2CO6A

Salmonella enterica safa pilin in complex with the safb chaperone (type i)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
125
structure length
125
Chain Sequence
b'GSDLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Fibril protein
total genus 20
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2co6A00
2FVNA 2CO6A 2CO3A 4OR1A 3UIYA 3UIZA 2IXQA 2CO4A 2CO7A 2AXWA 2CO1A 4PHXA 2CNZA 5D55A 2CNYA 2CO2A
chains in the Genus database with same CATH superfamily
2IALA 1H3WM 1R4XA 2BNQB 5F21B 2FECL 2H1LM 3VXRB 4E9VA 5KYWA 3L1OL 1JZ4A 2BSTB 2DWXA 3KWVA 3MNVA 3ZUNC 4OY9A 4FABH 1UXSB 3FT4B 5IJBC 3G6JA 2OTUB 2VDNL 2DYRB 2IDQA 2JQAA 3EOAA 4JRYA 3SKUD 3U1QA 1I3UA 1H6TA 1DSYA 3WIIL 3J7HA 2FBRA 4X9IA 4R7DB 5DRNA 3KGRA 3IGLA 5FYJU 1IAKA 2NSQA 5ICZB 3V5HA 2C7UA 2K6WA 4HWBH 5EU5B 3S37H 3V0VB 1ES0A 2DDQL 1FG9C 5AQ0A 1OGTB 4LVOC 1CFVH 2XVLA 3WJJC 1E9QA 3OBAA 1L7IL 4X9GA 3HE7C 1QO3B 4S1RH 3VRJA 3L3IA 5I1HL 1Z6JT 2EYTA 1OSZA 5L88H 4EAEA 2WNWA 1KTBA 3ARZA 5EIIG 3L3OA 3BQUA 3BFQG 4N8CL 1XGTB 4ZAKD 4Z76B 5AWNH 2XIDA 3RKDD 1DVFA 1W0YT 5DK3A 1KPVA 3C2AL 4KOBA 4EMZA 4JRXB 4XC1H 3GRWH 2V2XB 2DQIL 3EO0B 2XFXB 1OOWA 4UQ9A 1NAMA 4OZIA 1RUPH 2DM2A 1EHLL 1QABA 3SDXA 3VQ1C 2OCFD 1H5BC 3CHPA 3ZL2A 2I9LB 1DDHB 3QFDA 1DP0A 4GI6A 5I1AB 3N9GH 4HK0A 4QJ5B 3AM8C 4UT9H 4AOFA 5EBLA 4DKFL 1GAFH 4AJVA 1U21A 2E4TA 1ZVYA 2WWMD 1UXMA 5E5MB 4OJYA 4EN3A 4RX4A 2GC7C 2P43B 1BZ9A 5BCAA 1EAOA 4Q52A 3D8MA 1NCTA 2FSEB 3G6JE 3V4LA 4PGCB 4JLRB 2ROXA 2ADGB 1A2YB 2FGWL 5FA4B 4O4YH 1F42A 3NZHH 4ZTOL 1AS7A 3V2AR 1LE9A 2WJ5A 3U9WA 4CC4A 4M8QA 4PV8B 4YVNA 1Q9LB 3ESMA 2EDHA 4CDGC 4R5XA 3WDIA 2AC0A 1BG9A 5KSBB 1IM3D 3EJQA 5FA3B 5DHYA 1FNSL 5E94B 3JWDL 2DQEH 5DQJA 5C0BA 1CE6A 3TTSA 1XIWD 3NSXA 5E6ID 5B3NA 4XOEA 3VFMB 3J07A 1X9UA 4NSKA 1JI1A 2JWYA 2AQ1A 4HUVA 4EI5D 1S7UB 2GI0A 2ICWA 3S36H 4P9HH 2O6CA 4FLRA 3ZDYB 5JHDD 3QFGA 4LGSB 3B9VA 4TPRL 4YSQA 4OZIE 3ULAB 4MJ4A 1LDSA 4NZTL 3SDXE 4OIFA 1FL6B 2AQSA 2NXYC 3Q9QA 3T71A 1AOHA 3QGVA 2NY7L 2WY3B 1KB9J 3GSRB 4HT1H 4G59C 4KV5F 3VACA 3ZQ9A 4ODUA 3GMLA 4RGMC 4BSVA 3NSCA 2VQTA 2AGJH 3FUMA 4RFNB 2AXWA 1W6WA 3GMNB 2ED7A 5JZ7D 3EYVB 3MGTB 4X5LA 3LIZA 3SYPA 3HC4H 3Q0HA 1DSWA 2XY2A 4JW3A 4AEIL 2KL6A 4WV1C 5CCKH 5T3ZD 3NSYA 2YXWA 1EGJL 1PTZA 2F8OA 4XXWA 1BJ1H 2A6IB 3GWJA 3C8KA 1HQRA 2GSGB 1H15B 4O9HH 3V9CA 4TKWA 5IBUG 1JXFA 3CZGA 1G6RL 1OHZA 1Z9SB 1OEZW 3NZSA 1FNEB 2E7HA 2OMNA 3HFMH 3MNZA 1KJ2H 3S3SA 2XBTA 4FTVA 2IFGA 4F33B 5A6IA 4MMZB 5KVGL 4P46B 1CQKA 4CMMA 4DP7X 3QUMH 2WBJA 5TDPA 4H5SB 2CIIB 4J3OD 2XQYA 2K9UA 5F9JA 2OJEB 2KBGA 3RWCB 2AI0H 4HJGB 4FG6D 3BGFB 4ODSL 1FNLA 2EO9A 3K91A 2VXVH 1M71B 4M9PA 4MXWH 4OFYD 3D3VD 5EC2A 1K6QL 1VFBA 4MAUL 1P4IH 1IAIL 5DEFB 4PJCF 4NIKB 2FQDA 1T7WA 3TS8A 4Z3IA 4ELKA 2YN5A 3MXVL 3QW9A 1BZEA 4ZOBA 1TMQA 5D7LB 4PWIA 3ZYOA 5IKCB 4I3SH 2V9UA 2OP4H 3PV7A 8PAZA 2OW6A 5FECA 4KQ3H 5FUOH 1KCSH 2ZX9A 4NBXB 1AQKH 4MCYA 2VDRB 1NCAL 5KVMC 2K9FB 1K8IA 1KIRA 1QSEB 3LKRB 3MUJA 3ETBJ 3DV4A 4L5FL 3VX1A 4M56A 3TWYA 2FL5B 2KPNA 5HGHA 5DXWA 1ITBB 4QRBA 3QFJD 2VDQL 1NTDA 1TLMA 2LFGA 4JM4L 4PJ5A 5D4IA 4TSAL 2CLRA 2DL9A 5BRZD 4RQQB 1A9BB 1KGJA 3KL3A 2Y36H 3FFCA 5FO7A 1CK0L 3FU8A 4FTVE 4XODA 2X0VA 4WO4B 3KXFE 3RB5A 5DD6A 2Y6SD 3GS0A 5J13C 3L2LA 4QXTB 1NC4A 2DS4A 1UD4A 4X8JB 4RWYH 3KLQA 4Q9RL 3S4SB 2ATKA 4ZO9A 3ATBA 1S7QA 5B1JA 4BFOA 1KPUB 3NIFE 5CEZD 2IPTL 2V8MA 1R5WB 4H25A 4X8CA 3MQIA 4S0HA 2SEBB 3D9AH 4P2AA 3QISA 3WNOA 3GBLA 3T3ME 1UA3A 4W6WB 3WO4C 4N28A 5IT2L 2LV4A 5F1KC 2Z35A 2RA1A 5HJBA 3BP5B 1JHKH 3HZYA 4NFBA 5D70L 2XN9A 1J5OH 2WQXA 1AH1A 5EN2A 3RUGE 3M17B 2GK2A 3HE7D 3LVEA 1A5FL 1FVCB 2Z93B 3N41F 5E6ZA 3L6FB 3BP6A 3S2CA 3WIHA 1AR2A 4BH8B 1Z3GL 3CXHK 2VZVA 3BSGA 3T0EA 2YEQA 3MV7A 3BUBA 3QQDA 1BQSA 1PKOA 3NK3A 2J5LB 3HG4A 5AYUL 3VA2C 3UADA 2CM5A 4PY8I 1G7HA 4OBSA 4ZX3A 4GLRH 2IANA 3PHAA 4YXHH 4QTHA 1SEQL 3FAWA 2QQKH 3EDJA 5KG9B 1AD9A 4Z7QF 4BA8A 3W9DB 4JFFA 1GGBL 3QFJB 3IAQA 5F0JB 2QV4A 4MCZA 4Q89A 4R96A 4L8BB 2WAQA 4ZS6C 4XBMA 1IGTA 4O02H 5TQ0H 2J55A 1KG0A 1YNLL 3L1OH 5BRZB 3FFCE 43C9A 2H8PA 3KNBA 5C8JA 2WB1A 4U0QB 4U1MB 4JPSA 1MCOH 1S78D 4YAQB 5EEUA 2Z1PA 5E6YA 1NEPA 5DD3L 3HI1A 1NGQH 2QL1A 4A67A 4W4NA 4W68A 3C6SA 2C3XA 3QDGA 4QXGH 4XGZA 5T5NG 3S0PA 1W8OA 1JZIA 5D1QD 2DLGA 1ZHNA 3KCPB 2DI9A 1QKZH 3I74A 4ZBJA 1I9RH 2WXPA 3QORD 2CJTA 3UBGA 2IQ9H 3IXTA 3ZIMA 5JNYA 3MLWH 1OARH 4W9GC 4Y5VA 4AM0A 2DDQH 3VU1A 4OZHA 1LHZA 1OW0A 3TVMD 2QSTA 3KLHC 3P4NA 1JYNA 4RLDA 3CVBA 1KGIA 3MRFA 4FP8L 2XN9E 5BZZA 4ZT1A 3RA7H 2L4OA 2QQNL 1P7KA 3SDCA 1J10A 4LSRL 1F1GA 2EO7A 4ORGA 1B0RB 2JLPA 4FNRA 1KCKA 4UIMB 3UZVA 1FORH 3AS2A 1CT8A 2C4XA 3OKKB 3QUZC 3P9MB 1KYDA 2YR3A 5I71B 1XF1A 1Y6NR 4Z9KB 1X7QB 1G9HA 3ZUCA 4PLJC 5MENB 1NMCB 2IANE 2BNRD 1NDMA 5A6LA 3HBQA 4P57A 5DC2A 4WWKA 3CLFH 5D5MF 3ARDC 5H37H 4L9LC 4X6EA 3BE1L 3IDGB 4HC1A 5D6CA 3B2UD 1T89A 5DTFA 4CNIA 4R5TA 5DK2A 2LHAA 3O4LA 3D0LB 3LHPL 4JZJC 5F1NB 5CD3A 1MCHA 3OKLA 1C9SA 2K4AA 4HGKC 5HHME 3VI4B 3BAYA 4MZRA 3VTAA 2R9HD 2CHWA 2WXLA 4GUCA 3PGFL 3S35L 5I74B 2R23B 2B77A 2AK4D 3KPNB 