 4BK5A 4LSRL 1KIUA 1PVHA 4H25B 2CKNA 2CJUL 3MJ9H 5FYLL 4LLDB 2W0FB 1AHWC 5I0ZA 2OTPA 5T1LB 3VW3H 1U8OB 2VDMH 1RD6A 3MNWA 4OZIF 2OTUA 4HPYL 5GGRB 4PJCE 3MO1B 4NQVA 2C1PB 2IF7A 1UXSB 4BSVB 1A9BB 5D7JD 4PJBA 3C08H 1UFUA 3TA3B 4N0YL 1PYWA 3MRDA 5K33A 2R69L 1TZIA 1Q9OB 4HD9A 3AB0B 3GJFH 5DQDH 4HXBL 3BT2H 4N9GA 1HHHA 4NQCD 1FZMA 2VLKA 4GQPH 3T77B 1OY3B 5E8PA 1JF1B 1N5AA 5IVXB 1GC1L 5TE6L 3BPOB 1PQZA 1DTUA 2HTLD 4NCC1 1J11A 5D2LB 3CXDH 1EXUA 3JSSA 2G2RB 3D2UD 2W60B 4CADA 4RA3A 4Y5XC 4WEBL 4HS3B 4JRYA 3UTTA 1UB5A 4WUKH 2XTLA 3K8LA 4BFBD 5ISZB 2YOCA 2EC8A 5KJRL 4HKZA 5CMAA 3EYQD 3RGVD 4U1MB 4MA3B 3HPJA 5FKAA 1DQLH 1B0GB 5B38B 4J2XA 2P8MB 4ISVB 1A3RH 1NAMH 1PDKA 4M5ZH 1II4E 2QHRH 4X6BA 2D03H 2MCG1 5E4EC 3PWVB 1B2WL 3MV8A 5DRXA 4J1UB 1LDPH 4YUEH 2G9HB 1LDSA 2WMPA 4PJ7B 1DQML 3LQAC 3MRMA 5F70A 3H9SE 5C3LD 2WQRA 2HFFB 4XNMA 4NRXB 1S7XB 1G1CA 5CEXA 1D6VH 1T03L 3IJYB 1R5WB 4GW5B 2FHCA 4MDJA 3LKSB 4PJ9D 5KANI 4MNGB 4X9GA 4K3JH 2GTWA 3VXMA 3T1FA 5IK3A 1N6VA 43CAB 5F97E 1I9RL 3U36A 5DJ6B 1KCRL 2CDFB 3ULVF 2UYLA 3HNVL 4OI7A 2NYYC 4RGND 5TE4L 4KAQH 4ZDHA 5J3HD 1FNAA 1QBML 4KI5D 4WFED 2X4RA 1NDGB 3FOMA 2WBJC 3N50A 1ZSDA 1PEZA 3Q3GA 3S4SA 1IAKA 4MX7A 3LDBC 1NFIB 4HWEH 1FBIL 2DWEA 5T5FH 5D5ME 4AEHH 1CFNA 4J7RA 1FC2D 4NN7C 5E56A 1H3XA 3TN0D 3IAGC 2DKUA 3RWHB 5E8OB 3X14A 1AJ7H 1BFTA 3B9KC 1IKNA 4LQ1A 1AIFB 4OZHB 1J86A 4C57C 1HIML 5IMKA 4LKXA 4UZGA 2E7LA 2FJHA 2KDGA 4PIRF 2HT4C 1NC2B 3K4ZA 1KV3A 4NQEA 4X7SH 3BZFA 4KY1H 3RKDD 1DVFC 3FN0H 4WTZA 1BVKB 3QPQD 4WY7H 1CXFA 5HHOA 2IALB 2ADFL 5FO7A 2Y36L 5CCKH 3VD9A 3HC0B 2VXVH 5F1SA 2UZIH 4BH7A 1EA9C 5JIPA 3B8SA 1FLRL 1A1OA 5JIIA 4HUXA 1MFCL 4UV4L 2GJ6B 1FVDA 2G5BB 1AQKL 1GGIH 3HAEH 1I8MB 4Y19D 3NN8A 1X5IA 4YK4C 3VGEA 1U92B 1IAII 5DGRA 5CP3A 3VA6A 4PGBB 3MR9B 3TT3H 2NY6C 3JV6A 3HNSL 4X5XB 5IFJB 4KRMB 2JK5B 3RY6A 4UUJA 3SKMB 1FNHA 2VSDA 2P5EB 1U8NB 1CBVL 3MFFA 3OR6A 4EQ3A 1HYSD 1S9VA 2CO7B 4I77L 3UC0H 1GZPB 5IBLC 4OCSH 3HNTH 4ZNCD 2Y7QA 3WFDH 2N4IA 4HT1L 2YR3A 4XPFL 