1F4XL

Crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
210
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGTVTTSNYANWVQEKPDHLFTGLIGATNNRAAGVPVRFSGSLIGGKAALTITGAQTEDEAIYFCALWYSGHWVFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTNPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY S-20-4, FAB FRAGMENT, LIGHT CHAIN
publication title Crystal structure of an anti-carbohydrate antibody directed against Vibrio cholerae O1 in complex with antigen: molecular basis for serotype specificity.
pubmed doi rcsb
molecule tags Immune system
total genus 48
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4xL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4xL01
3CFJA 3EDEA 5KSBE 2ZCKH 5I1LB 5K33A 3OPZH 3QHZH 1FO0H 1NC2A 1AXIB 2YD9A 5ACMA 3WNKA 3GRWA 4PLKD 2GUOA 3LDBB 5I30H 3F7QA 4F7MB 3PQYB 3OQ3B 3GIZL 1XF5B 3VG0H 4Z7QF 1RUKH 3RVXD 3VW3L 2X1OA 5IFJA 5B38G 2EC9T 3BD4A 5SWZA 5BW7A 5D1QC 4X7TB 4UILL 1M6OA 3EDJA 4E41B 4OKVA 5M7QA 1YNTB 5IK3B 2F8XC 3BAEL 2AK4E 1BPVA 4XB8A 5D7SH 4WGVB 3SDCD 3DUUB 4ISVA 3D0LB 1N64L 2OXGA 1HQ4B 2VZSA 5EU5B 1MHCB 3C60D 3ES6B 1P7QB 5DD6B 1I9RH 3T77B 4LSUH 1NBZB 4FQJH 1P4BH 5DEFA 4DKEL 2OQJA 2VDNL 1Q9OB 4YH6A 4OZGA 5DC9B 5JO5B 4Q0XH 5GRYA 4JFZL 4PJCE 3KYOB 1J12A 4G9FE 1KOAA 3IDXH 3QDGB 5I1KH 1MH5A 1A22B 4D94A 1GRWA 2DQTH 2FJHA 3C5SB 4CNIA 3WLBB 4XH2A 2AEQL 5TE4L 4X4XB 5FYLE 3T3PF 1PZUB 1HSAB 4YBLC 5ADPH 4QYOA 4U1NA 2D9CA 2VSDA 1ND0A 3V52H 5TDOB 2BRRH 3DMMD 1IM3A 2JJUA 4IIQC 5KSUB 1MIEH 1X5KA 5DMJB 1IGJA 2HJLA 4OD1H 3HI1B 3LKSB 4PTTB 1FL3B 4P49A 1BZ7A 3H7LA 4DK3A 5GGVL 3N9GH 1XF2B 5GS1C 2CLRA 1BIIA 5CCKL 2PO6D 4PRNA 4J1UB 3MZGB 4KK8D 5DK2A 5L2KA 1YECH 4G8EA 2VABB 3MGOA 4GQ9L 3GSUA 4M43L 2VZUA 2WNGA 4MXVF 3U4AA 5DRWB 3BJ91 5TGBB 5HDBE 4PREA 5MEPB 5JLZA 1BFOA 3MBXL 4P2QD 4JRXB 1FVEA 4JKPL 4XP9H 3VI3F 3O6FC 4BQ9A 1CK0L 2PTUA 1LO0L 3QCUL 1QA9B 1NAMB 4DGIH 4IJ3C 2HG5B 1NMAH 5D6CB 5EBWB 4LFHD 3CXDH 1VERA 2DMBA 1MEXL 4X99B 1YEFL 1PDKA 1UWGL 5I8CA 4UIMA 3WLWD 4X0KB 2BNQB 4O2EA 3QDME 1GC1L 3ARPA 3S3SA 4QXUH 3OX8B 5F1KC 3HZVB 2OTWB 5FA4B 2IMMA 2ZOLA 1XGPB 5E6YA 3HS0A 4DQOL 5DRNA 5DYOA 1A4JA 4U6TA 1BVLB 5IF0A 4M7KL 3M1BA 5I73B 1S5IH 5A3IC 4HT1L 1QNZL 4GO6B 2YKLL 1H3WM 1MHEA 4GW4B 3I84A 3CFBA 2GJ6E 1OW0C 3BP6B 1N6QL 1WTLA 4PJ7A 4ZUTA 2SEBA 1XF4A 3WIIL 3KPNB 3LQZB 3NH7L 2RB8A 3I6LE 5FYJU 4YXLH 3LEVH 3TWCH 4XMKH 1GIGH 2PXYB 1J8HA 1HCVA 1SEQL 3AS1A 3GSQB 1DBJH 3W9EB 2B39A 5HGDB 5IVXF 3PE9A 5H94A 1TTUA 1JPSH 4QRRB 4LKXA 4BSVB 1IQWL 2VDQL 4IDJL 4J8RA 4PP2A 3QXDA 1DQLL 3KG5A 3ARSA 5E5UB 1F00I 3BGFC 4Z7NE 1I8IB 4NC1C 4AY0A 1F4WL 3HAEB 5T1KD 5ACZA 3CVIL 3FONB 2XNAA 3AC0A 2ICEA 4KKBD 4L5FH 1LO3L 5EUKB 2X05A 2YC1B 5HVGB 5KOVC 1I3RB 1KENL 1WFTA 5I8KL 2XWBA 2Y23A 2PF6A 1R3KB 3OKKA 2JIXA 3VG9C 1HHJB 2JK5B 2AJ3A 4F8TA 3WEXA 4OZGF 4KY1L 3DI3B 1S7RA 4O51A 3LKQB 2PR4H 4Z7OF 1H3UA 4K7PX 3UXFA 3MODH 4YDKH 4FNLL 4JG0L 1SVZA 1FGNL 1GGIL 1MRCH 5GGUA 1T5XA 3VXSD 4H25B 2EDXA 1NCAH 5E8PB 4ZUVA 4OFIA 3TNMB 4HUWA 1ZHKB 3PWPE 5FECB 5JW5A 1E27B 4M1CD 1F2QA 4PRBB 4ZXBB 4PYGA 2G75B 1D5ZB 3P4OB 4FQHA 5K9OB 4U3XA 5F89B 1MWAB 3C6SA 4I77H 4JQVC 4L8CA 3CX5J 4ODUA 1RUAL 3DVFA 1OHQA 1PBYA 2DQJL 3MA7A 4LLWB 2JB5H 5DUPL 1U41A 1O7VA 3CFEB 4J7RA 4LPYA 2IADB 3FJTA 5DHVB 3LQAL 1V3LA 5F9JA 3OG6B 4NO2B 3RVUD 4PJ8D 4JGJA 5BZDA 5E70A 3RPKA 4CVXB 1MCDA 4PRPB 2R1XA 4F8QA 4YUEL 1U9KA 3DYMA 4K2UH 2R0WL 5ESVB 2AJYH 1A7BA 5EU6A 1NMCC 1YUHB 3FT4B 5IW6A 1T3FB 2JTDA 3UBXI 5T5NF 2R9HD 3LPFA 2AJSL 2MQCA 1UADC 4ZUWA 4JY4A 1QSFB 4OZIE 4PGCA 5IMMB 3MOQA 4DGVL 4IRSB 3O3BB 1J0ZA 4HEPG 3VXUD 4OCRL 4UNUA 4PGEA 4X5XB 4HPOH 3PP3H 5F88A 1U8LA 2X6MA 2L0DA 3DGGA 3CZJA 3FB6A 3MRGB 3V95A 2VC2H 3UTTA 1PSKH 5J11B 4HJGA 5I18L 1BD2A 1G9NH 1P1ZA 2EDBA 4UDTB 4UIKL 1ORQA 2V2XB 1ACYL 3P11H 1HI6B 3EOTH 1T89A 5I1JH 4H20L 4QTHA 1ZA3A 5D1ZA 1G0YR 5C7XH 1S9XB 3HG1E 4YR6B 4XXDA 2X4OA 3T2NL 4UNVA 1NGYA 4EI5C 5I6XB 2Z9TA 3KJ6L 3ZYOA 2BY1A 3GMNB 3VD3A 4GBXC 2BVPB 3G6JB 5E6ID 1XAUA 1QQDB 1NUFA 3BMVA 4UAOB 2GY5A 1HDMB 3P9WB 5I71B 5K9QI 1QSED 1Y6MR 5DMKA 3U9UA 2ADIB 3ULVH 5D8JL 5LQBH 1A21A 2UY7A 4JR9L 4U6XA 4R0LC 3L5HA 3GJFK 3IFLH 4MSWB 2R2EB 5BJTA 4LCYA 3FB8B 2M8XA 4PRID 4JRYD 3D2UD 2XYCA 2OJZH 4M3KB 2BOBB 4GW1B 4RQQA 1MRFL 5CP7B 5D93C 4RGMB 3CPLB 1M7XA 1U8IA 4X6BB 3R06B 1CL7H 4Z7WB 5HHVH 1LO2L 2NY7H 4QWWD 2MHAB 5IQ9B 1V3JA 4NRXB 5HHQB 1YNKH 2F19L 3CLFL 4GUPB 4E0RB 3KPRD 1L7IH 2ADJB 5L2JB 4G5ZL 3HZMA 3SQBA 4KFZC 4Q6IA 4H0IA 4G8FA 1TVBB 1J9CT 2OL3A 1ZT1A 2RHEA 2DYPA 2NW2B 4R2GC 3PGCA 5GGTH 2AGJH 5E4EC 4FXGA 4KJWC 3V5DB 3EZ8A 1A47A 1FAIH 3BPNC 4P4KA 4JEGB 3T8XB 2OR7A 2A0LD 3WKMH 4U1GC 1IKFH 4KK9D 4LAJH 2D4FA 5BS0D 4C4KO 3K7UA 3H7BA 3KYMA 1U3HA 3L3HB 2BVYA 5C2UB 3KS0H 3D48R 2PCPA 3OF6A 5AD0B 2KZ1B 5DMYA 3QZWA 2P47B 1U58B 1G7LA 4N68A 4ZDHB 1G7HA 4NQCA 1T0NA 1MCWW 2F53A 5J3HD 1EJOL 5GGTA 5I0ZA 5I1GH 3DTXB 1WBYA 3IFNL 1AO7D 3QUZC 4ODXB 1CI5A 3SKUD 1EVTC 4RNRB 3UJJL 2DQGH 3L3OA 1MFBH 1MCOH 5IB2B 3ROLA 4QHUB 5IVNA 1AD0A 3HFMH 4UINH 3SO3C 3VXRE 3MUHL 2R0LL 3ZE1E 5CGYC 1DLFH 3MV9E 1I9IL 3TN0D 3X3GH 1MAMH 2R1WA 1GPOL 3S34H 