4ZQTA 4AT6B 4WU7B 1QYGL 3NCMA 4YDLB 4R3SA 3BKJH 4N2GA 4U6YA 1V3LA 1MFUA 2R59A 3V0GA 5A7EA 1PG7L 3OG4B 5GRJL 5FYKE 1GPOH 2IAMC 5D1QB 1IBHA 5D93B 1KZYA 5ABZA 3BVNB 2A9MH 1MZYA 3QORB 4OIIL 4OZHE 1YMMA 1A7NL 4U6XA 1ANUA 3O4OC 1T5WA 3BIKB 2F58L 4PGJA 5I28A 1MAML 1WVZA 2CHXA 5FFGA 1HSAA 3WFHB 4NWTL 1TZIB 1GS7A 2EE3A 4OM0H 4XZ4A 1Z3RA 5DZ9A 3MUHL 3WYRA 4EIZC 5GISL 3LKPA 1J8RA 3IB4A 4ZUWB 1U8QB 4XWGL 4AG4H 3I9PA 4OQTA 1TQUA 2NTSP 2F53A 3SDDD 1OSPL 3GRBA 3MRQB 4JFXB 4TPRH 3ZKMD 3FO2A 2E8ZA 3F5WB 2V5RA 3RL1B 3S5LB 2XV6B 1T5KA 5F7UA 2CGZA 2PN5A 3TBTA 3NIFF 4O2EB 1DJIA 3RWJB 3FN0L 1DUZB 4O2CA 5ES4B 4DN3H 4Y1AE 3U6XS 1F45A 3O8XC 5FR3A 3NOIA 4AZ8B 4QO1B 3TBVA 2LAAA 4G9FB 5DUBA 3L45A 4B9KC 2KH2B 3DJ9A 2XX0A 2YPVL 3GI8L 2X3AA 2J8UF 3BH4A 1E43A 3RU8H 3AVEA 3V7AG 3RUGF 3LJ3A 2HLEB 3BHBA 4EKXA 4XCNB 3FSWA 5DEGB 1I8KA 3ARWA 3LCYA 1MCCA 2GJ6B 4TQ8A 5GHWL 3RILA 1FLRL 4E9SA 2QSCH 2EECA 2JJUA 3KHOA 1FYTA 2OSLB 3RPIB 3W0WA 1SOKA 5DC0A 2H0PA 3MJ9L 2XWJA 2A4CA 1FRGL 3NIGE 3TN0C 1QTSA 3ZDZB 3IYLW 5LAXA 3C8DA 5K9KA 1EFXA 5JPNA 2HKHL 2I07B 2VLRE 3ECBA 4ACPA 3BWUF 4BFEA 1C5DA 1OAYH 1RP8A 3F7PC 5J1SC 5L8JB 3H2QA 1T5XA 2Q2EB 2RQEA 3JWOC 1J9SA 4AYSA 4MWFA 1UACL 1IUZA 4HIJB 4NYLA 4M7JL 1NSNL 3SE9L 3SDDB 3QIUC 1HOEA 3EJSA 3H7BB 3HB3C 3HBGA 6TAAA 2Q20A 3LKSA 2VDOB 4DETA 4GRLC 1NH6A 4AYFA 2WKOF 3FB8B 3IFPA 3OJDB 1I9IH 5CILH 2Z0UA 4F7EA 4NQVA 4GUPA 3ZZLA 1XL6A 3FU6A 3ZK0A 2XG5B 2YQ3A 2V17H 2WVTA 4WFGD 1XH0A 1OAJA 1KT2A 1MRDL 3MMEA 4ES9A 5IW6A 1WA0X 4IRJA 4RRPA 3D2UB 4BD4A 5AW8B 4DERA 4XPAL 3R18A 1JZFA 3EAKA 3UTQA 1FO0B 3MNWB 2GHZA 4XCFH 4G6AD 4OGAD 4OVVA 3QULA 1F4XL 2F54B 5HYIA 3CQPA 4E41B 1COBA 2JB6A 3PAZA 1DO6A 3VSQA 5BVPL 3WHE1 4KQ0A 1EV2E 1OZTG 1MHCB 1KBVA 1I3RB 3W0WE 3D85A 4G9DA 3ULUD 3VXTB 4ZS6D 4JJHA 2L8AA 4WEBL 1ET8A 3BXNA 3WFZA 4AJYV 3OGCA 4N1CA 3QWQB 4WSGA 5IMMA 1SLVA 2X7LA 1U8MA 3WSQL 1W0VA 1KGWA 2A38A 1HZLA 4A7GA 3FBKA 3NN8A 5ID1A 4C4KT 3I9AA 4G72B 4IGBC 1DQKA 5J1AB 1CBJA 3POCA 4M02A 4OV5B 1ZLWH 4HUXA 4IU2A 5FLVA 4GQ9L 4MNGE 2VM3A 5D1ZI 2VW7A 1XWVA 3KEHA 4RMRA 4W81A 2OS7A 4HKXA 1KTRL 4L8DB 4UINL 5CSBA 3HLAA 3VFNB 4DP1X 1AP2B 4YDJA 3RDTC 3N2JA 3VH8B 1UOLA 3VGAC 2AEQH 3HRZA 1JPTL 5TGBA 1ADQA 3V4PB 4C55A 5IQOA 3KLHD 1JV2B 1U8OB 1KB5L 1XGUB 2E56A 4F9PC 4PN6A 1XCWA 3NACL 4PY7B 1BCIA 3US9A 3SKJL 2O6FA 4AYBA 5T3ZH 4ZO6A 4ZK8A 1HCZA 5DMYA 2XZZA 3O0RL 5CS7A 3ABZA 1JBJA 5T1MA 3U0TA 3MRRA 2YGPA 2Y7QB 4G2AA 3SQRA 4AL8H 3BP4B 3K81A 4JHZA 4LSTH 4YZWA 3FSZA 4L3EE 5IJKA 3RHWK 2EDLA 1GGBH 4NX0A 4KXAA 1LQSR 1LO0L 2K8MA 3LRHA 1S46A 1MDTA 3R4RA 5E2TH 3QDMD 1JFQL 4CGUB 5C9JB 4HPOL 1TG8A 1SF3A 1TTFA 4FXKA 4MS8D 3WXWL 5LQBH 3DO4A 4J3OH 3UBXI 4BM7A 2EIBA 3NPZB 4X8GA 5LGJA 4EZKA 2DM4A 1N64H 4UUJA 3MGOB 3ZZ1A 2ZOOA 3L8QA 1RU9H 4KXDA 2UXTA 4MMXB 2P5WA 3FO1A 4I4WA 4QHMA 3SCMC 2WBKA 1RUMH 3JWNC 4JPKL 1HOCB 1NCCL 2H1PL 2ATAA 1KSRA 3FJTA 5DF0A 1G9MC 3TOPA 1JGEA 3VWKC 2AJYH 1F5WA 4OCXH 3T0XA 5GZNC 1I8MB 1IB5A 3K8MA 4DN4H 3QNXB 5JW4N 3JVGC 2C4FT 3GSNL 2EEFA 1FYHB 3B7RL 3EFFA 2AZAA 3Q5OA 1XGYL 3U9PH 5LGKA 5DVPA 4FA8A 1AIFA 5L4FA 2ENQA 1CICC 5ACMA 1JZDC 4YBQC 3U79A 3TA3D 3G5YA 4U49A 4P2YA 4M4RA 1R3IH 3TASA 3V4VA 4QRRE 4NM4L 1PQZA 1S8DB 5SWZE 3SKMB 3ZE0F 3NESA 3BISA 1LYQA 5DMKA 4XNZC 2G9KA 5CBEB 2DWSA 2W60B 2Z8WC 3L2NA 3NG5A 3BE1H 5AW7B 1GMIA 1S7XA 4KVNL 1VB9A 4HGWB 3COOA 4E36A 1RI8A 2FLRT 2ENPA 4HIQA 4WUUA 2KQMA 3O8XD 1UQSA 3INUH 1O7DC 3MLZH 2E0PA 1MUJB 2OJ1A 3QDMB 1HH6B 4UZGA 4X7CC 1CDUA 3S35H 2RB8A 4HUCA 3T3PB 5CEZH 1INEH 4AE0A 2IDSA 5C0FB 2JB5L 1CFMA 1YEEL 1VJSA 3CDGA 5EDXA 1S9VA 4IU3B 2P5WE 1CBVH 3BKYL 4CRPA 3FCUB 5I76B 2HMID 3B5HA 5HD8D 1R17A 1OB1B 3EJPA 1QG3A 1WD8A 3CFDB 1CF8H 2VZTA 4PW3A 4XMLH 1N2RB 3MHZA 5DA0B 4OUOA 4LARL 2PTTA 3WS3A 4WJ5B 5AAWC 4NRYA 4AC4A 1OGAA 3RFZC 5GISH 4Y4FB 4DZ8B 3VFSB 1SY6H 4RISL 2XNAA 3O3UN 4WHDA 4BGLA 1MDAA 3TFKC 5E9DA 5GRUL 3ZKND 4ETYA 4W1TA 4OLUH 1HINL 4POZC 1AGDB 1Z5LA 1CGSL 3HNSH 2CLVB 3I50H 5T1KA 3TA3B 4K15A 4J39A 3P1VA 4BFFA 1OAKH 1WUZA 3P11L 3ZR6A 2O5XL 4W9IC 4CBZA 4LL4A 1JPST 5DSCB 4JG0H 1SMDA 2JKNA 3MNMA 3O6LL 1E5BA 1WFJA 2PCPA 4R84A 3G5VA 4Y19A 5CLTA 5DHMC 5DO8A 5AOLA 4X4MA 2OAAA 4HAKA 1L9OA 3FSVA 3RVVC 4EZLA 2AAVA 5DZAA 1S9KC 5C1MB 1EHNA 2EXWD 1IGYA 1ZT7A 2OZ4A 1BA9A 1HEHC 1V5JA 4P5MA 3RGVB 3DLQR 4LCWA 5HXMA 4MJID 4Q4EA 1B4JL 2DMKA 1UXLA 5L0QB 3L81A 3WD5H 1DJSA 2C9SA 3F12A 4NHUB 4G5AA 3KWUA 4YHYC 3EGSA 5DVNA 3SY0B 3HC2A 5EU6D 1KLGB 4NOBA 1NMAL 4MD4A 5E1HB 1X5HA 4Z7UA 3ILPB 3K0WA 3KMDA 4HLZH 5JORA 5A43C 4KMLB 3DETD 2X87A 2CRYA 4U3XA 1F56A 1MHHA 2CD0A 4LZKA 5C0RL 2VXTL 4N6RA 3SPHA 1SGKA 5B8CB 1A14L 1Q72H 1QASA 3VGFA 1G7JA 3BT2L 2PMZA 3N1FC 1LE5A 4YHIA 5IB4B 2AANA 1AIZA 2C1PB 2N0KA 3D33A 1BVNT 2B3RA 1BOGA 1JGVH 2Y1YA 3BCFA 5DJ8B 3HE6B 1UACH 2P8PA 4Y7OC 3H3PH 4ZMXA 1V10A 1WBZA 4TUKL 4XCCL 3U36B 5AFAA 4PRHB 4GO9A 1WZLA 1TCMA 3GZQA 4BQBA 3TH2T 2W8CA 3CN3A 3KHQA 4Y19E 2IBGA 4PRIA 4XN8A 1WRFA 5D1ZB 2IO5A 3SGDI 3AQZA 4A39A 3MBWA 4X4ME 2B4CC 1ACYL 1MXDA 4QXWA 2DLEA 1X5FA 3CDFA 1J05A 4IIQA 3RI5F 2I24N 3BZEB 2AK1L 2MWCA 4XAWH 3RWHB 