1QKZH

Fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
DVKLVESGGGLVKPGRSLKLSCAASGFTFSDYYMFWVRQTPEQRLEWVATISDGGAYTYYPDSVKGRFTISRDNAKNNLYLQMNSLKSEDTGMYYCARDPLEYYGMDYWGQGTSVAVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVNVTSSTWPSQSITCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G-PRIME
publication title Crystal Structure of an Fab Fragment in Complex with a Meningococcal Serosubtype Antigen and a Protein G Domain
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immune system
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1999-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qkzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qkzH01
1EFXA 4LEXH 2FR4A 1MPAH 3QUZA 3O0RL 2UVFA 1EJOL 4NJ9L 3RTQC 1Q94A 2BVOA 3PHQB 4ERSL 5IMLB 5C07E 4CVXB 3CCHA 3F7YA 1RZIB 2C7UA 2J8UE 4P49A 1H0DA 5FCSH 3K1KC 3AGVA 3S9DB 2AXHA 2NX5D 3DX8A 4O51A 2HKHH 2NQCA 5CWSA 2NTFA 4KDTC 3FQXB 4R9HA 1NGWB 3P73A 2EE3A 3CFBB 1A1MA 1FGNH 1G6RL 3MNWA 5CJQH 4RFNB 1U58B 1YEFH 3OKLB 1M71B 4K7PX 3WHE0 1XCQA 3WIIL 4ETQA 1NUGA 4Q7DA 5DEFA 4OZFH 2IAMD 4OCXH 3CFCL 4XP5H 5T3XE 5C0AD 4YXLL 1JZ2A 4U6XA 1YPZB 3MLVH 1FBIH 1DCLA 4O02L 3OKEB 5DJAB 5EU4B 1KBGH 3BKJH 3ZHLA 5GISH 1CCZA 3BFOA 3DX6B 2Z91A 1KXTB 4RIRA 4QHKI 3MODH 3QNXA 3O3EB 4R90H 1AXTL 3ZZ1A 3K74B 2KQMA 2V5RA 3U46B 2A9NH 1I1YB 2C3XA 1OTTC 1N3NA 1BQSA 4PREB 5D1XB 1TQCC 1J11A 4JRXB 5E5MB 5CGMA 1IQWL 1T6WA 1ZANH 1MHEB 3MRRB 5DRWB 5F1SA 3ARFB 1UB5A 1DE4A 3BQUA 2IPKA 1N7ML 4AY0A 5DHYA 4PJ8B 3SE8L 3T2NH 3MLZH 2I27N 3G5ZB 3S88L 1VACB 5IMOA 5I9QC 1F00I 1KEMH 2DMCA 3OKNA 4OM1H 1R0AH 4QRQB 1UM5L 4WI2A 2P44B 4XNQA 3TH4T 4IOSD 4E42A 4CU8A 1T04B 2XA8H 3ARUA 3G6JA 2P24A 4P4KC 3WCYA 3PWJB 3MROA 4HUWA 3B9KD 3F8UB 4BSVB 5EO1A 25C8L 1WC7B 3LD8C 5KS9B 1RZJH 2HH0H 3RAJL 1EA9C 4CNIA 1D5BB 4ZUUB 5CP7A 4HGKC 4KUZH 4K94C 3NGBC 4XP6L 4TUKL 1A14H 3D39A 2ZSWA 4KMTL 4KRLB 3BPCB 4DN3L 1L9MA 2ZG2A 1RUAH 3MRNA 2P7TB 2F8OA 5EOTA 5DC0A 1MIMH 2Q87A 3P9LA 4PGBB 2OK0H 2H32H 3H42L 4N0YH 2F54E 3EAKA 4H1LA 3O9WD 4G43A 1JBJA 2ESVB 1UADC 2B2XH 5E99H 4ZXBD 1EHNA 3CLEH 4HAFA 1FO0H 1K6QL 3VWJD 4D9QE 1AD0A 5C08A 4L1DA 3SGJA 2DD8L 1HYSD 3MXWH 2KBGA 4QTHB 4RRPA 1XF2B 1OGAB 2Y1VA 4Y5YA 4YFEA 4NRYA 1BQHB 3IFPB 2IH3A 1GGIL 4LLWA 5B38A 5GIRA 2R8SH 4F80A 1OPGH 4WEMB 4QWWC 1A3LH 5ICYA 4X6FB 3ARZA 4YGVA 1XF3A 3ELAT 2HMIC 4DOHE 3THMH 1JPSH 1ZHBA 3MV8A 5D7JA 2GIYA 2WANA 4N9GB 5JIKA 3QDGD 4KPHH 3TIDA 2XWJA 1HEZB 2R2BB 3EYOA 4O2FA 2FIKA 3NZ8A 5KVEH 2Y5TB 1QNZH 3QSKB 4RFEB 4X4YB 3ARDC 3N85L 3MACL 1OP5H 3L95B 4G7VH 4L9LB 3ZT5A 4J3VA 4Z78B 3IDNA 3BD3A 4NSKB 1I8MB 2GK0B 4JFPB 4QOKB 4KRNA 4LCUA 4WFFE 1TPXC 1J0IA 2H1PL 4N8CH 4XNZC 4HCRA 3UXFA 5I16A 4N0UA 5HGAA 1ADQH 1SMAA 3O2DA 5EZOL 4P23D 3SOBL 3GHBH 4GXUM 3U4AA 2EE2A 2R4SH 3OAYK 4L4JA 4F37K 2EIBA 2XI9A 2A9ML 3MRPA 2HRLA 5DQJA 3VXNA 1JF1B 5LBSL 3MBXL 5C0CA 1NGYB 4YWGH 1R6VA 1BZ9B 4PJDE 2L0DA 4AYFA 3F7QA 5ITFB 3X11B 1MCEA 1NANH 3TIEB 2DLTA 4UIKH 3V6ZB 2DLIA 4PRBA 5A2KH 4X8JA 1U3YA 1PKOA 2I9TA 3MBEA 4PJEF 1J18A 4WW2F 3JWDL 3ARTA 4MZ3A 1M7DA 5JORA 2ICEB 1ITCA 1HI6B 4G9FA 2FNBA 1MVFA 2HFEA 2Z31A 3U7YH 3AUVA 1ZVSA 2O61B 3TA3C 1G7PB 3E1F1 4LIQH 1HN1A 1CFBA 3B43A 1T83A 4HLJA 1U8HA 4QCIA 4K3DL 3CFKB 3MRHA 4KI5F 3QXDB 3ULVF 2VJXA 4QRUB 1LDSA 4OZHF 5IG7A 3LQAL 2EYRA 4ZD3L 4XCEB 4GAGL 4GMTH 4ZAKB 2C4XA 1JUFB 3V4UH 4AENB 3DMMA 4I0PD 1I8KA 5KSAC 2DDQH 4WJ5A 5IV2A 4QRSA 4R96B 4TRPH 2VLRE 2IFFH 2OR9H 4JFXA 4NNYA 4YHLH 4L4VD 3HRZB 1LO2H 3LKQA 5GRWA 2VSCA 3TZVC 1I3RB 5F9WB 3GIVB 2DQDH 4FRWA 1QR1B 3GBNH 4PP2A 4XP4L 3BGMB 2FX7H 1U8JB 3CDCA 3ZDXF 4XBEH 4XPAL 3ZYJA 5EPMB 2E5EA 4EN3A 3K4ZA 3P30L 2R4RL 4PJXF 4CU7A 4M61B 3IS0X 4D8PB 1J8HE 2QQQA 3D48R 4NKMB 4Z7UE 4IMLB 4HUXB 3RA7L 1BBDH 4JFEA 3GIZH 1ORSB 2CJUL 3IGAA 4XAWH 5M95B 3KHOA 1K4DB 4V1DD 1B0GB 2A83B 4HKXB 4ZQKA 1GC1H 2PTUA 3HPJB 4H0IA 4LCYB 5IESL 3H3PL 3OPZH 3TN0B 5TPWL 5EBGA 4TTDD 2XZAH 5CIPA 4MAUH 3IDYB 4HGWA 4PY8J 1A7BA 1U8IB 5EH1A 4PLJD 4ISVB 3FFDB 4LLVA 4WFGE 4JN1H 3RWDA 3NFPA 4XXCC 1B90A 2I9LA 1J1PH 1M1SA 4G8EA 3D2UA 2FECI 1CU4L 2Z0BA 4BKLA 2PXYB 1QLRB 3MJ7B 3HRPA 2FD6H 1KCKA 5TFSH 4UB0L 3ZKXC 4OT1L 5KANI 5I66A 3PP3H 1NFDE 5EZLB 1X5YA 5ISZA 3QEQE 2AS5M 1UJTA 3AREB 3MNVA 1NBYB 3QUMA 4QF1B 3RPIB 5TGBA 3QDJB 4X6EB 4JREB 1RIHH 1EEZA 4KUCF 4JN2B 1N4XL 4U1LB 3SDDB 3UROR 1F4XH 2KUTA 4Y2DD 3IDMA 5AZ2L 3CPLA 4P46B 5TDNA 2YKLH 1IAKB 2LAGB 3MR9A 3V5DA 4WU7A 5E9DD 2OJEA 4Q58C 4F9LC 4YGAB 4LSTH 5K9JH 1MNUH 4AIZB 1YEEH 2HTKC 4L3AA 1DBJH 4KQ4H 3QNZB 3VG9B 4F9PC 4KKBC 4UU9B 1BD2E 1QA9A 1F2QA 1ZTXH 4NZTH 3VFWA 1XH3A 3LQZA 1DBKL 3ULUL 2VDNH 2DLFH 2CDFA 1JK8A 1H3PL 4OCMC 4NO0A 4H88L 3BO8A 4DW2L 1F58L 3VD7A 4K3JL 4YEFA 1KN2H 2WP3O 1FNEA 3MJ9A 5CZVL 4JFDE 2YRZA 1LEIB 1N64L 5I1KH 2H26A 3MV11 1TZIB 1MFEL 2Q8BL 3T0BA 4MXWL 4G7YH 1GIGH 1JI2A 1HNFA 1DUZA 5DHXB 2AKRA 5DT1H 1TJIL 1SEQL 3GKWH 1MFBL 4XVTL 1V7ML 4NFBA 4YDVB 5JOEA 3O8XC 4LKXB 5DI8B 2DQCL 2LAAA 2CK0H 1ZEAH 7FABL 4HT1H 2AJSH 4JQVC 1QYGL 1QSFD 1YJDC 2MCPH 3SGEI 3QPQC 1T1YA 3BE1H 5DVOA 5L8JB 1D5ZA 3RY4A 4GG6A 1TITA 2E7LA 4PB9L 2I26N 1JPGA 