2CO6A

Salmonella enterica safa pilin in complex with the safb chaperone (type i)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
125
structure length
125
Chain Sequence
GSDLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Fibril protein
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
total genus 20
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2co6A00
2CNYA 3UIZA 2FVNA 2CO7A 2CO3A 2IXQA 2CO2A 5D55A 2CO1A 4PHXA 2AXWA 4OR1A 2CO4A 2CO6A 3UIYA 2CNZA
chains in the Genus database with same CATH superfamily
3BZDA 3D06A 1P2CA 4J3WA 2XQBH 3SYQA 3I2CH 2DIBA 3ZE2B 4WHDA 3WN5A 1O6TA 1JNNL 1QZ1A 3TZVB 4M5TA 4ZPTA 4OM0H 1YMMB 5DZLA 5HGHA 1PVHA 3UPCA 2XZAL 4LMQI 3APCA 4YBLB 4XH2A 3WEXB 3TFBA 4AKOA 2QVFB 1ZT4A 1G9NH 1CGXA 3FB5B 4PR5A 1JHTA 3B9DA 3O4LB 4LNRA 2G30A 2WXMA 3D2TA 2NR6C 2ZWYA 3HZ3A 1NGXA 4PJ9C 1F4XH 4YDZA 1F3JA 2DQTH 5C92A 4WI2A 5DJCB 5C8JA 1UZGA 2A74A 2DN7A 4X83A 2ICEA 3OKDA 5I66A 1D5MA 2GJPA 4A04A 4KRLB 4TVPH 5DD0H 1XSJA 2IWKA 1MNUH 3BVTA 4YHKL 5BRZD 1CLYL 1UA7A 1SJMA 1W2KT 3FQUB 1VLXA 4G9FD 43CAB 2X4NA 3GHEH 4UT9A 2CO1A 1IC4H 2AZUA 2FTAA 3IJHA 4I18A 1SXAA 5E8PB 5JDSB 2M26A 2XZCH 3WNPA 4JB9L 2NX5D 4N0YL 5C7XH 3RIKA 1A6AA 1JERA 1NFAA 2XWTA 3C9NB 3FQUA 1ACZA 3F12B 1DZ0A 1JPTL 4C4KO 3QJFA 4K5LA 4AXWA 3MNVA 3OPZL 1BVKA 2ZUXA 5I1DA 3KR3L 4GW4A 5B1BB 3HNVH 1QLEL 4JHAH 4PYHA 2W92A 4EN3C 5HHNB 1KXQE 1AVAA 2VQ4A 4LEOB 3TIEA 2W0LA 3F7LA 1BQLH 5LGHH 3MRGA 3RIAK 5EOQH 1CK0L 4R7NA 3LHPH 2VR3A 3TPKA 4ZUSB 4MFHA 2JQZA 4KDVA 3MZGB 4ZYKA 4QF1B 3MLUH 4ZMLA 3NCYP 1HXMA 3H54A 5EU7E 2I85A 1CBJA 1OTSC 1J05B 2EDYA 1N18A 3UBXB 3CQQA 5TDNB 5D9SA 2EXSA 2WB1A 3REWB 3VFTA 2FT7A 2KKQA 2VDKB 4OFYD 3E80A 4M1DH 3WL9B 1INEL 1UWGL 4NDMB 5GS0H 1KT2B 1ZLEA 2XV6B 3V5KB 3QJRB 2ODIA 5FM5O 5L2KD 3ULVC 1KMGA 1C8QA 1KYUA 3S3CB 1E90A 1V27A 2VQ1B 4IK6A 4RX4D 3VGDA 4FTVE 1F4AA 1R47A 3T0EB 3PPEA 3P0YL 2BP5M 5AB0A 5J6GB 3IU3A 2K8MA 1BAFL 4UINH 4XNXL 3EH4B 4HZLA 5AW6B 4ZMZA 3L3KB 4YXHH 1GZPB 1M1XB 1TOXA 3MBWA 4PJIE 1XF4B 4JAMA 2Y1AA 3J2PA 3PHSA 2HX9A 4G7YH 4JM4H 2R69A 2AEPL 3CN4A 5EFIB 1FNLA 1AGDB 1FNHA 5EZLA 4XOAA 4JFEB 4M1GL 4Y1AE 1CQYA 4V1DD 1S5IH 3WXVL 2QVTA 4OCNC 4LOEA 5LAXB 1W8NA 2AV1A 3STLB 4S2SA 4CADB 1A3QA 2ATPB 2JKWA 3QULB 3BRDA 5F6HI 4NO5B 4WI0B 2P8PB 3RB5A 3IPEA 5IEKB 2P5PA 5B39A 2KS0A 5J6SA 1NOLA 1T89A 3VXUA 3F04A 3VGAB 4P2QB 3W9DB 2NW2B 4E9WA 1A21A 2O6EA 4JRXB 4P5KB 5GIRB 3BE1L 1XH3B 3CAFA 1TFPA 3LKQB 4F7PB 3GMMB 4MNQE 2OX5B 1RUML 1I3UA 3UYPA 1LDPL 2BINA 2NY2C 1LEIB 3GJEB 3I3BA 1IM9A 3KJ4B 3X1GA 5FYKL 43CAA 1BDYA 2CWRA 2NX5E 4MGXA 4QT5A 2OX5A 3ULSB 2CGRH 3SKOB 1AE6L 3CV5A 4LASL 4YX2H 3RWGA 3UJIL 3LOWA 1PMYA 5EC1A 5EF0A 5T1KA 3QQ3A 3UJJH 4GRWH 3ELAT 2CRIA 1IV8A 1RCYA 3Q0HA 3MNMA 5GGTL 3FO1B 3BAXA 2ZYIA 1MCLA 2F74B 4G1EA 5I1CH 5B7FA 3C8DA 3Q48A 4N2BA 1KCSH 5D70L 1DQLH 3TBCA 3ARUA 3MACH 3RVVD 4CVZA 3ZZQA 5C0JB 5KZCD 1M4KA 5EZJA 1FL3A 3DJRA 4LSTL 2VLJD 3PPSA 1TQBB 3FO0L 3TV3H 2QTEA 1L7TL 1MAMH 2YARA 4JPKH 4TKWA 2N1KA 4LEXH 3RUGB 4OI9A 1R46A 4ONFL 4LDOB 1QUNA 4TNGA 1IGTB 4WV1A 1EMTH 1LK3L 3QDGA 2H6OA 2Y7SA 3MUJA 4KQ3H 3ZIMA 1KGCE 2O72A 1XV8A 1AZBA 1LO0H 1GA2A 3GS7A 2CR6A 1W0WB 5EO9A 4U6YA 4BFIB 4QOKA 4QRUB 3QEHA 1A4BA 2CO3A 1SJEA 3LXAA 5EBLB 5HDBE 2WKGA 1YEIL 2J21A 2I26N 4K23H 4Q6IB 1QYGL 2G3XA 3NCFB 5DQDH 4XNZC 1BHGA 3QWNA 3DI3B 1QBBA 5HGAB 5FXCH 1CN4A 4JFPA 1CDCA 1C5DA 2YAPA 5FLUA 4ATWA 3G9AB 3H2WA 4LDLB 4LVHC 4MD5A 5F7FA 5EOTB 3UC0L 3VXMA 3QFJA 3QYMA 1TJGL 4X6FB 4NQQA 3ROOB 4JPSA 2UWEB 3MUGA 4HSCX 2D7MA 4FYRA 2X0UA 5D70H 4KPHL 3HZKA 1A1MA 4A66A 2FZ3B 3QDMA 1CXFA 2KLSA 2B3IA 1X5KA 2EDWA 2X89A 3OKNB 4FYQA 5BMFL 4M5SA 3FFCA 4OLVH 4PV9B 5JLZB 1J11A 5CXPA 5E6ID 1E9OA 4L9LA 4Q56A 5AG8A 3C8HA 2P44B 4IMLA 1HESA 4QRAA 4L4VA 1LDPH 3VFOB 3RIAF 2NXYC 5B38A 2Y3AA 2KMWA 4OLUH 3EFOA 3VTTA 4HYTB 4BSWA 4G6KH 1Q72H 1WA1X 1DSFH 1XCTA 3P11L 3UJTH 3TBVA 2PPAA 2Q8AH 1I75A 1LHZA 1G1CA 4CA4A 3Q1SH 3TVMA 2XN0A 1V05A 2X2JA 4YVNA 4L1BA 4ILDA 3RZCA 2ZKMX 4LCCC 1PL3A 1QYGH 1M57B 5DQDL 3V7AG 5CIPA 5CU5A 3I6LE 4R4FH 1GOHA 4HKJB 4Q52A 5IM7A 3BEWA 1G84A 2OM5A 5DRNA 1E5CA 4G43A 4XBEH 1J9SA 1KG0A 2APXA 1WFTA 3BQUA 1YY8B 1OANA 4O4YL 4J12A 3N1PC 1K6QH 2DLFL 2YOCA 4J4PA 3GC3A 4U7KA 2KPNA 4J3OD 4U1HB 1I9JH 4IIQA 1S5IL 4W4OC 4FXGB 2VR4A 1J8KA 3G6JF 4AV4A 3SKMB 1QKZL 3JWNH 4G6JL 5B3SB 3QUKA 4M1GH 4E0RA 5A6IA 3MLSH 1YEFL 4OJEH 3LRGA 1H8LA 1KEML 1J0HA 2ADIA 4BKLB 4G7YL 3V9FA 4E9SA 5L0QB 2KH2B 5J6HB 1VERA 2APBA 4LCYA 2WMPA 1CGSH 2HWZL 1R3LB 4F9PA 4FQQB 5J3HC 3PV7A 3HLKA 1CJYA 4G3YL 5TQ0H 5BJTA 3VRLE 3P0YH 4PY7B 2NMSA 1EGJL 4BFJA 5CD5D 2WBWB 2PW1B 5JNYA 3RB7A 1HOCB 4QRRB 3I3DA 3N41B 3GI9L 4PJ7E 1AG0A 2WZ0A 4G6MH 4JGJA 1T89C 3LRSA 5EIIB 1CE6B 2C3HA 3BVDB 4KQ0A 2BXZA 2VE6B 3ES6B 3GZOA 3C6EA 3EH2A 3IKCA 1JGIA 3ARFD 4Q4IA 1QA9A 7TAAA 4PJAA 3RJOA 1CD1A 3HBQA 4OT1L 1YEGH 4P2CG 4KAQH 2F1EA 4O58L 1U8QA 1J12A 1YMMD 4PRPA 1CTNA 1MWAA 2GTWA 1EFXA 1TVHB 5I75C 4Y9FA 3U4BH 5KAQF 5HVHC 1AO7D 4WHTB 2AI0L 1NTDA 4K8RH 1T2QL 2VYRE 4IDJL 4QHKI 4BUHA 1KOAA 3ESUF 2I24N 2BSCA 4JPVL 1QLEH 1N8ZB 