1F4XL

Crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
210
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGTVTTSNYANWVQEKPDHLFTGLIGATNNRAAGVPVRFSGSLIGGKAALTITGAQTEDEAIYFCALWYSGHWVFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTNPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY S-20-4, FAB FRAGMENT, LIGHT CHAIN
publication title Crystal structure of an anti-carbohydrate antibody directed against Vibrio cholerae O1 in complex with antigen: molecular basis for serotype specificity.
pubmed doi rcsb
molecule tags Immune system
total genus 48
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4xL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4xL01
4G8IA 4HK3N 1FL3A 1NCUA 1B6UA 4HPYH 4HUXA 1ITBB 3QRFM 1T0PB 4U0RC 3RBGA 3UYPA 5ID0B 3IU4L 5IFAH 1NMCB 2NZ9D 3HC0A 4PJ5D 3VFPB 1JHKH 2V2XA 3T0ED 2ERJC 1JF5A 3MROA 2Q6WA 4P5MA 3MLRL 4P57A 4JFXA 3RZCA 3VXTA 5FO9B 2YXFA 3DRTB 1JPSL 2CGRH 1VPOH 4RFEA 3O3BA 1N6QL 3BDXA 4KDTC 5TQ2L 4DWHA 1U8LB 3O6ML 1Z5LA 4PJBB 5EU6D 5IBLC 3K8MA 2VSDA 3RL2B 3FQRB 4HT1H 5BZWA 2NZIA 1UEYA 1T0NA 1G7PB 2NY7H 1PKQE 5CBEB 3G6DH 5E8DH 2HTKC 3QWOA 3QPQC 4MCZB 4NHUB 3N9GL 3OKNB 2QQNH 5ID0A 1E4WH 5JUEH 4R90L 3ARGD 3C5SB 4CMMA 1C7SA 3BN3B 1DQML 3RAJH 2AXJA 4PR5B 4X4ZA 5FDYA 1FFQA 3JWOL 3JWDL 5CSZA 3PHQA 5DWUL 1G7MA 5FO9A 1XZ0A 4NQEB 1CLOH 4M5YL 3DRTA 4R6UA 3FQTB 4G43B 1I3RA 2O5XL 2FCBA 1U8LA 5IVXB 2OL3H 4PJBA 2OS7A 5JPNA 3FQRA 2X5PA 4HKZB 2VLJE 3IS1X 4N68A 2HVJA 5J4MA 3MGAA 1O7VA 2EH7H 1F6FB 2YC1B 1ZT7A 1FV1B 2A2QT 3P4NA 3CSYB 2XG5A 4XWOD 3DURB 5I66B 1GXEA 4LLUA 1KNOA 4U2YA 4Q6YA 5E99H 4XVJL 4QTHB 2JIXA 1FH5L 3FQUB 4NHUA 4HWEL 3F58H 2YD2A 4M1GH 1PYWB 1TCMA 2CRYA 4G6JH 3GMNB 3UTPD 3LKQB 3P40A 4JFFE 3AU1A 3OKEA 3C5SA 2BJMH 4M61A 3FZUC 5EFIA 3FO9A 3RWCB 4OLWH 2VL5A 4NWTH 3MBED 1NCCH 1U41A 3KWWB 4NQEA 3BUYB 5DK2B 3FQTA 5K9JL 4R9HA 4KH2A 1NBYA 3PP4H 2F53D 2QKIB 5J3HC 1NFDF 4PD4J 1P4BL 3I2CL 3L1OH 4YAQA 4TVSa 1F8TL 3MV9E 1KJMA 1U92A 3DV6B 1FV1A 3MV01 1KG0A 5I66A 1CN4A 1X3DA 4L29A 5BS0E 2CO6B 4FRWA 3G5ZA 1IGCL 3UPCA 5CAYB 3FQUA 1K8DB 5GGTA 4Z7UB 3E2HB 4YBLC 2YPLE 4HSQA 3GMNA 2IAMC 2RB8A 5CP7B 1YEDB 4L8DB 5IF0B 5KSAD 2IG2H 3C6LC 1LDPL 1Q9KB 2DOCA 4EN3D 4KAQH 2P8MA 5HYJB 4U1GC 3KS0H 2A83A 2EYTA 2YPVH 4WVRA 2WQ8A 3KWWA 1IEBA 5IB1B 1A7OL 3BUYA 5DK2A 1NFDE 5D71H 4K3EH 3H9SB 4HUNB 2MKLC 4KKNA 4QKXB 1U8JB 3NZHH 1UJTA 4OJFL 5ICXB 3ZKNC 4M93C 2DWDB 3LQAH 4PB9L 3WFEH 2QKIA 3MODH 3EJJX 4JZJC 5EBWA 4OZFG 3X3FH 3T2NH 3S5LG 1F02I 2VZ3A 5EOQL 3CIQA 1A3RH 1F4AA 2HP4A 2H6PB 3CVHA 2LTQB 2WM0A 1U58B 1I9IL 1K8DA 3DVGB 1MCOL 4WFGE 3ORJA 4TULL 2N4IA 3MV8D 5CP7A 3DYPA 1M7DA 3IRPX 1GGCH 3NCFB 3LDBB 4KROD 5J9PB 1X5GA 2WBWB 4N9OB 4MA3B 4OLXL 3BKYH 1OTUD 