4YC2C

Crystal structure of the stabilized inner domain of clade a/e hiv-1 gp120 from e. coli in complex with the antibody a32.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
210
structure length
210
Chain Sequence
VLTQPPSASGSPGQSVTISCTGTSSDVGGYNYVSWYQHHPGKAPKLIISEVNNRPSGVPDRFSGSKSGNTASLTVSGLQAEDEAEYYCSSYTDIHNFVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords The stabilized inner domain of clade A/E HIV-1 gp120 from E.
publication title Paring Down HIV Env: Design and Crystal Structure of a Stabilized Inner Domain of HIV-1 gp120 Displaying a Major ADCC Target of the A32 Region.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 40
structure length 210
sequence length 210
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yc2C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yc2C02
3L3KB 4ELME 3BUYA 3PQYE 4JAMA 5DMGC 1C16B 5DUMH 4Y4HC 1KFAH 1P84K 2EDYA 4H25B 2OS7A 5SWZB 3MMEB 2CRIA 1DVFB 3QUXC 4JGMA 2KZWA 2NY3C 2I25N 4BFIB 3ZE2F 4O2EB 4Z5RB 1NFKA 1J8HA 4IRJB 3FB5B 5A2LH 2F5AL 5D7KD 1MFBL 3D85D 4U0RB 5GISL 1HYSD 5C71A 1AD9B 1Y0LA 5GS1A 4YDIL 3C6LD 5DRWA 3LKRA 3V4UH 1F3RB 1HSBA 3L3GB 1WSST 3OR7B 4N0UA 5C3TA 2MNUA 3MV8E 5SX5H 3TBTA 3IAPA 5D72L 3WLBA 2JCCE 2Y06L 3S88L 1KCRH 3BT2H 5IESH 1MCPH 4OI9A 4QRTA 1MHPL 1A3RH 5KOVC 1J0HA 2DTSA 3ARYA 4AT6A 1GL4B 2VO5A 3FQXA 5F7WC 3SDYH 5D7IB 4LVOB 2H2SD 1AY1L 3P4MB 3RUGE 2F8XC 2F53E 1D3CA 4YO0A 1TTGA 4K3EL 3RVXC 5J8OA 2JK5B 2ADIB 3O9WA 5HGGS 3GB7B 4CGTA 2VISA 4F7EB 5DI8B 1HHHB 3KPNA 4P5KA 3RWIB 3GUTA 4JN1L 4CVUA 2F74B 3DMMB 2R29H 4HPYL 2MWCA 5C0BA 1JZ4A 3ZSSA 4HUKB 3C60A 3DX7A 4G6FB 4OAWB 5LAXA 3A6OA 2ZJSH 4EN3B 1B0GB 4KK8C 4YDVB 1U2CA 5DMIH 4WY7L 1ZWIB 2FX9L 3ARGA 2WBJD 2G2RB 5F88A 2BVOB 3KR3L 2W0KA 3EYFB 1MPAH 3WKMH 5IGXL 5DMGD 1JNNH 3AREB 3ARRA 4P3CH 2W0FB 3KYOB 2XI9A 1YQVH 2VWEC 3BP7A 3N85L 4NP4H 5DJCB 4F7MA 1J8HE 3QUXD 4ACPA 1CQKA 1JHLL 2NY3D 1T3FB 5KVEL 1QFUH 5A2IH 3MREA 1BIHA 1CR9H 3QHFH 1CTOA 2BHZA 4N0UE 2IJ0C 2NZ9D 4ZOCA 4QCIA 2DWEB 4NC1C 1F13A 2FO4B 3CVHB 3QDGB 1QEWB 4LVHB 3WEXB 4IM8A 3BVNB 1G7IB 4V1DE 1ADQH 1IAKA 1YEGL 3ZTNH 5FYKH 5C0DA 5FUZH 3RNKA 3KYNA 1JPSL 5E2WL 1DBML 2VR9A 4DZBA 2VDKL 2F5BL 5B39G 3QYCA 3VFOA 1WJ3A 5D2LB 2CR6A 5EU6D 1FNAA 4Z7OE 3MRQA 4D9RD 1U3HB 4EXKA 3K80A 4FQPA 4RGOH 3VFTA 4NRZB 4QRPD 1UKSA 4WW2C 3C5ZA 3H3PL 5GGSB 2YA2A 1K8IB 1NEZB 5K9OB 4F37K 4RDQG 3TBYA 2QJDA 1YYLH 4UINH 3V6BR 2GUOA 1FL3A 5DEGB 3L5JA 4UT6H 1HCFX 3W5NA 3UC0L 5ALBH 4BM7A 1BQUA 1I9JL 2A1WH 5CIPB 4I8DA 4GRLB 1FAIH 3MACH 5I1JL 4U1SB 4AEEA 4KK8D 3SDXA 5ICZA 5EZIL 1DQLH 3W2DH 3PXJA 2XY1A 4FA8A 2UZIL 4AG4L 1DUYA 4I0CC 4ZPVB 3U0WH 2VDOL 2ICWB 5DA0B 3BMWA 2FJHA 3U2SB 3ESUF 4U1LB 1YZZA 4OB5L 5IV2A 2X4UA 1MJ8H 2HTKC 3KYKH 1CICD 3RTQA 5CEXB 4LCCA 2UY7A 1NFDF 3ECBA 2GT9A 1A47A 1LK2B 4UOJA 4BKLB 5CCKL 1T5WB 3QJHB 3DO7B 3QIBB 2WMPA 4NWTL 2P46B 3QCUL 3ARFB 4HUMB 4ZUVA 1W0YT 1XR9A 2Q8BL 4MCZB 3H2WA 1TJIH 1T1XB 2DICA 2EDDA 3EYQD 5DJYA 2BFVL 4G8GE 1HN1A 3PWLA 3HRZA 3C08L 2BNQB 1VERA 1P69B 3G6DL 1NEUA 3DLQR 4M4PA 1SY6A 4KMTH 3BPLB 2PTTA 2GJJA 1YUHB 3ETBF 1NLBH 2HN7B 5DVOA 4XMLL 7FABH 5DK2A 4X83A 4JDTH 1JPFA 3QUYB 4Y2DA 4Z7NF 2ADFH 2CK0L 5JPMA 3O8XC 1FNGB 4KTDH 4M7ZC 5DHXB 4FS0A 4HZLB 4PP2A 5C0RL 3M8OH 4QRSB 3GSXA 1WWCA 1JP5A 2ZG2A 4NKMA 4L9LA 3EO1B 2WINA 1ZK9A 4DKFH 5C70A 1SJVA 3VGEA 3DV6B 2VLJA 3X13A 5KG9A 1J87A 2P24A 5C86A 1RULH 3JTSA 4HUNB 4XPBH 2ED7A 3WN5B 4KI1A 5I30L 1Q0XL 3U9PL 2BC4A 1MHHB 4Y2OA 2EEBA 3FONA 3BGMA 2DS4A 3QUZD 1I75A 2HTKD 1NGPL 3X12A 3OKLB 3TVMD 2JB6A 5IFJA 5IB4B 1A64A 4R4BA 3DRQA 4CADB 3LEVL 4JM2F 3KDMA 1KCKA 3QNXA 4CMHC 5I19H 1GGBL 1I9EA 4OZIF 1BM3H 1HHIA 3DVIA 5DFTA 4F2MA 2BCKB 1I1FB 1PG7X 1LD9B 4OF5A 2EEDA 3RQ3A 1BIIA 2M1KA 4C83A 4NRYB 3BWUC 1MFDL 3A6BH 3G9AB 1Q0YL 3DROA 2EEAA 5IIEB 4J4PC 1TZHA 4L8BA 2EDKA 3T09A 1NMBL 1AXTL 2C7UB 4X6EB 5JOFB 2F19H 2QQLL 4XVTH 2CIKB 4P59L 4NN6B 5JA9A 2J6EH 2MMXA 4L4TD 3NIFF 4XXCC 2OXGA 3W9DB 3V9FA 3ZE0F 5DMKB 3T3PF 3QQ9C 3U0PB 1CFQA 2BNRB 3KPSA 2X4SA 5FGCE 1UZ6F 2IGFL 1FG2B 1H3GA 4HK3J 4X4YA 1UM5H 5F8RC 4PJ8A 4PJIE 3AM8A 3QAZB 3LKPB 3EDFA 4LAQH 2RFXA 4I5BA 3PL6A 2XG5A 2DB8A 1FO0A 4S1SH 2V2TA 4KJWD 3B3IA 1ZLSH 5IJVB 2Y1VA 4U05A 4NT6B 1OWWA 4GW4A 2OJEB 3R8QA 3A6CH 4PRAA 5LWYH 1AO7D 4JFOB 4P57A 3D18A 2WK2A 4UDTB 4OCSH 2K1MA 3BD5A 1UYWH 2Q7YA 4K94H 3GRWH 3QRFM 3GSRA 1OAZL 1KFAL 1F4XH 5IHZB 4ZFOL 5T1LD 1QRKA 2MQ3A 3QH3B 4HEME 4IDJL 3DSFH 5DVKA 5IW6B 1FVCB 5BS0B 4Z7VA 1JFQH 3SDCB 2F54E 8CGTA 1S7VB 2VLME 2A73B 3L7EB 2Z91A 5IK3B 4DZ8A 2IH1B 1UCBL 5C07D 3V4UL 5EPMB 1PBYA 5J6GA 2ZUQB 3EZJB 2H41A 3BT2L 4J4PD 5IESL 2IAMC 1M1SA 1A3RL 1I3VA 5IB5A 5JW3L 4GRMA 3SDYL 4HW6A 1IQWH 1I7UA 4XBEH 3BPOC 1U91A 1N4XH 1R3JA 3FRPA 3KPSE 3KVQA 3FQRA 4NO2A 3VGBA 1YN6B 3AFLA 1VFAA 2C5DC 3VW3H 3V6ZB 1P4IH 5C6PB 4XWOD 5H8DA 4K71B 2DQHH 5DFWH 3ZYOA 3EYSH 1S78C 5T3XD 5DDHA 1LE9B 3P73A 3T2PA 2ZJSL 5TDNB 2UZXB 4LP5A 3WJLC 4U3CA 3CSGA 2DMBA 5FM4A 2A83B 3FRPG 5E5MB 1XGUB 4DQOH 1OAQH 3P9WB 1EMTH 5DMIL 4V2BA 4ZSOA 2AABH 5MEOA 4BUGA 2QLVB 4DGIH 1TITA 2NY4B 1KPRA 5C0IA 4NQCD 2HKHH 1JZ5A 4JFEA 1MPAL 4KDWA 