1QKZH

Fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
DVKLVESGGGLVKPGRSLKLSCAASGFTFSDYYMFWVRQTPEQRLEWVATISDGGAYTYYPDSVKGRFTISRDNAKNNLYLQMNSLKSEDTGMYYCARDPLEYYGMDYWGQGTSVAVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVNVTSSTWPSQSITCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN G-PRIME
publication title Crystal Structure of an Fab Fragment in Complex with a Meningococcal Serosubtype Antigen and a Protein G Domain
pubmed doi rcsb
source organism Streptococcus sp.
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1999-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qkzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qkzH01
1MCDA 4S11A 1F3DH 4NQDD 4UT7H 1CLOL 1AHWB 4JPWL 4QWWD 1JFQL 1IILE 3STZB 5TF0A 2R23B 1WFTA 3JVGA 4JZNA 4ETQA 4ZUSB 2BNUB 4I0CC 5I73B 1M4KA 4PJGB 1X5LA 5J0BA 3PWLB 1OAZL 4OFKA 1F4YL 3L3IA 5HYQA 4LVEA 4MCYB 4W6YB 1QFWH 2FZ3B 1NCDH 1PW3A 3S88L 3VFGL 5I8KL 1BIHA 4XNQB 3CFKB 5H94A 5DVLA 3MOAL 3ARZA 3BZ4A 4OIBA 4PLJD 1NEZB 3A6CL 4UILH 4WI3A 2DQGL 4X6DA 2ITDA 4Z8FL 1VENA 3D3VB 4GAGH 1VEOA 2GFBA 5FOBB 1A1NA 3CSPA 2YD4A 3VA2C 5KVEH 3GM0A 3KR3H 1SJHA 2ED7A 1FVCB 4DVBA 1JNHB 4WFEE 3DPBA 5C07A 5DQDL 1U8IB 1M05A 3JUYA 1K9TA 1DUZA 2HMIC 4GRWE 5DYOB 3V2AR 4P2YA 4LU5L 3TT3L 4I2XB 3CVHH 4D0CA 3QNXA 3P2TA 2GK2A 3STLA 3QWRA 1MFDH 1YC7A 1GL4B 3RX5A 1BZ9A 2AXFA 2CLZB 3D39B 4R2GD 1VGEL 1BVZA 4NZJA 4G8GB 5FB8B 3PWNA 1NAKL 1CDUA 4OQTA 1K4CB 1EUUA 4X4ME 4JO3H 4YHZH 4ZO8A 3VFVB 4U6YA 1ZLUK 1QSVA 2L4OA 5MI0B 2F54A 4KK9D 4KRNA 3V6BR 4MA7L 1HIMH 5I16A 3RIAF 1IC1A 3QDMB 1C5CL 1JYWA 1IM3A 1OGAE 5GSVB 4K3DL 5DUBB 5T3XD 4P0DA 1NH6A 3G5XA 1EFXB 2LFGA 3NZHH 5FHBH 4M1DH 4HJJH 3RBGA 1T7ZA 1LE9B 1AJ7L 1CE6A 1R3LA 5DJCA 1X4ZA 3VFUA 3IDUA 1EV2E 1SVCP 2HFGH 3RY4A 3BN3B 3GRWA 3KPRD 4HS8L 2HVJB 3BYYA 3MRCA 2G60H 4Z7VE 5IJVB 3LPWA 4KTEH 1INEL 2VXQL 3OAZK 4ZD3H 1CI5A 1SMOA 3KS0J 3FRPG 3THMH 1QYGH 4LLMA 1K2DB 4LGRB 5JXAL 4MZ3A 4OSUL 3Q3GB 5TDPA 1G6RA 1YY8A 3CNKA 3QNZB 1NGXB 4O9HH 3VU2A 2WINB 2R2BA 4ZUUB 2ORBL 5INDA 4XVUC 1H5BC 4NSKB 2YKLH 3KS0H 1ZLVH 1WIUA 1BGXH 2VZ3A 3P30L 1CFVH 2P5EB 5DFWH 3JUZA 3FO2A 4E42B 4Y1AD 4GRWF 4PPTA 3TZVC 4WU7A 4KTDH 1MJJA 4LLVB 4N0UE 3OR6B 4G8IB 2EH7H 4P9HH 4RFEB 1RIVH 4H0IA 1HDMA 4BM7A 4PB0L 1H8NA 4TUJB 3RY6A 4PJCA 1RZ8B 5C8JA 3BP5A 4EI6B 3IJSA 5E08H 4BUGA 1B0RA 1BQLH 3JWNC 4LDEB 3HR5B 1UM5H 1T7WA 3KJ6L 2XG4A 3QFJA 1FZMB 5SV3A 1A2YB 2EIZA 2VDQL 4P57A 2JIXA 5ERWB 3C8HA 1AKJD 1CL7H 3I50L 4YXHH 4X7DC 1U58A 2BVOB 3KNBB 5DJXB 1CLCA 4X6BB 2HKHL 2X89A 4DFHA 3BDYH 5D1XA 1FNFA 1A6TA 4HXBH 4PJ5A 4JZOB 3CLEH 3T4AB 4JE4B 2Q6WA 4F7EA 2OBGA 3A67H 5KJRH 2BJML 5DC0A 1X5GA 4LEOB 4PJ8B 1EBAA 5C07D 1D5IH 5DF0A 5AUMA 1DBBH 5F3BA 2PTVA 3QEQA 4Z7VF 4GKSB 4WU5A 4UIKL 1ED3A 3INUH 2ATKA 3BISA 3MJ9H 5B22A 2A6KA 3AY4C 1IAII 3PUCA 2GKIA 2PO6B 4QXGL 4OI8A 1HNGA 4NM4L 3OKNB 1KPRB 3U4EB 5F7DA 3Q6GL 1A8JH 4IOIA 4XPHL 2VDMH 2WWKO 4LAJH 4P2QE 2BC4A 3EHBC 5IBLC 3P9LA 4XMKH 5FUZH 1KJVB 4XH2B 2V2WB 1B6DA 1MHPH 5L2KE 1KELL 3TEUA 1EHNA 5T3XH 5A3IC 4ORGB 3RZCC 3IETB 2P8LB 4I3GA 3SKNA 3TGXA 4BSWB 1QFUL 3K80A 5BVJB 5JO5B 2Z8VC 1IGTA 4JQXA 5KVFH 1CFBA 2YC1A 2BMKB 3SKOA 1XFPA 4MB5A 4LF3A 1XF3A 4MNHB 3I3BA 2H2PD 5T1LA 1IC4L 3AB0C 1AD9B 4P5TB 4DVRL 5DHVH 4I9WD 1BFOA 3D6GA 4YE4H 3TJEL 5JMOC 3EFFB 2EXYC 4E5XB 2ZG1A 2NCMA 1M7DB 3EGSB 3MRHB 4PRDB 5DK2B 3V6ZA 4ZFFA 3KPQA 4QOKE 4AG4H 2IG2L 4AJ0A 4P4RB 4ZUWA 1DVFA 4JPKH 4LCUA 5JOPE 3KPNB 5EUOA 1NLDL 1REIA 3LRSB 3SPVA 4OFPA 3GGWB 4X98B 4L8BB 1DBKH 3HC4H 1VFMA 5EIVA 2EXWD 1IAKA 2X7LA 5F7EH 1JRHL 3VXNA 3GHEH 4XHJC 3ZHKA 2LVEA 2VZOA 5T1MA 5J9PB 1ZT4B 2FB4H 5TF1H 3F65A 3NA4A 3H9ZA 1AR1D 4YNYB 1F45A 3BQUD 2P8MA 4EQ2A 3B2VH 2YR3A 4OKDA 2HFEA 3B9DA 4KH2A 1A6VL 1MEXL 3VWKD 3UPRA 1RUQL 2OK0H 1NLBH 4XMLH 4NQSB 3OPZL 1E0OB 1OGTA 2Y72A 5EO0A 4OZGE 4ZOBA 1MCBA 4J12A 3S8WA 2XY2A 1F8TL 1FDLH 4ETYA 5HHVL 1HH9B 1QACA 1AGEA 2W92A 2R0LH 2ZCKH 1U93A 1X9QA 3QXVA 1CGUA 5DRZA 3K2UH 2AXGB 3D0VA 3LN4B 2ZPKL 4XC1H 4ZXBB 3QEUB 5J1AB 4WENB 4QXTB 1LE5B 4NKMB 4DGIH 1PG7X 4NWUL 4QY8A 1EGJA 4DN4H 3H9SA 3RGHA 4FQCL 5HBBA 5KSBB 3K81A 2JIXD 4N8CH 3VFRA 3MV8B 4HJ0C 1I7RB 4NUJB 2X89D 3KYOA 5D1XD 1QBBA 4U2ZA 1CFSA 4PREA 4CVXA 5ACZA 1XMWA 2R0ZH 5GGSA 1NL0H 1J12A 1FNSH 12E8L 1FPTL 1YNTB 2R0KL 1KNOA 1NFIB 1OHQA 1GHFL 1IT9L 1RMFH 1LEGB 4BFIA 4GJTB 2FX8L 1RJZA 3LB6D 3W5MA 2HG5B 3C8KA 5D7JB 4JHAH 3W11C 3KJ4B 3PGCA 3AFLA 2CLVA 1OD7A 4J6RH 4LOUC 4OQTH 5JQHC 1A9BA 3L3KB 4WNQB 1KB9J 43C9A 4XPGL 4X4ZA 4PJ9B 5L8LB 1QO3A 4HS6B 1WZ1H 4H1LB 3MLXL 5EN2B 1K6QH 5C0AD 3V7AE 3RWHA 3FQWA 5DD0L 3VGBA 1JGUH 4TSBL 3C6LD 5DRXA 3SGEI 4OB5L 5EZLB 3ELAT 2HYMA 1I75A 3P4NA 2DDQL 5KZCB 2VH5L 4P59L 1MCWW 2AI0H 4OZGF 3MRPA 2FJFA 1CS6A 3U9UB 2XNAA 4FQLH 1D5MB 2A6DA 2GEEA 1V3MA 1T03H 3GRWH 3QO0B 5E9DB 2GY5A 1I9RL 1A21A 2X4TA 1D5ZB 3G6DL 2X1OA 4TYUA 5TE7L 5C0FA 3ZSSA 4R8WL 3BGAA 1GGTA 4OI9A 1J8HB 4HFUL 1CLZH 5J12B 4N1CA 2AJYL 3DHJA 1G6RH 1C5BL 5F8RC 3N85H 5T1KD 3TO4B 2O61B 3M17B 2AAVA 3EO0A 1KLUB 1A7PL 3VCLA 2IWGA 1TVHA 1TETH 4H25A 3GNML 1KPVB 2FCBA 2AGJH 3QP3A 1ONQA 3IDXL 5BV7C 