2PXYB 3BSZH 5E70A 4PUBL 3QNZA 3STLB 2A83A 3QQ3A 5JQ6H 4U6VH 4KTEL 1YUHA 4EN3A 1FE8H 5AD0A 1RIHL 4LIQE 4XHJC 4G8GD 4U1JA 4QRRE 3I3EA 3OKKB 1N8ZB 1S7TA 4G3YH 2BOCA 1XGUA 3GHBL 4GOSA 5I1EH 5BV7C 3GMOB 4P3CH 4PV8B 1CFVH 1VFBA 3DV6A 5IESL 2ARJQ 5D6DC 1CXEA 3MBEA 4G43A 2IH1A 4U1SB 1QLFB 2XYCA 3E6FA 3PWJB 4O9HL 4F7CB 3BVNA 1IKNC 3TNNA 5JHLL 4QRPA 3TJEH 4MSWB 5DQ9B 4Z7NE 4HX1A 4D0BA 3RVUD 4QYOB 1FPTL 2GJZB 2X40A 4EOWH 1CD8A 1F4XL 1VFAB 1T21B 1BECA 2OJZL 4D9LH 1U42A 2HJLB 4OFIA 4WUUD 4XNQB 3VCLA 5K9QG 2VIRA 4O51A 3ZHLA 5CJQL 2EIZA 5HVHC 1JN6A 3RWFB 1CLYH 1C16B 2P8LA 5CEZH 5DZLA 1PKQB 5EUOA 4P46C 4PY7A 1JGVH 2XG4A 3D0VA 5AZEH 5BZDA 4P5TD 3CVHB 4P2QB 2X4UB 4YHYB 4XT1C 2APWA 2DI9A 4KVNL 5E7FA 2GHWB 4YFLI 5DD5L 2CIKB 1JGEB 2NCMA 3SDCB 3SO5A 1ZAGA 1D6EB 3ECBB 4KJQC 2BY0A 4HMEA 2BNQB 3OF6D 3QDGA 2YA1A 2D0HA 4QT5B 2GUOA 4E41A 4YXLL 1RZKL 2W0KA 1X5ZA 1RU9H 2E9BA 3AAZA 5DD6A 2UVFA 2ZOKA 4PRIB 2FSEA 3T0EA 5E9DE 1Y18A 1EAPA 4HIIB 1NMAH 4JQVC 1CL7L 3IDMA 4WI6A 3RP1A 3LN4A 1KIRA 1JGLL 3QA3A 2GKIA 1IEBA 4XNYL 4KDTC 1OSZB 2DYPD 4UAOB 4PRPD 4MS8C 2D9QB 3LS4L 2F9BT 5IVXF 1NCBL 5CJXA 5LBSH 2DQHL 1FNEA 3LEYH 2W92A 5E2TL 3EOBA 5D2LF 4NP4L 5IF0B 2PO6C 6CGTA 5IR1B 3V0WL 3DUHA 3CDYA 1J5OH 4R7DA 4NSKA 1Q72H 1OT1A 2ZCKL 3I9GL 5INCB 2UVEA 5SX5K 4LLMA 1MVUB 4NN7B 4W4NA 1T66C 1JTTA 1FSKC 2I07A 3QULB 4J4PC 1M7XA 4OF7A 1MCIA 1T5XB 1EFXA 4DFHA 3F58H 5LGHH 1JWMA 1PZUB 5C0BD 4PJXB 4XP4H 5T33H 4Z5RB 1BAFH 4OF3A 5DVMA 3DX9A 2Q7NA 1BBJB 1LD9B 5F9AC 1G1YA 2PW2B 4P49A 1I9IH 4WV1A 4DEPB 5IUSA 1NBYB 3SDAC 3D9AL 3EIFA 1DVFB 2K1MA 3D0LA 1INEH 3WIFB 3ABZA 2R9HC 3C9NB 2NPLX 4HJ0C 3G9VA 4DKAA 5ACLA 1FIGH 1YJDC 5D72L 1J10A 2I5YH 4FQLH 3WFCL 1WUNT 3IFPB 4MVBC 3CFJB 3C5ZD 4ELMB 1LVEA 4PJCA 3I6LE 2R2EB 3ROLB 4U3CA 3RWIB 1QO3A 3BOVA 3DBXA 4K71C 5HXMA 3SDXB 4I0PD 1PG7H 3RKPA 1XMWA 4JFHE 1WTGT 2Z92A 4XWGL 2BCKA 1T7YA 1JHLH 3CUPB 4F7PA 2XICA 2NY6B 4HHAA 1MELA 1RVFH 1NLBH 5E94B 1BOYA 2AJSL 3D25B 5HBBA 2OQJA 1FZKB 3T4YA 3QQ9D 4JFQB 1PW3A 3WL9B 