2ZP8A 1NGXB 2BNRB 3I85A 3SPJA 3WO4B 3SDYL 5J11B 3VSQA 4U1NA 1KCVH 1HILA 3L4ZA 3MLVL 1F86A 3ISWA 3UPAA 3OKNA 2DJSA 4FS0A 2N7BA 1F41A 1KYOK 5IOPA 1A1OA 3ZN6A 3A47A 2GHZA 2P80A 1P7QA 3D0LB 2VLME 1S7TA 3B4NA 4OBRA 2W9DL 3OQ3B 2GEEA 5ITFA 3EG9B 2JK5B 3ETTA 3EJZD 4HUUB 4ZS7L 4WGWB 4AGQA 1JHKH 3BIKB 2Y22A 5K1JA 3EJPA 2Z34A 3EG9A 3VXTA 3FQNB 4X6EB 2WD0A 3RPIB 3SDAA 1TENA 1ZT7A 4HKBA 3GSNL 5I1IL 2HKAA 5EN2A 4O9HL 4BFBD 2LU4A 5C0DB 4DOHE 4LSVH 5GS2H 2G2PA 4FQJH 3ZTEA 5GGQH 1B0IA 1SRDA 1HWHB 3F7VB 4HGWA 1G9NL 2BS8A 1KLGA 4NO2A 1G9EA 3IS1X 4GAJH 2GC4C 1T0OA 3D85A 1R5IA 4FABH 1PG7L 1X5LA 3ULUE 5HI4D 5IBLD 4QF1A 2GIMA 1OLLA 4N2FA 1JXFA 2J71A 2OCCB 5KYUB 4OZFH 2DQUH 4R7DA 2P5WA 3ZQXA 4ZD3H 4P3CH 1OF2A 3HZVB 2CGYA 5DJAB 1UTDA 4HFWA 1KIUB 1R5IB 5LBGA 2BVUA 1SJVA 5FDWA 1QSEE 4P23B 2FYYB 3BXNA 3VWJA 2XZAH 4LRIC 4ATTA 4E5XB 2JCCA 4GMTH 5I1JL 4NQTA 2BP8A 1RZIB 3QWQB 5IESL 4XPGL 1EGJA 5K9OB 4F24A 3K80A 1MFEL 1AQDA 1MFCH 1MW2A 4BKSC 4I4WB 2N1TE 3QIWD 3FT4A 4HEPG 5E00A 4ABQA 3AG4B 2XQ0A 2F5AL 4M6OL 4TQ8A 3WJLC 2DH2A 1M7IB 5C3TA 2VQ1A 3N55A 1S7QA 4K3DH 3BUQA 2DBJA 2R51A 1JV5B 3GFUA 3HI6H 1J8HD 3OZ9L 4JN1L 1MI5B 3OXSA 4BQ6A 3LQMA 4F7MA 4Z7QE 3Q05A 1M42A 4G71B 3SGDI 4DCQB 3HAEG 4C56D 2YBRA 1BPLB 4YHOL 4JFVA 3V0EA 4MJJA 5FYKU 4ZFZB 3TPUB 3C5XA 5DJ2A 4NRYB 3PGCB 4W68A 1Z5LB 4HAFA 1AFVH 2X9WA 1UYWL 3FFCD 2PYFB 5JDJA 5F8QC 4FLSA 3T0WA 2IPUK 3L3OB 5FO9B 3SBPA 4N90D 5IB4B 4APQA 4ICWA 3IMUA 2YPKA 4CJ1A 4KKAD 3C12A 4C56E 3KNBB 3MV7E 4TLSA 4J23A 5GZNA 5KOVC 5JIDA 1P7BA 3BKCH 3OJVC 3TLRA 3QGVA 3MVSA 2HN7B 3P4OB 3STLA 3WFCH 3RL1A 3WNMA 3NIFE 4P9ML 4U0QB 4JG0L 2PCPA 4QYOB 1LEKA 3DHUA 2ZAIA 3H9HA 3FB8B 5LAPA 3VU1A 1GCFA 2CNZA 4CC4C 5D1QC 5I71C 3S8WA 2IALA 2H0JA 4ZMXA 5MP6H 3VI3F 4OLXH 1BAWA 3PAVA 4F9LC 2DL9A 4RAVB 4PB0H 2LVEA 5LUMA 5IB1B 2Y2YA 4QRRD 3KVDD 4OAWA 4RFEA 2JJSC 1Z9SB 1P4BH 3LRLA 5F89B 4ISVB 3WKPA 5KYWB 5DLML 2X7LA 4LMQE 1A4JA 3PWJA 3TNMB 3SKOA 1OKEA 4P59H 2L4OA 3IGLA 1UM6L 4K55A 5CU9A 2XWJA 1UD3A 4JPIB 3QFDB 2BS71 3OWEA 3O0RH 3THML 4WO0A 1CT8A 4P5MB 3CZJA 2EDJA 1JHTB 4X6CE 4TULL 1J1PL 1RMFL 4PJEB 2CQVA 5D7IF 3QUZC 3O9WD 1HHJB 1UJ3A 1WBZA 2WLKA 4LFHD 4PVMA 4QJ4B 4N8PA 5JXEA 1FL3B 1A14L 1RUKL 4GI8A 5SWSE 4GBXD 1E5AA 4U6XB 2WXGA 5C8JB 5FV1L 4PJDA 2C3XA 1DQMH 1IZKA 4X6CB 3VVVA 1MCPH 3BT2L 4ZMPA 3DC0A 4PI0A 3S3BB 3QUYA 1JUFB 3ILDA 3GIVB 5JR1L 1GXEA 3N40P 5IK3A 3UTQA 5DMGC 4AKQA 1HS6A 4AT6B 2XNAB 2ZYHA 3D85D 3F8UB 2AABH 4KXAA 1JD7A 1Q38A 2EDBA 4ZZFA 3HB3B 2DQHH 3IJ9A 2NZ9C 2G3MA 2QHLA 1N7ML 1EJOL 3O6LH 4PIRF 2EVHA 4PJEF 3UIZA 2H9GB 3G6JA 1KBGL 2A0LD 5CEYB 3RPKA 1FH5H 3HC3L 1Q9WB 1TJIL 1OCWL 3TC9A 1ULVA 4MQXD 2I9TA 1EBAA 1AGCA 1AO7E 3S48A 3MFGB 3UP1A 5FYLH 1EAPB 3MLWH 2V9UA 3BSZA 3MLVH 4P9HH 3QZLA 4YGVB 4J3OH 3RFZB 4NC1E 1IAKA 4RZCB 3T8VA 4D7PA 2JSFA 1HINH 4JM2F 4UOQA 3PYCA 1NDTA 4WWKD 2VGLM 1OARH 3OF6D 1GGCH 4N2GA 5AOKA 3H0TA 5CLWA 1FGNL 5I1JH 5JORA 3OKLB 1OK8A 4NQSB 2Q7YB 4WTXA 4M7KH 2WO4A 1XEUA 2R83A 3GI8H 2PO6C 2K1MA 3D4CA 3LZLA 5TF1L 1MCCA 2QFPA 4IDJH 2GTZB 2HN7A 1PKOA 5F3FA 3VFOA 1BV8A 1CI5A 1G6RA 1J87A 2LV4A 2WNXA 2PCPB 1QI5A 4AYID 1CICA 4WEMB 4X4ME 3ARGA 3WTSA 3O2WH 4TQEL 5I19H 1GYAA 1LO3L 5GJSH 1WUZA 1CFQA 1YEGL 1UKSA 2DWSA 4ELDA 1T1XA 4R96B 3TA3C 3QIWB 1NAMA 3PJSA 4LOVA 2VAAB 4Q8BA 4UYQA 3ECBA 4GNKB 4U3HA 3FK3A 4NZUL 4A7VA 1JDCA 4AL8H 5EO1A 5JA9A 5CEZL 1X9UA 3CZNA 4WEUD 5DFTA 2YHGA 4OD3H 2YKLH 1D5ZA 1NKRA 3A6OA 4YSEA 1MG3C 3KPSD 1FUNA 1I8LA 2VXUH 1HXMB 4HG4J 2ZQKA 4QGYA 2HX7A 4S11A 4Y2NA 3WNIA 4HOXA 3V4VL 4XGZA 3ZHDA 1CDUA 3HAEH 6CGTA 1WWAX 1KCBA 5LAXA 4PMFA 3NJVA 1ND0A 1WWCA 3GSVA 4M9OA 1T03L 3M8OL 3RP1A 4ZDHA 4ZZKA 4XAKD 1EEZA 1Q9LA 3BP5A 3AM8C 5AW5B 2X9XA 4O4YH 4GS7C 2XBZA 3POHA 1ZA3A 1I9JL 2AHIA 1T83A 3T6VA 3HZMA 4FFYL 4OY9A 3V5HA 4POYA 1K4CA 3EJYD 2XA3A 3C8KA 3RNQA 2Z0UA 3BHBB 3BD4A 2FLBT 4OIAA 5KVEH 3OB8A 3SDXB 4F7EA 4E2OA 5HJBA 4JFFB 1OM3H 4EI6A 5LCVH 1TZ8A 4BFOA 4JG9A 2VXTL 4FLRA 2JV6A 4YHLH 4LHJB 4RA3A 2KQMA 3WLWD 4XCCL 1TF4A 2YAEA 5E7FA 1CFBA 1CXHA 4MJIE 4BFFA 2DD8L 5DWUL 4AQEA 4P2OB 2ZSVB 4FXGC 1RZJC 3WI9A 1LO2L 4HJTA 4YDJB 1O7DE 3AU0A 3NOIA 4FFYA 2QVMA 2ZWLT 4M6ML 4ES8A 4EIGB 5KJRH 1TTRA 4R4NC 3UTTD 3BOVA 3MRRB 3RLSA 2KZKA 3EOTL 3OKOA 3REVA 3UIYA 3VYNA 1MRFL 2HFEB 3EJTA 3GYRA 5JPMB 5HGGS 3HBGA 3BPOB 4OQ1A 3CGTA 3RDTA 4BXVA 4PVNA 4EPSA 4G8IA 5TK2A 5E94A 4NRXB 3MRGB 3CX2A 4J4PC 3UP6A 3RHWK 2EVJA 4PP1C 5ICZA 1TZIA 1QPPA 3CXHK 3GTNA 4L29A 1A7RL 4K5PA 3VRIB 1PAZA 1VEMA 3WUZA 4PV8B 4AKPA 5IIEA 1YRKA 4BD4A 1DBKL 2P28B 5KJ4A 3QJVB 5FYJU 2XWBA 1AC6A 4RISL 3MRPA 1MFAL 2Y2WA 4JY4B 4XCYB 3UG4A 1U3JA 4H1LG 1W72B 3GSQA 4QRRE 3B6SA 4K2UL 2WK2A 3TT3L 1RP8A 3ZHLA 2X3CA 3FQNA 3ZL1A 5BRZB 2Z4QB 2HVKB 4H88L 1N5YL 2L7UA 3B2MA 4X6BB 1JCKA 2GI0A 5T3XD 1FYTD 2W9EL 2HRGA 4HS3B 2PPDA 3OLGA 2FLRT 4CMMB 3G6AA 3WLBA 1IL1A 1Q0EA 2HG0A 3QS2A 1CE1L 1S9XB 5JTWA 4KJYA 5I2IA 2F0CA 4HK3N 1SBSL 4LLQB 4YHZL 2DS4A 3QJHA 2ZPKH 1DZBA 3UAEA 3NZ8B 2UX7A 1WQVT 1KIQA 3L3IA 1EANA 4LHQB 4KVNH 1TSRA 2KYIA 1N3NB 1CZ8L 4WJ5A 2GY5A 2AQRA 3BVUA 3FSZA 1Q1JL 3RX8A 5GGRA 1UURA 3ZDZB 