1PKQA 4MDJA 4Q9BA 3A67H 1IARB 1RHHB 1VFUA 5DURB 3U4EA 3B2UC 3NMEA 3MRMA 2P5WA 4P59L 5DJ2A 3D0VB 1H0DB 3MGTA 4Y5XA 4PR5A 4O2CA 3T2QA 3AU1A 3VGHA 3K8MA 2FJFA 2PTVA 4YNYA 3RGVA 4JO1H 3DHMA 3V7MA 2LE9A 3OKNA 1J8KA 4JRXE 4HLZG 4F57H 5IOPA 1ZSDB 1AR1D 3L3GA 3RJDA 2O61B 3B9KD 1H3VA 1T1YB 2HLFD 1DQJB 5D70H 3EOAB 3HC4H 4CMHC 4MJ6B 5HHOA 2PTTA 3TVMA 3Q5OA 4ACPA 3PIQA 1I8LC 3QI9A 3EDKA 2X7LB 2LTQB 3HR6A 5FB8A 1E4WL 2GCYA 3PABB 3AAZB 2UWEE 1NGWB 2YMXH 4UOW1 1S7WA 2J4WH 3L5XL 4UTBH 1R3JB 2GW5A 4PJEB 5LBSH 5EC1A 1MPAL 2DL9A 2W0LA 3KPSD 1TZGL 5EA0H 4Y2DC 5F1NB 1A7RH 3TBSA 4JG1L 4BZ2H 1FNGB 1SYVA 5TPWL 4MD5A 2DI9A 2VDRH 4GKNA 2BJML 3BEWA 3ZKMD 2N56A 3UTSA 1XIWB 1TZHA 3BP7B 1FORL 4OGYH 4WFEE 4K7PL 4YQXL 4AIZB 1A7QH 1YMMA 3QFJB 1IQDA 2BDNH 4YHOH 4DGYL 4GXVL 3ULVF 2FX9L 2MCPH 4JREC 2OMBA 2OLDA 2Z91B 5TFSL 4MXQD 1VFAA 3HR5A 5TE7L 1AE6H 1KCLA 3OKYA 3WHE0 1DR9A 2AABL 4KKLD 1HYSD 4K23L 2VXSL 3OG4B 4OLXH 3OKOB 1SMOA 3LQMA 4ZSOA 1D9KD 3DX7B 4L9DA 5IQ7H 3VWKC 3KYKL 5BOZG 2WBJD 3INUL 2Y36H 4LSVL 4I48A 4G6KL 3JWDL 5CILL 5C1MB 3RKDC 4OCWL 5I17B 4EQ3A 1TFHA 3NTCL 5FYLH 4F7TB 1MUJB 2WSKA 2P24B 3JV5A 4HEME 5A2IH 1NGQL 2BSTB 1BWMA 5J6GB 4APQB 3THML 1CF8L 1NMBL 3L7EA 4O58L 2Y1VA 3MX0A 4M7JH 4YXHL 1ODAA 3LZFH 4Y4KA 4K8RD 3T65A 1OPGH 1NUDA 3SGJC 1Z0NA 3SDXA 1KLUB 2V7NB 4QRSA 5IB3B 4NUJA 4HD9A 2CK0L 4WJ5B 4YEFA 4N8VG 1MHHA 1MREH 5E5RB 1N3NA 3AMLA 4NP4H 4JHWH 4RA0C 5MERB 4M1DH 1LEKA 5IV2B 1KNOA 3V6FA 4OLVL 5ITFA 2I9LA 4S0TD 1EUTA 5DD5L 5HHME 1AJ7H 1NGZA 2A9ML 3I50L 4HUMB 4PJHE 3UTZA 1AD9A 1UKQA 1UZ6F 2J1KA 1IEBB 1BBJB 5EBLB 5D7KD 4L4TB 2YK1H 4TTDD 5CZKA 2F74A 3KXFB 3O6MH 1DSFH 4MCYB 2W65A 5BOPA 2J6EL 3FO0H 4F15C 3U1SL 2N4IA 3C09B 3PWLA 4NJAH 3S88H 3Q6FB 4JZJA 2Q8AH 2ICWI 4LBEB 3ZYZA 2Y5EA 2IBBA 2EEDA 1OL0A 1S9VA 2FX8H 1J0HA 2YD8A 4P23D 3RNQB 1UENA 2FGWL 4OZHE 2CLVB 3MOBH 4Z95L 3QUXD 4LSRH 1QRND 4JFQB 3BN9D 4RFEB 5J56B 1MFCL 4LSQL 5C6TL 2CO6B 1I7RB 4M4PA 4MWFA 2VL4A 2XXCB 5C08D 1T1ZB 4PGDB 5HY9A 3G6DH 4JZOB 3HMXH 1BX2A 2GT9B 2NY5H 3WDHA 2VIRA 4LDLB 5KW9L 2IPUK 4XP5L 3IKCA 3KNBB 5H37H 4IRJD 5FHBL 3MLTB 4HPYH 2UYLA 4PG2A 3WFHA 3ALXA 4XC1L 5D96C 4FTVB 4NCC1 4S2SA 5DJ8B 4XPBL 2YD5A 3QPQC 2BNRA 2DQEH 4KI1A 1CIDA 1CS6A 1IT9H 1I1RA 3EKCA 3IXAB 4XMPH 5GS0D 1WIPA 1LMKA 4ORGA 4KQ3H 1AGFB 4JFFA 1YDPA 3QIUD 3QIBC 4KRPB 1YMHB 1QFPA 2VE6B 3HMXA 5L7XH 1X4XA 4X5WB 8CGTA 2H8PB 3I3BA 4M8QB 1CGSL 1FFPB 3ECBB 3OAUL 2OP4L 3MXVH 2GJZA 2E9IA 4XBEL 5C09A 1BP3B 4CJ1A 4POUB 2A6KB 1SVCP 3IXTB 3LSOB 5MP6L 1HIMH 5DMIH 3H9SA 1WLHA 1XGTA 3EIFA 4GMTH 4HH9B 4RISL 4BFBD 4KUZH 4OM0H 3FQNA 1MLBB 1MJUH 2HFTA 3EO1A 2DLFL 2DM7A 2FYYB 4JFHE 4RFNC 3CCHB 3L6FB 4KXZI 4XBPB 2BVOA 3STZB 1N0XH 2MNUA 1JZ2A 4R7NB 1HZHH 3L95A 4YLQT 3RAJH 1BECA 3IDMB 5SX4H 3DRTA 4XAKD 4HCRH 1QFWL 3FFCA 3RWEA 4K55A 1KBGH 3BSZL 4CRPA 1D5MA 4RAUB 3GSOB 4LCCB 4WRLA 3WUWB 4P5MB 3ZKXC 3QIWD 4HMCA 2R0KL 3VMPA 4OIIL 3BZFA 2DQFB 4QRPB 5EZIH 4ZS7H 1ED3A 1MCQA 3TO4A 5BQ7A 1CLYH 1MVUB 1RZ7L 1MCWM 1FZJB 2BHUA 4UT9L 5EUOB 3VXOB 5KTEL 4NZUL 2EH7H 3TIEB 2I60H 3BWAB 4QHNB 4MB3A 1AC6A 4U6VL 5BVJB 4OTXL 4HIIB 1OWWA 4V1DA 2XA3A 4PRAA 2V9QA 8FABA 2EICA 1UM6H 3Q1SH 1YPZF 1EBPA 4OQTH 4PJFB 2I9TB 5F9OL 3F7VA 2XTJB 4Z0XA 5HYSB 5IB5A 1AXTL 3OKDA 4FABH 1TMCB 3VH8A 4G6ML 2YPLD 4OIAA 3L3DA 1HKFA 5ILTH 4KZEL 5DJDB 2GSGB 4QRUA 5IG7B 1WZLA 1LP9B 3FHQA 5E24E 1EA9C 1NUNB 4XCEA 4HH8A 1NFDB 4M6ML 2F54B 1OTUC 3WO4B 4XPTL 3OXRA 3RBGA 1WBZA 1BQLL 4LEXH 3X3FH 3MACL 4P2OC 2EC8A 4J3OC 3PWNA 4WW2A 4OQTA 3PQYD 1EX0A 2EDDA 3DROA 4NZRH 5IBLC 2GSIA 2V17H 4X8XA 4X83A 1ZLUH 2WV3A 5GJSL 4LIQE 2C4XA 3BVNA 2OTUA 4E41D 4BFIB 3RUGB 1DBBH 4JJHA 4N0CD 3UPCA 1I1YB 1FCCA 4YC2C 2EDWA 1CFTA 2WQRA 3CMGA 4K94H 5GSRA 5F97E 3BIKB 5ANME 3LH2L 2H26A 4TUKH 1IVLA 1K4DA 5C71A 4OFKA 4HHAA 4WWID 1ZGLP 1YN7A 3PL6B 4JN2B 5SWSB 2PW1B 1NJ9A 2ZJSL 4MQ7B 1ZLUK 4YHPA 4MMXC 3MBEA 5GRJH 3QEQA 3RWCB 2R69H 4JHAH 3O11A 3GEWB 3QH3B 3X13B 2QR0A 1CZ8H 3CD4A 2X4SA 3N06B 1DQQB 1FZOB 1SEBA 1PAMA 4UBDD 5ID1B 5ICYA 4O2FB 1QFUL 5T1LB 3O3DA 4NFBA 1JJUA 3GSNH 1PG7L 1T89C 4L4VA 1GH7A 1E4XH 4YO0A 1N5AA 5D5MA 2A6DA 5D1ZC 2XWTA 1HNGA 4GG6A 4UILH 3HRZA 3RVTD 4N0UE 4KHXL 4TYUA 2X09A 4JO2H 3BE1H 2EO1A 3KPPA 1H3GA 4BK4A 4MZ2A 3BQUB 4QEGA 3BISA 3V5KA 5F7KC 4PGZA 5L6YL 3QJHB 1SYSA 3IJSB 3U6RB 4YZFF 5D2NE 3ARDB 1RMFL 1ZHLB 1DEEA 1G9NC 4XP1L 1H3PL 2RCSL 3L7FA 5HGAA 2B5IC 4NRZB 5E9DA 4UT6H 1OT2A 4EVNB 1T4KB 3GSNA 4GXUM 1B88A 2ZPKL 4XVSH 1DVFB 2OR9L 5JHDA 2HVKA 1SBSH 5DHYB 1OTTC 5KVEL 5D7LB 4KTEL 4DEPC 3VXQA 3GSRB 3BYYA 2DBJA 2OJEB 3I2CL 5DGRA 3NFSH 4PB0L 3VE0A 3VXNB 4G6AD 5F7EL 2V5TA 3GO1L 1NKOA 1XCTA 4JKLA 3QRGH 2F5BL 2NCMA 2BNQD 3V6OA 3ULVC 4Q6IC 3MRHB 4ODVH 4PBWD 3DX9B 5T5NG 4XVTL 3O6LL 3ZDYE 4RDQF 4LGPB 2Z31A 1S7TA 2AI0L 2D7TL 1RFDH 4MX7A 1E28B 4JHZA 1X7QA 2C1OB 3BUYB 3QQ3A 1ZMYA 3BH9A 1GAFH 3JTTB 1P9MC 2VWEE 4LKCA 3RY4A 3TA3C 2QKIA 2NY0C 3IDYC 1ADQH 5DK3A 5E2VL 1T1WA 1F4HA 1CFQB 1CN4A 1F6AA 4GS7B 3FCTA 5IFAH 3FAWA 3GBNH 2OYPA 1U3HC 3KLHD 4PRIE 5I1HL 3T0EA 3D25A 2A9NH 1K6QL 3NCCB 5IROA 4RX4A 3WHXB 4RGNB 4D9RE 3T2OA 3IKKA 3TBTA 3E2HB 3IDIA 5KZCB 