1QKZH

Fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
DVKLVESGGGLVKPGRSLKLSCAASGFTFSDYYMFWVRQTPEQRLEWVATISDGGAYTYYPDSVKGRFTISRDNAKNNLYLQMNSLKSEDTGMYYCARDPLEYYGMDYWGQGTSVAVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVNVTSSTWPSQSITCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G-PRIME
publication title Crystal Structure of an Fab Fragment in Complex with a Meningococcal Serosubtype Antigen and a Protein G Domain
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immune system
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1999-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qkzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qkzH01
1JPSH 1S7RA 2OLDA 3BN9C 4XB8A 4MX7A 1JPGA 4K8RC 4PRHD 3BKMH 1A2YA 5SWSA 3ZSTA 5FKAB 5DEFB 1FYTD 1RUPL 1MCWW 2VAJA 4WEUD 3NCJH 4MZ3A 2G75B 4PLKC 2GYSA 3MNVB 5I1KL 1CU4L 3OKDA 3EYSH 2X1WL 3WIHH 1S9KC 4AK1A 5IJVB 3RI5K 3TV3L 2MCPL 1KXVC 1FYHB 4JPWL 3EO9L 4O02L 1XCQA 1R0AL 4G80A 2EDEA 3U9UB 5FKPB 1F6LL 5CWSB 4GAJL 1HSAA 4M62H 2D0GA 3IFNL 3M17A 2WBJB 4LCYB 5T3XH 4MB4A 5BVJB 2VLLA 4KV5F 1AGEB 4P3DB 4X98B 5D4QA 4OJFH 4TOYL 3CPLB 3FO9A 3OKOB 3PGCB 3D39A 1KTLA 4XBGA 1LE5A 4MD4B 5SWQA 4WFHE 5DRZB 5KANG 1T1XA 4WO4B 5IQ9B 5FHAL 2WINA 3BISA 1H5BA 3NCYS 4ZDHB 1YN7B 4P2QE 3TH2T 4DCQB 4L8BA 4HEME 4PY8I 2A83A 4BZ1H 25C8H 4L4VD 2VDRH 3I75B 4XPBL 5E9DA 3AAZA 3OXRA 4NPYB 5DK0B 1CI5A 5DJ8B 1RULL 3IDMB 3T3PF 2ERJC 3C6SB 5GS1C 1IAIM 5DMIH 1QFWH 5DC4B 1JHTA 4GAFB 4LSVH 3SE3A 3T4AA 3LKQA 5EU7C 4LVNC 4UILL 1YNKL 5I30L 3NN8A 1IGYA 3D25B 2P5EA 3HPLB 3ARFD 4HMCA 4XPAL 5A1AA 5ITFA 2B7DT 5FYKL 1IM3A 1RZGA 3DOSA 4E0RB 1YEGH 2PXYB 4M9OA 3UYRH 1IKFL 3RI5F 3MR9A 3IKKA 2V5MA 2Z8SA 4OT1H 2VZ1A 5CGTA 5I76A 2VLRD 4ZAKC 1ORSB 4PRHB 3O6MH 1CFNB 3BKYH 1B0RA 3KJ6H 4G3YH 3QZWG 4OF8A 1FYTB 3HUJA 3GMLA 1A9EB 1CDCA 3OPZL 4WJ5B 1AP2B 4KK6D 4YHOH 3PWNB 1E4WH 3AM8A 3JWOH 3INUH 4GLRI 3UTQB 4YO0A 3VWJA 3KNBB 3R1GH 1OAXH 5F1KC 3HUJF 1CLZH 3GHEH 5T3XE 5DO2D 4HDIA 3LKRB 1BQLL 1C5BL 3WE6A 5ENWB 3QAZC 2OXHA 5I17A 4C56A 4GW5B 2YN3A 3SPVB 1I1AC 3KR3H 4YHNA 3WDIA 5FUZL 4P9MH 4L3AA 3ZT7A 5DD6A 4POZD 3DSFH 3SKOA 3RA7H 3CFEA 3SDCC 5D7SL 4JFYB 5GRYA 3QG7H 5SWSD 1D5BB 1FVEB 5EBMA 4HIJA 1JZ3A 5DD5H 4PS4L 5CBEA 5HVFB 3P73A 2ED8A 5FECB 4OLZH 1DVFD 4MXWH 4WDIA 2Q8BH 1EEQA 3QWOB 2FH6A 2E9JA 2EDLA 5GS0C 3VXNA 3G6JB 5J13B 1NMBH 1G84A 4OCYL 1T04B 2G2RB 4I13B 3ARDA 4Y4HD 2P8PB 4L4VB 2DMBA 5CKGA 4UNTA 5EBWB 3KHQA 4NC0B 3O41B 4PJAA 1FFPA 4MLIA 4GG6E 4X4ME 1IC7L 4OFDA 3RNQB 4OM1L 1INQA 4S11A 3TA3D 1KYOJ 1SYSA 4LLMA 1UVQA 3O9WD 4PJAF 3VJ6B 2DTSA 4QY8A 5IMOA 3D1MC 3D39D 1KG0B 2YKLL 5DYOA 1FZKA 3T0AA 3JBG7 3V7MA 4JGMA 4RFEA 4JQVA 3SDAA 3MLXH 1YYMH 1G7IB 3IDJB 5C2BL 3MXWL 1A6VH 1G9MH 1QSFA 3ARFB 3ZE2E 5IB4B 2LTQC 4AMKH 4CU6A 6CGTA 5MEQB 5E6YA 4A6YH 2CUIA 2LU7A 1A14H 2VLRB 4HK3J 2X42A 3MV7E 2VJXA 4PJ9C 4LL9A 2GJZB 1ZLUH 1FNEA 1JYWA 5IHZA 1KBGL 1IZJA 3RZCA 2UYLA 5E2TH 4JM2A 4OIAA 4JFOA 3OF6A 4MWFA 4GBXA 4LSDA 3S37H 3TT1L 1A1NA 2ZSVA 4G9DA 3QIBA 1MIEH 1B9ZA 1IC5H 1JN6B 2OTWB 3Q6FB 2GK0B 1BJ8A 1XH3B 2H6PB 3GHBH 5JQ6L 2ITCA 4MAUL 4M1GH 3VRIA 4ELMF 1S7RB 4BSVA 3BIAX 5B39A 2DS4A 3TN0C 4KDTC 4MX7B 1KN4H 4HH9B 3RKPA 5C0RL 1LK3H 5BV7B 1A2YB 5SWSB 3NPZB 1IEAA 4JFZL 2VKXA 5BVPL 3IU4L 5EIQA 3VWJD 1JNHB 5KVFH 4NOBA 4X9HA 4IOIA 1Z5LA 3HNTH 3OKDB 2E7HA 3GFUA 3W11C 1DVFB 5JDJA 4U6TA 3QUMH 3G9AB 4C56D 1XCQB 3RPKA 3SGDH 5HHNA 1EO8L 1KLFA 2AJYH 4G80B 3QXTA 2J8UA 2GJ6E 3O6LL 3QDJE 4HKZB 3KLDA 4WCYL 4O58H 4W6YB 1HSAB 3CC5A 5E7BA 1KB5A 3M17B 5CD3A 2BXZA 1XGYL 2J8UF 1EDQA 1ZVSB 1GH7A 4KQ4H 3D48R 3Q0HA 4KUCD 2D03L 1MCRA 1EBPA 4KDWA 4IM8A 4ZUVB 5J1SC 1EIBA 2ADIB 3ULVL 5I1AA 3D39B 4OF0A 4Z7NF 1T4KA 3HE7A 4L1DA 1KTLB 4P2RA 4XBGB 1LE5B 3U46A 5SWQB 1T1XB 5CGYC 5T1MA 3P9LA 2WINB 4LGSB 1H5BB 4LVHC 5DMGD 5GGSY 4IS6A 1ZSDA 3PG2A 3ARDD 4L8BB 4GG8A 2A83B 4Z76A 1MCEA 1L9MA 5ESAB 1KTDA 5J7CC 4JY4B 5HJ3A 3RQ3A 3AAZB 1I3GH 1HNGA 5D7IA 3OXRB 3L9RA 1DN2A 2NW3A 1V3MA 3L5XH 2HT3C 4AL8H 5ITBL 1LO4L 3GRWH 3P30H 5D7IF 3T0VA 1OSPH 1JHTB 4NQSB 1JPTL 3WJLC 1KGCE 3T4AB 2UZIL 3LKQB 1MHHA 3TPKA 5EDXA 5KJRL 5EU3A 4UBDC 2EZ0C 3M8OL 3SDAD 4JRXA 3T77A 5AAMA 3NN8B 1RFDL 2B4CL 1IGYB 4HT1H 3I50L 4JM4L 4Y5VA 1QSFD 3MRRB 3LKNA 4XP9H 5ITFB 4BZYA 1IM3B 1Q72H 4Q6IC 4H1LH 3KPNA 2ZOKA 3U4AA 4EI6A 3VWKC 5HTSA 3MR9B 5T5NG 4JFEE 3W0WE 5I76B 3MACH 2H1PL 3FZUC 2NMSA 3EOYG 1MFDH 5GGVL 5CCKH 1FFRA 1KC5L 2BVEA 3HUJB 3GMLB 4P23C 2Y7QA 2YD5A 3VWJB 3W82A 1WZ1H 3L5JA 1OPGL 4F7EA 4PBVC 2QQKL 3C09B 4M7ZC 2P4AB 3QIBD 2M1KA 5I17B 1XAUA 1TENA 1HKLL 3GI8L 4C56B 4YHNB 1FV1A 1RZKC 4NYLA 4OBRA 2H9GA 2X9YA 5DD6B 3V95A 3SKOB 3CFEB 1CLYH 4EUPG 2ZUVA 1GRWA 2EEBA 1CLOL 5IBTL 3KPTA 5J9PB 2D7TL 4C4KT 5D96B 5EBMB 1YMHA 2I9TA 3P9WB 4RA3A 1VGKA 1HNFA 4JCMA 4MS8D 4NN6C 3UX9B 5DD0H 5CBEB 5CZVH 5E00A 2OM5A 1ZS8A 4LSTH 1CD9B 3P73B 3TBYA 4U33A 4MHHI 4WEMB 4WW1B 3U7YL 3BJLA 1CVRA 5EBLA 1UA6L 5IEKA 5C3TA 1OP5K 1IGIL 2BSSA 4WDIB 3VXNB 4NJAL 2CPCA 1WUNT 4S10A 3VXUA 5BXFA 2PCPA 4TNWK 3OAUL 3ARDB 1TQBB 1BFVL 3FONA 1WSST 2W92A 3KHOA 4PLOB 4UOW0 1CDGA 2KH2B 4PJAB 