3VSTA 5BO1H 3PQYA 1F41A 1INQA 4M62H 1TJIH 4RH4A 1T2QL 3DIFA 3BWZA 4IOFD 4TXVB 3ZTJH 3NCEB 1JPFA 4P23B 5IG7A 1I31A 3VI3E 5HPMA 1EMTL 3RY6A 3V0DA 4TQEL 3MROA 4J4PA 3L54A 4A7SA 5EV7A 4NUPA 3DTXA 2B1AH 4Z7WB 2W81C 4JM0A 2P8MA 2VYRE 1AHMA 2OR9L 5KBMA 3ZE2B 1EX0A 3T77B 4BCZA 2PPDA 2X10A 2VH5H 3HR5A 2W38A 4D9QD 2IIJA 2WC7A 3MYZA 1XSJA 4Y89A 4NO2B 5FDWB 4MA7L 1OP5K 5KJRH 3HMXL 3I6KB 1LWRA 5F89A 2E74C 1JXDA 1XHHA 2FJGB 4UYQA 2VDOH 3K46A 4ZUVA 3ROLB 4E0RB 3UAFA 3Q6FA 3UBXB 1R3HA 3QEQB 3CLWA 3JWOL 4ZPTA 3MLYH 1KN4H 1QWHA 5TE4H 5FK9A 2CBTA 5I1CL 3ZMRA 1F1AA 1DR9A 3WFCH 5PAZA 3BP7A 2CRZA 4ZO7A 1D3CA 4H2CA 5IFJA 4M29A 5KYXB 2QQQA 4O51B 1XAKA 3ARFD 1XGRB 1ZVNA 4DEUA 2L7UA 5IROD 3RTQB 1U3JA 1EEZA 3VWKD 2P80D 1JPTH 4UT6A 3CIAA 1JNJA 3RWFB 2DAVA 3GMQB 5D2LB 4WEEA 4L9DA 5HHVL 3LIUA 2J3SA 1BEYL 4MB4A 1FZJA 3S8FB 1T0MB 4TNVF 3BO8B 3S3PA 2GHWB 1FZKA 4CDHA 4EDXB 2DQTL 2YPKB 3T2PA 1LP9B 1IX2A 3CVIH 1CICD 4YQXL 2QKSA 4EO5A 2AXHA 2R8SL 5CEYB 1ET7A 2R51A 5CJOL 1K5WA 2A3TA 4UIKH 2GTZB 1RQ5A 1BD2A 1WZAA 2HT2D 3TT3L 5G2NA 3ZMNA 1OCCB 4KU1A 3TGXA 1HDMB 1NBYB 2ICWI 4KJPC 3P0YL 1W16A 1W6LA 2IH8A 1Q9WB 1UZ8A 2X28A 4QHLA 4I85A 1BPLB 5EORH 3T9WA 3QUXA 1F0LA 4AXWB 5ESAA 1F00I 4QHUA 4CJ0A 3BVXA 3CH8A 4KDWA 4MGXA 4PHZA 3RJDA 1CS6A 2QVMA 2EUVA 4KRNA 4YE0A 2BMKB 5AB2A 1L4IA 3U83A 3A6CL 3IXAB 4GAYA 4F5CA 1IGMH 2A99A 4XAKD 1AC6A 3EYSL 1A6ZB 3JV4A 4IHBA 2NW2B 5C2BL 1IO4C 3BPCB 4LP4A 3VX0A 1X9RA 1TU2A 3FF8A 2Q8BL 2QPDB 3NCFB 2R0KH 3EJRA 1QEXA 5HYJD 1UH2A 1GGYA 5C3TA 3CSTA 1EO8L 5CJBA 5KVEH 3W39A 5DT1H 2QPFA 3LXUX 1VIWA 5DD1H 5JR1L 1E9PA 2RHEA 3GJEB 1TPXB 1N10A 4Z5RB 3ATFA 4Y8DC 2Q76B 1KBPA 2CKBA 4HXAL 1BAFH 2PWGA 4U1GB 2YK1H 4YHOH 1ZSDB 4KROC 4A04A 4FJYA 2EYSB 3MA9H 4J3OG 3TFKD 5BZWA 3WO3B 2MIZA 2WV3A 2ISDA 1MY7A 3MBXH 1ZCRA 4R2GD 2YPLE 2WUBL 3FFDB 4FG2A 5IW1B 3WFEL 5BZDA 1BD2E 3SBPA 4PB0L 3D39A 3UP1A 2FB4H 4KVCH 5H2BA 3AROA 2OSYA 2ZUQB 4DKEH 3ULUH 2GK0B 5MEQB 4GG6E 5F9WC 5JIKA 3RZCC 4OFKA 3LN5B 3SE8L 4JHWL 2PYEA 5L8KB 1X5IA 5ITBL 1OTTC 2DPKA 4IS6A 1M9SA 1CGWA 1HH9B 4WHTA 2AJUL 4H8HA 1TEGA 1MLBB 4U4BA 5F3BB 1IEAB 1TVBB 1LK2B 3GGWB 1R3KB 1RUQH 3C6LB 2XBZA 4OT1L 1G94A 1QPPA 2CK0H 5B38B 4AGQA 3BWAB 3EJCA 1NGWA 2CK2A 1XB3A 3WJMB 2NY2C 1UM4H 1WO2A 4JK0D 2YAPA 5DC9B 1ZWIA 2WQUA 1G9ML 1NC2D 2QR0B 1NUNB 3TPUA 4DHLA 1EEYA 2WVSA 2FYVA 3DUSA 3E3QC 4NCC2 4NGHH 1AMYA 2WW8A 1VACB 3UAEA 3VI3F 1PDKA 4LDOB 2VOTA 5AOJA 4FFYL 1A7PL 3S3DB 1PKQA 4X8XA 3PPEA 2UY6B 5CCGE 4WTWA 5C0JB 4NT6A 4G1EA 1PSKH 4N8UA 1K72A 1MJJB 4LE8A 3KYOA 5I1GL 4KK8C 3BAWA 4XO9A 2F18A 3DX0A 4P2QB 1G4RA 2IALB 1MCBA 3UG4A 5I18H 3P3RA 1F6LL 5J11C 1KC5H 2HTKC 1Z2KA 2ZX7A 1WPCA 4OJFL 4JFEA 1XSKA 2R83A 3FAXA 4ZPVA 5KVGE 2DQMA 3DRTA 4F2MA 4NWUH 2V6HA 4X7TA 4PJXB 3RJOA 3PAUA 3VQMA 1JV5B 4PP1C 2LOEA 2ROYA 2NZ9D 5C0GB 3VTMA 1KF9B 1VFUA 2OMXA 2PYEE 4JRYB 3EOAB 3VD0A 4J3BA 2ZCHH 3QCUH 4IRZL 1B4JH 3VWJA 1UJ3A 4XVTH 3WFDH 4LLYA 4D3CL 5DRNB 3I6LD 2J71A 4G82A 4W9ZA 2V2TA 5C0IA 2EACA 1IAKB 1JPGA 4L4VD 3WGUB 5ECGA 3V5HB 1DLFL 2C7UB 1OWWA 4OLVL 1ES0B 3VO0A 2B2XL 3UPRA 4C4KO 2XXGA 5HI3D 3L2MA 1E9QB 2L7EA 3IMBA 4Z7VA 4QR7A 1MJ7H 1AVAA 2JIXD 4WRLA 3WDHA 3VRJB 3L3IB 2XWRA 2VDLB 3FMGH 2WZPD 1QR1B 4X6CA 1K4DA 3L3OB 3KS0J 2VXTH 4WWID 3T2LA 3R0NA 2W5PA 1QZ1A 1DVFB 2FO4B 4KKRA 3Q1SL 3OX8B 4ZX6A 3TF7C 4JG9A 3ZTCC 2Y4SA 1J1PL 2GBTA 4P2RE 5F96H 1AHWA 2K7QA 3ZDXB 3O6KH 4NO5A 5AG9A 1WWCA 5ENWB 3UTSA 5ITFA 4Z7OE 2VMJA 4HK0B 2D7PA 3H85A 3UG5A 4XC3L 4XX1E 1NCHA 5EBLB 3VFGL 1R19A 1LO3H 3BGFC 3LAFA 1ZPUA 2ETWA 2BWQA 3UOAB 3FB5A 1SHWA 2VXQL 1N18A 2LVEA 5DD0H 5LG1A 4HLZG 2A4EA 3ZO9A 4F2ME 3KD4A 2GITB 1JTOA 2A9DA 5JUEL 2NNAA 1PNCA 1WJ3A 3PV6A 4XNAA 3WJLC 4DAGH 1E5CA 4I89A 1RZJC 2CSPA 4YXKH 1UWGH 3WE1A 2JCCB 1F4AA 3BZ5A 2GJPA 2HJKA 4PW9A 4GKNA 5I9QB 1LE9B 2GI7A 1F02I 4M8QB 4UWQB 2B0SL 3GMMA 4XMWA 2Z34A 5TTRA 4L4VB 5FYLD 2D9QB 5EO1A 2ZXAA 4U1JA 5MI0C 2WTPA 2BERA 2YKLH 4KMQA 5F2FA 4Z7VE 3VD9A 1YJDC 3PWUA 5DQJB 1IC0A 5C0BB 2BPBA 3VXME 3LZLA 1Z0NA 2G3ZA 3GC3A 3NFSL 4MXVF 3WXVL 4N90E 4APXB 5K9QG 4KVPA 2IV9A 4KJPD 4NSKB 1M7UA 3O2VH 4HWUA 4XN9A 1OP3H 2AXFB 3Q44A 4HUVB 4YXLH 3SZ6A 2I5YL 1BLNA 3RVWC 4GG6F 1ZHBA 4WTZA 3OPUA 3GSWA 3HN3A 4XHJC 2E9WA 3ZSTA 1DFBL 1HNGA 4PJHF 4TNFA 1MW3A 4HHAA 1ZT1A 4PEEA 4TTDC 4ANKA 1EZUA 5E4EC 5LHDA 3QO1B 3VW3H 1M7IB 3QAZB 2P42B 4GMSL 4FXGB 4BSVB 3ZTJG 3SODB 3E1F1 4HWNA 3MLUL 2CGYA 3OB0K 1SZNA 4PJCA 2CUAA 3N42B 3QZWA 4KHXH 2P7TB 3N5AA 1E3FA 2DJSA 2EIZA 5B1AB 2Q5BA 3DSNA 1DQDL 2B4CL 3A21A 2J88L 2XXCB 1A02N 3C8KB 3CDZA 3OKYA 2ZKXA 4MXQC 4C8XA 1I8AA 3VG0L 3W37A 5JDJA 2V7NB 4KROD 1FIGH 1RMFL 3CFMA 3U7WL 5GRVK 3V0AC 1JUFB 5JDSB 1AANA 3O3DA 3QIWD 3MRIA 2ZWKA 4NJAH 3ARTA 3VXPB 1CR9H 1RHHA 4DPAX 1QI5A 1P7QA 5J3HD 1GOFA 1NDGA 4AV5A 4CMMB 4LQFL 3GLZA 5TDPB 4BXSV 3JV0A 2ICEC 2K3HA 5D1XE 3K2IA 3RZCD 4BE5A 4IBUA 2CXGA 2I7SA 3VMOA 1XF4B 3ISYA 4H7VA 2UV3A 2R29A 4LOUD 4L3FA 4ZMVA 5F72S 1TNNA 4ODXA 3VB8A 2XJLA 2VLME 5KUKA 5CIPA 1VFBB 2IXQB 4K07A 3MREB 2E75C 3QXUA 5F7DB 4AI7A 4ELKB 2AS5M 2AJ3B 2X88A 1ZHLA 3T6XA 1ICTA 4O5LL 4ONGH 1IT9L 2OLDA 