4YC2C

Crystal structure of the stabilized inner domain of clade a/e hiv-1 gp120 from e. coli in complex with the antibody a32.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
210
structure length
210
Chain Sequence
b'VLTQPPSASGSPGQSVTISCTGTSSDVGGYNYVSWYQHHPGKAPKLIISEVNNRPSGVPDRFSGSKSGNTASLTVSGLQAEDEAEYYCSSYTDIHNFVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords The stabilized inner domain of clade A/E HIV-1 gp120 from E.
molecule tags Viral protein/immune system
source organism Human immunodeficiency virus 1
publication title Paring Down HIV Env: Design and Crystal Structure of a Stabilized Inner Domain of HIV-1 gp120 Displaying a Major ADCC Target of the A32 Region.
pubmed doi rcsb
total genus 40
structure length 210
sequence length 210
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yc2C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yc2C02
1HNGA 1FN4B 1UH3A 3RWJB 2BOCA 2HT4D 5IHZB 1CWVA 5CHNA 3D18A 2ADGB 3CSBA 5TH2A 5C8JA 3QO0A 2GJ6B 1QA9B 3CX5J 3SE3A 4LLDB 5I2IA 2LABA 2YPVL 1QNZL 4RFEB 1B0GB 4LEOA 1T89A 1VB9A 1K4DB 2EDRA 4X5LA 2RHEA 1F97A 2AJYL 5ID1B 5ID1A 3TCXA 1XZ0A 5I30L 5BO1L 1MFEH 2DI9A 3U79A 2G9HB 5BRZE 3HS0A 4Y5XB 4N0YH 4P23C 1CD9B 4NQDD 3G5VA 1N8ZA 3GNML 2DLTA 3VD4A 3MV8A 4MAUH 2OL3L 3TFKD 4UU9A 1ZVSA 3I02A 1IGJB 3IU4L 3O3DA 1FBIL 3AB0C 1G7PA 3MXWH 2VLJD 3QQ9D 1LDSA 1P4LA 2NX5E 1BECA 3DHMA 1FYTB 4U1GB 1BPVA 3FMGL 2DWEA 4LQ1A 1AXTL 3GMRA 1MIMH 1NUDA 4R7NB 5M7QA 1PY4A 3WSQH 1ULVA 3KPPA 4HUUA 1T1XB 4NRZA 5D2LE 1SJVA 4ISVB 3IYLW 1NBYB 4WHYH 1U93B 4JQIH 5JHLH 2IAND 1ED3A 4M5YL 1A2YA 3SBWA 3TYFA 4FABL 3WE6B 4WEMB 2BRRL 1AIFA 1NGYB 1BZ7B 2UY6A 2VDKL 4Z7UA 5AYUL 2BSRA 4U1LA 1A3RH 1S9XA 1S7SB 4FABH 2NPLX 4EEEA 5JA9A 3ZZ1A 2VNCA 5JHLL 5KG9A 1W0VA 4UIKH 5LJYH 3AM8C 4CRPA 5J1TC 2FH6A 4PJDB 5DI8A 3VMOA 1AKJD 3PF2A 2PYFB 1U8QA 5JUEL 3BSZL 3IETA 4UDUA 4ZTPH 1ZA6A 4Y16B 1CLYL 2PO6D 2J3SA 1I7ZB 3CFKA 3HC3L 5BQ7A 1OW0C 2ZPKH 5IMKB 1IBGH 3SDDB 5ESAB 5HHOE 1X5JA 4LF3A 4I3GA 2VZ3A 3QCUL 4PV9A 2XI9A 4U7KA 4HJGB 2L4OA 4TULH 3GNMH 5D96B 1DLFL 5DRXB 1AGFB 4TNWK 3FONB 1T20B 4CMHB 5BO1H 2AJ3B 4H25B 1H0DB 2RR3A 3MMEB 3SKUD 2YD9A 4HUXA 1DQLH 5A43C 1Q9LA 4I2XB 2PYEB 3MFFB 2H6PB 2ZSVB 4YDLB 5FA4B 4OZGA 1T6VN 5JPMA 5JXED 1ZVYA 3TZVB 1FGVL 2EDFA 1U8KB 4R90H 2GITA 2XG4A 1KFAH 4ZUWA 3JV0A 1HYRC 3KPTA 2BERA 3RWEA 4F57L 1SYVB 4ZS6C 3FB6B 4LU5L 4YHPA 1HI6B 2CR3A 1DVFC 4GUPB 5GIRB 2A6DB 4NQCD 3TYGH 3DSFL 5DK2A 1A6UH 4G80A 1HHGB 5FV2A 5TE6L 4W4NA 1K8IB 3TA3A 5FGBA 1CLCA 5J1AA 5FO7A 3A6BH 5GRUH 4GSDL 4WHTB 4HS8H 4HFUL 1ORQB 2VXQL 3BUYB 1UGNA 3ZT5A 4QOKD 1G0XA 4G42A 4Z7QE 2CKBL 3MJ7B 1UVQB 1FIGL 2AK1L 2NNAB 4X98A 1CD1A 5GGQL 3ARDD 2DQUL 1Q38A 5B8CC 4PBVC 2FJHB 3CFEB 5C0EB 4L8BB 1VFAB 1FCGA 1I1YA 4PJDA 4PJ9B 2JCCF 3OZ9L 2P5EA 4WUKH 4WV1C 3IRPX 1KG0A 1FH5L 5FAAA 5ICXB 3MRMB 4N5UA 2C4FU 3K74B 1I9JL 3ZKSD 2YPLD 1MJJA 1C7TA 1PKQB 5T1KA 1XR8B 3ARXA 4MA8L 4P2OB 3MBED 1G7QA 5GS2D 5JW5B 1KB5L 4CVWA 3TYFB 1BBDL 3FFCD 3OAUL 1F3DJ 5D7KD 3GO1H 2J88L 3QQ4A 5CJ8A 2R2CA 4KKAD 4L4TE 2QQNL 4XVSH 5DEFB 4KXZI 2BVPB 3O6KH 1I3VA 3HZMA 5I9QB 4PRDA 4ZUUA 3IFLL 3SDCC 5D5MA 4WRLA 4FS0A 4I9WD 4RRPG 1AR2A 1T04A 1WBZB 3KPMB 4YXLH 1A3LH 3ALWA 2WWMC 2F54D 4IOSD 3L7EB 1QBMH 3EO1A 3IFNH 4QRTB 5MEOA 4KKCD 3K8LA 3L3JA 4XPHH 5JQ6L 4PR5B 1RZJL 5EN2B 3CXHK 4LL9A 1RUML 1XGUB 4HHAB 1KULA 1T5WB 1URLA 4JKPL 2OP4H 3IDUA 2Z8SA 3O3BA 1B90A 2KBGA 4JG0L 1ZHKA 4OFDA 4KC3B 3RY4A 3CSPA 3WJLC 4WI7A 3MLYH 2Q86A 1WBYB 4PJ5E 5D4QA 4Q97A 5HGBA 4GAGL 4X4XA 5HSFA 1CDBA 5F88B 5EZLB 3RIAF 2PCPA 1DBKL 1J8HA 5DD3L 2EYSA 1JGDA 2B1AH 1G6RL 3D18B 1Z6JT 4M61A 2WBJA 4LPVA 1D5XB 1EK3A 4H88H 3MACL 1KCLA 1U8PA 2EXWD 1U41A 3RY6A 5IFAL 4J3WA 2J7LA 2CIKA 3UZQA 1DVFD 3HAEG 5GSVA 5DRNA 2RAMA 4BZYA 1GRWA 3T4AB 5C6PB 3T0AA 4APQD 3C9NB 5DJ8A 5CUSL 3VMPA 8FABB 1A02N 1UYWH 1EERB 1F13A 2EIDA 3EYQD 4C56D 4GMSH 5IQ9B 1OLLA 2QEJA 4TTDC 1UM6L 3MRDA 4XNXH 3RZCA 2JJTA 3SO3C 1NL0H 3BHBA 3QFDB 4JDTL 4PRIB 4GUPA 4G6FD 4Q74A 1YMME 3GSQA 1CXLA 3GRWH 4DAGL 3VGFA 5IW1A 5CZXC 2NXZC 5F6IB 4CVXA 5DJ6A 3QEGH 1ADQH 5SWSB 2OQJA 3MLZL 4O2EA 3C6LA 1INDL 3SOBH 3TO2A 5F9OH 1U3YA 4JN1L 3E3QE 4PGDA 4HIIA 2IGFH 4EXKA 2NMSA 1IEBA 4PP2A 3TPUB 1AFVL 1UXWB 1RZIB 4OD3L 7FABL 1GOGA 4F9LA 2OYPA 2WBWB 3SJVB 2EDEA 4LSRL 4FQHB 2O5YH 2IAMB 4Z7NF 2IFFL 5FUOH 4G9FA 4QRUB 3QH3A 2HFGL 4OD2B 3O9WD 3RL1B 4FOMA 3VI3E 2ZCHH 4R9HA 1IMHC 2FR4A 3HI5H 5FF6A 2CK0L 1RHHB 3V6OA 1IC4H 2DQFB 2UVFA 4EN3B 1YQ2A 1J88A 4OF3A 5DJAA 1IFHH 3GSOB 3QRGH 3X3GL 3KR3L 2EYRA 5D7JB 4JAMA 4HGWB 5FM5M 2AW2A 4U1GC 1DL7L 1AI1H 1JE6A 3FAXA 4X7SH 5I1DA 5AUMB 1KELH 3IDMB 3B3IA 4I9WE 1BQLL 4OIIL 1GGCL 1HINH 5CIPH 5EU6A 2VB5A 1RVFL 3KPRA 2X6MA 4MNQB 4G8IB 1JHLH 2DTML 1MHEB 3O8XB 3M8OL 3O8XA 2H8PB 2ADJB 4NC1C 3KLHD 5GS1C 2IPKB 3CFCL 1F4YH 1TCRB 2FZ3B 3SCMD 5JXEA 4N8VA 5EUOB 3LCYA 2I07B 2NX5D 4HWUA 5DSCB 5HGDA 2GJ6E 1EFXB 2IAMC 2VXTH 1H3UA 1H8NA 2FO4B 2G75B 5C0ND 4LPUA 1JN6B 4DUXA 3EJJX 5I1LA 4JANA 4M1GL 2VDPL 2FATH 5IVZA 5D7JA 2XWBB 2ICCA 3DIFB 4D8PA 2HVKB 1QHOA 1RD6A 2E6PA 4V1DD 3BN3B 3KWWB 4XVJL 1WC7B 43CAB 3QIUC 5ILTH 