3WKML 2X42A 1JNNL 3FN9A 1T89C 4P3CL 5E9DE 4RQQA 1BFSA 2XKSA 2IFGA 1QKZH 3HMWH 1I1AC 1YQVL 3P9LB 4N1EA 4NP4L 1FLTX 1FL6B 2AJUH 1WZLA 4PRHE 1N8ZB 5EUOA 4OLWH 4ZTPH 5CWSB 2VLRB 4Q2ZA 3SGJC 1EFQA 2X7LB 2YD7A 3VGAC 1QFUL 4D0DB 1YNLH 3OXRA 4H20H 1II4E 2ZOKA 1O7VA 1CR9L 2EYRB 1PY4A 4OJFH 4PG2A 1K9TA 3LIZH 3D85A 1RY7B 3HNTH 1YPZE 3UYPA 5IMOB 2UYLA 4D9LH 1GHFL 1ADQL 5H35A 3VI3F 5JDJA 4JQVA 5FYKL 3ZTNL 1J0YA 2C4XA 2DQFA 2FYYA 5BRZD 1OP5K 1WGOA 5FUZL 2Q8AH 4W6WB 2X1QA 4NZUL 1LO5B 2WLZA 4OLVH 2W60B 3WBDA 1CXHA 1EGJA 3PUCA 4I4WB 3HFMH 1C12B 2RBLA 4YHOH 3P4LA 5CD5C 4KQ3H 4I0PD 1OAXL 4UINL 1YYLL 2R23A 4J3WA 1T6WA 4QOKB 2PYED 2XTJB 1MFEH 1HH6B 4UT6L 3BRGC 3R8BB 4DVBA 4XBGB 1RZ7H 5ALBL 3VJ6B 4UAOC 4NPYB 2A1WL 1FAIL 4L3EB 3MACL 1OL0A 2GFBA 4OGYH 3GMMA 4HX1B 3RIAF 1DQLL 3W2DL 2F15A 1NDGA 5E8OA 4JFEE 5GRXG 3G6AA 4EBQH 4OSUH 3U0WL 3OKEA 5ERWA 4IOIA 4RMUA 5I66B 5E6YA 3V7AE 2UY6A 2DIBA 3C09C 4HJGB 5EUOE 2QKIB 4RNRB 3ARDA 5BVJA 1MJ8L 4MJID 3KYKL 3RWEA 2XTLA 1FNLA 4XZUB 2YBRA 3LDBB 1EJ6A 4KU1A 4N0FA 2BVQA 2E9BA 4LGSB 5I1HH 2FATH 3FT4A 5D7KE 2DAVA 4X5WB 1JF5A 1TCRB 1WC7A 2YUWA 2ZNXA 1U41A 3RL1B 1WT5A 3W9EA 1GGCH 3CMGA 4MDJB 3L5IA 1TJIL 5HHQB 3NIDF 1S9WA 1ZT1A 3F5WB 8FABB 4UMGA 4GBXB 1D5XA 4O2FB 3TO2A 3MRCA 5GS0D 2EDNA 3CZFA 2RQ8A 1T7XA 4MB5A 2PTUA 4MQXC 4IRSB 4KMTL 2AI0H 1NANI 4ODUB 4ODXB 3CPLB 3TO4C 3U36B 4NHCL 1NLBL 5EU6A 3UEZA 4LLDA 7FABL 1OP5H 5CD5D 3C87A 4JDTL 5IG7A 1R3IH 4XNUH 4K8RD 4QRPA 2ADFL 4OF6A 1KLGA 4TVSa 4KTDL 4GRWB 5I2IA 3MLWH 3IRZA 5DUBB 1NC2D 2Z31A 3M8OL 1QFPA 3FO0H 2UUDK 3QCTH 3S4SB 2IBZX 5IHUH 3OAYK 2MSPA 3BX7C 1F42A 4UTAH 4KC3B 3GIVA 4DKFL 3BEWA 5AYQA 1DBJH 2GAZA 3V2AR 4FTVD 1IM9B 2HT2C 4LHQB 4NKOA 4R7NB 2BOBB 3FB6B 1RULL 4KDTA 4XPBL 4NYLA 5MEND 3AMLA 3S37X 3VMPA 4ESKA 3CH1B 4OCRH 1CDJA 5CHNB 1V7NH 5DK0B 1HSAA 3BH8B 2PCPB 2XWJA 4G43B 4UDUA 4NM4L 1OARH 3BXNB 2R4SH 3E2HB 1LP9F 4PR5B 3AB0C 3VD3A 2DM4A 1CICA 3HE7A 5HYQA 1QR4A 5DJ0B 4OBRA 1T83A 5I19L 4AEIH 1BM3L 1LDPH 4PGJA 5T1MA 2IQAA 5JXED 3GMRA 5D7LB 1IEBB 1HOCB 3BKYH 2LE9A 3WDIA 4QYOB 3TIDA 3QA3A 3U7AA 1W72H 3A6BL 3VXQB 1XMWA 4OZGF 4X6CB 1EBAA 2X89A 5I74B 4CNIB 1RZIB 4MQXD 1SHMA 2F19L 1XIWB 4JFYA 5EU6E 4XVTL 5B3JF 4D9RE 3QIUC 3RGVC 2NY7H 3TO4D 4Y19B 2J6EL 3IJHB 3QIWC 4FFYH 3T0XA 4QRPE 3O3EB 1OM3H 5C09B 1MSPA 4L1HA 3MLTB 1N59B 3JV0A 3K74B 1BVLA 4KRPD 4WV1C 2XZCH 1ZS8B 1UM5L 1KIPB 2FJFA 3GSUA 5BMFH 4QXTA 4M7JH 4CN1A 4KHXH 4LPXA 4S1SL 4R97B 1ZLSL 2Y4SA 1RJZA 4L3AA 4P9MH 1REIA 3OXSB 3VXUB 5KAQF 4TYUA 1TENA 4WU5B 2G75A 2VZOA 1QD0A 2YEZA 4YR6B 3A6CL 4F15B 1N0LA 4DCQB 5LWYL 2UUDH 2VDMH 1JNHA 3N06B 3PHOB 2E7MA 1BPVA 3OAYH 4XMKH 2EC8A 4POUB 5DHYA 1UYWL 2VWEE 1CFTB 4FXKA 3TFKC 4K94L 3GRWL 1V3JA 5CP3H 3QUZA 1F4XL 1CD9B 1MVUB 1KN4L 2OZ4A 1JGVH 3DSFL 4RMQA 1UM6L 3TVMA 3SDDB 1Q9LA 4XRCA 3N1GC 1JFQL 4HIEB 3B9KC 4LCIH 4OI8A 3TA3A 1WIPA 3PP4H 1DR9A 5GSRB 5B8CA 2EYSA 2MQCA 1NFDB 3P0VL 3MROA 4XNQB 1GYAA 1G6RB 5L2JA 3HMXA 3EJZD 4FHBD 4G42A 4P99A 1EXUB 2FH8A 1IQWL 4QY8B 4XBEL 5SWSD 1T0NA 2FSEA 3QIWD 4XCYB 2ADJB 1N4XL 4LLMA 2UWEF 1ZE3C 1FSKC 3MV7D 1G0XA 4XHQA 3V6FB 4OD1H 2FD6H 4L4TA 3PGCB 3RKDC 3VW3L 2ZSWA 4EI6A 5GIRA 1P4IL 5F1KC 4K23H 2L4OA 4RZCB 1ED3B 4ZXBB 2DQHL 2BZDA 3EYSL 1AQDA 4LLQB 4ELMB 3U9UA 3U48A 1FFOB 4W4OC 3PQYB 5TH2A 5IFAH 3LN9A 3IDIA 4FG6C 5DUPH 4DQOL 1OAQL 3D5OF 1EMTL 3NCYP 4D94A 1DLHA 4WO4D 2EDWA 3HLAB 3QO0B 5KSBE 3GSQA 2H6PA 2J3SA 2AABL 1G7QA 3TYGH 2X5PA 4DGIL 2B39A 2HKHL 2VITB 3D0VB 2PXYC 3AY4C 2MTPA 2WBWB 2OQJB 4MNGA 2ITDA 1AO7A 1CFNA 3O6FB 3KYAA 5JDSA 1LQSR 3HMWL 1QKZL 1DDHB 2B7DT 4XNXH 5FF6B 3CGTA 1OWRM 3OKDB 3FOMB 2JCCB 3VXMD 2AJUL 5DD3H 4OLWL 3RNQB 3KHOA 2O61A 1JK8A 4BZ2L 3ULVH 4JJ5B 2QR0A 3GSVA 1YMHB 5I18H 5E08H 5HJ3A 1YNLL 4H20L 4Y5XA 5MHSD 4XI5D 1HKLH 1IGMH 2V9RA 1JZ7A 2F53B 5J57B 3QWOB 4JLRA 4J3SA 1HEZA 1G7LB 5M94B 1FDLH 3HNTL 2W65A 1FPTH 5C07A 5IJKA 4PJBF 1V3KA 3MRKA 1P6AB 2MOVA 2EECA 5ANME 1XCTA 2AV7A 3JV6B 2V7NB 1YN7A 3M1BA 5DO2C 2FGWH 5FB8A 2C3HA 2Q8AL 2QQKH 3MRRB 2E8YA 2RR3A 5GZND 4PTUB 4U6YB 4ZO9A 2VAJA 4OLVL 2F9BT 1MQKH 4L4TE 2IALA 5FYLH 4JANB 2VXSH 2Z8WC 4KRMB 4QHKI 4DKAA 3HFML 2N1KA 1R5VA 2GQHA 3RKDD 4YHOL 1QHOA 1FGVH 1FH5H 3BPCB 3BP5A 5TQ0H 1G7HB 1N7ML 4Y1AD 4BSVA 1V3MA 3LAFA 4LPTA 2YPLA 1RZ7L 2GTZA 5T33L 4GAFB 1CS6A 1IGCH 4FQ1H 4KZDL 2HLFD 2R1WA 1J8HB 4OGYL 1RURH 2BP3A 1BREA 3CU7A 5DJZB 2H8PB 3EOBA 1Y0LB 5GS1B 2J88H 3OG4B 1N26A 4EBQL 4MHHG 4MNGE 4OSUL 1AO7E 5JW4M 5FUOH 2PXYD 4N0UB 5ESAA 4LPUA 4NQCA 1LEGA 1IVLA 1J0IA 3WLBB 3ULSA 4X6DE 4V1DB 4PRPA 1IL1A 3QJFA 4PV8B 1A9EA 1MI5D 4PGBA 5I1HL 3GSNA 4HH9A 1CD8A 1A6ZB 3UDWC 4M6NH 4Y16A 5DEFA 5C07E 1RJYA 3CLFH 3D1MC 5BV7B 5JO5A 2VISB 2AJZA 1FRGH 4GMTH 4IEFB 2QV2A 2HJLA 1GGCL 1Z0NA 4UOW0 4K94C 3CU1A 2OSLB 5I1DA 2CIIB 1BZ7B 1KIRB 4N90D 3ARTA 3STLA 1SBBA 3C60B 3DX7B 3MOQA 1AH1A 1VACA 2IADB 4FABH 3GFUA 3EHBD 1X5XA 5BRZA 2DM2A 1A4JA 5HSFA 4LSDA 4JY5H 3VWKB 1GVIA 2DM7A 1H8OA 2AI0L 4PS4H 4MAUH 4L5FH 3CDGB 4QNPF 3GJFA 5F88B 3FJTA 3NPSB 3EOAA 2XQBH 1R3IL 4XNUL 1QQDA 3RWDA 1KPUB 3BH9A 5MI0C 3MLWL 5T3XE 1KF9B 3BP7B 3QEHB 4I0PA 5I71C 1CGTA 1B2WL 4AMKH 3FO0L 3QCTL 3WHXB 