5FECB 4GS7C 3Q01A 3KH4A 4JFHE 4LLUB 4TSCH 3GUTA 1LO2H 1QHQA 1K8IB 2JJSC 1GZPA 3GKWH 4KITB 3DV4B 5E23A 5DRWB 3QUHA 5DUML 2ESVA 3LDBB 5IBLC 1U8PB 3QQ9D 4PAZA 1YNTA 4WHYH 1NBVL 4NKIL 1P5VA 4IM8A 3LZQA 2QT6A 4PJ5B 3F58L 1GZQA 2HVJB 3HC0A 4JEGB 4WI0B 1SXBA 4KK8D 3GD1C 4R4FL 3NCYS 2EVJA 1Y0LA 3REVB 3SZKC 1ZTXL 3FUEA 3VYPA 3IPEA 3MRJA 1LGVA 1I3VA 2KZWA 3QIWB 5DD6B 3IFLH 3O2DL 1KIQB 5LCVA 3VH8G 4Z7OF 1NC4B 5I6KA 1YEIL 1JAEA 4RSYA 3MA7B 1E5UI 2J6EA 1PF3A 1S7QB 3TH3T 4ADJA 2QHRL 1E2ZA 2DJMA 4PP1D 2LT9A 4H25B 5AB0A 5KYYA 2DWTA 1Z1WA 1FLTX 5TQ2L 3AXLA 5I6XC 1DANT 1KJVA 2YAHA 3D30A 2JF1A 4ZFOA 3IMRA 4Q0XL 3K0YA 3TZVA 2BIHA 4QY8A 2Z35B 2VERA 3GRGA 1IC5H 4KJWC 4KNSA 2CPCA 2IQAA 3CMGA 4NNYA 5EBWA 3HZYB 4JFDE 3TIEA 2DTML 3T6WA 3VRLF 3KDMB 1WAPA 3SIKA 5DDHA 1DHKA 1X5XA 3QIBA 5AZUA 2NDFA 5D93C 4CVZA 3BP6B 3WMQA 3ZRFC 4P5KA 2GEQA 2V37A 1I3GL 4FFYH 3T0EB 1BQLH 3MV7B 1GOHA 3DBXB 2XIBA 4NNPL 4MKTA 3IN0A 3QQDB 4HUUA 1L3NA 1PAMA 3ARRA 4PJFF 4WI9A 5HDOA 2ESVE 3BUYA 3ZHLA 4PJIA 1PLBA 2OM5A 3BCDA 4QRUA 1E90A 1ZLVK 1AD9B 2AEPH 1UTDA 4JFFB 2Y5TA 3ZJAA 1KENH 4XMZA 2PCXA 3VCLA 4CVXB 4MCZB 1IGTB 1YYMH 2XZQH 3LKOA 3MBEA 1E4KA 4OJFH 3GDBA 4Y4HC 2H8PB 2ZKHL 3KNBB 3PFUA 2VN4A 1CL7I 5F3HB 3VXSD 3CLEL 3STLA 1BFTA 1GH7A 1LXMA 3DX1A 3QA3B 4FC3E 5IVNA 5CGMA 4WNJA 3E80A 1JPEA 2QVFB 3OR7B 4JO4H 5HVGB 3U1PA 1T80A 4DH2A 4LRIA 2XWTA 3C6SB 3QDGB 4XGZB 5FYJL 4G6JL 4N1HB 3K6OA 1NFDF 2H3NA 2K6ZA 3IDXH 5AAMC 3L5XL 2ITCA 4AQOA 1RK0A 5JNYB 1QLRB 4GJTB 4BK5A 2EYRA 4Y5VB 1G9NH 2ARWA 3ROOB 4AM0B 1P2CA 4HDIA 3ELAT 3QJUB 1CZ8H 1AFVL 3UTTE 3KLDA 4F57H 3MRFB 3T6QC 1ZE3C 1A7OH 4TVSa 4HFUL 4NZUL 1P7KB 2KUTA 3SDCB 3TT1H 3QDJA 1TKWB 4GRWF 4JNXA 4MA8L 2I60H 3GSQB 3RPKA 2VISA 1M9WA 3B8SA 3UZVB 4EBQH 1CT8B 3K1KC 4XI5D 1S9WA 1D5IL 2RD0A 2X1PA 1WLHA 4LLWA 1O75A 5G4MA 3DECA 3LS4H 3BMVA 1Q94A 1QD0A 5C0CE 3S88H 1CDCA 4PJIE 2ZUTA 4FEMA 4P57B 4PJ8B 4RCAA 3TCXA 1YEGH 4TTDD 5JQ6L 2CBQA 1JE6A 4AYEC 5DI8A 4PTUB 1NM4A 1M3IA 5DTFB 4XO5A 4CNIB 3O4LB 5E8NB 2VE6A 2OXGB 2VXQH 1RJLA 3MLSH 5CD3B 1KEGL 5EOTB 3H53A 3GSVA 3H3KA 3IDYC 4WFEE 4TRPL 3STZA 5EIIA 2YXVA 3FRPB 3VXSB 4MSWA 2GY5A 4X6DA 2J7LA 2DLIA 2WWKO 4NQED 4UB0H 3RP1A 4JFZH 4M6OH 4ZMPA 2VLJE 1MN4A 3R0MA 1O9WA 3L95A 3G5XA 4U6YB 1T7YA 1ZVSA 3QI9A 4HCRL 3GLEA 5AVZB 4KZEH 5KSVB 1AC0A 1KBGH 2VDLH 4MXQD 4NPKA 1L9QA 3KPSA 3HR6A 1YMMB 4U6XB 1KEMH 2C9QA 4ZD3L 1T5WB 5IB5A 4QLWA 2GSMB 2WP3T 5JIHA 4N2DA 1UC6A 3W56A 1HHKA 3KWWA 3B7TA 1ACCA 1XEDA 3HC3L 3QP3A 25C8H 2CA3A 3N1PC 3LKPB 3TBYB 2NY0C 1VGKB 2ZSWB 3QDJE 4CU6A 4NPYA 4D9LL 1XR9A 1XD1A 5DJYB 5I8EA 4TOYL 2UWEB 2GPZA 4R6UA 2AEIT 2F53B 1U8HA 1S7SA 5L6YH 4AJWA 2F8IA 1WD9A 3IRPX 3MFFA 3FO2B 3P2TA 3QXTA 3QHFH 3B2PA 2R1YB 4MS6A 4YC2B 1CDYA 4KKPA 1IGJA 4UQ2A 5EZIH 4P4KA 1MIMH 2NNCA 3HVNA 4TN9A 4ODHH 3TBTB 5HVHC 4FDWA 1BREA 1CGUA 1H9VA 3S35X 3CN0A 1EZSA 2ZX8A 5GGUA 4PRPA 5ALBH 4O58H 3S96A 4QHPA 3B8YA 4F7PA 2YQGA 1BGXL 4XNMB 1AY1L 5DUBB 1U8NB 3H3BC 4Y8AA 1PG7X 3GIZL 4Q8BA 2FX8H 5KANI 4BJLA 3B9DA 3OQRA 4JFPA 4RMWA 1MCQA 4XWOC 4P3CL 4L3CB 4XVSH 4KTGA 3NPSB 5JO5A 2IMMA 4X6DE 4JQVC 2EVFA 3BHBB 2YD0A 5ELIA 1RZJL 1M56B 3QJHA 3CUPA 4Q2ZA 1I8KB 2L04A 5T1JA 3LKQB 2FAUA 2VDRL 4JR9L 2AV7A 3TO2A 3TYGH 2P5EE 2OW7A 1KTCA 3SSGA 1FYTB 5LBSL 1AGCB 4QOKD 5D71H 5JIPA 3ULVD 2VL5B 1YJDL 2X40A 3M7FB 5K9KB 4MLSA 1EFXB 1J5IA 1MCDA 4I9WE 3ECBB 3P0GB 1E28B 1A6AA 1C5DB 1KIUB 1NPUA 2BY1A 3BN9C 3L9YA 1Q0XH 4CSPA 4NQCD 5JW4Q 1CDGA 1UEMA 1T5XB 2VITA 4KNUA 4H8UA 3NIDE 4QAWA 2R0ZL 4RA0C 5C71A 5GJTL 4MWFB 1LK3H 1LL1A 4N0YH 4QPEA 4NYLB 4HFWA 4Q9QH 5CLXA 3O6FD 3NP4A 5DWUH 5E5UB 1X5GA 4HS8L 1TZHA 1YPZF 4LSDA 4XPTH 4AYFB 2UXGA 2ARJB 3B3BA 2D0FA 4GQQA 4F7EB 1CIUA 1D9KD 1W72A 3EG9B 4N2FA 4NQVB 4HGMA 4YK4B 4KJWD 6FABL 3OVUB 1L0XA 2X9XA 2JFCA 2NW3B 2VSCA 1T03H 4FQHA 4G6MH 4GO8A 4IRJB 4QLRA 1JL8A 1E2WA 4LEBA 3QRGL 4MRBA 4QUOA 1BVKA 4N0CC 5IMOA 3ZR5A 2GEEA 3DURA 3BDYL 3QULB 3AREA 4M48H 3HCVA 4PRBA 3P3SA 2JH2A 3HG3A 2OJZH 3UMTA 4N0UB 2JB6B 4X6FA 4AV4A 1NBQA 3WY2A 4WY7H 4UNVA 5IQ9A 5FYLH 2ZWZA 3R1GL 3TJEH 1FZMB 4XB7A 1FVDA 5I1JL 3W2DL 1BM7A 3O6ML 4G9DB 4GXVH 4YR6B 2KLSA 5TPWH 4KGJA 3V6OA 2X6BA 1JG9A 2R2BA 4KY1L 1OQXA 3P9WB 3EOTL 4W70A 1BP3B 1NIFA 4RDQF 1D7CA 5DLML 1H19A 5FOJA 5IMMB 2X7LB 1U8MB 1NCNA 2QHRH 2ZWYA 3GI9L 4N2IA 4C56A 4HV8A 1DBBH 3CQQA 2Q8AL 1J8HD 5ID1B 2LU4A 4IU2B 3MAWA 4KPHH 4PG9B 3O41B 4FKKA 3OKOA 4JM2D 1V3JA 4R0LA 1VSCA 3TNMB 5C0NC 4W9CC 3PWLB 4Z6AT 4JAMA 4WHYG 4IQHA 3HLAB 4PB9L 4NUQA 4YDJB 2AMUA 2ZG1A 3OQ3B 3HRZB 1BJ1J 3FTGA 3FNKA 3GNMH 5TGBB 4TULL 4KFZC 3BDXA 1D9KB 2K78A 5JQHC 1WWBX 4HKJA 32C2B 2IFFL 4YHLL 4LPYA 5JHMA 2EH7L 5E00B 1J5HA 2RQ8A 2WKGA 4NNPH 3CC5A 4WNQB 4AW4A 5LNEA 3QEGH 3H42L 3U0TB 1RL1A 4M3KB 1NKRA 3PP4L 3DX2A 3FSAA 1JVLA 4FQIL 4HF5L 5I5RA 5IOPB 3UTPE 1QSFE 3GXNA 1B4LA 3VXNA 4JFOA 3MLTA 1MHPL 3MOAL 2JE8A 1HYSD 3LSOA 4U6HB 3U4EA 1ETZA 2F1AA 3FYIB 4P5SA 4S11A 4MAYA 4WLCA 5HYQA 3FU7A 2X4RA 2ZKHH 4OCYL 5KTEL 4Q74A 2EVHA 4EE2A 3V6OE 4FXKB 2XQBH 4PJ9A 1P9MA 4FGMA 4V1DA 5LGJB 2MJWA 2VR9A 3DRQA 1CJYA 4BCYA 2P44B 4Y16D 4LCCA 