1NGZB 1ZGLM 5B4MD 1OAXL 4JHWL 4LVHB 3I6KA 2XICA 2NXYC 3BWAB 4MDJA 4KROC 4U31A 5DK3A 1QUNA 4P3DA 5HYJB 4MD5B 3TYGL 1T0NA 4RAUB 3V9FA 1CF8L 1C08A 3LSOA 4FFVD 5GGUB 2NNAB 3W0WE 5I1LB 1HHJA 4HD9A 1WUNT 1QR4A 4OUUA 1BQHB 4Z7UA 3QDGB 2YPLA 2XFXB 5DMGC 1YDPB 2YUXA 3UC0H 2GUOB 4PUBH 4TVSa 1MAJA 2Z35B 1J11A 1I1FB 4NHCL 5EOTA 4BQCA 4ZQKB 2VLJB 5D7LD 5F3HA 4DJMA 3PP4H 1MAKA 2MJWA 2ATPA 4HPOH 2C4FT 3A6BH 3P4LA 1DTUA 2AK1H 3IVKA 4XNMA 5FO8A 1RVFH 1NDGA 4PRIA 5GGTA 1Y6MR 1T6VN 4L29B 5F7HA 1MRDH 3W9DB 1XF5B 2Q7YA 1LO5B 3WNNA 4B50A 4JKMA 3MXVH 1AH1A 3OTTA 5F96H 3RBSA 1N4XL 3PWVB 2IH1B 4YFLI 2BHUA 2YD1A 4JAMA 4UV7H 3EO9L 2B8OT 1IAIL 4GG6B 4LBEA 3U7WH 1IC7H 5GS1A 1JGDA 1PX4A 4PJBA 1LEIA 2E7HA 5C9JB 1OVZA 1P7KA 2D31B 4PRAA 4ALAL 1JN6A 4CW1B 1AC6A 1KENL 3LS5H 5EO1A 1W0YT 4DTGL 2OTPA 1CGXA 3EZJB 2MWCA 3RUGA 1Y6KR 2H8PA 5I1HH 3D39E 1FFPA 1TIUA 4P4KC 1NCCL 1DBAL 2I9LB 2HKFH 1RZ7H 1ETZB 1F58L 4Y19B 1NGYB 2XKSA 3CDGB 3DX9B 4G6JH 2OS7A 4NQTA 2UWEA 3EJJX 2JELH 5GJSH 4YK4B 2RQ8A 4JY4B 3IXAB 4DUVA 4JFDB 3RKDD 5LQBL 1UADC 2QSTA 2Y5TB 3AM8A 3GSXB 5HVGB 4J1UB 3SQOH 1ZK9A 4UT6H 4YBHA 4OTXL 3U30C 2F74B 3GHBL 1T3FB 4APQD 1C5DA 1T7YA 2YZ8A 2WBJA 3TPUB 4N5EC 1AFVL 4G7YH 3S36X 2KKQA 4YHOL 2DRUA 3EDKA 4FMFA 3MLVH 4OGXL 2AEQH 1DANU 3O4LB 4JKLA 1AE6H 3UTOA 4IOFC 4EBQH 3B2UC 3VXOB 5TE4L 1OAQH 3LKQA 4LNRA 4LLWA 3VXRB 1KN2H 4FQ2H 4DKAA 4MJ4A 2K7QA 4LSSH 1T2XA 2FX9H 1Z3GL 2LV4A 3EFDH 4NRYB 5FCUL 5EC2A 2F5AL 2VL5B 4JFPA 3DXAB 2EYRB 1KACB 1UXSA 4JHZA 4KI1A 3SO3B 3D48R 5E6ID 1V7ML 4WHDA 3BT2H 5EU4A 5F21B 5F1KC 3I75A 3NZ8A 2QQNL 1KIRB 5DMIL 3UTQB 3DMMA 4OF7A 1LO3H 3GMQA 1FHGA 4QTHB 2OL3L 4X6EB 1TZGH 3K74B 2QADC 2DBLH 3R06A 5CBEB 4GT7A 2OQJB 1OTTD 1V8HA 1EGJH 2CJUH 2EYTA 3MNWA 1JTTA 2VR9A 5TPWL 4YHML 3CFEB 1XGUB 2VLKE 4E41A 4ZTPL 2EDQA 4HIHB 3LV3B 3AREA 4M7ZB 2VISA 4UTAH 1NEUA 3U36A 4KHTL 1VGKA 4A2LA 4R0LA 4HKJB 1A7OH 1MFEL 2NY4C 3N1MC 5E1HB 5I9QC 3QZWA 1UJTA 2IBGA 2YSSA 1YEIL 4HH9A 4JM4L 4RFOL 5HD8D 5A43C 2J6EA 3HS0A 4HHAB 5IVZA 1MOEA 2DWDB 2JCCA 5D7IB 4AL8H 1MCKA 4N1HB 2QKIA 3CCHB 1SEBB 3ZHLA 5IVXB 4KRPD 1ORQA 2WBJC 4DEPB 2GTZB 3IDNB 5C0AE 3NCJH 3O6FA 3FFDB 4FQXD 1KJ3L 4HDIB 4DWHA 4JRXD 3QULA 1EDQA 3OG4B 1XF2A 2EDXA 5E2TL 4W68A 4X99B 4I77H 2VLRD 1E27A 1U2HA 5FYKL 1Z5LB 3MRJB 2X09A 3KPSB 2HVKB 1IAMA 3BHBB 1EEYA 1I7UB 5CJQL 4RZCB 2BVEA 3CVIH 4PTUB 1XR9B 4HJGB 1FH5L 1EJOL 1NMBH 1X3DA 3X3GH 5F7YC 1P4BH 2OR7A 4BZ1H 3UX9B 4JO4L 3MXWH 4XPTH 4OD3L 3E2HB 3MRFB 5BVPL 3UTTE 2Y7QA 3L3HB 1E4XL 2L0DA 1GRWA 2NR6D 4DKEL 4Q9QL 4ONGL 3IJYA 3PQYE 4QT5A 5T3ZH 1O5DT 2YS4A 1BECA 5E8EA 5IB5A 2W0LA 3QI9A 4R4FH 5F72S 1IQDB 3VRLE 3NCYS 4R0LC 2DQJL 1YYLL 5HHOA 1F5WA 4XX1E 1IEBA 3VWJC 3BD5A 2V9QA 5HGAB 3MBEB 5MENA 1PLGL 3MFGB 4ENEC 1WISA 2HJKA 5F9OL 3EOAB 4JN2B 1S3KL 2I25N 3X11A 5J8OA 3DMMD 4EDXA 3GSUA 1RHFA 4NKIL 3O45A 4QXWA 2XWBA 1SM3L 1YECL 4LFHD 3RVUD 1WSST 1AO7E 4PJAA 2FJHB 3BPLC 7FABL 4WWKD 5C0DA 2W9DL 4EVNA 2QQQA 3EDFA 2LQRA 2DQHL 3HZMA 5CJOH 2ED8A 3ILQC 3CK0L 1I4FB 4XNUL 4AENA 2F8OA 5DO2D 2WBWB 6FABH 3CVHB 4GBXC 4QCIA 4O58L 5JW3H 4KZEH 3MGAA 4R97B 4TSCL 5KS9E 4RMWA 3FMGH 3H3PL 3ULUC 5JPNB 3ILPB 2CRMA 1X5YA 3MR9A 1U3HB 1WIOA 3UJJL 3C9NB 5GGTH 3VFPB 2ICEA 3FONA 1FORL 4L8SB 4FZEL 1I9IH 1MCQA 1OP5H 5EBLA 3IFPB 1B4JH 2YWYA 1LK3L 3WS3A 3IU3A 4PJXA 2P43B 1UQSB 1FN4A 3AU1B 5MP6H 1HHIA 1K85A 1CVRA 3ARDA 1KSRA 3ARWA 4JFFA 1U3ZA 1T0PB 3L5JA 3RQ3A 2CR3A 4GAFB 5J11C 3VFOB 3HC0B 1I1YB 1GZQB 1EH9A 4PRBB 1A7QH 4P46A 5INCB 4PFEA 5DHYB 1XIWC 5DJZB 1KCVL 3GIVA 3VRLF 3JTTB 5D5MA 5IHZA 2YUWA 1P2CB 4MWFA 1N5AA 2ZJSH 4H5SA 3DUSA 5LWYH 4X7SH 1MUJA 2O5YL 3ROOB 3MRIB 4QRPB 5T1DH 2B2XH 3LEXB 1ZEAL 3WBDA 4F58H 1N59A 2O5XH 4FN0A 5LVEA 4WW2A 1U42A 2R56L 2AJSH 4ONFL 3B83A 4FABL 1G7HA 4NO0A 3G6JB 2Z31A 1DBJL 4NQDB 4U1LB 4OCYH 3SDAD 1V7NL 3IGAA 2DAVA 2PETA 3M07A 3KWWB 3DHMA 3SBWA 3WLWC 5SWSB 3BVNA 3M1BB 4GLRI 5KS9F 1NFDA 2QSCL 3DYOA 4JFXB 1IEAA 1G7JB 1IKNA 4LLUB 2X4QA 5FYKE 4JGMA 3BKJL 2CKBL 4NN6C 5HDBE 5I8EA 3S35X 4YDIL 3PNWA 1PG7L 1X6LA 3LQAL 4JANB 1QRNA 3N1QC 5HHOD 3CSYA 3VG9C 3FN3A 3QCTH 5HHMD 1B6UA 3HUJA 3O2VH 5ACLA 2FLBT 4GXVL 3F12B 1CFQB 1TJGL 3QEGL 4HWEL 4FP8L 2ADIA 1S7RB 3DIFA 5BXFA 3VXTB 5A16A 5I76B 4OD1L 3ZKMD 4K9EC 4MS8D 3EKCA 2XKNA 1NAMA 3FCTA 3S5LA 3ARDC 4OF0A 3ZYZA 3MRBB 1WEJL 1T83C 5JHLH 3HG1A 1MJ8H 1IBGH 4X83A 4R3SA 4NC0B 3NFPB 1S5HB 4RGOL 4C83B 4YIQB 5J6HA 3ZYOA 2OSLA 1A1MA 2FX7H 4R2GB 1BFSA 4OGYL 1DJSA 5EBMA 5BMFH 4OBSA 3SDDA 5E2WH 1GC1C 5BOPA 3E3QE 5C0JA 4Y5YC 2BY1A 1WV7T 4P2RB 3GK8H 5F89A 2AQ3A 1NBZA 2NY2D 2YD9A 1BD2A 3O8XA 1VESA 3QBTB 3C2AH 4LSPH 3GUTA 2DD8L 2DKMA 1P4IH 4JJ5A 1JBJA 1HSAB 4U1HB 3K7UA 2Z92A 2J6EH 1IGMH 2XT1B 3V0AC 5TH2A 4ZSOB 4P5KB 2CSPA 3HN3A 1KFAL 2QHRL 1NCNA 1DSFL 2HTLD 1F6FB 1CK0H 3SGDH 2B1AH 1E6OL 1KCRL 2UVEA 5ISZE 1BREA 4JFFD 1OLLA 4JRXE 5DHVB 1FQ9C 1RHHA 1NJ9B 4DGYH 1TZIB 3KPRB 3WL9A 1OAYH 2NX5D 3QHZL 3MRDA 5HDBF 5L2JA 4M6NL 3WSQL 3B3IB 2PYFA 3TV3H 1JCKA 2YMXH 5FA3B 5GZND 3U48A 1Z0NA 3GKWH 3L1OL 1CT8A 4Y4KA 1CFNA 1ZS8A 2CQVA 2EDJA 1I7TA 4JVWA 5GQBA 2Q76A 2AS5M 1UVQA 1T5XA 1G9EA 2VUYA 5ESVA 5KVDH 