2OJZH 1BZ9A 5IHUL 4F33A 2GKIA 2KDGA 1RIUH 4ENEC 3BRFA 4M93C 1DBJL 2PN5A 4FQXC 4NQCE 4JFDD 4GSDH 4I48A 3B9AA 1JHKL 1JNLH 2A2QT 2P8MA 1NCWH 2MPAH 4NWUH 3MA7A 4I3RH 4OCRL 1DQJA 3NIGF 4WW2F 3LV3A 4ZDHA 1MCKA 3FQNA 5C0DB 2IFFH 1Q94A 4O2CA 5FM5M 1OARL 3H9ZA 4G8GB 3RNKB 1FZOA 1MWAH 3INUH 2UVFA 2XKNB 4RGMB 1KG0A 1UZ8A 3T2NH 2NY6D 4PFEA 4GXUM 4AEIL 1LDPL 3VFTB 3ROOA 4XPGH 1H5BC 3SO3B 3BKYL 4MD4A 4MNHB 1MHCB 2GUOB 3WO3B 2E9JA 1P2CA 5F7UA 1W72L 5BRZE 3SY0A 3C8KA 3TJHC 1F58H 1F11A 1YEFH 3H9HA 4ZUSA 4JM2A 3G9VA 2GSIB 1ZHNB 4OZIA 4AZ8A 3TM6A 5I16A 5ISZA 4FFYL 1P5UA 4HFWA 4UU9A 2ICWI 1JGDA 1OM3L 5J9PA 1XF4A 4ZOBA 1QHPA 5I1AA 4Z78B 3BP6A 4FZ8H 4CVZA 2FJHB 5F3HB 1DE4A 4DKDC 2PYEE 2XZCL 3PV7A 3RTQB 1DLFH 5BMFL 3U7WH 2GT9B 4M7JL 1FVEB 1YEIH 4KHXL 3OKKB 4FQ2H 2VABA 1CF8L 2P5WD 3NCMA 4P9ML 4QO1A 3RWHB 4H8WH 2AK4D 4NOBA 3SKOA 3JUYA 4ZUWB 5D1ZC 4H88H 4FTVA 5DEZA 4ZYKA 2ATPA 2VDML 4OT1H 4Z77A 5IM7B 4QWWD 5MENA 3BQUC 3MRHB 4MJIE 5E2JA 3LN5B 1F3DJ 3VXPA 1I8MA 1JGVL 3SJVA 4G8IA 4OGAD 3P9MB 3WIHA 3NACH 4LCIL 3WIFA 1SYSA 1GGIL 5E8NB 1EDQA 4HCRA 3MRLA 5JXEA 1JCKA 5ACLA 5HHMD 3GMLA 4BYHA 4OZHA 4PP2B 2FIKB 1SJEA 5FGCB 4KK9D 1ITBB 3GSXB 2R2EA 3NTCH 3OZ9H 2FX7H 1FP5A 4NKMB 3VDBA 4PJIB 4LGRB 4OZ4B 3LD8C 4TNVF 3MLPA 4GW1A 1QUNA 4R0LC 2XFXB 2V2XB 3I3BA 4P5TC 3X13B 4KMQA 5KG9B 3UPCA 3LRGA 4HQQH 1U36A 4ZUUA 5ICYA 4OD1L 2FD6L 1RMFH 3U7YH 2E7CA 3S97C 3BKML 3UYRH 4DUXA 1OT1A 5DJ8A 1YQ2A 2PO6A 4U1JA 1BQSA 1N64H 3F7QA 2JB6B 4LVNB 5IFJB 1BGXH 4R4BB 4LCYA 3DRQB 5DUPL 2QHLA 1OSPH 1RIHH 4H26A 4CW1A 3EFDH 3QDMD 1HHIB 4FTVE 4F2MB 1A1OA 3BZ4A 3DNKA 2F54B 2FECI 3D0LA 5D1ZD 2GTWA 3SQOH 5IB2B 1BF8A 4RAHA 1JHTA 1H0DA 5LBSH 4H1LA 5MENE 3RZCC 3BHBB 1G9MH 2V7HA 4O00A 4YLQT 4C83B 4J1UA 4X80H 1GZQA 2XN9A 4JKPH 1WAAF 1YA5A 4XNXL 4D0CB 1U8OA 2R2CA 5DD3L 1ZA3B 3ULVL 3RDTC 3QG6A 4LMQI 3AC0A 5I18L 3CLEH 5HGBA 5E08L 3RPIA 1HKLL 4H1LG 2UVEA 3TZVC 3F12B 1CFQB 4HWNA 5CJ8A 3KPSB 4OZHE 1FDLL 1FPTL 1T2XA 3KLAB 1AI1H 3O2VH 1CGYA 5C0GB 5DD1H 4NQED 2VZ1A 5FA4A 3PNWA 3AROA 2WP3T 4PLJD 2FGWL 1J0JA 2QQKL 2YR3A 5JQ6H 1F90H 5EC2B 5EC1A 2FH6A 4P5TD 1TXKA 2QSQA 4YZFE 1HHGA 5FYLL 5SWSA 2VXSL 4PY7A 1BECA 1I7ZA 2VZ3A 4MWFB 4MZ2A 1AR2A 4RFNB 4P57B 3P30L 3D18B 5D2NA 5C08A 3JVGA 1FGVL 1FH5L 1L4IA 4KK6C 2CLVA 3PJSB 5TQ0L 2Q7YB 1C08B 1A4KA 2X2YA 3C2SA 4X9IA 5E9DB 4X6BA 4L3CA 1IGCL 4FQ1L 4HDIB 4Q74A 3N1MC 2MCPH 3UTTD 4PRHB 5J0BA 1S9YB 3BAEL 4PUBL 1BFTA 4RRPA 1RURL 2N4IA 4PB0H 4HWEH 5F44A 2J88L 4S0SD 4WO4A 2HFEB 3VGGA 3BE1H 3IJYA 5FUOL 4PJXE 1CGVA 3ULUH 4F58H 3MBEA 1YPZB 2GITB 3P2TA 5B21A 1CLYH 2WQRA 1MCHA 1XZ0A 4GRMB 2IWGA 4RRPG 4LPCA 4YGVA 2SEBA 1R3JB 3ARXA 5F7DA 4M1GH 4C59B 4P3DA 3VFSA 4XC3H 3CLFL 1E27B 1Z2KA 5IROC 1FRGL 4GMTL 4WTWA 1R3HB 2FBOJ 5FO7B 1NMAH 1MFAH 4ZPTA 2KKQA 2Q6WA 1NDMB 4N68A 5K9JH 4E42A 4FABL 4PP1C 3VRJA 3H7LA 1J88A 5J12C 4LNRA 4K3HA 5SWSE 4JY5L 4TOYH 4GRWH 4MAUL 1Z9OA 4L5FL 4WFED 4AIZA 3MV7E 3I2CH 3CFDB 5K9QI 5C0IB 3LKNA 1T7VA 2XQBL 1OTTC 4UQ2A 4JFPB 3ZKMC 4KK6D 2CLRA 2BX5A 4Z7UF 3DVGB 1HCVA 4G8EB 3DV4A 4J3UA 1DEDA 1JYXA 4LLWA 4AMKL 2HT3C 5EUOB 2FX8H 2OJZL 3DMMC 4CDGC 1JWMA 4DGYL 1RIUL 3MO1A 1S9VA 4QT5B 2APFA 5DTFB 1VGEH 4FXLA 3TLRA 5E8PA 4YQXH 4GSDL 1QSED 4BJLA 3C6LB 1D7FA 1JNLL 2IC2A 3MV11 4APQC 1NCWL 3S3SA 2MPAL 3DYPA 2V5MA 4NWUL 4O5LH 5KSAC 4I3RL 1N6QH 5F6IC 3GBLA 2DQFB 2IFFL 1FC1A 3QQ4A 3VXME 2IBGA 1MWAL 5A3IC 2HA1A 2FECL 3AREC 3INUL 4LEOA 2PETA 3VCLA 3VFNB 3T2NL 5MHSE 4G9FD 3SKMA 5IMKB 4XPGL 4UNTA 3OF6D 1IGTB 5L7XH 5B38A 2YUZA 1BJ1H 1XR8A 3R4DA 4NQDD 5FKPB 1MQ8A 3TH3T 4HWBA 5FDWA 1RZJH 4LFHG 3MJ9H 1DQMH 3STZA 3EYUH 4QHUA 1OGTA 2A6DB 4LVHC 3ULVC 4PP1D 1LP9A 4LF3A 1N6UA 4HC1A 4OKVB 1YEFL 3MRPB 5J1TC 1E6OH 4HHAB 3GDBA 4FQJH 2Y9RT 4WDIB 3GMMB 1WQVT 1NGXA 4DN4H 1NDGB 5E8OB 3DUSA 3ESVF 3O2WH 4XAWH 2BY3A 1NL0H 5B38G 2WBJB 4FZ8L 4HIHA 4NUGL 3P0GB 4Y1AE 2D2OA 4PLKD 3ZZ1A 1GZPB 4OZGA 3WUZA 2NW3B 1JGEB 4MCYB 1DLFL 1LE5B 4E0RA 3QULB 3U7WL 5D93C 5T5NF 1RHFA 2IPKA 3QUXB 4WHYH 4BA8A 5HY9A 2A77H 2NY3B 1EEYA 3FT4B 4MA8H 4N0CC 4M62H 5I8EA 1SJHA 1M7XA 4GRLC 1ODAA 3F6IA 3VFWA 4IIQC 1UT9A 4H88L 4APQD 4AQ1B 4OIIH 4JFDA 2DYPA 3IDGA 4OT1L 3HR6A 5KSAD 4B50A 5LXGH 3L3OB 3KPRD 3BW9B 1D5XB 5K93A 2OMNA 3CZFB 3VGDA 5A3ID 2NR6C 4PJ7A 4NNYA 4Y8DC 1QR1A 5EFIA 1MI5E 3FB8B 1UH4A 5FCSH 2EH7H 1QBLH 3NACL 4PRNB 1YEEH 1ITCA 5JORA 5EU6B 3QP3A 2CGRH 1XCQA 1CI5A 1NFIA 3HPJB 5CJ5A 4JFZH 4AEHH 5HGAB 4QRPB 4WTXA 1BOGA 3CFBA 1TMCB 5C7XH 5F70A 4N90E 2X05A 3QI9C 3QUMB 4U6HB 3L5WA 2CJUH 1RZGA 3JBG7 4NNXB 3NTCL 3OZ9L 2FX7L 1BF2A 4WWID 1A2YA 2HH0H 4HKXB 1H15A 4IOSD 5KAQG 1PFCA 3CFCH 2D7TH 2WANA 2NLJA 1K8DB 2R1XB 3PDGA 3ARUA 2GAZB 4ZG1A 5FO9B 1YY8A 2ARWA 1PGRB 4QHNB 5I6XC 1JYNA 3CC5A 4L8SC 3QDHA 1HH9B 2NY2D 5DHVA 2M2DA 4YBQD 1RMFL 2Y6SD 4J3OC 4GUPB 3U7YL 1T7ZA 4RCAA 4GMSH 3UYRL 1U93A 4JFXA 4LSSH 4WU7A 1HSAB 4R3SA 2IF7A 3QUYC 4NRXA 4QHKJ 1TZIA 1N64L 2R0LH 5K59E 4ZS6D 3MZTA 3IDXH 3MC0A 5IVOA 1HILA 4Q9RH 4NKQB 3OB0K 3IJSB 5E6IA 1BGXL 5FYLD 4N0CD 5FKAA 4LKXB 1OSPL 1RIHL 4MAYD 2EO1A 4P49A 3EFDL 4A2LA 4KJQC 2IQAB 1Z9MA 4JFDE 3GMRB 3SQOL 3UP1A 1J11A 5GGQL 2DQDH 1CXIA 5LBSL 2CLZA 