2IPUG 1EO7A 4ODBD 5TDOB 1DANT 3VWKD 3SKUD 2X10A 3SQOH 4I2XB 3HTLX 4YBLC 2PTTB 5FCUH 5JO5B 4MA3B 5IB3B 1OSPH 4N0RA 4Y16A 2BDNH 4U1KB 1AGFB 3DUSB 3VD5A 1EHLH 3MOAH 2D3VA 4QRRA 3W0WD 1T22A 5D6CB 5JTWA 5GRJH 1FNSH 1OAZH 4JFOB 4MVBD 3H0TB 4ODUA 2R39A 4YPGB 5KS9F 1FYTA 1L6ZA 5LGHH 4JZNA 3VFNB 3VGEA 5CCKL 2EDLA 5DK0B 2EXYC 3BP7B 1T1WB 2K9UA 4KMLB 1NMBL 2M26A 4HFUH 3QXWA 8FABA 2Z8WC 4X5WB 5HYJA 3DSFH 4PJ7E 3O3AA 2N7BA 4HX1A 4G6ML 4Y5XB 1G7QB 4EXKA 1RZKL 1IFHH 2JIXA 2IG2H 4ZDHA 1H9VA 1T5WA 5KVDH 4XGZB 4F3FB 4NQTA 4NC2B 1A0QL 5I2IA 2COQA 5CJ8A 4NYLA 2HFGL 1OF2B 4X4ZA 5CJBA 3O6FA 4LASL 1AC0A 3I02A 3A0OA 4LCCA 2NY6C 3GJFK 1F8TH 3MUJA 1WIPA 2O93L 1MLCB 1NCNA 2E9WA 4B5EA 4FZ8H 2EEAA 3C6LD 3O3DA 4Y4HA 3BH9B 4CKVX 1INDL 4OGAC 1JFQH 1XAUA 3T4AB 2GUOA 2SEBA 5B4MC 1J8KA 4QT5A 5MEOB 3D9AL 4JJHA 2F58L 5D1QA 3B9EA 4FQXA 1WCBA 1QO3B 2WIMA 3W39A 3VXOB 1UCBL 4HMCA 3U0PA 3NZHL 4QGTA 1BEYH 2XTJB 1MCWW 4M6MH 5BV7C 2H6PA 3QFDB 4OGXH 4KK6D 4C83A 1T66C 2J3SA 4MJIB 1FZKA 4QGYA 3VG0L 3GO1H 1YEHL 1MIEL 2YPLB 2IAND 5DLMH 5GGQL 4CDGC 2Z92A 3GSWB 1CR9L 4NC1E 3QZWA 5ADOH 5LXGH 4H1LG 4G8FB 4HLZG 4RDQF 3TNNA 5T1LB 3QDAA 5D72H 5C2UB 4G9DA 2GHWB 3RY6C 4A6YA 3RIAK 1I4FA 3LEVL 4TVPD 3KPQA 3OAUH 3WFEH 3F7VA 2NXZB 4UQ3A 4P5MB 4LFHG 4Z7VF 1BFVL 3MCKA 3M1BB 4P2OA 2MFNA 2MQ3A 1YEGH 2EDEA 1HWGB 2LVCA 1MCSA 5FGBC 3KPOA 1FN4A 1H8NA 1I85C 1OWRM 4Z76A 1UYWL 2CRIA 1A7PL 1YYLH 5EUOE 3KPSE 1P84K 1R5WB 3E8UH 5E2UL 4YHIA 5DFWH 4E5XB 1GXEA 4Q2ZA 1DBMH 5B8CC 3BUTA 2EH7H 1Z3GH 5AZEL 2I07B 4WO4D 2YD7A 5INCA 5FFLA 5IJKC 4JCMA 4YK4C 3CD4A 5D8JL 5JA9A 3SCMB 4H26A 3R1GH 5EU5B 3PP4L 2QQLH 1MJUL 1X5JA 2VR4A 3G9AB 4XPBL 4PGDA 2UZIH 5CLWA 1MLBB 3SO3C 3HNTH 1ZWIA 5C0IA 4M03A 2WBJD 5F7DA 5TQ0H 4Y19D 5MI0B 2VISB 3TT1H 3IFOB 1X5ZA 2IAMB 2YSSA 4Y4KC 1OARL 5F1NB 5TDPA 1CLYH 5EWIH 5JIPA 5F72S 1JZ6A 5C0AB 1RZ7H 3EYQD 1LEGB 1W72A 2VLKB 1QSED 1L6XA 4M48L 4PJFA 1U93A 1AP2B 5JQ6L 4GG6F 2DQGL 3OHXB 3CK0L 4IMKA 3C08L 1MH5A 3PABA 3ZE1E 4LSVL 1WAAA 2X7LB 4P2RA 2OSLB 3EUUA 3O4LA 1BLNA 2XQBL 3VXTB 43CAA 1U8PA 4OIIH 2VXTL 3GI9L 1IZKA 3S37H 4JFFD 4OKDA 5F7YC 4BYHA 2OQJB 4OUUB 2F74B 2Q3ZA 4F7MB 4U1NA 2K3TA 5CD3B 4X6DA 3Q6GL 3SDXB 4YXKH 4KZEH 4JFZH 4PRDA 4O58H 2C3VA 4TUJA 3SEPA 2PO6A 1E0OB 2XPGB 4Q9QL 2ZCKL 5TE7L 4ZTPH 3GSRB 4YDKH 5DJXA 4FQCL 3HR5B 4Q9CA 4CADA 4XPFH 3F12B 3NA9H 5E6IA 2BY3A 2HJFB 3LDBC 4J6RH 4YHYB 2FO1A 1A7OL 4WIQA 3EO1A 3O6LL 1A5FH 4N8VA 3EBAA 4JGJA 4AJ0A 2JJSA 1BJMA 1FLRL 4GKSA 4J8RB 4TUOA 3B9KB 1VFOA 4NZDA 2P5EA 1PDKA 3QUXA 3N1MC 3EYVB 3O6ML 1J1XH 3ETBF 5I71B 4WW2C 1FFPA 2OCFD 1B3JA 3QIWD 4MNQE 4W4OA 1HKLH 4JKLA 2C1PB 3F7PC 1NAMB 2UY7A 4MJ6A 1MOEA 2VXVL 3QG7L 4GH7B 4YO0A 3T0XA 1S9YA 3OKMB 4NZUH 5FEBA 1AO7D 4KJYA 4JPWL 4XNUH 4X5XA 4NHCL 3WXWH 3MRKB 3JBG7 3X3GH 2BOBA 4JG1H 1MCDA 4PJGA 5EUKB 3KPPA 1YZZA 3O9WB 4ENED 4KI5C 2EDQA 2FATL 3ULVC 5DQ9A 5HI3D 2IWGA 4ZXBB 2JE8A 4NQVA 3LPGA 3CFEA 4CL7A 3VWJB 4EDWL 1IM3B 1M7XA 1Z0NA 5H2BA 2LQRA 5JA8B 3UPRB 3BGAA 3MLTA 3FB5A 3P9MB 4WW1B 1CLCA 5JUEH 3S36H 4U1MA 5CZXC 3ZE2E 3RVVC 1XGYL 1YN6B 2AJXL 3UTTE 4HK3J 4IRSA 4UV7L 3MJ9L 4LCIL 1A6VH 3SN6N 3TV3L 5C9JA 1AGDA 3K2UH 1KJVA 2PTVA 3EJYD 4H8WC 3BQUC 1RVFL 2EKSB 1AIFB 3MLYH 1QBBA 4XPGL 3NOIA 2GY7B 4ONGL 3BXNA 1MCPL 3WO3B 2OL3L 1ORQA 3FB6B 2AABH 4G42B 3L3OA 3QDGB 3EDDA 1IJ9A 5CSZA 1TJGL 3G6AB 5JHLH 3MRCB 2JELL 1MJ8L 1E4XI 1GZQB 5ERWA 4LLYA 5HHMD 1FAIH 1O5DT 3S35H 2XRAH 4PYHA 5C6TL 2R1YA 2NY3D 4M9OA 2F8XC 3SDYH 4JZOB 1B4JH 3E3QC 1Q9KA 4GKNA 2VLMD 4EUPB 3OG4B 3RDTD 5EU3A 4P5KA 3TBSB 1KNOB 4OQTH 5I30H 4OZIB 5K9OB 3MX0A 1B6UA 4KK8C 4S2SB 4I3SL 3C8DA 4HWBH 3KLAB 4P23B 5D5MA 4ELMA 4HKBB 3L9RB 1PEWA 2AXFA 5E2TH 4WHTA 1BVKA 2IH1B 1WITA 3OR7B 2WM0A 1GRWA 5DJ6B 4E9LA 4NNPH 1W0VB 3T77A 1ZAGA 1CFNA 4K94L 5GQBA 1A3RL 2HJLA 4EDXB 3O41B 1TCMA 4NPYB 3PQYB 1PY4A 5DUBB 5CD5D 4OLZH 4MDIB 4JR9H 1T20B 3PWPA 5CINL 4C59B 1DEEA 4X7FC 2YK1H 4U3HA 3MRQA 5D7LE 1J87A 3RY5A 3A6BL 4OFIA 4OIAA 3O2WH 4JRYA 2C26A 3DNKA 5FO7B 3T09A 5F3HA 3PDGA 3SGJC 3WIHL 1MQ8A 1Y6NR 2DQUL 3Q6FB 3P40A 3ECBB 4UTAL 3GSVA 3HMXL 1KIPA 1T0MB 5CZKA 2PR4L 5KTEL 5F88A 5FO9A 4RFNC 4JO1H 1WAAF 1CD8A 5D7JC 4GRMA 2AJZA 4I0PB 4Z0XA 4WUUD 1ZS8A 4Y8AA 3HKFA 5K33A 4MJ4A 4BK5A 1BZ7A 1OP3K 3MOBL 4M62H 1YC8A 2NW3B 1JWUB 4L4VB 2XN9E 1ZE3C 4KRPC 3HG1B 4G8GE 1Z9SA 2JTDA 1S7XA 4PRIA 1KUMA 1UM4L 2C3GA 2PCPA 3GMLA 3OJMB 4UQ2B 3ULUD 4FTVD 4TSAL 1LD9B 4MMZC 3TYFB 3DI2B 4UDUA 4Y1AA 3ILPB 3BKMH 3MLRH 3G04A 4NKQB 2CR6A 2FWOA 4N0FB 4UBDC 4FQIL 5D1XC 1HE7A 5DJYB 1CICA 2GY5A 1XIWD 2JJUA 3Q48A 4XT1C 4DCQB 5FYKH 5BQ7A 4Z0BH 4YHZL 4TSBL 3RZCC 3JV4A 5DR5L 4L8SB 4PJ8C 2AK4E 4V1DB 5HGDB 3RU8H 4OV5A 1P2CA 2V2XA 4PRPE 4UUJB 2ZUXA 1FZJB 4JHZA 2VDML 3ZYZA 4KMQA 3U6RB 1IC4L 2R0WL 4NO5B 2DQHL 2YMXH 2XY2A 1IEBB 4E41D 3VXMA 1Z9MA 3OB8A 3QPXH 2MMXA 5IBUG 2Z31C 4K9EH 2UUDK 4I3RL 1C08B 3BWAB 3DUUA 1T83C 3STZB 3QQ3A 5F7NC 5B39A 4GRWH 1EVTC 1VERA 4XI5D 2XXCB 4K3GA 3C5ZA 5T3XD 1U8KA 5AEAA 4F2MA 3JV6A 2PW1B 2BC4B 3RWCB 4IHOA 1OTUC 4BQ8A 3VD4A 5FUZL 1Q9LA 3UBXA 3HAEA 3OXSA 1K8DA 4B50A 4OKVB 3W9DA 4Y4FD 4X7SL 5E2WL 5AYQA 1FYHB 4OCWL 3DMMC 