4S1QL 4XX1E 1P7QA 1VADA 2WIIA 3U0TB 1CFQB 5SX5K 5HVHB 3QUMH 2Y7QA 3VD5A 3UTTE 3GIVA 4YWGH 3SJVD 5EUKA 3RBGA 5IK3A 4TTGA 4L5FH 1F8TH 4M8QB 5H37H 1ZGLM 3LSOA 2EO1A 3D39D 3K2MC 43C9A 4H1LG 1T1WA 2VZUA 5IV2A 3MA9H 1V7NH 4LSUL 1TVBA 4OGZA 1OQXA 1MF2L 4OLUL 4PRBA 2XWTA 3O41B 2OI9C 4CMHC 4PGBA 1PQZA 4UBDC 4CGTA 3ULUD 2E5EA 5E5UB 1FCCA 4QRQA 4O5LH 2N1KA 1NFDF 4XP6H 4AEFA 4LK4A 2X9XA 5D6DC 4G6KL 2P5ED 4Z95H 3AXLB 4L8SA 4YJZL 3PGCB 5J4MA 1TZIA 3RJDA 5CAYB 2VZ1A 5J6GA 2QV2A 3GSRA 1ZT4A 5H94B 4OCSH 3WIIH 4PLKC 4I0PC 4G8GE 4M6OH 4EDXB 4YHOH 2EXYC 4W4OA 3F5WB 1TJGL 3DGCR 3MCLH 3FCTA 5DJYB 3GSWB 3OJDA 5CGTA 4NWTH 4JJ5B 3UJJH 4F7TA 4NZRL 1JZ5A 2EYTB 4IDJL 1BZ9B 1HKLL 4LCWD 5C0IB 2NW3B 4PJEF 2E6QA 1EJOL 3JVGC 4LLWA 3HRZA 3DV4A 5C09D 5D7IA 1N2RB 4GRLD 3QUMB 1AD9B 2LU4A 3IKCB 1H3GA 3CVHH 1I4FA 2HFEA 1C08B 3UTTA 5FYJL 3S35L 1JTTA 3FO9B 1A1MB 1JHKH 5E8OB 4P5KA 1IGFL 1JHTA 5CSBA 3LZFH 3TF7C 4O02H 4IRJB 3MJ8B 5T3XL 3LV3A 3BW9B 2B2XL 3U4AA 3VFSB 5HHPA 4EN3D 3QULA 3D25B 3TIEB 1JWMA 4HJJH 2BC4A 4BFBD 3S36H 2AEIT 4JO2L 5BOZG 1CL7I 2R15A 3HNTH 4KQ4H 4QO1A 1ETZA 3DETD 3BXNB 1RZ8B 2PYEE 4UOW0 2K3TA 2W07A 5CILL 3NIFF 1KJVB 4JN2A 5BW7A 3PHOA 5CJOL 4YDIL 1I1FB 2VE6B 1SEQH 3T0VA 2GK0B 1JFQL 4HKXB 1RK0B 1JIBA 3HPLB 4LHQB 2M26A 4TOYL 3VXUD 2E8YA 3MA7A 5L2JA 1PG7W 3WD5H 3OSKA 2NY6B 3MZGB 4PD4J 2V6HA 4XPTH 3S96A 4RIRA 3SN6N 4WDIB 1NCWH 3TBWB 1MRDH 3RWEB 1QYGH 4P4RA 1V3JA 1G7LB 5CINL 5FCUH 4JG1H 4UDTA 4JR9L 2DLGA 3S3JA 1MELA 3BT2H 4K8RL 5DVLA 1QSVA 4WIQA 4OF5A 1WEJL 4HPYL 1OPGH 4I18B 1XF3A 4P0DA 3QUYA 1RULH 3Q3GB 4OLWH 4XCCH 1U92B 1YEHL 4ZO6A 3N1GC 5E4EC 3RWFB 5KSBE 3DYMA 2YBRB 3T65B 4DKDC 4FA8A 1K6QH 3OR7B 1G7QB 3VA2C 1OW0A 3BYYA 5MERB 2A9MH 2NY6D 3KJ6L 3VWKB 2CDEA 3MV9A 5I6XB 1LVEA 5BS0E 4I0KA 2HT3C 4RX4D 5E2TH 2DB8A 1SEBB 2VZOA 3JTTA 4RMSA 5EFIB 1B0RB 4Y1AE 4HKBB 1C5BL 1BLNB 4L9LA 2DTSA 1I8IB 1BVLB 1S9VB 2BNRA 2BHZA 3VFSA 3LV3B 1I7ZA 2XACC 2X89A 2YK1L 1V05A 2FJHA 4N0RA 3RHWF 5AZEH 3K7UA 4P5KB 2W60B 3EYFB 1A6ZB 1BOGB 2ZG1A 4KRPB 5K33A 4Y19E 3V4VL 2LVCA 1IZKA 2CPCA 1F2XK 1NBZA 1S7TA 3EJYC 5CLWA 3LS4L 2V2XB 4TYUA 2PNDA 1SM3L 1H5BB 5CP3H 2X4RB 4PJBE 4A2LA 4M02A 4Z7WA 2VLLA 1B4RA 1MCRA 1BZ9A 2FIKA 4P3WA 3O11B 2VL5A 3ESVF 4Q9QH 1SJEA 4HFWA 1NGYA 4LRNH 4D0CA 3EFDL 1ACYH 1RIHH 5JOPD 2DYPD 4NSKA 2VDRL 4NN7C 3TA3B 3IAGC 5ENWB 5ESVB 3QDMA 3JWOL 3QG6A 3UO1H 5L7XH 3DMMC 2P8LB 2IBZX 5E8DL 4ISVA 3BMWA 4UZGA 2DQGL 5EBLB 1WQVT 2J2ZA 4TSBH 4WTZG 5IESH 3KPPB 4HUUB 2B0SH 2P47B 1H15B 4MS8C 1N3NA 1JF6A 4Q9RH 5ITFB 3S9DB 4OIAA 1ZA3A 2ZUTA 1X7QA 4PJCE 5CZVH 3I85A 1JP5A 1DQMH 2HRPL 2D3VA 2ZOLA 3L3GB 3NACL 1MCBA 1YC7A 1M4KA 4LGSB 1L0QA 1XCTB 1IC5H 1R0AL 3IDJB 4Z5RA 2ZKHL 3U9PL 1QSZA 4LHUG 1N26A 3O2VH 2I27N 2Y36L 1I3GH 4MB4A 3I2CL 4CUCA 1CLOH 5IB4B 3KYNA 3E6HB 4JLRB 5ESAA 1XGQB 3T3MF 4M5ZL 5IR1A 3QULB 1TFHA 2UZYB 4PTUA 5HHPB 3SGEH 3MJ9L 3ARTA 3CFKB 3CGTA 3B9KA 3QPQC 4HC1A 4TNVF 3Q1SH 3PJSB 2D03L 5EZOL 2C1PA 4KMTH 4IOIA 1KB5B 2QQLH 3RUGF 2C3GA 4H5SB 4QOKB 4XP4L 4YXKL 4FFVC 3T0EA 5LWYL 5IB2B 1CGSH 2JF1A 4NHUA 2DF3A 4QTHB 2X4PB 2CRYA 4I0PD 2AQ3A 1F4AA 3WKMH 1MCOL 4U1IA 4O58H 1FIEA 1FLRH 1G84A 1D5MA 3QWOB 3ZE0F 4EI5C 3OJDB 1PX3A 5CEYB 3E0GA 3P9LA 2V9TA 4FHBD 4HGMA 1DFBL 3V0VA 5IG7A 1FNSL 3D9AL 5HHVL 2AABH 3OR6A 3UJTL 4AJ0A 1NBYA 2IEPA 4BFIB 4YHKH 4HEME 3QXAB 3WEXB 1HK6A 5E2UL 2B4CL 2ATKA 1J5OL 2VABA 3WUWG 1XFPA 1LE5A 1OAKH 4GQPH 2YPKA 1UZ6F 1D3CA 3TBTA 4DOHB 1IL1B 2JB5H 1E6JH 1U36A 1I7TA 1ZVSB 2A74B 4RBPH 2ZUQB 1EGJH 4PGBB 2NW2A 3OHXA 5D2LF 1JNHB 1OWWA 2NXZD 2HTLC 3RL1A 1I8LC 2R0LH 1MFDH 2H9GB 3F7QA 5DURB 2AAVA 3BP4A 4YHNA 2R1XA 1XGYL 1T3FA 3EBAA 1FG2A 2VR5A 5KS9E 3O81A 1K4DA 5IGXL 3ULSA 2JB6A 4ZDHB 3U0TA 5C9KA 5T1DH 1KEMH 4LMQI 3CVIL 4K3EH 5TGBB 1OM3H 3SPVA 4J3TA 3P30L 5C1MB 1X7QB 4NP4H 3MUHL 5DUMH 4ESKA 4U6YB 4C4KT 1KPUB 1JNLL 3L9RB 2PTUA 1N3NB 1OGAB 2QQQA 3G6AA 5ANMB 3SDXB 3UC0L 3GMLA 1R3IL 1DBBH 5EO9A 1J0HA 4X4ME 4OLVH 1X5YA 5BV7H 1JPTH 3VXMD 1QSFE 1NSNH 4PJXF 2VXUL 3QIWA 4G6JH 2ZCKL 2XKNB 3I3BA 2Y36H 4X80L 1MEXH 1PAMA 1Q9OA 2ORBH 4NQSB 3BP5B 3RWGB 3LEXA 4I3SL 1NKRA 3K81A 3KXFE 4BZ1H 5J6HA 1UXSB 1NAKL 4X6CE 3B3IB 5J9PA 2DJ4A 5KSVB 5EUOF 1Z0MA 3U83A 2R2EA 3AB0B 2FWOA 4PJ9D 3DOSA 1MPAL 3QPQD 3THML 4XP1H 5CZVL 2RB8A 2P42B 3T2OA 2BDNL 3MRLB 4LSSH 4XPFH 3B9KC 4ZQKA 4UNUA 3VFMB 2YKLL 4NNXB 4WCYL 1YJDH 4X6EA 1L7IH 1CU4L 2NY4D 2EICA 3EFFA 4FG6D 1HXMA 4YBHA 2DQGH 1BBJA 2CJUH 3S8WA 3D0LA 3CCHA 4XX1G 4YHIA 3SKOA 5I8EB 1T3FB 2NY1C 3FQWA 2R1XB 1HIMH 4OB5L 3V6FA 6FABL 4G6FB 2FD6L 3O6ML 2X1QA 1A47A 5DMGD 1PJ9A 1Q8MA 2CKNA 3SGDH 3EFDH 4UINL 1BIHA 2EDBA 4J7RA 5EOQL 1NKOA 4GG6A 2O5XL 4AL8L 1S5IL 3OKDA 4PY8I 4PRHA 3Q6FB 4JPKH 2EDXA 3SE8L 2GJZB 1KYOK 2L7UA 3GSXA 2BRQA 1XF3B 1KGCE 3V6BR 1JNNL 2EH7L 4RGNE 2JLLA 2J12B 3CXHJ 4WI9A 4ZD3H 4X6BA 1BVKA 5C0CA 2BFVL 3TP4A 5BV7C 4KROD 2X2YA 4CW1A 1M1SA 2OQJB 2YMXH 1YMHA 3ZDYE 4NO2A 3PDOA 3MRFB 3PQYA 2H2PC 3R8QA 3TH2T 4BQCA 1JWSB 1HZHH 3QQ4B 3BKYH 5IW1B 2D0GA 1D6EA 2N4IA 1MY5A 1C5BH 4OV6F 1XF1A 1QLEH 2BNQA 4RNRA 5DD5H 2FX7H 5EU5B 1RK0A 1WCQA 5MP6H 1VHPA 4HPOH 4EQ2A 3VFPB 4I0CC 4GT7A 3X12A 1LO5A 3H8NA 3T4AA 