1ZANL 1QYGL 4QRRD 5CZXC 1Z5LA 1F5WA 4NQXB 4MNQD 3RVWD 4G3YH 4Y5VA 3GBML 5FCUL 2XY2A 1TJHH 3MV7B 3FRPG 3SDAB 4JO3H 1JUFA 3RA7L 4CKVX 5DJXB 5HYFA 2BSRA 4UB0H 3MLUL 1ADQA 4O4YH 1WZKA 1PY4A 4L8BB 5B38B 1A6WH 5HYEA 1Q9KA 2ED7A 3GMQA 4CDHA 4WFHD 3V7AE 3MNWA 5AYUL 4TSBH 5ADOH 5GGSA 4PLJD 3JVGA 4GT7A 1PEZA 3KGRA 4Z7UA 4CU6A 1WC7A 1A02N 3PHOB 4M5ZH 2P8LA 4HWEL 4PJGA 3BH8A 1O5DT 1KN2L 1X5AA 5BS0E 4KJQC 2ATPB 3EFFA 2Y6SC 3BP4B 1K2DB 1FZKA 2DI8A 4Y1AE 5ETUB 3BEVA 4MNHB 5BV7B 2ZUQB 5ALCL 4LF3B 1P84J 2XV6B 2NX5D 3G9VA 4KJYA 4Y5XC 4WUUA 5D72L 3BO8A 5EORL 1J0KA 3SDDA 5F6IB 3K8KA 3U7WL 2ATKB 3RGVC 2AXFB 2R2HA 1PD6A 4F2MB 4ZOEA 2BXYA 4FFVC 2DJUA 2IBZY 5D5MF 4F7EB 2FZ3A 1AGDB 1A64A 5I2IA 5IHBA 1FNFA 3BZEB 3HE6D 3NGBB 1FBIH 1D6EB 4ZXBD 2R4RH 2AJVL 2N7BA 3IT8D 5IGXL 1G9ML 4OM1L 1YEKH 2VUOA 4JANA 1JCKA 3ZT5A 5IB1A 2D03H 1L0YA 2YXFA 4M61A 4M8VA 2C9AA 1OGAE 2XZAH 4IOIA 1TPXC 2XRAL 3F58L 4YHNA 1KIQB 1RU9H 2NY1D 1XFPA 4LRIA 2YN5A 4DN4H 1SJHB 2E7MA 4PRPD 2ADFL 1KIPA 1XH3A 5C0BB 4K07A 3DX6A 4K3HA 4LDEB 3LD8C 4JG0H 5FK9A 1D3CA 1PGRB 1EGJH 4G8GA 1FGNH 2APBA 1GGIH 4F58H 2FEDC 2XN9E 3QO1A 3NPSC 5CJOL 4NDMB 2VZVA 3OGCB 2FB4H 3MLZH 2ZCHL 2QADD 3CDGA 4RCAA 4DW2L 1NC4D 4G80B 1FFQA 1F6LL 4HGWA 1QSFD 1P7HL 3FQXB 3NZ8B 3SE8H 4Z76B 2NNAB 3C5ZC 3DURA 4FFYL 5AG8A 5C0GB 1TTFA 2UUDH 1RIVL 4H26B 1N5YL 2X4PB 4QKXB 5E8DH 2EH8L 2PN5A 3L5WB 4MAYC 2JELH 3ULUE 5L9DL 4Q2ZA 4X98B 4DOHB 4XCCL 1CR9L 5F1SA 4ALAL 3GK8L 1BIHA 3HPJA 2E8YA 4NO3A 4YDJB 4EI6B 1WSST 1EGJA 1A5FH 3BKCH 1HXMB 2WM0A 3FO1A 1OQOA 1AGEA 2CXGA 2KKQA 3ZL4L 3ZLQC 4JY5H 5DS8A 2G5RA 4EUPH 4WGWB 3HE7B 4EJ1C 1DBAH 5MI0C 1CT8B 1GZPA 3HNTH 4EZMA 5FDWA 2UUDK 3ET9F 1BJMA 3BOVA 3RDTB 1A7NL 3T0AA 1JGUL 4NWTL 2DAVA 3W0WD 3K1KC 4OD3H 3GSXA 1NANH 2IH1A 4Y4KC 4J6RH 3OJDB 3TH4T 1IAIH 3NCEB 4G6FD 3SY0A 5F1IB 3GJEB 2NY4C 3UJTL 3VXTA 1F4XL 5IMLA 4OZFA 4ODWA 3KLAA 1IBGH 2E27H 4LRNH 4N5UA 5E2WH 4RMTA 3GSWB 1CGWA 3VFGH 2HKFL 1I7TB 2HMID 2EYTB 2XZCH 1NFDE 4OLUL 4EUPA 3AROA 1NL0L 1M7DA 4K7FA 2F54E 3H6JA 2VL5B 5I18H 1IGFH 1OSZA 5BRZA 2DLGA 2E6PA 1C16A 4IOSD 3IRPX 1OLLA 3JUYA 4OFVA 4GSDL 5F7LB 3BWUC 4ZO7A 1MCFA 4PJGF 4XVJL 2R4SL 4TVPD 3SDYH 1Q9LB 5LXGH 3DO7B 4NBZB 1L6XA 3W11C 4PUBL 3QQ9D 3KPQB 4ONGL 1UJ3B 5DVMA 2ZSWA 4IMLA 2PYEA 4QHKJ 3VWJB 4HKJB 4XCFL 1OCWH 2DMKA 1X6NA 4MCZA 1A6ZA 4XBGB 5D8JH 3WFCH 1JI2A 1J1OH 5ESQA 2YWZA 3O3AA 2V2WA 3GDBA 3MRNA 2JB6B 3OKMB 3MLXH 3ZDZF 5JNYA 2P45B 4H8WL 3PHQA 1I1CA 1HXYA 4HGMA 3QUMB 3VFNB 1WV7T 1VACB 3CUPB 5C0CD 1A1OA 1I1AD 2Z93B 4OJFH 3MLWH 3FN0H 4NN7B 1BFVH 1JL8A 1DBKH 2CKBB 4Y5YA 4QCIB 4JO4L 1EO8L 5CMAB 1MI5D 3TIDA 4PJ5E 2BMKB 5DRXA 3EYOB 4KJPD 4Z8FH 4MJ4A 4ODHH 3QZWG 2MCG1 3X14A 5CZVH 3DPBA 3DMMA 4E5XB 1JWUB 2D31B 3JSSA 1J0IA 1OAKH 4LU5L 3CFDB 5I16B 2OI9C 3DBXA 1UB6A 3HLAB 4HS8L 5EBMA 5T3XD 1KCSL 1C08B 2KZWA 5IW3A 2F8OA 1LO4L 5F71A 3SJVE 4EN3D 1F42A 5FF6B 2I25N 4FQ1L 5CUSH 3N85H 3BJLA 4X4ZA 2NY5C 4PTUA 4HS6B 4FG6C 3GNML 4YAQB 2WWMC 4HLJA 4P2QA 4WHTA 5E08L 3I85A 2WUBH 3D3VB 4XPGH 2RQ8A 2APFA 3VU2A 4X9GA 5I19L 3EW3B 2EYSB 1VGKB 2EDKA 1FN4A 1WWAX 4JFOA 4NM8H 4BQ6A 3IETB 3QG6A 2BHYA 4RMRA 1T6WA 4LCWB 1P5VA 1UWEL 1KJMA 5C9KA 2WK2A 1HKLL 1KCUH 1A4KA 2A83B 2NLJA 5CHNA 5C2BH 3HC3L 2V2TB 3T2PA 5J9PB 5GGRB 4PRHB 1U8PB 1VFBB 1YQ2A 1CXHA 2E5EA 2WLYA 1DUZB 2E7BA 3SHSA 3CSPA 5B8CC 4LGRB 1UXSB 5DT1H 4HQQH 4PJHF 3GB7B 2APXA 3GHEH 4L3ED 2AEPH 2C3GA 1AHWA 4QF1B 5EWIL 1QBBA 4GBXD 4FZEL 1MWAL 4YBLB 5C0AA 5GRUL 1NBYA 3VXMB 43C9B 3BPCB 2Y06H 4NCDA 3TO4C 1GHFH 5KVFL 2LU3A 4K3EH 1RJYB 3PXHA 4IIQB 4FZ8H 3BKJH 4G8IA 2X70B 4P59H 2IEPA 1OAUL 4CAGA 2VQUA 5EZOL 2Y7QB 3HC0A 1RK0A 2FL5A 5GSVB 4GW5A 3DV6B 3I75B 2A77H 5IHUH 4PJBA 1U8OA 2VN7A 4OZHF 4G7VL 3QFJD 1PLGL 2VLKA 2W0FB 1R5VA 4FXKA 3ZTNH 5J7CC 1WFOA 5T1KA 4QHMA 2A6IA 3P4MB 5EU4A 4JPWL 2DN7A 3BHBB 3CLEL 4ZTOH 3D18B 3AS3A 4MD0A 3O6FB 2GTZB 2NR6C 1S7UB 2BSED 5F1OB 1MY7A 1E4WH 1QPXA 4XWGL 4YHIA 1CWVA 4GKSA 5IEHB 1EAPB 1HEZA 3WN5B 4KJWD 5F8RC 2FX7L 1QLRA 2H2PC 4J3WA 4P3DB 3OSKA 4HAGA 3C08H 4M03A 2EDOA 5FOJA 5C0FB 5EU7E 4P3CL 4R7DB 1T2XA 4N8CL 4WHCA 5L8KB 2VLJE 3IGAA 3KYNA 1S7XB 4KKCD 4U1IA 3VXSA 2BOCB 3JV6A 5CIPH 3FZUD 4P5TD 4ZNEA 1I9JL 5AZ2L 1MVFA 2AK1H 4YQXH 3M07A 4UT7L 1JK8B 4MAUH 7CGTA 3ARFB 3ARWA 3DIFA 3ZKQD 5TFSH 4OLZL 1KJVA 3D39B 5J57B 1K4CA 4U1SB 1FZMA 5B3NA 2N7AA 5F96L 1S7SB 3KYKH 2ICCA 2N1KA 3E6HB 4NKIL 3CSGA 3EGSB 1U8KA 5CIPA 4L4TD 3SOBL 3RY5A 3BGFB 3KXFD 3MBEC 4KKAD 4JFYB 3S4SA 1P4LA 1EHNA 4K71B 1D5XA 1FG2B 2H6PA 1N59B 1O0VA 3HUJE 4MA1C 4X6DB 2APTA 2NTFB 1YN6A 1U93B 4HKXB 3IDJA 5J1AA 1DDHB 1RVFH 4ONHA 5IESH 4ZPTB 4MNGB 4K94C 4Y19B 3O0RL 2IFFH 2O5XL 2IBZX 1C7TA 3IDNA 1CU4H 4WCYH 3FB5A 3VXUA 2CK0H 4G43A 1AKJD 1MFAH 1W72B 3DV4A 2LQRA 4YGVA 2EEAA 1DE4B 5CBAB 4P46B 1RIUH 3H8NA 2GITA 1P6FA 2QSCL 1NCNA 2J88L 3M17A 3RI5K 1LWRA 3MNZB 5CEYB 1P4IH 4OLVH 2YZ8A 2WWKT 3QFDB 5FM5O 1KCVH 1AC0A 2UVFA 3FOLB 3KYAA 3E8UL 1FPTL 3JV0A 5TQ2H 5CGTA 1GGUA 3QHTC 5F9DC 1RIHL 4ZUUA 1ZEAL 3QUYA 2UZXB 1N4XH 2BERA 2MWCA 3CSYA 2IPUG 4EEEA 3RL2A 1QSEA 4A2MA 1H9VA 4WIQA 3KPMB 4YHKL 2IANE 3G6AB 1KJ2B 4NN6B 1AY1H 4NQED 4ELKB 