5H35A 4OCRH 1MCCA 1QPXA 2AQ1A 4PJBA 4Y2DB 4R7NB 4UV4L 4YUEL 3M8OL 2ICWA 5E2VL 3UJTH 4EUPH 4XNMB 3WFCH 4PY7A 2WWMC 4DKEH 5E9DB 2AJ3B 4MNHB 4NRZB 4ZOBA 2A6IB 4NQCD 4NKIL 3MLUL 4Z7QF 5E7BA 4Z6AT 1AD9A 3ARBD 5I1DA 1CGUA 1A4JA 4EN3C 2HVKB 4ZFOA 4JHWH 1WZ1L 1T3FB 4CVWA 3L3HB 3L5JA 3QZWG 2JK5B 4HFWB 1DDHB 3QHFL 4PD4K 4PTTA 1RIUL 1MFDH 4YXHL 4GW1A 3GRWA 1WFNA 1OAQH 5F89B 5ITBL 5DK2A 5L6YH 1V7NL 5CS7A 3K4DA 2ATKB 2GFBB 3VXRA 3HCVB 1LE5B 1A7QL 3DJ9A 1MEXL 2IALA 2BNRA 3STLB 2MCG1 4IRJD 3HUJA 4N1EA 4X99B 5D5MF 4ELMF 3PV6B 5JHDA 3AVEA 5DFVC 3WDHA 3OKKB 2NZ9C 1WCQA 4OAWA 2EO1A 4YDLC 4RAVB 1IAOA 4XZUA 2X1QA 2EC9U 3RWGA 4DKDC 5J1TC 4DN4H 4NKDA 4L9LC 3LS4H 4NDMB 4W6WB 5DO2C 5HGHB 1FH5L 1QHOA 3RWJA 5SWQB 4FQJL 1QSFB 4JGMA 1OD7A 4OZFA 3TPUB 3NABL 2Z9TA 5C0BB 4K23H 1SJHB 4MSWB 4XX1G 1U8MA 4OLWL 3WNMA 5GGRA 3VE0A 1HQ4B 3FCTB 3MRMA 3RKDD 3VWKB 2X1XR 3OR6A 3U7AA 4XHJD 3MSPA 3U4EA 3UTZB 4UZGA 2ATPB 2N7AA 5FKAA 1A6PA 1DQMH 1U8OA 2DICA 3UJJL 4D9LH 2NTSP 1E27A 3ISWA 3IU3B 3BH8B 1RUKH 3W0WB 1ZVHA 3T0ED 3GSQB 3TJHD 3V2AR 4F7CB 3HS0B 2YHGA 3UMTA 3T08A 3LV3A 2CQVA 4DQOL 2AEQL 1KJ2L 4WWKD 1JWMB 3SE4A 3LSOB 3CFDB 3E3QE 3F6LA 4QY8A 2IBBA 4QXGH 1OOAA 1A6WH 1DUYA 3KLHD 1VEOA 3LKRB 4MA8H 4WTZG 3G6JE 2JB6A 4HUMB 5TE4H 3TJEL 2VKWA 5ESVB 4Q9RL 3U1SH 1EEQA 4S0SD 3B6SB 3MTRA 4PBXA 1VGEL 4GSDH 4O4YH 4BFIB 4CRPA 5LAXA 2XWTB 3E6FA 4X6CE 3D39E 2YA2A 3H9SA 5A43C 4MNGA 2B1HH 2YD8A 5TF1H 1MRFL 4MWFA 1PX4A 4FXKA 2HT2C 4OZGE 3C6LB 3KPRD 2FDBP 4JY4B 5J6HA 1TXKA 1ETZB 3OXRA 3QDMA 3AAZB 5F9WC 3KWWA 4Z7NE 5ACLA 4JG0H 1CIUA 1S7QA 3TEUA 4Z8FH 3LZFL 5GSRB 5IMKA 1T03H 5C08E 5GSVB 4EVNB 2Q7YA 1IGTB 5IR1B 1YJDL 1I7ZB 4UT7H 3MLXH 4XCFH 2J6EH 5IFAL 3REWB 3C8HA 2H32A 4ZS7L 5GGVL 3M17B 3U48A 4UINL 1EHXA 3ARSA 4Y16C 5GRUL 3KLDA 2Q6WB 3TESA 1XF4A 1WZLA 5TJWK 1WZKA 4N0CC 3MV8E 1TQBC 4U6TA 5HHNA 5KVGL 5GS0C 1FO0A 2IANB 4PRHE 5JLZA 2AXJA 3QRGH 2ZUUA 4YE4L 1UZ6F 3HC4H 1QSVA 4YEEA 1DVFA 2HKFH 1KIRA 3QEGH 5DTFA 2B1AH 2RIKA 1YMMA 2WBKA 5CBEA 3ILQD 3P11L 2FEDC 3Q3GA 2P4AB 2VH5L 1BP3B 2NY5C 4KTEL 2X89D 1EFQA 3WD5H 1NCDL 1CFTB 1X4ZA 2PXYC 4ORGB 4W81A 2W1NA 3IETB 4LDLB 5IROA 3BEWB 2F5BL 2AXGA 1VFAB 1KTLB 3NIDF 4N0UE 4HPOH 3KDMB 4DFHA 4G3YL 2OTWB 1CFQB 5EO0B 2CUHA 1FNAA 3BPNC 3O6FC 5C0CE 2Z93B 3RTQD 4BH8B 4H25B 4L5FH 1U58A 1M71A 1NGQL 1ZGLM 3BZEB 3WFDL 4WO4B 3FONA 5D2LB 1J8HD 1X5AA 4Y0GA 3EYFB 1RZ8B 3IDIA 2DQIH 2B20A 2ZUYA 1ADQA 1YPZA 2QJDA 5HHXL 3TBTA 3WKNA 5I1IH 4X5LA 2D31B 5BW7A 4I4WB 1HWHB 5E5UB 3PWLB 2WBJB 3UYRL 4HS8L 3WN5B 1S3KH 4Y19B 5KSVB 1C12B 4JHAH 2O26U 4OCLC 3FO2B 2APVA 2AV7A 2M1KA 3VXSD 5GRZA 1I1YA 5IVXA 5BV7L 1MREH 5J7CC 1CFVL 1QBAA 5HJ3B 3MRDA 1QSEB 2BVYA 4LEOB 4X7TA 4XHQA 3BHBB 4FZEH 2H45A 3VI4E 3CH8A 3OBAA 2OXHA 2FX8H 3IXAA 3KXFB 2ZG1A 4AG4L 4LPWA 3QULB 3SQBA 2V2TB 3B5TA 5KW9H 2PW2A 2XA3A 4M8VA 2QSCH 3IFLL 3G5ZA 1OTTD 3W9EA 5L8KB 1MFCL 5L2KA 4M7ZC 4JFFB 3FL7A 2ITDA 1Q9WB 3J8F7 3QEQD 4FP8L 1NDMB 3BEVA 1S78C 2QSVA 3O0RH 1EJOH 4NJ9H 5DJDB 4ERSH 3QNYB 2EDXA 4TYUA 5ACZB 2BY2A 4XC1L 2ADFL 2NY7L 4PB0L 2FGWL 4JFEE 4OSUH 4YLQT 4P2OC 4PRAA 3QQ4A 1S8DB 3I6LE 2X4RA 2R29L 2FRGP 1A6AA 1G6RH 4LMQE 1AKJD 4LSRL 1IRAY 3QH3B 2J88L 1WC7A 1U8NB 3WIIH 3WXVL 1GVIA 4K3HA 5KSUA 1BD2D 1D5BA 4JFHE 2ED8A 3C6SB 5J11C 3QQ9C 3CFCH 4N90D 5I76A 1QRNB 2F19L 4YXLH 3R8BB 2R0KL 4P4KD 4C56A 5MEQB 1F6AA 5FF6A 4PGBA 4O02H 4Y5XC 1NPUA 1VGKB 1KLUB 1ZSDB 2P47B 2HG5A 4U3XA 3DGGA 2CIIA 1EBAA 1QQDB 3QIWB 1C5BL 3PJSA 4U6YB 3G5YB 4MCZB 5IIEB 1IL1A 1J86A 4R8WL 5I1LB 2GI7A 2OZ4L 2GITB 4RNRB 2YEZA 1HHGA 1AO7B 5ISZE 1F3DH 1FL3B 4HC1A 1OGAA 3DX9B 1OHQA 3P4MA 2GAZA 1IQWH 3IFPA 1SYVB 1UH2A 1FZMA 1UJ3B 2X9YA 4PV8B 5F96L 1N7MH 2Y5EA 4XWOC 5FHAL 1JV5A 4XC3L 3VFUA 5I75B 1U8QA 2ZOKA 5I1CL 3SE8H 4M7LL 3F58L 3S88H 1WSST 1DQJA 2Y36L 2Z4QB 2P5WA 1FJ1A 1HEZA 2G5RA 1WT5A 5ICZB 1A9EB 1W0YT 4PJCE 4YR6B 4OCYL 2Y5TA 1KB5B 4QWWD 5GGSB 4X4YA 1UM5H 4NBYB 2P48B 2HMID 3UJIL 2MPAL 4XWGL 2XTJC 1WLHA 3L95A 5B39G 1ES0B 3P4OB 3BKCL 4M00A 1JGVL 3VMPA 4Z78A 3KYMB 1B6DA 2GK0A 1OGTA 5JOPE 3W11C 5C0NC 5BOPA 1FGVH 2J7LA 3ZLQC 3HAEG 5IJVA 5JW5A 3ORJA 25C8H 5AYUL 3A67L 3ARDD 2JCCB 3T65B 2NY3B 4XP6H 4TUKH 1E4JA 2B4CL 4X0KB 1JF1A 4KMTH 3OF6D 3RDTB 4JAMA 5ITFA 4NUGL 1CXKA 2FO4B 4NJAL 3H42H 5LGKA 2W92A 4FHBD 2JJSC 3QP3A 4OLVL 4RMVA 3JWOC 5MHSE 1GHFL 4RMQA 4I77L 4Z7WE 4P3WA 1K6QH 4C55A 3NIGE 4GG6E 1KACB 4LVNB 3D87B 4RSVA 3MRIA 3QEHA 5SWSD 2DD8H 3RWIB 1FLTX 1QBLL 2CO7B 4IJ3B 2XTLA 1KFAH 1F11B 1VENA 2W59A 3CFKA 3QXDA 1GGIH 1CFSB 2G9HB 2OP4L 2Z8VC 4QRRE 4L8DA 5D70L 1JYNA 1XMWA 5FYJD 3TA3D 2R23A 1JUFA 1EUTA 3EOBB 2XT1B 3SCMC 4NN7B 2FJHB 3UTPE 5D96B 1UCTA 3IKKA 4S1QL 3IFNL 5EBMA 1UVQB 2NXYC 4POUB 5GHWL 3S98A 3BZFB 1CXIA 1FFOB 1VPOL 2EC9T 3GIVA 3N85H 3P0VL 4NQSA 4OZFG 5FOBA 3ZDZE 3MACH 4BSJA 4BQCA 3BGMA 4K7PL 4GT7A 4RX4D 3IKCB 3RGHA 4WUUB 4M61A 4D0DB 5GGRY 3ET9F 4D8PA 1H3TA 1GYAA 2H1PH 2UZYB 2BOCA 4IMLA 4HUXA 1KCRL 3TZVD 3IB4A 3SOBH 2YR3A 1ORSA 3RWEB 4LVEA 2A9MH 3EO9L 1FZOA 2NY0C 4CW1A 2VZTA 3B8SA 3GJFB 3MBXH 4FTVB 5LBSH 3V0AC 5HD8C 3S4SA 4LLUA 3Q1SL 4S1RL 2X42A 5DZLA 1I1FB 3DRQA 1FHGA 4WEUD 2HFFB 1X4YA 