4GW5B 3I9IA 3DJTA 4Z78A 1TR7A 1PPIA 3KL5A 5E6SB 1JV2B 2NY4B 4UM8B 2E47A 1EA9C 3IRPX 4CL7A 3L4WA 3INOA 3QDAA 3IJYA 4QTIH 4U2ZA 1OW0A 4FKHA 2G5BB 1GGUA 2VN4A 2WBJC 1OGSA 3P0GB 4HJ1A 4EIBA 2E59A 4G43B 1AGFB 3QORD 4F15B 3KPSA 1CE1H 1BF5A 3GXFA 4XP4L 3MV7A 1H5BC 3V4PL 2R0WL 2YBRB 4POZC 2ATAA 2RMNA 2GJZA 1G7QB 1NANI 2KQNA 2ZCLL 1X5HA 1OAKH 5ACZB 3V0AC 2WP3O 3BLPX 5C0AE 2ALAA 5F1OB 4N8CH 3ARRA 1L3NA 3S88L 3JZYA 4I48B 5ES4B 1PZSA 4PCTA 1JPSH 4PS7A 5FA4B 3T4AA 4I13B 3QPQC 2OZ4L 4UNIA 5FYJD 1IMHC 4HC1L 4RGNE 4Z7WB 1UZ8A 3D12B 1QZNA 1NIAA 2QVKA 3FB8A 1Z9MA 3TBYB 5IW1B 4DK3A 3E3QC 4ABUA 1HHKA 4LHUG 1HJCA 1G0XA 4Z7WA 4RDQG 4HSAC 3FT1A 4O2EB 1TZIB 2JXMB 2BMKA 3T6ZA 1CPUA 5L6YL 2YKLL 5E1QA 2PP8A 1NBVL 1B0GA 1SXSA 4MS8C 1D6VL 3QJSB 4BCXA 3C5SA 3IF1A 3D2UB 3QNXA 1BEYH 5SWQB 4P2QD 3UYPB 5GS3A 5ACLA 1BZEA 3W11C 2EUXA 1E5YA 1EFXB 2EDRA 4JKNA 2VSMB 2X28A 3TBTA 3V95A 4HJJH 1A7NH 1SY6H 3MLXH 3O6FD 4YDVA 3ABGA 3ROLB 3UTSD 2HVKA 3SZKC 3TV8A 2YQ3A 3LPPA 4W9LC 2I7SA 3SY0B 3WXWH 5F1SA 4KX9A 3BW9A 4KROC 4Q89A 2DWEA 5IR1B 1OCCB 1DUZA 2PO6D 2VSDA 1BLIA 3IDJB 5DC0A 2CDEB 3ZT6A 1E2VA 5GRVL 5I5JA 2CD0A 4I0PB 2B0SL 4O2CB 1FPTL 4TSAL 4AYFA 5K59F 4ELME 1YNLL 3NH7H 1X9QA 3FFCB 4PV9A 1FNEA 5JLZA 4KK8C 5L4IA 2YMOA 2AJUH 4UNUA 3O2DL 2PTVA 5H37H 2IQ9L 5DJXB 5H2BB 4JDZA 2VERA 5AW9B 3MOQA 3T2QA 3ZE0E 4ODSL 1KCUL 2FEEL 1PJ9A 5DD3L 4WW2B 2Z7YA 4K73A 4JO5A 2EDOA 2ZXCA 3MREB 3A3YB 1MLCA 2X44D 3FCBA 1YMMA 3ECVA 3QW9A 2QT6A 3QAQA 5T5NF 1MRDH 2NUPB 3PREA 4LSRH 5C0DA 4GLRH 1WIPA 1WFUA 3VGAC 1Q9WA 1QTSA 5DK3A 3MJ7A 4DZBB 1G7JB 2AK1H 4Z7WE 4QRQB 2R4SH 3HI1A 1FO0B 2VW7A 4O2FB 5AWNH 5E24E 2B9AA 3WY2A 1HSBB 3II1A 1G1KA 4IGBC 1LTXA 5H94A 1PZ3A 3UAAA 5I6XB 4J8RB 1QO3B 2F08A 2VDMB 3QH3A 2XICA 1TXKA 4RMBA 5C08E 3OB0K 1E4WH 1D5RA 4WWKB 2WQSA 2DMCA 4KI1A 3TJHD 1IFRA 1KZYA 1Q94B 2PXYA 1CFTB 2OMXB 3GMQA 4HMCA 3QYNA 3SO3B 3V79C 1ORSA 5K9OA 4PJIB 3QSKB 4GAYB 2OMNA 4M3HA 4WGVB 4ZO7A 4MNHA 1DVUA 3RY4A 1MVFA 4QNPF 2AQTA 4MJHA 4UQCA 5IFJA 1IGFL 4XX5A 4FQHB 3D2UD 3B2DC 2P24B 4MTMA 1H6UA 5DUJA 5BZWA 4NN5C 4OZGB 1KB9K 3EJQA 3EYSL 5I6XC 3I6LD 1Q9KB 2ADYA 3LZOA 3F85A 4ZTPH 2XQBL 4F8QA 1MWAH 2ZF8A 3QHTC 5DQ9A 5SWZA 1CG9A 1J9CT 1ONQB 5LWYL 5CFAA 3PWNB 1S6NA 2JLPA 5JYLA 3D85B 4D7BA 1Y18B 3MRBB 5DI8A 4HKJA 1YJDL 5IM7B 2BSTB 3ZX1A 3C5ZB 4DVRL 3EOAA 4LSUH 1H5BA 1LYQA 1RULL 4APXB 4TN9A 2OLDA 4U7SA 1I1RA 4JY6B 3TYFB 1WICA 4O51A 2Z9TA 5LQBH 4GKLA 3ULAB 1BMGA 2X5PA 1FAIL 3LHAA 1FC2D 4FYTA 3CMOL 4HU8A 4I89A 4DH2A 4JM0A 5HYQA 3PV6A 1FORH 2CO6B 5D9SB 5GRWA 3ZHKA 2A0LC 3ARPA 4PRIE 5D96B 4EOWH 3CDGB 3MLYH 3NJIA 3QNYA 5EA0L 4AITA 2NTSP 4MAYD 4HF5L 1T20A 2NQ3A 3C8KB 3PDOA 4GRLD 1MY7A 4ZTOH 3VD4A 5IROC 1FNEB 3BYYA 4G11A 3KD4A 2WVVA 4Q6IC 3BGMA 2ZCHL 1JXKA 5LG1A 1AR2A 1OSEA 3B1UA 4BFRA 1T20B 5ENWB 2EH7L 3UL4A 4WEBL 1I3RA 2F6AA 2E6PA 2VITB 4OLYH 5FR3A 3JTSB 1IAIH 2F8VA 2WIMA 2XWJB 3DRQB 5C2BL 3ERXA 4K9EC 4NQDB 3THMH 1QBLL 2RD0A 4ZFOB 2EDXA 4G7SB 1QBMH 4H40A 4UU9A 4XWGL 2NY3C 2DM4A 4JQXC 1FN4A 1SM3H 1NFKA 2C1OB 4ZMWA 3M17B 3VRJB 1G0DA 4JJHA 5I73C 2LTQB 3BP4B 1RIVL 3FMGH 5E8OB 1Z66A 2C4XA 1RURL 2G4EA 4QHPA 1B3IA 3WDIA 2VW6A 1GGYA 5I6MA 1ES0A 3MBXH 1FN4B 4ELKA 4HCFA 2M1KA 3WDJA 1UM5L 2XYCA 2JELH 2YEZB 4S2SB 4W9DC 5FYJH 4CADA 3R4RA 1ADQA 3JV4B 3P3RA 4KKRA 1E8YA 4XZ4A 3MGOB 1X7QB 4H8UA 4TVSa 2A9CA 2DWDA 4ZMVA 3FU6A 4RA0C 3BSZL 1MCRA 4R2GC 2H26B 5KSBE 5CGYC 1F4WH 2ADGA 4L9DA 4IRZL 5C2UB 3KPQA 1KIUA 4ES9A 4KI5F 1CFNB 4MDJB 4LESA 4JG0H 4LEEA 4PQXA 1KXVC 2IDQA 4DKEL 4NYLA 3T0DA 4ALAL 2XDHA 4UANA 2HT2C 3KPRB 3DXAE 1DVSA 2ITFA 3JTBA 1RJZA 1IIIA 5CJ8A 1WVZA 3QQDB 3CFDB 5T1KD 5GJTH 4AZUA 3KGTA 4YPGB 5EOCH 3AACA 5IFHH 1ID2A 4FKEA 4DAGH 3KPRE 1HWGB 4H4NA 3D7PA 3EYVB 2MNWA 5AVRB 3OM3B 3U9UB 2DYRB 5F9JB 1TZHA 2JJUA 2VZOA 4YK4B 4Y5XA 5DHVB 5JQIB 5IVXF 2FSEB 3G6AB 3WLBB 3QJOA 1MJJA 4JRFA 1QWNA 4NJ9L 4RBPH 4J1UA 5D2NB 4QXTB 2ZOWA 3U7YH 1V54B 1YN6A 1A7QH 4Y16B 4AJYV 3DPBA 1E2ZA 1MDTA 1A0QH 4PLJC 2GQHA 1WFMA 5IV2B 1YNTF 5AYQA 1GMEA 1SPDA 2HJKA 4PRDA 5DD6A 3HZVA 2BNRE 4MD4A 3MRQB 3EYSH 1FA4A 1KBKA 4Z9KB 5CGMA 3OV6A 2YJLA 2DW5A 3FPYA 1DLHB 3QHZL 4UM8A 1IB5A 1LMKA 2F15A 5A16A 1WS7A 4F92B 4K8RL 4BQ9A 4DP8X 4AE0A 2L7EA 3NA9H 1NIDA 3RE0A 3ESOA 3NPZB 1PFOA 2C9UA 5F8RC 2V5SA 4JREB 4PD4K 2IG2H 1W16A 1TJHH 2L04A 3OMAB 4IKLA 3SD2A 4TUOA 4F9LA 3SKUD 3CH1A 1WZ1L 4PRPE 4TPRH 3FZUC 3MC0A 1IFGA 4RSYA 3W5NA 3DECA 1WSST 2ALWA 5BO1H 5I1IH 1SMAA 4U49A 5I30H 1CD0A 4RWHA 3UZQB 2VC2L 4PJ7B 2YGOA 3N9GH 3ZLQC 2FWOA 3WKMH 1KPUA 3N50A 2OK0L 5EU7C 3PWJB 1JDDA 3EF7A 4G6ML 5C0CA 1KWKA 1C12A 1IQWL 3PHOA 4DO4A 1AXTL 2XPZA 4UU9B 3S35L 3O3AA 1JZFA 3A23A 3KBEA 4W6YB 3VD1A 4UWQB 4A63A 1EUTA 2BSBA 3G7TA 3WELA 1P6AB 4D9QD 2Q7NA 3L3DA 4HWUA 3P69A 1SDDA 2O6FA 4V1DE 4OIBA 4P2YA 5F9WC 5E2JA 2FECL 5C9JA 3IJSB 2OR9L 1WITA 1A8ZA 2GK0A 2AV7B 2F2HA 2EDNA 3ZKNC 4PSPA 2O5ZL 1T7YA 4FZ8L 1HKFA 5BQ7B 1R5VA 4JDVA 4Y9BA 1TTAA 2D3JA 2IDTA 3CZUB 1G7PA 3O2DH 1Y07A 3FN3A 3RPBA 2ITDA 4C54A 1BFOB 3FT9A 4J3BA 3TL5A 1QKZH 5CZRA 3V6OA 4F7EB 1YY9D 1MHCA 1XD1A 2WXLA 2AAVA 1R3KB 1G7PB 4NHCH 