2BRRL 4OJCA 3T2QA 1U3YA 3QQ3A 4G6JH 4I4WB 4QHMB 5A3IC 1TQCC 4FKHA 5E95B 1F13A 3FUKA 1J8HB 2A6JB 3PP3H 1HI6A 5ACLA 1OHQA 3PF2A 1JERA 1JGEB 3A67H 2CM6A 2HRPL 3HG1D 1CC3A 4JM2B 5SWSD 1B0WA 3HNTL 2ZOLA 4LLQA 1LNUB 1RLWA 2XKNB 2EDMA 3CN2A 4OCLC 1L0QA 3SO5A 3EFFB 2VABA 2VDPL 3MV9D 1AIFB 5DJCA 2AW2A 4TLKA 3RZWA 2CU9A 3JV6B 4PCYA 4ZI8A 3BW9B 2XG4B 4OLWH 5B22A 4L18A 2DYSB 5F9OL 2NY0D 3X3FL 2DQJH 4NB7A 4XP5H 3ZU8A 4CSTA 4M4RB 4ALAC 1WC7B 2E76C 3V4VB 5ILTH 5B8CC 1I1AA 3IE4A 5ANHA 1PQZB 1OE2A 3PHOA 3W82A 2FSDA 3T5WA 3S7GA 3U1SH 3BVDB 5CGBA 4XNYH 2NR6A 4OSUL 4HJ0C 4ZS7H 5B7EA 3G04A 3UAAA 5HTSA 2X38A 5ISZE 5BS0A 3Q05A 1IAMA 3NDYE 2VDMB 2WQVA 4RGND 5TF1L 4PGBA 2XVKA 3RVUD 3UIYA 4WUUB 3W81A 3DJTA 5E4OA 3JSSA 2WOYA 4OFPA 5IJVA 4I18A 1ED3A 4V1DE 5D1ZC 1BIHA 1GGIL 4WIQA 5D6DA 5K1JA 1XXDC 3CDGB 5IBTL 1CYXA 2EDWA 2YC1B 4OLZH 4EDWH 1PJ9A 2GBVA 3VFPA 1XGQA 1YY8A 5D8JH 2M1KA 4DGYL 5JW3H 5AZ2H 4ANWA 2HRHA 4X5QA 5CN2A 3DYOA 1RZGA 2PTTB 4P23C 1M1SA 4M61A 1CFTA 3GXUB 4NRYB 1GJIA 1OGAB 1TF4A 5BUPA 2P47B 1N4XH 3CFCH 4HWBA 1FSKC 5IVXE 4E9WA 4NQDA 4EXPX 4PVLA 2XNAB 3SJVD 1N5AA 2BVQA 2K7PA 3CG8A 3QS3A 5E9DB 3T4AC 3ATDA 4YNYA 2ZKMX 5TE6L 2Y0SA 3PNWA 2PUQT 2YLHA 4LSSL 4JDEA 5E2VL 1I1CA 5KVFL 2YAFA 1Z5LB 4KTDL 3MV8D 1BBDH 1G1KA 1YYCA 4AM0Q 1A6UH 3G6AA 5E4IA 5HGDA 2AJXH 1UKTA 1YO4A 3D4ZA 2PCPB 3GRWA 1XTMA 2XQYK 5DRXA 3DO3A 4K5PA 2IH1A 3GMRA 3U46A 5DHVH 3VG9B 4R26H 1BSIA 2MMXA 2AJSL 4K9JA 1RLBA 1S7RB 1FJ1A 1TJGL 4XPGH 3QPKA 1ZT7B 1TO5A 4P5MB 2Y2TA 4LCWB 4RGNB 4UQ3B 5IB3A 5AW9B 4UT9A 3WAJA 2DF3A 4IOSA 3F12B 4GKZA 2WLZA 5AVVB 1FBIH 1ZK5A 3HZMA 3MJ6A 1QBML 2G9HB 3L4XA 2FEDC 3JXAA 1PGRB 4N0CD 1GJWA 4D0BA 4DQOH 4Z7UB 4LESA 1JGLH 4LSUL 1Z7JA 1T1YB 5JORB 5D7JA 5EUOF 1KTDB 2GJZA 3WEAA 3H6JA 4G80A 3QHZL 2G2NA 5IVZA 2EDTA 3FRUA 2X70B 4K23H 5LXGL 3IJHA 1CU4L 4HEPA 1WAAF 4N6RB 4NBYB 2NMSA 2AABH 2ORBH 4HXBH 4NM8H 4P05A 4S2SA 2YRPA 1N6UA 3ZYZA 1G7JB 5AZEL 2ZUWA 1CDHA 4XOBA 4WW1B 1SFDA 1FAIH 4YHIB 1HHIA 2WTOA 4H40A 2A4ZA 5EZOH 1BOGB 2IPUG 3IFNL 2H2SC 3SJVB 4F8PA 2OI9B 1F4HA 2P8PB 4TM9A 4JKLA 1U3HA 3AT8A 4NRXA 4WK0B 3VRIA 2HG5B 3QZMA 1NGPH 1RZFH 3DX9A 2I7OA 3EJZC 3S6CA 3TEUA 4FMFA 1A7RH 3G9AB 3MV8B 3G5ZA 3Q8AA 4YSAA 3OXSA 4PRIB 4F9LA 3LNIA 4LF3A 3TYFA 5F7FA 4G1MA 1HQ4A 5KBPA 3TNNA 3UC2A 1J05B 1PVHA 2IBBA 3VE0B 3L9RB 4XN5A 4X0KB 5IQLA 3UGXA 1EERB 2ZICA 3LPPA 3PQYB 3L3JB 5F7MC 3NJXA 4DTGL 3DIFB 3VD5A 3EO1A 1CGVA 3UO1L 5EEXA 1MRCH 1ILSA 5IG7B 1L9MA 1KXVC 2PTUA 2AEOA 3CE1A 3MROB 3JWNE 3R1GH 1NKGA 4QIRA 1UD6A 2NLJA 4G6KL 5ICXA 3U4AA 4ZOEA 4EVNB 5BMFH 3DTXB 3O6MH 4HUWA 2P8MB 5JQIB 3LPGA 1S5IL 1MFMA 3UROR 1AZBA 1LLAA 4KDTA 3HR5B 3EOTH 2B20A 2UY7A 4PWGA 5IIEA 1AKJA 4K7PL 3NZ8A 1SJVA 4D9RD 1PBYA 4XVJL 5A2JH 1KJ2A 3GI9H 3MCYA 5F89B 3NCYP 2B1OA 1O5PA 2A0LD 3UDWA 3Q6FB 3UZEA 1R3HB 3SYAA 4OZFH 3C60A 5KOVC 5KW9L 3IETA 2MPVA 2PPEA 3V7AE 5A3ID 5GS3A 2JVUA 4F15B 1BXUA 5JHLL 5IFJB 1C8PA 3GSXA 4KKQA 5DR5L 3SBRA 1MI5D 1MREH 4XPHH 3C6LC 2QMKA 4UOW1 2O1AA 5GS1C 4AUJA 1KLUA 1FZJB 1PIFA 5C09E 1MEXH 2DJUA 3IJSB 4APQD 5HHQA 2HX7A 2IWKA 4MMYB 5J89A 4L8SC 3NCBB 4PJDB 7PAZA 2DD8L 3H42H 2XX1A 4ZUTA 1B0GB 2C3WA 4DPBX 4MDIA 5GRVL 5CXPA 1U33A 2D4FA 1CTNA 3OD3A 2VQ1A 2OYKA 3DTUB 2B59A 1EJ6A 2ED9A 1RZIA 5J57B 3GHBL 1D2OA 3H4HA 4FULA 4ZX5A 1X7SA 4OM1H 3PUUA 4ZFFA 3ULVH 1EZVX 2WGXA 1RH8A 4P48A 2ITDB 3HUJA 1I53A 3ESUF 1XGZA 3HZKB 4DGUA 1P5UA 1JRHH 1UH3A 3X11B 4QHUB 4NENA 3QR1A 1HL9A 1WZ1H 3EJYC 4J5VA 2BSRA 5B21A 5CJQH 2PO6A 4P07A 2WOBA 4U1SA 3T1WA 2C1OA 3SGEH 3LRLA 5DJ6B 3KJ4B 2HKAA 1E2VA 4IRSA 2ZKWA 5LN4A 1ADQH 1ZMYA 1KGUA 5E1AA 5E2UL 1N0XL 3UACA 2XZAH 2Y7SA 4HQQL 4R9HA 2Z91A 3T8XA 4KGLA 1C5BH 1FZOB 2OMBA 1O6TA 3BIBX 5DJDA 1E9PB 4GAJL 3V8CA 3ETSA 4KRPB 1ND0A 1RUKL 5SWQB 4KI5E 3QH3A 4LCIH 3P40A 3H9SE 5GS2D 5I1EL 3ILEA 1KB9K 3L3OC 3BQUC 2FD6L 1TQTA 3QG6A 1Z9NA 4QRQA 1DVFC 1JD9A 4HBCH 4JKPH 3ABKB 4YHPA 4AV0A 3G08A 3CFBA 3M45A 4FNLH 5EOCL 5BZWB 3V5DB 3WKMH 1BFVH 5BZDB 3KDPB 1F2QA 1MLCA 4XMPH 4HOXA 3D39B 5K59F 5EEVA 4Z18A 5KAQG 3EHBD 3EOYG 5FGSA 4HMDA 1AYRA 5A16A 1JWSA 1ZD6A 1JNNL 4O2FA 4ERSL 1UGNA 2F19L 4XO3A 3PJSB 1CQYA 3RY5A 1SQ2N 1UKSA 1OT4A 2OL3L 4IS6B 2IDCA 3OKDB 3GB7A 3HMWH 4ZTEA 1FFOA 1OK8A 3EADA 4EN3C 4WHTB 4BXVA 2W9DL 3EZJB 1HT6A 4XH2A 2JXMA 5JIMA 3HZVB 1ZV2A 4O02A 1UYWL 2AKRA 4UQEA 4GQPH 3FHEA 4TLTA 4ZTPH 5D7IA 4DESA 4NQUA 3HPJB 3H54A 3FT3B 5CR1A 2LLGA 1RY7B 1ZWIB 3FB6A 2WJ7A 4XPFL 5I9QC 3TPUB 1EEYB 3HEIB 2V5SA 1UT2A 1XR8A 5I8CB 1YY9D 2MOQA 1PDKB 1LD9B 3S2AA 4HPHA 2FRGP 4GBXA 4J6RH 3C6EA 1DTUA 1YN7B 4FQ2H 1PKQB 2WYZA 3L5WA 1EDHA 4LOFA 1L5GB 3V4VH 1DQIA 2ZYIA 3ARQA 4S1QH 1UKQA 3CBJB 5GSRA 3IKCB 3OKMA 1SMAA 4NT6B 5CUSL 3JT0A 1GJUA 1EDQA 4TNEA 4FA6A 1I1YA 4NLHA 4ELME 4OQ1A 5J8OA 4X98A 3UP6A 3KYOB 3WTWA 1KYFA 4ALAL 2PR4H 4N0RA 2ZE0A 1YEWA 2VDMH 4X9FA 2FWSA 4WUKH 3EDFA 1CTMA 4Y5YA 4L8CB 4JFEB 5K1NA 4ZPVB 3RIFK 12E8L 3DRTB 4P2OA 1H8OA 1HNFA 4ISVB 2VZOA 3GIVB 3QO0A 3LD8C 2AJSH 2BNQA 3EHBB 3R06A 3T0DA 2G75B 2OMXB 1QRND 4G8GD 3SDAC 3DJZA 5EF1A 2LAGB 3MYJA 2M83A 2BSTA 4JO2H 5ANMB 4LLYB 1JYXA 2R1WB 2MQGA 