4A2MA 1FFPB 3T4YA 1G9NL 1MCKA 1RIUH 2AQ2A 1V8HA 5EU6E 1INQB 3SDYL 1SYSB 4LLMB 1UVQB 4XBPA 3PE9A 4QY8B 4DVRH 5IMOB 3HE7D 3WYRA 1OM3L 4B53A 3JVGA 4F3FA 1FZKB 4XHJC 4MLSA 4OZHA 4RFEB 4YHZH 3SDAB 3RVTC 5FOJA 2DQTL 1KPUA 1QSFB 4OZHF 5E8DL 1B6DA 2DTML 5ACMA 2AJSL 3FFDA 4ZS7H 1NAML 1Z2KA 4YDLC 2Z31C 5GIRA 2ZNXA 2CKBA 1FORH 5GGRY 1MRFH 2X4QA 2J88H 2Q1EA 1NBZA 1C12A 1FNEB 2FB4H 5IHZB 4KGLA 1S7WA 1PEZA 3RZCB 4OZFA 2UYLB 1G6RL 3DX9A 4JM2B 4JFOB 4MWFB 5F93C 3ZE0E 4BFEA 1Z3GL 1A1NB 4WY7L 4DGIH 2ZSVB 4G9DB 1SEQH 3QIBB 1SBSL 4YBHA 1AXTL 1UZ8A 4HWZB 4BZ2L 5TE7H 2ITCB 4DFHA 3VRIB 2VWEC 4BSVB 1HQRA 2DM7A 4NBXB 4Y1AE 5B39B 1Q1JH 3NH7H 4TUKL 1L0YA 4XNUL 5E9DE 1MOEA 1IEAB 5I9QC 4X7DC 4M48L 3EW3B 5FA3A 2N7AA 3MQIA 1OGAA 2YSSA 1BAFH 4IOIB 2VSDA 3VDCA 1Z5LB 2XPGB 2D2OA 2AGJH 4CMHC 4QRPD 4TSAH 5HHNB 1YNLH 1XIWA 1U58A 4WW2A 2J8UB 2P5EE 3DBXA 2JCCE 4L9LA 2VDNH 3CC5B 4XT1C 1KB5B 4HIXL 5CD3B 3GSUA 3WLWC 4WW2F 5IHLB 2OCFD 2DBLL 4AENA 1CZ8H 2NXZC 3CUPA 1JZ5A 3THML 3S3SA 3A6BH 3KWWA 3UJJL 3FB7A 1T4KB 3HE7B 4P2RB 1QFWM 1LDSA 3U46B 1S5IL 1T7WA 1XGPA 3KYOA 2AV1A 5T1MB 3P9LB 1DJSA 4E5XA 4DUVA 3VXUD 3W2DH 1D7FA 4IS6B 1MLCA 1ZSDB 5D93B 3MUZ1 4LQFL 5F8QC 4GG8B 1MFAL 4HKJA 4Z76B 1CFVH 1KTDB 4WHYH 3EAKA 1D6VH 1PDKA 1BZ7A 3DVGA 5HJ3B 3T0DA 2F53A 4YC2B 5D7IB 1U8MA 2XRAH 3L9RB 3V4UL 2NW3B 4N5EC 1Y6KR 3NIDF 3MRHA 5EOCH 4HWEL 1NCBL 3VGDA 5I1JL 1MHHB 3O0RH 5EU3B 4XP6L 1T1ZA 2Q76A 4MD0A 3WFDH 4JRXB 3HI6L 3T77B 3WSQL 4HBCL 5D72H 5TFSH 2F8OA 3QQNA 3TH4T 3JV5A 4Y5VB 2C4FT 1UACH 3LKNB 4PB0L 5FYJU 1JWUA 4OCWL 4AQ1B 1U8KA 3KPNB 2ZOKB 1R3LB 2B1HH 2GK2A 1MCLA 4EI6B 1MCOL 1YY8A 3VFMA 2WW8A 1T2JA 3RWCA 4FQXC 4IHOA 4YDIL 1D5IH 2DQDH 4M7KL 1FFQA 2VZOA 4FQIH 4GXUN 4UTAH 4XWOD 2C3XA 2O5XL 2Y7QB 5IHBA 1UYWH 4Y88A 2X40A 4NCC2 3LS5L 1PKQA 4UT7H 5IGXH 4ZOAA 3TT3H 2YZ1A 1CGSH 1F2QA 1KB5H 1T66C 1FV1B 2BX5A 4NYLB 2H9GB 3BSZL 3S97C 3W81A 4G8GE 2C4XA 3O4OB 1DSFH 4DGVH 1CG9A 5F9AC 3GJFK 2IQ9H 2UY6A 1YMHB 5L6YL 2I9TB 1NL0L 1VGKB 4KK9C 4NQCD 1NLDH 4NDMA 2VC2L 2XN9E 3V8OA 4EJ1C 1ZS8B 1JUFA 2DQJH 2HT2C 2GT9A 2AXGA 3TBYB 5EBLB 3WNPA 5IEKB 4LRIC 1PSKH 1V7MH 4Y7MA 4U1GB 2BSSB 5C0CE 1XIWD 3LQAC 5FUCC 3VXUB 5BXFB 3P0GB 1HH6A 2PCPB 4UB0L 4AQOA 1MJJA 4UOJA 1F4AA 2QSCH 3SGKA 3FONB 1U9KA 3QDGE 5GSRA 1FO0A 1JZ7A 2QQNH 3WCYA 1A4KA 1XCTA 2XWBA 2HKFH 3T4YB 4OKVA 4ZUSA 2J6EA 4YK4C 2YD1A 4HK3N 5E99L 4XBPB 2YRLA 2X1OA 5GGUA 1F3DJ 3E2HB 1J5OH 4F3FB 5F7KC 3O2WH 1CE1H 4OZHB 1WBYA 4Z8FH 4JG1L 4UINL 4CNIA 1AJ7L 15C8L 1E6JL 3JUZA 1KPUB 2JELL 5B22A 1YYLH 2PETA 5IROC 1A9BA 3FFDB 4R0LA 2HWZL 5INDA 3QA3A 1T1YA 3FHAA 4WTZA 4O5LL 4JFPB 5GIRB 3MJ9A 4DTGH 2YD7A 4K71C 2CKBB 5DI8A 2X4QB 2AEQL 4WUKL 5CP3A 4JG0L 1NBZB 3GJFA 4UNUA 4RDQG 1C12B 1T6VN 4D94A 4J8RA 1S7WB 5INCA 4OZFB 4H88L 5TF1H 4PREA 3C5ZA 5DHYB 3ZDYE 3DX9B 1OTTC 4OGZA 5CEZL 2DAVA 2V6HA 2W60A 2R0LL 5CIPH 3WJJC 1Z9LA 5SWZA 5FFLA 3LOWA 4NIKB 3HI1A 5LQBL 2JJUA 1I9JL 4P2OA 4OLWH 1UZ8B 4G8IA 1RUPH 5KANI 3D69A 5I1KH 1CU4H 1LO2L 1HQRB 5D5MF 2Q87A 5GXBB 1HYSD 2G9HB 4LAQL 3T3ME 5F72S 3TV3H 4JPWH 3EO9H 4NKIL 4UOW1 4NUGL 4WI2A 5C0GA 4ZTPL 1R0AH 1ZGLA 2DWEA 1OGAB 2YSSB 2KZ1B 1ZA3A 4GAJH 5ECJE 5JPMA 4NFBA 1J1OL 5J11C 4NO3A 1KIUA 5C6TL 3VG0L 1XIWB 1U58B 5KSUA 4JN2A 4WW2B 5T3ZD 4TOYH 3HFMH 4HJ0C 3DBXB 4RGNC 5F1IA 4L9LB 1B90A 2DLTA 5C0BD 3DTXA 3GSUB 3MYJB 1OHQA 1N8ZA 5FHAH 1H3VA 2AXHA 4AENB 1LHZA 2D7PA 3CUPB 3V5DA 2FEDD 3KWWB 3RWJA 4KZEH 4WFGE 3FB7B 1LDPL 5JZ7D 4J3OC 5FGBC 1XGPB 3KYOB 2AV1B 5DRWA 1KELL 2BFVL 2WMPA 5F7DA 5KS9F 2LVCA 1MLCB 2V7HA 1U8OA 3I6LE 2CKBH 2NXYD 3T0EA 1BIIA 2FX8L 4HKJB 4JDTH 5DVKA 1IFHL 1OCWL 1BZ7B 2WAHA 4LIQH 4MJIE 4LASH 4UILH 1YNKH 3KLSA 4N8VG 4C83A 2AV7A 5I30H 1KJ2A 1JZ2A 1U8MB 5C07D 1UJTA 3SO3C 2R29L 2E7MA 2F58H 4JREB 1F6AA 3HZYA 3O3UN 2GUOA 4W4OA 4WI6A 3MRHB 5FYKH 3BO8A 3ZLQC 3QQ3A 4F58L 4NNXA 5M7QA 1OP5H 1IKFH 1J0ZA 2NY5C 1AD0B 2BY3A 4U3XA 2Q76B 4MD0B 4U1HA 2NZ9D 3K8MA 4PY7B 1GZQA 3VCLA 2YS4A 5AEAA 1JF6A 2UWEE 2BERA 5GRZA 1EUUA 1JWUB 3FQRB 4XI5D 1YEDA 4JRYA 1U8KB 1YY8B 3TNNA 3VFMB 4NKQB 3GMOA 2DQCL 4TSCL 3RWCB 2NX5D 3UJTL 4Z7QE 4Z77A 1KCUL 2J3SA 3V7AG 1BQLH 4OF7A 4OD1H 1SJXA 4Q2ZA 1GYAA 4MDIA 3C5ZD 5IHUL 4HZLA 3DX7A 2R1WA 2UZXB 4I9WD 5FUZH 3O45A 1CGTA 1JCKA 5L0QC 4J3VA 5SWZD 4QXUL 2NY4B 5D7SH 1PKQB 4FXLA 2FBJL 4P2OD 1OB1A 4DN3H 4YHMH 4V2BA 4X8XA 4LPCA 4PJFE 4C54A 4PS4H 4OZ4B 3QCTL 3TBSA 4FFYL 3BIKA 5CZKA 3VXPA 1CG9B 1FZMA 2MHAA 1MRCH 1XF3A 4I1NB 5IEHA 4QXWA 4GAYA 5F7HA 1I9IL 4XNYL 4NDMB 2EH8L 1HKFA 1JUFB 4JO2L 3BRDA 2GT9B 3D18A 1QNZL 3I84A 4KC3B 5CSZA 3O6KL 2CUMA 4KY1L 4B0MM 3ZKNC 5HBBA 1IC7H 2J1KA 1YQVL 5DS8A 4D0DA 1HH6B 4XGZA 5JMRA 5FYKE 5TF0A 1CT8A 1MJJB 1NH6A 2NXYB 3F7VA 3L3JA 4V1DE 1AFVL 2YKLH 4UNVA 4AIXA 5GSRB 4MA7L 1FO0B 5ISZA 3W9DA 2FJGA 4I5BA 3BEWA 3KPRA 1A4KB 1XCTB 2XWBB 4X99A 4OKVB 4MNGA 3R8BB 2LVEA 3BDXA 3DO7A 4WI8A 4AY0A 1CICA 4Y4FA 5C2BH 3MXWH 2ATPA 5L2KA 4HWBL 1NCCL 2R56L 1VFOA 3HE6A 5GGUB 1W0VA 1ES0A 1WBYB 5LGKA 4PGBA 4CNIB 2YA0A 2ZUSA 3QDME 2C3WA 3T0ED 3KXFA 3SGJA 5M95B 5ACZA 1KBGH 3DWTA 1A9BB 4R0LB 2CIKA 5I0DA 5INDB 3MLVL 1T1YB 4O2EB 4PGDB 2N7BA 1CDUA 5DI8B 