4ZPTB 4A2MA 1U8MB 2JKIS 3RVWD 5I16A 4FMFA 5GRJH 3Q1EA 5CBAA 4RIRB 4OZIE 2ERJB 5T3ZH 3W56A 3ZKND 1CF8H 3SZ6A 4NWUH 4OR1A 4WO4B 3O41B 1IBFA 1OAYL 3L9EA 1FDLH 1PNDA 3H9SA 3RBGA 2WNKA 2OTUB 2QKIC 3PJNA 4ABVA 1KN2H 1UGNA 2EEAA 2IQAA 4K7FA 3REVB 1RQ5A 4PJHE 4CILA 3KWXA 3OPUA 3U7WH 1G7MA 4FMKA 3TWCH 5G5DB 4GSUA 1AZCA 2XG5A 1YPZE 1QTPA 4HUNB 4KY1H 1OE2A 1HZHH 4PCSA 5A1AA 5F6IC 1KCWA 2L7QA 5DTFA 1TMCB 3KM1A 5AW4B 1SUJA 1ZXQA 3QG7L 4OFPA 4W9EC 2WMPB 5LLIC 2VN5A 3O3BA 1BLNB 1G7MB 4AMKL 1T6BX 4UM9B 1QLFA 4WO4C 3L6FA 1QASA 4X7TB 2EVFA 1I7ZB 2ZIDA 1WZAA 4JQVC 1ZVSA 3NSXA 1O9WA 4FQ2L 1AGBA 4Q2ZA 5D2NC 7PCYA 2EUVA 4BZYA 4K5NA 5JNYB 1UACL 3NJHA 4JFFA 1JUFA 4WFEE 4JDZB 2ORBH 1M05B 4QY8B 2A73B 3B37A 5FCSH 2BWIA 2A6JA 1YYLL 2GTZA 2FHCA 2OBGA 4AJWA 1HNGA 3LZNA 4C59B 1RAMA 1EZVY 4HKXA 4WW2A 1H19A 4JLRB 5DYFA 5GISH 5CP7A 3RA7H 4B9YA 3O45B 4UT9H 3W37A 3PGFH 2QQLL 1THCA 4UTCA 5D1QB 4LDCA 5CCHE 3WHXB 2W65B 2OMTA 1MHEB 3HFML 4LCCA 3TCTA 2A83B 1K6QL 2DLFH 2FQEA 3AY2A 4IS6A 5CP7B 5PCYA 4OGXL 5EU6A 4A6YA 5I0YA 4MCYB 3GBMH 4E42A 3AG2B 4NUJB 4FFZA 1YEIH 3D39E 4LLWA 3GIZL 1AS7A 2OAAA 2AK4B 2F9BT 3L7FA 1EAPA 4D0BA 4L1HA 4UAOB 5D7KE 3SE4C 3ARDB 2Q8AL 4PGBA 3TA4D 3PHOB 4LBEB 3HE6C 4KUCF 1B9ZA 2XA8L 4OIFA 5GGVY 3W2DL 1CXLA 2JVUA 2ROXA 1MZYA 4R90H 3R7QA 2DQEL 4UMGA 3IDGB 4FAAB 5DF0A 3IDNA 1Q90A 4X9HA 1GYCA 4YL9A 4MNHB 2A77L 2P8MA 5HVHB 5IB5A 1A25A 3QWRA 4YDIH 1DQLL 1NEZA 2X9YA 5CSZA 2Q6WB 4AEFA 1QRNB 5EUOA 1BQHB 2I5YL 2J43A 2XIBA 3VGFA 3GPEA 2VABA 5CLTA 1E30A 3I3EA 3KLHD 4F1ZA 1MREL 4M8RA 1XIWC 4WFHE 5IVXB 3WIHH 2EDEA 3D69A 3HPLA 4R5VA 5JIQA 1GC1H 1QRNA 1J48A 1NLDL 3U83A 4P4KC 5DCCA 2OMVB 4XAWH 4ZFFA 3PUUA 1SBSH 4JFXA 2NSXA 1VZGA 2R15A 2YC1B 1S5HA 3A6CH 4WWOA 1M71B 3KBPA 3MRKA 4FDWA 4F33B 2BVEA 1I8MA 3EHBB 3X1NA 3F6LA 2QGEA 4QHLB 1Y6NR 4RX4A 4XPHH 3MA9H 3Q2WA 2Q3XA 4JHBA 2HLEB 2OMYB 3MCKA 4XAKE 3HCVB 3V6FB 2YD2A 4RGNB 1K2DA 2E46A 4P4RA 2R29H 4YDJA 2YGNA 5KWYC 4MA1B 4N8VA 4XMLL 1U3HC 2QQNL 5AEAA 1Z5YD 4DQOL 5B39B 2QKIB 4K94H 4RQQA 1T4KB 3WE6B 2P7TB 4RISH 4Y2DD 5KSUB 4NAQA 4FN0A 1LM8V 4WY7H 1ACCA 1X5FA 3N6YA 2H3NB 4Z8FL 1KJ2L 3TASA 2A74B 4RAHA 5E2WL 1CDYA 1GPOH 3ALWA 3HMXH 4IRSA 4XVJL 5H4YA 3H9ZA 4MAYB 4BRVA 1B0GB 3IN2A 4ZO9A 5I66B 2OP4H 1D7FA 4JO3H 4PCKA 2E56A 4YHIA 3QUXD 4TMPA 2Q20A 1I3RB 2WCPA 1AD9B 5KVFE 5CZKA 5G2NA 4F7KA 5FV2A 2B1AL 3FQYA 1RJCA 2H2PD 1K4DA 4AEHL 2FEDD 2CIIA 2DQFA 3N91A 3BUYB 5HI4C 3HC4H 1DBJL 2HRLA 2XT1B 4QMEA 2IH9A 4CMHC 1X7TA 4NM8L 1JMZA 1D9KA 4GEJA 4MMXC 3TCLA 2CGRL 3GRWA 1L9RA 1OLZA 1QFWI 5LQBL 4AG4L 4FG2A 3FTXA 3ECUA 1KPRB 3FN0H 4UT6H 3QQXA 1C16B 1BIHA 1RUMH 5E5MA 1IT9H 4QD2E 1ES0B 4ELKB 3BDXA 1NCTA 2D2CC 2FE0A 2GY7B 4H1LB 4EI5C 1FH2A 3SPIA 3MI6A 1KTLA 1W9XA 3DX4A 5F72S 3O6FA 5DFWH 1S3KH 3AJ7A 1O9ZA 1INDL 1DVQA 2VR9A 4HJ0D 2O61B 4KO6A 3B5HA 2JB6B 3VWKA 4QOKB 2GSGB 1I9RL 5JPNC 2CJUL 3C6LB 3RZCD 5GPRA 4G8GE 4ZUTA 1NOFA 2JWYA 2O5NA 3ISYA 3D3VE 1O6SA 3T0EC 4XMWA 4WW1B 5E2UL 2NZ1A 2YSTA 2EO1A 1HH6B 3GJFB 4EI5B 1NCDL 4LE8A 1MF2H 1U92B 4YXLH 4HIJB 3QO0A 4RSVA 1BCIA 2YPLD 3S5ZA 5A3IC 3F01A 2HYMA 4NKOB 2FLMA 2L8AA 2H32A 3FQRA 3IAQA 4MYPA 5HDRA 3HB3D 4HQQH 3QO0B 2P26A 2WXQA 4OIIL 3S8GB 1U8HA 4UTBL 1IC4L 4G7VL 3D25A 1T5XB 5LNEA 4MMXB 1Z32X 1TJXA 1G94A 5E99L 4BBWA 4HHAB 1L9PA 4IRSD 3VFVB 2Y0SA 3MNWB 1TEGA 3ZZSA 2YGVA 3BH8B 3V0HA 4Y0GA 4UF7C 4GSRA 4K3JH 2GVYA 4L0PB 4P2RA 4TV3A 4QLWA 3ARDD 3WTUA 3W39B 2X4OA 1QQDA 2B5IB 5JIMA 1N8OE 5HY9A 1KLFB 4ETQA 1RUPH 2J8HA 2F7IA 3E6HA 2AJXL 2R0ZH 1BZ8A 2LVCA 3GRWH 5FKPB 2WTOA 5CP3A 2NQCA 4XPAL 3U6XA 1U95A 2D3NA 2IBZX 5C0EB 3QJUB 5B3JE 4F91B 4L1TA 4NM4L 3AQDA 3KCPA 5I9QB 1GGBH 4MMZC 3KPPB 3BVVA 5I76B 1KZQA 2NOYA 2R23B 4MCZB 4ODVL 5FHAL 1OP5K 4PTTA 1C8PA 3KR3H 1GS7A 3HHSB 1S46A 4OCRH 3BFQG 1XR8A 5C0BA 5DHEA 4AQZA 4PJ8A 2R23A 5EU6E 4F37K 4OI7A 1F2XK 3U7AA 3WJJC 1Q94A 2ARJQ 1OCWH 4BFGA 2ICEC 5T1KB 3T0BA 4FMVA 1DN2A 4U1SB 2CO6A 3MROA 3T0ED 1MCFA 4Y5YA 5D55A 2WLIB 2AV7A 3ZZLA 4XP6H 4QTFA 4NKIH 3TJPA 1AQMA 2APSA 3S9DB 3OX8A 2AABL 5CEZE 5JHLH 5ADPL 3JBG7 2IFFL 3IKKA 3X12B 4KX8A 1I8LC 4U1KB 3PQYA 5L7XL 1HT6A 2AJYH 1WZKA 3KWVA 4YN3A 5IMMA 2B77A 1KYOJ 1WPCA 2VW4A 3LNEA 1F58H 1XGTB 3FTGA 5FS5A 2NTFB 1UFGA 1RJLB 2JXMA 1SVBA 1I1FA 2KDGA 1BREA 2HAZA 4AVHA 1EBPA 1WC7A 3GRBA 5CJXC 3BPNB 3U30B 3MJ8A 1X3DA 4IU2B 1A6PA 3B83A 4J39A 4TSCH 1JZ3A 1ZIAA 4URTB 1TYEB 5EPMA 5FYJL 5HI3C 3ASNB 43C9B 3K2MC 4RMQA 5ALCL 3WLWC 1TU2A 4F57H 4NXKA 1WO2A 5C0RH 3TA3B 2FB4H 1LMIA 4J3TA 1RIVH 2YEZA 3FMGL 1ND0B 1J8RA 1AANA 1GAFH 3PV6B 4HIHA 1ASQA 3KW7A 1U9KA 4QKTA 2EIKB 4P2QA 2BXYA 5MEPB 4ORGB 2VXVL 3US0A 2DWEB 2WXRA 5F9DC 2ZT9C 4P2OD 5AD0A 3BZ4A 2VDLH 5ERWA 2D8KA 3MZTA 4U3CA 1JZHA 3BAKA 4WHYH 2AITA 2ZOTA 1QO3A 5SX5K 5KBPA 2N59A 3RG1C 5E6YA 2GPZA 3GXIA 1RFDH 3AB0B 3LZFH 1T0MB 2DPKA 4GQZA 1ZLSH 1NINA 2IAAC 2VITA 4M43H 2R0KL 4PWEA 5AVWB 5B1JA 3ARZA 1NGQH 4DO5A 4JJ5B 2MIZA 2YXMA 3JWNE 5KVDL 1EDYA 5D2LA 1UOVA 2NY5L 2Q3AA 1EVUA 2XN9D 1B2WL 1XCTB 3HOGA 3OC8A 3FQXA 5J4MA 4MD0A 5DC9B 1S4IA 4CMHB 4EI5D 1FVCA 3V4VB 1BBDL 4EOWL 4OZGA 2A83A 4DFHA 3L1OL 3MU3A 