5D7JA 1BLNA 1INDH 1U8IB 1F3DJ 5DQJA 4EXKA 3L3IB 4QF1A 3NPSB 1CT8A 3ZSTA 2VXUL 1OHQA 4KJYA 4WFGD 2YPKA 1QFWL 3DUSA 4NQCA 1ZLVH 3AGVA 3O8XA 5L2KD 4BSWB 4M7ZC 5T1DH 2ZUSA 5IMLB 4XP5H 5DO2C 2RB8A 3MJ9L 1D9KC 1OAYH 3G6AB 3T1WA 1JPGA 2EXYC 5ACMA 5JO5A 1FORL 2ICWI 1GAFH 1E4WH 1F8TH 1DEDA 3VFRB 1MHEA 2CH8A 4Z9KB 5E5RB 5FHBH 5K9OA 4QRUA 5SWZE 5C7XL 3OB0H 1JZ6A 4ODTH 3RGVA 4N5UA 4K7PX 5E99L 4NCC2 4H5SA 2Z91B 3OR7B 3GFUA 3H9SA 3HZMA 2WWMC 1JRHH 3OZ9H 1TNMA 1U58B 4GKOA 2J7LA 2ZCHH 3KNBA 5C0CB 4X5WB 2CDEB 1CICC 3TBSA 3QIUD 1K3IA 3P0YH 3OKDA 3KWWA 1AXTH 3P4NA 1JPTH 2C3GA 2Y07H 3HMWH 4GAJH 3D1MC 2VXQH 4NO2B 5IT2H 3VRIB 4L8SA 3SKNA 5FA4B 4JAMB 5GZND 2CDGB 5C09D 4ZO7A 3UBXI 3UTZB 3W39B 3P9WB 4KGLA 4NPYA 1TTGA 3R0MA 1ZVYA 5IHBA 4PJ9A 2YWZA 3KG5A 4WI8A 2P1YA 3V6FA 1L6XA 3S36X 1A6PA 4LLUB 1QPXA 1HHGB 4UTAH 1P7KB 3LRSA 5IM7A 1DQLL 4I5BB 4OZGE 4XTRC 5IOPB 1XR8B 3VFGH 4YGVA 1A3RL 1JHTB 5C09E 3VG0H 3SKJH 4GS7C 4M5ZL 4JFED 2QHRL 4Y5YC 3NCBB 5D9SB 5EO0A 5EC2A 4H1LB 1LDPL 1O5DT 5JOFA 3LH2H 4Y2DC 2M1KA 5LJYH 1S7SB 4LIQH 5D7JC 3FJTA 4PLJC 4TQEH 5DHVH 3W9EB 4PRAB 3G9AB 1UG9A 2H26A 4NHCH 4K9EC 1BFVH 3TP4A 3QXDB 1NSNH 2NY7H 4ODHH 2F8VA 5KTEL 4K3JL 4WHYH 1AQDA 1TLKA 3OAUH 1C5DA 1I9EA 3N85L 1ETZA 3NIDE 4KK6D 1MRCH 5I8KL 3PHOB 3ZDXF 3RZWA 5F88A 3JV4A 4AH2A 1AP2A 4S10A 2Q6WB 3HN3A 5DVOA 3IVKB 1BQHA 4JM2D 4KUZL 4Z7WA 3WJLA 4P57A 3MXVL 2UWEE 4P59L 1IAMA 2DQEH 1ORQA 3IFNH 3RGVC 3EYQC 1T7WA 3S8WA 2FYYA 3SJVD 4HWEL 5T5FL 4BJLA 4YX2H 2WP3T 4Z6AT 5I8OH 1XF3B 3D85D 1RPQA 4R7NB 4RMWA 1RUPL 4Y19A 4JFDE 4JKMA 1I3UA 5DJCB 2DBLH 1WAAE 3FL7A 4FTVE 4JFOA 5JUEH 2A9MH 3SJVE 1Z5LA 1FV1B 4OZFB 3F7YB 3BN9D 2FL5B 5BO1L 5DWUH 2ENSA 3PDOB 4LDEB 2IQAA 1A6AA 4ODWA 4XBPB 3QNXA 4JHBA 3U0WH 1H15A 4YPGB 4X7DC 3PWPD 3TYGL 4PJ9C 1B0WA 1U6AL 4NRZA 2P42B 2ZPKL 4WY7L 4QRRA 5DHVA 5CCKL 3MV7B 3BQUC 2VXVL 1V5JA 2ADIB 3DSFH 4G8IB 3MX0A 1CK0L 1FZJA 3RL1B 5DJZA 3JWDC 3C2AL 4PBWD 1T80A 3P4OA 3GSQB 4RFOH 2R8SH 8FABA 1C5BL 5FCUH 3MNVA 3BXNA 4AG4H 3CFKA 2VZ3A 5HHQB 