5E56A 3JXAA 1T7VA 4M6NL 3JWDH 1T7YA 2AJYL 1XIWB 1U8IA 2GT9B 3D85D 3FFDA 4N1CA 5TH2B 4QRPD 4KC3B 3STBA 5LQBL 4QNPE 3HLAB 1XGTB 3QIUC 4WU5A 4PBVC 3DBXA 2XZZA 3DX7B 2H9GB 1QLRA 4YFLF 4G6KH 5HPOA 3PL6C 1U8LB 4K3DH 3PF2A 4YNYB 4F15B 4HUVA 5DMKB 4E41B 5EZLA 3DXAD 3LQAH 1AGBA 2F53D 4ZD3H 1NBYA 4GAGH 2EDRA 3WJLC 3EDEA 1CD0A 4U1IB 2WAHA 5E1AB 2IGFL 3D3VD 3VA2C 4S10A 1KXQE 2DKSA 4U1LA 1KTDB 3SDDA 4LCWA 1JYWA 4K7FA 5D7IA 5FUOL 3NN8B 2LABA 5D93C 1H5BB 4G5ZL 4L8CA 1JJUA 4ZPVA 1EJ6A 4ZUSB 4PTUA 4MDJA 3FHAA 4XP4H 4AIZA 2ZWLT 5D2NA 4XPAH 3P30H 3PDOB 2R4RH 4FG6C 1UB6A 4LP4A 4Y4FB 5CBAA 2CKBB 3PWUA 4ZMAT 2QHLA 3KPLA 1M7IA 5C0DB 3VA6A 3RA7H 4LSUL 1KT2A 4LHUA 4BA8A 3TO2A 3Q5OA 2CJUH 1KCVL 5FECB 3O9WC 2X4SB 2HTKD 4JJ5B 5IB2B 3ARBB 4KKBD 1A6TA 4W6YB 1A21A 1XGPB 3RVTC 4IS6A 5IESH 1TZIA 3HC0A 3H3PH 4MGXA 3RNQB 5TPWH 3ZKMC 3QFJD 4BELD 5EIIB 1MI5A 4XX1E 4YIQA 4DVRH 2Y06L 5CEZL 2BNQD 5I19L 1HINL 4OI7A 4LKXA 4ZUTB 2VZ3A 3OZ9L 3U9PL 3NPZB 1CU4H 1UZ8A 5JIIA 2ZCLL 2VDOL 5B3NA 5LGJA 4N9OB 4LK4A 2Z8SA 4IRJB 4UB0H 3TO4A 4OT1H 2P1YA 3ZO0A 4FQLL 2L7JA 6CGTA 3VH8A 5C6WH 4LMQI 2VDRL 4PJFE 3QT2A 3O8XD 1ZA3B 3UZVB 2FJGB 4KQ3L 3S37X 2YN3A 2PTTA 2CMRL 2VDLL 4MA3A 4YZFE 1XGQB 1N4XH 3HE6C 4P2RE 5HSFA 2E27L 3T4YB 3QPQD 4LDEB 5AZ2H 3QO1B 3O4LE 5D6CA 4ZOEA 4ZO6A 1X4XA 5B3JF 4JFOA 4HKJB 3H0TA 3V5HB 3VFNA 2B5IB 1HHIB 4PLKC 4OFDA 4UAOB 1KOAA 2X44D 5GGUB 4X5WA 4GBXB 1PBYA 3O11A 1OW0A 4IBLT 4X6DE 5C07A 3IF1B 3U2SA 1DBKH 3ULUH 4JANB 3V4VL 3T0EB 5C2BL 1H3PH 3IDGB 4LPXA 5E94A 1MCOL 2DRUA 5C8JB 4H88H 1D6VL 4MA1B 4DW2H 2CDGB 3BAEL 3FT4A 1F58H 2EXYD 3AFLA 4XRCB 1CDCA 1T5XB 4K3JH 2CGRL 2VQ1B 3V5KB 4PG2A 3UTTD 4I18B 4WV1A 4WWKB 3L3JB 5CZVH 4LVOC 1RJZA 1BFOB 1HCVA 3CFIC 1N64H 1S5HB 3L3IB 4OFYD 3BSZL 4HSQA 3JV0A 3GNML 1INQB 1JPST 2YD9A 1MFEH 2Q8BH 4MXWH 4DOHB 4G6JL 4YHNB 1T2XA 3RQ3A 3OB0K 5DMGC 3MREA 1DN2A 1SEQH 1TJIH 3WE6B 1MFBH 3MRGA 4XVTH 1V7MH 4HC1L 5FYLL 3WUWA 1JHTB 3FB8B 1RZFL 4MD4A 4AIXA 3QCVL 1LDPL 4M3JA 4AMKL 2P5EE 4JCLA 2DQCH 3T4AA 4HIEB 7FABH 5JW4N 2EYSA 2H8PA 3L3DA 5MEOA 2NYYC 2FGZA 4I0PC 1CL7L 1NFIA 1QYGH 2VOTA 4MD0A 3LKSA 5JXEA 2Y72A 2FHCA 4Q9BA 2BVQB 4Z77B 3PGDB 4PB9H 3ARRA 3ULSA 2NNAA 4OGAD 5MP6L 4UI2A 3GJEA 4PJGE 3S36X 4BUGA 5B4MD 1IEHA 4FFYL 3S97C 3MV9A 4PR5B 4AEEA 3CDGB 1C5DB 2CIKA 4X7DC 2NR6C 2AVGA 2YPLA 2VZ1A 3L7EB 1U91B 3GSXA 3PG2A 4PJDB 4PJ9A 1CLOL 3OAZK 5E8OA 5HDBF 4JFYA 3GSWA 5ENWB 5CCKH 3K7UA 4PGCA 4ALAL 2YN5A 4JKWA 4ZPTB 5F1KC 1QFOA 1TETL 3GKZA 2EEBA 1A8JH 1T66D 5BZDA 4J1UB 4G6MH 5A2FA 3WS3A 5A40E 1MF2L 1UWEL 1NGZB 3FZUC 5D7LD 5IB1A 4Z7QE 1RZKH 2IJ0C 2WV3A 3KJ6L 1NBQA 1NBVL 3VFVB 3BD4A 3RHWF 2ICCA 1OVZA 4L29B 5AD0A 2DBLL 1BQHG 1K5NB 4OFPA 1A0QH 3I6GB 3CXDL 3EFFB 5D1ZA 3DROA 1T7WA 2WLZA 1U2HA 4HLZH 4KV5F 2HFGH 2CLRA 5IW6B 3HA0A 4LASH 4LQ1A 4XCNB 3KJ4B 3SE4C 1X7QB 1VFMA 2VAAB 3FMGL 1UKTA 2D7TL 3WL9B 4AK1A 3SDCA 4K2UH 2X4NB 3WSQL 3QJFA 3H9ZA 4M6OL 3IU4L 3T0AA 2NX5A 1AHWB 3GMQB 4PV9A 5DSCA 3FHQA 5JXAL 3D9AH 1G84A 3FO0L 2F58H 1DQLL 1D5MA 4K8RL 1WUNT 3RTQB 4CJ1A 3BYYA 4CMMA 4O2CA 1UCBH 3ESUF 1G9ML 3NZHH 5EOCL 3QUYA 1X44A 1VB9A 2VISA 3RRQA 4OQTA 3EHBD 2M8XA 1J8HB 2AJUL 5F1NA 3PWVB 1UWGL 3PWPE 1BF2A 2V9TA 2VL5B 1MCRA 5CHNB 4HWBA 5EU7C 4UNTA 5FM5O 3VG0H 1RZJC 4QXTA 4EIGB 1YEHH 4JRYE 1MIEH 1QLFB 4HMEA 5GGQH 2BCKB 5GGTL 4X9FA 1YN7B 1IGJB 2F9BT 1CR9H 4U2ZA 4GFTB 2ZUQC 4Y4KD 3SGDI 3QWRD 2OSLA 4PJAB 2X09A 4OF5A 3VXSB 2CLVA 3KYNA 4X83A 5HYSB 3BRFA 1GGCL 3VXTA 3OJDB 1IM9D 2IADB 2AV1B 3S5LB 5ABDE 5JPMA 3JVGC 4ZG1A 1IGYA 4U05A 1N59B 2OQJA 5ESQB 4OUUA 3LEVH 1KG0B 1FP5A 1ZT1A 5KSBA 1Q0XL 3B3IA 4JZJA 3FFCA 2GTWA 4BZ2L 5CD3A 1FFNB 3UTSA 1BX2B 3SDXA 1BFVH 3FOMB 2ZSVB 4ZYKB 2A6DB 2X4OB 2CDEA 4NCC2 2G60L 5DD0L 1CD1B 3OKOA 1NFDB 3S3SA 1TQCB 4PRIE 3WV0A 4RBPK 1UYWH 3GSRA 3QEQB 1A7PH 4O9HH 2J8UF 1UGNA 5EA0L 4NN6C 2PYEA 5E2UH 5BXFB 4Y1AE 2NY5L 3SY0A 5AZEH 2LU7A 3HNVL 5F1IB 1RSFA 5D8JH 1EZVY 4UDTB 1C1EL 3AU1B 3RGVC 3X13B 4Y7MA 1CXLA 3PP4H 4MX7A 5IQ9B 1MJUH 2B0SL 1EFXD 4GAYB 4XPBH 3FO9B 4M1DL 3VXUD 5SX4H 4UMGA 1TVBB 3CH1B 3EYVA 1KCSL 1JPTL 5DK3A 1BD2B 3AY4C 5E4EC 1UKQA 4M4RA 1XFPA 3C9NB 3RIAF 2C1PA 3L6FA 4LLQB 1OARH 4AIOA 4U1HB 3NH7L 3VXME 4FS0A 2NY1B 4P4KB 3S96B 3AM8A 5HDOA 2IBGA 3CSYB 1A4KA 4QYOA 4M48H 5H94A 4D9RE 5JQ6H 2P8MB 3K4AA 4U31A 4XXDA 1L0YA 3LD8B 4NP4L 5KG9A 2DQGH 3DVNA 1KF9B 2VZSA 1VFBA 3CK0H 3C08H 4CVUA 3WIFB 1L7IL 2OR7A 3LS5L 4LSVH 3VWJA 2NMSA 3VFTB 1IE5A 2VLRA 1CDYA 3SGKA 2XQBH 3P9MA 5DJ2B 2VXTH 1NKOA 1I1CA 3GI9H 3FN3A 2HLAB 3MLPA 1ZLVK 1HHHB 1U95A 4EQ3A 5HPMB 1YN6A 1NC4A 2BJML 2DQJL 3LPFA 2JJWA 4KI5D 3DO7A 3ULVD 3FT2A 1DSFL 4PJBE 3PV7A 3V8CA 5ACMA 3WUZA 4JPVL 1QFWI 3QCTL 3PIQB 1A64A 2DTML 3Q6GH 4NQDE 4Z7UA 4Q9QH 2ZCKH 3D25B 5TE7H 2R69L 1WISA 1DL7L 5BJTA 4CN6A 2W9LA 4LQFL 5CZXD 1UWXH 3RVVD 4FQCH 1UT9A 2RQ8A 2W0PA 5I1HL 1GZQA 4HG4J 2OJZL 3BQUD 3VFOB 3VD9A 3NTCH 2W0FA 1MVUA 3DWTA 1A7OH 4CMHC 3P0YL 3HPLA 1JP5A 4HHAA 5F6IC 4EUPA 5C0RL 3O6LH 3OX8A 3QJHB 5CEYB 2WINA 4P2YA 3SKMB 4P9ML 2ARJA 1PYWA 4OJFL 1FLRH 4KK5D 5FGCE 2JJTA 1MHHA 1FVDA 1T21B 3O6MH 3VXRE 3JUYA 5HVHC 4KGLA 3HUJE 2BX5A 5DJ6A 1W0VA 