4A6YL 4BCZA 1IO4C 3M1CA 3DYMA 2GJ6A 1TIUA 4Q9BA 1FNSL 2ODHA 4L8SB 3B8SA 3CH8A 1FAIH 4FERA 4HCRH 2FVNA 4XO9A 5CZVL 3QZMA 3OJDA 1PFCA 5EHFA 3ZQ9A 5E9DE 4XNUL 4RMSA 3CBJB 4GAAA 2GBAA 2R2BA 4O2FA 3U4EB 1IM3A 5IMLB 2E0PA 1UOKA 4IIQB 3LZQA 4LT7A 4N1EA 1SJEB 2P43B 4M61B 5LXGL 3F58H 3AU1B 1TITA 4O51B 3EYUH 2VRAA 5AAMA 5I1AB 5JW4R 4JRXD 2HJLB 1UHVA 4KHXH 2Y6SC 3K7UA 4B9PA 2X4TB 4E9XA 4QCIB 5CO1A 3LKPA 1KN4L 4M1CC 1DBAL 2BZCA 4HEME 3B3BA 4J27A 2F54D 4L5FL 3C60B 4KC3B 5IMOA 3RFRA 1EHLH 3UPRA 3TEUA 4FXKB 4G5ZH 4OZHE 1ZHLA 2AVGA 2D2OA 4WGKA 2YLHA 1L0PA 4JHWL 2KI6A 3BVXA 3SCMC 2D7TL 4R0LB 1V7MH 1CICD 3FONB 3FT2B 5HDWA 4ZQKB 5FWRA 5TE6H 4B7LA 1XGTA 4DOHB 4KKNA 3ZKMD 2XTJC 3UMTA 4FP8L 1F1GA 3LDBC 4GQRA 4DP9X 2IOMA 1AIFB 1M6OB 1ZS8B 1GY2A 3R4DA 1N26A 2Y1ZA 3TJHC 3H2QA 1UA6L 2V17L 5IHUL 1Z9PA 2RA1A 3KL3A 4HH9B 5INCA 1XGQA 2W8CA 1YYMH 3ZDWA 5GSRB 3LD8B 2BJML 4QKXB 5AWNL 5EDSA 3VI3B 1WEJL 3FUJA 1A7OH 3CK0L 2XBDA 3U30C 1PEZA 1MSPA 3AFLA 2WUBL 5EO0B 4MZ3A 1UG9A 4ZNEA 5KSUA 2VDRH 2DAVA 4K3EL 4WTWA 2I27N 4F2ME 1A9EB 4X99B 2VLRA 3WFDH 4ANVA 5DFAA 1JJUA 1YUHA 1MELA 1BJ1J 3JWDL 1I3VA 3BUBA 1EXGA 3FO2B 3L5IA 1JE6A 3IJYB 3ENEA 3FOLA 1JPFB 3PU7A 5CHNB 4ZW6A 4I9WE 4JZJB 4X5XB 4Q58C 1BF2A 4MMZB 3T2PA 4FRWA 3BAYA 1FFPB 2F1AA 3CXFA 3L2LA 4Q7DA 3FAXA 4NQUA 3G04A 3QEUA 3F7KA 3OKYA 3OZKA 4TUJA 3BUPA 4PJEA 1SHMA 2Y5EA 4LLYA 2UZPA 4HDIA 5INDA 1ZLUH 1S9WB 5J6HA 5KYXB 1PZCA 1BVZA 3B2VH 1CUOA 1IGIH 3G04B 3K8MA 3N1MC 5EFIA 4ZI8A 1U41A 2GSMB 5FIEA 1IBDA 5IG7A 5GGVL 2V7HA 4LQFL 5J06A 4HMDA 3WD5L 1JPGA 2BFVL 5DHVH 2WKLA 1OGTB 2QPEB 5DD5H 5ICXA 2A9AA 2W95A 5TE7L 3C2SA 1QLFB 3UO1L 2XQYA 2ZX5A 3B7TA 3O6FB 4WK2B 1KTLB 2G60H 3NRQA 3LRSB 1JWUB 4LKCA 4P5RA 3RWDB 1PQZA 3VM7A 1JVOA 1QMUA 4AQ1C 1OSZB 1J1OH 1FIEA 4HBCH 1DQDL 2YPVH 3SDDA 5JW3L 5KSBF 3RWDA 3CSPA 1X5XA 3WFDL 1BVNT 4IU3A 4PJ9A 4ZUWB 2JCCB 1YC7A 4FEIA 2HTLC 2OMBA 4HUMB 4GBXB 4ZXBB 5CGTA 2WKOA 3TZVC 1A6UH 3WN6A 5LN8A 3B9KA 2H6UA 2Y07L 4YXKL 2GJJA 2QHRH 1KNOA 2ZXQA 1KEMH 1KBVA 4L8BB 4BEIA 2B5IC 1QHQA 2MMXA 3FQRB 4LB8A 1AHKA 1BYOA 3RNKA 2R1WA 5ALBH 1BYNA 2IH1B 4NAMA 2EC8A 4JVPA 2BNQA 3DYOA 2R4RL 2X2HA 2O1AA 4PJAE 2W60B 4WI7A 4NQSA 1TZAA 1ZXKA 3GBLA 3MV9D 3VGGA 3ARDA 2EZ0D 1GGTA 2DV6A 2HG5B 4OVUA 4OKVB 4Z3GA 4WDIA 1KIRA 2QADD 4F58H 5DHYB 15C8H 4X7DC 3ZDXF 2HLAB 3IDGA 1Y1UA 5C9KA 1A1NA 4FQLL 1QI3A 4D8OA 1NL0L 1DN0A 2UZXB 5H4ZA 3KDPB 1NMBH 1QHPA 2LU7A 3KPLB 4XP9L 3GXUB 2CBQA 1PEWA 3UJTL 2PYED 5C0EA 2AEQH 4BK5A 4P4KD 5CJQL 4DO6A 4Q6IA 5CNHA 5D1QA 3FCGA 3ARFC 2PYEA 4OCSL 1YECL 3HKFA 4A6YB 1UT2A 4N90E 4ERSH 1E7UA 4KVCL 5AYTA 4GG6A 3IU4H 5F3HA 4PJFF 3QI9A 2ZKHL 2R0LH 1MHCB 3TGXA 2BW4A 3OHMB 1KJ2A 4GG6E 2XN2A 4H1LH 5FEBA 3CFKA 4A2GA 3HS8A 3ZKQD 3HLAB 2NNAA 4ODHH 1B90A 4YR6A 4QXUL 1RZJH 2RHEA 3F6JA 1TEYA 4MJ5A 3CHXA 4GSQA 1A3RH 1ZHBA 4N0CC 4MA7L 3BD3A 3RTQC 4F7CB 1F6AA 3H4FA 3R19A 2FHBA 3SHSA 4Z3JA 4OJAA 4EN2A 2OXHB 2VZVA 1FIGL 4ZOCA 1HQRB 1J8HB 3MROB 4KRMB 4MSWB 4UCFA 1LD9A 1F1AA 2XWXA 1IRAY 4LPVA 3UAFA 4A7SA 1HL4A 4N9OB 3DVFA 4LIQL 4L2YA 5IQMA 3SO5A 2KHAA 3QUXC 3B2PA 4PEEA 5DTFB 4C55A 2CBOA 5HDQH 1QNZH 2AJVL 4N2DA 4NI3A 1E9PA 1GYWA 4WWID 2ENSA 1DL7H 1JI1A 1GZQA 3CFCH 4L3CB 1HI6B 3GO1H 4FFWD 4AIEA 1INQA 1FNAA 4IKKA 5D7IA 3UZEC 2W0PA 2PPCA 4HGKC 3UG3A 5GS0C 2UYLB 2FWLB 4JG1L 3BUIA 3WE1A 2WXHA 1MN4A 1B4JL 3HC0A 3L5XL 3CDCA 3VGBA 4HJIA 5ISZE 3BQUC 3FSVA 1NCBL 5FGRA 4NSKA 3DVIA 5CZXD 2CLVA 4RDQF 4UQ3A 1HOEA 3VFPB 3DA0A 3IRZA 4FFZH 5E8NA 4M8VA 4H0IA 4NKMB 3SGKA 1XAKA 1L7TH 4JFTA 5MEOB 2X70B 3IXAB 4Z95L 5LCVA 2R2CA 3A4EA 3CQPA 4IMKA 4HKXB 2O4EA 5HJ3B 4BV1A 4DW2L 2VDMH 3HNTH 5ID1B 3RL1B 5JMRA 4I1PA 2Y06H 1QW9A 3ASOB 2ZF9A 4OSUH 4PB9L 4ONHB 4ETYA 3CFIC 3NIDE 4OJFL 2WBJA 1G7LA 3TOPA 3VTAA 1T1ZA 5DC2A 2XCMC 4WHCA 4JGNA 1HSAB 3D9AL 4AM0B 3ME0A 4HAKA 3CC5B 4OF5A 1ICTA 2BVTA 5T5FL 2CJTA 3RIFF 3LKOB 3TU6A 4CU6A 4L4TE 1HZLA 3BWSA 5E1AA 4YPJA 2JB6A 1JAEA 3ECWA 3SJVE 4LARH 1CF1A 3M7OA 1EAOA 4D0BB 4AEIH 2BOLA 4DTGH 3CLFL 3F83A 4X5RA 2A6KA 4CC0A 4HUVB 1T83C 4YHLL 4ZSOE 5DJZA 4HFUL 1OP4A 4LBEA 5IQOA 1MFDL 2CJSA 2UX6A 1JYVA 3U36B 1YEEH 3F00A 1S7SB 4YHNA 1FBIL 2CDGA 3FHAA 4OCXL 1L7IL 1ANUA 3IAGC 1JN6B 3SPVB 2HB0A 5J9PB 2A9NH 4PJGA 5C97A 1MIEH 1FVCB 1ZJBA 1LWHA 3V4VA 2CO4A 3CHQA 2RTTA 3EJSA 5L2JA 3CLEL 3LS4L 1S7UA 1H3PH 3GZKA 4N5ED 4PJFE 1YEKL 1FVEA 4KITB 1U8IA 3OKEA 5FKAB 4LPTA 3RWJB 5EDXA 1S3RA 5AKRA 4R97B 4K71B 1OY3B 1YQVL 3PCYA 3S5YA 2VLRE 2X87A 5I6LA 1EZLA 1RL1A 3LKSB 4IS6B 4FC3E 5DUBA 3AXLB 1G9NC 3DNKA 3IGUA 3MA7A 3D1MC 3S37H 2DTMH 4AT6A 2B1HL 1PLAA 4NQCE 5T5NG 4B9FA 3WGUB 1DVXA 4JRWA 3BT0A 2APVA 3LKNA 3O2VH 3L16A 5DK0B 4AM0Q 4L23A 1MCKA 2X4SB 4XGZB 2Y5TA 4GRWF 3L95A 4H26A 2QADB 5GHWH 2WY3B 3CJJA 4L05A 4XNQB 3QARA 3QAZC 5DFVD 1AGEA 4HCGA 5C6WH 4ZAKD 3X3FH 1WCQA 2NY7L 4OFIA 3GBNL 1FYTB 4BHUA 1K2DB 4P4RB 5EN3A 3AT9A 5BV7B 5GS0L 2QVIA 3CDFA 4U6TA 3FO9B 4HXBL 3NRFA 3T3ME 5F70A 1E8ZA 5I24A 4XC3H 1K5NA 1C5BL 4S1DC 4U1JA 4Y4FA 4XMTA 4MVBD 2UZIH 1S8DA 2O5XL 3RGHA 3KYNA 4Z7NF 2R2EB 4TLUA 5I8KH 4UDTA 3VE0B 2V4LA 4BINA 3GBNH 3LPOA 3WNLA 1TQCC 