4PYGA 1N2RB 2OMNA 1BX2B 3CFIC 1LHZA 1QSED 3FQTA 3LKNA 1DQML 1MELA 1F6AB 1DBMH 2R2HB 3GI8H 1GZPA 1QPPA 3D2UA 4Y1AB 3ARFC 4OCSL 4Y5VB 4NO0D 4DQOH 1FE8L 4FNLL 5HTSA 4AK1A 4ISVB 3U46B 3Q48A 3P0VL 4OCRL 3FN0L 4JZNB 1LEKA 4NQEE 1UWEH 4OCMC 5IG7A 5DWUL 4KWUA 3CFJA 4DKDC 3L3IB 5HYQB 4N90D 4BQ6A 1U8NA 5KSAA 1FYHB 2GK0A 1OLZA 3QJFA 3VGGA 1VFAA 1F4WH 4HBQA 4XPFH 2XA8H 1CN4A 2A0LC 3BZ4B 3Q1SL 2PNDA 5C92A 1FZKB 5HI5D 3MJ8A 1YEKL 5DC4B 4YBQC 2ITDB 1A6UH 4LPCA 4MXWH 5I1CH 4X6CA 2CD0A 2GFBB 2A1WL 4OFIA 1A1NB 4NP4H 4MDIB 3EJZC 3PP3H 1KIUA 2G75A 4IRSA 2X05A 4Y4HD 1CDGA 4M43H 1BBJB 3HNSL 1XF4A 4DVBB 3AS3A 5C07B 4BQ9A 1MI5A 2E5EA 1M05B 3ZTJH 4LK4A 2ILLA 5ID1B 1YQVH 4KAQL 4D0CB 3LMJH 3MMEA 2QSVA 2W0FB 5CD3A 2AXFB 3QT2A 5DD1L 5C7XL 3E6HA 4XVTH 3KDMB 4KKAD 3BZDA 3SDDD 4RGNE 3V0VA 4YWGH 2IPUG 1BD2D 3VW3H 1TQBB 2F54B 2NW3A 2XTJC 1I3RB 5AEAA 5I16B 4HCRL 3ZKXC 1IM3B 1F3JB 3VXUD 5IFAH 4YR6A 1AXSA 1NGQL 5CSBA 1G9NC 1L6XA 1MFNA 3G5XB 3NFNB 1FJ1A 4Q97A 1BVKB 1J0YA 5EWIH 3KPPA 3THML 1SJXA 1CE6B 1R3LB 4PG2A 3VD3A 2P7TA 3FB7A 1KC5L 3MJGX 2APTA 1DDHB 4YHYB 2P4AB 5GGVH 1JPGA 1DQDH 4MX7B 4LFHG 3MRCB 1KXTB 1HILA 1T1XA 4MCZA 1A0QH 3OF6A 3I9GH 3MZGB 3S36L 2WM0A 2VXTH 5A2FA 5DHXB 5KSAC 4MXVE 1UACL 5CP7A 4Y4KD 1DZBA 1G6RB 4G5ZL 3BKYL 4XXDA 3FQUB 4ZO7A 2XA3A 4MMZC 4LRIC 2R2BB 2EDEA 4LCWE 2BOCB 1C8PA 1J1XH 5HYSA 2X5PA 3ARBC 3LZFH 3BQUB 3BKML 5SWZD 2N56A 3CC5A 4NC2B 1N3NB 4XNXL 2DQIH 3QZWG 4DOHE 1MJJB 2APFA 1MCCA 1UM5L 4CAGA 5D9SA 4J7RA 2B39A 3IFNH 2E6QA 1LO4H 2HRPH 3BEVB 2A9NL 3ZT6A 2RJMA 2FR4B 4BK4A 5C6TH 4P3CH 3TA3A 3FOMA 4PJCB 4F2MA 5C8JB 3BP5B 3L3GB 3EAKA 5C0BA 4ODTH 5FAAA 1B0RB 5E0QA 1SY6L 4KVCH 5MHSD 3GMMA 3N9GH 1YMMA 1T5WB 5B21A 2VL4A 2PYEE 4RMTA 3FB5A 1Q9WA 2Q86A 3ZKNC 3QFJB 1NPUA 5ICZA 5HHME 5ENWB 2EIZB 5K9JH 2JIXB 4KDWA 4WJ5A 2Y6SD 4ODVL 3SKJL 1U58B 5I18H 5KAQG 3QIWA 2CGRL 5D1XB 32C2A 4RDQF 2F8XC 1RUAH 1A6TB 1SYSA 2Q6WB 1S7UB 4F7EB 1MY7A 4IRSD 5GS0H 1NAMH 3V79C 4K71C 3TJHC 4PY7A 1MI5D 5AUMB 5F3BB 3IAPA 3QEQB 1S7SA 4HKBA 4XVJH 1TPXB 4WU5B 1ED3B 4GAJH 2A6KB 1QR1B 2QJDA 2YEZA 4JREC 4MXVF 4PJEE 1T7VA 3TZVD 3MX0A 5GHWH 2VDKL 5FGCB 5BO1L 1NCBL 1BM3H 5CZXD 4UT9L 2A9ML 3C5JA 2BC4B 4FXKA 5HGDA 3P9LB 3KPOB 2V17H 4J4PA 3TFKC 1KPUA 4FFYH 3QPQD 2VN7A 2E27H 4QRRD 3GIZL 4CMHC 4LIQH 1IM9A 1U8QA 2DYPA 35C8L 3FL7A 4UV4H 1MCHA 3FT4A 4G9FD 3IRZA 3SKNB 3RIAK 4FQ1H 5ILTL 4EI5A 1TENA 2R29H 1S8DB 1JNNL 2YC1B 1FL5B 3SKOB 2EICA 3PABB 2H3NA 4LF3B 1BZQK 1XF3B 4GSDH 1Z6JT 5C0NC 5T1LB 4R4ND 1FG2B 4P9ML 1BFOB 2NX5E 3CLFH 2XN9D 4MAYC 3P73A 2LTQC 1FFRA 3TF7C 5I74C 1JHLL 2X4SA 3NOIA 4RX4D 1KEML 4Z7QE 1NCAH 5AYUL 4ZFFB 3KPQB 2FB4L 1PYWB 4TPRL 4ZUWB 3SJVE 4ZS7H 5IOPA 3GB7A 3S34L 3S37L 1DVFB 4KGJA 1XCQA 4W81A 4HGMA 4ZOCA 1IL1A 3MRNA 1QLRA 1IGYB 2GYSA 3QDJD 5EUOB 3T2PA 3SPVB 3RGVC 3ZTJG 1HH6A 1EVUA 2R39A 4QRSA 4HIIA 4JB9L 1IAKB 2X7LB 3VXNB 5EOCJ 3WFCH 2B0SH 3QUYA 3LKPA 4DZBA 2R2CA 5T1MB 1MCPH 1G9NH 2ZG3A 3FQRB 2GSIA 1BJ1J 3LVEA 5H35A 4ZOAA 5K9QG 4NOFA 5I2IA 1GAFH 3R1GH 2HFEB 3BPCB 4J8RA 4D0DA 3SKUD 5IBLD 4G9DA 3UDWA 2WLZA 1IC5H 4JM2F 3V52H 2FL5A 3OXRA 5JDJA 1QTYT 3HCVB 1BIIB 4YBLC 3VH8G 5E1AA 5EOCH 1IE5A 3PGFH 5EO0B 2LE9A 4PJEF 4A6YA 1BJ1H 1T6WA 4N90E 2CKNA 3CX2A 3MYZA 5DD6A 3RU8H 1D6VH 4LSRH 2FEDC 1AGEB 4NPYA 1U93B 5DRZB 4ESKA 4S1SL 3D0VB 1YMMD 3OAZH 4PJ7A 5I8CA 1RIUL 4M7JH 1NC2A 2X1PA 5GRZA 5D7LB 1T2JA 2HJFB 1TDQA 3VFRB 2DOCA 4ZFOL 1BF8A 2Q8AH 1RULH 1YEDA 5EU5A 4JRWA 3WKML 3KYOB 2P48B 3LIZH 3HC3H 2FJGA 1CFSB 2DQUL 2AK4A 4WV1A 3QHTC 1CE1H 1JZ4A 4PJDA 4CVXB 5ACZB 5GGSB 4LMQE 1RK0A 3KXFD 4WI4A 3ZDXE 5A2IH 3NFSL 3RPIB 2NY6B 4BH8A 2Q7NA 3MA9H 2E3VA 1JPTH 3CMGA 2DMBA 4OQTL 4XHJD 1KNOB 4Z7QF 4DKFH 4KK8D 1I1CA 5CS7A 5DZNA 5DFVC 1AI1L 1HINH 3T0VA 3O3DB 5ANME 5GISL 1JGUL 3SGJC 4FRWA 5D96B 5DUML 4QEGA 3C8KB 1QBML 5IGXH 1Y18B 2CDFB 2CLVB 2GI7A 5FM8A 3LPGA 43C9B 4LNVA 1A3QA 3T0WA 4RISH 1IQWL 4KKCC 1MIEL 4RFNB 3RP1A 3RWHB 3FQWB 2KZWA 4LVOC 4KZDH 3HPJA 4OZHB 3MLTA 3QIUC 2HLFD 3P9MA 3QHFL 4J4PD 4XCFH 1IGJA 3V7MA 1YPZE 5DRXB 3QUYC 3QA3A 4G6MH 4KY1H 2LABA 2L7JA 2Y1VA 5H37H 2QQLL 3IDGA 1GGYA 3MRPB 2FJFB 1RURH 3EYSH 3CUPA 4NNYA 5JNYA 5CEZL 2XNAB 4HJ0D 1OARL 1E6JH 5C70A 3O9WA 2YA0A 4NQCE 5KTEH 2X4TB 5C0FB 5KN5B 4KK6D 3CDYA 5FUCC 3S5LG 4JFEA 3WNMA 3ZKSD 4NC1E 1RUKH 1ZVYA 3FFCA 4M48L 3MCLL 4LSQH 1A7NH 3QIBA 4JR9H 2D7OA 5C09E 1U8JA 3B43A 1J88A 3BKCL 4HV8A 4XPAH 4Z7WA 4YUEL 3RJQB 4K8RD 4I0PC 3IFOA 2IAMC 3PDOA 5GGQH 3WIFB 1VFOA 2BCKA 1VEPA 3NABH 3VCLB 1TVHB 3B9AA 3W11D 5SWZE 4ZYKA 2R1YA 1RFDL 3ZDXF 2NY3C 3S35L 4LOUD 1MJUH 4WUUD 1T66C 2Z9TA 1Q72H 3I6KB 1J0HA 3PL6C 5JOEA 4MDJB 5EOQL 3H42L 4P3DB 1T0NB 1GJIA 4KKNA 5AZEH 4M5YH 2BY0A 3B4NA 4PUBL 3LSOB 4MLIA 4XPBH 2WV3A 3MLZH 4OD2A 2X6MA 3BSZH 1I8IA 3MTRA 5D2NC 4XCCH 2VR5A 3WLBA 1RU9L 4OUUB 4Z7UB 5F9DC 1UFUA 4TUOA 4JQIL 2P1YA 3HE6A 3PV7A 5EU6A 5BRZD 1YPZF 5E99L 1ZVHA 1XGYL 4KHXH 4LQ1A 5EOTB 5DK0A 1NCUA 5F3HB 5LG1A 1ZGLP 2MPAL 5CKGA 3IVKB 4XNMB 5EU3A 5FO8B 5D1ZC 1NDGB 4PRIB 1JNLL 4LLAA 4UV7L 4X6DE 5DI8B 3PHSA 1NMAH 1HWGB 4JN1L 4LHUD 4HBCL 1VSCA 1Q0YH 1T21A 2IH3A 2Q7YB 2VWEC 4JHBA 4R7DB 4PG9A 