5JHDE 4LPTA 2VXVH 4HH9B 2M2DA 1DTUA 3CSBA 3KHQA 1I75A 4EDXA 1TPXB 4JPWH 3VW3L 4NHCH 3B8YA 4KK8D 4XNZB 4NPYA 4R4FL 1I7RB 1TLKA 4I0CC 5IVNA 2FATH 1NC2A 3T2PA 3CZJA 3WNLA 1GC1C 1JGLL 3D39D 4EDWH 3FOLB 5SWSB 3RUGE 5K9KB 4YHML 3MZGB 1OP3H 3Q6FA 3GSOA 1XGYH 5CGTA 4UV7H 1R5VB 3MJ9H 1X5XA 4LCIH 4X4MA 3TV3H 4GXUN 1A1OB 4G6AC 5KJRL 1RVFH 3D18B 5ALCL 2IQAB 4DZ8A 3U36B 1DBAL 4ELKA 4XPGH 3FQUB 4EEEA 4ONGH 5C08D 3TA3B 3VH8G 2WUBL 1MCPH 1PW3A 2W65B 1FFRA 1U3JA 2OL3H 3MA9L 4GLRH 1GAFL 1MJJA 3I6KB 1AGCA 3WS6A 4KUCD 1XZ0B 4XBPB 3CC5B 1TJGH 5E8PA 4NWTL 2JELH 1MJ8H 1WT5C 4F7PB 4ZUWB 5C6TH 4JFDA 2ZNXA 4OD2A 3O2VL 5D7JD 5ICXB 1SY6L 4ZO8A 4YQXL 3QEUB 5T5NF 3FO1B 3ILPA 4RGNE 1P4LA 3FQNB 3B9DA 4I3SH 4YDIH 3TZVB 3BMWA 1YNKL 2X70B 4KRPD 1CDBA 4GG8B 4PJDF 2J4WL 1T89A 2R2HB 1Q1JL 2EKJA 4MNGE 3REVB 4L8SA 1E28A 2ERJC 4K94H 1NJ9A 1J0HA 1A3RH 5SX5H 1QFPA 43C9B 3QDME 4UBDD 4HDIB 3U6RA 3DUHA 1K2DB 5EU7E 2P8PA 4FXGB 5CINH 1W0WB 1HDMA 4I48B 2P43B 1AGEA 4IIQB 1C16B 3KS0J 4QRPB 5L2JA 3JWOL 3A6BH 3RZCD 5C0CD 2IMNA 5ALBL 4FMKA 2PYFB 2UWEA 1PKQB 4ZO7A 1J0YA 3M45A 5KN5B 1FNGA 1C08A 2Q86B 1QLEL 3ALWA 3N06B 4FQQA 4PJHB 4EBQL 3WIHH 4TNVF 2CLZB 5EFIA 2DQUH 4UOJA 3T3ME 4UTAH 5D6DA 3HMXH 3O3UN 1H3WM 2PR4H 5KTEH 3RX7A 1S7TB 4NO3B 5IW1B 5J57B 4BQ6A 3G5VB 3DXAB 4G9FD 2F53B 2PW1A 4PJ7A 4Y5VB 5E5RB 3CXHK 1JGDB 2Z31D 2DWEB 3D0VA 4KRMB 4LKCA 1JZ4A 3DURB 5DRNA 4A2MA 3D3VB 3VCLB 1AC6A 4HS6B 1H15A 3G08B 3ZKXB 5L88L 2J6EA 3MOBH 1YMME 4XNMA 2ENSA 5J13C 4CVZB 5E9DA 2ADGB 1D5IL 1IILE 3SGDH 1OTUD 2WIIB 2MQCA 1OAXL 1UM4H 1G9NL 1KYOJ 2AERT 2J2ZA 1MRDL 4TSAH 4BFEA 2DQFB 1BIHA 4Z7UF 4X98B 1EXUB 1YDPB 3DMMD 3EYSL 2E9IA 1P9MA 3GUTB 2EE6A 3L3HA 2JK5A 3V6FB 4HFWA 3SPVA 1UQSA 5A3IC 4FQIH 2WWMD 2IF7A 3MYJB 5ANMA 3UZQA 1R3LB 3LKNA 1INEL 1KJ2B 5F9OL 2BNUB 4XPTL 2ESVD 4U7KA 1GL4B 1FVCA 4YHZH 4TSBH 5DR5H 5T3ZL 4Q6IA 4EN3D 1XGUB 4WDIB 1A1NB 4QHNB 2VDMH 4KDWA 3STLA 5CUSL 4PG9B 1IC4H 2R0WH 1RPQA 4WHCA 1YPZE 3L3GB 3VFGL 2BNQB 4BSWB 3I6LD 4EOWH 1R5IB 4HULB 1BGXL 4U1JB 4HH8A 4I3RH 4MS8C 5HYQB 4FMFA 5HGHA 4MHHG 1NFDF 1TZHB 1HQRB 3SJVA 3QWOB 2BVPA 4JM2F 1UXSB 4RMUA 5DFVD 4RMWA 2NZ9D 5IVXE 4MSWA 3BIKA 3TCLA 3EDKA 5JPNA 3O8XB 3LHPL 1S7WA 5FUZH 3UTZA 2EZ0D 5DO2D 3MFFB 3B2VL 4X7SH 5E2WH 5DFTA 2O5YL 4OCWH 1FL6A 2FJFB 1VSCA 4PGEB 5IB4A 3WBDA 2JJVA 4GW4B 4UV4H 3NCYS 3M8OH 2CPCA 3D0LB 2R0ZL 5E2VH 1QFHA 2NLJA 3M07A 3Q2CA 4F7CA 5L2KE 3H9HA 4NKIH 3MLUH 4YBLB 5FYJU 4N68A 5EUOA 3KPSA 1ZMYA 4LVNC 4TPRL 1WZ1H 5DQDL 3WLBA 3HB3C 1NAML 3IAQA 3ZTJH 3MMEA 3QHFH 4YXHH 1RIUH 3UBXI 5CD5C 1RK0A 2XNAA 5ITBH 3GSNB 2KQNA 1X5IA 1UACL 4I3GA 3UTTB 2ICWI 2FSEA 1X5LA 3X14B 2D9QB 4BFIA 5CEXB 1A7QH 2VLJA 1MEXH 5I17B 1CG9A 5CFHA 2BERA 4ODHL 4DGVL 1KJ3L 3O45B 3I75B 4NO0D 3VGFA 1G7MB 1QKZL 1ZHNA 3MA7B 5JOPD 1A3QA 4JVPA 4JY4A 1ZXQA 4OFKA 2V7NB 1G6RA 4D2NA 4FQHB 4Y2OA 1S9XA 4XNYL 5ESAB 1QP1A 1FH5H 4ODWA 4FQJH 4HV8A 2X5PA 4KY1L 2OXGA 4GRLA 2K7PA 5HGBA 3NABH 4XMKL 5GSVA 1HSAB 3TO4C 5T1MA 4OLWH 5IR1A 2HT2D 1I7ZA 4X9GA 5FYLE 1XCTA 1OGAE 5IGXL 5TE6L 2GSIB 1KELL 5D7KE 2C1OB 3AC0A 4LAJH 1SBBA 1LNUB 2OM5A 5FHBL 3N1GC 4XTRC 5IT2L 4LF3B 1HH6A 3UJJH 1F4AA 3DTXB 2A6KB 1BOGA 3CVHB 1BVLB 1SHMA 1G7JB 2W9EL 3CIQA 1A6UL 2P5WE 4PJ7F 1JRHL 4EXPX 1IKNA 1J10A 1HK6A 2ED9A 1KEGL 2GYSA 3TBYA 3MRBB 4DQOH 3MUGB 2AEQH 3FRUA 1KJ2H 1LO4L 4Y16D 2VITA 1JYXA 2ITCA 1OW0C 4N0CD 3TPKA 2VIRB 5GS0D 5D7LB 3I85A 2V7HA 4HJGA 5CSGA 1FYTD 1I7TB 3SKJL 3QAZB 3TJEH 4WFEE 4Q9RH 3KNBA 3FQRA 4Z18A 1WTGT 1VGEH 4QRTB 3VGBA 3KDMA 5HYJD 2FEDD 1CFQA 4WV1C 2KKQA 2G75B 2PXYD 1RHHA 4GOSA 1ZOXA 2V2WA 4HBCL 2JIXD 4H25A 3DARA 1MRFH 4A2LA 3ESVF 5E0QA 1CE6B 5D2LA 4NUJB 1HYRC 3QXTA 1FC1A 1RZ8A 1JMXA 3EKCA 3O6FD 3LZFH 3UTQB 3TFKC 4LEXL 4NKOB 3U83A 5B8CB 4PP1C 4EUPG 5EBLA 4I4WA 1E6OL 5D71H 5AUMA 1YJDH 3PWLA 3PNWB 5KSVA 5IFAH 3GMRB 1EAPB 3MFGB 1FL5A 4ZS7H 5GGVH 5DRZB 4OCSL 1WBYA 4UINH 1SEBA 2Y9RT 5GRUH 5DHVH 1P7KB 5HJ3A 1FCGA 4B53A 1FGNL 4LEOA 5F7MC 3SO3B 5KVGH 1DLHB 1YEFL 2AK4B 4HWZA 1YMHB 4YE4H 3C2AH 3IVKB 3VXPB 2KPNA 3TBVB 3BUYA 4NBXB 1FVEA 2RFXB 4Y4KB 1MELA 4KROC 4JPIA 1AH1A 5F9JB 4JLRB 3GMMB 2ADIB 3P11H 2VH5H 4LHJB 1YQVL 4JFFA 4KTEH 3FQWA 1RJLA 1NCDH 2Y7QA 1NDMA 1KPUA 4L9DA 5ACZA 3RNKA 5IM7B 4QHKJ 3MODL 1CXHA 1ND0B 2F5BH 4H5SB 4F7TA 5IOPB 5D1ZC 2LFGA 5EUOF 1F4YL 4G3YH 4U33A 3G5XB 1X3DA 1S78D 2EO9A 5FM5M 3SDCC 3MNZB 4H0HB 3NACL 1NGQH 3D69B 3WFDH 3OKDB 2FHFA 3C6SA 4JDTL 5IVZA 5MEPB 3NBNA 4P2OD 4UAOC 3GK8H 2VLLB 4YHOL 4L3CA 1MJ7L 3WKML 5HHXH 4GBXC 4L1HA 3K3QA 1EFXB 1ZGLA 1XF5B 3VXUB 2FR4B 3N1QC 3PGCA 4XVJL 1VGKA 1RI8A 4OM1L 1Q94B 5C0GB 3CCHB 3UYRH 4HS8H 3QIWA 3QUYC 4HZLA 5FA3B 3QQ9D 2C7UB 1H0DB 1I8IB 1IBGL 5I1LA 1PZ5A 4QHUA 4GJTB 4RNRA 3PDDA 3L5XL 5BV7H 5CWSB 5FKPA 2NTFB 2VDQL 5HHQA 1OB1A 4WI5A 1CFVH 1R24A 3P73B 1WWAX 2E8ZA 3DX9A 3ZE1F 1A1MB 4LSDA 3MNWB 4YJZL 1GGUA 2BXZA 4PJEB 1SYVA 5CMAA 4WW2B 1XCQB 4ETQB 5DA4A 4AG4H 5DEFB 4LGPB 5DJ0A 5D7IE 3MGOA 4BK4A 1RU9H 2RCSL 3IFLH 4MQ7A 1B9ZA 1EERB 4U6XB 1MFCH 5DEGB 2VDKL 5D2NE 4FP8H 5E6ZA 1NANI 5ICZA 4Z5RA 5IQ7L 5L0QB 3MV7A 4NCC1 4KV5E 1KB5A 3MO1A 4OZHB 5F7UA 4JZJC 2FB4L 4XC1H 4RIRB 