5TTRA 1NMCB 1BFVH 4AQ1A 1HEZB 2KDYA 3VNZA 4HZ1A 2FO4B 1AMXA 4GS7B 3DX8A 4ZSOA 3HPLB 3BKJL 1S9YB 3VD2A 1MCWW 5E6IB 1CU4H 3RKPA 1HHHA 4YE4H 4HEPA 3KLQA 4RESB 1O7SA 3CXHJ 3UTSE 1P7KA 4N0UA 3DO7A 1OARL 2CIIB 3BX7C 5IQNA 2EUZA 2UWEF 2ZCKL 4FYSA 2OTWB 2EE3A 4JPWH 3GWJA 1FFRA 2WQVA 2WW8A 5E23A 3CHSA 4IOSA 4N9GA 1O6VA 4H8WL 4DPCX 5IW1A 2YD6A 1AKJB 1OP9A 4XBPA 3HI5H 5D72L 5KEZA 2XZCL 3OKOB 5C7XL 3GMPB 2AK4E 3VXPA 1AQKH 2A9NL 3GLDA 1O7DC 4U31A 1RHFA 2R69H 2P7TA 1A6WH 1P7QD 2PWHA 1A5FH 1TG8A 2OCFD 2Y6SD 4G9FB 3V9EA 3IF1B 3QNXB 1AXSA 3HZYB 2OYKA 1T6WA 3ISRA 4NKQB 2BNUB 4IOIB 5D1QE 1TTCA 4TUOB 4WF7A 1NC2A 4FA7B 1IGCH 2H8PA 5AG9A 5DMYA 3DROA 3FU8A 2XVGA 3L9BA 5IZ7A 1D5BB 2X2YA 3H4HA 5DRXB 4ELMF 5HD8D 2Z31C 4FQ1L 2IADA 2DYPA 4NFDA 4AZ8A 3QUKB 2F54B 1IAII 2YSSA 1OTUC 2YWYA 3VMNA 4HIJA 2YWZA 3CSTA 4MA8H 1ZANL 4FG6C 1NSNH 1OAZH 3FOMA 3WIIL 3SDXE 4LCWD 4GXVL 3QJQB 3HC4L 5IB3B 3KYOA 1BJ8A 4LOFA 5A7BA 1U30A 2ZTBA 3INUH 3UYOD 3TTYA 1T1WB 3LEYL 3LKSA 4OM0L 1UZ6F 2A99A 4OZ4A 4KJYB 5FF6A 2C9QA 3FZUD 3WMPA 3GSOA 4H5SB 4UQIM 2WTPA 4RBPK 5DO2C 3BISA 3I75B 3NIDB 3KYKH 1JGEA 3PFUA 1FJ1B 3P2DA 3OHXB 4NNPH 1PD0A 1ZHNB 4U4BA 1CFVH 3CN1A 1X5YA 4KHTL 5E2TL 4AGLA 1JZ8A 1J5IA 1BZ9B 4X9IA 4FOMA 3IKCB 2CKBA 1QA9B 1FG9C 1W0WA 5EO9B 3UMNA 2IAMD 3K6FA 4OLZL 3LZRA 4WV1C 4E9RA 2DJ4A 2WWKO 5HDQL 2R29L 3HJEA 5KVGH 5ISZB 5DR5H 4OFDA 1RK0A 4OKDA 3E8VA 2EEXA 2V2XB 5HVGB 1KBBA 1ZEAL 1E4XI 3GSUA 2E27L 4PJ5E 5BVPH 1CDIA 3MLZL 4B96A 5IHWA 3RNKB 1TZGL 5E6IC 5I1EH 4YSDA 4N22A 4W9CC 4EZKA 2D03H 4WUUB 4EBQL 1MEXH 3T2OA 1ZT4B 3KPPA 3AQZA 4V1DA 5B1AB 5E9AA 4U6XA 3QFJB 1NGYA 1DEDA 1RU9L 5T3XE 4KKAC 3ZMNA 2ZG1A 3VRIA 3MLTA 4K7PX 3PWPE 4V1DB 4QXVA 1NEUA 1A1MB 2G0KA 3P0VH 1AZRA 2ZWZA 1LK2B 3DIVA 1DLFH 2QGCA 3LH2L 4QRPD 3WKQA 3VGHA 3GJEA 1IC1A 2FT6A 1JYNA 2PR9A 1EHAA 4TNWF 5LN4A 3HG0A 4FCAA 4QTHB 1JZ2A 1YSOA 3LZPA 3QXWA 5E6ZA 5T33L 4P4KA 3JV5A 2IIJA 3JVGA 4KO9A 1K8DB 3D51A 3VXPB 2QQKH 1KELH 3IPFA 2OL3H 4K9JA 3ZDYB 2EVGA 2VDQH 4P4KB 5MEND 1F1DA 4PMEA 2H9GA 3G6JB 3GMOB 3L9RB 4KK8D 4Z7UA 5C0AD 3DMMC 4ZYKB 4GMTL 2VDNL 2X4RA 3EOAB 3ARFA 3EBGA 1OOAA 3V6OC 1TMQA 3ATAA 2AP2A 1AIFA 3HRZA 3MV9A 1TPXB 3RHWF 3KS0H 4A38A 4YR6B 3QDGB 4EKXA 5FECB 5HHOB 4JO8A 4UQ2A 1BD2A 2APTA 1W6WA 2WIIA 4L1DA 4XO8A 2YD8A 5E4OA 4WNQB 3WNOA 1BXVA 3P4MA 2EABA 5GGRB 3QK0A 4XMKL 1I8AA 3ML8A 4IQHA 5FHBL 4CSZA 2QQLH 1M2VA 4LSSH 5DVMA 4LSPH 4KTDL 2DJUA 3Q8BA 4JVWA 2AC0A 1KPVB 2ZUTA 3PABB 4FFTA 3C60A 3GM8A 2ADIB 3V5DB 1AACA 1T66D 3IFLH 3KS0J 2Q8BL 1B2YA 3KLDA 5FGBA 2NRDA 3C5ZD 5E5LA 5FYKD 2EIZA 1C5DB 1KCRH 1JPFA 4RGND 3NZUA 3C09C 3X1FA 5JZ7C 1CFSB 5ISZD 2ENPA 1NCJA 1RZKH 3KDMB 5KW9H 2EE0A 4Z0BL 3UACA 3VD0A 1JK8B 3ECBB 1ODUA 3HUJB 4DERA 1CFSA 2NW3B 4WKZA 4KK9D 5TH2B 5DZPA 3HN3A 4H0LC 2JCCE 3ULVE 3SJVA 3BAEH 1CLZL 5BCAA 2AQ1A 1WAAA 2ED8A 3DURB 2AV1B 2N56A 4QHNA 3ML9A 3Q6GH 3T3PE 3AC0A 3FBKA 1N5AB 4AW7A 5DA4A 2C8NA 4CW1B 3HNSH 3NFPB 3CN3A 4FI6A 1T1ZB 4U6VL 3GMNB 4HPOL 3QCVH 1WFJA 3T08A 1BQRA 3P9LB 2X4QB 2TAAA 5DJYA 2ICWJ 3N40F 1MJ7L 1S7XA 4CW1A 1Q9LB 3HS0B 5L88H 1SMOA 3P30H 4UQDA 4YZFF 2WJ7A 2J1ZA 2RR3A 2E8ZA 3NABL 4PJXB 1A9VA 2X4QA 2V8MA 4X4YB 4FXLA 4R4BA 1KFAL 4NO0D 3TXAA 4AH2A 3FOLB 1FO0L 1I85A 5AW2B 1LDSA 4NFBA 3RVXD 1ILUA 3CBKB 3N1GC 4D3CH 3IGFA 3AU1A 3R1GH 2JCWA 4L48A 2JKLA 5E8PA 3B7RL 4X7SL 3WIAA 4JFOA 1R17A 3LMJH 5C71A 2BRRL 3WUWG 2EDFA 4TQHA 3SPVA 3GTVA 4KZ0A 3ARBC 4X6DF 4G6FB 3SY0A 5LDSA 5F9JA 3MODH 3V4PB 4KXCA 1NC4A 2AZAA 3PS6A 4MDIA 3FRUB 4XCFL 3SDXF 5B4MC 1UXSA 2XJLA 3NVQA 1WTGT 2J4WH 2F58L 4X6BA 3A6BH 3ZVVA 3TCLB 3SE3C 1MI5E 4Z7QB 1EHNA 2H41A 1J88A 4HS8H 4BZ2H 4FQQA 3TIEB 4X7EC 1KGUA 3TJEH 1YEFH 1AXIB 4U6YB 2SEBB 5EZJB 4PUBL 1FF5A 2WYTA 4Z3HA 4BUGA 2H2PC 4R9HA 1BAGA 4D9LH 3IRCA 4CVXA 1N3NA 5T1LD 3NA9L 3MN8A 5EH1A 5L2KA 2JJVA 3E8UL 2F8IA 2YN3A 4KK5D 3LTVA 2BP3A 3M7FB 3OZLA 1FLRL 2EECA 3NIDF 1NPJA 1XH0A 2AS5M 1GJIA 1QR1B 4IJ3B 1R5WA 2CHXA 2DKMA 3H3PL 1QG3A 1MCSA 4A7GF 1JGLH 1YUHB 2Y7NA 5CLXA 5J11C 1S9VA 1X6NA 4G80A 3ETBJ 5DEZA 4PJ7A 2IC2A 2ED9A 4YH6A 5IP4A 2EINB 2J56A 5DMKA 4M8QA 4MXWL 5ENWA 4P8QA 3T6XA 3QRLA 5C0NC 2X4PB 3RQ3A 4OI8A 4ZPVA 1Z3RA 2OXGB 3BPLB 3VG0H 2WXKA 1UEYA 3QBTB 4XMUA 2AQ3A 4XNUH 4PBWD 4S1SH 3ZYIA 3G3LA 4NX0A 5K9KB 1RVFL 1VJSA 1ZE3H 4GQPH 4C47A 4HCRL 2MCMA 2BNRD 3R06A 3ZR6A 1GHFH 1YN7B 3EO1A 3WEOA 5K1NA 3D08A 4P5SA 3Q43A 2FBJH 2FHFA 3LQZB 3JUZA 1AKPA 4NNYA 1JMXA 5E6RB 1WA0X 5FHBH 3ZPDA 1URIA 4ZT1A 1BFOA 1RP9A 2WYZA 3Q2VA 3FUIA 4BQBA 3MLRH 2CRZA 3HG1A 1P6FA 4Y8DC 4A2FA 1A4KB 3Q6FB 5I8CA 2VL4A 3VDCA 3HZYA 1AH1A 4GAFB 3N41F 4NN5B 1H5BB 1SHXA 2ED7A 3CMGA 4PWKA 3RU8L 3DSNA 3PP4L 1JK9B 3JTTA 3KPSB 2Y3NA 1EHKB 5KSAD 3BC9A 3L9YA 1I4FB 3MOAL 5HHVH 1MAKA 2OTUA 3SDAD 1KG0B 4M5ZH 1IQDB 1FZOA 4XR8C 1OSPH 4PS4H 4WWPA 1MJUH 2H0PA 1NM9A 2HFTA 4HT1L 5E4EB 5C09D 3T65B 1I4FA 4N6RA 5FDWB 2CK2A 4TYUA 2NUTA 4B9IA 4XCEB 2M2DA 3FFCE 4JQIH 1HQRA 4A7TA 1IC7L 3BGAA 2CUAA 4FZEH 4KKBD 5IB3A 5DDHB 3RZWA 4K9EH 4FFVC 3T8XA 1H9VA 3LXUX 2R1WB 1DJXA 1IE5A 1D2OA 3O6ML 3H42H 2IH1A 1QPKA 1NCHA 3LDBB 1CVRA 2IMNA 2IPTH 5TJWK 1AGBB 