1MCCA 1NMAL 4AY0A 4WI5A 5IB1A 2G9HA 1BX2B 3DGGB 1LE9A 4G8FA 3RWFB 1KB5B 4FMKA 3QUMB 1HNGA 5TQ0L 1U8JA 2XKNA 1X7QB 5C6WH 4ZOBA 5KVEL 2QSVA 2DWDA 4WWID 4F15C 3L5WB 5T33L 4QY8B 4ORGB 3O6KH 4X9FA 1SM3L 1S7RB 3A67H 1JPGB 1UYWH 5C1MB 4ODWB 5DI8B 3MRNA 3TFKD 1XF3B 1HDMB 1ED3A 3ALPA 1YEGH 2UVEA 1AGDB 3OL2A 1QR4A 2R9HC 2DBLL 3U9UA 5F93C 2RCSH 4GKNB 3QEUB 5DJCB 3BMWA 4PGZA 4J4PC 5J9PA 1G7HA 4MA3A 4YXKH 3U82B 4F2MB 4G42A 1C5BH 1X9QA 5EU3A 5FCUL 4OF8A 1ULVA 5DHVH 3VXOB 5DMIH 5I75C 2ED8A 3DGGA 5F1NB 4XMPH 4PJ8C 5BV7C 1U2CA 2X70B 4LARH 5F97E 1X7QA 1A6VH 3FMGL 5D7LA 5FFLA 5A1AA 1VGEH 2OP4H 2XQBH 4QY8A 1C08B 4KQ3L 4Z7WA 5C09D 1CZ8H 4Z5RB 5ADOL 1IC7H 2VWEC 1JPGA 2HT3D 4HMEA 4ODWA 5HYSB 4I3GA 1T1WA 1PKQB 1XF3A 1DVFD 4AH2B 3CFKB 3RDTC 4ZAKD 4JANB 3SKJL 1DLHB 4OGZA 5J6GB 1AGDA 2FBJH 2IALA 2LAAA 5FECB 5HD8C 3IETB 3MGTA 3ALWA 2A0LD 4UIMA 1JCKA 5LGHL 4M00A 2X4SA 4L5FL 5LCVL 4DK3A 4GKNA 3QEUA 1YJDC 2R4RH 3TT1L 5JW4M 4DW2L 4X6BA 1U9KA 2P5WE 2IJ0C 3IDIB 4G3YL 1VFAB 2VWEE 3QCUH 4F2MA 2V5YA 4IBLT 4DAGH 1HXMB 4LLMA 5CCKH 4UIKL 1U8OB 3EHBD 3MBXL 1WUNT 3OAYH 4H5SB 4LFHD 5GIRB 5JO5A 2FZ3B 1AC0A 2O26U 4FFYH 1HWHB 1QYGL 1YY8B 4L4VA 5FYJE 4TUOB 3SY0B 2H45A 5EU7C 1C08A 4JHAH 4V1DA 3B9KD 1NDGB 1YEEH 3KJ6H 1ZLUK 4OZFH 3DUSB 4JR9L 3RFZC 5T3ZE 1V7NH 4JANA 1DLHA 5JPMB 2V5TA 1RULL 5FECA 2DQUL 4X6DF 2Y36H 2FIKA 1W72B 2JJUA 4XB8A 3G6JF 2A9ML 2V9RA 3T2QA 4R7DA 5J12B 1A8JH 5EU7E 4U1MA 5IB4A 4Z7NF 1NGQH 3PNWB 3WLWC 1XH3B 3IDIA 2UYLB 1ODAA 3VG9B 4WI3A 3CFIC 1VFAA 5EORH 1WICA 1ZEAL 4MQTB 1CGXA 5HVHB 3BX7C 4JFPA 1U95A 5IMKB 4ZDHB 3RGVD 1XCQB 2Z92A 2C3HA 1NUNB 4H5SA 4YE4H 2UZXB 2EECA 4P5KB 4KK6C 1UKSA 3L3KA 4UMGA 1A6UL 4HJ0C 3WSQH 1MHHA 1A1OB 4KU1A 1JFQL 2VXVL 4P9HL 5GJSL 1Q72H 3KYOA 1BQLL 3HC4H 3DUSA 2V9TA 4R0LC 3IFLH 1II4E 1CFSA 4TUJA 2CUHA 4X6DE 4AG4L 4TUKH 3WFBH 3LKNA 5HHMB 4QRUB 5F1KC 3G5YB 3G6JE 3HPLB 5BS0B 3TT3H 4Y5XA 2D2OA 5KS9F 3MV7A 3RWHA 4FFVD 4Z7NE 3W9EB 1IKNA 1S9VA 3VRLF 2AABL 5F3HB 2GTZB 4FTVE 2IH1B 1X4YA 3JV4B 2VDNH 1KCRH 4XNQA 1YMMD 2VN7A 1M7IB 2FWOA 1PZ5B 2EE6A 1FNFA 1XH3A 1A3LH 2W0KA 5CEZL 4P4KA 4UT7H 3WO4C 3VFNA 3VRIA 1A22B 3DMMA 2OM5A 1FSKC 4XC1L 1P6AB 2VC2H 5HDQH 4TTGA 5D1ZB 3LH2H 3CFEB 25C8H 1OAUH 2AJVH 4P5KA 3REWA 3VFVA 3BGFB 2HWZL 4MB4A 4O2CA 4KQ4H 1UT9A 1QKZL 3LQZA 3UYOD 1FFOB 3ZTJG 3D25B 1I4FA 1FO0H 1N5AB 1HKLL 5AWNH 4U49A 2X7LB 3ARRA 4LSTH 4FZEL 3RPKA 4U1GB 4U2ZA 1NSNH 3MRGB 2HLFC 4QRUA 4HFUH 2XWJB 3Q2CA 1OSPH 2V17H 4M4PA 1OW0C 2CK0L 3W9EA 1I1CA 3ZDYF 1Z9MA 2KQNA 1X5IA 5L7XL 1CD1B 2VDLH 1OB1B 4R4FL 1U2HA 4WO4A 5FYKE 5KSUB 4TVPE 4JZJB 2D9CA 4ZFFA 1GZQB 2NPLX 4ZODA 3Q6GH 1A7PL 4DUVA 4NQED 1MVUA 1KULA 1M05A 2WAHA 1J1PL 1S8DB 4JKPH 4X5XB 5F7EH 3UAJD 4HPOL 1FC2D 4HXAH 4P99A 3QDGB 4QRTB 