2ADFH 2NY7H 3EIFA 3QNXB 4P2RD 1ES0A 3P4OA 4PB0H 2FGWH 1NH6A 4JM4L 3KYMA 1N3NB 1JVKA 4PFEA 2ZCHL 3MRLA 2R29H 1KCUL 5INDA 3P4NA 1I8LA 4MD5A 3RWHB 4KJWC 4LSRH 3N50A 3DVGA 3MCG1 1UB5B 1RY7B 2J88H 3W5NA 3BQUB 2IPKB 2PUQT 3WXVH 2VL4A 5DHYB 4ZUVA 1AXSA 4X0KA 1P1ZA 4PRPA 2AAVA 1MI5E 3L5IA 1Z6JT 3RDTA 3EDFA 2R0KH 3W11D 5C0ND 3CFJA 2FO4A 1I3GL 3OKNB 3ZDYE 1HHJA 1N8ZA 4E0RA 4KHTL 1AQDA 1I1RA 2XQYK 3C60A 4ZOCA 4R0LA 1SM3L 1C5BH 5GS1A 4YBHA 5EZJA 6FABL 3HZYA 3FAWA 4R8WH 4ZTOL 1F3JA 2OZ4H 1XR9A 5GRVL 4QLRA 5F7EL 3G6JB 2P24B 3AM8C 5CGYC 2EDWA 3MROB 4HUWB 4I2XE 4JQXA 3ZE0E 4EI5A 3U0TB 5EO1B 1CFSA 5AAMA 5EG6C 5F96H 3BZ4A 4CNIB 2ZOLB 5CP7B 5FHAH 1RMFL 1TTGA 1YC7A 1MHCB 3D39B 2ZSWB 3QIBC 5I1CH 5HHOA 4M7LH 5EOTB 1AHWC 2BVEA 4YBQC 3SGKC 2Y36H 5ID1B 3P9LB 4WUKL 2DIAA 3BESR 1G1CA 4WGVB 1OM3H 4PS4L 2D7NA 4U6VL 4PGJA 5I8CB 4OCYH 4K9EC 4G43B 3BZFA 4HPYL 1RAMA 2MPAH 4XWGH 1VADB 3PWNB 4MCYB 5C08B 3BKCH 1DANU 1JGVH 3SCMD 2BSRB 3SO5A 2OI9C 4D0DA 5M94B 4Y5YB 2VSDA 4NRYB 4TOYL 1CL7I 5IB5A 2IH3B 2NXYD 5B38B 5AYUH 3A67H 3RWEA 1FPTL 2R1XA 4YGVB 1XF3B 3CZFA 2B4CH 3FN0L 4B7IA 1UC6A 3VFPB 1TENA 1G9EA 3OKYA 5D7JB 4I5BB 3TIDB 2XWJB 4NJAH 1I1FA 2VLKD 1IGFL 3EYOB 1YA5A 2HFFA 4OLVH 4YHLL 1YEJL 3QCUL 2FIKB 3NZ8B 4KRPB 2DYPD 1GHFH 5T3ZD 1XIWA 2GT9A 4I77H 4GXVL 2NY0D 4QO1A 4JQIL 1LO5B 5HD8D 1WGOA 2D7PA 4C58B 3IDNB 1PG7X 1F6FB 1ONQA 5I18L 4HWUA 4LCUB 1ZHKB 1QBLH 1U8LA 5I16B 3ARQA 2X2YA 4JM2C 1UM6L 3MV9E 5HGAB 4E41A 3EFDL 2OP4H 5D70H 4PIRF 5DQJB 2VR5A 3VXNB 3RZCB 1E6JL 2YPLE 3QIUD 5C0CB 3CMGA 4TVPL 3NPSC 1W2KT 4JPKH 5E1AA 2QR0A 3H8NA 2DBJA 1IAIL 4NNXB 3PL6D 5GRVK 4PRBB 2I9TB 4X8JB 2FCBA 4RGMC 4OI9A 4S1QH 3IFNH 5E00A 1FIGL 3T8XA 3DECA 1M7DB 3PWPD 1H5BA 3X12A 5GHWH 4APQC 5JORB 4G9FB 1VPOH 3P0VH 2HFEB 4C4KO 5J56B 2Z31B 1K85A 2HTLC 4K7PH 4JDZB 3BISA 1ZVSB 4Y4FA 2GSGA 1GOHA 3SE9L 1CI5A 4TN9A 3K1DA 1MCKA 1J5OL 5C0EA 1U8HB 2NY1C 5HBBA 1Y18A 4Q6YA 4QCIB 5TFSL 5C0DA 3CUPA 5I74B 4P48A 4WCYL 2QADD 1KCRH 2J12B 1ZT7B 2VXSL 4WVRA 1V5JA 5IG7B 2QQNL 1OSZA 2FYYA 3BP5B 5FECA 2A74A 3EO9H 5T1DL 4NQCA 5J3HC 4X6CA 2IQ9L 2E6JA 4FG6D 4WTXA 3I3EA 1XGPA 3DMMB 1I8KB 5IV2B 4QRSB 2IBZX 3BJ91 3Q1SH 4S1RH 5A2JH 3F65A 1F4WL 4JFXB 2NX5E 4NNYB 4OZGA 2QHRL 2EH8L 5EIIA 4M6NH 4NFCA 35C8H 4U6HA 1LP9A 3LKQB 2AJYH 1WBXB 1H3VA 4S0TD 1TMCB 4PP2B 1J0JA 5LQBH 4RQQA 4ZFGH 5EU6D 4EN3B 3RX5A 3RVTD 2GTZA 4HIIA 1I9EA 4NZTL 3T1WA 3DV4A 3ZKMD 1HOCB 1MUJA 4IRJA 2VAJA 1CDHA 1P84J 1BWWA 3PE9A 4JFEB 3VFRA 1R3IL 5BRZA 4YAQA 1TVHB 2FHBA 3IGAB 3CLFL 4ODXA 1KC5L 4ZQKB 3TYGL 5EOQL 4PRHA 1PVHA 1JTOA 5D6DC 5FUOH 5CIPB 2GQHA 4HGWB 1TTUA 3H3BC 4YDLB 4G5ZH 2HN7B 4LLVB 2AK1L 4FQ2L 1HHIA 2AJVL 3RWDB 4HJ0C 5CJOL 3NFPB 5EDXA 4Z7OE 1G6VK 4HXAL 3F5WA 5KSBE 2I9LB 4D9RD 4G8EB 4NQED 3FFCE 1YY8A 3HE6D 4BKLB 3UTSE 3IF1A 3SDXE 2VE6A 3BE1L 4LSUH 5I66B 1JMZA 2DKUA 5EC2A 3GBLA 4NO2A 1KCVH 2WP3T 4PLKD 3E2HC 2DWDB 3QUMB 5EIQA 2PYEE 5FCUL 5LG1A 15C8H 2R1WA 4I18A 1EEZB 4YPJA 2WWKO 4Y88A 3R06A 4PLOB 5DZNA 3IDMB 1ACZA 1P9MC 1FE8L 5TDNB 4P4RA 1XF1A 3PQYD 4QHLB 3NMEA 1HIML 3MR9B 4X6BA 3V5DB 4WU7B 4WHDA 1RIVL 1MAJA 2Y06H 5CEZH 2OJEB 3PP3K 5FAAA 5I19H 4J2XA 3EYUL 1CDGA 1BHGA 1BECA 5GJTL 2I60L 4Z7VB 3OZ9H 3U9PH 1QA9B 2VB5A 4P5TA 3LOWA 3VFWB 3LQZB 2VDOH 1T2JA 4NQXA 4FNLH 3NCCB 1JK8B 4OIBA 3QA3A 1EK3A 1OY3B 3QO0B 3GMNB 5MERA 4F33A 4NO0B 5DMGD 1PFCA 3PGDA 1NCBL 1H8OA 2VDRH 2JB5L 3BO8B 5KVDL 4YHKL 5I8EA 4IRZL 5FYKE 3KPRA 4KQ3H 5T1KA 1MRCH 3B9AA 1KB5L 3I50L 2H26B 2NYYD 3DRTA 5IF0A 1W8NA 1C5DA 1MFAL 2E27H 3BGFC 2BNRD 2C4FU 3UPAA 4BM7A 4NC1C 1DUZB 1NGXA 3VGAB 1U91A 2AKRB 1B2WH 5ENWA 5C92A 1A6ZA 4TQEL 3HG1D 2IFGA 1XR8A 3C8KA 3OGCB 1MCBA 5DC4B 4DUXA 2AP2A 4JFQA 4J1UA 4W68A 3BW9A 3GB7A 2NR6D 4O2EA 4JHBA 2Q7NA 4MJ5A 3V4VH 5C2BH 4GRWE 1D5ZB 1MCOH 4GG6B 5DJZB 4LU5L 3QDGE 1OCWL 1D6VH 1JPGB 2PNDA 3BAEH 4PRNA 2EIEA 1K5NA 3BIBX 3I6GA 5HY9A 2CGRH 1I1AC 1BBJB 4IIQC 4XP1L 4OM0L 3EOTL 4Y16B 1IEAB 4RMRA 5IW6A 5JQHC 3G6JF 3L5WB 3DO3A 3BSZH 1TQBB 3GNMH 2X89A 3HI5L 1H8SA 3FZUD 5I1JH 1EV2E 1T22B 2VAAA 4M9PA 1IQDB 3WL9A 4ODUB 2X4NA 4LP5A 1FYTB 5DGRA 4OZIE 2DM2A 1DQQB 5FYLH 4HC1H 4X6CF 1RZFH 3QCVH 1LDPH 1RUML 2FIRT 4AMKH 3MGTB 4Y5VC 5C6PB 8FABB 5HYJB 3GMQA 3LEXB 5FUCC 4HX1B 3TP4A 1GSMA 2V6HA 2V5MA 1CL7H 3MUY1 4OZGF 2JIXB 4ZDHB 1T5WB 4Z7NF 1MSPA 5BZWB 5F9DC 4L4TD 5M7QA 4F8TA 5I2IB 3FTGA 5MP6H 3ZT7A 1KSRA 1SYSA 4GS7B 2QQKL 3MRFA 3BPNB 4FFYH 4KDTA 3EO0A 3O6FB 3I02B 3H9SD 4LCCB 5IBUB 3MZTA 4O00A 4AT6A 4GRLC 3H7BA 2APTA 3TBWA 1CLOH 1IGJA 4LSSL 4KHXL 2BSTA 4MMXC 1A2YB 4ALAH 3O3DB 4HUNB 4X4ME 4F7EA 4PJAA 3ZSSA 1TETH 1BMGA 2GUOB 1AFVL 2SEBB 1QR4A 4X9BA 3LN4A 3OJDA 4QT5B 4PJCA 2QQLL 1M05A 1MF2H 3BDBA 1UWEH 3S5LA 5F3BA 3AS0A 4FQXB 1CZ8L 3KJ6H 5ESQA 3WDIA 1KG0A 5JR1L 1NBVH 3U0PB 4WY7L 3R8QA 5K9QG 1N2RB 4NM8L 2DBLH 2D4FA 5JW3L 1BX2A 2H6PB 3CXDH 1OL0A 4LRIA 2A6DA 2X4OA 3B2UC 3TM6A 3T04D 3V6OA 5KAQF 2ARJQ 2W0LA 1PGRB 2HT3C 2IC2A 3FMGH 5BMFL 2D7TH 2HVJB 4M5ZL 4HIXL 2Z92B 3WSQH 2EDDA 4M3KB 4M6OH 2OL3A 5DXWA 3IU4H 2D03L 3TWCL 2HWZL 5F1IA 5IFJA 4DUWA 1E4WL 2PETA 3DI3B 4PYGA 2FH8A 4QTIL 1YY9C 3U7WL 4UDTA 1YMMD 2FECL 3TNNB 