1N0LA 4NZTH 4Q2ZB 1G9MC 2B2XL 3K3QA 1ZSDB 4CU8A 1QUPA 2GIYA 4BCYA 3MRCA 1FE8H 3C6SA 3PQYD 3K5RA 2WPGA 5EBMA 3X12A 3VXME 5DQJA 1MEXL 1JNLH 1FZJB 5JDSA 4GINA 1H9DA 4CJ0A 4M5YL 4X4KA 4XHJC 2X70A 4UIKH 3P77B 2CCWA 1GOGA 3M17A 1ZTXH 4HK3J 2A4CA 4RMVA 4XPTL 3O9WB 3S2AA 2FT8A 5DT1L 5K9QG 1A5FL 2PCFB 3O11A 3FU3A 2C3VA 1ASPA 5AKSA 3A67H 4Y1TA 2DQJL 3WS6A 4EDWH 3EYQC 1PG7X 2R56H 2YAQA 4Y2DC 2E6QA 5I6PA 3I6GA 1V3MA 2ARJA 4OLWL 2Y4SA 5LGKA 4JY5H 3ARWA 2OZNA 3MV11 1PZUB 3QC6X 2IV8A 4AJ0A 2W60A 4EVNB 1E9OB 1U2YA 4L9LB 4PREB 1N6QL 4AYFB 3CSGA 3JV0A 1E28B 5F71A 5BZZA 1Y6KR 3ET9F 3GD1C 4J6IA 1TNMA 4XNXH 4JM2A 1A6VH 3L2MA 4DSYA 4OCYL 1BWMA 4RRPG 1HL8A 1VFMA 5KTEL 4TSBH 2FYVA 2Z6FA 4WW2C 1ZANH 5J9PA 2Z1PA 2GK0B 2R2EA 2SODB 2HH0L 4LU5L 4HS6B 1D2PA 2UVFA 3F7VA 4EUPH 1G1YA 2YMXH 3CBRA 2JI2A 1NC4D 3LEXA 5D2NA 2Z91A 5GSVA 4JZNB 3NT0A 2BOCA 5AUMA 4G6AC 4UZSA 1OP3K 2PYEB 1JK9A 3JTTB 1B0WA 4OB5H 4UT7L 2EXYC 1YNKL 2J5LB 3CX5K 1N0XH 3L4YA 3ZY7A 4JZNA 2QLYA 2QMJA 3EOYG 3NN8B 4R3SB 3OKKA 5BUPA 1UWEH 4YHMH 2X09A 4J7RA 1L0YA 5J8OA 5DVLA 1QEWB 4H0GA 4EDXA 2WZ5A 4B9KC 3QUZD 3DBSA 4EQ2A 3PWLA 5IUCA 2PETA 3RVUC 1BGXL 4U1GC 2G75B 3T3MB 1SVCP 4N6QA 4ONHA 3KVPA 3JSSA 1N59B 4R2GB 3S37L 5HYQB 2EXTA 4ODSH 3MJ9A 2H3NA 2YBGA 3L48A 1YQVH 1OPOA 4YXLL 1F00I 4NQEB 2V9RA 3DSFL 1TQSA 3VFNB 5ADOL 1DEEB 3GK8H 4C4UA 1HEJC 5DSCB 4Y2LA 3LNFA 2V2WA 1FL6B 3PG2A 2AXWA 1IAOB 2VTFA 1GGIH 2VKWA 4LPWA 1CLYH 2ZUSA 3QWOA 1MHPL 4QT5B 5D7IB 5FO9A 3ULSA 4HULB 2NW3A 2P45B 1M05A 1NAML 3IN0A 2HLFD 3NJXA 1J5OH 4UTAL 5I8OH 3UTPD 3EXLA 2BIIA 2JI3A 2DOCA 2C4FT 4U1MA 3ALPA 3V4UL 1QW8A 4ZFOA 3ZZ1A 2YAFA 3QO1A 1GCYA 5E08H 4ZOBA 2B8OT 3FQ4A 2F68X 2C7UB 2CO7A 1BOGB 2E7CA 3MRMA 3QCTL 1A65A 4X6CF 5SWSD 5TQ2L 4LCCB 4PSRA 2ZXEB 3RDJA 4CRPA 3O6KH 3TO4B 5DD1H 3RL2B 3C60D 3QULA 4XB3A 3HR6A 3AY4A 3KPSE 1JGUH 3K71A 1LWRA 1I8KB 1OGAA 4JJOA 1VCBC 1C5CL 1HILB 2NLJB 3I75A 3O4LA 4KV5E 2WXFA 4HIIB 3TO4A 5AQ0A 5IVZB 3RAJH 1P4IL 1W72L 2ADJB 4Y9CA 1GJWA 3K71B 1AP2A 1DQKA 3QDGD 3N44F 5SWZE 1KXQA 4TNVF 2CUHA 2ADGB 3DX1A 5AOZA 1KB5L 4X50A 3FAWA 3NP4A 4XE0A 3GF8A 2XXCB 1KYAA 3Q8CA 3QZOA 4K7PY 3QPXH 3S35X 1QACA 4JPQA 1YDPA 1UENA 1UADC 2X3AA 1KTDA 2FATL 5I28A 2DYPB 3VH8A 3GSUB 3CFUA 4LIQE 4JFFE 3W57A 3HE6D 5D6DC 2H1LM 4YDVB 1JPSL 3ZE0F 1A6AB 1XF2B 4HMEA 3SGKC 4BK4A 3A67L 1L7IH 5E4IA 3GSQB 1JFQH 3BW9B 3U0PA 2R56L 3D0VB 4XNZB 1M56B 4ZAKA 5C6PB 3S5LB 1V55B 4QRBA 5DEFB 3RUGA 5FF6B 2E7HA 3SQOL 3QJXA 3ZIYA 3BJLA 3IMRA 1UWFA 4DTGL 5AAWA 3N44B 1K4CB 4FTVA 3MJWA 4MQXC 2V3EA 1CL7L 1T2JA 1N4XH 2WTRA 3OSKA 4KK9C 2JIXB 4LPCA 4NQXB 5AFAA 2ZSWB 2B20A 1PX4A 4ZX4A 2BDNL 3RI5F 3SDDC 1BSIA 2WTRB 3LIZL 2YPLE 3G5WA 3K6IA 4PLKC 3OMNB 2JJWA 3P3TA 2VDNB 4EZMA 4O5LL 5M94B 2VH5H 4NPYB 1OZUA 4NZTL 3WEXA 2NY6C 4AX3A 1NGPL 1X5JA 1X5IA 1BJMA 5AVTB 2D0HA 1I1AD 3ULUH 4BZ1L 1RPUA 4OCSH 3F6IA 3BWAA 1V7NH 3MFFA 5DRNB 2BY0A 4U1JB 2VM3A 1XGRA 2ZD0A 1UKQA 2GT9A 1CR9H 5AAPA 2IAMA 5JXEC 3SBWA 3FTUA 3CTTA 3SBQA 1EZSA 4MWFB 3BO8B 3VFWB 4ADIA 1CD9B 1RK7A 1BXAA 1H3UA 2PR4L 3KLAA 4L3AA 1UH4A 3F62A 2QSCL 2XVBA 3ASWA 2ZKXA 4HXAH 3UTTB 2D0FA 1ZVNA 2LW3A 3T3PF 3MAWA 3HE6A 1FYHB 2HLAA 1PCXA 2DZEA 3IJ7A 4QTHA 1U8OB 2AJZB 3ZMRA 4GMSH 4JFEA 4HWNA 1AC0A 3RGVD 1R24B 3LQAL 1IU1A 4PRHE 1PF3A 3F7YA 4BGDA 5KOMC 4G1MA 2NNCA 2OMZB 2UZYA 1T04B 2E9GA 1EO7A 3JV6B 3DDFA 4W9HC 3V9CA 4M4RB 3ZE2F 2HKHL 3IU3B 5IJVB 1GHFL 4ANKA 4HJ0C 1H8OA 4MB3A 1KTRL 3L3KA 4E5XG 4X0KA 1H3VA 3BEWB 4I0KA 3UC2A 3EH3B 3RTQD 1NBYA 1FG2B 3FB6B 5IF0A 4XI5D 2PN5A 1SOQA 4XB8A 2HJFB 4NHUA 5HHXH 5SX4H 3QP3A 4D0DA 1H3TA 3GMMA 3APNA 3HG2A 1VF5C 1MRFH 4FLOA 4F7TA 2O6PA 1CLVA 1E4XL 3A21A 3EUDA 1IVTA 1L4IA 1YMME 3CN2A 4HWZA 3DLQR 4JY6A 3TYFA 1JIBA 4JZJC 5SWQA 4CSTA 3VA6A 4I3SL 2ZX9A 1LNUB 5BOZG 3LPWA 1JVLA 3CZGA 2CA4A 3PABA 2WUCH 5EU3A 4Q97A 1F4HA 1OVZA 1G7HA 2W0KA 4WENB 4IOSD 5CUSH 4AH2B 1MCJA 1C08A 4X4MA 3NJLA 3OB0H 3I6SA 4MDRA 3JWOL 1MJ7H 4PJ8C 3CD4A 3G08B 4ONGL 5D4QA 1AS8A 2ITDB 4DGYH 3MO1A 4LVNB 5EZOL 2EIDA 3R8BB 3WNKA 4XNMB 5K93A 3EO9L 4D9LL 1MLBB 4Q74A 3UADA 3TYGL 3FL7A 3GSWB 5J1TC 1TLKA 3U6XS 1SMDA 3OG4B 1U6AL 4LSQL 1E27A 1KTJA 2E5EA 5I0XA 1WRFA 5FO8A 2DF3A 4NRZB 4OLEA 2WLLB 2RFXA 3BKYH 1C16A 5CEYA 4YDLB 5JMOC 5B1CA 2EE6A 2D3VA 3EHBC 5EU6B 4BZ2L 4F8PA 2O30A 5E70A 3AM8A 4JFQA 5IBLC 2IAMB 4FQCH 4WCYL 1KXVA 1TDQA 1GOFA 2EH8H 5JIPA 1AQHA 3CDYA 4X7SH 3HI1B 4E41D 5MERB 4ZNCD 5IFAH 4P57A 3LKOA 3MV8E 2LAAA 1PS3A 2ICWI 3LKQA 4F7PA 3NCXA 2F19H 2VWEE 5KSBB 4I3RH 1JZJA 2BVQB 3D0LA 1XSKA 2Z1KA 1CLCA 4XI5C 4PJFA 5TGBA 5JO5A 1G6RB 1X5AA 2C9SA 3D2UA 3VSVA 1LO3H 1TEFA 1ZD6A 3U0WL 1W80A 2YGQA 1MH5A 4MQ7A 4LLAA 2RCSL 2V7NB 2J3SA 5DEJA 1S7VB 1WD8A 3QXTA 4Y4KB 1UXLA 4XMVA 5J0BA 2EUWA 1NJ9A 3NESA 3VFMA 3L5WB 2OSLA 3H7BB 4GRMB 2D7TH 4MYWB 4X8CA 3JWNG 4XP1L 4M7KL 2KZBA 1AR1C 3PL6A 4UQAA 5ESAB 1TO5A 2CXGA 3T0EA 4HPOH 1U8IB 3AITA 3OKEB 4G42A 5C0IB 2IAND 4IIZA 1XSIA 2F8OA 4L37A 2HMIC 1G6RL 3S0PA 3OKKB 1A0QL 3NN8A 3HRZC 3ARFB 4RFNC 3NZHH 5DVKA 4PJ5B 3L7FB 3BAEL 5T1MA 5CINL 5F44A 1BZDA 3TWYA 1UKTA 3QFGA 4FG0A 4CVXB 3E0GA 2YD4A 1AZZC 