2NX5B 3TT1H 3H6JA 4K55A 2CDGA 2YMXL 3GJFB 2VQ1A 2F8VA 4G7YL 4J8RB 5INCB 4LLWA 3C5ZB 3TLRA 5JQ6H 4FMKA 4MAUH 4R97B 2XOTA 3UDWC 3QFJE 4JPVH 1J0KA 4Z7OE 5SWZB 5DEZA 4PD4K 3HI1B 4P2OB 3BESR 4JFZH 4JRYD 1R5IA 2NY0D 4G8IB 4JKWA 4NO0D 3IU4H 5D5MB 4KI5C 3D69B 4K9EL 1L6ZA 1QSEE 2A0LC 2BNQA 2EDXA 3DJ9A 3WO4B 3AREC 5ELIA 1GOHA 5B3JF 2F53E 3I6KA 3I9GL 4IJ3C 5C0GB 3S35X 1EO8H 1ZGLB 1X6LA 1NMAL 3S98A 2DWEB 3O6LH 4X4XA 3ARWA 4HJGA 1ZA3B 4WCYH 2IFFL 3RWIA 5JPMB 4YX2L 4L9DA 3R06A 2H2SC 1XGYH 4I18A 4NO3B 3SQOL 3ZKSD 5D6DA 4XNXL 4YLQT 5JIPA 4PV8B 3BGFC 5C6WH 3EOAA 2D03H 3EFFA 3MBXL 3GK8L 4JN2B 3RRQA 2RJMA 3MBEC 1U3HC 5F1IB 3ULVH 3HCVA 3DTXB 1GPOL 4OLEA 4MVBD 3U4EA 4J23A 1N8ZB 1UADC 4YUEL 2XTJE 1JYXA 2W9LA 4E9LA 4NQVA 1IAKA 4X7SH 3V5DB 1YPZE 2QHRH 1II4E 4P4KA 3RWJB 3VE0A 3SKMA 5KS9B 4MQXD 3A6CL 3N0PB 4P2CG 1HHGB 3NPSB 5DRWB 4OCRL 5H2BA 1TZIA 3ZE1F 5F7DB 2Y1VA 5I6XC 2W0KA 2MQCA 1MQ8A 2L7UA 1HCFX 2V7HB 1U8OB 3UTPD 2IBBA 3T0EB 1BIIB 4BYHA 5ITBH 4P46A 5CP3H 5ISZD 2NY3D 4BSWA 1JPTH 3RVUD 2UZIH 3KPRD 3CNKA 5KJRH 3MLZH 4C83B 2AV7B 1KJ2B 3AS2A 3M8OH 5CHNA 1RFDH 5DMKA 2B4CH 4YPGA 5AG8A 1CICD 4Y4FD 3I50H 1F6AB 3HZYB 4JM4H 4NRZA 3RUGE 5L2KD 1EZVX 2GUOB 3GUTA 3BO8B 3QQ3B 3HE6D 4ZFGL 2FHBA 1P9MC 1S7XA 4LNVA 5TGBA 4HUXA 3X12A 4U1HB 4JFXA 1F90L 1GZQB 2VERN 3SCMA 2H1PH 3VCLB 3KXFD 3ROLA 4HGKC 3FQNA 2CLRA 5GGVH 3AVEA 2GITA 1YEDB 1KC5H 4KRNA 4JRYB 2NY0B 1ZAGA 4KKCD 4NO0B 3TNNB 1TQCB 3GMOB 1W72A 1OPGH 3R0NA 2QQKH 4L5FL 4Z77B 1EO7A 3PGFL 5K9QG 1PYWB 1U3ZA 3EYQD 4Q2ZB 2QADD 5IVOA 4F9LA 2Z93A 4MDIB 1D9KA 4K3JL 5HYJA 2HH0L 1HKLH 3GI8H 4HZLB 3GKZA 3DX7B 5CP7A 2R1WB 2ATKA 2VE6A 4P9HL 3ULVE 1OT2A 3F6IA 3O45B 3SDXA 1TVBA 1JI2A 1CLOH 5IBTH 5TPWH 1EUTA 1I75A 3QQ9C 1YJDL 2D7TH 1OB1B 4DEPB 3SDXF 3TGXA 3O6FA 4DK6A 1F5WA 2HRLA 4UAOB 5MENA 4HG4K 3O8XA 3HAEG 2BNQD 3U7YH 2NW2B 2WBJC 1UA6H 3UZEA 3X3GL 3VXPB 1UJ3B 1FZMB 1IGIH 1XF3B 2MHAB 5IEHB 4LPWA 5EA0L 4NJAH 5IBLC 1SY6A 4GAYB 4Y8AA 1DDHA 1B88A 3ULSB 3D18B 1BFVH 1YA5A 4Q58C 4D0CA 4WO4C 3KS0H 5FM5O 1HHIA 1G9NH 5CSZB 1ADQA 4FQ1L 4CDHA 5TDNA 5DS8B 4D0DB 4XGZB 3FTGA 1CT8B 2ICEA 4O2CB 1TXKA 1VFMA 3V4PL 1QYGL 5MI0B 1VEPA 3F7VB 2VXTL 3L3JB 3CU1A 3S36X 5HHVL 5ISZB 2NY3B 2FJGB 3AROA 4I5BB 1BBDL 3BEWB 3KPRB 4X99B 4MNGB 3K74B 4NT6A 3DO7B 1FGNL 4J1UA 5JOPE 2ZUQB 5K9KA 1CICB 2DQTH 4Y4FB 3DUSA 1A64A 3HRPA 2ATPB 5L2KB 2DTMH 3HE6B 2AJSH 3VXQA 4M3JA 4X83A 4LPYA 1NAMH 5DURB 1U91B 1KTKE 3O2DA 1W0VB 3B9KD 5FV2A 4PGBB 2EYRB 4XPGL 4ZSOE 3KXFB 1ITBB 5BO1L 5ACZB 4P46D 4BSJA 4Z7VE 2PXYC 3SHSA 1ZHKA 2CIKB 4U1LA 1G6RH 3RY5A 1XF4A 1A5FL 1Z3GH 1ED3A 2BY1A 4WY7H 2GSIA 4OCXL 4ERSL 1HI6A 1FNGA 2CDGB 4GH7B 2VQ1B 2FRGP 5L2JA 3WDJA 5BS0E 1AXTH 2QADB 4BZ2H 2LU3A 4LLWB 1ZGLP 1WBZA 1E0OB 1JGVL 2ID5A 2X6MA 2NNAA 5FHBL 2F15A 5DMJB 1I85C 3WEXA 2YPLE 4TUKH 4XNUH 4J7RA 5IP4A 2FJFA 4M48H 4GLRH 2XKUA 2YOCA 3MYZA 3TIEA 1OAZL 4PIRF 2P8MA 2BNQB 1I8IA 1BJMA 3CDFA 4KDVA 4OQTL 2AJVL 4GKZA 1D9KD 5HYJD 4XTRD 1T03L 3REWB 3I6KB 4MA3B 3C8KA 2V7NA 4X4XB 2UVEA 3QWQB 3RWIB 4XNQA 5EUOE 3N06B 4N0UA 4TTGA 5C0IA 3R06B 4NQXA 4I18B 5J13C 3O6FD 1A6UL 2AJZA 3K46A 1LQSR 5HHMD 3HB3D 3TYGL 3EOAB 3FFCA 1Y6MR 3EFFB 3ARGA 5MEND 4KJPD 2VKWA 3THMH 1H3TA 3UJJH 2H32A 4F8QA 3MRBA 4WUUE 2KUTA 2W38A 3HCVB 1JP5A 2LFGA 4TNVK 5HHXL 3CFIC 1MQKL 1S5IH 3U4EB 1OTSC 1QLFA 3B6SB 3IAQA 4NQVB 1IAKB 4ZS6D 3NVQA 4LQFH 4LSPH 3DMMA 1MFAH 2R2EB 3QNZB 3VE0B 3SKMB 2W1NA 1T3FA 3AFLA 5H2BB 1TZIB 4W68A 4YNYA 3V4UH 3VXMD 1AGDA 3QUKA 4DKFL 3ARFC 4OAWA 1BF2A 4P46B 2ZJSL 4HWEH 1NCBH 5FM4A 4BSWB 4Z95H 5I1JH 3UROR 5HYSG 5F7EL 3C60D 4XP6H 4X0KA 3QG6A 3HI6H 5CHNB 3WSQH 4HBCH 3S4SA 5DMKB 4G8FA 4YPGB 1EHXA 4HWBA 3PDOA 4EVNB 1JVKA 1AHWA 4NRZB 3GUTB 4Z0XA 1SJEA 2ZUWA 2ICCA 4OCWH 3M1BA 1MCOH 1S7XB 4KK6C 5E2WH 2QQQA 2V5RA 5TGBB 4HUXB 3X12B 4YDIH 4AEIL 5D1XD 4JFXB 3SCMB 4JO4L 4M7KH 5DO2C 1I1FA 3MUY1 2VNCA 3ROLB 4IDJH 3FQNB 1JNLL 1OP3H 3BGMB 4HMEA 2GITB 1F3JA 2E7LC 1ZXQA 1N5AA 5GGTL 2O5XH 3VFPA 2W65A 5DJ6A 1W72B 3EJZD 4ZOCA 4POZC 5A40E 3MUGA 3LS5H 3B9EA 4U1IA 1ZLSL 4XPTL 1EHLL 5BV7C 4ODXA 5AZEL 2IG2L 1CIUA 3WV0A 2Z93B 1D9KB 5HYJB 4TNVF 4YE4L 5CP7B 5EUKA 2ATKB 2VE6B 1N2RA 2FHCA 3SDXB 4K7PX 2GTZA 1TVBB 5EO1A 4LLYA 1YNTA 5I66A 4QEGA 1DVFC 3EO1A 5L6YH 5I1CL 5CMAA 1NL0H 3O6FB 5ETUA 3RL1A 2ZCKL 5HHMB 2VC2H 5MENB 4RWYL 2CIIB 2EE6A 1NDMA 1WEJL 4PLKD 2Q6WA 1BZQK 4JKLA 4XNZB 4UB0H 1DDHB 4I0PA 4KGJA 3JSSA 3VRJB 5F7MC 3GMPA 1QQDA 1UWGL 4D0CB 5C70A 4QHKJ 1RZJC 4MDJA 1HHIB 5CSGA 1H5BC 4G6KL 4Z7WA 3KDMA 5TDNB 4NSKA 1DQMH 1EJOH 3ARGD 5E99H 3LZFL 3FTGB 2ICEB 4OV6F 3TYFA 2W0FA 2OI9B 3SKUD 5HY9A 1A3LL 3C60B 4NT6B 4PJDA 4JG1H 4UINH 2GSGA 1AJ7H 15C8H 5K9KB 3DMMD 5I15L 2JELH 1S9XA 2Z91A 3DUSB 4MNHA 2WUBL 2RQ8A 1W0WA 5EZOL 3BD4A 4KXZI 3UTSA 2HWZH 4YHIA 3FJTA 2C26A 1GC1C 2FL5A 1BVKA 3MRNA 1OW0A 2AEQH 4WUKH 3LMJL 1S7VA 5F89A 2K7QA 3NIFF 4ISVB 4H88H 4U1LB 2ZUYA 4XH2A 1XF4B 5CEZH 3IS1X 2HA1A 5I8CB 5ANME 3RY6A 5HHOE 1ED3B 2GSIB 5L2JB 4K23H 4IMKA 1I9JH 4HQQL 1WBZB 4D2NA 3VWJC 3AM8C 1OSZB 2NNAB 1MJ7L 1LO2H 3C09C 1GGCL 3HR5A 3WEXB 4AH2A 4LAQH 2ZPKL 3RVWD 4NKIH 2FJFB 2NTSP 4PRAA 3EOBA 4ZTPH 3QUYA 