1RVFL 3FQXA 1UD3A 4BZ1L 1UXSA 1JPGB 1QFUL 4XOCA 4OFDA 4OF0A 1CVSC 5FUZL 2DH3A 4TF4A 3CVHL 3UPRB 3PUCA 4Z0BH 4ZFGH 1E67A 1UZ6E 4OCWH 3IMVA 4XXWC 4X7EC 1YNKH 2AQNA 3EOBA 5GQBA 2APBA 3QHZH 3SKNB 3HI5H 3K4ZA 4P2CG 3E8VA 5EU5A 4L37A 4J8QA 2GW5A 1BF2A 4Q56A 1I9JL 5DEJA 4FL4C 2ZXCA 4B3VA 2D3VA 3TFBA 4LASH 2WBJC 3FRPG 1GIGL 1XGTA 3E2HC 2GAZB 2V8LA 1RULH 3GBNL 2B16A 3JTSA 4WQOA 1UOVA 5EF3A 3KPMA 1JHTB 3MRNA 3MUUA 2ADFH 5ITFB 3UTSB 3M1OA 3WNIA 2XFXA 1AZVA 3DMMD 4PJHA 1MQ8A 1Q1PA 2VR7A 1PLGL 5DVLA 3PWVA 2YUZA 5EUKA 4WW2F 1DDHA 1XB8A 2DWEB 3OLIA 3FB5B 4YX2H 2E3VA 2F08A 1GHFH 1NOAA 1WBXA 1UD8A 1YQVL 1YDPB 5TE7H 4OCRH 5AG8A 2NNAB 4N0FB 2BNQE 5E8PA 3PV6B 4LEOA 1QFWM 5I17A 3VXRE 4A2DA 5E5MA 4TQHA 2AQ2A 2DBLH 1JZ8A 2Q9OA 1QRNB 2W9EL 1BX2B 1EIBA 4G8GB 1VPOL 5CGYD 3SDYH 4OFQA 2EE9A 2R1XA 2BSED 3GMMB 3R19A 4PGCA 2ADGA 5J1TC 2FT6A 4Z1PA 5T1DH 3PWUB 3U0WL 4PRNB 1MJ8L 3F6LA 3WY4A 4RMVA 2AQ3A 2W0FA 4N6QA 4X5RA 1A3ZA 1TLKA 1Z32X 5KSBA 3QJOA 1VFMA 5C0EB 4JQIH 2QZ5A 1BLNB 4MLIA 5AEAA 2XJKA 1IC1A 1ZHBB 2X3CA 4FMKA 5T5FL 3VFMA 1JZ3A 1GYCA 2RCSL 1EUUA 1XZ0B 2DYPD 1ZT1B 2J20A 4HHAB 1IBGL 5B1JC 2BLFA 2WIIB 4YJZL 3Q06A 5KW9H 3QC6X 4JRXE 4LFHD 1HSBB 3DMMB 3UYRL 3AS3A 4PJCB 3OF6D 1I7TA 5GGQH 5KYUB 1ZEAL 3QZWB 2XWEA 3P0VL 2BO0A 3STBA 2WKLA 3GSRA 2XBDA 3FUJA 3QWRD 3FN9A 1VGEL 2XRAL 2WXJA 2XKUA 3DGGB 4H8WH 4CU7A 5FYJE 4J3TA 2GQHA 3GXFA 3CDZB 1TIUA 3WFBH 2KHAA 3HG5A 3HS0A 2C7FA 1R5IA 3ME0A 3RVTC 2ERJB 1A7QH 4PJBF 2ZNWA 4PS3A 3FTUA 3O3DB 1X4XA 3NCWA 3MRIB 3P4OA 3U7YL 2HT3C 4NN5C 4ELMF 1Z9SA 1B2WH 4OZFG 1KLFB 1P7QB 3CK0H 1NDGB 1N9PA 4FFWD 2XLLA 3F7YB 5EC1A 2F2HA 2YEZB 3FQUA 5G4OA 3MLPA 2Y06H 1FNFA 1MCFA 4JO3L 4YFLF 3GLAA 2EDXA 1H8SA 2IWEA 4QRAA 5I1IL 5KSBE 3K6DA 4OFVA 4MMZA 3C12A 1SEBA 1IM3A 4K3EL 1RSFA 2UZPA 5D4QA 2G0LA 4H5SA 2CIIA 4GRMA 1JWMA 3L7EB 4EN3D 5K69A 3MLRH 5E6IA 5CJXA 4M5SA 5CIPB 1JZ5A 3VNYA 1TETH 3OXRB 2DYPB 2WNKA 4OF8A 3ZDYE 1NCOA 4HJGA 4EI5A 2PLTA 3TA4D 1I7RA 4M9OA 1R24B 4QRSA 1ZHLB 4S1DC 4MD5A 5C9KA 2SODB 2YMXL 4Y5VC 3BLPX 1DQMH 3FPYA 4IYKA 5DEFA 5GS0C 4WF7A 1OW0C 1XBDA 3GUTB 4FQLL 4IBVA 5E99H 1RXLA 1GZPB 2WUCL 5IKCA 3BRDA 1OLLA 3I3BA 1UM6H 3N41B 3D05A 4FXTA 3L4CA 4XNXH 2ADIA 1J0YA 2C8NA 1F4WL 3OZ9L 4MQ7B 4ZMZA 3CZNA 3U7AA 4AVHA 2WZ0A 4XXCC 4YDIL 3H55A 5HYEA 4OGQC 3B9KD 3LKRA 1GZQB 1WHOA 5TH2A 4A2FA 4RETB 5EOCH 3PCYA 2R0LL 4M7LL 1KULA 4IEFB 2VR6A 2P5PA 5FDYA 3TBWA 5J06A 5IFHH 3LKNA 1UCBL 4RBPK 1Y0LB 4Z7QB 5DK0B 1MKFA 1HILA 4YO0A 1HKLH 2WANA 2VC2B 4WWKC 3EH3B 2WO2B 4YFEA 4I1RA 4JDTL 1ULVA 5CKAA 3EO9L 1NCGA 1AE6H 1H9DA 1T89C 3C08H 1YEFH 4J8RB 4K4KA 4DP2X 1A3LH 5IGXH 4CVUA 1KUMA 2ODIA 1YYLL 4PJAF 1OSEA 1UA7A 5FGBA 3SDAD 4X8JA 1KJVB 3QBTB 1U4EA 1RK7A 2X1OA 4K3HA 4FERA 4ZFOB 1Z0MA 3QYNA 1KPUA 2Z6FA 1PYWB 5HI4D 4DW2L 4NNYB 3K71B 2CJSA 2IQAB 5EBWB 2ZIDA 1J1XL 3OKNB 2X12A 5GJSL 3EYFA 2SEBA 1MIEH 4XPFH 4HJSA 2X6CA 1Q90A 5DDHB 3BAEH 1IBYA 2VGLM 4CVZB 1J0ZA 4OFYA 4KTEH 3D3VA 2RIKA 4UTBH 4XNQA 1LDPH 4K5MA 4KX9A 3QWOB 3K8LA 4HUUB 5D7LE 4FTVD 3S3CB 2WLYA 1FVCA 2Z93A 3LH8A 2QFRA 3KXFD 4E5XG 3L6FA 3VGHA 4M5YL 3TWCH 4FQCH 2X4TB 2WBJD 4HX1B 3FU3A 1QSEE 2E7DA 3S98A 3LYRA 4U3CA 3VCLB 1CGTA 3B9KB 4UTAH 2C9RA 4XMTA 1NAML 5KSAD 1IFHL 3LKOB 3MBEB 3Q43A 2BW4A 3RHWF 4DGVL 5D5MB 5KG9A 1OM3L 4WKZA 4GINA 3W9DA 3BUDA 2DWDA 5EEYA 2EDJA 3HS9A 3QFJA 4ATTA 3UYPA 3QJTB 2ZXQA 1VADA 3QYMA 4BK8A 4AQZA 3LXAA 4L8BA 3BPLC 1KZQA 5BRZA 3BGMA 1E40A 4YSEA 4LPCA 1BVNP 4Z7AA 3WTUA 3A6BH 2H3NB 1FPTL 3FONB 3NH7H 1RK0B 3IDIA 1T0NB 5CFHA 3QCVL 1H8LA 1T1WA 2EYRB 1DQLL 1QNIA 4HDIB 4ZMWA 3WOVA 1CF1A 3V8OA 4M43L 1JGUL 2J4WH 2OBGA 3KCPA 1AJ7H 3ESOA 1X9QA 1A0QH 1OGPA 4M8UA 4NRZA 1RFDH 1YEJL 3AFLA 1MH5B 3MTXA 5MHSE 1N59A 3TIDB 1K5NB 3HAEB 4X2UA 4FE9A 1I9JH 2OXHA 1S9WB 3W5NA 2DM7A 5TF0A 4NJ9L 3FFCD 4QKXB 3MVSA 3N85H 2PXYB 5JPNC 1Q94B 2XPYA 5GSVA 2IGTA 9CGTA 1B0RA 3HE7A 3GMPB 5FM5O 4AK1A 1E6OH 3WKYA 4XE0A 1QFOA 1OTUC 4RFOL 4JCMA 2XIIA 1ZT4B 4HYTB 2VAJA 2NNRA 5DI8B 1SY6A 2C3GA 2FWUA 1MNUH 1X7QA 2VE6B 3FZUD 3II3A 1UG9A 3GSVB 2LTQC 2Y25A 4PWKA 1PAZA 3IDGA 3OG6B 1R46A 3QFJE 1AZZC 4PPTA 4FFZH 3UPAA 4E9LA 4L4JA 5EIIB 1OAZH 4LDCA 3STZB 2FK9A 5IP4A 3DK0A 2C9XA 2DM3A 2FHCA 4FI6A 2FATL 4GSDH 4WEUD 3NJGA 3MRGA 3RNQB 5BRZE 4G8AC 2G4GA 4MVBC 3AM8A 3L95B 1A22B 1NWOA 3CBKB 4JN2A 2J8UB 4IRJC 4PWJA 4OB5L 5J12B 4XCYA 1QFHA 1ZVSB 2P1YA 3LIZL 3MRCB 3QI9B 5LGHH 3RUGB 2R23A 1Z5HA 4TLUA 3KPNA 4AT6A 3RAJH 4OLYL 5TFSL 1G0DA 4QTIH 3KPSB 5F9DC 3ALWA 1MFDH 3OLEA 1IC4H 4FZEH 3O2WH 3MCLL 4KHTL 3U0WH 1HHKB 1MJ8H 3TO4D 4ZG1A 1A9VA 5CEZE 2XPZA 3BYYA 2FX9L 5D1QA 3H2WA 4B96A 4GMTH 4LK4A 1NCDL 1V3KA 3QORA 1ZDQA 1QVOB 2F1EA 5I8EB 2HN7B 4QNPF 3BIKA 3GHEH 5F71A 4U2YA 4UNIA 4F80A 1U8HB 1S7SB 3TVMA 1C5CL 3RX7A 1BDYA 1OALA 1QBLH 1QSVA 1E7VA 3L08A 2RCSH 4X7SH 3P2BA 4X9BA 4ZUWA 3PRZA 4F7CA 3FCSB 4FZ8H 5HHMD 1IGJB 5GGSB 3RX8A 1KN2H 2ZP9A 1HXMB 5EB9A 5L2JA 2E7CA 1UWYA 3NAAL 5GGUB 4PRPB 3C75A 2BIIA 3AW5A 1RCYA 5TDOB 2NY3C 5BV7B 4DVRH 1YPZA 4F7PB 1H6EA 3DPDA 4TS6A 3HI6L 5MENE 1QEWB 1NCBH 5FYKD 4S1DD 4GEJA 4I7ZC 1PS3A 2O6EA 2BNRA 1MFCH 