2B4CH 1LO3L 1A6ZB 4QF1B 3S8WA 1M71A 1JNNL 1FFOA 2QSQA 3D25A 1IFHH 3V6OC 1IGML 2AW2A 1N5AA 5DQ9B 1XR9B 1A4KA 1ZVHA 3AMKA 3N1QC 5ADPL 5HHOA 2X7LA 4BKLA 4I18A 1N64H 3T09A 3HRZB 1LK3L 3N1GC 5DHVA 4XCYB 5GRJH 4XPFL 1NLDL 3DRQB 1L6XA 4G80A 1OB1A 1MHCB 1WISA 2AGJH 4F15B 3BKJH 1KXTB 1MEXH 4J3TA 3BWAA 2DQTL 1QRNA 2DD8L 1NGXB 5KW9L 2W9DH 2WLZA 3DO3A 3ZZ1A 2DQIL 3GGWA 3OHXA 3RVWC 3RWDA 4KRNA 2DMCA 1S8DA 3ARYA 2VXUH 4A6YL 5I76B 2WUCL 1CI5A 5E1AB 4GLRI 2I9LB 3LIZH 3QDGA 1HZHL 1DUZB 4QF1A 3VXPB 4I5BB 1TNNA 1CIUA 4QYOB 3IU3A 3GNMH 1ZVSB 1IBGL 1OSZA 4P2OC 1I1AC 5HHVL 3TJEH 2JJVA 1ZGLP 1AO7A 4XCCH 3TPUB 1FE8H 3KPOA 1H3VA 4FMFA 1VFBA 3DRQA 4QRSB 5DJ6B 2FJGA 4YHYC 4IRSC 1AFVL 2YPKB 4JN1L 1WQVT 4OKVB 3D3VE 3GBNH 5HYJD 1N0XL 4ZMAT 1A7RH 4BFIA 4NC0B 4WY7H 5FHAL 3F12B 4OLYH 4R97B 2J88L 3GMMB 4LLQA 1N8ZA 3H9SD 4OZFA 2BNQB 4OD2B 1CDHA 5I76A 3NZ8B 1DQDL 5E1AA 5BQ7A 3T0AA 3TH3T 1DUZA 1NAKH 2OJZL 2ZCHH 2R2BA 4JKLA 5GGQH 3VXPA 1BOGB 2LAGB 4QYOA 4HKXB 3I6KB 3ZTJH 4YGVB 2DQJL 1QPPA 4KMLB 3MCLL 3RP1A 1KPRA 3VWKD 2I07B 3TPUA 5SX4H 1QR1B 4IRZH 3T1FB 2P43B 2BVTA 5AAWA 4HGWA 5JTWA 3V5DA 2IFGA 4LDEB 3HI1A 4M7JL 4MNHA 4GJTB 1GYAA 4GW4B 1UWEL 3V4VL 2F5AL 2PXYC 5E2WL 3GMMA 3ULUL 4KJPD 3CLEL 2H26B 4YXHH 4GAGL 4YHZH 2BNQA 2GT9A 2IQ9H 4K3HA 1FIGL 1YYLH 4X7SH 3MC0A 1YPZF 3BEWB 5HVGB 2JB6B 4I0PA 1AIFB 2FATL 5IG7B 2PW1A 2VLRE 2XZAH 4K71B 1MFBL 2E27H 2E6JA 4OLUH 5HGHB 4RNRB 1JF6A 3RX5A 5KSVB 4HKXA 3RHWF 3WBDA 4PG2A 1NQBA 3WXWH 3RU8H 5HYIA 4OCYL 3UTTE 3QQ3B 2HKFL 3RHWK 2I07A 4PLKC 4LFHG 1D5ZB 3L7EB 5IFJB 1JNJA 3V95A 1D3CA 4XMLL 3LB6D 4FTVB 3WMSA 1A6PA 5F1OB 1MQKH 3CSGA 1UB5A 3ZE0F 1RZJL 3GUTB 3K1DA 3L5XH 4JQXC 2C1OA 4RAHA 4YX2H 3MLVH 1YPZE 1N5YH 1MFCL 4FOMA 2CLZB 2OTWB 1UCBH 4UAOB 2EDFA 1C5CL 2YA0A 4TTDC 3M8OH 3K4DA 1UVQB 4TOYH 5E6ZA 5L0QB 3KYMA 3BEWA 1ZANH 2JB6A 4F7EB 1NCAH 1MAKA 4NCDA 1AIFA 4HUWA 2IANB 3L7FA 3QJHA 1T2QH 3L3HB 5HGHA 4GRWB 1HI6A 4RNRA 1CU4H 2XWBB 4J3OC 5KSVA 2PYFB 3QEQA 5F70A 4Y5VC 3TN0A 2P1YA 4AENA 4E5XB 1OARH 3WO4B 2A77L 2OTPA 4KKBC 2CLVA 3ZE0E 1EO7A 3RUGB 1NCBL 4KTDH 1S9XA 2X40A 2NY6C 3V4UL 3L7EA 3MA9L 4BQBA 1G9MC 1A7QH 4KTEL 3MJ7A 5FDWA 4M6NH 1O7SA 2XACC 4MXWH 4HUVB 3GUTA 2IGFH 3MRFA 1WFTA 1REIA 1Z2KA 3UDWC 5D2NC 3EDFA 3DSFH 3LPWA 2CLZA 1MPAH 3D48R 2BVPA 1RY7B 1RPQA 1UVQA 3PV6A 2HTKD 4MS8D 4JAMA 2PR4H 1IEAB 2BFVH 3MRRB 1ACYH 4JY4B 1Z9SA 2IANA 3PWLB 3WCYA 1N59B 2GITA 5DJAB 3RTQB 4Q9RL 2H9GB 1FRGL 4I3RL 3OKDB 1IM3A 5B3JF 2ADFL 2PYFA 4YNYA 3MGOA 3PDDA 5D1XA 3Q6FB 3BE1L 4E5XA 3EOBB 4OKDA 2E7BA 4ZFZB 2NX5E 3EYOB 1BFVH 4M8VA 2DIBA 2FX8H 2HMID 1UJ3A 2Z91B 3O2WH 3TO4A 3QUXC 1RK0A 3HCVB 4GKZA 4X8JB 4X6FB 4I77L 5E1HB 2Y5TB 1QFWL 4HUVA 1A64A 5C2BL 4XHJC 5F72S 4P2RA 1D9KB 1MFEH 5C6PB 1MFAL 1JWUA 