4K71B 4KI5C 1CL7I 3MA7A 2AV1A 4NO0D 5EUKB 1RFDL 2ZUVA 1KXVC 4M6OH 3QH3B 3O4LB 1T0NA 2V5SA 5H94B 1P5VA 3TT3L 1FAKT 3GMLA 2BERA 3TN0C 4ZXBD 4WI7A 1IL1B 2GYSA 2VZTA 5TGBB 5FYJE 1E28B 1WC7A 2NXYC 3O11B 3T0WA 5MEND 3DX7B 3PXJA 4ZO6A 3EFFB 3UC0L 4MB4A 4OCSL 4C83B 3HNTL 2DQGH 2VXSH 4JKWA 4X9FA 3WFDL 4CMMB 3TBWA 4D0CA 3BSZL 2CK2A 1C1EH 5I1JH 4UIKH 3MRGA 4YZFE 1KF9B 3L3HA 4WUUA 4YWGH 3RKDC 5CIPH 1D9KB 5HHNB 4H0HB 3QPQC 1CN4A 3V0VA 5IB2A 5I1EL 4V1DB 4J3WA 3BJLA 1CFVL 3HR5A 3UTSB 2Z31C 2VLRB 5ICZA 5GGRY 1UB6A 5JZ7C 1VGKB 3LKNA 5HHVL 4BZYA 4NJAH 3D3VE 4P5TA 1YMMB 4JG1H 1GOGA 4ELMF 2OL3H 3ULUC 3TJEL 1S78C 3EYFB 2XA8H 5ID1B 2VXTH 3WO3B 1U8JB 3SDXF 2WZPD 1WIOA 1LP9E 3TIDB 1IILE 4FRWA 5D1XB 3OF6A 5DK2A 3HI1A 4OGYH 4KKAD 5CBAA 4D9LL 3FQWA 2NR6D 3I02B 1J1PL 3HC3H 1J1XL 4TNWK 1Z9LA 2NQCA 1XF1A 3NCFB 4MA1C 3FB8B 2ZSWB 1QLRA 5JMRA 5E8NB 4FQQA 1AXIB 1NCWL 3D18B 2R0KH 1CFSB 5HDLA 1QNZL 4AM0B 4LASL 3S37L 3FQNB 1JZ5A 4F3FB 4R4BB 3WN5C 3P4MB 1DBAL 3GSNB 3EDDA 5IROA 3ZKND 1D5BB 4HBCL 4EUPA 3CFDB 3A6OA 1MJJB 3G5XB 3OJMB 2AK1H 1OT2A 4MD5B 1QFWI 4U6YB 1A1NB 1JPFB 1TJIH 4XNZB 3U4AA 1MI5D 5EU3A 3KPSB 4Y2DB 4ZAKC 4OTXH 5TE7H 4WWKC 3HFMH 2P24A 4PJ5B 3CSYB 1A21A 1J7VR 4HF5H 5GS2H 3O2VH 2AJVH 2FX8H 1PGRB 5FA3B 3V4VH 2C4FU 1RJLA 4D2NA 1HXYB 3QO0A 3NIGF 4LLYB 4L8BA 1AO7B 4DN3H 5C0BA 1QLEL 4X7TB 1HCFX 4M6NH 4LHUD 5LBSL 1XR9A 4J3UA 1A6ZA 3NA9H 1U93B 2IEPA 1CQYA 4YHMH 1XIWA 1BD2D 2VDRH 2AABL 1J5OL 1WTLA 1AGDB 2BY1A 4P9HH 3MRJB 1CG9A 1HHKA 4AZ8A 1WCBA 3LS5H 4JLRA 5SWQA 3TGXA 5GGUA 3GHEL 4F33A 4I0PA 4ZFGL 3VE0B 3NFNB 4LAJH 5AZ2H 3F58L 3QG7L 5E03A 1H3UA 3ZT6A 2BRRL 3BWUC 4WI9A 5IIEA 3GSWB 3PWUA 4HIEB 4KKBD 3GSVA 1B4RA 1T0MB 1WICA 3O81A 1KN4L 1BAFL 1K2DA 1YEKH 1A7QH 4Y4KD 4GBXD 4GKZB 4FQJH 2D7PA 3R1GL 2N56A 4L4TE 5EIIA 4IJ3B 1I9IL 3O2WH 1OD9A 1INEL 1FRGH 2IMNA 4PGDB 5IHLB 3VD4A 3MRLA 3V5KB 1EX0A 1KJVA 2FD6H 3BQUB 1I4FA 3P77A 2MMXA 4MXQC 1FIGL 2I5YL 4FQLL 3S5LA 1X5LA 3SN6N 1OCWL 4WNQB 2L4OA 5L2KA 3VFNA 2NY2B 1QQDA 4E42B 1QSFD