3JTSA 2FHFA 1VDGA 2W9LA 2NXYD 4KROD 4Z76A 4GXUN 3OKDA 4LBEB 3U79A 3RWGA 2W1NA 1JGDB 4ZUVA 1LEIB 1J0ZA 4FQXB 4PRAB 3CFBB 3C5ZC 4WO4A 1PKQE 5L7XH 1ZANH 4QRRE 3RWEA 2WLYA 4G9FE 3RA7L 2VLRB 3SQOL 5FDWA 1EXUA 5DMGD 1N0XH 2OCFD 4RMQA 4U0RB 3CMOL 3MA7A 1UYWH 4RMSA 1KBGH 2ZSVB 4S0TD 2UWEB 4JFYA 2RIKA 5T5FH 3H3BC 1HKLH 3VMPA 4K2UL 1ZKAA 3QFDA 4XTRD 5ESQA 2NY5C 1NSNL 4L3EA 1EIBA 1TQCC 1DCLA 4OCXL 1FIGL 3O9WD 3PWPD 4LQFL 3T0EA 1C5DB 4XP9H 1HHKA 2J8UA 3QISA 1R3JA 1ZHKA 3TH2T 3O6ML 2E8YA 3RAJH 1QLFA 2EDTA 5CKAA 3QDJE 4JFED 5C0RL 3ZLQC 4ZAKA 1Q0XL 4K8RH 3CSGA 2JB6B 1N6QH 4RQQB 3LKQB 5LGKA 4LNRB 1UA6H 1HHGB 4LLWB 3U9PH 1T22A 4IRJA 2H9GB 4WY7L 1TITA 4OF5A 3ZTNH 4X6DF 4YJZL 5T33L 1UJ3B 1MQKH 5EC2B 5CEZE 1F4AA 4L4VA 1ZMYA 4O5LH 3VG0L 2BSTA 5I15H 3BE1L 2DBLL 2DF3A 2FBJH 1QSFD 4PRHD 1AHWA 2E7LC 2F19H 4A6YH 3NZ8B 1CICA 4P4KD 4N0FA 4NZDA 3B9KA 4ZUSA 2GQHA 3DMMB 2BNUA 3RKPA 1JMXA 3OJ2C 3PWLA 3QUMA 5BV7L 4KDVA 4MB4A 1BMGA 5H37G 5BOZG 4ELKA 4WWKB 4KUZL 4TULH 3R06B 2VQTA 3MLUH 4XNQA 4XAKD 3IU4H 5BW7A 1K5NB 1M7XA 2W60A 4OQ1A 2EYTB 3MNWB 5IKCB 5ITBL 1JGLL 3P0GB 5CGYC 5EU6D 1WK0A 3FAWA 3AREB 4HG4J 2VISB 2W91A 1I7ZB 1YEJH 3ME0A 3KYNA 5FOBA 1L7IH 1VGKB 1LO2H 3U4AA 4LCIL 2PXYA 4WCYH 4HUUA 1OW0A 3X3FL 4K3JH 3KXFE 4Y5XB 1N7MH 5IMOA 2PR4L 5L0QB 5GPRA 2CR6A 3VGAC 1MHHA 3OBAA 3LQMA 3QZWB 1U8IA 1MREL 3U1SL 4HH9B 3HA0A 5DYOA 3E8UL 5F1NA 2CRIA 5IVZB 1J8KA 4P23C 3VD9A 1ROWA 1U91B 4I2XA 3UBXI 4PJ5E 5HDQH 3BRGC 4Q58C 3ES6A 3O2DL 5C0CA 2JCCB 1OP3H 2QKIB 1HYSC 3T0EC 3W82A 5I75C 2FIKA 2JLLA 2EDYA 2W0PA 4N0CC 1NC4A 4FQJH 2OLDA 3O6FB 3Q5TA 1K4CA 3QULB 4POZC 3HNVH 4OUOA 1XF2B 2OZ4L 3MLRL 2QADD 3QDMA 1ZT7B 1P9MC 1E27B 4UIMB 2VDLH 2EDNA 4YC2B 3GBMH 4LP5A 2X41A 2MOVA 1EFXA 3CJJA 5C0GA 4HUWA 1EEYB 2BRRH 3JWDC 2A6IA 1GGCH 3PDGA 4JO2H 5GRUL 4KU1A 4MGXA 3FHAA 1Z9LA 5I73C 2R8SH 3UO1H 1YEHH 1H3WM 2NYYD 2NY7L 1T89A 5IJVA 2ZKHL 3D1MC 2HT3D 5FYKU 2Y7QB 1IKFL 4WTWA 1GPOL 3NTCH 4J3SA 4O00A 5JIHA 2RFXB 4KDTA 4BELD 4QT5B 3QNZA 1I3GH 1MJ7H 2WINA 1RIHL 4KQ3H 1WBXA 1X5ZA 4WUUE 2XY1A 5IB5B 4LRNH 3QI9B 1NBYA 4DK6A 4NSKA 2FH6A 1KCUH 1P7HL 5C08D 3DSNA 5HHOB 1OTSC 2A77H 4MA3A 4LLVA 1F4HA 4OI7A 3MOBL 25C8H 2HJKB 1X5XA 3MGTA 3OMZA 3B9KD 4TUJA 3X11B 1DL7H 3RDTA 4EDXB 3GSUB 2LU7A 1S5IL 1MIML 3O6LH 2XWBB 3FMGL 2VKWA 3D85A 1TZHA 4AT6A 1K4DA 4PJAB 1EO5A 3HR5A 5CHNB 4K7FA 2RAMA 5I19L 4BZ2H 5C0DB 4EVNB 5BRZE 2V6HA 3DWTA 3MRMA 5DUPH 2EC8A 5J06A 4TVPL 3HZMB 2BRQA 1I9IL 3DTXB 5ERWA 3DSFH 5D71H 4NNPL 4M7LL 2OJZL 5MI0C 2BVOA 3KNBA 4J3UA 4X8XA 4V2CB 2NY2B 5F70A 1WBZA 1OSPH 3S3PA 2PXYD 2JF1A 4UUJA 4OM1H 3H9SE 2ICEB 4XP5L 4NNXA 3V4VH 4S1QH 1PDKA 4LEOA 5CCKH 4B5EA 3WFEL 3VH8B 5ADPL 1V3LA 5EBLB 4J3WA 4GKSA 3IU3B 3WS3B 5L8KB 1VERA 4PJXB 1A7QL 1DLFL 3JV4B 5IBTL 1UZ6E 3DYPA 1ZLSH 3VXSA 1HHIB 1CD9B 3RVTC 1XF1A 2NY1D 3GI9H 3VI4E 4Y4FA 1N5YL 3VWJD 2VTFA 2WUBL 1LO0L 1FRGH 3OKNA 4I3SH 4J3XA 3U0PB 4EXPX 2EEDA 5A2JH 4JFFB 2JJTA 2VXUH 5L88H 2XQYG 4XAWH 4PJFB 3WS6A 4JFZL 2EIEA 1RZFL 4X7SL 4ZUTA 1EERB 5EUKA 4ORZC 1LQSR 2J8OA 2B2XL 1KYOK 5T1DL 1N26A 5EH1A 4KDTC 4P46B 1CFTB 1UENA 1KJVA 3GIVB 4B41A 5IHZB 3NAAH 4MWFB 1N5AB 3WN5B 2KZ1B 2EECA 4P48A 4H5SB 4ORGA 1CLYL 1MUJB 4JGJA 4NKDA 3KPMA 4HT1L 1FNGA 3ILQD 2G5BB 2BMKA 1FVDA 2MQCA 4JFQA 1KTKE 5I30L 1N59B 4WEBH 5I6XB 2DIBA 3GSQB 3ULUD 4WW2B 5KVGH 3PWPE 4EIGB 1T7XA 1OM3L 1NUFA 2XQBL 5J13B 3EFFA 1A3RL 1G7HB 4NO0B 4HC1A 2Z31B 2WZPD 3VFWA 1OAUL 2OTUA 5JTWA 4GOSA 3EGSA 3SKMA 1FGNL 5DK2A 3WD5L 3VXPA 3IGAB 5K9KA 4KJYA 4P4RA 4WW1A 1WCBA 2V7NA 3EYQC 5I1AA 3BVNB 1HHHB 1NFDB 3V4UH 1CDHA 2VN4A 1IEAB 2X4QB 4WGVB 4NO2A 4HF5L 5FKAB 3TNMA 1P84J 5J9PA 4L3CB 4KJWD 5B39B 2X4RB 3P40A 4OT1L 3PNWB 4NN5B 1X4YA 3AMLA 4YNYA 4QRTA 3JWDH 2ERJB 4RWHA 5L6YL 1SVZA 4K07A 1QRNB 5E8PB 3RX8A 3KYKL 3CSYB 3WO4B 1QKZL 5GZOD 1XIWD 2ICWA 3HUJB 4ZTOH 5IQ9A 1OTUC 1UZ6F 4PJ8C 4IDJH 2EDRA 3VI4F 3DNKA 3AROA 4JO1L 2ADIB 4KXZI 3UAJC 1JHTA 3QUMH 5JMRA 1KB5L 3DIFB 4N9GA 5BXFB 5KSUB 1QLEH 3RDTD 2FX7L 5E2WL 1KULA 3S5LB 15C8L 3FHQA 2PO6C 3BAEL 3D85D 4MJID 2AXGA 5ESAB 2FWOB 3P0YL 4NUGH 1U95A 5I1JL 3DOSA 4TQEL 3HG1B 1CIUA 4NJ9L 4QXTA 1LE5A 4NKMA 1SMAA 3C6SA 3PXHA 5AYQA 3UYRL 1WFNA 4R90H 3BD4A 3FQXA 4NBYB 5EBMB 1AGDA 3SDDB 5C0JB 3DVGB 4CNIB 2YPLE 4PRPA 5F97E 1CTNA 5F89B 5IVNA 4G6FB 4RIRA 3F7RA 3TWCL 1NBZB 1BD2B 1ZA3B 3O8XB 4Z95L 3GUTB 4QXUH 1OPGL 5KOVC 3OAYK 5DXWA 5IT2H 4XT1C 4JJ5B 2CPCA 1J5OH 2Z92B 2VITA 1FL6B 2QQKL 3VXUB 5BS0D 5CSGA 1RZJC 1NFIA 4WEMB 4P5TC 5TH2B 3RWFB 1OAYL 1UM6H 4IMKA 5GS2D 4NQXA 5J6GA 3ULUL 5C6PB 2QTEA 2UY7A 2VB5A 4TVPE 1EK3A 2ZCHH 2R2EA 1FFOA 4GXUM 4HUXA 2PCPB 1DUYA 4GRLA 1KIPA 2E7BA 4MJ2A 4KQ4H 4PJ9A 5L2JB 3MRDB 2QEJA 4HS6A 4HWBA 5E94B 3WJJC 2AV1A 2PYFB 2ED9A 1RUML 2ZUQB 4TSAH 1CU4H 4C56D 1CT8B 4OGAD 4PJBE 1CFNB 1ZS8B 1FIEA 4Y4KB 4TUKH 1I7TB 2ZOKB 5E8OB 2Q76B 3UTZB 1KGCE 1UVQB 1T5XB 3NIGE 3R8QA 3RUGE 5ESVB 1W72A 2MMXA 4EN3A 1JWUA 3FQTB 2FO1A 1Z0MA 3NPSB 3LKNB 5GGVY 3TP4A 1AD0A 3L3JA 1GZPB 3D2UB 4HFWA 1TVDA 2N7AA 3BD3A 4F7TA 2K3TA 4HLJA 3C5SA 4S1RL 3DBXA 4C54A 1U92A 1J8HA 1HZHH 4M5ZH 4XPFL 5L9DL 2J2ZA 3F7YA 2AV7B 5CEYA 1LEKB 4ZXBC 