4KVNL 2ITDA 4X4YA 5GRXG 4QXTB 4BH7A 2DLTA 4KK5D 3BFOA 3U0WH 4G9DA 3V6OC 4JRYA 4NOBA 3D2UA 3UJIL 3I9GL 1OWRM 3RFZC 4PJIE 4ELMA 1CLOH 2Z31C 4MLIA 3MRBB 4MA7H 4DJMA 3QUKA 4JY6B 4GQPH 1NMCB 1PQZA 4LEOB 4KQ4L 5LCVL 4ONFH 2D7PA 5KW9H 1NCTA 32C2B 5EO9A 4XPAH 5H37G 3CMOL 3KPRA 4NSKB 4HFUL 5F3BB 1H15A 2R8SL 1QVOA 2A73A 4F9LA 3BP5A 3DUSB 3N1QC 5E8OB 3O2VL 4NUGH 1FL6A 4X6CA 1JRHL 5IROC 1QBML 4ZAKA 2BVTA 1G7JB 5TDNA 4TSCH 1ONQB 3B3IA 3QQ4A 1JZ8A 3S7GA 1NC2D 3O45A 5EDXA 4PY7B 1D7FA 4Y5VC 4ETQA 5C8JB 2A38A 1J0JA 4UNTA 1UH3A 3FAXA 4YDVA 1MAJA 4PV9B 4ZPVA 1UM5L 2YRPA 4YPGA 1JHTB 5EZJB 3QNXA 4B5EA 3IU4L 2OSLA 3C9NA 5SWZD 3CFKB 1MCBA 3HB3D 4WEUD 3VRJB 4KDVA 4PS4L 2YN3A 2NZ9C 3BKYH 4N8VB 5EH1A 1NDMB 2WP3T 3JVGC 3QWOB 1FHGA 1ZVHA 2ZUYA 3QYCA 3K74B 2EYRB 4Z7VA 1NFKA 4BFGA 2HFFA 1AO7A 4UDUA 4R26H 4MJIB 1UKTA 5LWYL 1RJLA 5GQBA 1X44A 1VENA 4UQ3A 1PVHA 3KDMA 1HNFA 1BGXH 2RR3A 1AQDA 1KEMH 3U7YL 3KPLA 5B3JF 3PDDA 1CGTA 2JCCB 3RNKB 3SDDC 4LPTA 1HE7A 3TN0A 3U0PB 4PGBB 4WI5A 3IDGB 4P4RA 4ZYKA 4NC2B 4MNQE 4RDQG 5GISH 2C7UB 3V2AR 1FJ1A 1QHPA 1DQML 1PX3A 4JDVA 4ZOBA 1X5HA 1U8QA 4YBHA 1LK2A 4D9LL 4M62L 2PW2A 5KTEH 4JPVL 4U1HB 4PP1C 5JXAH 3NIDE 5HI5D 5E4EB 3RI5F 4F3FB 4DUVA 3O4OC 2FIRT 4PJXB 5DUBA 4WDIA 2WIIA 1JF1B 4PLOB 5C9JA 3MRJB 4U1GB 1HWHB 3CDCA 5AG9A 5ALBH 3MFGB 4LRIC 4C56B 1R24A 3EFDH 3OMZA 1GJIA 4JDZB 4LHUA 5C07B 4YX2H 5FYKD 4UUJA 5L2KD 4CN4A 5KS9B 3HNSL 3L9RA 3MREB 4R90L 2QSQA 2P5EB 2NX5E 2CSPA 3HI5L 1VEMA 1X5LA 4KZEH 3MRKB 1U95B 3MRRB 2X5PA 1T20B 4I2XB 1CE6A 4G42A 1GZQA 3LKPB 5E95B 3PL6D 1CFVH 1IGML 5SWSD 1MLCB 3QUZB 3RPIA 4OF3A 1LK3L 2IQ9L 2X4RA 2XPGA 3FN3A 4XPTH 2IPKB 3DRQA 4WO4C 5TH2A 4ELMF 3CC5B 5F7MC 1IGYB 1MJ8L 3X17A 4M6NL 2B2XH 4QOKE 1S9WA 1EHAA 4MS8D 5DVNA 5T1LD 4DZBA 1L9MA 1JHLL 4KROC 2NYYD 5D7IA 1D5BB 2VDOL 1NGXB 5JUEL 5ELIA 5DJYA 4RFOL 1JGVL 1QLFA 2M2DA 4PRDB 5FGSA 2KBGA 4X6CF 4QRQB 4P0DA 4J3TA 3QNZB 3EO9L 5FGCB 3BQUD 5DK0B 5F9WB 5EZLA 3K1DA 4K8RH 4I3RL 4HX1A 5JPMA 3HZYB 3U36A 1MNUH 4YFLF 1TQBB 3FTGB 4AENA 3G5VA 1NBVH 1D9KA 4Z18A 5GPRA 1FLRH 3O41B 2CO7B 1T80A 3V0AC 5EOTA 1YEJL 3OXSB 1FNSH 5HYJA 4LLQA 1VFMA 4OB5L 3SE9L 1JFQH 1MF2L 5DD1H 3BT2L 2ADGA 3MLPA 5BXFA 4FQIL 4PLKC 3MRIB 2F58L 2FJGB 2CGRL 2VLLB 1IL1A 3TO2B 4CMMA 3LKNB 2DQIH 4J4PD 1BBDH 4S1SH 1BM3L 2AP2A 3MV8B 3QHFL 4J3UA 4NQDB 5HHPB 3RVXC 4F33B 1T7ZA 4CW1A 4Z7VF 1PG7H 2HRLA 2VERN 2L7UA 2AV1A 1FFNA 1OAZL 3CH8A 1CTNA 3IJYB 5INCB 4GRWB 1WBXA 2AJUL 5SX5H 4IHOB 3UPRA 2JIXD 4HDIB 4NKMB 1Q72L 4LCUB 3SDCC 4CL7A 4Y2DB 5CEXB 5GXBB 2D0HA 3D69B 2Z8VC 3C60C 3AREB 4S1DD 2FBJH 2W9EL 3L3JB 1CG9A 1T6VN 1IMHC 1X5YA 1KB5L 1RMFH 3TBYB 1H3PH 3S35X 3ZT6A 3MA9H 1WITA 4M5YH 4EKXA 4XMLH 4JAMB 2HP4A 1J18A 2X4NB 1RJZA 2VXQL 4JREB 2DMCA 4LSSL 5JDSA 1F11A 2ZPKH 3D9AL 4UQ2A 2OCFD 5C0DA 5MENB 4ZFOB 2GIYA 1SJEB 5JQ6H 1TETH 3BDBA 5K9JH 4Y5YC 3AY4C 4PJDE 1HCFX 2F8VA 4ENED 3VWKB 4P23A 3MV7D 3GO1H 4LLDA 3VI4E 1PEWA 4XNYH 1QRNA 5GS0H 5JW3H 4TVPE 3DMMC 2HKHL 4UOW0 3ULUL 4HMDA 1A6TA 5ISZB 4MNGE 4M93B 1KLGB 5IMKA 4JDTH 4NKDB 5IVXB 1W0WA 3DVIA 4LLUB 5DJ0B 2PO6C 4D0DB 5IR1A 4PIRF 3T1FA 4KK8C 5AAWA 1GXEA 1JGEB 1X4ZA 2VYRE 3ARGB 4IRJA 4JCMA 3KLSA 4XNMA 3UZEA 4Q7DA 2ZUSA 4ZTPL 1L6ZA 1RZ8A 1EIBA 1KPVA 2OTPA 2DWDB 4AJ0A 2DB8A 4OCXL 1QR1B 1OGTB 2GAZB 4BM7A 3DECA 4M48L 1DL7H 3QDJB 1FO0B 1CL7I 5C0CE 2VJXA 3NBNA 3QXAA 3HHRB 1EEYB 4KKNA 5J1SC 3T1WA 3WLWC 5FCUH 1YEEH 3UTTD 3O4LA 3PDOA 1BD2D 5DJAB 4KMTL 5F6HI 5IJVA 4EDWL 1R5IB 3C6LB 1NKRA 1BVZA 3M8OL 2H9GA 1RHFA 5FUOH 4F15B 5T3XE 1FNLA 1AHWC 3GM0A 4NQSB 1UA6L 2IWGA 2PUQT 1QLEL 3TJEL 3WE6B 3CZFB 3BIAX 1S5HB 1RZIB 3TZVA 4AG4L 4EIZC 4GKZB 2XQBH 5E5MA 3FB7B 3WJJA 4S10A 5GRZA 4HWBH 2X1XR 3S35H 4LP5A 3EYSL 1FVCB 1M4KA 4URTB 5ENWB 3KR3H 3GFUA 3QXVA 4LLVA 5ID0A 4EBQL 5EORH 4EOWH 3WV0A 4LMQI 4XPFH 5IBTL 3AVEA 3U7WH 2I07A 2ARWA 4XB7A 4LQFL 5K59E 1KEGL 1OTTD 2CMRH 4Q9RH 1DUYA 1YY8A 3PGFH 4M6OL 1V7MH 2ZKHL 5JLZB 4KKBC 3B83A 5SWQB 1F4YH 4MMZC 1UG9A 3V4VH 3FT2A 2X4TB 2YD6A 3OR6A 2FWOB 1A1NB 1KUMA 5EOCL 4NNYB 4BH8A 4HXBH 3G5YB 4MQSB 3VXPB 1JZ7A 2IG2L 2FR4A 4L3EE 4NQVA 3QIBB 2DYPD 2GJJA 2F5AL 2X40A 3GMOB 5FOBB 3HRPA 3TGXA 2XRAH 2H1PL 2DM4A 2V7HA 3G04A 4OFYD 4Q9QH 4P4KD 1JWMA 3NAAL 3VFWA 2NY0D 2BVQB 4JCLA 1FL5A 2V9RA 3I02B 2YPLA 4P2RA 3FMGH 3RDTD 5FFLA 3MLRL 1PYWA 5DYOB 1WCBB 5EPMA 4LNRB 1MRDH 1Z6JT 2H41A 1FRGL 5GJTL 4TRPL 5DD3L 2P8PB 5IM7B 3OF6D 5IHZB 1ZGLM 1EXUA 2YUWA 1C5CH 2IPTH 5I1LA 4M1CC 1HWGB 5DSCB 2F53D 5CZXD 3PP4H 2X9YA 3O9WD 2C3VB 3NABL 3PQYA 4Y4FB 3T0XA 4HIHB 1RULL 1XF5A 1VPOH 1CR9H 2OK0L 1NEZG 1CD8A 3R0NA 5ERWB 3SQOL 2B1HH 2OX5A 4B53A 4UV4L 5DQDH 4X7TA 4HAFA 3U9PH 3QXDB 4E41A 3RVUC 4PJ8C 3EOYG 4EUPG 4JN1L 4KC3B 1YNTA 5IK3A 5ITBH 5J6HB 1F02I 4PJXE 4LASL 1D6VL 3UTQB 3DUUA 1Q9WB 3D0LA 5IKCB 1HQ4A 1CE1L 4C83B 5D2NC 1VADB 4BQBA 1JE6A 2R9HC 4HBCL 5FKAB 1MHCA 4NWTH 1IZKA 2DD8L 3ES6A 2QQLH 1P7QA 1D5IL 5DD6A 3VWJD 1XGYH 3T77A 1KXQE 1NBZA 4RMWA 5LGKA 2YA2A 2O5YL 3NFPB 5JO5A 1LVEA 4KK6D 1GGBL 2HT4D 3WEXB 4Z7QE 4OF7A 2B0SL 2CKNA 3KYOA 3B9VA 3NZHL 4I2XE 3QDGA 1ZTXL 4CADA 4UZGA 3C5SA 3WLBA 4NZTL 2X89A 4X4XA 1EFXB 4M6AA 1HSAA 