5C0FB 1G9ML 4MQ7A 3FO1A 2G60H 1B3JA 3G6JF 4PJ7E 2ZCHL 3QA3B 3WN5C 4U1NB 4GW5A 5H37H 4X0KB 1FV1A 3I6LD 5AG8A 4WGWB 4JFYB 1A6AB 4TUOA 1KYOK 3KPQA 1SYVA 3EFFA 3ZTJG 4GG8A 5CKAA 1NUNB 1IAOB 4GXUN 1JZ2A 2CKBA 2FIRT 1MRCH 1XGTA 4WW2B 4RAVB 3G5XA 1UC6A 3RHWK 2NXZC 1AI1L 3K46A 1MLBB 2BSTA 3QI9D 4KI5C 5DD1L 3RY6C 3FQWB 3K8KA 3MJ7A 3I50H 4NHUA 4G7VH 4WI9A 2PNDA 1XGRB 5JQ6L 1F90L 3B2VH 3RIFK 5FFLA 1UJTA 4YFDB 4AENA 1VESA 2HFGH 5D1XA 3MCG1 4OLYH 3PWUB 1U92B 5CAYB 2YEZB 3CD4A 4XNZB 3T1FA 5KSBB 1PAMA 5AZ2H 4PJBA 4PGZA 1K4DA 4HIIB 4FXKB 1DQTA 4BH8A 3QUZB 4RX4A 2R39A 3V79C 2HMID 2ZG1A 3VXTA 3QEUB 4NZJA 3IXAA 1Q9LB 3W82A 2CUMA 4EDWH 2P5WE 2MCPL 2AK4E 2YWZA 5E0QA 4G9DB 4KJQD 4UIMB 2XWTA 1CYGA 3LEXA 4HWEL 1FN4A 5LG1A 3CXHJ 3QDMA 3TCLB 3LMJH 3D2UD 3BE1L 5HYJA 2GYSA 3OB0H 1RZ8B 2O5YH 4O58H 5DRZA 3ULUL 3JTTB 5TF0A 5C1MB 1CLZL 3ARBA 2Z8VC 1D9KD 1YEHH 2Z4QB 1SEBB 5BV7H 1CLYL 5ANMB 2PYFA 4D9QD 5E8EA 4G42B 4H8WC 5F9DC 5GRUH 1YMMD 3WFHB 2R2BB 4M1GL 4OFYD 4U6TA 4XH2A 3TN0C 4XC3L 4L4TB 5HD8C 3HCVA 2FEDD 4AH2B 1Q72H 1WBZB 1IKFH 5HHME 2NXZD 1XGQA 4I18A 4NC0B 4M7KH 5CUSL 4KI5D 3ZE1E 1NMAL 1MFAL 4M7ZB 4QRUA 5GSVB 4C4KO 4LDOB 3BEVB 2VKWA 4AK1A 5K9JL 4I2XA 3SE8H 1HKFA 3THMH 2ZUQC 1MCEA 1LGVA 3ZDYF 3WS6C 2Q3ZA 2O93L 1D5ZB 3EO0A 1X4XA 4TOYL 3ES6B 5E8DH 2H6PB 4UT7L 1G7QB 4YDKH 4F37F 2CXKA 3I2CL 4X4XA 2P1YA 2EIBA 3B4NA 4JHZA 4NDMA 3HI1B 3T04D 4IOFC 3IVKA 4QRQB 3PIQB 5T3ZH 2GJ6D 4MNGB 2ITDB 1CFNB 2XQYK 4P2QD 5JDSB 5DRXA 4W6XB 2ICWJ 2A6KA 2F58H 2FHBA 2VZTA 2OMBA 4YHML 3SKNA 2FX8L 4G6JH 4JPWL 1ZHKA 4X6DB 3TNMA 5T1LB 1S5IH 1ES0A 4YX2H 2LTQC 3NZHH 3QDME 1C5DB 4RBPK 5HJ3B 2ILLA 1EX0A 2BVYA 1VEPA 5I76B 3L3HB 1BEYH 1MOEA 3I85A 5D4QA 3V52L 4CMHB 4Z76A 4PGEA 1T21B 2NNAB 3RFZC 4YQXL 4ONFH 3HR5A 3WD5H 5C07B 1DANU 2DJUA 1NCBH 2APWA 2VYRE 3UTZA 2ERJC 4O5LL 5C9JB 5IBLD 1X7QB 1RI8A 1RUMH 2AV7B 1N6QL 3MRFB 1A6PA 2Z9TA 5FB8B 4DUVA 4MA7H 2DOCA 3ZHKA 4PJHF 4TNWK 5I1CH 1ONQB 5ILTH 3TN0D 2QSCH 5BQ7A 4HWZA 1G9MC 3H42H 3QFDA 1J9CT 2K9UA 5T1KD 2XYCA 4PLNC 1OF2A 2X4RB 2JJWA 5L7XL 4PJFA 5I9QB 4ZO7A 5KW9H 5ACMA 4I2XE 1RZJL 3MNZA 4NQEE 2AJYH 3EYUL 5DVNA 4BSVB 3P4NB 1MHEB 5FECA 5BVPH 1ORQA 2YK1L 1PQZA 1T7YA 4YNYB 1S7XA 1R24B 3PWVB 3IAGC 4JY4A 2R1WB 1E6OL 5EO1A 3V5DA 5C2UB 4FQJL 1UB6A 1VA9A 5DWUH 4IMLB 3D9AH 4DN4L 1L9NA 3DTXA 3O2WL 4H0HB 4IOFD 4XAWL 1NL0L 4EQ2A 3TBWA 4MA3A 4IS6A 4NQCB 1LEGB 4JKWA 1U2HA 2VE6A 2VR4A 3NCFB 3NA9H 4ODSH 2QBWA 4LASL 5DURD 1ACYH 1S7QA 1MLCB 5AYUH 1NMCC 5L8LB 4PD4K 3FFDA 3I6GB 3RWGA 4HV8B 1OQXA 4PGBB 4HF5H 3UTTE 2XTJC 3E6HA 2QSVA 2A77L 2X4TA 3WIIH 3UXFA 4M62L 3UTSD 32C2A 3FQUA 3MV9D 5JO5B 3E3QC 3N1QC 1BX2B 1GAFH 1XF2A 1CDIA 1Q9OB 5HPMA 1L0YA 4Q9BA 3S35X 1BAFH 1NCCH 1X44A 1SY6H 2OTPA 3MRIB 1P7HL 1KB5A 2DMCA 5LXGL 2VH5H 4RBPH 3SPVA 2ESVD 3GMNA 3OTTA 2X4PA 4OF8A 3H3KA 2IAMB 5D7JD 3QT2A 4F9LC 4OCYH 5DJXB 5DZLA 3SE9H 5HHXH 1EVUA 2P45B 2YUXA 2EH7L 3TPKA 4JRYA 1YEEL 3GJFB 3LDBC 4XPTL 4PJFE 2CGRL 4HJ0C 3EOAB 3ULUC 4KTYA 4JFZL 4AEHL 3S34H 5EBLB 3G5VA 1UKTA 5IVXE 2ITCB 3OF6A 1FQ9C 1TDQA 1U8IB 5EO9B 1KOAA 3TPUA 1YY9C 5BW7A 1M7IA 4P4KD 1H8NA 3SCMA 2CJUL 5HXMA 2PYEB 5F9JA 3O8XA 1E4WH 1T1YA 1BZ9B 3SBWC 2V9TA 4F33B 2HH0L 4M8QA 2FJGA 4GBXC 3CFCL 5F1SA 2D7TL 3BWAA 5INCB 4WFEE 5AAWA 2P5EB 1IC1A 2MKWA 1F3JB 5HHPA 1WV7T 5KVMC 3IFOA 5BXFB 5DJAB 1UEYA 1A6TA 2R9HC 1ZSDA 3MUGB 1T22A 1TVDA 3ABZA 5ID1B 3DXAA 3OKYA 4GMSL 3RZWA 3IB4A 3GJEA 3DRTB 1JL8A 1IMHC 1EH9A 3FQNB 4LSSL 4ZDHB 5EOQH 2YC1B 4O2CB 3BN9C 1INEH 1I85A 1ZEAH 2R0LL 5C0CA 5DMYA 3IDXL 4Q9RL 1QLFA 2DQUH 4MJIB 4GAGH 1AD0B 3VGAB 4EI5A 2NMSA 1QSEE 1FYTD 1A5FH 4Z7UB 1TJGH 4TVPH 3MRBB 4JDVA 4MD4B 2G60L 2X41A 4LPVA 4UV4H 4YHIA 2E7LC 3FRUB 3OKMB 4P46A 2EKSB 3C8KB 4S1DC 1FNHA 4NM8H 3MCKA 1F11B 2AKRA 3H9HB 3PWNA 4GG6E 1WCQA 4ZUSB 1A3QA 4GQ9H 1VADB 1JBJA 2E7BA 4OD2B 1X5IA 2DLIA 4H5SB 2GSGA 2XPGA 4KVCH 4LLAA 4G9FE 4JN2B 4PYHA 4HJ0D 1CIDA 4PTTA 2C3VA 3JWDH 4BZ1H 1JTPA 3QR2A 5D5ME 3BP6B 1MRCL 4HUXA 4NQDE 5AWNH 2CSPA 5D6DA 3SE4A 3VMNA 1S7RA 4QHMA 4M7LT 1WAAA 3MFFA 5TGBA 1NC2B 3I50L 4G7VL 2GCYB 2H9GA 4UAOB 2YPVL 1X5YA 4QTHB 4XXDB 3B2VL 2BJMH 1QNZH 4XCEA 2HFGL 1MCIA 5I74C 1RD6A 2AQ2A 3MGTA 4D8PB 2W0LA 1TVBA 3TCXA 3MJ6A 4FTVB 1RZJC 5AZ2L 2R9HD 1MCDA 3RVWD 4X99B 4QHLB 1HI6A 4WUKH 5FGRA 5MENB 4CJ1A 3PHQA 4KKAD 3UO1H 3L7FB 2O5XH 3C09B 5JLZB 3D87B 4FQHA 1IEAA 3PDDA 3MCLL 2YD6A 3P4OB 4Y4KD 1BVKA 4G8IB 3HHRB 3VFUA 3KXFD 5DRNA 4EDWL 2EZ0C 3ZSTA 4MAYA 2Y72A 2VB5A 3VGFA 1U6AH 2VC2H 3LMJL 4N9GA 3TGXA 2E6JA 3RRQA 2D7QA 3GMLB 2O5YL 4O58L 3KPRE 1FNFA 5HHNA 4OZHB 2VMFA 1SJEB 4PRID 5C8JA 4ZFFB 4S1DD 4PJAA 2B4CH 1YEHL 2R2EB 5BV7L 2YWYA 1KC5H 1VFMA 1QTYT 3BO8A 4MYWB 2DJSA 1NBVH 4ONGH 3BISA 4FP8H 5TDOB 1D6VH 1YNTA 2DBLH 3QG7H 2DIAA 3TO4B 3VXRD 1LILA 5F89B 4ZAKA 1OGAD 1Q72L 1IKFL 5DS8A 3ZHDA 5DJ8B 4M7KL 2AXGB 1ETZA 4KROC 1I8LC 4F9PA 2KUTA 2R69H 3MRDA 3SE8L 2E9WA 3THML 1QRND 5I1LA 4M4RA 4Z7QF 3MNVA 5EBWA 2NXYC 2C3GA 1IZJA 4CMMA 5E8DL 1RHHA 1ZA6B 4YDKL 2GTWB 1JHTB 1S7SB 1H0DB 1T7WA 4HIJB 1MH5A 1DSFL 3MLSH 5FOBA 4JRXA 4LSQH 4WNQA 1CXLA 1HDMA 1P1ZA 2V7HB 2BSRB 5IWLC 2CXGA 1EVTC 3WNOA 4EXPX 2DI8A 5DSCB 