1GGUA 3NCBB 4FFZH 4M6OL 4ZAKD 3TIEB 4HS6A 3G6DL 2P8MB 1J1OH 1I8IB 4N68A 5I19L 1DZBA 5D96C 2CK2A 4GKZB 5C6TH 3VG0H 3PWJA 4BH7A 3C8KB 2V7NB 3SDDA 4XNQB 1JRHI 4N0UB 5C0IB 4NQXB 4MNQE 1I1AD 1QD0A 2EC9U 2FEEI 2OZ4A 2AJZB 5IVXE 3VXTA 2XY2A 5DMGC 3ARGB 3GSOA 3ARDC 4XXCA 4AJ0A 3MRBB 1TQBC 1I8LA 2BY2A 4TULL 3ZO0A 3D87B 4YFLF 4KVNL 3CCHA 4XP4L 1WWWX 4ETYA 5DVOA 3HA0A 1KELH 2BFVH 1QLFB 1CD1A 5GGVY 1A21A 4I0PD 3DMMB 2FX8H 1F00I 5DFWH 4K7PY 4Z7UA 1IFHH 1T3FB 1HWGB 4B7LA 1OCWH 4HCRL 4NO2A 5CEZE 1PG7W 3SKNA 1T5WA 1IGFL 4TVSa 4JQVC 3UYPA 3SDAC 2A6KA 4Z7UF 2R29H 4YNYB 8CGTA 2CK0H 1K4DB 4YGVA 4DN4H 1AGDB 4OAWB 3WN5A 5F6HI 3NIGF 3QUZA 4F58H 2HMID 2HT4D 3LVEA 3GMMA 4XVJL 3NOIA 2Z4QB 2J4WL 4HPYL 4YZFF 4AEFA 1CFSA 5I71B 4X0KB 3QG6B 5C6PB 4PJHA 5CILL 3LY6A 3S4SB 4G8FB 3PDOB 1T89A 1AHWB 1W0YT 1ZGLM 3LH2L 5ALBL 3WXVL 4I0CC 4Z0XB 1SJEB 4RAVA 3WUZA 5EG6C 2QSQA 1KN2L 3RZCC 3MLTA 4JM2C 3ULUF 3M1BB 3PL6A 4NQEA 2DQCH 4TSCH 3UJTH 4JPKL 1KCUH 4I3RH 3IAGC 3QIBC 1I1FB 1RZFL 5LKNA 5C8JA 4I3SL 2G5RA 3IU3A 1F3JB 1N5AB 5IHUH 1BWMA 3MV8D 1NC4A 4LDLB 2W65B 5DJ6B 4ZAKB 4HKXA 5C08E 4JR9L 3MUGB 3QRGL 4QXUH 3WD5H 4IIQB 2FBJH 2UY7A 3VMPA 3D85A 4ODXB 2HAZA 2IPUG 4PPTA 5FK9A 3DUUA 4MS8C 5GS3A 2VDOH 5EUKB 4X4YA 3QCTH 3M45A 1N2RB 4FABL 2HRPL 4FFYH 1T6WA 2GTZB 4LCUA 4LLYB 5EO1B 4GQ9L 1YNTB 2H32H 5I66B 5J1TC 5ICXA 3EO1B 4JFDA 3V0VB 5CMAB 5ETUB 3RL1B 2EDRA 1I9IH 4XNYH 3QUYD 1LNUA 2EH8H 5IIEB 4U6XA 3MJ6A 4M93B 2J5LB 1LO5A 1MFBL 1QNZH 2Y5TA 4NHUA 1UCTA 2HFEA 1NDMB 1RIVL 3HG1E 4J2XA 4HPOL 2Q6WB 1F4YL 3O6KH 2C1PA 4KY1H 4QOKA 4XMKL 2DIAA 1LWRA 3IAPA 4I0PB 2DD8L 4URTB 3SDDD 4ONFL 3W11D 3GMPB 1QQDB 1AFVH 3HE7C 1R3IL 4EXKA 4MA7H 4QRSB 3RPIA 5ESVA 3UPAA 3ZHDA 4MDJB 5C09E 4LSUL 2XACC 3KDMB 5D1QA 4NSKB 1AC0A 3KPOA 3RTQA 1MI5A 3KYKH 5D93C 1C7SA 3GSNL 1TJHL 3TYFB 4HWBH 1IAMA 1NCCH 2R56H 4O4YL 2W0FB 2YD4A 2Q86A 5HY9B 2R2HA 1GOGA 3CU7A 2AKRA 5BRZA 4CVUA 4YC2C 1KUMA 4MZ2A 4F33A 2GSGB 1DBAL 3ORJA 3DROA 1S9XB 1ZLVH 4MNHB 3RX5A 5GQBA 5D8JL 2YEZA 1NSNH 1W0WB 3BP6A 3VH8G 3UTSB 3AY4A 3MLVH 4YHIB 4F7TB 2R2BB 1BOGA 1BVZA 4N1CA 2FL5B 1BVKB 1DBKL 5E1AA 3MRNB 5T1KA 4ELME 1RZIA 4YJZL 1WT5A 1S7VB 4Y5VC 1WF5A 1M7IA 5DK3A 3QUZD 4L29A 5FYLL 3OGCA 4G7YH 1RJYA 3OAZK 1A1OA 3MV8B 4XH2B 4K07A 4QTIL 2OX5A 3FFCE 5D7JA 3RBSA 1T83C 3CH1B 3BFOA 1P69B 3ULUD 4GRWH 2C3HA 5F9OL 3ZYJA 1MJ8L 4OGXL 3PL6D 3MODL 4NQED 1X5ZA 3G5YA 4K9EH 2D7MA 5KVEL 3ZSSA 3BE1L 5C0AE 3HR5B 1SMAA 1U36A 3BRFA 1FNFA 1ACYH 4DKDC 4ZNCD 2RHEA 3G5XA 3H3BC 3IETA 2NY2D 4PJCA 3I9GH 4PRAB 2DBJA 3EOBB 2R4SL 3GB7A 3QUYB 1NMAH 3VD7A 1U8JA 5HVWA 1WAAA 2C5DC 3O4OC 3SGEI 2IFFH 4M7JL 4HS6B 4YX2H 4PJCF 9CGTA 2FIRT 3D85D 4Z7NE 1WAAF 4O2FB 3SQOH 4A2LA 1A6AA 4OCSL 4XNXH 3WXWL 4E42A 3PWJB 3MBXH 3GK8H 4BH7B 1N59A 4JZJA 3SDDB 2A6DB 2R1XA 3FT3A 4B50A 4WWID 3ZHLA 1GPOH 4W6XB 3OSKA 3MRQA 2EXYD 4U1GC 4R2GD 4JFDD 4YUEH 4PJ5A 1UCBL 2CD0A 4NFDA 2B1AL 3VXTB 3QEQA 4YFLI 2KQMA 1UZ6F 3P4MA 3GSOB 2FO4A 4F7PA 5F44A 3A6CH 4U6YA 3CCHB 4CU8A 2ARJQ 3H3PL 4OCRH 5GJTH 1CD1B 4QOKD 5GZOD 1AO7A 5ID0A 1ZHLA 4OV5B 3I02A 4Z7UB 1UH2A 1BECA 3E2HC 3JVGC 3JWDC 2P5WE 4NO2B 4X6CA 3SKNB 1T5WB 1Y6NR 3O2VL 3CIQA 4LCWE 2A6KB 3J7HA 5D1QD 3RTQD 1FAKT 1MI5D 1NUGA 1YEIL 3GNML 3UTTE 3OKEB 4KU1A 4X6CF 4GRWE 4YGVB 4RMSA 4JZNA 3NTCL 3HC4L 3L7EA 3WN5B 3WHE0 1AIFA 4MJ5A 4Y19E 2JJVA 3QUZB 4ZFGH 4LSRL 1N3NA 2VLME 3I3EA 7FABL 3GMMB 4JLRA 3T1FA 1XF2A 1NEUA 1RK1A 5DZLA 1NGWA 4LVOB 1QFPA 4RAVB 1QUNA 5C9KA 4LLAA 4XWOC 3MLTB 2DQIL 4FHBD 1A6ZA 3H9ZA 2QTEA 2IANA 3PL6B 4NQEB 1A7NL 5T1KD 3BDBA 4L5FH 5L7XL 3Q6GL 4F15B 2DWDA 4QRPE 2F9BT 5GRWA 2ZOLA 3X11B 3PGFH 3FHQA 4OUUA 5C8JB 5IOPA 1YMMD 2Z31D 4QRRA 3AU1A 3IU3B 5C7XL 1I9RL 4K3JH 4K3DH 2HH0H 2NY2B 1F8TL 4Z7WE 1Q9LA 1X5JA 2H26B 1NC4B 1I8KA 2BHZA 2E5EA 3NZ8A 4P9HH 2OR9L 4EUPA 5D7JD 4HKXB 2EKSA 1NBYA 4Q6YA 3BVNA 5B38G 2VYRE 3D85B 1FAIL 3A67L 3EYOA 3P2TA 3K2MC 1YJDH 3C2SA 3CMOL 5FK9B 3DUUB 4PRPE 4PJDE 2DMKA 4RAUB 4X4YB 1ZT7A 4EDXA 1IRAY 7CGTA 4M03A 2BVYA 1BEYL 4LCUB 4UZGA 5CJ8A 3X3GH 2X09A 1K5NA 3KVQA 1WLHA 5ICXB 1BQHG 4R2GB 4JFDB 4D9QD 5EA0H 2UZYB 4DW2L 2EE9A 1XIWC 4ODUB 1I7RB 3OB8A 1LNUB 4K8RL 3DHJA 4WW2C 4WI7A 5E24E 4U6XB 4K3HA 1DQQA 1LO5B 4L9LC 3QI9A 5A2JH 2Y5TB 4NHUB 4JB9L 2HFEB 5BZDA 2K7PA 3BMVA 2V9TA 4HD9A 3VGBA 2C1PB 4FQ1H 4QOKB 1NCDL 2DICA 1U3YA 1JRHL 3V4PH 1FNHA 1QYGH 2VXTH 5HHVH 2XT1B 2WK2A 2FEEL 1KCRL 3CSGA 3T0BA 3U9PL 1BBDH 2ZNWA 4NCDA 5ESVB 4J12A 3RPIB 5CJXA 4PJ5D 1Z9MA 4AM0A 4PTTA 1FGNH 4YDVA 3K1KC 5D1QB 3KPOB 3RTQB 1MI5B 5EOQL 1CDJA 2E9IA 3WLWD 2XQYG 5LGJA 2LV4A 2APTA 2Q86B 4FN0A 1T80A 2R2HB 5H35A 1XR9A 3FN0L 1NCAL 2VDML 2AKRB 4WIQA 5F3HA 1G7MA 4PJ7A 3GMRA 3GM0A 1QFUL 1X5FA 4F33B 4JREC 3DROB 3MUJA 4XPGH 4D9RD 3WKML 5BO1H 4PJ7F 2YEZB 3BP6B 2YA1A 1WFUA 1A5FH 3VA6A 5E1AB 5T1KB 1RZIB 4QWWD 4OCXH 4ERSH 3DSNA 4O00A 1M7IB 5FCSH 1TJGL 1L9NA 4L29B 4ZMAT 3MFGB 1LO0H 3OGCB 2X5PA 1OAKL 2JTDA 1RJYB 1A6WL 4IBLT 5IB2A 1A1OB 5D9SA 1JGVH 3SO5A 4U4BA 1C16A 5D7JB 4HHAA 5FHBH 1V3KA 1S7UA 4KJQD 4OZGE 1DBBL 1R5VA 2PKDA 3U7WL 2V2TB 2JJSA 1HYSC 4NQCE 3K0WA 2O5ZL 3E3QC 2ZWLT 4G9FA 1RZ8A 3G5YB 5D7KD 4QRUA 