3EYUL 3V79C 5CEZE 4YE4L 4XNXH 1NGPH 1S8DB 4FQQB 4OFPA 5HHOD 2DLEA 2VQ1B 3TVMD 5TDOA 3QI9D 3QUYC 5KSUA 4X9FA 1OM3H 1NAMH 1IC5L 3HI1A 3LKSA 4PTTA 1FL3A 4P2OB 4WHYH 3RP1A 2HLAB 1RSFA 1XR9B 4JFEB 5FYJD 1XF2A 1UC6A 3OWEA 3ILQC 3WUZA 4J1UA 2YD3A 1A7PH 1KCRH 2VABA 2EIDA 1MFDL 5FGCE 3U30C 3WD5L 1ZGLB 5DEZA 1KT2B 1R3HB 5DRWA 4LARH 4TUOB 1QG3A 5TGBA 2EXWD 5MEPA 4AMKL 2GYSA 5I1CL 1KELL 1FYTB 4JRXA 3UTSD 6FABL 1JYVA 4LK4A 3D3VD 4H8WH 3T3PE 1MHPL 5FAAA 3CX2A 4HUVB 4Z77B 4M4RA 3P0VL 4YC2B 2W92A 1QA9A 1NAMA 4X4ME 4QWWC 2HG5A 5D6CA 5EBWA 5CJXA 4LSTL 5BV7L 4ZODA 5BVPH 4X99A 4ZUWB 4X0KA 1WFNA 2Q20A 2BNQA 4PY8I 6CGTA 2VAAB 4OT1L 3EAKA 4PRHD 5IBUG 3R0MA 3MV8E 3OX8A 3HZVA 2OTWA 1XGPA 3NCJH 5DI8B 4LFHG 1MY5A 1BVLA 1EAJA 2ESVB 1U8LB 4BUHA 4EIGB 2YD1A 3FB6B 5BMFH 5E99H 4MXVE 4GLRH 4HJGB 4HFWA 5J89A 4GW4A 5T33H 4AQOA 4M7ZC 5EIQA 3HAEH 4KK9C 4NQEE 3U46B 2E9JA 3KPNA 2NY3D 3LQZA 1YYML 5D1ZB 4FQCH 1S7QB 1MQKL 4PJAA 2PXYA 4RAVB 3H3PH 3W9EA 2GY7B 1I85A 5HGDA 3LKOB 1Q0XH 4D9QD 2AJXL 5C0EB 3SGDH 1JVKA 5J3HC 4QRRA 5HVHC 4BSVA 4HV8B 3MC0A 1P69B 3LIZH 1NCDH 1J1PL 2WBWB 4YBQD 1I8IA 2B5IB 3LS4H 1T03L 1CDGA 3HAEA 4LCYB 5EIIB 3FONA 3GJFB 3B5TA 4OLWH 2W38A 2HH0L 3JTSB 5EUKA 3SE4A 3HA0A 2YC1A 2B7DT 1I3RA 1OD7A 2DQDH 2BCKB 3NACH 1Z3GH 1ZKAA 4DEPB 2I26N 3CX5K 1T0PB 2EIBA 1R3KA 3TN0C 5DA4A 3KPOB 3OTTA 1XEDA 2JK5A 4Y16B 4XVUD 3GMRB 1CICD 1GOGA 5FM5M 3CK0L 5I8OL 3B43A 3LKQA 3ROOB 4N5ED 1YNLL 2BVUA 5SWZE 5E2UL 1C12B 3QEUB 3DLQR 1XGUB 5CJQL 5DHVH 1RZFH 2XZZA 4L8SB 2BSSB 3RVVD 1QSZA 4XP6L 5E8PA 2DDQL 3TNMA 3TA3B 5FECA 1BJ1J 2VMFA 3LEYH 1E27A 5I0DA 5JMRA 1P7KB 5CKAA 4ZD3L 1JV5B 4HK3J 4IOFD 1ORSB 4WEBL 1Q1JL 4PRBA 4ZXBA 5JZ7D 3QDJE 2G75A 1D5ZA 3LN5B 3P4OA 2VITB 3ME0A 2HLFC 4PJIF 3TT3L 5JR1H 5K9OA 3ARFD 4XAWL 5F89A 4JQIL 5SX4I 3JWOL 3C2SA 3QZWB 3D87B 3D39D 1V8HA 1U8MB 1IC7L 3W39B 4OZGE 4KAQL 4LLWA 2HRPL 4QGYA 4H0HB 3CFEA 2BNRD 4Z7OE 3R1GL 3D5OF 5AZEH 2IADA 5DHVA 1A14H 4NO2A 2V5SA 4P99A 4W6WB 5LGHL 2NPLX 4JFFD 4CVXA 4PRPA 3ZYIA 1DJSA 3EO0B 2HWZL 4LDOB 2QHLA 4KZDL 2IQAB 5IHLB 5IWLA 5ESVA 3ZE2E 5CJ8A 3RWIB 5JHLH 3FT4A 1YUHA 3P30L 3ZSSA 5I1IH 1NLDL 2R23A 3ZKMC 3V4UL 2VXVL 1NC4A 4S1RL 3S37L 4Y19D 5C09D 3WFEL 1QSFA 3S4SG 3V0VB 5IMMA 2VKWA 4IRSA 43CAB 1DQDH 4MQXD 3UYPA 3O3BA 4Z5RB 1CTOA 5H2BB 3CAFA 2ARJB 2Q3AA 4MXQC 3MROB 4X5XA 3TP4A 3QO0A 1QFWM 5T3ZD 3MRGA 3V4PH 4KKLC 4IS6B 4LQ1A 3UYRL 5L2KE 1HYSC 4UDTA 2IALB 1K5NB 4I0PB 2V2XA 1D9KC 1HI6A 1MCKA 4YNYB 4N1CA 1RK1B 2GTWB 1SY6L 2WBJC 3IAGC 4R97C 3QUML 5F96H 3O2WH 1S9XA 3FFCD 4YR6A 1UCBH 5IOPB 1XGRB 2WUCL 1KF9B 3GMNA 2BVPA 3G6JA 4PJAF 1QQDA 2J8UB 4N90D 1LD9B 4I13B 4KTYA 4WW1B 1HDMA 3C2AL 3NCBB 2HAZA 4JPKH 2FATH 1CXEA 1U91B 5HDQH 3KWWB 3L3IB 2ADIA 1UWXH 4K8RC 2UZIL 3PWJB 2IGFH 1U6AH 1WEJH 4OFDA 2R2EA 3FB8A 5FM8A 1DANT 5KANG 2EXYD 3T0WA 2BOBA 4GW1A 3CSBA 5CP7A 5CAYB 4XXCA 4IMKA 4YXKL 5JORB 4F7PB 4LOUD 3FQWB 3V5HB 3CPLA 5I1AB 3T09A 3LD8B 4X6BA 3R06A 4Z7WA 1V7NL 3NPSB 2MHAA 5IQ9A 2H2SD 1BF8A 4NRXA 3ZTJG 5HHQA 5DDHA 4GUPA 3MJ7B 1J8HE 2ADJA 3E8UH 1FPTH 4TTDC 5L2JA 3O2DL 1NCWH 1IGIH 1AH1A 3C5ZB 1TVBA 3Q3GB 3V8CA 2Z0BA 1GCFA 2NW2A 2QHRL 4MAYB 2DRUA 5J13C 4CU8A 3V5DA 4C57C 2R1YB 1I4FB 2H2PD 4DTGL 5DWUH 4KTDL 2IJ0C 4P23C 1TVHB 5DQJB 3V7AG 5JMOC 3QUXC 3BN9C 3L3HA 2AK4B 4BZ1H 2P1YA 3L1OL 5AD0A 1JN6B 4KHTL 1U58A 3QCVH 3LV3B 1I1AA 4ZDHA 2CJUH 3BDYH 5LGJB 4OAWB 1WIOA 1RY7B 4Y4HB 3CDFA 3DTXA 5LCVH 4ODXA 4IRJC 2FEEI 4HIXL 4MDIB 4MJID 1I9EA 5DJCB 5C3TA 4NBXB 2VXTL 4ZFGH 4PJCB 4NUJB 1UJTA 1J5OL 3EBAA 1KTDB 3FL7A 3Q6GL 4G9FB 3O2VH 5IB2A 2HYMA 4YHLH 1Q0YH 4QHUA 5GS0C 4TOYL 4EN3A 5I76B 2FD6L 3QIUC 3EOBB 2EIEA 3QEQD 1NGZB 3LEXA 5JW4M 1NAKL 5HTSA 3RY6A 1JHKL 4XPHL 2GK2A 3REWB 4NGHL 5DR5H 1JPGB 3RJQB 4ZG1A 1YPZB 4LPWA 2E9BA 5F7HA 1RHHA 5JOPD 1RURH 3G5XB 3HMWL 1QEWB 1I3VA 4F7CB 1U3ZA 4XHJD 3V0WL 1YZZA 4L4VD 3D0VA 5IFHL 3S36L 1H0DA 4M3JA 2ZUTA 3WYRA 1OTSD 4RWYH 4ODBD 5EFIB 1ZHBA 4KDTA 1WQVT 4AK1A 5F7DB 3TV3L 4HSQA 2V5YA 1I8MB 4TQEL 1ZSDA 3TT1H 3WJJC 3REVB 4N9OB 4C56D 3O8XB 3QXWA 3IFOB 15C8H 3Q5TA 2O61A 5D1XB 1T1YA 5EU6E 1OAQH 1DQJA 4NO5B 5C07D 1HYRC 3EOAA 3G6JF 2M1KA 4FQXD 3JZ7A 4N0YH 4X8JB 3P0YL 4LPVA 2RJMA 4MJ6A 4LCIL 1BZ9B 4GAGH 4BK5A 3MR9B 2CRIA 5E9DD 2X7LA 1DFBL 5F70A 2VXUH 4K3DH 3QIWC 3PABA 3V6ZB 3AAZA 4LP4A 4KV5F 1NGWA 4P48A 3T4AB 1FYHB 3BXNB 1DLHB 4XNUL 3U4BH 3WL9B 3DYPA 1MFEH 1T2QL 2X4UB 4I3SH 1R3JA 2YSSB 3QDMB 4WFFD 3LN4B 2Y4SA 4NT6B 2R29H 4PJEA 2AV7B 3UTTE 1BD2E 5F1NA 2X1PA 1FNGA 5L88L 2OI9B 4QTIH 2A1WL 2NY2C 5IMOB 4JPVH 4HGKC 4Z7WF 4PGJA 2Z4QB 3VD4A 3FHAA 2XICA 2GJ6B 1XIWA 1YDPB 3OAYK 3BP7A 2CDFB 4AIZA 2HVJB 5C0IB 2Z31D 3QFJA 1Y6KR 4RRPA 5DD0L 1Z9LA 4OQ1A 2J8OA 2P4AB 2Z91A 4IRZL 1LO5B 1ITBB 1YEHH 4P9HH 2J5LC 3OKOA 4TVSa 3SPVA 3HI5H 1F13A 3WO3B 2A74B 3T0ED 5KVGH 1Z9MA 4PV8B 1KIRB 1CDIA 25C8H 4RX4D 1C5DB 1J11A 2EE6A 4LAQH 3C5JB 4AEIL 5I17A 1RUQL 5KJRL 3VFRB 5A2KH 3RX5A 4F7TA 1MUJA 2P24A 4D0BB 2OMNA 5F7FA 2BSTA 3WMSA 1A6VL 5J8OA 3O81A 5B8CB 4APQA 5J6GA 5DLML 3LPWA 3HI6H 5T5FL 4NQDD 1IEAB 1JZ4A 4Z0BH 3ULVE 2Q87A 1AXSB 1KLUA 2V7NA 5DXWA 5IB3A 3H9YA 4HXAL 1LDPH 4WJ5A 4FQ2L 1T22B 