3B6SA 4L4TE 5IG7B 5IIEB 4Z7UF 3CFJB 4MXWL 4DN3H 1MWAA 1UZ8B 3QJFB 1VFAB 5BZWA 4GKZA 4WRLA 3NCFB 2WIIA 3MJ8B 3F58H 3MRQB 3VXMA 3MV7D 3QWOB 2UZIL 4IMLA 5EG6C 5I1EH 2M8XA 4G7VH 4JFHD 1INDL 2VE6B 2G75B 5GGUA 4IRSB 2D7QA 4NZRH 4HGWB 5I1LA 3DURA 2G2RA 5IQ7H 4ODSH 3SE9H 2OR9H 2Q87A 1IZKA 1YEFL 4LSUL 1MI5B 3DARA 5DSCA 1BJMA 3WO3B 5D7JC 2XFXA 3KJ4C 3W5NA 3KLSA 4U3XA 3GO1H 4PP1C 2YUVA 3MMEB 4JG1L 1I1FA 4PJ9C 4PJBF 3ARFD 4ZQKA 5CD3B 5FYLH 1WZKA 2VLJA 3OGOE 3J7HA 3NIGF 3MLSH 4K9EL 3RUGF 5IEKA 1BAFL 3TESA 1NKRA 2EH8H 4L5FL 3CXHJ 3AAZA 4R96B 5EFIB 4Q0XH 2IANE 5EWIL 4E41E 2NW3B 5JHDA 3V0WH 5DLML 1DE4A 4CDHA 1ZVSA 4UDUA 5GS2H 1NGPH 2VDNL 4PJHB 1G7PA 2Y36L 1G0XA 1LO5A 2H1PH 5F1IA 4QHKJ 1C7TA 1MPAL 4QKXB 4LCYA 1GC1L 2OXGA 2A0LD 1PKOA 4X9GA 3S98A 2ESVD 3PWVA 4G80A 1IAOA 5LCVH 3KPPB 3AUVA 4GG6A 4U2YA 2XN9B 1E4WH 1JGVL 2P7TB 3LEYH 5C9JA 5J12C 1H8OA 1B2WH 1J87A 4YO0A 2BNRA 5IESL 3ESVF 2UUDH 1UC6A 4RWYL 2V5MA 5IBUB 3OB0H 1RZKC 1PEZA 3CFCL 1HILB 3TO4C 1WTGT 4G3YL 2Y06H 2JB5L 3T77A 4FZ8H 4F3FA 5ID0B 2XRAH 4MXQC 4W4OA 2VXVH 4GUPA 5CP7B 2VLMD 3BZEB 4MAUL 4CVUA 3DX9A 4XXDB 5HHPA 1MFAH 4LVHC 1D6EB 3ULUE 3BIBX 1NGWA 3IXAA 4JFDA 5IROA 3U0WH 2CK2A 5TFSL 1KJ2A 1IGFH 5D1QA 4EN3D 3GSXA 4HC1H 5KW9L 2ITCB 5B8CA 5C86A 2C1OA 1NUDA 4MYWB 3CC5B 4LSVH 4YHKH 1T3FA 3N06B 4KVCL 5DD3L 5ICXB 3TPUA 2XTJD 5D9SB 5TQ0H 1F2XK 1EAPB 1U6AH 3O4LA 3HLAA 4D0BB 1MRFH 2ICWJ 3TCXA 4F2MB 3VXOA 5C0BB 5E4EC 1B90A 5I18L 5IFHL 5D2LE 2A38A 1YMMB 3WIIL 4JKWA 4N8VA 4NRYA 5JZ7C 3FB5B 1Q9WB 2Q86B 1NAML 5ICZB 1NANH 1T04A 3IDYC 3HMXA 4J23A 4WJ5B 4LGPB 4RMVA 3BO8B 3F7VA 5I0DA 5K33A 4U6TA 1A14H 32C2B 1VEMA 2P49B 5AWNL 1U8MB 2IFFH 2OI9B 3V4PL 1G9MH 2AXJA 3L6FA 2AABL 4X6EA 3BFOA 4F80A 1EHXA 2YA2A 5EBGA 5MENE 2MNUA 1EA9C 1TVBB 4HWNA 4U49A 1MFCH 1S7SB 2I5YL 4HKBB 3TN0A 3ARBD 1XR8A 4ODHL 4XWGH 4B0MM 2V17L 2D7TL 4JQVA 2OYPA 1AY1L 1Q1JH 3MGOA 4PR5B 4GQ9H 1SYVB 3UYPA 3LS4H 3RVXC 4HKJA 3ULUF 1O7SA 1S7QA 3BXNB 2IEPA 3C5JB 3S9DB 5HGDB 4X4MA 1KEGH 5BS0E 4UU9A 1KPUB 3ULVC 3BIAX 3K1DA 1IM9B 1U8QB 3RY5A 4NFDA 4OFYA 3FT4B 2MCPL 4HHAA 4KKBC 1OGAA 1BEYH 4UTBL 3ZKND 4MQTB 3MLYH 3FQNA 2H3NB 4BYHA 1SEBA 4KMTL 3T2NL 3SQBA 3RL2B 3L5HA 2GTZA 3P73B 3FFDA 5EZOL 5D2LF 2W9EH 2BNRD 1R24A 4HWBH 2X4SB 1FZOA 4Y88A 2B0SL 4IRZL 1HSBA 2W0KA 2WNGA 4Z7VA 5IOPB 3GB7B 2X4UB 2P5WD 1XCQB 5DEGA 4AEIH 4BUHA 1IL1B 3MRNB 3R1GL 3ARXA 4NFBA 3MRJA 1XGPA 1U3YA 4V1DD 1HH6B 1W72H 1YJDC 2EE2A 1FYTD 2HVKA 1OCWL 4QRSB 3BHBA 4HIIB 2GJ6E 5CZVH 3BMWA 5CINH 3LKPB 3B5GA 5D5ME 3SO3C 1XR9A 3TNNB 1BQUA 2GSIB 2Y4SA 4I18A 3D69B 1GIGH 1H3GA 3OSKA 5D6DC 3SO5A 5HI4D 5IW6B 4JCMA 3SCMC 1KN4H 4PV8A 3GMRA 4D0DB 2B1HL 3EOBA 4O4YL 4FFWC 5LBSH 4KKLC 4WHCA 3OXRB 1T4KA 4Y2DA 3L3HA 4Z7NE 5E1AB 3TVMA 4M7JL 5E2UH 3E1F1 3HI6H 4KPHL 4UINH 4G6KH 3OKKA 2YPVH 4Y0GA 4RGNC 1JYXA 5DD6B 1FC2D 1MWAH 5I66A 3GMPB 5D6CA 4NM8H 2ZCLL 5IK3B 4M7ZC 1DQTA 3LEVL 2X9WA 4MNQE 1MCEA 4PJ7B 2PTUA 2X40A 5EORL 4MAYD 5EO9B 4LCCB 5I8CB 5DD5H 2GIYA 1NC2B 4QHNA 1DP0A 4XCNA 3QUXA 4GO6B 1UWGL 4YXKH 2XZQL 1SBSH 4WWID 1I1AC 5HGAA 3NCCB 1P53A 4JFHE 5E5MA 4U1SA 1BF2A 1YEDB 5EU5B 3EOAA 3K1KC 4XP4H 3OHXA 1HINL 5CGTA 3QO1A 5I1IH 2FJGB 2AK4B 4WV1B 3ZYJA 1F11A 4PJDB 4HIEA 1F90H 4M1GL 5LGHL 1FLRL 1NCWH 3QPXL 2Q8BH 1RK0B 3HE7C 1BOGB 4PLKD 1FVEA 4BH8B 2SEBA 4XWOC 3VGFA 2FJHA 4WFED 2XKUA 4OIAA 3U83A 1JF6A 3BJLA 4DAGH 5K9OB 3TN0D 4DEPC 1YNKL 1I4FA 5E8DL 3PJSA 5I8OH 4KROB 1FGVH 3F6LA 3QG7L 2FYYA 5IB3B 2JJWA 3MREB 3ILPA 5J56B 1QZ1A 3RWIB 4PTTB 5F7FA 5M95B 1OY3B 1WAAE 5D5MF 5TE6H 3BGFC 3WFBL 2EO1A 3ZDZE 4K7PH 3HPJB 4L8SA 1YEGL 5D7SH 5FGRA 1JWSA 2FEDD 4X4YA 1IGJB 3DUHA 2HH0L 5L2KA 2DLFH 4YHNA 2ESVE 1OGAD 4OIIL 3A6OA 1ZTXL 4Z7NF 2EC9T 2KQMA 4LHJB 2C3GA 3L7EA 1LD9A 4JDTL 5I1GL 2H6PA 3IDGB 4U1KA 4U1NA 3OZ9L 3CUPB 4NNYB 5JNYB 1W0WA 3E2HC 4UBDC 4OLVH 3CDFA 4GMSH 1F3RB 1FBIL 3O9WB 1I1YA 2HJLA 4OM0H 5INCA 3QQNA 1MFBH 4LPUA 3FKUS 4JFEB 1NFDF 4WI9A 2M2DA 4HS3A 4WHTB 2EDWA 3QIBB 1DN0B 2O5ZH 4BKLA 1U8JB 4M62H 1CXIA 4BFGA 3NACL 4HV8B 4YHLL 4Z7WB 4ZFGL 3ROOA 1CDCA 5FFLA 1U41A 5DFVD 4YGAB 1JUFA 1HE7A 5MEPA 3LEXA 4XI5C 3PDOB 1RK1A 5FV1L 2YD3A 1KJ2H 2BCKB 3SDCA 4NO5A 3MBEC 4ZYKB 2R1YB 5DJ6B 3CPLA 4LSTL 2LU3A 2IJ0C 2AJUL 4JY5H 1K8IA 2KUTA 5CMAA 5D7KD 2XTJE 4KKCD 4RNRB 2YUZA 2JTDA 3QNYA 1QSFB 4PRHB 2OP4H 3ORJA 4NJAH 5C3LD 2J88H 1R0AH 3TVMD 1JTOA 4KHXL 5HVFB 4OD2B 4X4XA 2HLAA 4XB8A 1LDSA 1I8IB 4CVZB 1WAAF 4LASH 3WLBB 1KJMB 3DGGA 4R97C 2DMCA 3ZDZF 5CFHA 2I9TB 2RCSH 3HE6B 4OKVA 1A6WH 3P4MB 1J0KA 3UROR 1CDYA 3HMXH 5EU6B 3U30B 4JANA 3HMWL 5F8QC 1U3HC 2X4NB 1NMAL 3QUXD 4KVNH 5DK0B 3QRFM 3B8SA 4X5WB 1ES0B 4YX2L 5JR1H 1A4KA 2V5TA 3R0MA 2HWZH 2DQTL 1G7QA 5T5NF 3QJHA 4NQUA 2E9WA 3GSNL 1SBBA 4QLRA 3TBTA 3WDHA 4QHMB 3BMVA 5C9KA 5CBAA 1HQRA 4X6CE 2UV3A 4FXGA 5FIEA 3MRBA 1T21B 2IH3B 3DV4A 4L3AA 4AM0A 3L7FA 4EKXA 3RWCA 2NY3D 3RWDA 4NWTL 2D9CA 3KGRA 4PG9B 1T66D 1OOAA 3JTSB 4P99A 3LHPL 2YD7A 4ZOEA 3PL6D 5IJKA 1VPOH 5D8JH 3BZFA 4FQIL 3OKDB 3LD8B 1ACYH 3RWGB 1M1SA 3RVVC 4ZUVB 3CZFA 3O2WL 4HXAL 2WQ8A 1YNLL 3IYLW 1A64A 5CWSB 2XTLA 3DX7A 4HQQL 5DMYA 4P2QD 1JK8B 1VKXB 3WV0A 5FDWB 