1EO8L 3MNWB 4F37K 3ZL4L 3AFLA 2Z31D 1AH1A 1RULL 1M05B 3ZDZE 4P2OD 3IJYB 4NKIH 4Q58C 4X9GA 1E4XI 1NJ9B 4S1SH 4LLAA 2VIRA 4K8RH 5GJTL 4MVBC 3VFUB 3FQUA 2PO6B 5J1SC 3AY4A 3OL2A 5FB8A 1X5AA 4JFEA 4HCRL 4M93C 4X7EC 3QDGD 4L3EB 3O3AA 3L3DB 4PV8A 1NGPL 4JFHD 4X7FC 3JZ7A 5EZIH 1YNLL 4G42B 4KXZH 4DZBA 1T0MA 1WBYA 4I1NB 4XPTL 1BJ8A 4PRHE 2VDOH 2KL6A 4FFZH 4NNYA 4GXUN 1A14L 1L0YA 2XFXB 4JFFE 1FZMA 4PJAE 2VLRD 4RAHA 3WL9B 5DEGA 1ZHKB 2DAVA 4UOJA 1L9NA 4QXWA 3GJFH 3CU7A 3PWVA 2D7OA 4R8WL 5DMYA 1YNTA 4ORGA 1EHNA 3IJSB 3T8XA 5ISZB 2BY2A 4RGOH 3CLFL 1KTRL 4O2FA 3P40A 4JFDB 2NZ9D 1HHGA 3FFCE 5CJOH 1BIIB 4EVNA 3GSWA 5HXMA 4J8RA 4ODVL 3VCLB 2GTWA 2ZP0T 2FEDD 5DD6A 5D8JH 5A1AA 2JKXA 3KPOA 4MB5A 4Y1AD 3LKRB 5F7WC 2CKBB 4XHJC 3UTQA 1J86A 3MGOB 3NFSL 3GSRB 3DSNA 4GBXA 5DVNA 2SEBB 2UWEA 2EH8L 2WLZA 1ZEAL 5DD1H 3BZDA 2X44D 1BD2E 5SWZE 4K23L 4AT6B 1IGFH 1IKNC 1JHKL 1KIQA 3D5OF 4I0PA 3SDXF 2NY2B 3CVHL 4EI6A 2P8MB 1BJ1H 2HTKD 4QRRD 1PQZB 1ZANH 3HTLX 1VENA 1XAUA 1NMCC 4XWGH 1D5IH 4W81A 4GG6B 5KANG 3HZVB 3CJJA 1GIGL 4Y4KC 1G0YR 3ZKXC 4KHTL 2WP3O 3GMOA 4F7EA 2GCYA 2BP3A 3RDTD 4DCQA 2OTWB 2WBKA 4PV9B 3EHBD 4AH2B 4UT7H 4YHOL 4OCSL 3O2WL 4FZ8L 5F7NC 3IDNA 2GFBA 4FMKA 1R3JB 1U8QB 2CH8A 4HWEH 3JUYA 5C0AA 5IMOB 4BFGA 4NQVA 4WW2F 1CZ8H 4EBQL 1U3ZA 1A1NB 3RGVA 3I6KB 4NUJA 1YY9C 4EKXA 2EDLA 1M71A 1JZ8A 5D71H 2VC2L 3TFKC 4JFDD 4XVUD 5D2NC 3O0RL 4F58L 5B3JE 1KXVC 3LN5B 1E27B 4QF1A 3V8CA 1DQDL 2XT1B 1MCPH 4NM8L 4IEFB 3FRPA 5GIRA 4G9FE 3OJMB 1H3WM 1NMCB 4WW1B 5KSBA 2DRUA 2OXGA 4LHUD 3U7AA 3V8OA 4ONGH 1UCBL 1BF8A 3ZKXB 1U3HA 3TV3L 3MROA 3RNKA 2K7QA 3S4SB 5ACLA 1YEJH 2SEBA 2UWEB 5D6DA 2Z31A 3ESUF 2A6JA 4JFZL 4CU6A 3I6KA 1C5CH 4RFOH 5IVXE 4NQDA 3K8MA 5JXAL 3O3DB 4XAWL 2VDPH 3H9SD 5F6HI 2APFA 2H6PA 2VLJE 4XPAL 4LHJB 4G6MH 5EUOE 3VGGA 2VXTL 5BS0D 3WHXA 3GMPA 3BPLC 2G2RA 5ISZA 4Y5XA 5FGCB 1H0DA 2IQAA 3K8KA 3BRGC 1VA9A 5TDPB 4ODSH 3IXAA 2Y6SC 4FQ1L 2A73A 2GCYB 3PHQB 2DLIA 4WUUB 2APTA 2XQBL 2NXZB 3HI1A 1FAKT 5F6IC 1DE4B 2VKWA 4XCEB 1RVFH 2KQNA 3F62A 1A6VH 2DLHA 2MFNA 4KJPC 3SDDA 2R0ZL 1S3KL 4L3EA 2OLDA 4QOKE 1TJHH 2Z8WC 1T1YA 4XP9L 4IBLT 4WTWA 1RU9H 3QO0B 1EHLH 3C6SA 1MCIA 3V79C 5C9JA 1VGKB 3D0VA 4LSVL 3UTTB 2W91A 4XMKH 5IROA 4GQ9H 4DGIL 2JK5B 1FN4A 1A7RH 2BSTA 1PG7H 2F9BT 4NQEA 4GBXD 3MCKA 1IFHL 3QUZC 2VDLL 4C58B 4KJQD 5FECB 3P9MB 1ZHLA 2B5IC 1T7XA 3VXPA 2GAZB 1KTDB 4JO4H 2BSRB 4U1LB 3I9GL 4XNUL 5H2BB 1H3XA 4IM8A 5E99H 4NYLA 2ZCHL 4QXGL 4MWFA 1J1PH 1INQA 3PWNB 1A2YB 3NPSC 3HR6A 5BZWA 4RWHA 2DQIH 3MBEA 2E7MA 3BPLB 3GMMA 3STBA 3OX8B 4E42A 4GS7B 3OKKB 1OB1A 1IGIH 1KPRA 3L7FB 3KS0J 4NRZB 4JO3L 4AIZA 5JTWA 4Y2DB 1F6AB 1U3JA 1EEZA 5E8EB 4ZNCD 2WM0A 5D7JC 2JK5A 3TVMB 2IGFL 1SMAA 4Q6IA 1NUGA 4PRNA 1MFBL 5ACZA 4W68A 2A38A 1ZS8A 5F9OL 2E7CA 1D5ZA 4XBEL 3SOBL 3B9KB 1CICA 4C83B 3DROA 3HZYA 3JSSA 4HZLA 5DR5H 2V7HA 4H0GA 2OTUA 4PJXE 4F9LC 1DBAL 3F12A 1DE4A 3GRWL 4KI1A 1E4WH 3QIWD 4FXLA 3U46B 3KYOB 2NY1B 5MENA 1UM5L 4NKOB 3SDAD 4Z0BL 5DVMA 3QA3A 3TZVC 2P44B 3QEQA 4R4FH 4FTVB 1UB6B 2DLFL 3E8UL 2ED9A 1Q9KB 3IVKB 3C5ZC 3RWHA 3L3JB 1OGAE 4YZFE 2PF6A 3SDXE 4Y4HB 5E6YA 5FXCH 2DIBA 2IADB 4LHUA 4H88L 1OT1A 5B4MD 2UUDH 2FHFA 3M1BB 4WO4A 5KSUB 4I13B 4NO2B 5EOCH 1S7QA 4YC2C 3BIKB 1CQYA 1MFBH 3P77A 2VXVH 1BJ1J 1DBKH 5F96H 3LIZL 4UOW1 5CMAB 3KXFB 3K46A 4LLMB 4TNWF 2AKRA 2P8LA 4OQTL 3TVMC 2Y4SA 5T3ZL 3CX5K 5F3BB 2G60H 1MLCA 2X70B 4Z0BH 3RY6C 5GZOD 1AHWA 4N90E 3MTRA 5LQBL 1UM5H 3WS6C 4F37F 4YNYA 3BRDA 3MYZA 4JRYE 2OP4L 1G9MC 3SCMA 4TVPE 3ZKNC 4YBQD 3ARBB 3F7RA 1RUMH 5DR5L 3BJ91 2X4RA 1RZJH 4TPRH 3L9RA 3FQWB 4Q2ZA 4L4TA 2J6EA 3HR5A 4KAQH 5MEPA 1J87A 2VDLH 5TE4L 4PGZA 3GSOA 3N9GL 2GTZB 5ICZA 3L5WB 1FC2D 4MJIE 4OSUL 3H3PH 1ZLUH 4LSVH 3O6KL 3I84A 1ZLSL 1IGIL 4ODHL 4Y4FA 1QD0A 1BLNA 4L9LB 5E08H 4Z7QF 3UROR 3EJZD 1C5DA 2MTPA 5HBBA 3BWUC 1S3KH 4PJ8C 4U31A 5IW3A 1QSFA 5F7LB 3LB6D 4N90D 1J1PL 4X5WA 2V17L 1RFDH 1U8NB 1YUHA 4OFIA 3F7VB 3KPSD 5ITBH 1F6LL 4JO4L 2XNAA 4ODTL 1NCAL 3HMXH 4Y19B 1JBJA 3RWFA 5FHBL 2FJFB 1IL1A 1RZFL 5DJ2A 1DANT 1OAZH 4HK0A 4PJFB 4WUKL 5JQHC 2GT9B 3VXSD 2IF7A 3NCYP 4I3RH 4K3DL 2OR8A 3GMLB 4GAFB 2YC1A 5C7XL 4AY0A 2R0WL 3VFVB 4ELKA 4EI5D 5C0BD 5DHVA 1TITA 5FYJE 4UT6H 1UA6L 1BQSA 2CRIA 2GITB 3TIDA 1J05B 1NLDH 3BZEB 3GSQB 2IMMA 3P9LB 1UCBH 1I85C 5I16A 1VFBA 3BRFA 3V5DB 1U3HC 5EDXA 5FKAA 3W39B 3BGFC 1V7ML 1R3HB 2R9HD 1QRND 3C9NA 5DJ8B 2DI7A 1AGFA 5FYLD 1FVEA 4K9EH 1EXUB 5GRUL 3U46A 5DRNB 3GBNH 1GAFH 4UQ2B 3CFBB 4G6ML 1I7RA 3HB3C 1N59B 1A6UL 3ARFB 3BKCH 5JO5B 4FZEL 1T66D 4PLJC 4JM2C 5BVJA 3VXNB 4IRJD 4NJ9L 3WFCL 1HYSC 3PP3H 4Z6AT 4H26A 1C5CL 4JFFA 4N0UA 2A77H 4JFFB 4QRSA 3HE6D 4DFIA 2PCPB 1G9EA 3IETB 3DXAA 4X9BA 3BEVA 1G7IA 4M00A 4D9QD 1KFAL 2VSDA 1C1EH 4GRLB 3OKYA 4JFPA 2VITA 4PLOB 1PW3A 1F11B 3L95A 2MCPL 3P73B 2E6JA 2LFGA 4JFQB 4NN5C 4WJ5B 3U9UA 4C59B 1D9KC 3OX8A 4RWYL 5D9SB 5JW4M 1NC4D 1XGUA 5JOPE 1U8HB 1ZHBB 1RUPL 4BKLB 3VMNA 2C9AA 1VFMA 4PJGA 1I9EA 3DVGA 1DLFH 4NFCA 4PRAB 4ZUTA 3I75A 1WV7T 1NANH 4KUZL 4TULL 1ZHNA 3EKCA 3W9DA 4BK4A 5H94A 1T2JA 2X4PA 1LK3L 1MWAL 1G0DA 5JIIA 3P9MA 1CZ8L 1AQKH 1T1XA 4PRPB 2YC1B 5HVFB 4PRDB 4ZUUB 2CLVB 2EC9U 