5KN5B 1PZ5A 3TYGH 4RFOH 4OF5A 4N0CC 5BQ7B 5IV2A 3BZ4B 5HGGS 4RMSA 1XCQA 5T3XL 1A0QL 1EO7A 2DBLL 1OAXH 3ARED 4S1QL 3VFVB 1A6AA 3HNVH 5B39G 1AFVL 3PWPB 3LHPL 1RZJH 2AW2A 1IEBA 1BBJA 5EBLA 5D7JB 4L4TA 1JPST 4WUUD 2WZPD 3DXAB 4RGOL 3GKZA 3KXFA 3SCMB 1K8DB 4MCYA 4NQCE 4W70A 2F53E 1ZVYA 3S5LG 1F58H 3W5MA 3MXWH 2B1AL 5MEND 3WXVL 3OKDB 3CFCL 3Q6FA 5CINH 2XY1A 9CGTA 3I6KA 5IJKA 4LBEA 1ZHNB 1G6RL 3TJHD 2CRZA 2O5ZH 2Z35B 3RNQA 4U6HB 1L4IA 1KACB 4HKZB 3ARVA 3RVTC 2CLVA 4JFQA 4RFEA 1BEYL 3A0OA 4ODTH 1I7RA 3UX9B 5FO7B 2BZDA 1M1SA 4XCNB 1Q72H 5BZWB 1CFNB 1T1ZA 3JWNC 4PGDA 1UZ6E 5JOFB 1NPUA 1JNHB 1OQXA 2GT9A 2IH3B 5JXED 4LMQE 4L3CB 4NZJA 1U2HA 2GSIB 4AQ1B 1EVUA 1IAII 4O02H 3KNBA 4OZIB 2QQKH 3CNKA 3ARGD 1N2RB 1FVDB 1OARH 2O26U 3MLTA 5IT2L 2P5WE 2I5YH 4G8GD 4DVRH 3MZTA 4FTVA 4YHYC 3QG7H 5J1TC 1GSMA 5DJ8A 4PJEF 5K93A 1A6PA 4RZCB 4QT5B 2E6JA 5E7BA 4YWGH 5MHSD 3IF1B 1X9QA 1LEIB 1ZE3C 1BOGB 1AGFA 2YPVL 2IAMD 5I8EB 5CJXC 1YMHA 3MRFB 4PFEA 4G6AC 1IM9B 4H88H 2VE6A 4X5WA 2H8PA 3HG1B 4WTWA 4M8QA 1FFPA 3ECBA 3WXWH 3WSQL 5DFVD 1FV1B 1ZT7B 5IB4B 1UXWB 2IF7A 5KSAB 2HTLD 2WW8A 2JJTC 3C6LD 1BLNB 2A6KA 2DF3A 3IXTA 3LSOA 4UTAH 3P4LA 1TJIL 4U0RB 5F3HB 4J2XA 4FQLL 4MA1B 5MEQB 4HH9A 3VDCA 1MLBA 2X9WA 1WICA 3LCYA 4TULL 2FYYA 5F7UA 3CCHA 2MPAH 3L6FA 5DZOA 4XBPA 3KLHC 1ZAGA 1BAFH 4R7NA 1OY3B 2HN7B 2PXYC 4YHML 2HT3D 1XGQB 3IDMA 4FFZH 1IKNA 2VR4A 3UTSE 4ZFZB 3BPOB 1F2XK 5J0BA 1MOEA 1YMME 3ARQA 4RAUA 3GSOA 1FDLL 4LCCA 3WUWA 4P5MA 1SYSB 1X5JA 2BRQA 1MCPL 3RVWC 3IYLW 1IEHA 1UVQA 1VEPA 1CD0A 3Q5YA 4GJTB 2DQFA 3OL2A 4QRPA 1KC5L 2OXHA 3L7FB 4MD4B 1JZ3A 1J1XL 1OSPH 5B4MC 1U8HB 1MVUA 3GSNB 1A7OL 2EDTA 5BRZD 2P43B 1FZJA 1XF3B 5EUOA 4ZSOE 3VXOA 3SE4C 1CLZH 3BWAA 3NA9H 1WAAA 4YGAB 3TCXA 4QHNA 3PDGA 5E1AB 4PLJC 5BVJA 4HIIA 4IBLT 1R3IH 4NPYA 5CEZL 12E8L 3MLSH 4K3JH 1UZ8B 1OVZA 2W9LA 5KG9B 2XFXB 4PJFA 3U79A 3UTOA 3MCLH 1A3LL 5KVDL 2I9TA 2PYED 3FOMB 5FUZL 1R0AH 2Q7YB 5HYSA 3P73B 2OZ4L 4JM4H 5DA0B 3SDXE 4MXWH 1C1EL 3I6GB 5DJDA 2GSGA 3BIBX 3RTQB 4D9QE 5IG7A 1LP9A 4WWKD 3GKWH 3NA4A 2CDEB 3AGVA 5CP3A 1L7TH 2K7QA 1QKZH 5FYKH 3GI9H 5E2TH 3HE6C 1F6AB 5FGBC 4ZXBC 4WI6A 3SKOB 4V2CB 5HGBB 7FABL 2DQCL 2P8MB 4JFDB 1K8IB 3BGMB 3VXRB 3CVHH 1KJ3L 5CLTA 4JJ5B 4OI9A 3RWDB 1N8ZB 3CIQA 1IAKB 1YPZE 3VGEA 3MOAL 2G60H 3MLYH 3UO1L 3GHBL 3MV9B 5I1EL 3P9MB 1IGCL 1F8TL 5EOQH 1OD9A 3QAZC 2NY1C 2WWKO 1WFUA 4BFIA 1X5IA 4OCSH 4YDIL 3RUGA 2EDYA 1CCZA 3MNVB 1I1YA 2VR5A 4OCYL 4R8WH 2Z8RA 4JM2B 5IWLC 2CH8A 4F9PA 1U92A 2PNDA 3BIKA 3RWHB 1E6OL 2HFGH 2EKSA 2QADC 4M1GL 1YEIH 5AWNH 3SKNA 3CVHA 5FO8B 1JRHI 3PL6A 1T04A 3FQUB 1MJ7H 4JN2A 5FA3B 3RZCB 5SWSA 4IRSC 2PW1A 4MQ7A 2FLRT 4NM4H 1B2WL 5ESAB 3RWCA 4JFXB 4XP4L 1ZLSL 1GYAA 3QH3A 3X13A 4DN3L 3VRIB 1DQQA 1FZOA 5ID1A 4O2FA 3BO8B 4EXPX 1CDHA 5T1LA 3BDXA 2UWEB 3BKMH 4PLNC 4D0CB 4AEEA 4O9HH 5I6XC 4ZFOL 1R3LB 4KPHL 1NSNH 2ZUWA 3FQTB 4MA3B 1B3JA 4HC1L 4JFFE 3K81A 5FHAH 3BQUA 5C0AD 5M94B 2Y07H 4LASH 1KFAH 5I71C 5GGQL 1FGVH 3QJHA 4JFED 3IJSA 3U6RA 2EE9A 4JB9L 3U83A 5JA9A 1ZHLA 2LFGA 2OM5A 1OP3H 3O4OB 1UYWL 2F15A 4HUUB 5C09E 4R6UA 4NRZA 1LE9B 4EVNA 1T4KA 1DBML 3H9SE 3NOIA 1DVFA 5HHXL 2ITCA 4XXCC 2R56H 1A3RH 2YRLA 5DHYA 2HMIC 1I7UB 5D7LA 1RPQA 1M7IB 4RAHA 4ETYA 1WAAF 5FK9B 2VLKD 4J4PA 3GSRA 4OLYH 2OJEA 2DTMH 4XWOD 1ZWIB 3VXNA 4OUOA 5HYQB 4PB9H 1WCQA 3CDGB 1BQHB 2VDKL 5KBNC 5DFWH 2WP3O 1XZ0B 3HZKB 2ZCKL 1QO3B 3WFBH 1EHLH 3OPZL 4HZAA 1HHIB 3UPAA 4PJFF 3FFCE 3QHZL 1FO0L 2DKUA 3B2VH 3DX9A 4NYLB 5DC0A 4G6JH 4OV5B 1OAYH 4XI5D 4YZFE 4OSUH 4NO0B 5C6PB 4WHYG 4WO4B 2WINB 3QQ9C 3MO1B 3VG0L 1F3JB 1E28A 3QBTB 3B5HA 5AUMA 2C1OA 3BUYA 3IJHB 3JTTA 3MUGB 3D85B 3OJVC 2PYFB 3H9HB 5IEKB 1X3DA 3MRPB 1CFQA 1WF5A 4GAYB 5GS3A 1E4KA 5KANI 1FE8H 1VGEH 1LGVA 1QBLH 5D7SL 3WHXA 3ZE2F 4V1DE 1I1AC 5HHMB 4PJHB 1P84K 3P0VH 1RZKH 3DXAE 5ICXB 1I9RL 1TZIB 4LSUL 4NQXA 4FQJL 3MV7A 4KJPC 3FRUB 3SDAA 1I1FB 4Q0XL 1NEZB 4JFPB 5DJXA 3MPCA 4L8BA 5B38A 1KIUA 3OKEB 4XCYA 3IDXL 5I1KL 4ZO6A 4JVUA 2DQTL 4EN3C 1YYLH 4K7FB 3HAEG 5ADPL 1OSZB 2D9QB 3PHOA 4Y16D 1NCUA 4OZHB 3UMTA 5I66B 3V52L 2ATPA 2B4CH 2BRRL 5INDB 3BP4A 1K2DA 5ETUA 4MNHA 1MIEL 3FKUS 4W6XB 2E7CA 4OD2B 4OD1L 3X12B 3DSFH 4LF3A 4H5SB 4DAGH 2VZ1A 3SDCB 2QV2A 4NKOB 2BNUB 3N9GL 4DKFH 2ATKA 2AXFA 4F2MA 4HK3N 3C60B 4O5LH 1YECL 2VH5H 3SO5A 1BFTA 1UB5B 5DUMH 4AIOA 4F7EA 1AGDA 3BZEA 5JQHC 3KJ4B 3KVQA 3AM8C 4WU5B 3P4NB 1WJ3A 3VGAC 3CH1B 2VLRD 4XP9L 5BO1H 4PJ7F 2APWA 5DHXB 2H3NB 4DGIL 2NQCA 1NMAL 3QUYD 3CXDL 5J4MA 4CVWA 2JLLA 3QEQE 3VCLB 4MA8H 1Z2KA 3PP3K 4I1NB 4Y2OA 1ZA6B 4KRNA 3ILQD 4QXUL 5C0BA 2DQUH 4ESKA 4LLYB 1K3IA 3LY6A 3DBXB 2OL3H 4L4VE 1MELA 1RQ5A 1S5IL 5D5ME 4NDMA 1IE5A 2GQHA 4GG6E 3W2DH 4G80A 2PO6B 5EG6C 5ECJE 3PWVB 2EIZB 3FQXA 3NZ8A 3VMOA 1CGUA 5KAQF 2NNAA 5C0GA 4I0CC 1VHPA 4YXLL 3A6OA 4H26A 3LEVL 3TWCL 4XMKL 4EXKA 1GIGL 2X4PA 4PD4J 4ZO8A 3L5WA 1DBJL 2ERJC 4X98A 2MTPA 3UAJC 3JWOH 35C8L 4WTXA 3F7YB 3UYOD 5JW4R 3LMJH 5E9DE 1JPSL 4FFWD 4YDJA 3FQRA 1HXMA 1F4AA 2XWJB 4ZAKD 4HJJH 3R1GH 1WWBX 1U8NB 5CHNB 3WIFB 5CBEB 5EN2B 5JHDE 1UEYA 4OFYA 3E0GA 2NY6B 1RUPH 3HE7A 3MV01 1S3KH 2ED9A 4L5FL 1CT8A 