1EXUB 4ZSOA 4RBPK 5L2KD 1X4XA 4M6ML 2EE3A 1GGIL 1SJEA 1FNHA 2KBGA 4MZ2A 3SE3A 1M71B 1CVSC 4U6XA 2FD6L 4JFYB 5FEBA 2GSGA 1XH3A 3QQ3B 1WJ3A 4Q9RL 5ESQB 2F5BL 1EMTL 4HUKB 1J1PL 1ZLVK 4P9HC 4BQBA 1GGBH 3PIQA 3DUUB 3K8KA 4F9LA 4UB0L 3HNTH 3ZKQD 1HHKB 1L7TL 2J8UB 1ZHKB 3MFFA 1QLFB 3S96A 5CJXC 1NBVH 2DQDL 4ZAKB 4RGMB 4QOKD 4V1DE 3FZUC 2BVYA 3OG6B 3NCYP 1T2QH 1JRHI 1YY9C 3UZVB 3ZL4L 5JOPD 3EOTL 3U4BH 4O02L 1CD1A 4ERSL 4IRJB 3GJFA 3SDCD 3QQ9D 2GJJA 4PP2B 4ELMB 2P44B 2R2HA 5C08B 4X6CF 1TTFA 2XZCL 5J4MA 1JHKH 3AS0A 4Y1AA 2VDRL 2BSTB 3HI5H 3L5WB 1Q94B 4G42A 3S97C 2D4DA 4JZJA 2XZZA 4OLWH 4TULL 1I9EA 4Y16C 2YK1L 4ISVA 3U46A 5FHAH 4G6AD 1A6ZB 1CICB 4N0FB 1LNUA 3B9KB 1FO0L 1I8LA 1QVOA 2CMRL 4G43B 4NZTH 1FCCA 3QUMB 1X6NA 4HPYL 3T04D 4ELKB 1C1EH 4R2GC 1QNZL 4K3JL 2BVQB 4MA1B 1N7ML 2W60B 5HDOA 1FZKA 4B7IA 4TTGA 1UGNA 3FB6A 1AKJA 3SDXE 1NKOA 5E24E 5E5UB 1QD0A 3HRZA 3VA6A 3KYNB 5E6ZA 1OWRM 4MNGB 5AG9A 2PXYB 4AIZB 3LY6A 4HUUB 4MDIA 1CLOH 4JPWH 2DIAA 3TT1L 4PGDA 5IMOB 2VQUA 5F6HJ 2DJUA 3CIQA 4U7KA 1BBJA 1RUPL 2WBKA 1MHHB 1NUNB 1XT5A 2AERT 1DLHA 1OAZH 4FQJL 1F4YH 5ICYA 1KB5B 2Z8WC 4NC1C 2E6JA 3RTQC 5KG9A 1MLCA 5F1NB 3S88H 2W38A 4Z0BL 5ID1A 2DJ4A 3VFGH 1J18A 5I8KH 3DETD 4K3GA 3ES6B 2NY1B 5C0CB 3VWJB 2W0FA 4YDKL 4F9LC 1URLA 3A6CH 2FIKB 1AXIB 2DQGH 2W59A 2P8PA 3ARGD 3DRTA 3KDMA 4I5BB 1NC4B 4OLYL 5DVMA 1EFQA 2MCG1 2YN5A 3NCMA 5IB1A 5GRJH 2IPTL 5FKPA 1I3RA 3I2CL 2XZAL 3BPLB 1GGCL 1WZLA 1F3JA 2V2TB 3MV9E 1D9KD 4N8VG 3IDIB 5DQDH 3UTSE 4LKCA 3NPZB 5AAWA 3NFNA 4UMGA 5C0GB 1BVKA 4HUWB 4LU5H 3TT3H 1BHGA 1MNUL 1TJIL 3CU7A 4Y5VC 5JIPA 1DQLL 2A6IB 2X4PA 5TQ2L 5HHQA 1VGEH 1DDHA 3JVGC 2ARJQ 4MX7A 1MF2L 3T0DA 2F58L 5IHUL 3DVNA 4UAOB 3OAUL 3P3YA 5CIPA 3NA9L 3IF1A 3SDXF 5SX5K 4MA7H 4FG6C 43CAB 4KK5D 1C5CH 2JJUA 4P23D 4HULB 1I8KB 5IVOA 4PY8J 5JA9A 4K3DH 3FQUA 2NY5L 4YAQB 4QTIL 4S2SA 4N9OB 2BOCA 4YPJA 2FO4B 2XPGB 1WBXB 3DECA 3MODL 2FEEI 4GQPH 5D7KE 1NBYB 3BQUA 1AJ7H 3CXDL 4PB9L 3Q5OA 1J05A 1MH5A 1WC7A 1N3NA 3OKEA 5SX4I 3VWKA 4MA3B 1OQXA 3BP4A 2J3SA 5JLZA 1CDBA 5EZJB 5F6IB 1NDMB 3MGTB 1INEH 3BEVA 2FR4A 4ODXA 1OD9A 3RDTB 3L3GA 4M7KL 4I0KA 5D71L 5JXAH 4OSUH 3W0WD 3N0PB 4MJIB 3D85B 1ZHBA 1TZHB 3WIHH 4AT6B 1K4DB 1T5WA 1ZLWH 4K7FB 2CDGA 2APWA 1LWRA 3MRMB 2ORBH 3VI3E 5JDSB 3UYOD 3LN5A 5MEOA 3BEWB 5ENWA 2ZWLT 3OB8A 5FUCE 5IMLA 3ARUA 3P30H 2VLKA 4GRMB 5DMJB 4AEHL 1TQBC 3L3DB 1PSKL 1X44A 5HI3D 3H7LA 2G9HA 1WBZB 3C08L 4UUJB 5CJ8A 4L8CB 1S7UA 3N1GC 4E0RB 3EUUA 4PB0H 1BBDL 1FRGL 3G5ZA 4NNXB 4I3SL 4J3VA 1L4IA 4XAWL 5ACMA 4L9LA 4X5LA 1N6VA 2ZUSA 2VDPL 3D3VD 1JPST 1KXQE 3QCUH 2AK4E 4K7PX 3VXSB 4YHYC 1QR1A 1KB9K 1OTSD 4Y4FB 3KJ6H 4B7LA 2VDQH 3NMEA 4JRYE 3I50H 1QFWM 4ZUTB 1LGVA 5EUKB 5C0AA 4XMPL 2HKHH 5KANG 4AEFA 4XC3L 1T1ZA 5M7QA 5D2NE 3WXVL 4GW1B 3KPOA 4Q2ZB 2DI7A 3C6LA 1AQDB 2DLIA 3C87A 1S7WB 3FB8A 2BJMH 3GMOB 5KVGL 5DZOA 4C56B 5J57B 3D39D 3QUZD 2AJVL 3NBNA 1QFPA 1EHLL 2FRGP 3BQUC 1S8DA 5CP3A 4NKDB 3KPMB 1FNGB 3C60A 1CGVA 1FL5A 1FVDB 3FO0L 4JFQB 3PABA 4D9RE 2FGWH 4RRPG 1MAML 2YN3A 1FG2A 1QHOA 5IWLA 2DI9A 4QXGH 4Y5YB 4NM4H 9CGTA 3U0TA 1QSZA 3SY0B 2VAAA 3Q6GH 3O6KL 4XPHH 3VFWB 4HIXL 2OTUB 3RY6C 5C2BL 2D9QB 3OJMB 1M6OB 3SKMB 3ISWA 3VI3F 3VXPB 5K9KB 5GJTH 4KJYB 1PYWA 4WW1B 1WCBB 5JQ6L 2NZ9D 2VWEE 3GMLB 1Q9OA 2V7NB 3SE4A 5I17A 1UM4L 5I1AB 3JWDL 1IGYA 5T1KA 1KELH 3WEXA 2A83A 3I3EA 5GRVL 2F53E 3BUYB 4NO2B 5ECJE 1QFUH 3GJFH 1ZHLA 3LCYA 3PQYA 3RVTD 5EBWA 2ZUUA 2DLGA 3TNMB 3FFCE 3FQRA 2CDEA 3CU1A 3T4YA 3V6OA 1IC4H 3CH8A 2XWTA 1SEQL 4QRTB 4DVRH 4F15B 5D1XC 1WFOA 4YHPA 4NGHL 3TJEH 3BPCA 3MV7B 2ICWB 3MCKA 5IQ9B 3HCVA 2VYRE 1BIIA 3HFMH 4U6HB 3T65A 2EDKA 5I1DA 3RI5K 1JHTB 4OZIE 4R90L 1TPXC 4N9GB 3W9EA 1NLDH 2KDGA 1A7RL 4F7CA 2X44D 3LB6C 3SDYL 5EPMB 3REVA 1J0IA 5BJTA 3LDBB 5CJ5A 4K3HA 3WDIA 1AO7A 1U95B 4M00A 1JRHH 4R7NB 5DJ0A 4C55A 4FTVE 3OKMA 2Y07L 4QXUL 5FGBA 3C6SB 2R0WH 2CIKB 5IT2L 4AQ1B 2R4SL 1E4KA 3FQXB 5D7LA 2HJFA 4MMXC 2VLKD 1AGDB 5KS9A 1A6VH 1MEXH 1RPQA 4PRPB 1RZIB 3DJ9A 3O4OB 4RIRB 5IMMB 4XP1L 1RUQH 3EYQD 3OPZH 4M4PA 1WT5A 1SQ2N 4ZS6D 1TCRB 4JQXC 1WFUA 3RPIA 1F8TH 1L6ZA 2DQEL 5HHVH 4X0KA 1Q38A 4UI2A 2VITB 3VFNA 3ZZ1A 3WXWH 2D03L 3CGTA 2GT9A 2OL3A 4KQ4L 5J6GB 2OJEA 4NQXB 5E7FA 2ZPKH 1NBQA 3M8OL 3O3DA 3BH9B 4KI5E 4GMTL 5FUOL 4N0YL 2WUCL 2R2EB 3DYMA 1J7VR 1FFOB 4FQCH 5FYJL 1Y18A 2CDFA 2YPKB 3SOBL 4TUKL 1OTUD 4HUXB 2ARWA 4PJ8D 1DUYB 3FJTA 2BNQE 1IJ9A 4GRLB 4CN1A 1DVFC 1KIPB 1EO7A 1EJ6A 3SE4C 1F4XL 1ZA6B 2VABB 2YZ1A 4OZHA 2AV1B 1CBVL 2IADA 4M3JA 4U6VL 5C2UB 5DGQA 1C12B 4PGBA 5HSFA 2PO6D 4U1GB 12E8H 4JKPH 2YD2A 1FPTH 1F2QA 4WI5A 4J3OC 2HFFB 5B4MC 3V6OC 2HA1A 4OCWL 1LP9B 2HT4C 4ZPTB 5JW4Q 4F7PB 5MEQB 1GHFH 3C60D 1W72B 5DURD 3O0RL 4OZIF 4NOBA 4EN3B 1JWUB 2FX8H 4OV6F 4N1EA 1R3KB 3L3OA 1KYOJ 1AD0B 3L3JB 4FFVC 4HFWB 2KQNA 4APQA 4YFEA 5KN5A 5CIPH 4F7TB 3ZE0E 1E4XI 4XPGH 3ZMRA 1W8OA 1MCOL 3C5SB 3DBXB 1QFOA 4LAQL 1U92B 3IFLL 3CFDB 3MLXH 3UJIL 5FGSA 3BP6A 4XBEL 1AXTH 3F7YB 3ARSA 4ODBD 5DR5L 5CEYB 3UTTD 1N8ZB 4TSBH 4NYLA 4JJHA 4L3EE 3B6SB 4OB5H 4JDZB 3WFZA 5IM7A 1H3XA 2BY2A 3T0EE 3WIFA 2DDQH 2VH5H 1MWAB 1PEWA 2GY7B 2BERA 