4NJ9L 5IK3A 2NY4C 2E6PA 3MV9E 2VLJA 5EULV 3NGBB 4FXGA 4OQTH 2AJVH 3G5XB 1JF1B 3IETB 2VZ3A 4BH8A 1T03H 4PJCB 1EBAA 1NGZB 4AYFA 4XCCL 3GB7B 2GKIA 3ROOA 1FQ9C 3OTTA 4M3KB 2QLVB 4HAGA 5I8EA 1AGBA 2ZCHL 4QHLA 5C0DA 4PB9L 3WLBA 4ZO8A 1A6AB 2CGRL 1DQLL 1A6UH 3FCTA 3OMZA 4BK4A 5DUML 4E42B 1WC7A 4PJHE 2FEDC 4XAKD 1P53A 1N59B 2YD3A 1V7NL 4LEXL 2R1XB 3FT3B 5JZ7C 2I27N 4PUBL 3FB6A 1HQ4B 4LGPB 4MXQD 3REVB 5HHXH 2OL3A 4QNPE 3LEXA 1OVZA 3LHPL 3FB5A 5IW6A 1T1WA 5DVMA 1T20A 4PJ5B 4ODBD 3QEQB 1NUDA 3PWLA 5D2LE 3QWRA 1FLRL 2DIBA 2DIJA 5FOBA 3P4MB 2F8XC 2FO4B 3S96A 2NXYC 4Y2DA 4F7PB 3SGKC 3QI9D 1A3QA 1IARB 2D4DA 3S5LG 3N1MC 1P84K 4X5LA 1KCVL 3BDYL 1EEZB 2EKJA 4XVUC 2HT2D 4YEEA 1RPQA 4HULB 3DLQR 4OZIA 1Q0YL 4LU5L 5ID0B 1OOAA 1ZHLB 4DKFH 1B0GA 5GS0L 4KKAD 2ZJSH 3I02B 3VFTA 1N6QL 2QV2A 4OZIF 1ZVHA 5F7EH 4X6CB 2PR4L 3AS3A 4LVEA 4KTYA 5LGHL 1H9VA 3ZKMD 2NZ9C 3MRCA 4AG4L 1U8NA 1JYNA 1S9VA 1D5ZA 2PUQT 3AMKA 4JZNB 3L7EB 4PJBE 1AIFB 4MJ5B 5TQ2L 1DBML 2XFXA 4XI5C 1N3NB 4R0LC 1S7TA 4Y2OA 5ADOL 4JLRB 2JB5L 3T1FB 3G6AA 1XF2B 1ZE3C 5MEPB 4JO4H 1RK1B 2EEDA 1NGWB 5BCAA 1JNLH 1X4XA 3C5ZC 5GGTH 3MJ7A 1JI1A 1A6ZB 4R97C 2IANB 1NANH 1HXYA 3MNZA 1ZLSH 2BVOA 3B5GA 4XPTH 2DWDB 1VGEL 1EHLH 2DQHL 5IOPB 4OUUB 2A74A 4GJTB 2IG2H 5AZEH 2YRZA 4P2OC 4QRRB 3ZTJG 3AU1B 4YE4H 5B3NA 1Q9LB 4NQTA 3K4DA 1I8KB 3ARZA 3NZ8B 43C9A 4EUPB 3NZHL 4M4PA 4M43L 4WFFD 2EKSB 3QHTC 1NBYB 5K33A 3BVNB 4XVSL 4TN9A 3EYOB 3WO4C 4J3XA 1MFEL 1URLA 5I1CH 5BRZE 1IAII 4G9FD 2ZCKH 4WENB 2VXVL 1ZT7B 2XKNA 1ZMYA 1WWBX 2E6JA 4EDXB 4RWYH 3PGDB 4N8CL 2EIBA 4XHQA 2KPNA 1K5NB 2VLJD 3D3VE 4ZNEE 4DUWA 1JNJA 3V6OE 1WEJH 2ICWA 3PF2A 3OAZH 1EV2E 3RL2A 1BOYA 3GEWB 2VZVA 1JHKL 3U0TA 5ESQA 1DQQB 5HGDA 3QI9B 4CKVX 1UWGH 1HH9A 2EC9T 2GEEA 3B2VL 3WHE1 5C07E 4GW1A 2RBLA 5BZDB 2YXMA 2YUXA 1WTLA 4PJEE 1JTPA 4G6KH 3TP4A 3ILQD 3IDIA 4PRBA 3MZGB 1FIEA 2HG5A 3CVHL 3LZFH 5A3ID 3CDYA 3V9FA 1G7QB 3U36A 2MPAL 4JHZA 3ZDXF 4QYOA 2BRQA 5KVGL 3IDUA 2VDLL 3NPSC 4Q0XL 3DIFA 2DM2A 1A3LH 4N90D 4AM0B 4PTTB 5EU4A 4YDVB 3QWRD 3VRLF 3HNSL 3P4LA 3T0EC 3DXAE 4Y2DD 5I15H 5IB5A 3QO0A 5LGJB 2VAAA 2WUBH 3EFDL 5EZOH 4E41D 3ESUF 4QT5A 5H35B 4YPJA 1XR9B 4PD4J 4ZPTA 5F3HB 2VIRB 1UXSA 4PJ7B 3GMRB 4WWKA 2D7NA 3A0OA 3IDYB 4RGOL 2AEIT 2ZCLL 4M6NL 3LMJH 1AXIB 2HN7A 4QO1A 3BZEA 5F1SA 3BKJL 1KACB 3SE8L 2Q3ZA 3I3DA 4PTUA 5IESH 2P49B 5FGCE 4R9HA 1IE5A 4BQ9A 1ZV5A 5I16A 3NA4A 2NY0C 4HQQH 3DV6A 3D2UA 3AS1A 5D9SB 4GW4B 3RWHB 5A2LH 2D31A 1C16B 4APQA 1JMXA 1MJ7H 4HHAB 4KAQH 1GGCH 1S7UB 4PBXA 2GIYA 1S7QA 3U83A 2FH8A 2Y23A 2ZPKH 3EYFA 3L3GA 3AC0A 5HXMA 1QA9A 2YUWA 5JIHA 1MNUL 1J1PL 2ESVD 2X41A 4G9FB 4LMQE 2DMCA 4PJIA 4M6OH 2X4UA 1P4IL 4KKLD 1CLCA 1AO7E 5IK3B 3G6DH 4ZFOL 2FWOA 5TDOA 4KKBC 2VLJB 5I19H 4DEPC 4FXGB 1QPPA 1TFHA 1A47A 1JNNL 2HYMA 3ROOB 1XF5A 4UAOC 5DJZA 4HJJL 5I8EB 5E6ZA 1AGBB 4G6AD 3ARRA 4QHLB 5C0DB 4UUJA 3RY4A 1LO3L 1UJ3C 4TVPL 4MVBC 3WLBB 1H3GA 4R90L 4JAMA 4HX1A 1CBVL 3FCTB 1KENH 4MQ7A 3MGOB 1WC7B 4BM7A 3V6ZA 1X4ZA 3IXTA 4WFED 1EGJL 4KTEL 4TULH 5E5MA 2VR5A 1OARL 4XMLL 3TO4A 2R1YA 3FB6B 3ZYZA 4KVNH 3TNMA 2FECI 5CKAA 2OL3B 3LEXB 3LDBB 1RZKL 5IW6B 3FB5B 1T1WB 1G1YA 1T20B 2F54E 1IILE 1QBML 3WIHA 3PWLB 1LD9A 5FOBB 1VENA 3S96B 3EO0A 4Y2DB 5MI0C 1IZKA 4JVPA 5IT2L 4WHTA 4QRRE 2NY3C 4U05A 3RVUC 2FSEA 5AZ2L 1BQUA 1CR9L 1DLHA 4HCRH 4E41B 5MP6L 1K9TA 4FQHA 1IGFH 3PJSA 2R8SL 3CJJA 2ZUQC 4OLYL 3NCFB 1CICC 4OZIB 4Y4FC 1DQJB 4S2SA 4NZDA 1B0GB 3HE6C 3V5HA 3VFTB 3ZKND 1LMKA 4ZQKA 2NLJA 1KCKA 2J12B 2J4WH 4K7FB 4HPYH 2A1WL 1UWXH 5E56A 3MRCB 5CILH 3TFKD 1U8NB 3QUXD 1D5ZB 3SGJC 3LH2H 1A1MA 2D3VA 1DQTA 5ALBH 3WXVH 4TTDD 1KN2H 2XFXB 1S7TB 1HCVA 4KKCC 4MHHG 4N0YL 4XCEA 4EDWL 5CLTA 5JA8B 2FLRT 4PYHA 4WWKD 4JPKH 2I07A 1OTUD 1EEYB 1K85A 1RZFH 4I3SH 4HG4J 4CVXA 5L8LB 3EYQC 2X7LA 3HHRB 5JXEA 1JZ6A 1B4RA 3MJ7B 1HHJB 2ESVB 3EIFA 1RUAL 4XMPL 4JR9H 1HXYB 3QRGH 4KMTL 2BVOB 4MB5A 3JTSA 2A74B 4NC1C 5C2UB 4GG6A 2R0KL 4FQ2L 4X4MA 3D2UD 4EN3A 4L8SA 5IVNA 4APQD 4FABH 1MWAB 4GG6F 1X9QA 2HRPH 5L88L 4KQ3L 4WFHD 1QFOA 2R39A 1ROWA 3PDDA 2X4TA 2YD9A 4XPHL 2B2XH 2HTKC 2WANA 4P2QD 1DUZA 3OAYH 4LOUD 2Y36L 1J8KA 1L6XA 1MFBH 3GJEA 1EHAA 3C9NA 1RIVH 4I18C 2ICWB 4M5ZL 4HPOH 5D6DC 2VUOA 4NBYB 3ZE2F 1F4YH 3F7QA 1KPRA 1PY4A 1VFAA 2MMXA 3RL2B 4P49A 4ZFZA 3FQXA 3MV7A 1O7VA 1HEZB 4XMKH 3BW9A 4YEFA 2DD8H 4ONFH 3U0TB 5ESQB 1C5CL 5HGDB 2FIKA 1HH9B 3O4LE 4Y0GA 5AUMA 1TTGA 4LSUH 5HPMB 1HK6A 3IDIB 2HG5B 1ZLUK 1BWWA 3GSNH 1TJHH 3TO4D 3U36B 4AZ8A 1QOKA 4QYOB 4R8WL 4RIRA 3IKCA 4JFHE 2I24N 3DIFB 1AGCA 2BC4A 2D4FA 3QO1B 3BZFA 4G6ML 3KPPA 4GXVL 3PIQA 3SOBL 5EU4B 1M71A 1DBAH 3QUXB 5IB5B 3QO0B 4P46C 3VD4A 4ODTL 5D8JH 3HMXL 2YD8A 4OF3A 2PF6A 1MLBB 4QT5B 5E8EA 2P45B 4ZPTB 5T3XD 1JGUL 1UXSB 4B41A 1BGXL 1DBKH 1UC6A 2VRAA 4WWKB 4ONOA 5C1MB 3OL2A 2A6JA 4OD3L 3BZEB 4IEFB 3OR6A 1GCFA 5FYLH 1BVLA 1DANU 2OMBA 3VFOA 5DDHA 1CDIA 4PTUB 2EDWA 2GJ6A 1DL7L 4QTIH 3QDJA 5J6GA 2ADGA 2D0FA 3SCMC 4NKDA 5D7LE 3WFBL 5KW9L 3WMSA 5F9OH 1IJ9A 3DV6B 1MJ8H 3D2UB 1YECL 2GQHA 4F7CA 3MODH 3BPOB 2D31B 4APQB 4DJMA 4HUWA 1GJIA 5KVEH 5JORB 4A6YA 1S7QB 4PRIE 3NFPB 3EYFB 1D9KC 4HC1L 