2NW3B 2QEJA 1EEZB 4H1LB 1S9YB 5AEAA 4UV7H 4U3HA 1X5GA 1B0RB 3RDTA 5JDJA 3BUTA 4KZDH 1QPPA 3MRLB 4KKCC 3Q48A 3SE3A 5HGHB 3FZUC 3P30H 4P5TC 3V6OE 2VXVH 4GOSA 2D7OA 2AVGA 4JQXC 2DWEB 4R4FH 5F1IA 3GJEA 4DCQB 4HF5H 1SM3H 1H8NA 3NVQA 1RAMA 2NXZD 2PR4L 4I5BB 4FP8H 3H42H 4U1LB 3MODL 3O9WA 4YDKL 3GSWA 4DFIA 4OGXH 1I7TA 2EYTA 2Q3ZA 1MRCL 5JTWA 3X11B 1JPTH 3ARTA 4WFGE 2VL5A 5DJ6B 1DP0A 4XNZC 1TVDA 4JFDE 5HVFB 3K0WA 2AJZB 3QUMH 5GGVY 3W9DB 1M71B 4RMUA 4KKAC 1Q9LA 4QHMB 3DO7A 2A6IB 4HUNB 4I77L 2CKBH 3OZ9H 1DN0B 3V6BR 3KPQA 4B50A 4PJ9B 1UJ3A 4Y8DC 1E6JH 3WBDA 5A43C 4JLRB 5IJKC 2J2ZA 4HKJA 5GGSY 2JB5L 3VWJA 1UQSB 3UDWC 4D8PB 1EEUA 4U1KB 1TNNA 4WU7B 4XBGA 3MLVH 4YFDB 1KGCE 3VFUB 1NCBL 3VFPA 1FC1A 2EDFA 2JB6A 3OKMA 5ICZB 1CFBA 1RZJC 5FYJH 2AK4D 1ZT4B 1CIUA 1CXFA 3QUMA 1VACA 3CUPA 4K2UL 2AJYL 2Z93A 4PJGE 5ANMB 3QDAA 2CKBA 4KMLB 1EV2E 4QCIA 4Y4HD 1V7NH 3F12A 3JV6B 5CMAA 1LE5B 4LHUD 4NNPH 4R96B 2BMKA 3EYOA 3TM6A 4WUUE 5C0RH 4QY8B 4E5XA 1JWUA 2D31A 3MRDB 4HPOL 2KUTA 4P9MH 3CFDA 5I16A 2DQHH 3HLAA 2VC2L 1C08A 2W9DH 3WNNA 1G9NL 1UM4H 5FF6A 2QQNH 2APVA 2VLME 3P11L 3EOTL 3VMNA 1HINH 1ES0B 1UKSA 3OB0H 3ZDZE 4HIEB 5I1JL 4KK5C 2PKDA 1I3GH 4N0UB 4PJ8B 5JA8B 1QR4A 3D3VA 2COQA 1J10A 2EYSA 1VGKA 1INEH 4RIRB 3IETA 5LAXA 1I7ZB 4LCWA 5D2NB 2Q8BH 1IC4H 5D71H 3WJLA 3ULVL 3RU8H 5LQBL 2A83A 4F80A 4WTZG 4OCMC 5DO2D 1EJ6A 3LRGA 3IFLL 2V2TA 1J88A 5J9PA 2ZOKB 2OR8A 3IDNB 3OB0K 1RUMH 4HIXH 5GGRA 2CDGB 4PRHA 2OJZL 2RFXB 4G8GE 5D1XD 1VFBA 1DUZA 1I8KB 3MJ9H 3Q6GH 5ABDE 2LVCA 1IKNC 1JF5A 4ZUSB 1UXSA 5HYJD 2ORBH 4CGTA 3GB7A 5CD5D 2EDQA 4I0KA 1CQKA 1CL7L 5HHVL 4LCCC 2NY7L 4QF1A 3EZJB 1YNKL 1KN4L 3SKJH 3VXMA 2VDML 43C9A 1CBVH 1L7IL 2VQTA 3BPCA 3ZMRA 3QDMD 5TF0A 3C8KA 3A6BH 2AXHA 3T08A 4RSVA 5CSZB 4ZUUB 1RJYA 2W1NA 4IIQA 5BW7C 5E6IB 4ERSH 3DETD 3HB3C 3V0WH 2Q76B 2X70A 5GGTL 2XA8H 2AGJL 3S36H 1FAIL 3MJ9A 2Y7QA 5GSVA 1QSEB 4FMKA 2GJ6D 3DV6A 3I75A 4UMGA 1AQKH 3WKML 2CUIA 1IKFL 4X4YB 1VESA 2W0FA 3I6LD 4NJ9H 4PRIB 2YS4A 3VD5A 3P4MA 3MFFB 3LS5H 3HTLX 2XTJC 3BHBA 3PJSB 4BJLA 3O6FA 2GTZA 3BPLB 4LCIH 3ZHKA 2YBRB 1S7UA 5EU3B 3SKMA 3MYJB 4GG8B 4HW6A 1DFBH 4OGAD 1QACA 5I1GL 4YDLB 1A9EB 2V5MA 1HH9A 5IEHA 4B7IA 1EAPA 1CICA 3WO4C 3WN5A 1EMTH 4AEHH 3ILPB 2DQGL 4P3DA 1MFBL 1MCOL 1QUNA 5C0FA 4PG9B 1JGLH 4R7DA 4GRLB 3HFML 4ODSH 4UINL 4L9LB 3P9LB 1S7XA 4W6YB 3UBXB 5HI5C 1T0MB 1DLFL 2BOCA 2JF1A 3MTRA 4M7ZB 2ZUVA 3X3GL 1MAML 1AI1H 3O6KH 3S34L 5BS0B 1MCSA 3A67L 3WDJA 4QLRA 1JK8A 4Y1AB 3FO2A 3MRCB 1DANU 3ARFA 1OP5H 5F21B 3AS2A 2PYEE 3EUUA 3TPUB 5GRWA 1W0YT 3D39A 4F9PC 4U1SA 4JO1L 2ZG3A 1H8SA 5GHWH 1S78C 3PWPD 5HVHB 1S7SA 3PL6C 3E6HA 4C59B 1W72H 4YHZH 4Y7MA 1AO7B 1NLBH 4DZ8B 5D7JD 5T3ZH 1F97A 3KLDA 4NWUH 3K2UH 4JFYA 1H5BB 5D70L 5EB9A 4AH2B 3HC4L 2VDLH 4KRLB 1FG2A 1WUNT 1N59A 3CJJA 4JZNB 5DJZB 4U6YB 1KPUB 1V5JA 4X6DA 3EDDA 2NTFA 1A9BB 4BKLB 1U93A 3O4LD 3EJYD 4HKXA 4MS8C 1QTYT 3RWGB 3EYFB 4G7YH 3GUTB 1DDHA 4ZPTA 4Y19A 1OGAB 2BC4B 2YMXL 4P57B 4LSDA 2J4WL 1KB5B 4OZ4B 2NYYC 2C1PA 4NN5B 4YPJA 1G0DA 4UTBL 5TQ0H 2WBKA 2ZZUT 1S7VB 1CGVA 3GI8H 5LBSL 1JGDB 1W72A 1KJ2H 5EA0L 5CBAA 4P46A 3BQUC 1A7RL 3TZVD 1C5BH 1YQVH 3JV4B 1TIUA 4BZ2L 5EC2B 2XN9B 5JIHA 2XKNB 2KH2B 2VDRL 3MNZA 5CEYA 2EDRA 3IVKB 3QFDA 4U4BA 3RL1B 4OGYL 4P2QE 3FOLA 1A7QL 4P3WA 1FP5A 2AEIT 2BDNL 4WUKH 4YHOL 3QEGH 2MCPL 5I15H 2AXJA 3DI2B 1MJJB 1IRAY 3B9KB 4XGZA 1RZGB 2JJSA 3L5IA 3SDXF 1AE6L 3WNOA 1OLZA 1YJDH 4J4PC 5GRVK 3KPMA 4OLXL 3G6AA 1KJ2A 3HPLA 1U2CA 4ELKA 5IQ7L 1JI1A 2Y5TB 4CVUA 1IM9D 2Q86B 3WCYA 1FH5L 3WFZA 2Y36L 1EFQA 1JNJA 5DQ9A 1GGCH 2NY2D 4NC0B 2YEZB 2I27N 5FYLL 2X4RB 5CJBA 3WKNA 1UACH 3KPSB 3MRBA 4DFHA 1UT9A 2BY2A 5C0AE 3RKPA 4JY6A 4S1DC 1E4JA 4LEOA 1JNLH 2W91A 3UROR 3LZFL 2B8OT 1OPGL 32C2A 4K9EH 3SBWA 4NSKA 5F3BA 4DZBB 2MQ3A 4P2RD 3DHJA 1E4KC 3TNNB 3DUSA 5E8OA 5L8JB 3A6CH 4JHWL 2FDBP 4M1DL 3DARA 5TF1H 1Q38A 1G7JA 4PJBE 3QJFB 1ONQA 3E2HC 1WZMA 3DYOA 1CDUA 1JNNH 5D9SB 3ARBB 1AJ7L 4OF0A 2VLKE 4PY7A 3K46A 3IAQA 5IVZA 4ENEC 5LG1A 4D3CH 3DOSA 2YPKB 2WBJB 4N0FB 3MRQB 5EO1B 2YK1L 4PV9A 4X5LA 4TPRH 1JHTA 3ETBF 5EZJA 3O6ML 3DVNB 1DSFL 3WUWG 4I9WD 1CD1B 3CFKA 5AYQA 3FT3B 3VRJA 3FO0L 4NJAL 3QPXH 4R3SB 1N7MH 1IL1B 4N8VA 3N1FC 1TJIH 4NHUB 4EQ2A 1NDMA 3QWOA 4GRMB 2JKXA 2EYRA 3EYQD 2FX8L 4LPCA 1RZKC 4MJIA 5D2LA 3MOBL 4LSRL 4WVRA 1QHOA 1P7QD 2ZUQC 3VXSE 3RX8A 5B39B 1B0GB 3WS6A 3MJ8A 1HHHB 4ZNEE 2H32H 3G6DL 1ZLWH 2JCCA 3HMXL 3RNKA 2NY5L 2XZQL 3GGWB 3RTQD 4Z9KB 1UH2A 3U0PA 5I1DB 4PGBA 1F3DJ 3S5LB 2P7TB 4L8DB 4PJ5B 3IDGA 3QDGD 1MCPH 5JOEA 3ESUF 3OR7B 4HPYL 5HYSG 2C7UA 3BI9X 3NGBC 5T1DL 3GIZH 4N9GB 2X89D 2DQEL 3VW3H 1IT9L 2B4CC 4XMPL 4U1HA 3RWFB 2D4DA 3SJVB 4KQ3L 5J13B 4EDXA 4GLRI 4XTRD 4F3FA 4HWNA 4PJXA 2H32A 1ZLWK 3ZDXF 3CU1A 1JF1A 3BAEH 1TNMA 5L7XL 3MRJA 3BRGC 4AIXA 2QQQA 4C56A 1N64H 2NXYB 2HJKA 5B3JE 3QUXB 1QRNB 5C07A 1A3LH 4LSPL 4FQXA 1KTLB 3OAZH 5KS9A 4JM2D 1U0QA 4DKEH 1G9EA 1HIML 1NDGB 3MREA 5DMIL 5C08B 2P5EA 1LNUB 2VDNH 3KHQA 4GMTL 3NCFB 1FSKC 3MRKA 1U95A 3MRRA 3SGDI 4KUZL 4OM0L 1T20A 4JFZH 4I2XA 3VXUE 4NQTA 5IR1B 4JRXD 3LKPA 1KB9J 1MJUL 2X4QB 1RV6X 1G0XA 4NNXB 1T7XA 3SGEI 