3S8WA 4PJXB 3C6SA 2OTWB 3F6LA 5D1QC 5DGQA 2F58L 1U8OB 3RY5A 5D71H 2EDFA 1FCGA 3V7MA 5FYLE 3SGDH 4MDIA 4G6JL 4GKZA 3AB0B 1HNGA 1I1AA 1W0WA 1S5IL 4YX2L 4R4NC 1JWUA 1QP1A 2EZ0D 5HGBB 4Q9QH 2ZUSA 2VN4A 3BIKA 3NN8B 5JHDD 2IH3A 3QFJA 1ORSB 5DQDH 5CEZD 4PPTA 4MSWB 3MLUH 4PBWD 3MOAH 2EIDA 3REWB 1MUJB 3T0WA 1EGJH 1RUML 5FA4B 3MNWA 1RVFL 1U3YA 2A6JB 3I6LE 2RB8A 4BQCA 3H7BA 1D9KA 3O6FC 4MA7L 1EZVX 5IW1A 4CL7A 2DI7A 1I7RA 5I1CL 1ZT7A 4M61A 1MCJA 3QIUB 5SWSB 1YMMA 3W39B 3QIWB 1IC7L 5DA4A 5K33A 3H42L 4RIRB 2E7HA 5J13C 3MV7B 1VB9A 1AHWA 3BESR 5KSUA 4JFHD 3QB7C 1WCBA 5KW9L 1C5BH 2J8UE 4PBXA 1U3JA 3FB7A 5CBEA 4CVWA 4WV1B 3L3DB 2AJYL 3WFZA 3LKSB 3TEUA 5BVPL 1FORH 1D6EB 3FO2B 4L3CB 5E99H 4EUPA 5HDBE 5DR5H 4OM0H 3TBSA 3HUJA 1YEDB 2NXYD 3ORJA 3L9RB 5DWUL 3VFRA 1KNOA 1U8NA 1G6VK 4WO4B 1ZGLP 2AXFA 1FNEB 2XXCB 3QPXH 1GC1H 2XWBA 3T0EC 4OIAA 3NA9L 4ODSL 1FVDA 4NQVA 1ACYL 5D1QD 1NUGA 5CZXC 1EAPB 1MJJB 5AYUL 4EUPG 5D5MF 2FBJH 3FTGA 1E6JH 4X9FA 1JRHH 4R4ND 2SEBB 3VXMB 4PB9H 1I4FA 5DD6B 2Z92A 4HD9A 5FK9B 3HG1D 2HT4D 1D5IH 2NZIA 1GAFL 3FL7A 4ZNEA 1BAFL 1NCCL 4PG9A 1SY6L 3KS0H 3S96B 5GS1C 2YRZA 1WZMA 1UGNA 2VH5L 5D7IF 1PW3A 3E8UH 2AJSL 1F6LL 4D9QE 4E42B 5E00B 1W8OA 2Y5TA 4HS8H 4OCYL 4ZFOA 2OTUB 3SE9L 5E95B 5HHXL 3WKNA 2YHGA 3WDJA 5JTWA 4MJ5A 4KKBC 4PJCE 4YK4C 4HZAA 3BKJH 4XP1H 1BJ1J 1NBYA 3OX8A 3LKNB 3X3FH 3I3DA 2NTFB 3IDNA 2I07A 1N6VA 2VLKD 3S34L 1B90A 4KI5E 2CLRB 5T1KA 1JWSA 3O9WC 5IF0B 5BV7C 3ZDZF 1F4HA 4FXGA 2XIDA 3VE0B 3SKUD 2R2HB 4LLWB 5DYOB 5DJ6A 3HUJE 1MY5A 5ID0A 1E4WL 1XF3A 4Y1AB 2OR8A 1JWMB 3V5HB 5CILH 4G8FA 5C0EA 3UROR 3NAAH 2FR4A 3CZJA 3C60C 4TN9A 3VU2A 1S5HA 4NBXB 3SGDI 3AAZB 4WEBH 5DJDB 3UPAA 3T77A 2GJ6E 4UIKH 4P2QE 3T0ED 2ZUYA 2PXYB 5IMMA 2VUOA 1EBPA 1IE5A 5CZXD 5EOQL 4NO0A 3QQ4B 3MRJB 1INEL 1J05A 1ZEAL 1D5MB 5FA3A 2DQUL 4AL8H 4HUUB 1L9MA 4HMCA 1BWMA 3VCLB 4ELKB 1BBJB 4XTRC 3ULVF 1MI5B 4JKMA 2I24N 3KPOB 4BZYA 5FIEA 2EDHA 5F7NC 3UTSA 1A5FL 4RWYH 1TJGL 4YAQA 4TVPL 3A67H 5TDPB 3B5TA 4YHKH 5FYJU 4JB9H 4DUWA 2JJVA 1DN0A 4UV4L 1G0YR 4GAYA 5F6HI 3STZB 5D2LF 4PJ5A 4PJGA 1U8LA 5BZWA 3RX8A 4NM8L 2ESVA 2B1HH 2DTMH 2L7UA 4KKBD 5D7JA 4GQ9L 1JV5B 4KVCL 2EDEA 3DUSB 4EDXA 1NAMA 1XF1A 4JFFD 2X4NB 4BZ1L 4HJJH 2R0ZH 1MCNA 1GJIA 5AWNL 2RAMA 3VI4F 3G6JA 1S3KH 5EUKA 3C5ZC 2VDQH 4Y0GA 3UBXB 1FBIL 4RISL 12E8H 4AY0A 1AGCB 3SO3C 4E0RB 4AM0B 4LLUB 4P4KA 4PJDA 5C0BD 4ZOAA 2IPKB 2A74B 1EEYB 3A0OA 3EYOA 2BJML 1QNZL 4XHJC 3LKOA 3CCHB 3S6CA 1JUFB 4PGDA 2EE3A 3CFIC 2H2PD 4WWKD 5IVZB 2OZ4H 3HZKA 1Z5LA 4HKZA 4JPIB 4JFDB 3ARGD 3V0WL 3SE3C 4WUKL 2NX5A 2YZ1A 1M05A 2V9QA 4YIQB 3UO1L 4YBHA 2D31B 2O5XL 5IQ9A 2AV1A 1CN4A 1D5BA 5I8CB 4KY1H 4HG4K 4PJ7B 4LHUG 1F8TH 1S9XB 2WQ8A 4PJEA 4I13B 1G9NH 1WBYA 2IMMA 2D03H 4ZUTA 1KTRL 1FZKA 2J8UF 4MJ4A 2V2WA 5DVMA 3RTQC 3UTSE 4KMLB 3EAKA 1QOKA 4LCCC 3VFPB 1C5CL 3MV9E 4TRPH 2NY6B 5T3ZD 5FO8A 1FZMA 1DQDH 3HMXH 5EOTA 1U6AL 2VC2L 5FV2A 3B9KA 3HKFA 4WI3A 4PJGE 2K7QA 4U1IB 1TNMA 2V6HA 3G5ZB 1BHGA 3GEWB 2ESVE 3F58H 5M95B 1RZGB 2DLFL 5EU5A 5H2BA 5I1GH 4JR9H 5KS9E 3MBXL 2MJWA 3QDJD 1KC5L 1A2YB 1H15B 5CKGA 1ZXQA 1NBVL 4ONGL 5A43C 3X3GH 1CL7H 2MHAB 1A1NA 4FP8L 1ZGLA 1D6VL 1FYHB 1N5YL 3MLVH 2DBLL 3OBAA 4EIGB 4FQCH 3V0VA 5CD3A 3I02A 2V5SA 2ZOLB 2Y07H 3EKCA 4PREA 2H32A 1MIMH 3CX5K 4X7FC 4LLVB 4JFXB 2G5RA 3L5XH 5KSVA 2DF3A 4PJDE 5MI0B 1WBXA 4P48A 4NRXB 4U0QB 3EOYG 2R69L 1N5AA 1I9RL 3OB8A 5EDXA 3K4AA 3IFPA 4HLJA 1CQYA 5FKAB 5HHOD 2F8VA 3IXTB 1F02I 4M93B 2P5WB 4FQQA 4L9LC 3JXAA 2AK4B 3LPWA 4K9EH 3O11A 2CLZB 3MLSL 3SKJH 4ZMAT 1VENA 2VDPH 1N2RB 1AC0A 4K7PH 2IAND 4D0BA 4YHPB 4PJEE 3M07A 1AXSB 3TYFB 2JJSA 4IRZH 1WWWX 4OFIA 4K7FA 1W2KT 4P5MB 4N5ED 5C0AA 2CDFA 4GG8B 4Q9QL 2DBJA 3DUUB 4Y4KA 3GJFK 5AD0B 1A7NH 4ETQA 4LVNC 4HK3N 1E28A 1FYTE 2W1NA 4Y7MA 4C56A 1HHKB 5DQDL 1E4XI 5CJBA 2ATKA 3S7GA 3MLUL 5KTEH 3MOAL 3QXDB 2HVJB 4OD3H 3FCTA 3Q6GL 4NIKB 3UZVB 5I1EH 3NPZB 5HHMB 3G08A 4JO4H 1IM3B 2VKXA 4PRIA 4NHUB 4LIQH 1ZT4A 5LQBH 4X7SH 4KKLD 4FFZH 4Q6IA 4NQSA 2DIJA 1JGUL 4PV9B 1HQRA 4HXBH 1PZ5A 1J10A 3FN3A 1RIVH 5DT1H 5T3XH 5ADPH 5SWQB 2FHFA 4WRLA 1BD2A 3VXRA 5HYSA 1C5BL 4HMDA 3WUWB 4NBZB 2HAZA 4LLYB 4U6XB 2Z35A 2J4WH 3UAJC 4Y2DD 1WIUA 2VZSA 3LSOA 5DD0H 1FORL 1X4YA 1JF1A 3VXTB 3KWWB 4X7TB 5DR5L 5HGDA 4R26H 3AM8C 2OCFD 3JWDC 3T0VA 4NO5A 1R5IB 3FAWA 4N8VG 1BQHA 4UNVA 3PL6C 1KTDA 3MJGX 3OWEA 5CINH 4P2OA 1VKXA 2J1KA 4WHTB 5D1ZB 3WE6B 2VLJD 1UM4H 4NCC2 2I9LA 3QPXL 3TBVB 5MEPA 4DTGH 3GSNH 1GC1L 3IDJA 1V7MH 5DC0A 5HI4C 5LGHH 3BJ91 4JVWA 4U1KB 2PYFB 2QSTA 2FBJL 4KK5D 2BY2A 2AJ3A 1E6JL 3KXFE 1JRHL 4GQPH 1FL5A 4PB9L 1BQHG 3GSOA 4F7TA 4OFKA 4NBYB 5J1AA 4C58B 1TFHA 2Q86A 2FCBA 3CDFA 1D5IL 4YDLC 3HI5H 5HBBA 1ZV5A 5GPRA 3HZYB 1JNJA 3ARQA 3PABA 3VRIA 2GEEA 1XGQB 1PG7W 1U58B 2XZQH 4PRIE 3PGDB 1DN2A 3GJFH 3E8UL 4AIXA 4NQEB 4JREC 2AEPH 4HS8L 3OJDA 1EHLH 1S9KC 3EJYC 3LD8B 2HLAB 1VPOH 5HTSA 4R0LB 1OPGH 4GKNB 4TVPD 2W9DH 4P5TB 3BKJL 3VXRE 4XP1L 5HGHB 4NDMB 3CH8A 3X3FL 1OGAE 2VXVL 4OUUB 3Q3GA 3HB3D 2HJFA 4HKBB 1RSFA 2B4CC 3UAJD 1H3UA 5DRXB 2P7TA 4JO3H 1K2DA 1S7UB 5ELIA 1WFOA 1JYVA 3MRNA 1QRNE 3TIEB 4PJ8D 1FFRA 3NAAL 3MYJA 2BHUA 1PYWA 