3X13A 4M7ZB 3IDUA 5JXAH 3F6IA 3FO0H 4P3DB 1EUUA 4A6YB 3RHWK 1DQLH 4Z7WA 3U30B 2BMKB 4K8RH 1I4FB 1AKJA 1P4IL 3KPQB 4V1DE 3VXQB 1A9BA 3E0GA 5EC1A 1G9MH 1TVBA 5C0BD 5EOCH 5EBWA 5CLTA 4LLMA 4UQ3B 4FFVD 3C9NA 2AJUH 5SWZA 4LLQA 3IDXL 3MCKB 3RGVD 1V3MA 1UWGH 4P2OB 2PKDA 5T3XL 3KPOB 3N0PB 1FN4B 3S96A 3C5SA 2A77L 4Z76B 1WFTA 4LPUA 4MHHI 1CIDA 3WLWC 2UWEE 4HJJL 4P2CG 5J9PA 4M8QA 4Q2ZB 5GGTH 4XPFL 2CKBL 5A1AA 3K80A 5J11B 5INCB 2JF1A 3WFBL 1P6FA 2VXQL 1KPVB 2XKUA 2F15A 3VI4F 1GGCH 3RWFA 4BQ9A 3CMOL 3N9GL 3R0NA 3FQTA 4HS3A 1R3JA 4PGDB 5I8KL 4R4NC 1ZWIB 4MAYA 5DDHB 4D0CB 5C0IB 4JVUA 1Q0XH 4GO6B 2EECA 5F7DB 1RD6A 5AG8A 4KJPC 3WIHA 4BZ2H 3UZEA 1VKXB 2YSSB 1T4KB 3HMXA 5TDPB 3QISA 5C1MB 2YA1A 5E9DE 4GQ9L 4R2GC 5IP4A 2G60H 5DD0H 3UC0L 1W72B 1U93B 1F90L 5TF0A 3EOAA 5EA0H 3BP6A 1MH5B 2YRPA 3MJGX 3PABB 1KPRA 3HNVH 4JO3L 4P2RB 1R3HA 5ANME 1BLNB 1C1EH 4MZ2A 3DOSA 43CAB 1S7UA 3LPWA 3QJHA 4HK0A 4M7JL 1YNTA 5L2KD 1RJYA 2B0SH 3EGSB 1DBBL 4M1DH 1GCFA 1J88A 2Y6SC 2AI0L 3QG6A 1T21A 1KCSH 3ARDA 1JPTH 1U3ZA 4U1NB 5I1AA 1S5IL 4EJ1C 5J1AA 4IOFC 2EEDA 1U9KA 4PRDB 4R7DB 2C3VB 1M6OA 3NH7H 2PO6B 2YUZA 3OF6A 1FG2A 5E03A 4MA7L 2FH6A 4GMSL 1LK2A 1FQ9C 3KYKL 1L7TL 1RHFA 1ULVA 1HXMA 3OJVC 1GGBL 4NP4H 4PD4J 4CADB 3LVEA 3VJ6A 1KENL 3LEYL 5E6YA 1D9KC 5J0BA 4ZNEA 3SJVE 1L7IH 1QSFE 3LS5H 3QAZC 5HVFB 5JW4R 3FOLA 3HE7A 3EO1B 2R2EB 4N8VB 2V9QA 1D3CA 2CRYA 3JWDC 3PUCA 4C56D 1JL8A 2AQ2A 4GKSB 4TUOB 4P2QD 2BJMH 2DQJH 2P5EB 3FB7A 4GKZA 3NVQA 2DQTL 2KZWA 1DSFH 4EIZC 5IHBA 1FFPB 1BFSA 4JPVH 2Q76A 2KDGA 3QCTH 2N56A 2DTMH 4U1SA 1NCTA 5DWUL 4MJ6B 2W65A 4PJCF 5F6HI 4KJYB 5BOZG 2R69H 1DL7H 5B22A 4X5XB 4XBPA 3CC5A 1UXWA 3LQAC 5BS0D 1Q38A 3BN9C 5I1HH 2BOBB 1S9VA 3IJYA 4PJGB 4UIMB 3KPPB 4PJIA 4ZUWA 1TCRA 5DS8A 1N6QL 4G6AD 2OJZH 4OZ4A 2APXA 2IBZY 1EVUA 4FFWC 1D6EA 2KZ1B 5H2BB 3EHBC 3P0YH 4NT6B 2MKLC 1ZLSL 5C0RH 5KSAA 3QEUA 3FO1A 3HHRB 5F8QC 4P9MH 1HILA 5F71A 4OJFH 1JNHA 2A6JB 3FQNA 4LLDA 1I8LC 5FUCE 4IRSB 2NXYB 3TZVA 5C9JB 1AGDB 1EHAA 1KJVB 4GG8A 2VLJE 5L8LB 4LNVA 2R2HA 1T1ZB 1PLGL 2L4OA 2MKWA 5FDWB 3HZVB 3BXNB 5IEKA 1S7RA 1ORQB 3ALXA 1HSBA 4ZO9A 5CSZB 43C9A 3VW3H 4Z7WF 3KGRA 3RBGA 1CDIA 2WUCL 1OAYL 5FXCH 1EO8L 5E7FA 4LBEA 1KJMB 4R4FH 1FFQA 5ERWB 3NIGF 1J1OL 1PX3A 5DF0A 2DYPB 3HFML 3C60C 1Q0YL 2R1YB 4R0LC 3KXFD 5D4QA 3D85A 5DJCA 2NY0B 3JZ7A 3VDBA 3P4LA 1C16A 1NMCC 3ARGC 4QRPA 1JGLH 1IGIL 5GS1C 5J6GA 3BRDA 1Q9KB 1S9WA 1EX0A 1ZA6A 3TNMA 4GKNB 1H3GA 1PKQA 4HEPG 1WWWX 4P57A 4KTDH 1BIIA 1KTRL 3N1FC 1GJIA 4PJHA 4WTZA 4M4PA 3O3BA 1G7LA 3S7GA 4D0BA 3P2TA 5F21B 2DI8A 4JQXC 4EI5C 1PJ9A 5D5MB 4ELMB 5KJRH 3DXAA 4DVBA 2F53A 3KLSA 1BVKB 1Y0LA 5ALCH 1J05A 4Z0BL 4AZ8A 1DBAH 2DWEA 3QIUB 2MOVA 3DURA 2WUBH 1HH9B 1XT5A 4KGJA 3D3VA 1CFNB 3MA9H 1GAFH 1UA6L 2HJLB 1G7IA 2E9JA 3PL6B 1RZGB 3ZDZF 4NWTH 3JTTB 2G5BA 2YMXL 3QUZC 3PWPB 4CVZA 2ADGA 1VA9A 1DEEB 2V5YA 2WIIA 3P0GB 4JY6B 3O2VH 4U7SA 1FV1A 4PPTA 1OLZA 5I1GL 3MC0A 1SY6H 4KWUA 4YQXH 1WIOA 1QRND 4HIHA 2C4FT 3GSVB 5T33L 2EIZA 1KIPB 5F88B 2QADB 5D93B 2ICES 1YNKH 5FO9B 5C3TA 4WNQB 1KJ2A 2J4WH 1OD9A 3DHJA 1LK3L 1UG9A 4FA8A 3U82B 4MLIA 4F9PA 1G1YA 4L8BA 1OTSC 2AJZB 4GRMB 4Z0XB 4WDIA 1L0QA 1T1XA 1A1NA 2FEEL 2W91A 4RA0C 1X5HA 5D2LE 4DK6A 1BZ7B 3I3DA 2Y07L 5A3ID 2EYTA 3QFJA 3UCRA 5ID0A 4W70A 4QNPF 3V8OA 5L0QC 1RURL 1LWRA 4BSWA 1S7XB 4PRIB 2X4PA 3JWOH 2PCPB 3GMLB 5ALBH 4U1JA 5JOFA 4UDUB 2UY6A 5EU6B 1UEMA 5JDSA 1QFUL 4XBGB 1QLEH 4OLXL 4Y1AB 3B9VA 4EBQH 1NCUA 4OV6F 5EO9A 4ZFZB 3QWOA 1ZHLA 3L1OL 3G6DL 1BZQK 4OGZA 5I73C 5C0FA 4DKFL 4QXWA 4HXBL 5FGRA 2VMFA 4HKZA 1MWAB 5BQ7B 5L6YL 3QI9A 3JV4B 3NFSL 4MS8D 3FKUS 1QEWA 1P2CB 5CJXA 2V2XB 4JQVA 3L7FB 4PGEA 3CDFA 5L88H 1OP9A 1NCCL 4KK5C 4ZODA 4FABL 4JFFE 1D5IH 1V3LA 5DHVA 1OAXH 4YC2C 3BN3B 4TNVK 2CKNA 5C09A 1G9NH 1MRDH 3TVMA 4NQEB 5J1SC 1EH9A 3HE6B 1KLGB 3EYSH 4LCWD 2X40A 3QQ3B 4TVSa 5B39B 5F1OB 5A16A 3C5ZB 4GW5A 1INEH 4P59L 2E7HA 5F9OH 2UVEA 2OTPA 4XPTH 3S5LG 3ROLB 3BP4A 1N0XL 3UEZA 4X4XA 2YBRA 4IHOB 2W60B 3WO4C 3UBXB 3HAEB 1K8DB 1YEIL 3W9DB 1QD0A 1DQDL 4HF5L 5H35B 4OUOA 5CEXA 2FLBT 2N1KA 3HB3D 4O5LL 2DI7A 2ICWB 3ZSTA 5CUSH 2XZCL 4PY7B 4LHUD 3VFGH 3ZMRA 3OQ3B 1ZVYA 3FRPA 4FFZL 1BGXH 3AB0C 1X5FA 2V7NA 4LVOB 5I1DB 1E4KA 5EORL 1A4JB 1AXIB 4ZFOB 2EDKA 2XXMB 5DUPL 1RULL 3V0VA 4ESKA 1HXYA 4PJFF 4WEBL 1VFUA 4Y5YC 2B39A 4PTTB 1D5XB 4GW1B 1MI5D 2VQTA 3NFNB 1T0NA 4YZFF 5DK2B 3QHZL 3VRJA 1OAKL 4O4YL 5FGCB 3LRSB 3B2VH 3E6HA 3VXRB 3MXVL 2O5YH 1CE1L 1K4CB 1S7VA 1RUPL 3DTXA 2IALB 1E4XL 2BNRB 5IBLC 4R3SA 4GAJL 2R0ZH 3TO4D 5ELIA 3HUJB 3TCXA 3WDJA 1G7JA 3IJSA 1UEYA 5IEHB 4OAWB 4K07A 3HI1A 1IAOB 2ID5A 1QRKA 4X6DF 3RWGB 3FN9A 5E4IA 3MV7E 1B0RA 3MUGA 4XTRD 4J4PA 4TPRH 3RWJB 5JNYA 5DQDH 1JGEA 4Z95H 3LN5A 1NAMH 3QXAB 5HHPB 1MCIA 2ZKHL 1U8MB 1KGCD 4HGMA 5GGRB 3RFZC 4UT7L 3VE0B 2H3NA 3OR6B 1FAKT 5F44A 4KVCL 4PJ5D 3U4EB 1UACH 5HHME 3LKPA 5J8OA 2EXWC 4CN1A 2JCCE 1U8OB 2DS4A 2MWCA 3RY6A 5C07D 5IBTL 3T0VA 2V17L 2ZJSL 4MQTB 2VLME 4ODHH 4DGVH 1KJ3H 3MBEC 4GUPA 1QKZH 3LV3B 1BJ8A 5DA0B 4NUJA 1LEKA 4BFGA 1O7VA 4NWUL 1N5AA 3GBML 1I85A 2ADJB 4P5TC 3SDAA 4TNWF 4KY1H 3UTQA 5ETUA 5FYJL 5FB8A 