4HV8B 3BSZH 5EBLA 3K4AA 4L29B 3HUJA 2NLJA 4PJFA 4CBPA 1NUNB 5FEBA 2DOCA 5DGRA 4H8WL 3U7YH 3BPOB 3OXRB 5E8NA 2XRAH 3W11C 1FL5B 4L3CA 4UIKL 2ZG3A 1OCWH 3F7VA 5D2NE 5FOBA 4KHTH 3D2UD 4ODVH 5IB3B 1LEIA 4MJ2A 3NABL 3WNNA 4EN3C 3CNKA 3MRPA 3QI9C 4EIZC 4RGOL 1NANI 2EDDA 4HUWB 4E5XA 5HD8C 5LGJB 4I5BA 3FT3B 2J4WL 1T2XA 2R2HB 3P2TA 1YYMH 1EAJA 3K4ZA 4OFVA 1U91B 1P7QB 3V4PL 1R6VA 2R39A 2VN4A 1A14H 2OSLB 5TQ2H 3H9ZA 1REIA 4ZO9A 3OKMB 1U58A 3D3VE 1DQQB 4L1DA 1DBJH 1JYNA 4MQSB 3QXTA 4TUJB 2HJKA 3VD3A 2HKFL 2BNRB 1GC1C 5CHNB 3C60A 5IHLB 2IG2L 4HS3B 3NFSH 5KW9L 4JANB 5ITFA 4S1DC 5K9QI 4YEEA 3MGTB 3W11D 1DBMH 3H7LA 5GJTH 4N8CL 4D2NA 3WFHB 5KS9B 1NCTA 7CGTA 1NAML 1O0VA 3SCMB 3KPNB 1QP1A 5F7YC 5EWIL 5I1JH 3MQIA 5DJ2B 1FQ9C 1JMZA 3U6RB 2YWZA 1VKXA 4NWUH 4M7LL 3LN4B 3QXWA 4I48B 1GOHA 1CGTA 4PJCA 1G1CA 2AJYH 1KJ2L 2Z35B 3QIUA 3BP7A 4PS4H 2FX7L 3ZT7A 1BEYH 2R4RL 1OAXH 3CD4A 2VDOL 1QLEL 1MUJB 5DD5L 5EBMA 32C2A 3WFHA 3P77B 4HD9A 5ANME 5KS9A 1CK0L 5J8OA 1T7WA 5D7SL 2VXSL 4HGWA 4AENA 3QQ3A 3O6LH 3EYSL 4HS3A 4M6MH 3FRUB 4WDIA 5A2LH 4QRPD 3MV8D 1MREL 2XXCB 3LB6C 2V2TA 2CLZA 1KEGH 2BFVH 5DTFB 3QPXH 3WIHH 3QXUA 4JZJC 4X6CB 1AGDA 3S4SG 1I3RB 2IH3B 5KSAA 1J0JA 1CD0A 4HKBA 1NCDL 3RA7H 1MRCL 1HSBB 2OTWA 3PHOB 5MP6L 5HTSA 1MCSA 4P23A 4BH7A 5ALCL 3MNZA 1DCLA 2X05A 5DHVH 1QR1A 5FOBB 1I8MB 4LDLB 2FD6H 4BQ9A 4U2ZA 5C92A 2GYSA 4LPWA 4WU5A 1HZHL 3HZKB 5IT2L 3TPUA 4PLNC 2I60H 5SWZD 2R4SL 4YQXL 1CCZA 2P8MA 4FQQA 4IRSA 4JHAH 3SE3C 4PRNB 2NLJB 5HVGB 1FLTX 5J3HD 4Y4FD 3IFPB 5FO9B 3AMKA 4RISH 1DSFL 4EZMA 1Q72H 2AV1A 4AT6A 3TO2B 4UDTB 4OCNC 4ZNEA 2VDQH 4D0DA 3BIKA 4LLWB 5HHNA 4LSSL 4CN1A 3OKKA 3SE8H 1MPAH 3TBWA 5IBUB 2F5BH 3A6CL 4NBXB 1S5IH 5E00B 4AL8H 3I3DA 4PRID 5AWNL 3I75B 4PJHF 3MLXH 4R4NC 4NPYA 4UINH 2ICEA 3PGFH 3G6JF 3PGDA 3MLPA 3NAAH 4I3SH 3IF1A 1YN7A 2ATPB 3QBTB 5DJ0A 1UB6A 3G6JB 3VXOB 1EVTC 3MRIB 2Y06L 1I1FA 4OD1L 1QRNE 3S37X 5J6GB 2YXMA 2X1WL 1W72B 1CU4H 4OGXH 1U95A 4OLVL 1TQCB 1UJ3C 4MQ7B 2ITCB 2P5WA 3HC4H 3ARUA 5DZNA 1YC8A 4PREA 5JNYB 3RHWK 4U6XB 1PSKL 5CBAB 1RSFA 2AJXH 1GZQB 4KTYA 3QAZC 4XP5L 1C08A 2W1NA 1MCFA 5HYEA 3HAEA 3P4OA 1OM3L 4FTVE 1RZJC 3RBSA 3HPJA 4C56E 1I7RB 3CFBA 1MQ8A 4PD4K 4JVPA 5C07D 4OZFA 2NY6C 2LQRA 1ZTXH 4HDIA 4CDGC 4P3DB 3IDGB 3MRIA 2PN5A 2ZCKH 2BVTA 1CR9H 2VXUH 4M7ZB 2ATPA 2E8ZA 1IGML 4F7TB 1CVRA 3O9WB 5GGUA 4RNRB 4N5ED 4NRYB 5DK3A 2IAMD 4K94C 4PGEA 4RGNC 4PIRF 4WTXA 1YNKH 2FB4H 1JWSA 3R1GL 2ZUVA 3RAJL 3CC5A 2EDNA 5DUML 4GJTB 1I1RA 2JB5L 4WGWB 5IOPA 3H6JA 2VISA 3KLHC 3MROB 5HDQH 3RNKB 2Q8AL 4UT9L 1BVKB 4ELMB 4YAQB 4JRYB 1IQWL 5T1DL 4UV7H 4OZIE 3FFCB 3T09A 1QRNA 2KZ1B 5C0BE 5I6XC 2C3VA 1R5WA 4ZOEA 2HJLA 4OF0A 3ME0A 3D9AH 4G8IA 5T3ZD 3UCRA 3VG9C 1WBXB 1RJZA 1U2CA 1KCRL 3TN0C 4ZFOA 2R0LL 3CSYB 4WWKB 4K7PL 2WWKO 3KPRE 4R6UA 43C9B 2MWCA 2HMID 3IXAB 4O58L 4G6AC 4HIJA 1MCOH 2D4FA 2J8UF 1CIDA 5A2FA 4WI2A 1U8IB 1RUKL 3GIVB 1FV1B 4JPIA 1HH6B 1EPFA 1BHGA 2G2RB 1WAAE 1IILE 4XP4H 4YXKH 5C0AB 5TFSH 4K3JH 2JJTC 3VRJB 5IBTH 5L88H 1J5OH 2Y6SD 2BCKB 3O9WC 5DJDB 3VG0L 3B2UD 3H3BC 5GJSH 4M3JA 5B22A 5D7LA 4R0LA 1TXKA 1IM3B 5I1LB 4XHQA 4JE4B 3P11H 5F9JA 3WXVL 4DJMA 3UTOA 3S4SA 4OAWB 4L4VB 3ARBA 3DX9B 3PL6C 3RX5A 1CR9L 3O6FA 1CFVH 2X1PA 4OUOA 3GHEH 1ZE3C 1FLRL 4GRWE 5JOFB 1ZTXL 3SKMB 2CDFA 3S35X 2DDQH 2VN7A 2Y07L 4MGXA 5J1AB 5F93C 4RQQA 4GRMB 1NFIA 1O7SA 3V7AE 4DVRH 4HLZG 3F8UB 2GJ6D 3MCG1 5L2KB 4D0BB 1KIQB 4P2QB 4X4ZA 4JZOB 5IB1A 5IW6B 5DQ9A 1G1YA 4BJLA 1BX2B 3ZKMC 5EZOH 2VISB 4DZ8A 2B39A 4AMKH 2PUQT 2NXYC 3C5SA 3M1BA 5KSUA 2XIDA 1IJ9A 4NJAH 4ZFFB 4E0RA 5LKNA 4HIXL 3FHQA 1YECL 1ZWIB 5F3HA 4APQC 2MPAL 2F74B 5GS0C 3CAFA 4ZAKC 1UG9A 1DUYA 1I9RH 4ZSOB 2OSLA 5E8DH 1FNEA 3SDCA 3UO1L 1F90L 2HYMA 5DWUL 1BFOB 1A7NL 3VXMA 4XMLL 1YPZF 4CDHA 3U9PH 1IC5L 1R0AH 3IJHB 4U1KA 1G7JA 5E6IC 4LRNL 2HJFB 2OMNA 5DMGC 3IDIA 1VDGA 3PP3K 3UDWA 4LBEA 4Q9QL 2HRPH 3S36X 4KJPD 2M1KA 3GSNB 2RJMA 1I1AC 2V7HB 2H32B 1J1XL 5J57B 1FJ1A 3OHXB 4MSWA 1LWRA 3L3HA 4IS6A 4C83A 5CSGA 4IMLA 2VDQL 3EYUH 5EORL 1P4BL 5D1XC 5EZLA 1A1MA 1DSFH 5FGCE 4LPTA 3O4OB 4KZEL 3HUJB 4XB7A 3GSVB 5EC2A 3HCVA 4JHAL 4LSQL 3IDXH 3QUMA 4YQXH 3S37H 1ZGLB 5F1KC 5HPMA 2BJMH 3JWOH 1KC5H 1GSMA 3X12B 5JW4Q 1GJIA 3VGBA 1KNOA 2ESVA 2VLME 5KVFH 5BZWB 4DN3H 4X9FA 5DJXB 3DRTA 4P2RD 2QADB 4PRPE 4XAKD 4DN4H 5DQJB 5IQ9A 3U4EA 3WV0A 4NFBA 4DKEH 5K9OB 2XWJA 4MXWH 3IJSA 3T8XB 3NGBB 4XXDA 2OZ4A 3VE0B 1YEHH 2DQHH 4RGMC 4IRZL 5IIEB 3G08A 3RWIB 3WL9A 1KEGL 1FZMB 2XTLA 5B38G 3KLDA 3SBWC 3AXLA 3ET9F 2ID5A 4L8SB 4JR9H 4M6ML 2QTEA 3GBLA 1DLHA 2YSSB 2Z4QA 5C0FB 1FFOB 4D9LL 4FXKB 4UTAL 1YEDB 3PJSA 3O3AB 3NIDE 2C5DC 3EOYG 5E0QA 3W2DL 5D5ME 2OK0H 1YY9D 2PXYA 1MFCL 1IAKA 3ZE1E 1N8ZB 3C8KB 1F4WH 3KPLA 4MAYD 4I77H 4MD0B 5T1KB 1CDCA 3KYNB 5IV2B 4P99A 3EYOB 2VAAB 5T1LA 3TO4B 4LBEB 4M7LH 4D3CL 4UQ2A 4YHMH 5IM7B 4TOYH 2DBJA 4PJHE 2HJFA 1G7JB 3KPSE 3D3VA 2Q20A 3D3VB 1JFQH 4JDVA 5I1JL 4QY8A 1R3HA 4OLWL 2BNRE 4YDIH 4WHDA 4X6CA 4M8VA 5IKCA 4MD0A 4KHXH 1FVDA 3G6DL 5T33H 3G04B 1DQJA 5I17A 2BNQB 4JFHE 2V5MA 3RTQC 4ENED 2NY0B 4JO2H 5FCUL 2IG2H 3S36L 3LRGA 3AAZA 3KPMA 3BAEL 1CFNB 4LCIL 4YBLB 1NCWL 2YRLA 3DLQR 