2I27N 3PL6D 3UTTB 3U79A 3ZYZA 3QNZB 4LSUH 2LU4A 4Z76B 2J2ZA 4QF1B 1G7JA 4WEBL 3RZCB 3O4LD 4FQXA 3UTZB 4XCFH 5FDYA 4HPOL 4C55A 1UH3A 3N9GH 2BVTA 3ZKNC 4KFZC 3DX8A 3O45B 1ZLWH 4WI2A 5GZOC 3LRHA 1T04A 1T1ZA 4AL8L 4HUWA 3FT2B 3RDTB 2P8LA 2NY5H 4A6YB 2VDNH 4KV5F 5JHDE 1LK3L 3FN0H 3HG1A 5KVDH 4R2GC 4IJ3C 4RWYL 1KLUA 5GS0H 4PJ9A 1OF2B 4UT9H 2BRRH 3A67L 3D69A 4YHKL 4PG2C 3AS3A 4JB9L 4L8DA 1AGDB 1FZJA 4LSPH 1QPXA 3I75B 3RI5K 1FFPA 5IVXB 3C6LC 5FECB 1PQZB 2B1HL 3EJYD 3ME0A 2DTML 3V5DB 4JQVC 5IMLA 4K8RH 5KVGH 3IU4L 2AS5M 4WEUD 4LKCA 4HJJL 4JFHE 1RAMA 1G7MB 3HAEA 25C8L 5LGJA 3TBWB 1A1MB 3IGAA 2VE6B 3L95A 1ZKAA 2VLKA 4ODWB 1I8IA 1S3KL 3FT3B 1AGBB 1OSZB 1BOYA 4HS6A 4RA3A 5JNYA 5F7LB 3RA7H 2VDQL 4N8CH 3ZDXE 2X9YA 1A9BA 15C8L 2X4TB 2GK2A 3SO5A 2H3NA 2VLLA 3HAEG 1XGPA 3T3MF 4NKDA 2JJTA 5IEKA 1IBGH 1RJLB 2OZ4L 2BY1A 1SQ2N 1KB5B 1QSEB 4YWGH 2ICEB 1KJ2A 3ZKND 3WIHH 4JZOA 3HE6D 4OI7A 1NCTA 3MUY1 5GZOD 4L4VA 3SPVB 3ULUF 2C1PA 3QCVH 3DIFA 1IKNA 4KY1L 2BNUB 4ZO8A 1F8TL 4TUJB 5JPNB 4JZNA 1JN6A 4HCRH 3GI8L 4QXGH 1VFOA 2X09A 3T8XA 2D03L 3ARDC 2AXJA 4P2RB 1AIFA 3V5KB 4PGCA 3HG1E 4GG6B 2H26A 2ZNWA 2Q20A 3U6RB 4TRPL 4OLUH 3O6MH 3QXAA 1OP3K 1JPGB 4R2GD 1DQDL 4G9FB 1HQ4B 3S36H 3HMXL 3SN6N 1GC1C 3CDCA 5H94A 1R5WB 3WXWH 1CDYA 3J7HA 3CFKA 5D5MB 4NQDB 1WT5C 1T80A 2BY0A 3OR6B 3F58L 1XFPA 1DFBL 2NZ9C 2VQ1A 2CH8A 4XP9H 5I1GL 4JR9L 3HZMA 4G80B 1CDUA 4TULH 4PLOB 5GJTH 2E5EA 1FFNB 2B8OT 2WWKO 3EBAA 5J12B 3OHXA 2OYPA 2AEQH 2LVCA 3X3GL 4MXQD 3SGKA 2D4DA 2Z8RA 1IQDB 3MLVL 4GRWF 4KGJA 1GSMA 4OCXH 2CO6B 4FQCL 1J1PH 3NMEA 2VLKE 4JFFA 4OFDA 1KTLA 1B6DA 2J8OA 3IDYC 1Y18A 2Y07L 4BSWB 1X5HA 3GNMH 1MIML 3GJEB 2JB5H 3L5XL 4D3CH 3CNKA 4HK0A 4NCDA 3FO9A 2BRQA 1J1OH 4H1LH 1QLFB 2HVKA 3WS3A 4HT1L 2Z31C 3IT8D 4GKOA 3HPLB 3EW3B 4MD0A 1XH3B 4ODBD 3UTQB 1ZTXH 2Q7NA 3P0YH 4K9EL 4JDVB 4LAJH 1CIUA 3T0EE 2VDPL 4IMKA 3RL2A 1F4YH 3OKNA 4WWKA 4APQB 3SGEH 5JXAH 4K7PL 4YJZL 4YHIB 2DD8H 4JDZA 1QZ1A 3EGSA 1PJ9A 4KDTC 3S36X 1M71A 5KSAB 3CFJA 5F6IB 3KPRB 2EYTA 3H0TB 3MCKB 4L8CA 2CK2A 4OQTH 4IRZL 2CDEA 3NFNA 3ARDD 1MAKA 2XPGB 3QHTC 1A7NL 4TTDD 3HE7C 1CICC 2ZSVA 4ZFZB 1KUMA 4U3XA 4Y5YA 1T83C 4X6CF 3SDCD 5B39A 3QQ3A 3ZKXC 4GKSA 3T08A 3TZVA 1S7RB 4QHMB 4OD3L 3OGCA 5F7EH 5I1EL 4NUJB 5GRWA 1CFSA 4JO4L 3VXOB 1QLRB 3PDOA 3ZT6A 4Q7DA 1DCLA 3RWJA 2CR3A 1OP3H 2VDLH 1I8KA 1QSFA 3OJ2C 4Z0XB 3EYQC 3FOLB 1QACA 5LQBL 4X7SL 3QDJA 4NZRH 4FFZL 4Q0XH 4XCEB 3QUKA 1LO2H 4JFFE 4MMXC 1U8JB 2EDOA 3QPQC 1BJMA 4HXBL 1N3NB 3MOBL 2ARJA 4U1GB 5T3XL 1Q9KA 3GKWL 1U42A 4Z7WA 2NY2B 4RA0C 1MCOL 3MLYH 1U8MB 4DFIA 1TQCC 2XNAA 3PHQB 5C0NC 3HZVA 2J4WL 5EZLA 2ADGA 5C0BE 4TTGA 5DD0L 3ROLA 4U1HA 1DL7H 2Z31D 2VDRH 5D93B 4HGWB 1AR1D 5J11B 1KENH 2N7BA 2CDGA 4MX7A 2C3WA 1T4KA 5HHOA 4MAYB 1IC4H 3MLZH 4ETYA 5CINL 1AGFB 3RWCA 4CU6A 4FN0A 4N9GB 1I1CA 4XCNA 4IIQB 5HI3D 2AJXH 3E0GA 3GHBH 3KYMA 1UM4L 5MERA 2VL4A 4DTGL 3GSNL 4Y4FD 4XNZC 4EQ3A 1V7ML 3NZ8A 5D6CA 3U30C 3UPRA 3KLSA 2IANA 1WITA 5LGHL 2R1YA 3BO8B 1KGCD 2C1OA 2IG2H 1UG9A 4KUCD 3QUZC 1NSNH 4JO2H 2HWZH 1IT9H 5FYJH 3HE7D 5T3ZE 2VAAB 1YNTB 3EO9H 4G6KL 3TVMC 3K2UH 1C16A 3HI5L 3K8MA 1WFUA 4QRRD 1UA6H 2VLRD 4H25A 3MMEA 4X6FB 2KQMA 1DVFA 1KLFA 3TA3C 2XZQL 2WIIB 5CSBA 4BFIA 1K4CA 1XGYH 1ETZB 4O2EA 4Z5RA 1JZ8A 4IRJA 4JG0H 3RP1A 1G9NC 2J8UB 3QI9B 3FB5A 1H3TA 3QDJE 5B8CC 5BJTB 1AD9A 4XAKD 3C9NB 2AEPL 3CUPB 5I1LB 2O5ZL 3L3GA 2IQ9H 3DWTA 3OR7A 2X89D 5EBWB 5F6HJ 4CMMB 1OPGL 1KJ3H 3WXVH 3QPQD 2W9DL 1TTUA 2Q76A 5IHBA 3MR9B 3Q1SH 5DF0A 3VXSD 5FOBB 5I6XB 3LRSA 1PG7H 4L8SB 5I15H 4ELMF 1FE8L 4XX1G 1TNNA 5C0ND 3KAAA 1R0AL 2HJKB 2L7JA 3NH7L 3C6SB 4JO3L 1UFUA 5J89A 4X5XA 5F1NB 3ILQD 2ADIA 3SGEI 3GM0A 1DQQB 3GB7A 2EDLA 1NBZB 1BFVH 1W0WB 4JO1H 4F7EA 1OTUD 3L6FB 5DI8A 1HHHA 3RWIA 2F74A 5BOZG 4YFEA 1U95B 3RGHA 3BIKB 3SDXE 3LS5H 4LSUL 1YC7A 1H3VA 3FHAA 4KXZH 4OAWA 5D8JH 4L3ED 2R4RL 4KJWC 2JCCF 3D2UB 2IANE 4EN3A 3NFPA 4XCFL 4XP4L 1N0XH 3N9GL 3REVB 2BK8A 2EIZB 1BMGA 5HHVH 3H7BB 1D9KB 4GLRH 4FZEL 2BVOA 3RUGF 1UJ3B 3EYFA 4HWBH 3EOTH 2NY5L 3R0NA 4K9EC 2VDNL 2ZWLT 5C6TH 1M6OA 4PJCB 2W0FA 3FN0L 3KYOA 3KS0J 3ARPA 5FEBA 4DJMA 4FFWD 1U8PB 5KVDL 5F7KC 3RY4A 5GS0L 5DJCA 3TA3D 4UT9L 2BRRL 4Y5XC 4ZTOH 3V6OA 1BQLL 3LQZB 2NXZB 5E94B 2WM0A 3B2UC 1MWAB 1W0VA 5IJKC 4N1CA 4C4KT 4EUPB 2ZKHH 4IHOB 5C6WH 3QXWA 4A2MA 1DUZB 2DWEA 1NAKH 3U46B 1G1CA 3HUJB 3WJJA 3S9DB 2FO4A 3CVHA 1P4LA 3QDGA 1MAMH 4K8RL 4UTBL 5KVGL 4RAUA 1G7IA 3W0WD 1V8HA 1UB5A 2Y7QB 3IETA 4NSKB 2WWMC 3DGCR 3B9DA 5L8KB 5DQJA 4KVNH 5K9KB 1HINH 4M02A 5I8KH 2HKFL 2Y36H 5F1IA 1P9MA 3CK0H 1FGNH 2XWBB 4XGZB 3MPCA 2GJ6B 3RX7A 4P2QB 4XWGL 3RA7L 1U3HA 4O02H 5I9QC 3FTGB 3ZT7A 2HTLC 5FHAL 4NRZA 1O5DT 1AFVH 4XWOC 5GGSA 1I4FB 4F8QA 3TT1L 3S5LB 1NEZA 1MCFA 5E4EC 1LO0L 2E6PA 1QVOB 3I9GH 4KKCC 3RVTC 3KPPB 3U0TB 4W4NA 5CLWA 5DEGA 2VLJE 1OOAA 1IBGL 1PDKA 2VJXA 1QPPA 5GJSH 1X6NA 5CIPA 3K8LA 4U1SA 3O4LA 4TSCL 3CDYA 3QCVL 3FQTA 3CFEB 1NBQA 4HCRL 3QO1B 4QXGL 4Z7OF 4ZPVA 1NEZG 2ICWA 4MJ5B 3EYVB 4OF7A 1J86A 4J8RB 1FC2D 5DUML 4LGPB 1K5NB 3ARSA 2OR9H 4OLUL 3U2SA 2W91A 4NFDA 2APTA 3TN0B 5F97E 2YMXH 3V6OE 3IDNB 2I07B 1A7QH 2YSSB 1EHXA 3WYRA 