2X4TA 4XMKH 4PJGF 3VRLE 2XY1A 2KH2B 5I74C 3FT3B 4L4TB 5IGXH 2X4UA 4Q0XL 5TE6H 5IJKA 3AS2A 1KELH 1U3HA 3VGGA 2CD0A 5FHBH 5F70A 1YNLL 5IT2H 5LAXB 5E08L 2XWBA 4KI1A 4JEGB 2XKNA 2JLLA 2P8LA 3HR6A 3TFKD 1EGJA 1FC2D 3H9SB 5HHOE 5C0JA 4MB4A 4PP1D 2AGJL 2HLFD 2W9EH 2VWEE 1CT8A 2OZ4A 5GJSL 4NQDA 4MWFB 1JRHH 4FXKB 3VXPA 3TBVA 4XVSL 4LNRA 4Y4KA 2ZG3A 3QWRA 5J6HB 1KEGH 3KWWB 5F9JA 1LO4H 3HZKA 3QB7C 2GCYB 1S7QB 1IM9A 4XH2A 5IMKB 4QXUL 4KKLC 5CSBA 2VN4A 1FSKC 5EN2A 3SKJH 1KN4L 4JDVA 2ZUQB 5IM7A 3WFHA 3DLQR 4KROD 1ND0A 1T6VN 2H32B 3T0WA 2Z8RA 4NFDA 5IOPA 4JO2L 5E8EA 2F8VA 2YUVA 5FM4A 1KIQA 3T1FA 3G5XA 4BH7A 5FK9A 1OQXA 2VABA 4OGYL 1A7RL 3ROOA 5HHNB 3ULUE 3IRPX 3IYLW 1FO0B 4X8XA 4HBCH 3ZTNL 5JLZB 32C2A 3OKDA 4ZFFB 2NZIA 1WWBX 5DTFB 1KIRB 5D1ZD 2YWZA 4YDJA 1YMMB 2EZ0C 3GHEL 5CBEB 5IK3A 2WBWB 3Q3GB 4UILL 1BREA 1IAII 1K3IA 1WTLA 4U3CA 1XF5A 2XZQL 3VXUA 5DD6A 2E7BA 4NN6B 3SDCD 2CH8A 3GZKA 1E6OH 5C0GA 3UDWA 1NBZB 3LB6C 2FZ3B 3B5GA 5FA3A 4UOW0 3RUGA 4V2CB 2AXGB 2VN7A 1I8IA 4MJ2A 3RGVB 4OCSH 4OSUL 3L3KB 2RB8A 2F54D 2GJ6A 4E41E 5MENA 2HAZA 4GBXD 4WWID 2YC1A 4OLUH 1I3VA 1ED3A 2YPKA 1I7UA 3ZTJG 4PJEA 4D9QD 5HYIA 4WW2A 1UH4A 3QUYD 5E4EB 3KS0H 2EE9A 3FONB 2XKSA 1TNNA 2OTUA 3IDIB 4ZSOA 4N5UA 1IAIM 3KR3L 1T7ZA 2CXKA 4LHQB 5DEGA 3TBTB 1YQVH 2LE9A 3LMJL 1R3KA 3X3FL 2WW8A 4OZHA 5J12C 1WBZA 1DFBL 1CD9B 4AM0B 4I8DA 1Z5LA 2AV7B 4LRIC 5DURD 4CU6A 1F4YH 5IVXB 1NMAL 3V6OC 4JGUA 3MRDB 4NQCE 5I0DA 2HJKA 4X7TB 3RWHA 1Q9OB 2BFVL 3ZYIA 3IXAB 4KZDL 1P6AB 3ARPA 3NACH 4OI8A 3FFCD 3VGAC 5FA4A 3UTSD 4JDTH 3V95A 1LP9E 2PW2B 4WFFD 3W9EB 1CGTA 5H8DA 4FQ1L 4YHOH 4NHUA 3O6KL 5JZ7C 4PJXA 1MJ7H 5L2KB 2X9XA 3WKMH 3OV6A 2ITDB 2XFXA 3BEVB 4KJWD 4XVJH 2PYED 3NCJL 1EEUA 2G2RA 4JKMA 2E7LC 2DLEA 4CMHB 1MY5A 3WEXB 2YOCA 1IBGH 5F6IB 1YEKL 3KAAA 1G7HA 2OMBA 3L5XH 4PRAB 3QQ4B 5BRZE 5I6XC 5F97E 4XCYA 2VDQH 1JF6A 2X4RB 3AXLA 1MCWM 4J23A 4L3EA 1FGVL 1A6AB 4MXVE 4N5EC 1A7NL 2QKIA 4ETYA 3U0TA 5HVHB 1C5CL 4I9WE 5KSUB 2ZOLA 2WZPD 1MHCA 3IXTA 5ECJE 1MCNA 5I76B 1WVZA 3GI8L 2RCSH 2BSSA 4NC0B 4PJBF 5CGYD 4C56B 5ID1A 1F6AB 5FF6B 5IKCA 3GSNL 2VDKH 4D3CL 4P2QB 5FYKD 3ZKNC 5IQ7H 5I8CA 2HG5B 3DGGB 4MAYC 3PHQA 5IMLA 2CIIB 1HNGA 2A2QT 2EDHA 3BIAX 2FB4H 3PJSB 4CVXA 4YFDB 3I2CL 3QIBD 3T0EE 1VADA 3PWNA 1IL1B 4MCYA 4U1GC 1RZIA 3VFMB 2VLRD 4DTGL 1JTTA 1UENA 1NL0L 2YEZB 1YQ2A 1HHGB 4YBQD 2BSRA 4JM4H 2IEPA 2GJZB 4GS7C 3VGHA 1OAUL 2ZCHH 1KCUH 5BO1L 3FQXA 3P4MB 2GAZB 5BS0B 8CGTA 1NGWA 1KFAL 1NC4D 3CFBA 3HN3A 4LCCC 1FZMB 2DL2A 2I25N 4DAGL 4ZS6C 3OKLA 4ZNCD 1JV5B 4X7EC 3UP1A 3VFUB 1U8QB 2ZOKB 5HI4C 3VFPA 3LY6A 4Y4HC 4I5BA 1NUFA 1QOKA 3QBTB 4DZBB 3CX5J 4AEHH 2YXFA 5GGVY 1DQJB 5CKAA 2P5WB 1FJ1B 1I3GH 5GZNC 4KHTH 1MHPL 3HUJF 3OKEA 4OD3L 5DJAA 2HA1A 3B5HA 5D1QC 5EU4A 4FQXC 4XPHL 1SM3H 3OTTA 5KVFL 3DX6A 6FABH 2NY2C 1QG3A 3CVHL 4ZTOH 1LO5A 3O3EA 3GFUA 4YX2L 2UV3A 5F7EH 3PGFL 1OGTB 3U46A 1G0YR 1C7SA 4EQ2A 3KPRE 2X4QB 4PREA 1ZHKA 5D1XA 4WFGD 4JRXA 5IJVB 5JW5B 5E5MA 1MHEA 3MRRA 5KOVC 4RFOL 5DRWA 3ARFA 3RUGF 1RMFH 5DD3L 3RZCA 4DEPC 4LVHB 1SJXA 4PJ8A 3NIFE 3DIFB 2ERJB 3HE7C 3EW3B 1N0LA 1IARB 1DLFL 4JAMB 3QYCA 2HP4A 4NNXA 1SMOA 4HK3N 3FRPG 4WUKH 1VACA 4HEME 1X6NA 5E70A 4XMPL 5H37G 3INUL 1VCAA 4JM2D 1F02I 3U30C 4PS4H 4U6VH 1NC2D 4NQUA 4HPYH 4QRQA 1EEYB 3HNSL 5J4MA 3U9UB 5K9QI 1SVZA 4JDZA 3HI6L 1GGTA 3MRIB 1X6LA 3DGCR 4YHPB 3QEHB 3KPNB 4QEGA 1T04A 4G6KL 3VRIB 4TOYH 3PWJA 4KTYA 1ZT7A 4APQD 4BSVA 5KS9A 1FPTH 3BP5A 2D4DA 4L8DB 2FX9L 3FN0H 4ZUUA 2HTLD 4M1CC 2XYCA 2R23B 3BPCA 3ARWA 2NY1D 2P7TA 5HYFA 2VZOA 1IGFH 3RL2B 4S1SL 1RK1B 5J13B 2ORBL 1YEJH 2DB8A 3QCUH 4RZCB 5EBMB 1WBXA 2PF6A 4JFDD 4GXVH 2ESVA 5FOBB 2VQUA 1EGJL 4NQSB 3CVIL 5J3HD 1JN6B 4JQIH 2DLGA 1AXTH 1SQ2N 5DJ8B 1N6UA 2FLRT 1ZT4B 3UAJC 5I18H 1HOCA 2F5AL 4QTHA 4TTGA 1XF2A 1CF8L 2BOCB 3BRGC 1BQHA 1YUHB 4IDJL 1UM6H 3WHXB 3EFDH 4WI3A 2QSTA 1TVHA 4IMKC 1FZOB 2CO6B 4CW1B 1D7FA 4X6FA 4HZAA 3T3MF 4D94A 1E6JH 5IMMB 4TVPH 5K59E 1DN0B 4K71B 1A02N 3S4SB 4LLUB 1KLFA 4N9GA 1IAIH 1F5WA 3DRQB 2R0LL 3U0WL 1CDJA 4PJAE 2R2BA 1U42A 3VXSE 1FIGH 1QBML 3OAYH 4DVRL 2HN7A 4RFEA 4WI6A 1QHPA 5I8OL 4WU5B 4L9LA 4LPYA 3DBXB 3EDJA 4R97B 2FL5B 3SE9H 1I8MA 4NSKA 2PO6C 2X1PA 4JFPA 3MLWL 1J5OH 4QOKA 4JKPL 1I9RL 1K9TA 3NAAL 4WCYH 5LCVL 4HUVB 1IAMA 1CBVL 3PHOB 3V6OE 2VXSH 4OB5L 5DVMA 3H6JA 2QQNH 2OX5A 1NGPL 1AGBB 4J3OC 3RAJH 4HJ0D 3AMKA 2DWDA 4NCDA 1VEMA 4HUUB 5E6IC 2IQ9H 5T1DH 5I1EL 5C7XL 1NGYA 3BDYL 4DN3H 1BZ9A 3TC9A 2DN7A 2VDPL 2X6MA 4LCWB 3X11A 4K7FB 3D1MC 1F4WH 3TIEA 5D7IB 3IJHB 4KK9C 4P9HC 3V6ZA 4ORZC 5ADPL 2QHRH 2EH8H 4QHLA 1EZVX 2DF3A 4I0KA 4CJ0A 2HRPL 3QUXC 2ICEA 4L8CB 4ZPVB 1HI6A 4WFHE 4PTUB 4MDJB 4W4OC 5CP3H 5D2NB 3VGDA 3MLSL 4Z7VA 1UB6B 2O61A 1G7PA 5CBAB 4XAKE 1YPZF 3PWUB 3JWNC 4ODSL 4ONHB 3K8LA 5SWZE 4WI7A 2Q20A 3KPLB 4N90E 1M7IB 3WNOA 5F8RC 1KT2B 3QO0A 3GMNA 4LHUB 3TO2B 1IKFL 4QRUA 1R3IH 3VU2A 4DK3A 2C9AA 4XMLL 2EDYA 4NZRL 4XCEA 1LHZA 3CLFH 3BPLB 1A6TB 4ZAKA 1KC5H 2EDFA 3ULVL 3TYGH 5EOQH 5IVXF 4IS6B 4AENA 1CK0L 3HC0B 2EDBA 1LGVA 4R96A 3GMPB 1MI5B 4YIQB 2W9DL 3HRZA 4IRSC 2AK1H 4FQ2H 3BT2L 1I3RA 2AJVH 5FOJA 2Q8AL 5CJOH