3PWPB 5ESQB 3QHTC 4JPVL 2NY5C 3HZMB 4P2RB 4XVTL 3ECBA 1NCNA 3WD5L 4WFGE 2VZSA 3KHOA 2J4WH 4X6BB 2R1WA 5C0CB 3TBVB 2F8OA 2R69H 3GJFA 2D0HA 3LEXB 4HS6A 1D7FA 4KUCD 3TT1H 1XF4B 1A64A 2W9DL 3ARGD 2V7NA 3FQRA 3FN9A 4OCXH 5D1QA 3RZWA 1DN2A 4W6WB 3NABH 2FIRT 4PJAF 5DLML 4KK9C 3ZMRA 4KRNA 4KI5F 4NZRH 3WFBH 4EUPB 3UJJL 3UZEA 1IM9D 3MRQA 3MCLL 1RIUH 1WLHA 1M71B 3G6AB 2A9NH 4GBXC 5ANMA 5LBSH 4CKVX 1QEWB 3ARSA 1C5DB 1KPVB 3QG7H 1GC1L 3DVNA 4ODXB 4YUEH 4LIQL 4OTXH 4KJWD 1TQCC 4HULB 3B8YA 4D9RD 4RMVA 4NM4H 1AQKL 3LY6A 4K8RC 2BCKA 4HLJA 1MWAH 2O5ZL 1LK3H 1CFTB 4JFOB 4QT5A 1RHHA 1HKFA 3EOBA 1YEGL 3HHRB 3NCCB 1MJ7L 5GRJL 2M8XA 3NFPA 2X7LA 3EO0A 4R97C 4F8QA 2F8VA 1OAQH 4OLUH 3SKNA 3OPZH 4OQ1A 2IAMA 4ZODA 5IB3A 3ALXA 4U1KB 3O4LD 4KY1H 5E9DD 4Z7WE 1OD9A 1I85A 3ULUE 3MV9D 2VLMD 3SJVA 1Q9OB 3T0XA 3O3EB 2MCPH 1T89C 5CJBA 4YWGL 1RK1A 4YGAB 3CIQA 4KWUA 3C6LD 1BQUA 2CGRL 4XRCA 5INCB 4UILL 1FSKC 3MLWH 1HI6A 4RA3A 4S1QH 4DUWA 2D7TL 4ZFFA 3LD8C 4QXUH 2CLVA 2CRZA 1NDMA 3LKOB 4O5LL 2G5BA 3LMJH 4OKDA 5C0AD 1RZKH 4P4RB 1NEZA 4ONOA 4ZUWB 4P57B 3EDKA 4YDLC 4OCRH 4WO4B 4KDTA 5IEKB 4MJIA 1Q1JH 3GDBA 4HH8A 2D7MA 1FZJA 3R06A 2Y5EA 1AO7A 4ZUTB 3QJHA 1IGTA 3BHBB 3QFDA 4PRIA 1RQ5A 3CDCA 1MAJA 1XCQA 1Q9KA 4OFYA 3QWOA 4PJBF 3RWCB 4CVUA 1F4YL 4G3YH 3L3KB 3EO9L 4NCDA 1GHFL 4UAOC 1JHLL 5IBUG 4M93B 3FT2A 4YHNB 4JQVC 3L95B 4BFEA 2F53A 4NRXB 2UZIH 5HHQB 5FYLL 3DX7B 4OIIH 1KTKE 4JFPB 5E5RB 1B2WH 1ETZB 1XIWC 4UT6L 5IMMB 4ENEC 4HZLB 3VRIB 1DL7H 3VXUA 4BQBA 3DXAB 2R0WH 1ZSDB 5KZCD 4R2GB 4M1GH 1S7WA 3V0AC 1K2DA 3TBTB 4GW1B 4G5ZL 4S1RL 5ADOL 5AAWA 4LOUD 1LDPL 3T0ED 3BKMH 5I73C 2YEZA 2ZUYA 4MCYB 3L1OL 3RVUD 3UDWC 2G9HA 3DX7A 1SQ2N 3MJ6A 4XCNA 4XWOD 4AIOA 4P46B 1TTUA 4AIZB 2LTQC 4ODTH 2OS7A 1BFVH 1UACH 4KI5D 1FVEB 5C0RH 3CFCH 1OB1B 3DV6B 1H3TA 3BIBX 5T3ZE 5DJCA 4LVEA 3Q48A 3SKJH 1B0GA 3TEUA 1NMAH 2QHRH 3GI9H 1BAFH 2XN9A 3FHAA 3T08A 1KLGB 5DURD 4HWBH 3E3QC 4YK4C 2HJLB 3LQZB 1X44A 1NFDB 3R06B 1AD0B 1FE8H 4HUVA 5JR1L 4BM7A 4ELME 5HYQA 4M7JH 4UQ3A 4URTB 2P5EE 3H3PL 4S10A 4P57A 1PBYA 2R56L 1UB5B 3T0EB 3LKOA 4ORZC 2FEEI 3LQAC 3U0PB 5LAXB 3LH2H 4XNYH 2NTFB 4JJHA 4X9HA 4MJ5B 4Y4KB 1ZT1B 3ARRA 3GHBL 3QB7C 2C3XA 1U8OA 5C08B 4EDWL 1Y18A 3QEGL 1GGBH 1T1YB 4KDVA 4NSKB 4ZS7L 3SY0B 3W81A 2EDKA 4BSWB 1SY6L 2IFFH 2FX9H 3N85H 2O5YL 4J1UA 1NL0L 1XF2A 4Z7OF 3SDAA 1KGCD 1RPQA 4HG4K 2WZPD 3NFPB 3ZYZA 2BNUB 2G60L 3MODH 3OTTA 2X10A 1CT8A 3TBYA 5ERWB 3CCHB 1NBZB 1ONQB 4YHIB 5F9WC 4Z7VF 1I3RA 3ARED 3T3PE 3RQ3A 5ETUA 3GK8H 5DTFA 2NY4B 5CP7A 4FQ2H 5IUSA 4YHZH 4LSTH 4HT1L 2BOBB 2EE9A 1G9NC 2RFXB 1MIEL 2DI8A 2R0KH 4W6XB 5D1XB 5I18L 5M94B 3ETBF 5DD3H 3JTTB 4JHWL 2EE3A 5DF0A 5D1ZB 3PABA 5GS2H 1MCEA 4N68A 1U3HB 1CXIA 1FVCA 4M4PA 1KN2L 1VACB 1HHHB 1ADQA 4R4FL 3QIBD 4U3CA 3MLYL 3GKWH 4XI5D 4P2QE 2KUTA 4IOFC 3OR7A 5H35B 4JY6A 3RPIB 5IBLD 2XA8L 2EIBA 3M45A 3TCLB 2X9YA 4X83A 5D1QB 1UENA 4EJ1C 4QF1B 4UB0H 3H0TB 4B53A 3QXVA 5DK2B 4ZXBD 5C07E 3CLEH 4G9DB 4Z76A 5CWSB 1RIVL 5CP3A 4Y5XC 1DJSA 4I8DA 4UMGA 1G7LA 2VUOA 5E4IA 3QP3A 1H5BA 1G6RH 3FRPG 4R7DA 4YDVB 3HNSH 4NUJB 4U6YA 1NC2A 4RSVA 4UTBH 5HJ3A 3T4YA 1BD2D 3F7YA 5I19L 1DUZA 2H1PH 1F4HA 3RWHB 2H2SC 4Z78B 5J06A 3QZWB 1HH9B 2AJZA 5CD3A 3PWPD 5F1NA 4WGVB 4WU5B 4HUXB 4M03A 3P0GB 4JG0H 3PL6D 4Q0XL 3OAUH 5T3XE 3BISA 1X5XA 2C7UA 1N0LA 4WV1A 2OL3B 2MCG1 5D1ZC 5E99L 3AU1A 2E27L 4J4PC 2O61A 1VERA 2GSGA 1I9JH 3QFJE 4WNQA 1X5ZA 3C8KA 5KSAB 4FQIH 1AGEB 4OLYL 1MJ8H 1BOYA 3QUZB 4JFOA 5HYFA 4IRJA 4OCWL 1GZPB 3HI6H 5D1QC 4OF8A 1ZS8B 2APVA 1A7PH 3ROOB 4OM0L 5J3HC 4FNLL 1FFOA 3MBXH 2X4NA 3LRSA 3QDGE 3RGHA 4FQXC 4XVSL 5GPRA 5GS0L 4UNTA 4PRPA 4XNQA 2J88H 3MX0A 5JZ7C 1A6VL 4P5MB 3EOTL 3R4DA 2CKBH 3FZUD 4N9GA 2YUXA 5FK9A 1ZHNB 2EYTA 1LO2H 1S9YA 4LLUA 4OCYH 1UADC 1D5MB 4HKJB 2W59A 5D9SA 1KTDA 1Z3GL 2Q6WA 3WLWC 2E7LC 4JRXA 2F58H 3GJFB 2BNRD 2J8HA 5LG1A 1QFWI 4Z7UE 4XPAH 5TE6H 5I71C 1AY1L 1XGTB 1F4XL 1F11A 2XFXA 1SJHB 3NA9H 3DPBA 5SWSD 5SX4H 1ZGLA 4NQTA 3P4MA 3SGJC 3OJVC 2OZ4H 2DWEB 3QEQD 3HCVB 1D9KD 1LGVA 2BC4B 1OF2B 4MNGB 3C6SB 1YEJL 1PFCA 4RZCB 4TUJA 3VGDA 3TV3H 5DQDH 4QHUA 2XV6B 2VTFA 5E8OA 5F88A 3DMMA 3G04A 1V3LA 2VIRB 1OVZA 2QL1A 2Z92B 2WBJD 1QVOA 1QLRA 1F3RB 2Q86B 1DQDH 1J9CT 1YDPA 4OFKA 3ULVC 3MNWA 1YQVH 2BNQE 4LDEB 4X9IA 4Y4HC 5EG6C 5EUKB 1LK2A 5EBGA 3EGSA 1T83C 1HSAB 3DSFH 3O0RH 3W0WE 1OSPL 5FDWB 3QHFH 4FFYL 5LGHH 4LU5H 4WTZA 2HT3D 3ZE2E 1FL5A 1ZT7A 2AGJL 3R8BB 5ADPH 3QEHB 1Y18B 4MLIA 1FFQA 2YD4A 2ZPKL 4EBQH 4M48L 1ZT1A 1CLYH 1UZ6E 1FGVH 4GMTH 4JFEE 4R90L 3SQOH 4NC2B 1QR4A 4JZJB 3HG1A 5FHAH 4FZ8H 1W72H 3O2WH 3F6LA 5A3IC 4HWBA 4PYGA 2GT9A 1BF2A 4IIQB 5HHOD 1XEDA 3W9EA 1L9MA 5B8CB 5T3XD 3QNXA 1HXYB 3LN9A 2XN9D 4RQQB 4HUVB 3QQNA 5DUPH 5C6TH 3U4EB 1CBVL 2ZSWA 1RURH 4XHJD 3MR9A 1IC7L 4GAYB 4M3KB 1OTTD 4BKLA 1GIGH 4N0FA 4LCWB 2VH5H 2XN9B 4C4KO 4XWGL 2VL5B 5IQ7L 1HEZB 4M6AA 1ORSA 3QFJA 1HCVA 1S5HA 4MA7H 1A6PA 1FL6B 3P73A 5I8KH 1IM3A 4XCNB 1S7TB 4ZFGL 3D0LB 3SKOB 1A4KB 3ULVH 4NO5A 1JGUH 4L9LC 4MHHI 5JUEH 5C0BB 5I1EL 1D6VH 2RBLA 3BEVB 1MIML 4MB3A 1JGUL 1WC7A 43CAA 4U1JB 3N1MC 1S9WA 2PXYC 4ZFGH 4NNXA 4F33B 3FQXA 3HR5B 1FBIH 2LE9A 3BJLA 