1R3HB 4UILH 1YYMH 3STZB 5B3JE 1MREL 4JY4A 2OTUA 4ONFH 2VLMD 2X1PA 3NIDF 1EA9C 3OKDA 1QG3A 3OF6D 4O51A 3Q6FA 3B8YA 4GRMB 5HHMD 1FL6A 2FB4L 5BS0D 3EOBA 1F2XK 4X99A 3GKWL 2WP3T 3T77B 3MFFB 3LKSA 3TNNB 2DQGL 4NKDA 4XAWH 5JA9A 1RVFL 4JHBA 2R15A 3D3VB 4WJ5B 4FQ2L 1QFPA 4ZNEA 3SGDH 4S1QH 4GMSH 3MLRH 4LDLB 1JGLL 2YRLA 3QXDB 3JV6B 2FEEI 1J0ZA 5D1ZD 1D9KA 2BY1A 3NIDE 3BIAX 3BMVA 2ESVB 1R3HA 2NY5L 4KGLA 5EUOF 1SY6H 1QLEH 2C7UB 3PGCA 5CSBA 4YC2C 1XIWC 5J6HB 1Z3GL 1C1EL 3QSKB 3VFRB 2C1PA 5ACLA 1CE1L 3VXSE 5FOJA 1DEDA 3PWUB 1I7TB 3W9DB 3O2VL 1BQHA 2FX9H 3HC3L 4X83A 1SEQH 3N9GH 1UWXK 3TH4T 3FB7B 3ZKXB 4S1RL 1HYSC 5C0EA 4X9GA 3WEXB 3OTTA 4E41A 3NCEB 1KF9B 1F4XH 1DQMH 4WJ5A 2OJEB 5HI4C 5IBUG 3KJ4C 3JWOH 5JIIA 3JWDH 3MJ6A 5BMFL 2AK4E 1FNAA 3QA3A 4KGJA 3GSNH 3I6GA 1EJ6A 5DA4A 5GQBA 4KWUA 4PJHA 1LQSR 1E27B 4KV5F 4NCC1 3HZMB 5ALCH 1LWRA 5T1MA 4HH9B 2HLAB 3MRIA 1I85A 3QDGD 4PV9B 1R3JA 3VXME 1KB9K 2NY2C 2EKSB 5J6HA 2BNRB 2VLRB 2MTPA 5MEPB 5J1TC 5DF0A 3VFRA 3DV4B 1S5HB 5I1EH 2VZOA 1IAMA 1VKXB 2B2XL 4MB3A 3P30H 2FLBT 1I7TA 3VWJA 5CUSL 1S9YA 3W9DA 5D1QC 1VGKB 2EDLA 1FH5H 1H3TA 5JHDB 4PRIB 1SYVB 3I50H 1G6RH 3SKOB 1I7ZA 1LVEA 5C0RH 4LCUB 4IM8A 5AG9A 2OJEA 4KV5E 4S10A 4BUGA 1TZHA 3BXNA 5DJ8B 4LOUD 5I1HH 5GPRA 4XP4L 2YWYA 5CP3H 3ESUF 4G8GE 1TZIA 2J2ZA 4P2QE 1WEJL 1VEOA 5IP4A 4Z7QE 1CD9B 4LAJH 2HLAA 1S7TB 4PV9A 4XPBL 2YUXA 4HV8A 2EEAA 3WHE1 4S2SB 2EKSA 1DBAL 5MEPA 3EDJA 2X89D 2WQRA 1F8TH 5GGVY 5TFSH 4LVOC 5I30L 1CQKA 1YNTB 1VKXA 1NGPL 3R0MA 1EEZB 4APQA 3BESR 5C07B 1DQLH 1T4KB 4H8WL 2V2TB 4MA7H 4DKFH 4YHLH 5JHDA 4PRIA 2Y07L 1SYVA 4ZUTB 4GAYA 4UNTA 1A14H 3SKOA 1NBZA 1UFUA 2EE2A 4ZFOL 1KENL 4MNGA 2JKXA 5FB8A 5IWLA 3PQYE 5DJ8A 3L3IA 3BD4A 5IJKC 4XBEL 1N7ML 2BNQD 4OUOA 3S37H 4LSUL 4XPHL 1KJ2L 5F6HI 3OXSB 1YUHA 5T1LA 2EC8A 3BKCL 4YFLF 4OJFH 2CMRH 5DMKA 2VABA 1BAFH 4PB9H 1BJ8A 5DUML 2I9TB 1K6QH 3MLXL 1DANU 1R0AL 3FRUB 1JK8A 4PJCF 4Y4KB 5TDPB 1EGJL 1MHEB 3BPCA 1P1ZB 3S4SB 4YPJA 2YD9A 3GSOA 5C07A 1T4KA 3TCXA 4QNPF 3QUKA 4L4TB 3QUYA 1MJ8H 3IXAB 4Z7VF 5A40E 3KYNB 4MA1C 2P4AB 3C2AH 2JB5H 5GRYA 3T4AB 4LPVA 3O45B 1AXTH 3VCLB 2VDKL 3K46A 4B5EA 4GRLA 3BHBB 4EUPG 4FXKB 3LKRA 43CAB 2QR0B 3OWEA 2WP3O 2I9TA 5E8PA 1E4JA 3ZE1E 3KPNA 2W9LA 1QLRB 4QNPE 2EDDA 1CICC 1CL7L 1MCNA 2IFFH 4M7ZC 1CDUA 4ODBD 3T3PE 4LVNB 3LKOB 1DEEB 1PJ9A 1F6AB 4L4TA 2ZKHL 3KPPB 5TE4H 4FTVD 4Y16B 1LO0L 1RZKL 3RWJB 4JM2B 5E95B 4LK4A 4LSQL 1SY6A 3IXAA 5C08B 5JR1L 3V6ZB 5E08L 2H32B 1A6TB 5DJDB 5EIIA 4K94H 4DOHE 1RK1B 3MRPA 4JFYA 2AEWA 5I1AB 3O6LL 1XFPA 2UUDK 5E9DE 1N4XH 4WEUD 2IAND 4MA8L 4XXDB 3BH8B 43CAA 2QR0A 1U3ZA 4MCYA 5I18L 5MENB 4NN7C 3UTQB 2B0SL 3ARPA 4EI5B 4LQ1A 4U1KB 4GKOA 1PW3A 4PJFF 1TJGH 3UPAA 2Y7QA 2XWTA 1JP5A 1YNKL 3LKOA 5HGGS 