1KB3A 4F3FB 2BDNH 2E4FA 4AZ8A 5JO5B 1KJMA 1DCLA 3T8MA 4KUZL 1MVUB 4I5BA 2BOLA 1TDQA 3QJHB 3CUPB 4Q2ZB 4HIIA 4DEPB 3VI4E 3TO2B 4UV7H 2AV7B 2J43A 5D7SH 5EA0L 1Z9LA 1NUFA 5I0WA 4XN4A 1TJMA 4XCNA 3II2A 5DEGA 4AZUA 5I1DB 2AK4A 2NZIA 2WQSA 5GGSY 5IJKC 1QFPA 4HWEH 1NFAA 4HW6A 4QMEA 2DQ6A 2ZWLT 1IILE 1GZHC 4KAQL 3TO4B 4HALA 1UH4A 5FC9A 1KFAH 4Y1AD 1GGTA 4NZDA 1CLOH 3BQVA 3UMNA 3VDBA 1HCVA 2O5NA 3RWDB 4AIOA 4FXKC 1NKOA 4HFWB 2JKWA 1UEYA 2CCVA 2I07A 3OPZL 4L29A 1NINA 5IBUB 4PS4L 1MPAL 1RKRA 5HHMB 4IBQA 4HIJA 5MEOA 5AVQB 3SDDA 2K70A 2NY5H 1HEZB 1TYRA 4AMKL 1EK3A 3NTCL 4GW1B 4BHUA 1BWWA 4FQHB 3B6SA 3X1GA 4YE4H 3ZE1E 5IQ7L 1F8TH 3OJDA 2MSPA 4G6FB 1LWHA 4GKSB 1VRSA 4LVEA 5CZKA 2XG5A 1LEGB 1EQWA 4B53A 3EYUH 4PRBB 4G9FE 1IBFA 1Y1UA 2QGDA 4K9EH 4HZAA 4YWGH 4LDLB 5C3IA 5DJXA 2WQWA 3WIHL 2VLRD 2A74B 1EAPA 1FVDB 2FT7A 4HKBA 2F54A 5DUPL 1MFEL 2HA1A 3BSZH 1N5YH 1Q0YL 2NZ1A 1OB0A 2W59A 2R2BB 1FDLL 2GJ6E 5J5EA 4JFYB 5EFIA 3WHXB 1MHCA 3FTSA 4XBEH 2CJUH 2R29H 4K8RH 4M1DL 1PCSA 3OAYH 1ID5I 2BFVH 3EO9H 1AZNA 5I75C 4C56B 2L0DA 3V55A 4K2UL 4HV8B 2O72A 3VXTA 5CIPH 3AQDA 3KLLA 4M5ZH 4GI8A 3ZDZE 1HE8A 1LO4L 2JELH 1SXZA 3BSHA 2JI3A 4ACTA 3OKOB 2V5YA 5D2NB 4HIHA 4R0LB 3UJTL 4CMHB 4JAMB 4YUEL 4H4NA 3CH1A 4OV5A 3FO0L 5K9JL 5CN1A 2A77H 4M00A 2OCCB 1N19A 3FTGB 4YSPA 3X1FA 3CHRA 3I2CH 2N7SA 4EI0A 5EMYA 5CLWA 1EVTC 2GIMA 4HKJB 3GPSA 3V5KB 2RMNA 4YHZL 4BQ9A 2DL2A 2ED6A 3VH8A 1U8JB 5GS0L 1UOWA 1TNMA 1U8OA 3ZMEA 1ZANL 5BZXA 5E9NA 4PY7A 1WTGT 1E6JL 1EXUA 5FFOA 2YJQA 2EVIA 4TUUA 2BOCB 4GQRA 4NZFA 5ABAA 1U93B 3D08A 2Y72A 2X2HA 3UGEA 4GAAA 2X09A 2YWYA 2EUXA 2AJZA 3MLTB 2VLKD 4JHAH 2VC2H 2Y7QA 4M6NL 3ZE0B 2F54E 3FW6A 2X4RB 1HESA 4Z7NE 1H3VA 4E41E 2H41A 5IHUL 3CV5A 1K8DA 3F62A 3M8OL 4PJ9B 2ZAHA 5T1LD 2J2ZA 1P6FA 4OGYH 2VXUH 4MCNA 4HC1L 3VG9C 2K1MA 5C9JA 5IHLB 3QQ3B 4PJGA 3B2VH 3BUPA 3L3HB 5C2UB 4LDEB 3D50A 1KOAA 4XP6H 4I13B 3MGOA 4MNQD 4OKVA 2A1WH 3R8QA 4N2BA 5AW3B 3T2NL 2HZHA 2M26A 3D25B 4MMXA 3AAZB 1MCPH 5KJ4A 1MCWM 4LLQB 3IBOA 4DP6X 1RUAH 2RAMA 3B7SA 1HOCA 2YUXA 4L3ED 1X3DA 1XEUA 4YHNB 2V5TA 3BDBA 4OTXH 3MX0A 1UJTA 4UAOB 1CLZH 4AE1A 3ARGD 3ML9A 4AKQA 2YSTA 2R4SH 5EOQH 1HVXA 5KSUB 1Q4NX 1P0SE 2ZPKH 2P4AB 2FBJL 2Z64C 1I1AB 1A4JB 2ZX5A 5HY9A 3FQWB 1XCXA 2D31B 4HEME 3MPCA 2WIMA 3PJLA 4OQTL 5KVEE 2ZXEB 4RNRB 4EEEA 2IDUA 2DKSA 1AKPA 4Q58C 1XZWA 4BFJA 4R8WH 4HAFA 2VLKB 4QI3A 1Y18B 2IADB 2NX5D 4B50A 1YUHB 4KKAC 4F8QA 4X80H 4BSWB 1DANU 2E8YA 3O81A 1ADWA 5LB1A 4I18B 5J9PA 1HIMH 5T1LB 3AU0A 4JY4A 4XP1H 1E4XI 4HZ1A 4OD3H 1YEHL 1EBAA 5E1IA 5F8RC 5F7HA 1MUJA 3QDMA 4IIQC 3LY6A 1RZ7H 1ZY9A 3ZE1F 2XN2A 1NAKH 1ZVHA 4OB5H 2Q10A 4NERA 4HPYL 3PGDA 2VR4A 4I0PD 3IMWA 4JREB 3W11D 5IVOA 4MNQB 2VUYA 4OGXL 3WNNA 5F7NC 3UPCA 4QRRD 2OK0L 5EUOA 3HAEH 2H1XA 1OB1A 3J2PA 4BCXA 5JIIA 1QFWH 3D0VA 5SWZD 4W9DC 3CFDA 3PL6D 3CVDA 1H3PH 4NQDB 3P30L 4LU5L 5CZRA 1N2RA 2BVQB 2F5AH 1N12A 2X4SB 4FQJH 1UVQA 4WJ5A 3QPXL 4N2LA 4YNYB 1T4WA 2CGRL 3PNWB 3VGGA 1T7VA 4JDEB 2R4RH 1CDBA 3ARGB 3KR3L 4Y4FA 2ATPA 3I9GL 1PJWA 1XMWA 2QQLH 3LB6D 5EU4A 3VFSA 1HZHL 3QS2A 5IHZA 2GIYA 3G6AB 4GLRI 5HGDB 1WA2X 1M2VA 1UM5L 3NAAH 1IU1A 4I9XA 2EH8H 1PFOA 2IH1B 3HN8A 1AGDA 1THCA 1XCQA 4J12A 3TA3A 3U4BL 1HHHA 1TYEB 1JN6A 5KVDH 5L7XL 4HHWA 5B39B 5C08D 5HDQL 5IB3B 2NX5B 2IOOA 2Y7OA 3D06A 3KJ6L 4X4XB 5FW6A 1HFUA 3CXFA 4BWTA 2ZOWA 4A63A 3NCXA 4KK6C 2NY1B 4RZCA 5BQ7A 3QDME 1BQ5A 5EA0H 2ZUVA 5D7JB 1UADC 2GJZB 3T3PE 4G80B 1P6WA 1RZKC 1AGBA 1KLGA 5CCJA 4I0PB 2F1BA 3IJHB 2HTLC 2XTJB 3ILPA 5IJDC 2X6MA 4XCEB 3LH2L 4S2SB 6PCYA 1LJMA 5E8DL 2RACA 5JXAH 4QRRB 3LQAH 1IBZA 5HSFA 5T33H 2WYIA 1QLFA 1WCQA 1HHIB 3KG5A 1OT1A 1U6AH 3KYKH 1E0OB 3NJFA 4Z7NF 2HLAA 4Y4KD 3MLVH 3QUXC 1U3HB 4NRXB 3FQNA 4XMUA 1WFTA 1I8LA 2FO8A 3OPZH 1M4KA 5G5DB 5C92A 3DX9B 2C1PA 4CAGA 5BV7H 2BFGA 5DMIH 5LUMA 1KCLA 4XO8A 3TEZA 5DJ8A 3HE6A 1YRKA 5CP7A 1IM9D 1CL7L 4I77L 2H2PC 3OXSB 3F7QA 4P3WA 4LF3B 3DOSB 4JG1H 1CVRA 4H20L 5HJGA 4G1MB 1HQ4B 3U36A 3UCQA 1F97A 3GZOA 2MTPA 4U1IA 1AZUA 1EAJA 4N9OB 5INDB 1EVUA 2EQDA 1NANH 2A9NH 1ZDSA 3QDAA 1FNGB 2J56A 5C08B 3UL4A 5JYMA 3W9EA 2NUTB 5I8OH 2X41A 3EO1B 3TEWA 3OHXB 1NWPA 5EO9B 2WXIA 4ABUA 4PG2A 5HJ3B 2BHUA 1ROCA 2EE0A 4YN3A 4F1SA 1PNDA 1FE8L 4N3UA 4R4ND 2FX7L 2NTFB 4MJIA 3V9EA 2NLJB 1MCLA 2VDKB 4NAQA 4HUWB 1MFEH 2Y22A 2A7BA 4FFTA 4MRCA 5F93C 3KPRD 1V27A 5EU6A 1EHKB 2PP9A 3CSFA 4MQXD 1HE7A 5T1KD 4AW7A 1G0XA 5IIEB 4YDKH 2WQ8A 4M1DH 3CVCA 4L1SA 2PPCA 4EZJA 1KJ2B 2YZ1A 3V52L 3C5ZD 3QUKB 3K2KA 3GO1L 4F58H 5BO0D 2G5BA 2DJ4A 2JQZA 1MJUL 2KZ1B 4ZZKA 3ARBD 4NO2A 5FDWA 3I6KA 3PAVA 2X2YA 3F7LA 4BDVA 2UYLB 4JFQA 5IR1A 2FJGA 3DHJA 3MODH 3GSXB 4LLDA 1KCUH 3ROLA 5GZOD 5IEKA 1FQ9C 3V4UH 3QEQA 4DK3A 2NY4D 5CU5A 2ZG3A 2Z8VC 2E6JA 3NSDA 5FYKH 3HNVL 1KLUB 2QVTA 5AOIA 1AR1B 4B6ZA 4PRHE 5KYXA 4O51A 2AFNA 5HHXL 1ZSHA 4OZGE 3RTQA 1AQHA 2HLFD 5D2LA 4ZUTB 3B83A 3WNLA 3QUYD 4WJKB 4B9ZA 5B4MC 1E8ZA 1S7WA 4TL5A 1T6BX 3Q48A 2DIEA 5C0DB 1UHVA 3BO8A 3DIDA 3L3DB 2VUOA 1OAXH 2WSKA 1TJHL 1TTRA 2VQ1B 4KKCC 4R90L 5MERB 4EDXA 4JUTA 1YQ2A 1LP9A 2UXVA 4JRFA 4E42A 2EVGA 