5D2NE 3L3GB 4WU7A 1QA9B 3MLSH 2R4SH 3BAEL 4P2QB 2X4UB 1CXKA 3QP3A 4QGTA 4HUKB 4M7JH 3DVIA 3LEYL 1BMGA 4HUVB 2FWOB 4X6BA 5TDOB 5EZLA 4OCSH 1CFTA 3O6FC 3WXWH 4EN3D 1J9CT 1QR4A 3HB3C 3IRPX 3OXSA 1XF5B 5DJZB 2X9XA 1RZ7L 4UUJB 4HSQA 3CAFA 1IAIL 4UIMA 4JAMB 1H3WM 4HX1B 1UCBH 4HIEA 2FYYA 2BRRL 4MQ7B 5AYQA 4XNZC 3OJVC 4ZS6C 3V6ZB 4M1DH 3IXTB 5I8OL 1UM6L 5KZCB 4V2CB 5E5MB 3TO4B 2R1YB 3TNMB 2IPKA 3H3PH 5DUPL 3QIWA 4KDTA 3SJVE 2A73A 4FZEL 3QT2A 4YWGL 4JFEA 3W0WA 2AP2A 3UBXB 35C8L 3UBXI 4F9PA 3MV7D 1LD9B 3QUMA 2WBJD 3RGVA 5FYLE 5TH2B 3EO0B 2AS5M 2OI9C 4WHTB 2YC1A 1NGQL 1I9EA 2YD2A 3QISA 4OGYL 2FSEB 1DLHB 3O2VH 5SX5K 3UTOA 3C60C 1IBGL 1FE8L 3NAAL 2I60L 4QRQA 1YEIH 5EO0A 5IV2A 4LLVA 4G7VL 4U1MA 3HC4H 5A2KH 3GI9H 3V5HB 2C3VA 3LQAL 4LSRH 7FABH 3FT2A 4ZQKB 1WIPA 2NLJB 1KEGL 2MTPA 2WUCL 3ES6A 2HLAA 3UO1L 5I18L 1MPAL 1XEDA 3CFBA 3CFKA 1A1MB 3TF7C 4KXZH 5F97E 2VITA 2Z0BA 4ZO7A 3L5HA 1S9WA 4BUHA 3PQYE 3P4NA 3PP3H 3EJZC 1T7VA 1I7TA 6FABH 5K9JL 2I07B 1B6UA 4P5KA 5L7XH 3Q6GH 5FM8A 1V05A 1MFCL 4CVXB 2X7LB 3QB7C 5T1LA 1I9RH 2HFFA 5KAQG 3HZKA 5FO7A 1X5GA 1F8TH 2GJ6D 3GRWA 3QDJD 2OR9H 4K94C 5JIKA 1R3JA 4U0RB 2IAMA 3BHBA 3JTSB 1FAIH 3A67H 4X6FA 4UQ3A 4GG6B 4OLVL 5EU6A 5J6HA 2YXFA 3CMOH 3PWUA 4EN3B 4X6DE 4L3EE 3HAEA 3VD5A 2IADB 4H1LA 5CJBA 1QO3B 4C58B 5KBNC 1BEYH 5DWUL 3VDBA 5C86A 1VADA 3S35L 2ZZUT 4MJ2A 5JQHC 1QHOA 5F7LB 2X4TB 4DW2H 1KFAL 3R0MA 1DUZB 4K8RH 5E7FA 4YXKL 4ALAL 5JHLL 4OB5L 1KYOK 2B8OT 3GKWL 5B8CA 3QDAA 3ZKXB 3GJEB 3C9NB 5JXAL 5TE6L 3VXME 4D3CL 1GGIL 4K3EL 1KPRB 1VFAB 3UZVB 1RU9H 3MGAA 1NCDH 3ARGC 3FQXB 4ZFZB 3MV7B 1JRHH 1GGBL 5MERA 3BW9B 4OZFG 5CEXA 2FIKB 1KGCD 2CR3A 2EDBA 4EOWL 2XQBL 1KCRH 2EIZA 1PZ5A 5AUMB 4ZUUA 3L95B 5F96L 5ALCH 1I7UA 4BQBA 3SE9H 5HD8D 5HVGB 2Y06L 5EOQH 4DUXA 3DMMC 4OF6A 4NP4L 3ZE0F 5K59F 4R7DA 3KLAA 3C08L 4KRLB 4RIRB 2ZSWA 3IKCB 3QIWD 5E4IA 1AGCB 2BC4B 1K3IA 3BZFB 3FN0H 1NCAH 1ETZA 2BVQA 2VDMH 3KPPB 4KUZL 4P5TA 3PIQB 4PJIE 4JO1L 1M71B 4Y1AA 1QFUH 3NCMA 3RGVD 3NA9L 4HAFA 4DAGL 2QEJA 3WKMH 2N4IA 4RAHA 1OTSD 3VFNA 4RQQA 1A7RL 4R26L 4CBPA 5E8EB 5ADPL 4JANA 2YK1L 5I71C 1KOAA 4LCCA 3S3JA 3DVFA 1AHWC 5LJYH 2A6JB 3HRZA 4TQEH 4OI7A 3OR6B 1TJGH 1BVLB 3JTTA 1HIMH 4YBQD 1OAKH 1A6WH 3VFOB 2GJ6B 2EDNA 1UGNA 2HJKA 3QDJB 2AJXH 2JCCA 3P9MB 4JY6A 5J6GB 3H7BB 2ADGB 4HGWA 4NWTL 3MX0A 1LP9E 1DBBH 1SEBA 1N0XL 4NKDB 1ZHNA 2DM3A 1CDHA 2JCCF 4XC3L 4HW6A 3RVWC 4M6MH 3LD8B 1NBVL 3MSPA 3Q3GA 1N7ML 4F7CB 3LSOA 1VCAA 1JE6A 1Y18A 4HUWB 3DETD 4NJ9H 2DI7A 4IIQC 1SVZA 1H0DA 5EWIL 4A6YB 2NY5L 5J57B 2Z8RA 2GAZA 5T1LD 3PUCA 1FZJB 4WU7B 2DLHA 4XCCH 4OFKA 1RY7B 4NZJA 2QSVA 4JN1L 2ZCHH 3MFFA 2IAMD 1PY9A 2X9WA 4X6BB 4PB9H 3ARBA 5AWNL 5EZLB 5EU6D 1ORQA 2CGRH 1DQLH 1CFTB 3GZKA 1AQKL 5DUMH 3OJMB 4I48A 1MWAL 2D7QA 3OXSB 3QHZL 4M93C 1IM9A 2GCYA 3H8NA 2J5LC 2R0ZL 1V7NH 2IJ0C 4LEXH 1INEL 3V6FA 1AKJA 4PUBH 2CRZA 4GS7B 3SE4A 4TPRL 3LHPH 4UIMB 4F80A 3SY0B 2D9QB 4XAWL 5KG9A 3V7AE 1FLRH 5HI3D 3EBAA 4I0PC 2X10A 4OGAD 4KUCF 1GAFL 1LGVA 4ETQA 4ELKA 2F74A 5F71A 3RX7A 3RAJL 2IPKB 4MYWB 4CMMB 5IW3A 3QIWB 2A73B 2BMKA 3BDYH 4JFEB 3W0WB 1IL1A 3HI5L 1NFIA 3QUMB 3KG5A 4LU5H 3RGVB 3TIDA 5GS0H 5HYSA 2MSPA 3SGDI 4R96A 2HMIC 2YC1B 2HT4C 1N6QH 3TEUA 1OQOA 2PR4H 3CLFL 4DOHE 5FCUL 5LGHH 5EU7E 4YQXL 3WO3B 4QRQB 4AG4H 1QRNE 5EO0B 4LLVB 1P7QA 2VO5A 2C3VB 3FT2B 5ADOH 3ES6B 2R2CA 4P5TD 5FB8A 2HLAB 4G8GA 4Y1AD 4LSSL 3L6FB 1OW0C 4IRSA 4UT6L 3V0AC 1TNMA 3CFKB 5E9DD 2N1KA 2VITB 3EYUL 3QXUA 4KWUA 1S9WB 2XA3A 1QEWA 2XN9A 3MCLL 2AQ1A 2FX7L 3P4NB 3RY6C 1I7TB 3LKSB 4P5KB 1OY3B 4HFWA 3QNXA 1FH5L 1VGEH 2DQHH 5C0CA 4F8TA 5SV4A 3DPBA 5T1LB 2HFFB 3HZKB 5FO7B 3U0WL 1ITCA 5HDQL 4M5YL 4ZG1A 2P5ED 3NZHH 4EEEA 5CINL 4JM2F 4M43H 4B5EA 3QDGA 3ZDZE 4BK5A 1OL0A 1R3JB 1TCMA 4PLJD 3VI4E 3RVVD 2IAMB 4XVSH 3MRFA 3BHBB 3NCEB 4X6FB 3RGHA 1A6PA 3C8HA 4UQ3B 2FJHA 4YFEA 5FAAA 1MFEH 5DJ0A 5EU6B 5J6HB 3L7FA 4HUMB 1OAUL 4OM0H 3VXRE 3PWUB 2APBA 3I85A 3QUYC 2D0HA 2VXVH 2H8PA 1JPGB 2WM0A 4H1LB 3LN4A 4N8CH 2EO9A 1VADB 1TCRA 3H3KA 2R4RL 1YEFL 5FO9A 3Q1SL 5H94A 3SGEH 1GXEA 2EXWC 1JHKH 3SDDC 1IEBA 4GSDL 2YD6A 2HLFC 5B8CB 3B2VH 1KLGA 4WTZG 3FOMA 5DQDL 1T7ZA 3OG4B 3MROA 3MRDA 4DK3A 4NWUH 3BN3B 3U1SL 1FHGA 3CVHH 5MERB 1Q9KA 2I9LA 4XXCC 1BLNA 1I8LC 3UTZA 3K1DA 1AKJD 5CEXB 2MPAH 2W9EL 2VLLB 4ZXBA 5KVGH 2Y5EA 3KPSE 2EIZB 4Q0XH 43CAA 1PZ5B 1SVCP 2DKSA 4KRPC 4ZUUB 1EVUA 3BKML 2JB6A 1I7UB 5IBUG 3FO9B 3GBNL 5E08L 3HNSH 4EI5A 4KJWD 3NCJL 4RNRA 4NQUA 4WV1A 1F13A 3IJYA 4BA8A 4Y4KA 4R7DB 3KLAB 3EFDH 3EDJA 2ZSWB 3BUTA 3VU2A 4AEHH 1ETZB 2BVQB 1RIHL 5DUBA 4P5TB 4YH6A 3BT2L 4Y1AB 4RGOH 4M6NH 2HJLA 1JFQL 2AXJA 2OYPA 5E9DB 3WN5C 3QUZC 4JFFE 3V4VL 4RQQB 4TYUA 3N50A 3SE8H 1NCWL 1XGQA 4JANB 3T3MF 5T3XL 4LCCB 5IWLA 1T89C 3QYCA 4KHXL 3DGGA 3ULUC 3HRZB 5H8DA 4LVOC 5JIIA 3X17A 1L7IL 4UTBL 3JTTB 4UMGA 2P1YA 1KIQA 2HJKB 3PL6C 4G8GD 2P5EB 1CXEA 1PD6A 4IRSD 2JCCB 3WUWG 4JY6B 2P42B 1VEMA 4HGWB 4F15C 1VFBA 3HAEH 1RZGB 1DP0A 2R69L 1SEBB 4LPTA 1ZHNB 1JZ4A 4PRDA 3ME0A 2NY2C 1KJMA 3Q3GB 1ND0A 5SX5H 2XN9D 1J1PH 1F58L 4OTXL 1HDMA 1A02N 3LSOB 1P4IH 5HGBA 1Y18B 1UFUA 3HNVL 5KOMC 1B0RB 1MRDH 