2RIKA 3KPPA 1F13A 1UA6H 3O4LA 3QEGL 1BGXL 2NY1B 4FFZL 3GSNA 1NDMB 2B1AH 1WT5A 5CD5C 4L5FH 5LCVH 5FYKD 4TVPD 4YC2B 4OSUL 1KCSH 2FIRT 3TT1H 3V6ZA 5IIEB 4XPAH 1B0RB 3UJJL 4Y4FC 5C0DA 1A6TA 4G3YH 1IAIH 5BVJB 4G7YL 1RK1A 4LPYA 3N06B 5GS0L 2AK4B 4PGBB 2X4TA 4N0UB 1WCBB 2YN3A 1SJEA 1K3IA 3RKPA 5I1AA 1AE6L 1GC1L 3OR6A 1E6OH 4XXDA 4YEEA 2XNAB 4P4RA 2GI7A 1GOHA 3RTQD 3VXMB 2J5LB 5C0BB 1FLTX 2D31B 3UTQA 4K8RD 3EGSA 2VOTA 1RZGA 4O5LH 4ELKA 3C08H 5JXAH 4NKQB 4UQ3B 1F00I 3CGTA 5CEZE 3JZ7A 2ADGA 4ODSH 3CU1A 4NKIH 4OLVL 5CP3A 1RULH 4DGYH 1J86A 1YQVL 5D5ME 2V5MA 4PJ9A 2Z35A 3K3QA 3PP3K 5IIEA 1TFHA 3O81A 5DS8B 4HS8H 4LSPH 1D9KD 4Y2DA 1EZVX 3S36X 4N0UA 1WCBA 3UYRH 2RAMA 1G7JB 4Y89A 3QISA 5SWSE 2XNAA 2KQMA 2CXKA 3N1FC 4N0RA 4NQSA 1A6UH 3L3DB 4DVRH 1MIEL 2CUIA 4GFTB 4EUPH 4HUKB 2D31A 2IPUK 1J1XL 2VDPH 1OQOA 3P9LA 5DEGB 5GJSH 2YS4A 1SJHA 4RBPH 1HHKB 3P0VH 4LPXA 4ZOCA 1U3JA 2QL1A 4PJGA 3VH8B 3VGAC 5DYOA 2C3VA 2W9EH 3TV3L 4LSRL 2P5EA 4XWGL 4MNQB 2X9WA 1RUML 2VZUA 5EOCL 4FG6C 1GJIA 2Y5EA 3RRQA 3D3VD 3PIQB 3TA3B 1KFAH 4LAQL 1X5XA 4R4BA 4N8CL 4LVOB 4XC1H 1NLBL 2ESVD 3GBMH 3WE6B 2HWZH 3L3DA 1YEKH 1XMWA 3RVTC 4IEFB 4O02L 1QKZH 4ZS7H 1WFUA 1HKLH 1DLFL 3BQUC 1FNGA 4UDTB 1HHKA 2PYEB 3VA2C 3VH8A 5E6YA 1XGYH 5HHXL 3ARWA 4OD3H 1AXSA 4M6OL 3PIQA 2EDYA 1P84J 3TA3A 4KI1A 5JXEC 1X5HA 3QYCA 1KEGH 1I9RH 3ZHDA 3GSRA 4PJ7F 4WTZA 4XVSL 4FABL 2EC9U 2HT2C 3FHQA 1X6LA 1AGEA 4LEOB 3EO9H 4K3JL 5DQDL 5TGBA 1EZVY 3LV3B 3M45A 3SDDC 1B2WL 3U46B 4HPOH 3PGFH 1T21A 3F65A 1OWWA 4P3WA 2BNRD 2VLRD 3WD5L 7FABL 5EU4B 4H0HB 3QRGL 2PO6C 2ZOKB 1NEZA 1VDGA 4UDTA 3WN5A 3HE7B 5L88L 4F9PC 5A2KH 3AC0A 1BLNA 4ZO8A 2MQ0A 4IRJB 3C60B 3M1BB 3TBSB 2BSTA 3WS3B 2PYEA 1LK3H 5JHDD 4PRID 2Y25A 5F9DC 5CSGA 1JZ3A 3UP1A 5IB5B 2AJZA 4PJ7E 4YIQB 3NPSB 1F4HA 4PV8B 2XN9A 4AEHH 1KUMA 4BK5A 4NBYB 3BZ4A 3KLAB 3FONA 4DOHB 3K7UA 4KZDH 3TEUA 2NXYB 1PD6A 1CT8B 4NO0B 1KGCE 2B39A 5C8JB 3SDAB 1OWRM 4M7ZB 5EC2A 3CU7A 3VD4A 1FP5A 4MJIA 3LV3A 2F8VA 1QSZA 1BVKA 3OXRA 2XRAH 3FJTA 3MRHA 4CKVX 3L5IA 4NPYB 2BHUA 5GS2H 4QGTA 3GFUA 3OQ3B 2ZOKA 4JEGB 3VXNB 1F6LL 3B43A 4NN6C 1IBGH 3HE7A 4LKXA 3FQXB 2YK1H 5IB2B 5C07D 4IRJA 1MCQA 4CVUA 1IC5H 3PABA 4P5TB 2J1KA 1R5WA 3SPVA 5ITBL 1BD2E 4PJEB 1LNUB 3QDJA 4YIQA 3U0WH 5CILL 5KVDL 3HHRB 3MFGB 4PV8A 1A0QL 5I1IH 3CK0L 5FHAH 1KB9J 4ONHA 4UOW0 2J88H 4WHTB 2VLKE 1BFOB 2CO7B 3EYSH 1CT8A 4Y4HB 3IJHB 4NO0A 3SCMB 3QQNA 2ZSVA 3SDAA 4ORZC 4LCWE 1B90A 5DK3A 1NBVH 5FGCE 2FO4B 1FL5B 3UTSB 3VFTB 2W60B 2MQCA 5EOTA 5DLML 3D85A 4ENED 2GW5A 2WANA 4J8RB 4PUBH 4WI2A 4Y4KD 1MCIA 4ODXB 3QCTH 4FQXB 4GUPA 3BWUC 3BDYH 4DN3L 5E7BA 1CDYA 5IB2A 1HQ4A 4P46C 4ZUUB 4FQJL 1HILB 4L4TD 4LPWA 1A21A 3PF2A 4I9WE 4P5TA 3ZLQC 4PJIE 2BSRA 5D5MB 2WINB 4HJJL 4OF6A 