2O5ZH 4ESKA 5CEYA 4YHKH 4NHCH 1RZIB 3P3UA 4N5EC 5IZ7A 2EXYC 4D94A 2E27L 2D7MA 3HUJB 3K5SA 5E8EB 4HHGA 1P5UB 4LFHG 1NBYA 3KPRB 3ZLQC 2WZ5A 4NENB 4KWUA 5ESQA 1IAIM 1RURL 3MKKA 1Q9WA 4WI8A 2BSRB 1DL7H 1YEKH 4Z7WE 3W5MA 4PMFA 4BA0A 1IARB 2PO6B 1FHGA 4KRMB 4U1SB 3ZE2E 2C1OB 2Y07L 1A6WH 1G7QA 2DQDH 2MPAH 4AXWA 5JA9A 2Y3NA 4U33A 3VWJC 1UJ3C 1K85A 4LIQL 4PTTA 5D96B 2VZUA 2Y5QA 1ORQB 4N9GA 5E1AB 3T2NH 3ARBB 1QBBA 3UJJH 5SX4H 1IL1A 2Z91B 4Q6IA 5CBAA 3QEQE 2YIHA 3NYKA 1ORSA 2NW2A 3OTTA 5DJDB 4GUOA 3BPCA 3OZLA 5I0VA 1TZGL 4K71C 3QZPA 4IDJH 4PJ7F 3EJUA 3T3PF 5J4MA 4YL4A 3PY9A 2EC9U 3VI3B 4LPWA 3QJVB 3RY4A 3QRFM 3EBAA 2UUDK 1UWEH 4WTXA 3ARSA 4JPVL 4RGOL 3ARFA 5IROA 5K5YA 4QRQB 5D2LE 1INDH 4U1HB 4YOKA 2OCJA 2P80A 4YHPB 3VWKA 1KWGA 3G08B 3CFBB 3GJEA 4Y9FA 2F6AA 4Z5RA 2J6WA 2Q76A 4FFYA 1AHWC 4NQXB 1ZSDA 1RZQA 1QUPA 5LDUA 2EYSA 4GW4A 1EBPA 4AIZA 2XZCH 1CICA 1JWSB 5CZXD 5F7EL 5F88A 4ADIA 4U3SA 4XZUB 3Q9PA 3QCTL 3FFDA 1D5RA 4PLKC 3PXLA 1DBML 3RGBA 1DVTA 1IQWL 2XKSA 1FFOB 1WICA 2OMYB 2GK0A 2ZAGA 3L16A 2D7TL 3MTRA 4QRPE 5C0AE 1BF5A 1NOFA 4P9MH 5FUCE 1IGIL 4NCC1 4ZSOA 3UC0L 2YLKA 1NUGA 3JV5A 2HT4C 2OZ4L 3P3YA 2C5DC 1R34A 2IJ0C 3GMOA 5F97E 1MLBA 2RGSA 4WI4A 4D9QE 1WUNT 3BVUA 4JVWA 1KY7A 1LK2A 2YGVA 4IRZA 4ODTL 1DVXA 3GGWA 1R3KA 1WEJH 2GFBB 3JTBA 1EHAA 4JN1H 1XDTT 1EEUA 1AS6A 4GBXB 3RKPA 1JZJA 1FL5A 3NJMA 1DE4A 2YPLD 2HTLD 4UT7L 1BM3H 2NCEA 2J72A 4FQXD 2UZIL 2CR0A 3AJ7A 3NCJH 2ALAA 1YN6A 5D1XC 4X4KA 1I1YB 1IIKA 2Z3FA 5HYJA 5AD0A 1JD7A 2DI8A 3O9WD 3I9GH 2UY6A 4XNUH 1V7MH 2HCZX 5C0JA 3KL0A 4ENEC 1BFOA 1JDCA 5LO7A 5AAWA 4EIUA 4KMTH 4Y5YB 2R56L 1MJJA 2M2DA 3WEMA 3RFZA 4G43A 5GGRB 3SQOL 1AS8A 2H47C 3QO0B 2WN3A 5DD5H 2Y2YA 4KNTA 4F7MA 3R06B 4WW2A 2H2PD 4XT1C 2F7OA 5L7XH 4PMEA 5SX5K 1VFAB 5C86A 3MYJB 5BQDA 3C09B 2BIQA 3HAEG 6PAZA 3FQXB 1JSYA 4PJXA 3DSFL 5C07D 4AYGA 1JV5A 2D7NA 5C0GA 4JZNB 3FTYA 1LMIA 2VXQA 1HL4A 4Q9BA 4JQXA 4PBXA 2DWYA 2KDYA 4MJ6A 3JZYA 4OZGF 4LQ1A 4MHHG 1B0IA 1F4YL 2XICA 2R15A 3EOBB 3HN5A 5TK2A 2CCLA 2P8LB 1T20B 5KWYC 4L37B 3CCHA 3LMJH 4H88H 5E2WL 1CXHA 1FFNA 4DUWA 2PNDA 2ZXWB 3P2DA 3ORJA 3ASWA 3D69A 4LSQL 4XAKE 1MRFL 5GGRY 1CLYH 1QR1A 5FM5M 3K6FA 2DQGH 2PF6A 3GQFA 4XMKH 1NC2A 5FKAA 3C2SA 3JTSB 4MJJA 5FX3A 3KPMB 3MRNB 3VXUD 2FO4A 5DCCA 4UMGA 4GG6B 3OX8A 1T0PB 4PJHB 1BAGA 3TEYA 4ANXA 2B14A 4GT7A 3ZKSD 1U3ZA 3PWVB 3O9WB 5EUKB 1D7BA 3I02A 4PLOB 2NY6D 4XB8A 4DPRA 5KS9F 3Q2LA 5ENWA 4KXZH 1WBXB 4MKMA 3QJFA 1NLBH 4P2QE 1L7TH 1XVSA 1RIHL 3GXDA 3QE5A 2L3BA 5E8PB 5FGCB 1PY4A 4LEOB 3MRDA 1ZLSH 5I17B 3LX9A 1S7VB 4WFHE 2N4IA 2VQ4A 3FH5A 5E1GA 4NUGH 4ZXBD 5T3XH 1FGNH 2DEWX 4PJEF 3SY6A 4GSRA 2R69L 5L4MA 2YAEA 1ASPA 2GITA 2AJVL 4PJXE 4TQIA 1VZIA 1BIIB 3B2MA 2R1XB 4WI7A 1P69B 5C07B 5EG6C 3T0AA 4JRYE 3UH8A 1F90H 1ZIBA 1AO7D 3NT0A 1Q38A 2IBZX 1G5AA 1A7BA 2JCCA 4X83A 1ASOA 4P2RD 3C5SA 5HDBF 5C7XL 4NN7C 4TSBL 4Z3GA 2W0FB 2IG2H 1NCIA 1RZKL 4L4VA 4HJIA 1FL3B 2X1QA 1G6RB 1PZ2A 2CAKA 4E9QA 3ZN6A 5MP6L 5ADOH 4ICWA 2NOYA 3RIAK 1SFHA 2JIXA 3L5HA 4APXA 1SYVB 2AXFA 2O26U 2WZPA 3TONA 5KN5B 2WSPA 1MW0A 3V10A 35C8L 3QQNA 1VAHA 4ZAKB 4TVPH 2YOCA 5FXCH 3VXUB 5CF3A 5LBVA 1FC1A 1FGVH 1QPKA 2F0CA 3RWGB 5K39A 4Y88A 5GIRB 3ZDXE 3TZVC 1I7TB 4Y9EA 3QO1A 1VEPA 2NY6B 1M7IA 3QZLA 2IGFH 4FXGA 5IESL 3ZGIA 5F6IB 2UZYB 5IMKA 3DROB 3QIBC 4GAGL 3VXMD 2YOAA 3DYMA 2P7TA 2OV0A 2B8OT 2Q2LA 2QVIA 3HS0B 1O9VA 4N90D 2X9YA 4H0GA 1J1OL 4F2EA 1R5IB 3ME0B 2EABA 4CILA 2VDKH 2Q87A 3GK8H 5IREA 3TBSB 1G1YA 4R90H 3L4ZA 1OAQH 3P4OB 2CKBL 2DQUH 1FH5L 4LRNH 3SGJA 4Z3HA 2JCCE 1AO7B 1IZJA 2GTQA 2PR9A 5EC1B 2ZOTA 1IAOB 3FQUB 2V7NA 3B9AA 3FTXA 3ZHFA 2JKTM 1JUFA 1XQ4A 3LPWA 1G7LB 2M8XA 2VDQB 4JB9L 4L4VE 5JDSA 4DFHA 4ES8A 3GS7A 5B3JE 5BUGA 1S7TA 1MWAL 1NCWL 1MFBL 1NL0H 2AMGA 3GBEA 2J8HA 3SYOA 4P4RA 4PLKD 4K94H 3VXPA 1DQVA 4Z7OB 1SEBB 5CLYA 1IM3B 5L4JA 5C0BE 1NBZB 4WI2A 5HI5D 4MJ5A 1FI8C 4H8QA 1P1ZA 1CXLA 4GRMB 1JWMB 3CX5J 1XIWB 4CN4A 2WLKA 5E6IB 3LQMA 3UCRA 2DQCL 3IWUA 2IEPA 4QXUL 1IC7L 4PJAA 1PX8A 4LRIC 4S0TD 1RZ8B 1XF4A 2QKIB 2VMCA 2L7JA 4EI5B 1I7RB 1K2DB 4QRSB 3NA9L 4KBPA 5JHDB 4EOWL 2F5BH 4DP9X 1MZZA 4MD5B 5K9QI 1OPGH 4BK5C 1OCOB 3M07A 3D87B 1N3NB 1MNNA 2IXQA 4A2MA 5JPMB 3DWTA 3MREA 4JY5L 4MFHA 3H8NA 4M1GH 4L4TD 2ZCKL 5F7DA 4FLQA 2OMVB 1TZGH 2AJ3A 1O0VA 5DURD 4J6IA 5I73B 5DHEA 2X42A 1FFQA 4ONFL 1QI4A 1QA9A 3U30B 3BVVA 2ADIB 4NAJA 3S34H 4AGPA 2EE2A 4LLUA 4JPVH 2A2QT 4FNTA 2ZUUA 3P02A 5TH2B 3CFKB 1SXNA 3Q8BA 5D1XD 3M86A 3VXMB 1A1NA 5DVMA 4PJFB 5DRWA 2CBPA 4BUQA 4AQ1B 3Q2VA 2FIRT 3TBWB 1U8PA 3C87A 3LKNB 4LVHB 5DS2A 1U95A 3X12B 1ZHKA 1OCZB 4ENED 1HILB 4NQQA 4YO0B 4G7YH 3SQBA 2HVJA 2VLMD 4WI0A 3ZGHA 3DPBA 5IJCC 3THMH 3REVA 3REWA 4DUVA 1BW8A 3PWJA 4U1KB 3QIWA 1KIQA 4WWPA 2DW5A 1EJOH 2OTWB 4PH8A 3MA7A 4JFHD 5J6HB 2CUMA 1MCKA 4AGMA 3KBPA 1T4KA 2Q7YA 3ZT6A 1NFDB 3D52A 3RZCA 2ICCA 4HCIA 2V33A 3PFQA 1U9KA 3EYFB 4DPCX 3ZQXA 1RIUH 3APCA 3SO3C 4UQIM 2OZNA 3E8UL 4RVBA 2DQHL 4LVNC 3G6JF 7FABH 1UZGA 2VXSL 3D3VB 3FDWA 5HPOA 4XNQB 5FS5A 3OWRA 3KDMA 2G30A 4H44C 5D72L 2QFPA 4GRWB 4JFWA 2R2EA 4L4TB 1QMUA 3K2UL 2TSBA