3RZCD 5FUCC 3HCVB 1A1MB 1MLCA 3QUZA 5IIEA 2MKLC 4WV1A 3VGGA 4AEFA 5FCSH 5IVOA 1N0XL 3WNPA 1HZHL 2AEQH 2ZSVA 4UU9B 5TE4H 3RAJL 4ZNCD 3CC5A 4HCRL 1IGYA 1X4YA 3ZKSD 1KBGL 3OAZK 3T4YB 1LEGB 3MOAH 3QIUB 3GHBH 3N1PC 2XT1B 5EZIL 1NGXA 1A2YB 4Z78B 2XTLA 4U1MB 4ZS7L 5GGVH 4P4KC 4PRDA 1CLYL 1QSEE 4QRQA 4YIQB 4U0QB 5CCKH 3QNZA 2EH7L 5DK0A 5JIKA 2I60L 3RDTC 4XX1E 3HZYA 4GQ9H 1B4JL 3FTGA 4M43H 3SE3C 5I75C 4JRYE 2YA0A 4GRWH 3O41A 2PXYD 4WFED 3MBXH 4WW2F 1SHMA 3OXSA 1UM6L 3Q1SL 2FSEB 2CK2A 4JKPH 3LOWA 3MSPA 4OQTL 1CK0H 3RHWF 4ELME 4ZQKB 5E5MB 1LO0H 4RA3A 1AR2A 3QCUH 1T7VA 4N0RA 1J05B 3MRIA 3O9WC 4B41A 2XG4A 1HHKB 2FIKB 2FJGA 2VLLA 3TO2A 1MEXH 3LKNA 2W0KA 5ILTL 1YEFH 1UWGH 3KPRE 5TDPB 4DN3H 2ICWB 4F33A 3MV8A 4NQDA 4MGXA 5B4MD 5HHPA 1ZS8B 1GC1H 4WNQA 3QIWB 4X6CE 3G5ZB 2VDPL 3IS1X 4DQOH 5INCA 3IJYA 5D2LF 2UVEA 4M7KH 4KPHH 1FFOB 4IHOA 2OS7A 3N0PB 2YUZA 4LEXL 4HT1H 1QNZH 4HDIA 2YKLH 4GAJL 4NKMA 1JBJA 4P5KA 4LCUA 2D0FA 1N6QH 1G7MB 4Y2DA 2VLJB 3VFSB 4NZRL 1UJ3C 2WIMA 3WIIH 1KSRA 2JCCF 4LHJB 3NH7H 5KAQG 2V17L 3AREA 4E42A 2LAGB 3VWJC 3D85D 1W0VB 3L3JA 2YUXA 1H3XA 3I3DA 1ZK9A 1SEQH 2EDJA 3TBYA 4JRWA 4KK6C 1HH6A 2HT4C 2V5RA 3ABZA 4I18A 3TBWB 3WS3B 4JAMA 4JPIB 2ICWJ 2X4NA 4U1JB 3VFWB 4LHQB 5MENA 1IQWH 2VDQH 4IDJH 4ZFOA 4Z7VE 4K94L 1SJEA 1AO7E 1DQLH 4GG6F 2YPLB 4U05A 1TQCC 1HQRB 4TUKL 1KTRL 1VKXB 2EDHA 1F4WH 3CVIH 1MQ8A 3VWKA 1LO3H 4PBVC 3TVMC 2VRAA 3IFPB 4W4OA 3QI9C 2X2YA 1KENH 5GRJL 5I8KH 2R69L 4JHAL 4LLAA 2ICES 5ISZA 4BYHA 1KLGA 3HUJB 5KS9F 1NQBA 1CZ8L 4KVCL 4WI4A 4NKDA 5IVXA 3PV6B 5JXEA 4LLUA 5DJ0A 4KY1H 4D0DA 4MJ5B 3GSNL 5MEOB 2HT2D 3ZE0F 3AUVA 4IM8A 1JGEA 1E4XL 3ARGA 1WZ1L 3SGJA 4FNLH 4FA8A 1G1YA 4LVEA 2EXWC 4DVBB 2G9HB 5CS7A 2YOCA 4JO2L 3BE1L 4A6YB 1ACZA 2DWDA 4HUXB 2CUHA 1LDSA 4XRCB 1QR1A 1OGTA 1KPRB 2GAZA 2BFVL 1U3JA 4IRSD 1J87A 3NCYP 3QDJA 1FO0A 4LVOC 1HHGB 2IAMA 1T7YA 1EEYA 3WJLC 4AT6B 2YD7A 5H35B 2FEEL 1JYNA 2ILLA 4UT6L 1RUAH 5DJAA 2DI7A 2EDEA 5DEGB 1R5IA 4AL8L 4XVSL 3C6LA 2DQJH 5DUPH 1SBSL 4OZFH 1BQUA 3OGOE 4GKOA 1Y18B 4CADB 3LQAH 2IANB 3K4AA 4NQSA 4I4WB 3NFSL 1VA9A 3S96B 3WE6A 3CZFA 5A2JH 1S5HA 1RZIA 2DLIA 4MLSA 3KPSE 3QRGL 2NY3C 3ARXA 4GKZA 4YUEH 3FB7A 3OHXB 2X44D 4HS3B 2R0WH 2ZUXA 3DVGB 4ODVL 5HDOA 4OF6A 4PJIB 1FVCA 2AJSH 2IFGA 5ENWA 2KDGA 1RFDL 4DGVH 4CU7A 5D7IE 3QRFM 1GAFL 3PG2A 4OCRH 2CIIB 1ADQL 5GZOC 4JFHD 4YBQC 5HPMB 5IFAL 3GBNL 4GRWF 2BHZA 3QR2A 4UIKH 2J3SA 5SWQA 4Z7UF 2FCBA 4YHYB 1ACYH 2A9NL 3F5WB 1MCIA 4HWZA 2X4TA 5HPOA 4H20H 2FWOA 1A1NA 4NNYA 3T2NH 5HYJE 3G5YA 5TE6L 3VXPA 3KJ6H 3QIBA 2H45A 4G3YL 4KWUA 4WI8A 3GMOA 5FOBA 1P6AB 1TJHL 4QNPF 4JO3L 4XVUC 1CVRA 1CICC 3WN5C 4JZJC 2UY6A 3QXUA 2EE2A 4UB0L 2NY6D 4O4YL 1A6WL 4N5EC 4QHLB 1KYOJ 1IILE 4E9LA 5IUSA 2BVQA 2K1MA 3I02A 1WCBA 2X41A 4JR9H 4TSBL 4LNRA 3TYFB 5ADOL 3RVVC 3F7PC 2DLHA 4HFWB 4WWKA 2P8PA 4BELD 5IM7A 2VR9A 5IHZA 3BZDA 1MRFH 5HD8D 4M5ZL 3MJ6A 4Y89A 1MSPA 3H0TB 4IOFC 5JZ7C 2Q6WB 5DSCA 1SJVA 3ARFC 1LO2H 4HK0B 2C3VA 4PJAB 4XZUA 4Y4FA 2F19H 3FRPA 4HIHA 4QRTB 3CLFH 5CWSB 4PG2C 3EJZD 1NEUA 35C8H 5D7KE 4G5ZH 5ERWA 3ZZ1A 3VA6A 4NRYB 4MNQB 1P2CB 3E1F1 4OLEA 1TTGA 1FBIL 1URLA 2R4RL 4LPXA 5J6HA 4K71C 3UTQA 1Q9WA 5IKCA 5DTFB 1YEKL 2VO5A 5D1QB 4C83A 1VADA 4PJ9D 5FKAA 5DURD 2D03L 1QRNE 2XZAL 2WAHA 5EO0A 1JZ5A 3UEZA 3NFPA 4MQXC 1RU9L 4LGSB 5C08E 2YHGA 4DN4L 2GFBB 4P46C 3E6FB 1EJOH 1JPFB 2A6JB 2DM3A 3IFNH 1EGJL 4F58L 2NX5B 1TJGL 1Y6NR 2FB4L 3MLZL 1EFXA 1GGTA 5E8NB 5A16A 2IC2A 3UJJH 1S8DA 4FQQA 1EO5A 3CXHJ 3SE8L 1SQ2N 2VQ1A 4OGZA 1NFIB 2R0LH 3HE6B 1MCHA 5E8DL 2IMNA 2JJSC 3ZHLA 2JELL 3MCKB 4R4BB 3LKRB 1I9IH 4P2OA 4X6FB 2HLAA 2VZ3A 2VISB 4QOKB 1XR9A 4JFEA 2C5DC 2K7PA 1GPOH 1T83A 4NN6C 3IU3B 3O4LE 2W60B 2P42B 1A5FL 5KOMC 3BKCL 4HKBA 1ZGLA 2DJ4A 1KT2A 1R3HA 4TUOA 3QAZB 1NCBH 4JY5L 2NY1B 3VJ6B 2EXYC 4BSJA 3GMLB 3FO9B 4X7DC 1DBAL 1FYTA 4HULB 5GS1B 3HNTL 1XIWD 4XNQB 1INQB 4LOUC 4HUVA 3Q0HA 4Z77A 3L3KB 5F44A 3BW9B 4KI5D 5E00B 2BY3A 2H2SC 4OD3L 1B6UA 4HZLB 2R23B 2QADB 4J6RL 1IAIL 1NC4B 1B9ZA 5C0ND 1YJDC 3PNWB 3SBWC 1HILB 3UAJD 3U82B 1ZVSB 4XAKE 2R2CA 2VAAA 2X9XA 1AGBA 1F45A 1IBGL 2E27L 4IJ3B 4LRNL 5E2WL 5DI8A 3VFGL 2XZCL 4AYFA 2LV4A 2ESVA 3QO0B 4ZFFA 2AKRB 2FH6A 3L5XH 3QWRA 1IGFL 2JE8A 3ARUA 3GJFH 4WW2C 1MPAH 5GZND 3U46A 4Q9CA 3S3PA 1TZGH 1BJ1H 1YC7A 3NN8B 3OKLB 5K9KB 4APQD 3NIFF 3SDYL 4JG1H 3NCYS 5TPWH 1VCAA 4K9EC 3GIVB 1S7QA 3EYVB 5LXGL 3TPKA 2BJMH 4RAVA 2D7QA 3LB6D 1FORH 4K7PH 1IJ9A 5LJYH 3TH3T 1L0QA 3LKOA 2AXGB 4OUUB 3SGKA 3TH2T 5C0EA 4DGYH 3R4DA 3W0WB 1AIFB 4X6EB 4GXVH 4HV8A 2FX9H 1OCWL 1T21B 4LPUA 3WFCL 4G6FB 1J1OL 3P40A 5TE7H 3PWUB 3RWJB 1CLCA 2YPLE 4P2RE 5EIIA 2AABH 3VFTB 4ZS6D 3GJFA 3QULB 3MLXL 4K23H 2VXSH 4LVHC 3JTSA 3WS6C 1HOCB 4D9RD 1WTGT 2C3HA 1FFRA 3INUH 3MLWL 3FN0L 4LSVH 2BCKA 4OJFL 4G6KH 1BFVL 3JWDH 4BSWB 1DBKL 1CXKA 3QDHA 4PJDB 2C3WA 4S0SD 5CILH 3KPOA 4OCWH 5HI4D 5FO9B 3NTCH 5E8EA 1T66D 5DDHB 1KN4H 4Y16A 4FMFA 1U8JB 4Z8FL 3WDIA 3GMRA 4ODHL 1NGQH 1OB1B 2CLZB 2VDMH 1BHGA 3PQYE 5CZVL 3THMH 3SEPA 3B6SB 2AERT 1CF8H 1NMBH 3ROOA 5C3LD 4O58H 4YXHH 4XHJC 1OAKL 5E1HB 3F62A 3QNYB 4GRLD 4I9WE 3VG9B 1C12A 3QEUA 1XGUA