1GVIA 1NUNB 4XC1L 3RZCD 4FTVE 3ETBF 5C0CD 4JM2D 2A9ML 3OF6D 2GAZB 4GBXD 1MCJA 1KIRA 5I1IL 4K7PL 4YO0B 1JNNH 3IDXL 1Q94A 5EZIH 1CQYA 4HDIB 2VH5L 4HJJH 1BJ1J 3MFFB 3RIFK 3TPUA 3WE6B 1WWAX 1LO3H 4MJIA 2V17H 4TVPH 3ARBB 2EXYC 3LEVH 5CIPA 4OI9A 4R2GC 4K3GA 3ARUA 1ORQB 3PDGA 2BVTA 4HUNB 5ERWA 3VGHA 1Z6JT 1CBVH 3NFNA 2RGSA 4I48B 2CQVA 1IM9B 5F7FA 2G5BA 3V6FB 1AKJB 1OARH 3MCG1 4XMLH 4HIJB 3CFCL 3L3KA 3OWEA 2IPUK 3RIAK 1RZKH 1WK0A 3CLEL 3VGFA 5GZOC 5KG9B 1GIGL 1DEEA 1NEZA 2UWEA 4ETQB 4YHOL 5IT2H 4ELKB 2B0SL 2F74B 3INUL 3NIGE 2CUHA 5AZ2H 4HS8H 1CR9H 4X80H 1YC8A 5MP6H 2UWEF 3BD5A 2BMKB 2XIDA 1E4XI 1IL1B 1NFIB 5D1QC 2R8SH 3RTQC 4OLYH 5IFAL 4Z7QF 3TIDB 5HYSB 1UB6A 5LWYH 4R96B 3DSFL 5E94A 3BXNA 5E03A 2A1WH 2COQA 5FEBA 1KNOA 4P2RD 1YEKL 5DYOB 5DD5L 2XKSA 4Y4KD 1P7QB 3C2AL 4QXTA 4PJFA 3AY4C 3EDKA 2O5YH 4N0YH 5HI5C 4EDWH 3K4ZA 2DF3A 5F9WB 5FB8B 4G8GB 1E27A 3H2WA 4X9IA 5JR1L 4IRSB 4PJFF 1EK3A 1WT5C 1T21A 4IRJA 1DANT 4N1EA 5CZXC 2MOVA 3CFJA 2XA8L 1MCNA 5F7NC 3QPQD 1IEHA 4HWNA 1QEWB 1PGRB 2XN9B 4S0SD 1WV7T 5D7JC 5IB3A 4WVRA 1RUAH 4TVPE 3QPXL 4DWHA 3BH9A 4HFWB 4H8WC 4KMTH 3UP1A 3QNXB 1K6QH 1NGXA 5C0CB 1ZANL 2R0KH 4FQ2H 4JJ5A 4GBXB 4JRXD 2ARJA 3D9AH 5BOPA 2V9RA 5J12B 2P24A 1AR1D 2O26U 3T0WA 3MC0A 1B2WL 1CXIA 4G43A 4V1DA 1EH9A 3QDGB 5L88H 4KQ3H 5DSCA 1OLZA 1NC2A 3MRFB 3MLXL 1YYML 3NGBC 2FJHB 3STZA 4XPHH 5DC9B 5DJ0B 4W81A 4JO3L 4WFGD 2H8PB 3S34L 4JKPL 4TNWF 1N4XL 2APFA 3LN4B 3F7PC 1Q38A 1YDPA 1ZHBA 3VA2C 1TCRB 5DJCA 5T1DL 1X5KA 2A38A 4M5ZH 2LAGB 3BZ4A 1HINL 5JW5A 5FO9B 5H94B 3I6LD 3QDMA 2VTFA 1IEBB 1PZUB 1C5CH 4MJID 1KLGB 5GS2H 4XNMA 4GAGL 3MROB 2EECA 3BPCA 2ENYA 4AT6A 1QHPA 2ITDA 2L4OA 3ET9F 4WU5A 1Q9KB 2I9LB 1BLNB 3UTZB 2DLEA 1D5MA 4FQQA 1ZVYA 4IOSD 4G6MH 4QHKI 4GXVH 3QFJA 2JB6B 3SOBH 5I1AB 1CD0A 2MKLC 4N8PA 4RNRB 4WV1B 3VH8A 3IJYB 4ODTH 4Y4KB 3V6BR 4JZOA 3G08A 5KVFL 4U1SA 1J88A 3HMXH 4LHUG 2YRPA 4W6WB 5D6CA 1M6OA 5GZNC 5IKCA 5DUBB 1H3XA 1QSEA 1BGXH 1YMME 4IOFD 1U2CA 3W39A 4QWWC 1KTRL 3FQTA 2HJLB 4OD3H 3TJHC 4RBPH 1YZZA 4Z0BL 4HS3A 5DVLA 4UV4L 4I2XE 4YDKL 4LARH 5FUOL 2R9HD 5LVEA 5EORH 4Q74A 4PV9A 4KJQC 3DGGB 3MV01 3KPLA 2BSTA 3GO1L 4QHUA 4LFHD 1VPOL 2DB8A 3WFBH 1L0QA 1NLBL 5KW9H 5CJQL 1YECH 5FDYA 4NZRL 4N0CC 4HBQA 4FP8L 1INDL 1KIQB 1I4FA 1G9EA 4CN6A 4IRJD 1VFBB 4I3GA 4LAJH 2VWEE 3TH3T 3VG9B 5IW1A 4EQ2A 4PRDB 4HC1H 1KJMB 1ND0B 1JZ8A 2AJ3A 4QTHA 1YPZA 2WLZA 3BAEH 4IRZL 3B2UD 4PJXE 1HDMB 5HGBB 4YBLB 3MRIA 3MZTA 3LEYH 5I1LA 1YPZF 1NFDE 1B3JA 4P0DA 2XNAA 5CS7A 3UPRA 4GKOA 4AL8L 4F7EB 5HYFA 2VDQL 5FYKD 2GFBA 5LAXA 1Q94B 5JPNA 1UZ6E 4V1DD 3K8KA 3T2NL 1QACA 3TPUB 3D0VA 1MAMH 1RZ7H 3F5WA 4MXQC 4MJIB 1YEHL 1IAIH 5CIPB 2BK8A 3O3BA 5ERWB 3QH3A 4XP9L 2BRRH 3NFNB 5BV7L 3VI3E 3RUGA 2ICWJ 3PWPE 2R0WL 2G5BB 3QI9C 5DQJA 5I8OH 3UDWA 3L3KB 4HV8A 5DUPH 1JF5A 5HDBE 3RUGF 4PLNC 4FZEH 3VXSE 1OGAD 4YWGH 5E00B 5HYQA 35C8H 3QDMD 5IMMA 1DEEB 2DQUL 1NEZB 1FLTX 1OP9A 2UWEB 4GRMA 2WIMA 2WZPD 3RHWK 4KKAC 1ULVA 4NFCA 4OGYH 5CJXC 2QR0A 4CW1A 1IBGH 5BZWA 3ZKMC 5J4MA 1FE8H 3NAAH 4JGJA 2J8OA 1KB9K 2ADFL 4G7VH 3D5OF 1UB6B 3LQAH 2K3TA 5E94B 1KEGH 3QFJD 3SBWC 2WUCH 3BXNB 4X9FA 2UUDK 4X9GA 3IDYC 3X3FL 1KNOB 3UO1H 4AIOA 1MPAH 5L8KB 5LCVL 1FBIL 1RZJL 3EDFA 4GQPH 3ULVF 3QCVL 4U1KA 3CSYA 4QXTB 4PJFB 3FRPG 1R3HA 1TJIL 5GJSL 3ZMRA 2X70A 1QSED 3RWDA 4MGXA 5K9JH 3IDNA 4IRJB 1T21B 2XQYK 5CLWA 1A22B 2MCG1 1MFCH 3CFJB 2F53D 4J4PA 4KMQA 2AEWA 4PGCA 3VMNA 5IB3B 1DLFL 5B38A 4G8EA 3BH9B 2I5YL 1NGXB 2JJSC 2BDNL 3T08A 1GC1L 4FXKA 4OLVH 3WIIL 1FGVL 4JJ5B 5HGHA 2ARJB 1BHGA 2P24B 5JA9A 3CXDL 1Y0LA 4G43B 4V1DB 3B8SA 4NM4L 5DWUH 3RJQB 4KK5C 4JFQA 5DSCB 1BQHA 2XTJD 3K3QA 3STZB 1KFAH 1WVZA 1NMCB 1YEEL 4X9BA 4YXKH 3MCKA 4OB5H 2WQRA 3GKWH 2MCPH 3ZYIA 1YDPB 3CX2A 1ZHBB 3QFDA 4O02H 4NHCL 5DJCB 3ZKQD 2J88L 5JXAH 5TE6H 5FA3B 1Z9SA 3BZ4B 4D3CH 1GGIH 4K3EH 3VDAA 5GSVA 3ILQC 5JW5B 3QDMB 2NY4D 4ZSOA 2DLIA 1GGBH 3IFNH 5A3IC 3MREA 5JHDE 4XP5L 4Z7VA 3B3IA 1R3KA 3T1WA 4RZCA 1SJVA 2IMNA 2DL2A 4EOWH 3LDBC 2XQBH 4FRWA 4XNMB 2FNBA 5F96H 4BQ8A 4GO6B 2X44D 4Z7VF 3NBNA 2NR6D 4AT6B 2ITDB 5KTEL 2Y06H 5TE7L 3T8XA 4WU5B 3PXJA 4BUGA 4Y2DC 4NP4H 3CX5K 5BS0A 1V3JA 1D5MB 3MPCA 1S3KL 3C08H 4FQQB 3RU8L 5CBAA 1NQBA 3QFJB 4KUZH 2PW1A 4JO1H 2YPLA 4DAGH 4XPBH 3VH8B 1N0LA 1I1YA 5E95B 3U9UA 4E5XB 4JZOB 3G08B 3ALXA 1A7RH 2JJWA 4R26H 1QVOA 1E4XL 4BFBD 1BD2E 1RULH 5D6CB 1M6OB 5ADPH 5IKCB 3I6GA 1QSEB 5BW7A 1AGEA 5JDSA 1LEGA 3W39B 4ENED 3FQTB 3DVGB 5F6IB 1QP1A 4N0RA 2F53B 4XVUD 3ULVD 2Y4SA 2AK4E 4HS3B 2B20A 2BNRE 4XPAH 5EUOA 1CZ8L 4PV9B 1B0WA 3KPLB 2UV3A 2BSTB 2E6QA 1N0XH 1YN7A 4QHUB 4XC3H 5EUOF 4WRLA 1NBVH 1T1ZB 4OSUL 3V8CA 2VDPL 1N7MH 4ORZC 1I4FB 3UCRA 4KKLC 4WUUA 4LKXA 3G04A 1NAMA 1TPXB 2E9BA 2EIEA 4NPYA 1FL5A 2VR9A 5EWIH 2ZG3A 2NY5H 3OPZH 2XTJB 3EZJB 5IW1B 4DKAA 4IHOB 2AJ3B 4QTHB 1YPZB 4AEEA 5IG7A 1D6VL 4LSQL 1J8HE 4G6AC 1C5BH 3MRIB 3U0PA 4JN1H 1G6RA 2M26A 5I1LB 2XNAB 5AWNH 1GOFA 3UPRB 4QKXB 3HPLA 4XX1E 4GXUM 1AQKH 2PN5A 1OT1A 1DCLA 2GFBB 5LAXB 5JPNB 3QHZH 3L5IA 1IKNA 2R0ZH 3PV7A 4LNRA 1INEH 1ZKAA 3D0VB 3F5WB 3K80A 5D72L 4TPRH 4RGNE 3VFWA 5EH1A 3BRGC 12E8L 5JOPD 3O3BB 