3IU4H 4X98B 2Y9RT 5C09E 4XWOC 3VH8B 4JKLA 1WIPA 1NGWA 4OZIF 2WANA 5CEZD 3QI9A 4MAUL 5IQ7H 1OP5K 3DWTA 4QRUA 3VXTB 2Y5TA 4PJIF 1EXUA 4N0YL 1IC7H 4QHKJ 4M5YH 1RURL 3L3KA 3LPWA 3GSUA 1CIUA 1PLGL 1JF1A 3V95A 3WCYA 1DUYB 4FFZL 1VFBB 4G80B 4L4VD 4EUPH 4XMPL 1W72L 1ZWIA 4YK4B 3WSQL 4NKDA 1AXSB 2FSEA 1Z5LA 1WAAF 3TIDB 3DUSB 1L6ZA 5JHDB 5DRZB 1T7ZA 1TJIH 5HY9A 3VXSE 4N0UE 1PX4A 4M48H 4M9OA 1WAAA 1E4XH 3DVIA 5F7EL 1E28A 4PLKD 3JBG7 5B39B 4D0BA 2FECI 5L2KA 1TMCB 35C8L 3QHFL 4FFYH 1W0YT 5EBWB 4G7YL 1UWEL 4O00A 4EVNB 4U1NA 5J7CC 2JIXD 2ICWI 3VDAA 4B5EA 2E9IA 3UPRA 5JOFA 5JW4R 2VE6A 2X4QA 4X6FB 2V2WB 1DN0A 1QFHA 5MI0B 5MENB 5DMJB 3ROLB 4F15B 4L4VA 1LEKB 1UZ8B 5HHME 3FQNB 1X5FA 3PWLA 5I8OL 2WLYA 5DHXB 3VW3L 1T0MB 4XTRC 5D70H 3FQTB 5IHUL 5DQDL 5DS8A 3EDEA 5BMFH 2J5LC 3MPCA 5J13B 1L7TL 4QCIB 5GISH 4KMQA 5C3LD 2W38A 1I7TB 3A6OA 1J8HB 4J3SA 4TQEL 5JORA 4U1JA 1JJUA 2DWDA 4WW2B 3GEWB 5ICZB 2Z9TA 3BD4A 4OKVA 4Y5VB 4ZD3L 3QDHA 3CU1A 3NA9L 3HG1E 1CVSC 2EH7H 1MCWW 1FAIL 5C6WH 4ZXBC 4JPIB 2GUOA 2OJZL 2F58L 2HVJA 3U1SL 4DVBA 4BH8A 3DX6A 2O5XH 3WDHA 1Z0NA 3HAEH 3JWDC 1CDGA 5GGVY 4XI5C 5EOQH 4OCYL 1ORSB 3SDAB 4LCCC 1GH7A 1CFSB 3O6MH 1LO2L 1RZ7L 1TNNA 5E70A 1R5WB 4M1CC 3OKNB 2RCSH 4J4PA 1S7UB 2CJUL 5E00A 1U8OB 5C08A 4XCFL 3ZYJA 1AKJB 3D2UA 1WCBB 2OR9L 3NCFB 2W9LA 1YJDL 2K7PA 3BESR 3NTCH 5LAXA 4BA8A 3MBXL 3ECBB 1TZIB 3GRWA 2BSTB 2W9EH 3TM6A 1HHKB 4H20L 4P48A 1C7SA 4CVZB 3CC5B 2YXFA 3THMH 4IOIB 4FTVD 4ACPA 1PZUB 4NZTH 1IEAA 1MNUH 3X11A 3KNBB 4Y2DD 4FQIL 4ELMF 1LO3H 4XPGL 5LCVL 1OP5H 4UU9B 3RU8L 1JCKA 1NAKH 3OKDB 5GGUB 5AD0B 1XGQA 2XWTB 3O41A 4OGYL 1F3JA 4PJ7B 3DI3B 4Y5VC 1QLFB 2VLKB 4KJYB 3BDYH 3GJEA 1MEXL 3D69A 3CVHA 2W0PA 3IDGA 3WDIA 3QUKA 1KENH 1IRAY 1MCDA 4TRPL 2GUOB 1S78C 1G6VK 2EECA 3BZ4A 1MHHB 3OKLA 4LEOB 1HQRB 5GS1B 1BGXL 1Z9SA 3HAEB 3P4OB 3QEQE 3RVXD 1P84J 1LQSR 4PR5A 1OAYL 2NXYB 5I19H 3DROB 2VDNL 3HZYB 1QPXA 5JORB 1FFNA 3MOAL 5CBAA 1AHWC 1A6WL 4HJ0C 2ADGA 5B4MC 3X11B 2EO9A 5A3ID 4NQDB 5IVZB 3FQTA 3AS3A 3ZHLA 5DHYB 2FWOB 4NUGL 3IB4A 3UYPA 1QSEB 2JTDA 3CLEL 4XXCA 1OLZA 1KLFA 1W72A 4V1DE 3BDBA 2VDNH 3QR2A 4HH9A 1IAMA 3FT2B 1OAYH 5ECJE 4F9PA 4X6FA 3QIUB 3TT3L 2H26A 2BY1A 3LKQB 3U30C 3V4UL 1YEIH 3HA0A 4NFDA 2YD3A 4HKJA 3CK0L 4CNIB 4LQFH 1T4KA 3TNMB 3QIWC 3GKWL 2YRZA 1EZVX 3NIFE 5TQ0H 1I1AB 1KLUA 3PV6B 1CD8A 5TPWH 5ID0A 4GKZB 4X0KB 3V6ZA 3BPNC 4YHPB 4CADA 1PKQA 4S0SD 2DJSA 4MQXC 2GK2A 1NCBL 5J11C 1E6JL 1LO0H 4F2MB 1NEZB 4MYWB 5FECA 2QQKL 1J1OL 1PVHA 1A7OL 2IC2A 3L5JA 2AP2A 4WEBL 4QXTA 3DUSA 5JHDA 2X4NB 3LRSB 5CLTA 1NC2D 4AEEA 5D7JD 1MHCB 3HE7C 5DVKA 3QQ9C 1UWGL 4M7LT 3VXQB 3HE6B 1AJ7H 1G6RA 2BSSA 4H20H 4I2XA 4Y5YB 4NZUL 1AP2B 4N0CD 4E41E 5HHVH 3O3EA 1EBAA 1FNSH 2R2BA 2NNAA 3U4BL 4JFYA 5EFIA 5F7DB 4QHKI 3MLTA 1WWCA 3NGBC 4P23B 4BH7B 3QNZB 4ODWB 2WW8A 1RY7B 1NBQA 4KRLB 4RGMB 4EUPG 3EOBB 4KVNH 1JWUA 1M6OA 1FNAA 4F33A 1T22A 4JEGB 1S7VA 4XNYL 3PWJA 4KKBC 3MRNB 4EI6B 1QBBA 1A9EB 1JTOA 2D03H 1A7QH 2ARJB 3Q1SL 3MV01 3ARVA 3QJFA 4QXTB 5L0QC 1DEDA 1J0ZA 2A6JB 1KB9K 4N0CC 5J0BA 1KXTB 2ARJQ 1HWHB 5DQ9B 1FORH 3OR6B 1R5IA 1TZHB 3OAZK 4EUPA 2AV7B 4HAGA 4M62L 2CIIA 5KVGL 4HC1H 4Z7UB 3S34L 4GKZA 3W0WA 3HE7B 3VW3H 3SKJL 4DEPB 1BIIA 4X4YA 3MV7A 1JRHL 1A4JB 4F7MB 1U8HA 1N64H 5F1IA 3U0WL 2ADFL 1E27A 1UACL 1BFVL 1ZAGA 1RJLA 4P5TD 1Q0YL 1EIBA 1ZLWH 3TBVA 3D39B 4JRXD 3SGKC 1B6DA 5DC9B 2Q7YA 1DQML 3QNYB 2NCMA 3BKML 4PTTB 4DTGL 1NLBH 5IVOA 3UBXB 4HJGA 4G7YH 2VQ1A 3QWQB 1T03L 1QPPA 2W0KA 2V5TA 1ES0A 3STZA 3QCVL 5BQ7B 3IDYB 1BFTA 5F7EH 4PTUB 4FQCH 1SBSL 2UZIL 5L7XL 4X4XB 4YFDB 5C70A 4HWZA 4XPBH 1YN6B 1K5NB 1FV1A 1N2RA 4ONFL 4JO1H 5E2JA 5I1CL 1EFXD 3NZ8B 3N0PB 5HYJB 3MRPB 1FP5A 4WY7L 4NQCB 4HXBH 2FGZA 1EO5A 1PLGH 2VAAA 5T1LB 5KAQF 4OCLC 4PRHD 4PJ7A 2DICA 4ZFOB 4JHZA 2UV3A 4NHCH 3WS3A 4GAYA 3LS4H 3OXRA 4WFGD 1EHXA 3BN9D 3ZHDA 3L7EA 2AEQL 4Z0XB 3KXFD 2F54B 1XIWA 4NDMB 1JV5B 3RWJA 5E03A 1XGRB 4L3EE 1NGQL 3KPQB 1NAMB 3FT4A 1KCSL 4N9OB 12E8H 1PZ5B 5TDNA 4DFHA 1FNGB 4WWKC 1UWXK 5IHBA 1PYWB 4XXDB 5EOCJ 1X5KA 4S0TD 2GSIA 1N5YH 4JVWA 4KY1L 4PRAA 5I66B 5HPOA 2A9ML 4J8RB 3AREC 2DD8L 3OPZL 5GS3A 4ZOBA 2XYCA 3NH7L 4KZDL 4HAFA 1K6QL 4YPGB 1KNOB 4PY7B 1YNTB 1L4IA 3FTGB 4LASL 3S3PA 5TF0A 3REWB 2YPLB 4M8QA 4RCAA 1J0KA 3CFDB 1BQHB 1OPGL 4YZFF 4L8CB 3GI8L 3PDDA 1BBJB 1LNUB 1Z9OA 2FL5A 4OV5B 3STLA 4MD4A 4JG1L 4JPWL 1YA5A 1BD2B 5CINH 5EA0H 4UV4H 3DMMB 4R2GD 1CE6B 2R8SH 2BSED 3I6GA 4Z7OE 2YUZA 1GC1H 4H26B 2I5YL 4H8WC 1KV3A 3OF6D 3T0WA 3SQOL 3L3HB 1OF2A 4MSWB 4ZUVB 2RIKA 1UVQA 4WNQB 3REVA 1MAKA 2PO6C 4MMZC 4ZXBB 4P9HC 2Q8BL 5J9PB 4XAKE 3WYRA 2X4QB 4LP5A 4PUBL 5DFWH 4PJBA 3O4LA 5I1AB 2Q8BH 1YN7B 2J1KA 1ZMYA 2RQ8A 2VUYA 1JK8A 1A4JA 4F7MA 1MFAH 2WWMD 3RUGE 4I18A 1G9ML 4XVTH 3HNTL 2OXHA 2ADIA 1KYOJ 3LEVH 2PTVA 4P5TA 5GZND 4Z7VE 3MO1B 4N9GB 5IEKA 2B2XH 1YMMA 4R96A 3EYVA 3LZFL 1E28B 2WMPA 1OGAA 1YMHB 4K7PX 2QR0B 5FYKE 1IGYB 3BDXA 3S35H 2XOTA 4JPWH 4APQA 3QJFB 2ZUXA 4JZOA 5IB1B 5IW6A 3GMNB 4P5TB 4G9DA 1AXSA 2FSEB 2MKWA 4MJID 5T33L 3G6DH 2Q1EA 3PQYE 3VXRA 5F9DC 2D4DA 1EJOH 3ARGC 4RDQF 1RUQL 3WN5C 1JF1B 3K4DA 3HPLA 3LKPB 4ZFZA 3BGAA 3Q6FA 4FQXA 4O9HH 