4W1TA 2XYBA 4AMWA 4QYOA 4BSWB 2NZ9D 4I0PD 3FH8A 4XPBL 1DLFL 2EKSB 3TO2A 3I9AA 4CAGA 3WTXA 3F7PC 1AG6A 3CVCA 4ZS6D 3WYRA 3CFQA 2NSQA 5AB2A 2WN3A 1W8OA 4KRPD 4LVOB 2ZUVA 4LCYB 2NUPA 1DVFA 4XODA 3OR7A 1AAJA 3UERA 2EQDA 2Q6WA 2NY0D 5J1AA 2VQTA 3MUGB 3VFSA 1DJHA 3B2UD 1RY7B 3GGWA 4KJQC 2DQDH 1QSFE 4KZEH 3MOBH 4IRJD 2ZG3A 5LBSL 5DVPA 2CKBL 3T3MF 4GBXC 4Z7NB 3ZE1E 4I2XE 4P2OC 2WXPA 2FX7H 2CLRB 1FZOB 4AQ8C 5FA4A 4TM9A 1LO4L 3R0NA 4BDVA 3MXWH 3MBWB 4IBVA 5F7HA 4Q6YA 1GTNA 2WLLA 4Y5YB 2C7UA 2CO7B 2W59A 3PUCA 2CCLA 2ZXGA 4XVSL 4P05A 1KENL 4FHKA 2O26U 5D8JH 3AVEA 2FR4A 2FQDA 2LLNA 2PWGA 1L9QA 2J6EH 2CKNA 2EO7A 2F5BH 1VENA 1YEJH 2C9AA 4FNRA 2E9BA 4HUXB 3UTZB 2GUOB 2NXZB 2NY1B 4JFYA 4QPEA 3HMWH 1A6TA 5JQHC 5IK3B 2VDKL 3A0OA 3IFOA 3LH8A 5CBEB 1HKLH 2MCPH 3Q6FA 5I8CB 4R7VA 3T2NL 4OLYL 3QNZA 4ZRGA 4U1NB 5I23A 4X9BA 3ULUL 1URZA 5HHPA 4OCWL 2CDFB 4JQXA 1YEHL 1C5CH 1XGYL 5JO5B 5TGBB 3UBGA 1WGOA 2VH5L 2YPVA 5SX4I 3NAAH 1HCVA 2C7FA 4XZUA 3CVHA 5EV7A 1IQDA 2V7NA 1TVHA 4B0MB 4MDJA 4EZJA 1CL7H 1ADQH 2D03L 32C2A 3DX9A 1WP6A 1DUZB 4PBVC 3BKCL 1CS6A 4CBPA 4FQXC 3RWGB 1FHGA 4DGIL 3TVMD 1AHMA 5KVDH 2F54A 2YSSB 3EAKA 2UXFA 3MNZB 2Y7MA 2Z7UA 1NUGA 2HLFC 5L9DH 3IMBA 1IL1B 4JW3A 4X6FA 1FFQA 1MI5D 1NCWH 4XP6L 4CU7A 4HWEL 5E03A 5DS8B 1GTFA 1KGWA 1OAUL 1X4YA 1I8UA 1IBGL 5IOPB 3TN0B 3GNML 3MV7D 4HHAA 2CCVA 4F93B 5KBKA 4UB0L 1P7QB 5ILTL 1M6OA 4FEMA 4PG2A 3CVDA 1CGTA 1ACXA 5EBMB 5CZXC 4Z7VA 2Z31B 1PX8A 1MUJB 5GGSA 3MREA 2CALA 3TBWB 1Y0LB 3VI4E 2AANA 1BIIA 3DK2A 3FQTA 4G8AC 4TNWK 1MVUA 3ECQA 2GEQA 5F93C 3K6NA 4OD2B 3P40A 3GJFA 3L54A 4EI5A 2CLZB 5T1LB 2H1PL 1Z9OA 1BIIB 6TAAA 3FB7A 2VN6A 5ELIA 1TT6A 1JGVL 4DKTA 2YK1L 2XN9A 4LCWB 2VO8A 3ULVD 2BIHA 2CSPA 2MKWA 3CLWA 4NBXB 4NQCB 4MA8L 4YIQA 3O8XC 2VXQL 4NAJA 4ZD3L 1DANU 3QH3B 5G4MA 2YGPA 4LCIH 5EULV 5ICYB 1X9RA 4FQ1H 3D39B 3DOHA 1TPXC 4MMZA 1YNKH 1OIOA 4PJ9D 4M61A 5HDBF 2VDOH 1RUQL 2Q7AA 5L7XH 3SN6N 3TEWA 4AWJC 2YEVB 4HKZB 1NAKL 3GSNH 1GYUA 2Z35A 4GRWB 5KG9A 3ABMB 1MW1A 5JW4N 5IMKA 4C83B 4Q9CA 2FD6L 3BP7B 2BX5A 4OQTL 1CICB 1WLHA 2N7SA 1HCZA 3HBPA 1BM3L 4NJAL 3EBHA 5IGXL 1PIGA 4JO1H 2CHWA 3PL6D 3SCMD 4UTBH 3OXRA 3BD5A 3CFDA 3SDAC 4W4OA 4HS6A 1QSFA 1GGIL 1CG9B 3APFA 3LQZA 5ADOH 1CGYA 3US1A 4ZQKA 1C7SA 2P8LB 5CBEA 3ILPB 4LPXA 3BZEA 2PMZA 3KGSA 1IAOA 2C9VA 1U91A 2L7JA 3CHOA 4KKQA 4JPWL 4WUKL 2RIKA 3ATBA 4X0KB 4HIEA 3E6FB 2DQIL 3ZTJG 4OBSA 4X8JA 3FN9A 4YE4L 1R6VA 4XXDA 2XFGB 3PE9A 4ZK8A 3BKJH 2VZUA 4BXSV 1U3ZA 2BY1A 3HRZB 3SDCC 4D9RE 1CLOH 1BGXH 1Y18A 3MRBA 5DI8B 2NY4C 4U1HA 3K91A 3IAPA 3TNMA 4Z3FA 3GHBH 3ZSSA 1KGIA 2MOVA 5A2BA 2AQQA 4XT1C 2VLMD 1JZEA 4HHWA 2O5XH 2LTQC 1AQDB 1L6XA 1WFIA 2CDEA 2EC9T 4LCWE 2BIOA 2JB5L 1V10A 1G4RA 4JFWA 2OMUB 1XB8A 1J8SA 4HV8A 5JUEL 3ZDZE 2Z3FA 4LARL 1DDHA 2R7EA 4WI6A 4WLCA 5F1NB 2JKRM 5C09B 1XBRA 4OF0A 4WIQA 5I1GH 1PLBA 3AS2A 2BVOB 3CVIL 3QUXB 3WIFA 4I2XA 2DDQL 2YMXL 1A7PH 4ZODA 3T77B 4TL4A 5KTEH 2OULB 3GHBL 1FLTX 1KLUA 1YEHH 3JT2A 4X4XA 4OJFH 3U1QA 2DKSA 3AREB 4FI8A 4CN4A 1HHIB 2E75C 4HW6A 2XRAH 4ZMYA 3T2NH 3K0WA 5AVQB 3LH9A 1RJLA 2N0KA 4KMTL 1A6VL 4GIAA 4JR9L 1DANT 1QI4A 4JGUA 5IB4A 5C07A 2FAUA 2R9HD 5H35A 1L9MA 2OP4L 4JO3L 2A6JB 1BOGA 1PZBA 4S0TD 4MD0B 1EFQA 3OGOE 4X9FA 3UGXA 4EUPB 2FX8L 1TQCB 4C4KT 4BGLA 4LHUA 2F5BL 1MJUL 4GKZB 2OJEB 3MV8A 2AXFB 1SDDB 2CU9A 3CZEA 4W9KC 5I75B 3S5LA 3T0AA 4NENB 3MGOA 1B0RA 4GG6B 5HHVL 3LS5H 2J1YA 1HAWA 2J7LA 4G6FD 3VRJA 4A67A 1KXHA 1IBGH 3TIDB 3P54A 2I9TB 3MYZA 3SIKA 4KX7A 2HKFL 3HJ0A 1NA8A 5A6MA 5IHBA 4JO4H 4PN6A 5EU5B 1I31A 5ILTH 2ARJB 1OPGL 5F97E 5EZIL 5SV4A 4GO8A 4LLWB 2VQUA 4XNQA 4QOKE 4WFFD 4YHPA 2HRPH 1U4EA 4C56A 4W9IC 4PS8A 4DGIH 4ZMQA 5CR1A 3DGCR 2LLGA 2X7LB 2ZG2A 4FQXD 3KLSA 3VWJB 2UUDH 2XY1A 1J8HA 4MSWA 4U3SA 4JY4A 2NYYD 3VQ1C 4E9QA 5IFJB 5T8IA 3O41A 1I7TA 3GSRB 1NJ9B 1I3GL 2VL5A 1KYFA 1XR9B 1A47A 4FJYA 1G9MH 3S6CA 2A9MH 1MREH 1EEQA 2YQBA 1EZUA 1FWXA 3BZEB 2BNQB 1YG9A 1RIUL 3MRIB 1PZAA 2B3RA 1R3JA 3G5VB 4Y9GA 5K39A 4G8FB 4BH7A 4MXQC 4MWFA 2UWEA 3DIDA 2IH8A 2CHDA 3U46A 3BCFA 2A77H 3VCLA 3MCLH 5I0DA 3ZR5A 1ZLUK 5IVNA 2ZX8A 4AC4A 4Z77A 2P5WD 2E9WA 5IREA 1DN0B 2PKDA 4WSJA 4EF3A 1NKOA 4KXZI 3D48R 4DN4L 4N5EC 5EZPA 1XGQB 5D7HA 4HT1H 1EPFA 3BGFC 1NCBH 1SEQH 3WN5C 3MRMB 2QQNH 3T0VA 2WP3T 1DVYA 3PDGA 2P5WE 3CZKA 3L3HB 1J9TA 2VMCA 5I1KH 1AS6A 3BKML 2YS4A 1HHKB 2AKRB 1H0DB 3FXIC 4A1RA 4F58L 3KBHE 5HGDA 3WTTA 2F18A 4AIOA 1BQUA 3QUZB 4UV7H 5C6TL 2V5YA 3ZO0A 2GSIA 5DHMC 5IQ9A 1F02I 1MY5A 1MRCH 1TQVA 3FUHA 5FB8B 1UCBL 4FQPA 3QUYD 2LE9A 1RK1A 2ZOLB 4NZRL 2YZ1A 3VXOB 4AVIA 4Y19B 4GRLC 2ISDA 5FDYA 4LF3B 2Q2EB 1LEGA 1SOKA 2I69A 3N42F 3N5AA 4WKXA 2Q1EA 3QI9D 2VDPL 3UXFA 2PTTA 4H25B 1H15B 1IKOP 2W94A 4Z76A 1VEPA 2DQGH 2BVPB 3A6BL 5I73B 3GSVB 3ABZA 5TFSH 3SKMA 2CRMA 2H7WA 2B59A 3BH9B 3QZWA 1NFDE 1LNUA 3SEPA 3UTTA 3ZTJH 1JFHA 3HA0A 3IJSA 2QBWA 4XCFH 1WJ3A 4GP8B 3IVKB 1BQKA 2WNGA 4Y4KC 2XWEA 1Q8MA 3VD9A 3I9PA 4DK6A 4H20L 3X1EA 3W0WD 3S34H 4ZFGL 3G5XB 1EO8L 1C9SA 1L6ZA 5CINH 5A2JH 4J3OF 4JQVA 4OU3A 4ENEC 1AD0A 2WWOA 3L3JA 5EB9A 1KN2L 4Z0XA 3BE1H 4UDUA 5DC4B 5GS2D