1LNUA 4NUJB 5E24E 5JORA 2QSTA 4KVNL 3KPSE 3QQ9D 2WUBL 5KG9B 4Y0GA 2OR8A 3HMWH 4M7JH 3GSUA 5CBAB 1XGRB 3QDME 1KN4H 5KVGL 2JK5B 2F54B 3WUWG 4ESKA 4QTIH 1M4KA 1XT5A 1C5DB 2FX7H 3FQNB 3H3KA 3KPRE 4YWGL 2F5BL 1P7KB 4U1IA 2FO4A 5F88B 1QA9B 4J6RL 4PJXA 5F1IB 3H0TB 3KYAA 4U6HA 4UTBL 5BV7H 1MFBH 4M03A 3WNKA 3ZHKA 1N0LA 2ZJSL 5I8CB 1FBIL 3SGKC 3GJEB 1GOGA 4W4NA 4FQXA 3OKKB 3R8QA 5KJRL 4ZO9A 4OCYH 1HILA 2GTWA 4AIZB 2DLGA 4Q97A 4BSVB 3ABZA 2YMXH 5FM5M 4Y16D 2DIJA 4JM2D 5ISZE 4XMLH 2ZCLL 4PRPA 5C08D 1HYRC 5KG9A 5E2UH 5FYJH 2DDQL 1MFCH 1YJDH 3QUZB 2VDMH 2WBJB 2JK5A 4XCFH 1QVOA 4Y19E 2P24A 3AS0A 5F9WC 3C5JA 5T3ZH 1MAMH 1Q9OA 1S7QB 4QT5A 4U1SA 5LG1A 4KRPC 4L8SC 1YC8A 4AQ1B 5GJTL 5MEND 5DZLA 5DDHB 6FABH 4POYA 5E56A 3AREC 5F1IA 3QNZB 4HWBH 5F9OH 5SX5K 1FZMA 1HHJA 3UBXB 3MMEA 5DD3L 4EI5D 5FGBC 1WK0A 4MLIA 4AEEA 4CU6A 3OSKA 2COQA 2D7TL 4XBGB 4N5EC 5IM7B 3OKKA 4M6ML 3AXLB 5F7KC 4AIZA 1A9BA 4OCWL 1JRHI 2NY1D 3MV9A 1YEFL 2HG5A 4HEPG 1G7IA 5I8EB 3NAAL 4A6YB 1JZ4A 3IT8D 1IKFH 5IFHL 4GAJH 4OUUB 1CVSC 2CSPA 3U9PH 4UT9L 2YUZA 4BFBD 4M62L 3QUZA 2AK4D 3BQUB 3HS0A 2YPLA 5I0ZA 5IW3A 3ARDC 3RIAK 2Q8AL 4KDWA 5HJ3B 4M7LH 3VXMD 1NKOA 2P7TA 1F90L 4ZTOH 2R0LH 2W1NA 3BVNB 5C0BD 1P2CA 1RIVH 3QNZA 1NJ9B 1RJZA 5DVOA 5AEAA 4Q9RH 3BGAA 4RGMC 3WDJA 5JZ7C 1LP9F 3ZDXF 3WHXB 5A43C 4NBXB 1UG9A 4O58H 1PGRB 5ESVA 1IT9L 3FOLB 3H8NA 4YHPA 2IAMA 2AAVA 4JO4L 3C6LA 1TTGA 2DQCL 5I8EA 4I77H 1FN4A 3ROOA 1YECL 2NY0C 5FXCH 1K4DB 2R4SH 4U6TA 3PJSB 5F6HJ 4D8PB 4OUUA 1CXLA 1VCAA 3MZTA 5C2BH 3W5MA 5EZOH 3IAPA 1S7XB 3WNMA 1RJLB 4KMTL 3H9YA 2OX5A 5C0CA 2E9IA 4BZ2H 5HJ3A 2AV7A 5ACZA 1T5WB 1MFAH 1AQKL 4OB5H 1LP9E 3ZDXE 3LHPH 4ZOEA 4BZ1H 2AI0L 2KKQA 2GUOA 2NXZB 3CNKA 2NY3C 2BOBA 4OCLC 5IHUH 5ACMA 4RAVA 3WXVL 3WHXA 4MMZC 1GAFL 1B4RA 4JFZL 5GGSA 4CJ1A 3JVGC 3FOLA 5C7XL 5IQ9B 1OLLA 4S0TD 3GI9L 5CINL 3GKWH 4JRYB 4MNQD 1AD9A 1B6DA 3IRZA 5IVZA 3TA3D 3HN3A 4EJ1C 2DF3A 2ITDB 4JGUA 3E8UH 3REVA 1EEUA 5I1KL 4PRNA 1RJLA 2VLKB 1IZKA 3L3OB 5DFTA 1EXUB 1T5WA 2FGZA 4LCYA 5EG6C 3O2DL 4LCWB 2UVFA 4C56E 4ACPA 5ID1B 4NHCL 2OLDA 3DARA 3K2UH 4Z8FH 4N0CD 3VFMB 1C1EH 3ESVF 4QHNB 1WITA 4H0IA 1ZSDA 1CE1H 2J8UE 5E6IC 3DYOA 2PYED 4LL9A 5KSBB 1S78C 1KN2L 5IQ9A 4I3SL 3F6LA 1MLCB 3ZT6A 3CMOH 4J4PA 5JQHC 4JRYA 3OGCA 3KHQA 5ICYA 4PJIB 3O3DB 4MQ7A 1F3JA 5EZJB 3HB3C 3LD8B 3B3IA 2VZVA 4PJ8A 4XTRD 2WIMA 4U7SA 4HWZA 4KXZI 4PRAB 2O5YL 5T3XL 2X4NB 2Q3ZA 3MO1A 5TDNA 3KVQA 4P46B 3SE9L 4YDKH 4W6WB 4PRHE 3X13A 4JY5L 4LP5A 4Z76A 3MLYL 4XP5L 5LJYH 1BIIB 3BPLC 3RDTA 2HFGH 4NO5A 3VFMA 4QHNA 2J6EH 2R1WB 4QOKE 1QBAA 3QXAA 5D6CA 5E5MB 3HE7D 4IRJD 3C60D 3ZDZE 1BJ1H 4JFEE 5KSBA 3C5ZC 5DEFB 1MLCA 3VFOA 3H42L 3RVVD 2EO9A 1ZT1A 3MLUH 3VXRB 3NN8B 5ISZB 3CUPA 3QHZH 3JTSB 2NTFB 5CGMA 