3O4LB 2A1WH 3QA3B 4GRWF 3RVTD 1U8NA 1T20A 4LRIC 4Z9KB 4D3CH 3BPCA 3PHSA 3QH3B 3TJHD 1IAOA 1MFCH 1H3VA 4M6OL 3BXNA 4ALAH 2YN3A 1EEUA 5D72L 4LSPH 3BQUD 2ZNXA 4RAUA 5D1XA 2UWEE 5FYKH 1R3LB 3EJZC 2BOBA 3BKJL 3CZFA 3WFDH 2HTLD 4Y7MA 2BHUA 5GS0H 1DUZB 1JRHI 5IVXF 1KJ2B 2QKIB 1KJ3L 3QQ3B 5CS7A 1FYHB 4AENB 4MDIA 3RPKA 3OKEA 4NQED 4R7DB 1QEWA 5T5NG 4KK5C 4R4BA 5E9DE 1QACA 3HI6L 4GAJL 3RZCD 3QFJB 1MF2H 5C0IA 3MA9L 3FTGA 5KSVA 3DARA 4KK8C 4PJAA 5C0NC 5L8JB 2I9LA 5CWSA 4IHOA 5CD5C 3BP7B 4J23A 5I0DA 4MDJA 5ID0B 5L6YH 1X4XA 4OZFH 4RMUA 1WBXA 2AXGA 5EU3B 1FL3B 4LCUA 1YEFL 1JK8B 4BQ8A 2NY7L 3ARGB 1K3IA 1A21A 3QIWB 3WN5B 1KC5L 3HN3A 3VJ6B 3X13A 5BZDB 3FFCA 1XF4A 5EU4A 5F21B 8FABA 4P59H 3VFGH 3S37L 4NHUB 5EO1B 1CL7L 1GL4B 3MCKB 3WHE0 3VFOB 4TVPL 3PWPA 3QWRA 3SE9L 1FYTA 5DMIH 5DVOA 1EDQA 2JJUA 2VO5A 2ITDB 4P2QD 4Z0XA 3LKNA 3U2SA 4DK6A 1NLBL 2RFXA 3H9SA 4BQ6A 3LQZA 3VI4F 1VPOH 4X6CF 5CGYC 3D85A 2ERJC 2AK4E 2HG5B 1U8JB 1AO7D 1CG9A 4I5BB 3QEQB 2C3WA 4M43H 3U0WH 1RMFL 4KQ3H 2A73B 4KUCF 4XMLH 3DUUA 1A7NH 3DUUB 3QUXD 4NO3B 1F90H 2EDJA 2NY0C 4OF6A 5HYSA 3HLAA 5INDA 2Y23A 1HINL 5GRVK 5SX5H 5A2JH 4PB0H 1FDLL 3HPJB 5DGQA 3EYOA 1KELL 4NQDE 2WIIB 3RX7A 4X7SL 2HG5A 2CUMA 3M07A 4PGCB 4HIXH 4P4KB 2ZOLB 1AI1L 4MX7B 4NNPL 1JGEA 3SY0A 1KN2H 1CICB 4MVBD 3EO1B 2HP4A 5DXWA 5DMKA 1TVDA 4JHWH 4O2CB 3X3GH 4UUJB 4Q6IB 4PJDE 2IWGA 3V9FA 3U0PA 1MIEH 1JN6A 2G75A 1HCFX 1NPUA 2B1HH 2CK0H 5C0DB 1KIUA 5F71A 4JCLA 1MHPL 1NGZA 3RTQD 2XZCL 5HYQB 3CMGA 1TCRA 5K9JH 1QBLL 3V0VB 3RVTC 4HKZB 3DVGB 2HFFA 1FL3A 4LCUB 4OI9A 4G8GA 5BRZB 4NPYB 5JW5A 3L6FB 4P2OA 1YEEH 4LSRH 4K94L 1IAIM 2FIKB 2ERJB 1JGVH 3P11L 4ZPTA 3WXVH 2FX9L 3N85L 4LFHG 7FABH 5ICXA 4O51B 2FCBA 5ELIA 4I2XE 2WUBH 4MAYC 3MXVL 4E41B 3VG0H 5F70A 5IJKA 4NQEB 2EYRB 4G8EB 2ARJA 1KJ2A 1WSST 2B1HL 4IMKC 2X9WA 3IU3A 4K3JL 3CFEA 2LVEA 5C0EA 1FNLA 4FQQB 3EDFA 4IRSB 5IVXA 1NCCH 1S7VB 1LO0L 1MOEA 2XN9E 4HXAL 2DN7A 1OTSD 1JWUB 1M6OB 4GG8B 4DAGH 2FYYB 2GY7B 2EZ0D 3PL6A 2XA3A 4XCYB 4NNPH 2OBGA 5TQ0L 2DYPB 1S7RB 3DURA 4K7PH 2Q3ZA 5JR1H 4F7EB 4RFNB 4WUUA 4LQFL 1KCRH 1YPZA 5TE7L 2KKQA 3G9AB 5MERA 1FDLH 1WIUA 1I8KA 2HAZA 4NKMA 5D7KE 3BEWA 3A67H 4POYA 4FFVD 2A6KA 4U1NB 2WIMA 5H37G 4M43L 4CJ0A 3P4NA 5IFAH 4QTIH 2X41A 3TN0A 3MRRA 1QKZL 5FDYA 1U9KA 4MJIB 1A6TA 3FN3A 1SYVA 5JW4N 3OAZH 4L8DB 2IPUG 1YNKL 1OTSC 1JPGB 4OZ4A 4NO0A 3C5ZB 4K3GA 4LLQB 4EXPX 4CADB 3G5YB 1BWMA 1A9EA 4NKDB 4UAOB 2FO1A 4HK0B 3PV6A 1CL7H 3VWKD 5EU6D 1NFIB 1UQSB 5FYLH 3C09B 4JKPH 4DGYL 3BEWB 4JRWA 5I1AA 1P2CA 4HS6B 4HUNB 4OGYH 2NY7H 1YUHB 3SDDC 1YEFH 3FONA 3O11A 4XPHL 5JQ6H 5E6ID 3IFNL 2J8UB 3ARWA 1VEPA 4ERSL 2J8OA 3QUXB 3VXTA 1CXFA 1EA9C 1RZ8A 3RL2A 4RFNC 1A3LL 4YX2L 5D96C 4XVUC 1MNUL 2AXFB 4YXLL 4NZTL 3MV9E 2Z91B 1FZKB 1Q1JL 4LEXL 3CSGA 4ZAKD 3DI2B 4L9DA 4OCRL 4Y5YA 1GGUA 3SEPA 5HYJE 2E9JA 1SVCP 3EOAA 2OMBA 2QQNH 4NQCE 4BSJA 1UJ3A 3DMMD 1U91A 3WFDL 1I8IA 1JGLH 2ICES 3KLAA 4AH2A 5M95B 1LP9E 4N8PA 3V5KA 2ESVD 4HIJB 3QEUB 5IFJB 5KG9B 4LSPL 3OMZA 3VFPA 3VFWB 4ALAL 3WO4B 2FJGB 4U1SB 1BZ7A 1IAKB 4LCWA 4YIQB 1OD7A 1RJZB 1EZVY 1FH5H 4L3CB 5CJQH 4YH6A 1OAQL 1PGRB 1A7BA 5E5MB 1T5XB 5FGBC 1KACB 3C09C 4JRYD 5EIVA 3FN0L 5GRJH 4YBQC 4MJ5A 1MJ7H 2XICA 3VI4E 4YAQA 3RGVD 2HKHH 1UWXH 3VFTB 4H0HB 1IGCL 1HHKA 4OFPA 3ZYIA 3VFRA 4OJFH 4KKLD 5IOPB 4NN6C 2R4SH 2FHBA 3OF6A 1RUAH 2JE8A 3B2UC 2CKBA 2KQMA 1CGYA 1J12A 4LIQH 3NMEA 4NQXB 1BFSA 5E5MA 3WIFB 2YPLE 5TDOB 1P84K 1AGCB 4PJGB 3QYCA 1GGTA 3V52H 4MX7A 5DJXA 5CSZA 4ZYKB 1FG9C 3QT2A 4DQOH 5GGRB 2XZQH 3RA7L 3BGMB 4LVHC 4PJ7F 9CGTA 4HBCH 4HDIB 3TYGL 4DVBB 3UTSB 3QCTL 4PUBH 2KH2B 3TO4A 5DFVD 1I1YB 2Z93B 3TT1L 4RFEA 3GSVA 1F3JB 5EC2B 5FYJU 2IJ0C 4ZOAA 1E4XL 3D85B 1JYWA 4LKCA 4RMWA 1SMOA 2GJ6A 1ZSDA 4PJ7E 5SWSE 4D8PB 1ES0B 3STZB 3KYKL 2I5YH 3ARFC 4LCIH 1XMWA 4DKAA 4XMPH 4AM0A 3C08L 4MQ7A 1M05A 5EA0L 5KOVC 1I1AD 4GLRI 1KJ2H 3RUGB 3TH4T 1M7DB 3TNNA 2H32H 4MXQD 1K8DA 1Y6MR 3D2UB 4JRXB 3SJVE 3G6JA 3VXOA 2QBWA 3GFUA 4NN7B 3TA3C 3WN5A 1S7UA 4PJHA 5D7IE 3MV7B 3BH8A 3ISWA 4QGYA 3DRTB 4PJ5B 2Q3AA 5HVWA 3PWUA 4MJ6B 2VLKD 4QNPF 4N8CH 3ZKQD 4YHML 5A40E 4P3CL 4FQJL 2DQCL 1R5IB 2ED8A 5B39A 5JMRA 4MS8D 5KW9H 3PQYB 4GKNB 4V1DB 4ZTPL 3LEYH 5HHNB 3W2DH 1DBJL 1D6VL 1T0NB 3W5NA 1BX2A 4PLJD 2VLJA 5KJRH 2NY5L 4LLYA 3MOQA 5TQ2L 4MQXD 5SWQB 3L3IB 2ICWA 1HDMA 3PWJB 3VWJC 1GZPA 5B21A 1T1ZB 4YFLF 4YEFA 4IRZH 1YZZA 5AYUH 1I8KB 4NKMB 5BJTA 5KSAC 2BRRH 5DRXA 3QNZA 1U6AL 4RBPK 4PRIE 4DKEL 2YD8A 3PHQA 5DUPL 5C6TL 2VR9A 3JV6B 2CUIA 4UIMA 4FQHA 1NGWB 2XRAL 3HFMH 1EMTH 4R0LB 2V2WA 4H8WH 3VWJD 4FQXB 4R3SA 5EO0A 2IH1A 4JO1L 3GMPB 4OUUB 2AJZB 1NEZG 3L5WA 1AXTH 4P4KC 4Y8AA 3VRJA 1QRKA 3GGWA 5EC1B 5BXFB 1IKFH 5CFHA 1CDJA 1MHCA 3IAPA 2CSPA 3IDXL 5K59F 4U6TA 3RTQA 5C0CD 1OGTB 1NC2B 1KPVA 3CMOH 4U1HA 5KS9F 2NTSP 2V5RA 3QCVH 1FL6A 2I9TA 2QLVB 4U7SA 5LGHL 4OQTA 4F7PB 4GKNA 4U6VL 32C2B 1MUJA 4GXVH 4M4RA 5MHSE 2W0FB 1J1XH 3CXDH 3PWUB 4MJ6A 5I30H 3BP5A 1EBPA 3TA3D 4RWYH 4I48A 4GRMA 4NBYB 4FQLH 4WFFE 2ZJSL 3TCLA 3TN0D 3U6RA 4MXVE 3GB7B 4MNQA 3KDMB 5T1MA 4JY6B 3V5HB 2YPVH 2AS5M 2NQCA 3SGJA 2W0FA 4IIQA 3KG5A 1MRFH 4JKWA 3D3VD 4GKSA 2Y5TB 2IQ9L 