4P59H 5GXBB 3TH4T 1U36A 3PQYD 3QXAB 2ENSA 1F42A 5BZWB 3U7YL 3NH7L 4GKZB 1HXYB 2WIIB 3VFMA 1I9JL 4EUPG 1BPVA 4YQXL 2FEEL 1GOHA 4KGLA 4LEXH 1I9RH 5E6IA 3V7AG 4OAWA 3VXMB 5HYIA 3G6DH 5HJ3B 5TE7H 4IMLB 4R8WH 2NY6C 4KI5F 5FDYA 3K3QA 3GO1L 4HFUH 1WWCA 4X9BA 4PV9A 4L4VE 2X9XA 3DURB 4GFTB 2AJYH 4X8JA 2G2RB 4KMLB 5FYLL 2IGFL 2WQRA 3OGCB 4U1IA 5C3TA 2ZOLA 3OJDA 5D96C 2NQCA 5DSCB 1KLGB 1OQOA 1A7PH 1AO7D 1WBYA 4MQ7A 4QRUA 3GNMH 4PJGE 5HHXL 4GW5A 3IDXH 4LARL 1OAXH 4RFNC 1YEEL 1DEDA 4JHWH 1CIDA 4NRXA 1ZOXA 5IEKB 3LKSA 2QHLA 3QAZB 3TYGH 4X80L 1YYMH 2B5IB 3AAZB 2ICES 4ZXBD 1CF8H 3QQ4B 3B8YA 1CGTA 4JKKA 5DI8A 5JHDB 5JORA 4XZUA 1DE4B 1ZVSB 4UDUB 3D3VE 2NY0C 4NCDA 1PZ5A 3L5XL 4LKXB 1ERNA 1V5JA 4YDVA 1G7PB 3ZE0F 3NGBB 5F1IB 4LCYB 4R7DA 1WVZA 4OLXL 1IGCL 1CD8A 4IHOA 2E9JA 4G80B 1S9YA 1IAOB 4H26A 2A73A 4RA3A 5JUEL 3X13A 4NHCH 2AJXL 4YO0B 4FQXA 5ISZA 2BNRB 4HMCA 3I6LD 4POUB 3CFBA 4I2XE 4JRXA 3OQ3B 4OGZA 1MFAL 1RZJL 1T1YB 4XP6L 1JMZA 3V5DA 3G08A 4K71B 3ZT5A 3T77B 2P5WB 4EXKA 2VLRA 4Q74A 3PGDB 4F3FB 4G8GE 2VIRA 4GUPB 5CP3H 2BSSB 4HSQA 4QF1A 1FYTB 3VDAA 3QEHA 4L1HA 4JREB 2ZSVA 5HHPB 1T0MA 1NGWB 1L9NA 1N4XH 3QDME 1KJ2B 1A6PA 5D1QB 3MQIA 3EO9H 1IAIH 1T1WB 5FYJE 2V9TA 5B8CB 2FDBP 2C1OB 4ALAH 3IJHA 1KENH 2AEIT 4PJGF 5KSVB 4CMHB 2QL1A 1UCBL 3HLAB 3ET9F 2C5DC 2JB6A 1OTTC 3WNOA 4RQQA 4DZ8A 1NCCH 1DBAH 4NQEA 3RWJA 1O7VA 1IFHL 3BIKA 1F58H 1HHGA 2H9GA 4DGVL 5FYKD 4K94C 4MAYB 3BDXA 3S4SA 1UJ3A 2IFFL 4N8VB 5I74B 5LQBH 1N64H 1T04B 3KYMB 1AGCA 4OTXH 5HY9A 3G5VA 1GGUA 5J3HD 2YD5A 3GHBH 3MRLA 3F7VB 2GTWA 4JY6B 3IDMA 2JK5A 1B3JA 4MXQD 5CILL 3BH8A 4XWGL 1AFVH 4YHOH 4IS6B 3L6FB 2P5EE 1MHEA 4JLRA 4F9PA 3QRGL 3JSSA 3L95A 3GKZA 2YD8A 1OP5K 4WWKA 5TE4H 1S9VA 3TN0B 1A3LL 1XR8B 5HYJD 1G7IB 1K5NA 5GS1C 5IKCA 2BVUA 2CKBA 4GRWB 3H6JA 4FQXC 4HUMB 4TTDC 4WUKL 1Z3GH 4UQ2A 1JYNA 3H9HA 4Y7MA 5FCUH 2F5AH 2IMNA 5JOFA 1I7ZA 4WFHE 3MGOB 4YBLB 1I85A 1BEYL 4X7TA 1OAKL 4Y89A 5KOMC 1S7QB 4BK5A 4Y5XA 2UVFA 5E2VL 4F57L 2BSRB 2QQNH 5DMIH 4U0RC 4NKOA 3MACL 3GSNB 4UU9B 2QSQA 4CJ1A 4YEFA 2RBLA 5FYLE 1UH3A 2FNBA 2OL3H 1OGAB 3BUTA 1U91A 3CX5J 3AM8C 5D70L 4XCEB 5JZ7D 3FQNB 3RHWF 2ENYA 1FCGA 4JPVL 4QYOA 3RJDA 2CO6B 5TPWH 4YHMH 1Y0LA 1CXEA 5HPOA 4ZTPH 3DX8A 4AMKL 5TDNA 4MVBC 5ISZD 4JFOB 2NR6C 4KHTH 3H3KA 1R24B 2X1QA 4K7PY 1FZOB 4GS7B 1CR9L 5D72L 1WQVT 1HSBB 3D25A 1MFEH 4Z7VB 1QBAA 1DANT 2D4FA 1ZT7A 5DEGB 4UIMA 4IIQA 5AZ2H 1XGPB 1YEIH 4JM4H 4RFOH 1U8HA 3EYUL 3SE8L 3P11H 4OFVA 2YHGA 1FAIL 2HT2D 5JXED 4LCWA 5KVMC 5E2UL 3HI6L 4I18B 1RZKL 4G6KL 1YZZA 2DQFA 1QFWI 3RIFF 5EB9A 3RVXD 1DFBL 1WLHA 2VZ1A 3DMMC 4PV8B 3GMRB 1B0GB 4Y19D 3SDAA 3EOBB 3TIDB 1H0DB 1KJ3H 1T4KB 3MROA 2AVGA 3QR2A 4Y2DB 5GGRA 2IFGA 3ULVD 2ARJB 4N0UB 3TVMB 4WWKC 5DD5L 1GXEA 2RFXA 3LKRA 3OKKB 4KKBD 4KJPD 2XOTA 1Z9OA 3D18A 2WWMC 4NQED 3SGKA 5FYKH 3HHRB 5I66B 5D6CB 3SGEH 4LP4A 3QCVL 3AREC 2FIRT 2OR8A 1H3PL 4I3RL 5I1IL 5CJQH 4D9LL 3UJTL 3DO3A 1CQYA 1S7XB 4QHNB 4XCNB 1PJ9A 2PYEA 3MUGB 3UTPD 3LPFA 3QUXB 2GJZB 1EJOH 3T8XB 5L0QC 2BX5A 4JO4H 5E5MB 3U6RA 4MA8L 4CU8A 4U1SB 1XZ0B 3W81A 4OD3H 3VXRD 2LVCA 5DDHA 3JV6B 5BVPH 1RY7B 3MBXL 3OHXB 3TYFA 1A47A 3QO1B 4D3CL 2JJVA 1E4XH 4DFIA 5DJ8A 1F11B 1HXMA 4U3HA 4HIEB 4LDLB 4OLUH 1R3IL 4DKEH 4Q9QH 4ONGH 1FVEB 2SEBB 1SJVA 2HRLA 5CHNA 1WCQA 2NY3B 3W2DL 3O6FC 1GOGA 4JM2A 4K94H 3GM8A 4EIZC 2DN7A 3PJSB 3PL6B 1AGBB 3DTXA 3SCMD 5JPMA 2DQJH 1YYLH 4FFWD 3RX7A 2FYYB 4OLZL 4AY0A 4JG0L 4YDLB 1PLGH 1IGIH 4RGND 5F9OH 1KT2A 1S3KH 4YC2C 3IRPX 5KSBE 4P2QB 2VUOA 1JWSB 2DM3A 3MV8E 1LK2B 4NKIH 4X4YB 1W2KT 3MYJA 1SM3H 3VH8A 5L2KB 1YECH 1L0QA 4YHNB 1KCKA 4XNYL 3ABZA 5DTFB 7FABH 2DWEA 3JV4A 2W9DH 2D0GA 3L7EB 4XX1G 1LD9B 2DQHH 2H6PB 4U1KB 2V9RA 3CK0H 4U1NB 2MKLC 4XNUH 3U0PA 1FZJA 1I1AD 3I6LE 2Q20A 1W0WB 2I60L 3ULSA 4KUCF 4PJFA 1VADA 4TSCH 4FQHA 2NX5A 3ULVL 3H3PH 3I02A 3D0LA 3IS0X 2YBRA 2HJLB 3RPKA 4Q6IA 3VRIA 1CFTA 4N8PA 3UJJH 3HE7D 3HZVA 2VSCA 4HS3B 1EO8L 1FORH 4M6OL 4QOKB 3WN5A 5IV2A 4CADB 4FZEH 3SJVA 2R4RL 4TRPL 4BKLB 3HAEG 2X1WL 3QI9C 1BFVL 1HCFX 4HCRA 4I48A 2G5BA 1JUFB 5MEPB 1LK3H 1RK1B 1AQKL 1EZVX 4H88L 4B53A 3SDCB 1QSEA 3G9VA 3GSQA 4O51A 4NO5B 1U0QA 4HX1A 4LCWD 4M1CD 3CPLB 4QRQA 1PBYA 1H8SA 1K8IB 5CMAB 4YFDB 5EA0L 4MHHI 3QNYB 3IAQA 3ZKMC 1B0WA 3KPSD 3QB7C 3H7BB 5F71A 4LMQI 1YJDL 1KCVH 1CL7I 5E9DE 3PP3K 1HHHA 5DQJA 5LXGL 2X2YA 4OZGB 1AC0A 4X4XB 1V3KA 4BSVA 3WJLA 2HLAB 3EYFA 2O5YH 1KTLA 1J8HE 5FKAA 1BFTA 4L3CA 3DGGB 1ZEAH 2C3XA 4FFZH 3UZEA 5B39A 2X4RA 1PY9A 1Q9LB 5KSBF 1TCMA 1A22B 4OKVB 3PG2A 2MTPA 2R56H 5E8PA 3QXWA 2PYED 4ONFH 4X5XB 4FABH 1ZT1B 3TIEA 2K9UA 1A4KB 1XGQA 1DBJH 1G7QB 3QJHB 4OJFL 2R69L 1V7NH 2IQ9L 1U9KA 2DMKA 2ADFL 4Y4HA 3D9AL 5KSUA 3X12B 3IB4A 3TBTB 1TLKA 2HTLC 1MRCL 2QSCH 4P2OA 4I1NB 5CBAB 4XVSL 5FO9A 1HQRB 1ZHNA 2E9IA 1H15B 4FXGB 5HYJE 2PUQT 4YXLL 2ZNWA 4LPTA 5ESAA 2FWOA 2R9HD 3BKJH 3DV4B 1KCSL 2CKBH 3PF2A 3MBED 3FTGA 4AM0B 2XI9A 3L7FB 3RWCB 3RWDB 3ZYIA 1SY6A 2PTTB 1FSKB 4JM2D 2DTSA 1PG7H 3LQAH 4P46C 3LH2H 3N50A 5ANMA 3BZFB 4K23L 3ARGB 2VMFA 3DVGA 4CNIA 3QDGE 2NXZD 5GZNC 3CZFB 3ROLB 2NLJA 5FECB 1ZA3A 4EUPB 3H2WA 2KPNA 3WFHA 4GXVH 