3ULSB 2VDRL 4XNMB 1ES0B 1IGIL 1MCPL 4QO1A 3VW3L 4X4ME 2G2RA 1YN6B 12E8L 2NXYD 3QEHB 5D2LB 3O3AA 2VXTL 4PYGA 4NO0D 1KXVC 1FZJB 3CFJB 5C0AA 3SDAD 2AXFA 1INDH 3VE0B 2ZNWA 1JE6A 4C57C 4P59L 1JNLL 4XPBH 3LEYL 1ZKAA 4KJQD 4X4YA 2OQJA 2CR3A 4LCCB 4YH6A 1FG2B 1HCFX 5E4IA 2R39A 4EZMA 3HG1B 3OJDA 1B9ZA 5C0JA 1FZKB 3NTCH 3OB0H 1EMTL 1XF2B 2HFFA 2VB5A 1BWWA 3RL1B 4P5TD 3QG6A 3SBWC 4YHML 5AYUL 3U7YL 3FB5B 3GO1L 4I48B 1P7HL 1RZIB 4X6DA 2Y07H 4KK9D 4M5ZL 5D7JA 1CGUA 2HRPL 1EAJA 3O6FB 2YUWA 5DQJB 3ULSA 5T1KB 2GCYB 4XNMA 1ITCA 1F42A 4EVNA 1AHWC 3SE8L 1YN6A 2R29H 3VFWB 5D2LA 5JMOC 4Y4HD 1T04B 1OP9A 2ICEB 3SCMD 3WJLA 3SJVE 5IEHB 4GS7C 5DMGD 1FZJA 3O41B 1KJ2H 3U4BL 4OM1H 43C9B 4CU8A 3RZWA 4NRXB 1ZS8A 3UTSD 4YR6B 3WFCH 3HNVL 1LEKA 1YEJH 1FAIH 3OGOE 4LCCA 4JN2A 3S98A 1FG2A 2QEJA 3MLXH 1Q8MA 4FQXD 4OLEA 1Y18A 1HQRB 3HG1A 4GBXB 1KTKE 3BI9X 4MQSB 1CLCA 4GLRH 1YNLH 5I16A 5DD1L 1MJJA 2X44D 3FB6B 3IB4A 4OCSH 4XXCA 5CEZD 4NQVA 5INCB 3V6FB 3G08A 3HMXL 5EN2A 2QHRL 1OTTC 3FB5A 4KKAD 5KS9A 4KK8C 3VU2A 3IKKA 1DBJL 4YUEH 3IFNL 4EKXA 4DKDC 3WUWA 2FGWH 5DQJA 5JIHA 4MAYC 2GCYA 3SGEI 1CFBA 4R2GC 3U0TB 2C3XA 1AP2B 4MAUL 2F54D 2ICEA 2CDEA 1CIDA 4JQVC 3K1KC 2J4WH 3WKML 4P3DB 5HI5D 2XY2A 4N8PA 2BMKB 4LHUG 3ARZA 3AS1A 3O41A 3P4OB 3MOAH 1HCVA 4LKCA 3MLTB 43C9A 5JW3L 3AGVA 2ZUXA 4YR6A 2HTLD 1OAZH 4K2UL 4Q2ZA 3E6FA 1ADQL 1DBBL 1W2KT 4PP2B 4NC1C 1S7WB 4MJ2A 2NY0B 1IAOB 4HQQL 4Y5YB 1QSVA 1HQRA 2A6KB 4GBXA 1OW0A 1RZFL 3EO0A 4WNQA 3FB6A 1N6VA 2APFA 3FO0L 5MEOA 1MCFA 5IQ7L 1EJOL 1A6WL 4JFHE 1JYWA 1RZKH 3S35H 5I1CH 5JR1H 1G9MH 4NC1E 3ILPB 2ITCA 2X4UA 5F96L 3JUZA 2R0KL 3QUZD 5FM8A 3S97C 1RUPL 4HKJB 2WBJD 3MXVH 5E08H 2AV1A 4H26B 4FFWD 4ISVB 3QPXL 1MJUL 5FF6B 2EDHA 2L7JA 2ZSWB 4YHNB 1K2DB 3V6OA 3L3GB 4NNXA 1QBMH 4B53A 3DVNB 3LSOA 1BMGA 3MLSL 4LCIL 2R2EB 1MI5E 4C56B 3EJZD 4FG6D 3WIFA 4PP2A 4X7EC 4Y5YA 4M43H 3MREB 4RMRA 4G5ZH 4UT6H 2J8UB 1FVCB 4OQTH 4X7TB 2AKRB 1SJXA 5ETUB 3THML 5EO0A 4KRMB 4XRCA 5IFAL 2E7LC 5H2BB 1YNKH 4ALAH 5HGAA 4PPTA 5DJXB 4DZBB 5I73B 1BGXH 1Q1JH 1JHKL 4TNWF 4NQUA 5FA4B 2JCCE 1HXYB 2DQEL 4XVTH 1U8MB 3CX2A 4XT1C 1NCDH 3UJJH 2J7LA 3BQUD 4H26A 1NC4B 3PL6B 4ISVA 2J6EA 1VPOL 2XT1B 4N1EA 4K3GA 5E6IB 3LPGA 3IDUA 3PWNB 1J0YA 4K3DH 5JLZB 1WBXB 4ZSOE 1H5BB 3C8HA 3B2UC 4P2OA 2NY7L 1J05B 1DFBH 2H1PH 3G6DL 5JHLL 4YXLH 3MCKB 4QOKB 4M8QA 3MREA 1FVCA 3GSVA 5ETUA 2AKRA 1OAXL 1S7SB 4JFEB 2QQNL 1FFNB 2X4PB 5K59F 1RU9H 5JUEL 3O4OB 4OLVH 2YKLL 3RAJL 5DRZB 4P48A 2BOCA 4NDMB 1U3HC 2ED7A 5FA4A 1HXYA 3AY4C 4HZLA 1IQDB 1J5OL 4Z7OF 2OMBA 3ILQD 3HZKA 4HGMA 3BO8A 3NFPA 1ZT4A 3RPIB 3P0GB 4HIEB 2OL3L 3PWNA 5D93C 2YZ1A 4I4WA 3DUUB 2NXZD 2EH7L 3DX9A 2XA3A 3VMOA 1JN6B 4N8VB 4OZHB 1J05A 5K59E 5FYLE 1TENA 1HNFA 5E99L 2LVCA 4ZFOA 