5FM8A 1I9RL 3PNWB 5KVGH 3REVB 1H3PL 3O2DH 3WUWA 2AK4B 1MJUL 4JKMA 3VH8A 2EE2A 2OZ4L 1JGDB 3ZDXF 1V5JA 4FQPA 3SPVB 1NMBL 1F4XH 1QFWH 1ZT7B 1A7QL 3S5LG 1N4XL 2ZZUT 2HLFD 3SO5A 3BP6A 4YC2B 3U30B 3RVVD 4K9EL 5FF6B 1LNUA 3OKLB 4BK5A 1FG2B 1F58H 4KVNL 1TLKA 3G6JE 1B88A 4DVRL 4HBQA 3BMVA 4TUKH 4KJYA 5I0ZA 1QUNA 4IDLA 5I1KH 1J7VR 2LV4A 4R26H 3HZVA 4FN0A 1EX0A 3HKFA 3N1QC 1CFVL 1NLDL 2A83B 3G5XA 4TNVK 2XXMB 1QA9A 3T0DA 4IRJC 2E7HA 1GZQA 2ZSWB 2OJEB 3HUJF 5JLZA 3U4BH 4RZCA 1IEBB 3O8XC 2X42A 3O2DA 5C7XH 4DKFL 4ZO7A 3W9EB 1A7PL 1DLHB 2YSSA 4ELMA 3PG2A 1BM3H 1WZKA 1AJ7L 4Y5YC 5GJSL 3DUHA 5K9KA 2FBJL 3UX9B 1T0NA 1FO0A 3MV7D 1W2KT 2B7DT 1FZOB 3C8HA 5F1OB 5FHBH 2E7LA 4MHHG 4U0RB 5TFSL 2UYLA 3H9HB 5EU4B 4PJGF 3VGAB 1MH5B 3BWAB 3B6SA 5ITBL 1VSCA 1T5XA 3MLVL 4BELD 1I8LA 1WFUA 2ZNWA 1X6NA 1RFDL 2IFGA 4DGVH 3PWNA 1INQB 4NRYA 4KV5E 4HJ0D 1NCUA 4CL7A 2F54E 4NQEE 3T1FA 4H1LB 3KHQA 5ALBH 1HILA 3ARZA 3UTZA 1TENA 2P5WE 2DM7A 3DV6A 3EAKA 4F3FA 1ZHLB 3CK0H 1YEIL 3DX6B 3ZSTA 1ZLSH 4NC1E 1JUFB 2CR6A 4NNYB 3T04D 4XNMA 3BQUC 5JA8B 1UJTA 2ZOKB 4H0IA 3DYOA 3J7HA 2ENSA 3TLRA 5E8PA 2C1PB 3HNSL 2CLRB 2W0LA 4H1LH 5EIIB 4WI6A 1P4IL 3AROA 3VDBA 4IMLB 1NGXA 3MREB 5CEZH 3ULUF 2R23B 5J56B 4FXGA 1AGEA 3MOBH 5GHWL 5CZXD 1I8MA 4JZNB 5ACMA 2X5PA 2BMKA 3PIQB 5HGBB 1ZVHA 3ZT6A 2DL2A 1N59A 1WICA 2CMRL 3ARYA 4AEHH 4U3XA 5KVMC 2D31A 3MNZB 1OHQA 4OBRA 1OP9A 4WV1B 3ARDC 4LDOB 2E9BA 4LSDA 4XGZA 4JQXC 2IMNA 3OGOE 1IGMH 3BGMA 2EIZB 3QDJA 1KENL 3AUVA 1IQDA 1BZQK 3ILQC 3BE1H 4JB9H 4Z78A 5B3JF 1MCKA 2VXVL 2WUCH 2AI0L 4M1CD 1FZJB 4WFHD 1IT9L 2AEWA 1G9NL 5LCVH 1OQOA 4HT1H 5GRZA 3MRFA 1VCAA 1EEYA 1S7XB 4ELKB 2FEEL 3RY5A 2VDMH 4CU7A 3GK8L 1KCVH 1A3QA 2AXHA 5F89B 2WV3A 2EEBA 2W9EL 1OL0A 1INEH 2PETA 3E8UH 3V7MA 4HX1A 2J8UE 3MODL 2ZSVA 3NTCL 4QRRE 3H0TA 3LN4A 1RK1B 4OLEA 1XT5A 4GRWB 1N0XH 4NKQB 4KTEH 4XCFH 1X5LA 1GGYA 4JM4L 4OT1L 1E4WL 4HFWB 1LILA 4P9ML 2FJGA 4U1SA 4P49A 2DMKA 2X4UB 4G43B 1VACA 2CD0A 2YD5A 4K8RD 2VOTA 4ZXBA 1RZ7H 4ZFOL 3NN8A 2CK2A 4M6NH 2X4TA 4PJIA 1BP3B 5EZJA 5C86A 2UZXB 3MLXL 1Q9WA 1OAUH 4GKOA 4PJ9A 4OZIA 2XY2A 1WT5C 3C5ZD 2AJUL 2DBLH 2OJZH 1LP9B 3EOAB 3B9DA 1HH9A 5CD3B 5EIIA 2R56H 1G6RB 4PRPD 1M7IA 3TZVD 1AR1D 3F7PC 5C0BA 1KIRB 5JIPA 4TUOB 3K3QA 4RISL 4JQXA 4OLZL 3HRZB 3DRQB 3G5ZB 2X4TB 4PJIB 1JMXA 1PKOA 4M7KL 5BMFL 3REWA 2CO7B 1OOAA 1NMAL 2QHRL 3GI9L 3F58H 5D70L 1WZ1H 3L3OB 5DO2C 1QFUH 1B3JA 5I8OH 1A0QL 2MHAB 4PBWD 4XNUH 1TPXB 4WI8A 1T21A 5BS0B 4HF5H 1S78D 1UM4H 4S11A 4I18C 3T0BA 5I66A 1L6XA 3HC0A 2DQEL 1AC0A 2A6DA 3LKQA 3L1OH 1OTUC 1ZT4B 1LDPH 2DQDH 5DUBA 2NTFA 1PG7L 3B2VH 5DA4A 3WIHL 1DTUA 1S9KC 3PGCA 5FGRA 2PYED 3A0OA 3QUYC 1RU9L 4D9QE 1CLZL 2BY3A 2D2OA 1JV5A 1GPOH 1TJHL 3VU2A 3X3FH 3AAZB 4LHUB 3KPOB 3DVFA 1B2WL 4E41D 5BVPL 2P48B 3RDTC 4LPCA 4PGEB 5KVEH 4MCZA 5B38A 3WLWD 2YD6A 3UTSE 3G5XB 4KPHH 4P4KA 2A6KB 4G3YL 1FVDB 4LARL 5D93C 2VKXA 3MMEA 2R4RH 5CEXA 3LSOB 5HYJA 4GXUM 3MRKA 5DEGB 3KYOA 5IWLC 3BYTA 5IM7A 4NWUL 1QO3B 1K5NA 4Z77B 4KTDH 4PG2C 2VLKA 2OTUB 4DZBB 1WIOA 1SY6A 4HEPG 5LXGL 2JIXB 1RZKL 4PV8B 3OV6A 4LLDA 1FNFA 2IALA 2R23A 1K2DB 3NCJL 1JHTB 4UDUB 1DBML 1R3KA 3HG1D 3N1PC 3ZDYF 2GQHA 5F8QC 4Z8FH 2EDQA 4Y4KA 4JRXE 5C0FA 4M1DH 4UILH 3FO0L 4LIQE 2HKFH 3P4MB 1P5VA 1R24B 4JGJA 2FO4A 4PTTA 1WFOA 5D7IB 5BRZD 1T66C 4XH2A 4I4WA 1T2QH 2O93L 4BSVA 1OSZA 4P4KD 1KPRB 1MCPL 5JHDD 3ULVL 1W0VB 5TF1L 3LPFA 3C5JA 4LCCA 5T1KD 1RJLB 1KIPB 2NW3A 3KPSB 3V4PH 1YYML 1S9XB 4KFZC 5I8KL 1N7ML 1EJ6A 3GB7A 2IPKA 5DQJA 2EDWA 1CYGA 3BUTA 5HYSG 3FAWA 4F58H 5J12B 4OZFG 2VC2H 5EULV 5EU6B 2F19H 4MLSA 1YEGH 4KK5D 1RHFA 2GAZA 5GRWA 1KIPA 1NGZB 4DWHA 3VWJA 3B9EA 4CN6A 4YXHL 1KBGH 2O5ZH 4BH8B 1EH9A 1KT2B 3FJTA 3FKUS 5CKAA 4W4OC 3GSNL 2MNUA 3C2AH 4YUEL 1LO4H 2YEZB 5F7FA 5FHAL 1UH2A 3QG7L 2GIYA 5INCA 5GXBB 4GMTL 3CDYA 5C0CE 2A9NL 5LBSL 3D87B 1MCJA 4Y19A 5J89A 4OGAC 2EEDA 5E2WL 2IALB 5EU7C 4QCIA 3MV8B 3JVGA 1FJ1B 3TBSB 5JPNA 3GKZA 1TVBB 3KS0H 4PRBB 5KSAD 2GSGB 2Y25A 4HQQH 5GRYA 3ARFA 3RVVC 5F8RC 3JV6A 4AG4L 1P53A 5DC0A 4Z77A 4IOFD 4KUZH 1QSFB 4NRXA 5HHQA 1OSPH 2W9DH 1JZ4A 2YD2A 2BXZA 3IDJA 4Z5RB 2H2PD 1ZOXA 1HXMB 1N7MH 3OG4B 5E9DA 3QFJD 1YQVL 3ARQA 3IAQA 1UXWA 1JTPA 4POZD 1MQKH 1HHJB 3DGGB 1I7UA 4KROC 3L3IA 3DO3A 5SWQA 3VXQA 1XR9B 5FYLE 2YN5A 5HHXL 1ZEAH 5DD1L 2EH8H 4LLYB 3K1KC 3T4YB 4DOHE 3MNVA 5C71A 4Z8FL 5DDHB 2Z31B 2B5IB 1BJMA 3ULUH 3PNWA 5DC4B 3QDAA 5KSBF 2A77L 3B5TA 4TSAH 3BH9A 3MRQB 2CDGA 1J8KA 5E94A 1WJ3A 3V6ZB 4OI8A 1P6FA 3NPSB 5MEQA 1Z9LA 1TNMA 5GGTA 2XTJC 3CH8A 3PQYD 1P7QD 4ZS6D 1NQBA 1SJEB 3LRHA 1IM9A 4MDJB 1F4WL 1J0YA 3FO2A 1IKNA 2R1YA 3Q0HA 1CF8L 1MCNA 1T7VA 3DBXB 3UMTA 3QIBB 4KPHL 1NGPH 4KRMB 4X5XB 1MWAB 2FH8A 5SWZA 3MNVB 2WBJB 4HCRH 2X4OB 4RGNB 2GJJA 3BQUB 3JTSB 4NQVB 2FBOJ 3X3FL 1FFNB 5IWLA 1CLZH 5HDLA 4NKIL 5FYKU 3GMQB 4WFEE 2DQHL 3IVKA 4HK3J 2C4XA 1WVZA 3ZL4H 4MD4B 3LDBB 4K3DH 4HMDA 3STLB 4I3RL 5IKCB 1U8MA 1D9KA 3E2HC 3UTTD 2AERT 3AY4C 2DQDL 4RAUB 1FO0L 2R29H 5LGJA 1WFNA 1MJ8L 5FFLA 4OLYH 1RZFH 2JCCB 4Z7VA 2CDEB 3MV9B 3CVHB 3HMXL 4J12A 5HHOA 4HF5L 3IXTB 4G43A 1K3ZA 2X4UA 5IVNA 2E27H 2MKLC 3CSYA 4WWKA 1A0QH 5AD0A 3HMWH 2V17H