2D7PA 1TJGH 1RV6X 5K59E 3MV11 3QEGH 4CKVX 2ZZUT 4HWEH 3KLAB 4FP8H 3DX7B 2VLJE 1ULVA 5LGJA 1FL6A 4OD1H 3VXUA 1D9KB 5I6XC 4I13B 3VFSB 1GGBL 3RWFA 4WW2C 2V5YA 1WEJH 1SJEB 2B4CC 1Q8MA 4PGEA 4U6XB 3ZSTA 2BZDA 1Z2KA 2Z31C 4PS4L 5JHDE 3UP1A 2GSGB 1XH3B 4RGOH 4HUVA 5I1KL 5GRYA 3GBNH 1D5XB 2PCPA 3HPLA 4OGYH 3CZJA 1ZGLA 2BFVH 5DT1L 3SBWC 3PIQB 3OJVC 5E03A 4NQCA 3VGAB 5E94A 5DVKA 3O3AB 1IKNC 2NZIA 3KHQA 4LVNB 3ZE1E 1DQQA 4PLOB 1VHPA 3FO1B 3MFFB 3S96B 5IMKB 4GG6E 2DD8H 4OF8A 2VNCA 3VD4A 3SJVD 1U8LA 4G8EB 2ZOKA 4P23B 4Z0XA 5E8OA 1S9XB 3AVEA 5C09A 3UTZA 5LKNA 2FATH 2R1XA 4H8WC 4NN5C 3T08A 5HI5C 2DJSA 2ERJC 2YRPA 1NQBA 4UT7L 5FHAL 1KFAH 2QHRH 1CD1B 1DSFH 3GJFB 3WHE0 4MJ6A 3RVVD 5SWZA 1E6OH 4Y19E 1KCRH 3VXQA 3PHOB 4Y2OA 1QFWL 1NCDL 4G42B 3ULVE 4QRPD 1CGYA 4JZJB 3BPNC 3QHZH 3BPOB 5I71B 4M6NH 5GS0C 3WSQH 4JFDE 1II4E 1LNUB 2AV7A 3BJ91 2NPLX 4UILL 1WITA 1S9KC 3KAAA 5IIEA 1QVOB 3L1OH 4H0HB 3MOQA 5DRWB 3W0WB 2DM2A 1UWXK 4GAGL 1UZ8A 3O81A 5K59F 1RJYB 2FBOJ 4M9PA 5KVEL 3SDDC 3KR3L 3O4LE 4KKAC 1F02I 3UTPE 4ZPVA 3U7AA 3O8XC 3FB6B 5SWSD 1AKJB 1DQMH 3HRZB 3MRQA 1PVHA 2E8ZA 3MNZB 3VXRE 3QWOA 4OCSH 1J0JA 3BN9D 1FE8H 4FNLH 4XGZA 2JKXA 3CVHL 4AIXA 2VE6A 2GCYB 3FZUD 4PGDB 4HGWA 1GH7A 1MFDL 3DXAE 3P0VH 4LPWA 4OCRH 1YY9D 3FN0H 2IBBA 4QHUB 1QQDA 2XXMB 5DWUH 5F7MC 4P2OD 1DLHB 2DM7A 5IW3A 3K2MC 1IMHC 1BVLB 5ICYB 3EJYD 3Q2CA 1H5BA 5KG9B 1MLCB 3ZE1F 4HK0A 4JO3L 4YHZL 3PE9A 5GRJL 4FQQA 4GG6F 3BI9X 1FNEA 1HIML 5F7KC 3TZVA 4EZMA 3Q1SH 1YEKH 4Y16D 2X70A 1G7LA 2P8PB 2ZUQC 3DRTB 3Q6FA 1CXHA 2ICCA 4Q7DA 4WFFD 5IEHA 4Y4KC 2X4OA 2A1WH 3NZHL 2VO5A 4R96A 4ZFOA 4HEME 2AKRB 5EFIA 5IB1B 5FHBL 4M1DL 4HJJL 5HHNA 4IEFB 5FKPB 4U0QB 1PKQA 4XRCA 4QRRA 3HNSH 3QUZB 3S4SG 2HFGL 4PJHA 4G9FA 2JE8A 4CGTA 3ULVF 2DTMH 2H2SC 3ARRA 3DI3B 3NPSC 3IXTB 4LKCB 4P2RD 2OM5A 2G60L 4KTEL 4ZD3L 1O0VA 3V95A 4KAQH 1QYGL 2XN9A 2X4PB 3GFUA 1XGTA 5HHQB 1D3CA 5DD1H 5C7XH 4RX4A 1BWWA 4O9HL 2AQ2A 1EEQA 5D7IE 3CAFA 3DVNB 3DO7B 4NQCD 5CIPB 1HKFA 5IVXE 1Q9KA 2HFTA 2YKLL 3IF1B 5ID0A 4MSWA 3QDJA 1BOYA 1BGXL 3IDJA 4JPIA 3WNLA 2HMID 1CFVL 4WHYH 3RTQD 4HCRH 3BZEA 2C3VA 5C09D 3AY4A 4KTDL 1NGQH 1D6EA 4S2SB 4P9HL 2EH7L 2Y6SC 1RIVL 3FAXA 4PD4J 1CWVA 2AEPH 2B4CH 5E2JA 6CGTA 4GKNA 4RBPH 2ITCA 3RVWC 3KPSE 3VD7A 1J05B 1KC5H 5B3JE 1MH5B 1BQLL 1WC7B 4IRSC 3OKEB 5E08L 3WIHL 3VWKB 1FFNB 1D7FA 1L9MA 4OZ4A 5ICXA 3BP4B 2DICA 5JLZB 1EAPA 1HI6B 4AH2A 3FO9A 3RZCA 4D0BA 4F37F 3S36H 4ODXB 2Y25A 3QXUA 1UACH 1CL7L 1YMHA 4ONHB 1X5KA 4YXHL 1FLTX 1ZHBB 4G5ZH 4RDQG 5D4QA 4AEEA 1UKTA 3BKYH 3BDYL 4NKQB 2CDGB 4H8WH 3W39B 4HXBL 3NVQA 3CLEL 3LN5B 2EDFA 3QG6B 5KJRL 3A67L 5CZXC 5MEOB 5IMLB 2W65A 3BKMH 1D5IL 2VLKB 1DBBL 2G5RA 3QPQC 3BO8A 4D9QE 4XNXH 3AXLB 1J10A 1CG9A 2CH8A 1H3UA 2G9HB 3INUL 3QCUL 3MJ9L 1U8MA 4FG6D 4HKZA 5F7WC 3KXFA 3V5KB 2A9NH 3G5ZB 5IB2A 7CGTA 1WWAX 1J1OH 4A2MA 4R4NC 4L9LB 2VDML 4GLRH 1TVBA 5D7IF 2ADJB 1SY6H 4PG2C 4XVUD 5HGGS 5IVXF 4XMKL 3V6FB 3O11A 5FUZL 3H9YA 1WIPA 1MHPL 1BP3B 5T3XL 4O2FB 4PR5A 4NT6A 3BRDA 1SYVA 4WDIA 4ODVH 3SKJH 5KVFL 4DUXA 5C0AB 3BXNA 2CGRH 4BA8A 2Z8RA 2FGWL 1T1ZB 2N1KA 3C8DA 3C6LB 3FB8B 3H0TA 3QWRD 4ONOA 3VGDA 4YE4L 2HP4A 5B3JF 3SEPA 4HH8A 1JP5A 2KL6A 3MUZ1 8FABA 3C60B 2V2XA 5DURB 4AG4L 5GJTL 4Z6AT 2Z93A 2CRZA 4YHIA 5LAXB 4JPKL 5AD0A 2F54D 5TDOB 3RL2A 4Z9KB 3U0TB 3U2SA 4F33A 2VAAB 1DBKL 3HC4L 2J7LA 2VDKH 1KXVC 5F7EL 3TA3C 2ZNXA 5BO1H 1NCBH 3GHEL 4UT9H 2A9MH 3VMOA 1ITCA 5TF1L 3N1FC 2X4UA 2EKSA 3UTTB 1Q9OB 5I17B 5T1KB 3WEXB 3B2VL 2A83B 4IDLA 3GIZH 4PBWD 35C8H 4TNWF 4ZFZA 4C4KT 5ILTH 1ZHLB 3PQYB 4KMQA 1ZLUH 2OK0L 5EBWB 1NLBL 3HFML 4XMLL 1JNNH 3TNNA 2X9YA 2CDEB 3T4YB 4WUUA 3D69A 3QIWC 1FDLL 2XWTB 4P9MH 4QRPE 4NQVA 5IW6A 4YHPB 2R0LL 1L0XA 2OI9C 5IF0B 1JYVA 3QWQB 3EHBD 2ZCKL 1JHLH 5CEZD 3GJEA 1EZVY 1F13A 3K2UL 4LLDA 3MCKB 3VGHA 4D8PA 4XC1L 1KEMH 2DL9A 5AYUH 3T65B 4DGIL 4ZDHA 4Z78A 5A3ID 4DN4L 5I1DB 4KK8C 4TPRH 2R0WL 4XCYA 3RZCD 3H8NA 3S34H 3S37H 2GAZB 2FHCA 3G6JE 4HIJA 4S0SD 3W9EB 4N8CL 3GMPA 4NQDE 4F7CB 1LMKA 3REVB 5IK3A 5BJTB 2BHZA 4JB9H 1AO7B 1A1OA 5DS8A 5DJ0B 5EDXA 5SWSE 2GITA 3HZKA 3OKMB 5EO9A 4LCCA 3WFDH 3HAEB 5SX5H 5BRZA 1RJLA 1WZMA 3EYOB 2EXYD 3CSBA 2R0ZL 1NL0L 1FNSL 4NN7B 1ZWIA 3WXWL 2HLFC 4J4PC 3WE6B 5KS9B 2BK8A 3LRHA 1F00I 1RMFL 5HXMA 4WHYG 4AIOA 4WFGD 4EI5C 3QFJD 4JHAL 1BOGA 2D0HA 1I1RA 4LHUA 4J6RL 4X0KB 5DJ2A 3VFNB 2J4WH 2H32A 2GT9B 5K9OA 2OL3B 2OJEB 1WZ1L 4S1SH 1K6QL 1MCFA 2CUIA 4M8QA 3F8UB 3WHXA 2D0FA 4KK6C 1RIUH 4PJ5D 1MSPA 4WFFE 4CUCA 4JKPL 3MREA 5IB3A 3RWIA 4PTTA 1X7QA 2AI0L 2DL2A 3QEQD 1TJHH 4K8RC 3WKMH 2IADB 2DQUH 3EDJA 4FQLL 1T03L 5B39G 3GRWL 4PGBB 3TCLB 4P2RE 1OT1A 3NFSH 1S78C 2LU4A 1E28A 2C4FU 4X6FA 5FYJU 1JZ3A 5EIQA 1K8DA 5FO7A 4WVRA 1JZ8A 1CLZL 1AI1H 1AXTL 3UDWC 5GISH 3G6JF 5MERA 1G6RL 3O2DA 5DUMH 4ZSOE 1S7VA 3N85L 4Q9BA 1QBMH 3L3OB 5T3XE 3PWPA 3LQZB 2Q3ZA 1UCTA 4L1DA 4MHHG 4APQB 2DS4A 3TO2B 1TETL 1IQWH 2XQYK 1MIEH 1J86A 2AGJL 3BP6B 2BVPA 4WHTA 2EIDA 5IHBA 3OKOA 1DN0A 5T1LD 2K7PA 3QHFH 4YDJA 4NYLB 4LEXL 3KPRE 3SN6N 2OZ4A 3RZWA 4LCCC 4P5MA 1RJCA 5IM7B 1IRAY 5KBNC 2F15A 2Z0BA 2CIIA 1UB6A 3MJ7A 2QQLH 5DJ6A 2VC2H