3QH3B 1CFNA 1ZEAL 1OQXA 1OD9A 2FX9L 4IMLA 4XAWH 3CZJA 1MCFA 3AS0A 5DR5L 3RUGB 1A9EA 2ZG1A 3H9HA 2OP4L 3PV6A 1GAFH 3S5LA 5DQJB 5JW3L 2EDJA 4NZTL 4HV8B 4Q9BA 2F5BL 4OCYH 2DYPA 5IQ7L 5HYQB 3RJDA 3HI5H 5KSBE 2YN5A 2AXGB 5IMMB 3H42L 4Q97A 4NQDE 1MIML 4GRMB 1BP3B 1WZKA 1MCDA 1NPUA 4OM1H 2QR0B 4CW1B 2YBRA 5FCUH 5BZWB 4YQXH 1KB5L 3IJSA 4GMTL 3TFKC 3QUXC 1OP3K 1MCQA 5BQ7A 3P11L 3BQUA 4XCFL 4TTDC 4ZUSB 2RFXA 3M07A 3MLUL 2GHWB 2IQ9L 1PW3A 4LSSH 4WWKC 2DQFA 4UT6H 1OTUC 2YPLD 4YDJA 4GUPA 5EZJA 3EYUH 3CSYB 1F3DH 3FO1A 3L1OL 4LQ1A 3MCLH 5MHSE 3DX8A 2H2PD 1R3HB 4JRWA 2X70B 3RWDB 1QFHA 2VXUL 1FH5H 1JL8A 1XF1A 3FAXA 3GDBA 3QA3B 5EIIA 5E5UB 3DO3A 5HDQH 1F4HA 1NDGA 3BPOC 2MWCA 4M61A 2C9AA 5CINH 4APQC 4PGCB 1VDGA 4S1QL 2XV6B 5B38B 4G8EB 5A2IH 1IQWL 1PKOA 4NZUL 4PREB 3E8UL 4FXKB 5E8PA 5ILTL 1JIBA 1OAUH 5HGHB 2W60B 4WUUD 5C0RH 1Y0LB 4C55A 4LOUC 3TCLA 4JFQB 1BQHB 5BVPH 3RNKA 4Y5XA 2BNUA 5MEOA 2R4RH 1YEFH 1WWCA 1PG7X 3Q1SH 3MCKB 5B21A 2XYCA 1FJ1A 1XZ0A 3MLRL 4GSDH 2HFGL 4ODWA 2W07A 3BKCL 4LGRB 3N85L 1HYRC 5CFHA 4ZSOB 3DYOA 1XH3A 4KKBD 3MREB 4Z7VB 1R3KB 3TO4C 2W9EH 4RZCB 3BPLB 1E6OL 4HH9A 5KSUB 4RSVA 3KPQA 4HMDA 5ANMA 4MCZA 5HHOA 4YXHL 4G5ZL 4OLWL 3GBNH 4CN1A 5E08H 3T8XB 5BS0B 5J06A 1JNHA 4PJGE 4DQOL 1PJ9A 5CD5D 5CBAB 2DYPD 4PGZA 1RIHH 1J86A 2PW1B 3BT2H 3RX8A 1DVFA 3LQMA 4U2YA 1TTUA 1KCLA 2GW5A 3HPJA 1G7JA 1HN1A 2YPLB 1JFQH 1I1YB 3N1GC 5DMYA 4HKZA 3V4VH 1QVOB 1SMOA 4Y4HA 3VXOA 1NCWH 3I6GB 3LKPA 4JHAL 1ZVSA 1TIUA 5JDSB 1LO4H 4MAYA 1UT9A 3B8YA 1LEGB 4KHXH 5ABDE 3BQUD 3WIFA 1QBLL 3TA3A 4GRLA 5I1DA 1L7IH 3HFML 2AI0L 4UTBH 4ZUVA 3O9WA 5C0EA 3GMNA 2ADIA 4PBWD 1CDYA 3QEGL 1UXWA 2XWTA 4NN7B 4OCLC 5EUOB 3IVKA 3JWDL 4MNQA 4NNXB 3TM6A 2R69H 5DURD 1AE6L 5JLZA 1F4WL 4KZEL 1KXQE 5JXEC 1CGWA 5IVXA 2RR3A 5ESAA 1F58H 4OTXH 4S1RL 4JY4A 3HMWL 4BJLA 4WUUB 4XBEL 4LKXB 3HNVH 3G04B 4G42A 1NAMB 5IVXF 1FNSL 3MTRA 4U0RC 1FL5B 4KI5E 4XC1H 5I1HL 2VLKE 2A9MH 2CKBL 4TUJA 3H9SE 4JDTL 5I1IH 1X5AA 4K7PH 4L8SC 4EN3C 4NQSA 2EH7L 5DXWA 2UUDH 5IG7B 3IDXH 4LIQL 2BP3A 2VH5H 4CN4A 3OR7A 2CO7B 4LASL 3U0PB 2A2QT 1G6RB 4DVBA 1QBBA 1O7SA 2F58L 4P3WA 3MRRA 4JQXA 4L4TE 1DFBL 5C0FA 2Z8WC 4Z5RA 4LNRB 3L5WA 3CFCH 3JWOC 3I2CL 3ZKXC 2I25N 3TVMA 3MA9L 3U4BL 4L1HA 3VFWB 3CLEH 5DJXA 3TBSB 4IMLB 1GIGH 3BIKB 3QXWA 3H9HB 4KFZC 3PV6B 3S5LB 1T0PB 4H0IA 2B0SH 4CGTA 2HTKD 2DLFL 3VFVA 1QTYT 2DYPB 3OAUH 3MRJA 4OD1L 5I1GL 1U8IA 2CDFA 5IFAH 3OBAA 1EXUA 5EO9A 2PYEE 1FPTL 3SDYH 5C08A 5J9PA 2YBRB 1B4JL 5HHOD 4DN3L 3IJSB 4YHML 1YEKH 1OM3H 3ZYOA 5BQ7B 3W9DB 2NYYD 3BQUB 4FQCL 3C2AH 4H5SA 4WI5A 4WW1A 2RFXB 2NY1D 2FZ3A 5IFHL 4P4KD 5DLML 3OKNA 1MRCL 3OV6A 5JR1H 5JTWA 2DQFB 5E8DH 3I3BA 4YDJB 4GUPB 2XZAL 3AMLA 2XA8H 5EZJB 2F5AL 1ES0B 5H37H 3FO1B 4HK0A 3MLYL 3STBA 3DX8B 1FRGL 1ZT4A 3GMQA 5J1AA 3DYMA 1CXLA 4MAYD 1U42A 1FC2D 3QPXH 4RMTA 3HG1A 4GRLD 3IJHA 1ZANH 3S88L 5EIIB 3LD8C 3MMEA 1G9MC 1UH3A 4NM8L 1NDGB 4M61B 4HEPG 1B2WH 3KAAA 1SBSH 2GTWA 4MNQD 5HYIA 3IXAA 5C09A 5E8PB 1G7HA 4JO3H 1QPXA 3F7RA 3SCMD 3S34H 4JKPH 3MRGA 3TCLB 1N4XH 2CDEA 4CVZA 5KSAA 1R5IB 3HLAA 4RISL 5T1DH 1ERNA 3RNKB 4Y5XB 2BNUB 5MEOB 4RWHA 1HINH 2BHYA 1A8JH 4MXVE 4LHJB 4U31A 4X7TA 1JBJA 1FJ1B 1XZ0B 1ONQA 1EZVY 4GS7C 5E4EB 4FG6D 2EC8A 4MCYA 5CEZD 4ODWB 1U8LA 5ICYA 4GAGH 4HJGB 4ELMA 5HD8C 1ZLVK 4HWZA 2RAMA 4XVTL 3T04D 4HIXH 3LRGA 1EFQA 2FGZA 2DBLH 4JPVL 3TVMD 4U7KA 4PRNA 3QIWC 4L3CA 3KPQB 5T3ZL 4R6UA 3O8XD 5ANMB 4MCZB 1CFQA 5HHOB 3R8QA 4F9PC 1EA9C 5HGAA 3RGVC 3T65A 4ZD3L 3D6GA 1BIHA 3T09A 1Q9OA 2XPGA 1EFXA 2NY1B 3F8UB 4P4KB 2VZSA 1QSVA 2DJSA 5C0AA 4RRPG 5IJKA 4JPIA 4RMQA 3HPJB 1G7JB 4R3SA 1JTOA 3ZTJH 4YBQC 2X4SA 1U92A 4Y4HB 2WBKA 4Z0BH 4HIIA 3VXOB 4UV4H 3WS6A 5C08D 1G0DA 3QCUL 4YDKH 1FDLL 5FUOH 3LKPB 3VFGL 4MAYB 1FO0L 1FL3A 5D1ZA 3WIFB 3GO1H 3MRKA 3TA3B 4GRLB 1VPOH 5I1DB 1CGUA 3O9WB 1NLBH 2W9DL 3GMNB 2DOCA 3MLWL 4PRHE 5C0EB 2VL5A 2J6EL 3BP4A 5CJQH 4NZRH 4FP8H 1INDH 1UXWB 1FYTE 1CS6A 2XWTB 2QHLA 2CXGA 3AXLA 3DETC 5CEYA 4PB0H 5ICZA 3IVKB 4WI3A 4MNQB 4X7SL 3H0TA 2QHRL 5JLZB 3DUHA 2YR3A 5IVXB 5DEGA 1K3ZA 4IRZH 4GKNA 1JPFA 2FLBT 1MELA 1X5IA 4G42B 4P59L 4CADA 2CLRB 4QHNA 2IAMC 2VUYA 3HG1D 4Y89A 5EOCJ 2VQTA 2DKMA 3MJ9L 4EZMA 4TUJB 1A7PL 3WNNA 5C0JA 2VDQH 3OKKA 3OR7B 2WNGA 3FL7A 3T2NH 3MLZL 3LB6D 1J11A 3QXAA 4DVBB 5L8JB 2P5WA 1YEHH 5C09D 2DQEL 4LCWA 5DFTA 1EAPA 3BSZH 3DECA 3UTTA 2V5SA 5HI3C 5BV7H 3G6JE 5C0FB 3VD3A 4Z5RB 3D0LA 1R3LA 2VABA 4OGAC 3VFRA 4FZ8L 3QHFL 2R0WH 4Y19A 5DHVA 5KSAD 3L5WB 5B8CC 3QEUA 4P5MA 3RDTA 3TVMB 1T83A 1G7LA 4GRWF 5F7WC 4ODHL 4L4VE 3O8XB 5DJXB 4CUCA 2DQUH 1RI8A 4KRMB 3N9GL 2CO6B 3VFVB 1P5VA 3MRJB 1U8IB 2CDFB 3IFLL 5IVZA 4QRPA 1EXUB 5EO9B 2ADFH 1T2QL 4RGMB 2KL6A 1TITA 4TUOA 2WP3O 1MAKA 3FFCD 4C57C 4P5TC 5C08B 5TPWL 4J6RL 2XZCL 1KIPA 3STLA 3X3FH 4Z7WF 5J3HC 5LCVH 1FBIH 5T33L 1RZJH 4X7CC 3QCVH 2ZG2A 5SV3A 1QKZL 2VLRE 4KROD 3OJ2C 4H5SB 3EDDA 4PRPA 1EFXD 4J1UB 2FZ3B 2DDQL 1E6JH 2DRUA 1TJIH 5GJSH 1HILA 3OKNB 4WGWB 2XICA 4LCCC 1P1ZA 1AQDA 5C0AD 3FQUA 4M4RA 4PJDF 5EU5A 4YHKL 3SE3C 2Z8VC 3VXQB 1VA9A 3NACL 3RKDD 1MHCA 4O5LH 1GGYA 2VQUA 4HK0B 3GGWA 3OKLA 4JG0H 1ZT4B 3GMQB