5T1KB 3RWFB 1AP2B 3RAJH 1LK2A 4Y16C 1TVHB 3GMOB 3B2UD 5GGRB 4BKLA 3ELAT 1BLNB 1T5WA 4XP9L 3QJHA 5DHVH 3DO7A 4TULL 3QIBA 2GK0A 5GJTL 5HDOA 3ARFA 3BZFB 1UXSB 2AEQL 3NA4A 1KCRL 1T1XA 4MCZA 4TVPE 5HPOA 3R06B 3DGGB 4MD5B 1MCPL 3RHWF 2WWMD 4OCXL 4Y5VA 1J1PL 1IZKA 1R3KA 2BNQA 4UUJB 1H3PH 2EE9A 1GGYA 2D7OA 4RMSA 1QFWM 1CTNA 4J6RH 1JZ6A 3C8DA 3GNML 5GGTA 2HG5B 5EU3A 2JB5L 4D3CL 4KXZI 3ZTJH 3O41A 1YUHA 5GGUB 3M17B 2DRUA 3RIFF 4ERSH 1J05B 5DURB 1NJ9B 5ITFB 1J1OL 1UVQA 2HN7A 2HTLD 3T4AB 1KULA 3T0AA 2R29L 4I0PC 3QUYA 2IPTH 2YPLD 2LTQB 4KKCD 1EEUA 1FNGA 5EO0B 3RVTD 4GLRI 4HZLA 2B5IC 4LCUB 4POYA 1S8DB 1ZANH 4WIQA 2FRGP 3MV9B 2LABA 3P0YL 4QRSA 3O4LE 1UXWB 3ET9F 1F4YL 1I3RA 3Q5OA 5JXAL 1DN0B 3EO1A 1NKOA 2WSKA 2DD8L 3OG6B 3U1SH 2ERJB 4LSTH 2P47B 1CDGA 3QNYA 2CKBH 4PJGB 1U8LB 3HE6A 4CVXB 1KCUH 2ESVB 1NKRA 1CVRA 4HMEA 1K85A 4OQTL 5AAMA 5TF1H 5D7JB 4CDHA 3VA2C 5KS9B 3MGOB 4LRIA 3MJ8B 4PRPD 1A3LH 1MHHA 2GY7B 5IKCA 5IOPB 3DOSA 3MRGB 3OPZH 4Z7VE 1IGJB 5GRYA 4ZQKA 3HC0B 4LSVH 3OKLA 4K3DH 4Y16D 5KJRH 2NY1C 1JVKA 3RVUC 4WI8A 3UBXI 3VXNB 5C3LD 3QHFL 4CADA 1P7QB 4O9HH 5F7EL 3GKZA 4XMPH 3FZUD 2BCKA 4P4KB 3NCYS 5CGTA 4ZODA 5IB3B 2VDLL 2NY5C 3DI3B 3EYOB 1KPVB 3PE9A 4NZRL 4Q0XL 3SDAD 1LO2L 5GS0C 4ZO6A 4NRYA 4JM2C 5IIEA 1PX4A 4HKZB 4N8PA 5GRJH 4X6EA 2C7UA 3MLYL 5JOFA 1ND0A 1S7WA 4RGOL 2CIKA 3QWRD 2Q3AA 4MQSB 1NMCB 3O3DB 4GAJH 3W9DA 5DMKA 4K8RC 3U0PA 4P2YA 2VDRL 1FZKB 1UKQA 2BNRA 4WW1A 3VFVB 1KENL 3VDCA 3T0DA 1IC4L 4R8WH 3MLZL 3PP3K 3IRPX 4ZSOE 2WLYA 3LKPA 1DBKH 1FYTB 1JJUA 1PD6A 1FFQA 2BMKB 3CAFA 3KNBA 3DBXB 4RWHA 3VH8B 1F6AA 4NT6A 5I17B 1RFDH 2OJEA 2EICA 2QL1A 2AXHA 2IG2L 4OUOA 4JFOA 4YH6A 4JO2L 4UDTA 1K6QH 2HWZL 3MLXH 3BSZH 43CAB 3EO9L 5EIIB 3K2UL 1KJVB 1K3IA 3BGAA 3I02B 3I6KB 1EHAA 2NY1D 3RVUD 4PREB 3VRLE 3QH3A 2H32B 3S37H 4PJIF 1CXKA 1FVCA 5BS0A 1XGYL 3SDCA 5FYKU 3EIFA 1S7VA 4JG0L 5JXEC 2A73A 4FQLH 5IK3A 2IH1A 2W92A 3MODH 5F71A 1I1YB 5EPMA 1W8NA 5ABDE 2PW1B 1KJ3L 4JKLA 3WXVL 5FGSA 4FQQB 4JM2D 1QA9B 3F7VB 2YD8A 3Q1SL 3WS6A 1PG7L 1QO3B 1LEKB 3LKQB 4I3SH 5I15L 5ISZD 1CCZA 3P3YA 1I7TB 2YD3A 3HS0B 3BIAX 2C9AA 4Y88A 3H8NA 5EWIH 2G5BA 2A6IB 1QG3A 1YECH 2OI9B 3CX5J 2HYMA 1BFVL 2PO6C 3UTOA 4JO1L 4UBDC 3B5HA 3DX6A 4KRPC 4OV6F 4Y4KB 3KXFB 4HULB 1JGLH 1MJ7H 1UWEH 3BYTA 3LS5L 1U9KA 5D8JL 1HZHH 2Z93B 4R96A 5TDNA 1QSVA 3EDKA 3D39D 4HKJB 2A83A 1N0XL 5E5MA 1XGUA 4A6YH 5MP6H 1HXYB 3GSWB 4CBPA 1X5KA 4KDVA 4Y4FA 5HHVL 3GMPB 4AEFA 2WBKA 3K0WA 3PP3H 5BZDA 4K7PY 3U4EB 4HWBL 4NQSB 4J3XA 4MJ6B 3SJVD 4NZDA 1BP3B 1AGEB 2KBGA 3P9LA 3VXRB 1FL6A 5HYSB 1MJUH 5FV1L 3U83A 4M9PA 1C1EH 5E1HB 1OGAB 4QRRA 2VLRA 4ZTOL 3HTLX 2OP4H 2ZP0T 1NPUA 2X7LA 4NCC1 4D0DA 3DETD 4NNPH 5D96B 1IGYB 3VFMB 1KB9J 4ODVH 2EYRA 1LWRA 2B0SH 4TNVK 2ZKHL 5CP7B 1PKOA 5K9QG 2YD2A 1ZMYA 5INDB 3C5JB 1QRNB 1MAML 3BZEB 5IMOA 5LKNA 1KTDB 3AU1A 1CU4H 5ACZA 1ZVHA 2HP4A 3EJZC 4KVNL 2X4OB 5I8KL 3VXSA 2EDRA 3CK0L 4YUEH 1FGNL 3W11D 4OQ1A 1WUNT 4LARH 4HXAH 5D2NC 3F7YB 3JVGC 4O02L 3NOIA 2AJ3B 5D9SB 4I4WA 3L3IB 2PO6D 1FIGH 1C12A 1OW0A 3STBA 4UBDD 1AFVL 1KB5H 4JFQB 4MXVE 1T20B 2Q86B 4BFBD 1IGFH 4LAQL 4QOKA 1YPZF 1HH6A 3NCBB 4XBGA 3VRIB 5JHDB 3VJ6A 4M8VA 1H9VA 1LMKA 4L3EA 2AAVA 3I3EA 4F57H 4WO4C 3NCJH 4MVBD 4HX1A 3LHPH 1ZOXA 3GK8H 4HS3B 2XN9D 1OHQA 1KGCE 3MBEC 4OCSL 1MCWM 1HXMB 2DLHA 4JY6B 4TQEH 3S3PA 3KPMA 2OR9L 2YA1A 3S88H 2QKIA 4RNRA 4QRRE 4WJ5B 2YMXL 5AUMA 1A7QL 1UWXH 2HJFB 3D25B 3RAJL 3CSPA 4XI5C 5J3HC 4PRBB 4DAGH 1K2DB 4KROB 2K7PA 4X5WA 3Q0HA 4XAKE 3TESA 1TCRA 3M45A 3RL1A 2D3VA 1G0DA 4P23D 5IR1A 5CZKA 4R6UA 4MDJA 4GFTB 4X7EC 5HHQA 2FGZA 4ONHB 2NXYB 3TNNB 2VIRB 3F5WA 2QTEA 5D70H 3VXSE 1JPST 5DC4B 4O2FA 4K3JH 2BXYA 3W0WA 1NCUA 1G7JB 5GZNC 5EUOF 1NC4B 2BVPB 4HWUA 1KXTB 1RK0B 3ZYIA 5L0QC 4IRSA 3UMTA 4JZJA 5C08D 4ODUA 4ODXA 4ERSL 1CD1B 3CPLA 2FX9H 5D1QB 3U36A 1T04B 1KCSH 1O7SA 4HUWB 3VRLF 43C9B 1CG9B 2P8PA 1Z9SA 3MX0A 2BVEA 3N0PB 4K07A 3HG1B 4L3EE 1ZANL 2ENYA 1E4KA 2HLFC 5J6HB 3S4SA 4WENB 5HVHB 2ID5A 4L8DB 1FZJB 1PEWA 4LSTL 1A7OH 2Y25A 1CT8A 3EDJA 4HGKC 1KCUL 5I73B 3MBED 1IM9A 4R7NA 2BOBA 2B20A 3FB6A 3LZFH 5TF1L 3T4YA 5IMLB 2DJ4A 4MNQD 4PIRF 1A3LL 3MV8B 2AJVH 3OV6A 3OPZL 1YEGH 5CHNA 4ZTPL 2YN3A 3S4SG 2PCPA 1URLA 3BXNA 5J13B 4PR5A 4K3DL 3L95B 2V5YA 5J3HD 5D7SH 5EN2B 3BP4A 4O9HL 4OJFL 3K7UA 4XMPL 3RUGB 5DJ0A 2VOTA 3LIZL 2IBBA 5ITBH 1A9BB 1JTTA 5EU4B 3WO4B 3HNSH 3PV6B 5FYJD 5D7LA 1IEBA 1LEIB 4D9LL 3K1DA 4XT1C 1A8JH 1HOCA 4NZTH 2X4QB 2H3NB 3AXLB 4OV5B 3W0WE 3ZE2E 4O51B 5ENWB 4QYOA 2ZCLH 4YDJB 4R7DB 5IEKB 3EHBC 3UC0H 1WVZA 1MRDH 1LVEA 2BERA 1OD9A 4CNIA 5TE7H 5GRJL 1RZIA 3QXVA 1IJ9A 1XIWA 2D7NA 3T0EB 1WTLA 1F6FB 2BOCA 1EJOH 3F62A 4AG4H 4JZNB 4GAJL 1WFTA 3O3EA 5EIVA 2VDOH 4KQ3L 5C09A 3BUYB 4CUCA 4U7MA 4JAMB 4LU5H 1AIFB 1HWHB 1MFEL 3VDAA 4DGVH 3BD3A 5FM8A 1N59A 2R15A 3QXAB 4OB5H 4R8WL 4Z18A 1KIPA 2JLLA 4M03A 4DOHE 3E1F1 1DBKL 4N1HB 3B83A 5E7BA 5A1AA 5DRWB 3LKRB 2VQ1B 1HSBB 3OXSA 1SVCP 3HZMB 1QSZA 2XT1B 4WU5A 1RFDL 4XCCH 3TBTB 3OHXB 4LFHD 2A9MH 3PHOA 2J7LA 4QRTB 1K6QL 4YK4B 2X10A 3MLXL 4KGLA 4AT6B 3FQXB 1DBBH 2Z0BA 3O3UN 4QXUH 2FATL 1Y18B 1YJDH 1P84J 4XPHH 2NY6C 3FKUS 3S37L 5MEQA 6FABH 4YO0B 2VQUA 3SDDA 3O9WB 4X98A 2GJZA 3FO9B 4HBCH 3KPNB 4P5KB 1J5OH 1MFCH 4FQLL 3GUTB 2HVKB 1IILE 3VWJD 3WS3B 4I0KA 4LDLB 3MODL 4WHYG 1OY3B 2ARJQ 2V5TA 1WICA 5C0BB 4QTIH 3RX5A 2AVGA 3LQAH 4MD0B 4LNVA 5LAXB 1G84A 1NFDA 4LPWA 3SDAA 2XA8H 4I3GA 4XNQA 1G6RA 4QKXB 4I3SL 3RL2B 1X4ZA 3V0AC 4WWKB 5FAAA 1HK6A 4LIQE 3ARGB 4JDZB 1F4AA 4QY8A 3CFJB 5EWIL 4XCYA 3VG9B 1YECL 3QWRA 4NGHH 2YPLE 3PGCA 3O2DH 1T0MA 4F7MB 1ED3A 2ED8A 1JGLL 1MJ7L 1UWEL 5E6IC 4ZXBA 2ZSVB 4I1NB 1NGPH 5E9DD 4LLQA 4Y5YB 4ELMA 1FFOA 4UTAL 1KIQA 3PQYA 3MREB 4TSAH 5B39B 1EFXD 1XEDA 2WIMA 1XT5A 2FO1A 2LAAA 4A6YL 3GGWA 4QCIB 1ZVSA 5MP6L 2DYPD 3HLAA 2D4FA 3QO0A 3JSSA 1A7PH 4BQ8A 2DLTA 4PRPE 2FHCA 1G7PA 1IAKB 2VITA 1V7NL 4QWWC 3QUKB 3D0VA 3PHSA 1MNUH 2OQJA 3KYNB 5IVNA 3O6FA 2R4SL 1MFDH 2ZG3A 4DZBB 1DDHA 4EUPH 3VFOB 4MJ2A 5F1OB 3OKDA 2JCCA 4OGAC 3MRQB 1MJUL 3RNQA 1C1EL 4RMWA 3L1OH 1KACB 2OP4L 2NY0D 4JJ5A 5EZLB 2IMNA 3C5ZB 4ODVL 1PSKH 3TBYB 2F53A 1Q1JH 1NFDE 3QWOA 5KSBF 1FL3B 4IBLT 4MX7B 3BPNC 1OQOA 5C2BH 4KK9C 4UI2A 2CQVA 1CU4L 2V7NA 3JV6A 4S11A 4XCNB 5D1XC 3SDXB 3KYMB 5ICZB 3GHEH 1EHNA 4YUEL 2NY7L 3G04A 1P6FA 1DUYB 4U6YA 3NZ8B 5EOCH 3UPRB 2IANB 4LARL 4HXAL 5ALCH 5DK3A 3VA6A 1FIGL 1PKQA 4O4YH 1KB5L 2EO9A 5IV2B 2X4UB 3BPCA 5DFVD 2HRPH 5E6ID 4LCCB 1IGFL 3ECBB 1G7HA 1OAZH 5DJ2A 4IDJH 5ESQA 3B8SA 4F57L 1K4CB 4Z7NE 4KQ4H 3KLHC 3NCJL 1V3LA 3D39A 3LHPL 5DJZA 2H8PA 4ZUVB 4B7IA 2WUBH 1XR9B 3GK8L 4KH2A 1X5AA 4HBQA 5DJYB 4EJ1C 1UCBH 4XMKL 2VTFA 3ARBC 3PWLB 5CBAA 3HRZB 2HFFA 4TQEL 5IUSA 2Q76B 3BYYA 3LRSB 4Q97A 4V1DA 2PTTB 3MZGB 4PV8A 5JW3H 2ORBH 1T1WA 3RU8H 2D0HA 5DK2B 4DAGL 1JPFB 3PP4L 4I18C 2K3TA 4X5XB 4Y2DB 1A6ZA 5JPMB 2PR4H 4X9HA 2OSLA 2CIIA 1BZ7A 1KIRA 2VXUH 5D70L 4OZIE 2YXFA 3U82B 4PLJC 4GS7B 4L9LB 5D1XD 4K3JL 2WINB 5ISZE 4X8JA 2IADA 3NFPB 2VLJB 4X6DF 3VWKA 3FAXA 2P24B 2H1PH 3JTSB 4L9DA 1PKQE 5DVLA 3CDGA 2BC4B 3WFBH 2C3XA 3FONB 4OGXH 3BGMB 1KCSL 4K23L 1F45A 3N50A 1RZKH 4RX4D 1OLZA 3B9VA 3X12B 4RGNC 1CE1H 1QFHA 2J12B 1M6OB 1KPUA 4Y4HD 3AS1A 5IFAL 1A6UH 5CGMA 3QEHA 3NIFE 3ZE0E 3T3PE 3KDMB 1A7RH 3D39E 3QNXB 3WHXA 1JMZA 3KLHD 4JPVH 1FNSH 1UZ6E 4CU8A 5HYJD 1NAMH 1W0VB 3TYGL 5F72S 1A7OL 4ZS7H 1OCWH 1BIIB 2OL3A 3ARBD 3LZFL 1P4LB 2PW2A 4E41D 3DROB 4RAUB 4F7CA 2AJVL 4YC2C 3B8YA 1TZHB 3SJVE 4L8BB 1UB5B 1GHFH 4KWUA 3IETB 2AQ1A 2Z8SA 5DQJB 1ZHBA 1X5LA 4G8GA 4U2YA 5F1IB 4NZUH 5CFHA 2P43B 1AQKH 1J7VR 2EXYC 2XKNA 3MXWH 5D7SL 1IGML 1CVSC 1U8QA 4ORGA 4YBLB 3HC4H 3RVXD 2X4SB 5ITBL 3HNSL 4R90H 2JJUA 4X4YB 3CSBA 4PJ8B 4NZTL 4P23A 1OAXH 4MNHA 1MHCA 2ZCLL 3QEQD 2RFXB 3WNPA 4I5BB 3PL6B 1FO0B 3N1FC 5EIQA 2V2TB 3B3IB 2EDJA 1MRDL 5GRVK 5TE7L 3ZYJA 1MQKL 3O4LB 4GW4B 4YHNA 1KJMA 2GSIA 1ZHNA 3FQTB 4PRAB 1EJOL 1SMOA 3SE3A 4WUUD 4HEPG 4Z78A 4LU5L 3GSRB 4RGND 4LQ1A 4DGVL 4LCWD 4FFVC 5F3HA 1VDGA 1AXIB 2JIXD 4YDLB 5KS9A 3GMQA 3TJEH 4Z7VB 1FVEA 1VFBA 1X6LA 2FEEL 2Z91B 3H9YA 3OKKA 4DZ8B 1A14H 1NGZA 2C26A 3RWHA 5LCVH 4HAGA 5I1IH 2XN9E 2GK0B 3U4AA 4XCCL 5J6GB 4ZUWA 4JREB 4K2UH 2H32H 2QEJA 2A9ML 4M48H 5IB5B 5IM7A 3MRHA 4MNQA 2VXTH 5E5UB 4Y5VB 1DBBL 1R3KB 1X5JA 2KH2B 3LN5A 1I7UB 1U91B 4QXUL 1YJDL 2EXYD 4XPHL 5CJOH 3O3BA 6FABL 5EU3B 3FQRB 1MCLA 3P9MA 4M6NL 4DW2H 3O41B 4NO2B 1VFAB 1UH2A 3NFSH 1UVQB 4HBCL 4NHCH 1J5OL 2YPKA 1MFCL 4ODHH 1OAYH 1XAUA 1WIOA 5E8NA 1RUKH 5BW7C 4QTIL 3SCMC 5DDHB 4XVUC 4Y8AA 3LQAL 3P73B 4HUVA 2XQYG 2R8SH 3CIQA 3TV3H 2FIKA 2XA8L 3ZMRA 5L8JB 4KUZH 1I3RB 4PJIA 4PS4L 4AIOA 4ZSOB 4OZ4A 3EUUA 2DQEH 5MEOB 4HGMA 3WNMA 5D2NE 5C08E 1KPRB 3QNYB 2AEIT 4W68A 2XFXA 2V2XA 3HE6B 4JFEB 3VI3E 4MLIA 1KXVC 5IBUG 4FMKA 4NGHL 4RQQB 3QWQB 1I85C 4FFVD 5IKCB 4PLKC 3O2DL 1LO3H 1VCAA 4Q2ZB 4NM4H 4ZQKB 3OKOA 4MA1C 4R2GB 4IJ3B 2YD9A 3DSNA 3OXRB 4TSAL 4EI5C 4M43H 2ZOKB 1TPXB 4H0GA 1F3DH 1HNFA 2YD1A 1MRFH 3D85B 4GO6B 2ZPKH 1GOHA 3IFLH 2NTSP 3KJ4B 5F21B 1A7PL 2F54A 5IB2A 2UYLB 9CGTA 3BHBA 4P46C 5H35B 4MNQE 1TQBB 2XICA 4U49A 3L3JA 2WWKT 2FYYB 3QQNA 1MNUL 4CAGA 1GIGH 4JQXA 2WZPD 4JRYD 4D0CA 1T5XA 1GPOH 1ZA3A 2GW5A 3L1OL 1ND0B 1X5ZA 1S7WB 4NN5C 5D6DC 3SE4C 3ALXA 5FYJE 2Q1EA 4JJHA 3F12A 1A21A 1PSKL 2R23B 4WW1B 1Z6JT 1Q1JL 3L5HA 3GIZH 3SCMD 4EOWH 4RMRA 4XVUD 3MTRA 3VWJA 3O8XD 3GO1H 5C2BL 4DVBB 3D6GA 3KLAA 2A9NH 5C0GA 1F58L 3CSYA 3SQBA 2GFBB 3BDBA 2LQRA 2NQCA 3GHEL 1NGQH 5EC2A 2EDXA 3BGFC 3KNBB 4N0YH 3G6AB 3NIDE 4U1GC 5EOCL 1F6AB 1OB1A 3OKEB 3DXAD 5ERWB 2NY2C 1FLRH 4YBQC 4IOIB 3TT3H 2Y6SC 5ALCL 1RPQA 4MWFA 4XPFH 4DWHA 5FGBA 4O4YL 1WFNA 5C0CD 3UYOD 5CEZH 5BO1H 3ARDB 3TH2T 5BVJB 3PWJA 3RWEB 2HRPL 3PJSA 4YPGA 1C08A 2YBRB 4OZHF 1AKJD 4ZS6C 1YEIL 4N0FB 1MCQA 2BVQB 1MF2H 5J11C 4FQ2L 4EI5D 5E9DA 5IB1A 4MAYC 1KN4H 5DGRA 4HDIA 4H8WL 1UM6H 1WC7B 4KQ4L 1EFXA 4PRHA 5I8OH 1S9YA 3W9EB 2WUBL 4JCLA 1S9WB 1ZT1B 2HFEA 3PF2A 4P46D 4YZFF 3ZLQC 2VUYA 5JW4R 3TO2B 3MRCB 2ZUTA 1YYMH 3P0VH 1UADC 1YPZA 1I9IH 3QSKB 2DQGH 4J3VA 2IBZY 2ENSA 2GITA 1ROWA 3RI5F 1CFVH 3IDYB 2ORBL 3RU8L 2VERN 4LLDB 3QZWA 4ZAKC 2G5BB 3S98A 5IG7B 3DYMA 3QQ9D 1GXEA 4XBPA 3UJTH 1KLGB 5CEYA 1E27A 3OL2A 5I2IB 1LP9E 2PR4L 3DX6B 4F9PC 2Z31B 1ACZA 1R3HA 3O6KH 3ZT5A 5FO7A 2VXUL 1NGWA 4PJXF 1TJHH 2R0KH 2EH8H 1YJDC <