5F8RC 3FOMB 3H3PL 5F7DB 5I0DA 2ARJB 3F58L 3U4AA 1FFNA 3KYKL 4G6JL 5EPMA 4JRYD 2F9BT 4Z7OE 3SE3A 3PWJA 2BJML 1KLUA 1KJ2A 4LSRH 4XWGH 4LLDB 4CN4A 5H35A 5E94B 3CCHB 4NDMA 4OLWL 2X4RB 4CVZB 2I5YH 1ZHKA 4NWTL 4LAQH 4X4XB 4XGZA 2EZ0C 1UWXH 3EOTL 32C2B 2VLKD 2XFXA 4N8CH 4HIEA 4M1DL 3P0YH 3SJVB 4JO1H 3FFCE 3PP4L 5BXFB 1KYOJ 2Z31B 4LCWD 2NZ9C 1YPZA 4KY1H 5FCSH 1NGYB 4F7PB 2D7MA 4LLYA 3T0EC 1N6UA 1A7NL 5HPMB 4JGMA 3KNBA 4OZHA 3D5OF 1L7TH 4OM0H 3TYFB 1ZA6B 4OFVA 5L2KE 4K23L 5CFHA 2AEPH 2EDBA 1GCFA 1K8IA 3G04B 1TPXB 4GKSB 4PJAB 1G9NC 1H9VA 5D7IB 4XP6H 5I8OH 3BOVA 1EIBA 2NR6D 1D6VL 4LLDA 4KAQL 4KJYB 3DHJA 1D5MB 3T0EE 5INDA 4CVZA 2YZ8A 4K9EC 2MCG1 2VR5A 4CUCA 3NACL 1MCBA 3EFFB 5D71L 4K3EL 4UTAL 4U6YB 1OM3H 4YHIA 4XVSH 1OL0A 2M8XA 4P46D 3VDAA 3NZHL 4IJ3B 2O61A 5BXFA 1PEZA 3LQAL 4AMKH 3MODL 5DQDH 4M6AA 5IJVB 4FXLA 3X3FL 1B2WH 4F7PA 1H3GA 2UY7A 3T2NL 2D7QA 1UXWB 2FJHA 2PUQT 1EBAA 1JPFB 5HPMA 2DL9A 3U6RA 1A3RL 1OGAB 3TYFA 3QRGH 4TPRH 1ZA6A 1R3KB 4BSJA 4IDJL 3ZT7A 3G04A 5CWSB 3FB8B 4XNYL 1ONQB 3P9WB 3UPRA 5ELIA 4PJAA 5D7IA 1P9MA 3VXRD 4NZTH 4TSBH 3IGAB 4XNZC 3UDWA 1GGCL 5D9SB 5ISZD 2W91A 3EKCA 5D2NA 2ZP0T 1HSBA 2OXGA 4HJGB 5CGYD 3MRKA 2HJLB 4XWOC 2NX5A 3BKYL 5E2VH 2YRZA 1CBVH 2APXA 3MRQA 3HAEB 3IVKA 4U6YA 2YA1A 5GGRA 1I3VA 1P4LB 4NSKB 2VISB 5F89A 5EUKA 5FIEA 2A6IB 5F6IB 4B50A 1WLHA 1JGDB 3D87B 4RA3A 4PJDF 5C0GA 1UYWL 1UXWA 2DIAA 3C6SA 1MI5B 1A1NA 3QO1B 3HG1D 4GO6B 4BH8B 1OGAA 2WNGA 3BD5A 5BZDB 1YEGL 4QRRE 2EIBA 3QUXA 3I75B 5IW6A 4XP9H 5HDBF 1T20B 4KTYA 5K9OB 3GI8H 4R4ND 3BIKB 2RCSL 5J1SC 3QH3B 4YHOH 4LLVA 3O6FD 2Q8BH 5T1KD 4YXKL 1JVKA 4HJGA 1U36A 2BVOB 2JCCB 5CILH 1C5BL 2D7OA 3LEVL 3OR7B 1QBBA 1N3NA 4LIQE 5DMIL 5I71C 1QQDA 1RUQL 3HAEA 4XMPL 1DCLA 1JZ5A 4ZYKB 1P4LA 4HLJA 2N56A 3QFDB 4NSKA 1JMXA 1A6VL 1NL0H 2VISA 2B7DT 1R5IA 1VGEL 2A6IA 2OP4L 2XQBL 4ZSOB 5IHLB 4QXGH 5KSAC 1L0YA 1X5YA 3B5TA 1JGDA 4EN3C 1IC7L 3V2AR 5D96C 3MNVB 1WWCA 1YN7A 2WZPD 1WC7A 1FDLH 5BVPH 1CWVA 2IPUG 3RWIA 4XP1H 2DB8A 3ES6B 1T20A 3F7YA 5IVOA 3SDXB 5K9OA 5DXWA 1IGFH 1T1ZB 4X6CF 3DX8A 4YDJB 3O0RL 3P2TA 5ESQB 2R4RL 3VFGL 3F7RA 3UX9B 3VXSA 3DX7B 3S88H 4HJJH 3MOQA 4ZXBB 1MIML 3ROLB 2GY7B 2ICWB 2OI9C 4JPIB 2CDGA 3LKPB 3ZL4H 4RGNE 4KVNH 4Q9QL 2WUBH 4FA8A 3QFJA 3HUJF 3VA6A 1QFHA 5C9KA 4DAGL 1AKJB 4JB9L 4GW5B 5CCKL 5AYQA 3SDYL 3STBA 3B5HA 1A02N 3P77B 4NJ9H 3OG4B 2VLLA 4FFYL 5SWZB 3DXAB 4N0FB 1SVCP 4EI6A 4JREC 4NWUL 2V7HA 1ZLWK 3NIFF 1OT1A 1CXHA 4JHAL 2A1WH 3VGDA 4HHAA 1DE4A 1I75A 4KROC 1NC2A 5EUOA 3MNVA 4J6RH 3KJ6L 3AROA 2OMNA 2NY0D 1UM6H 5LQBH 1OTUC 5C0FB 1F3DJ 1V7NL 3DX6B 3WLBA 5EA0H 2AQ1A 5KJRH 2Y36L 4KKLD 4G9DA 2LU3A 3TBTA 5JQ6H 1B4JH 5DGRA 3HUJE 1T22B 4J7RA 3DJ9A 4N5UA 3MV8E 5ESQA 3B2VL 1NGQL 3UZVB 3CC5A 5CZXD 3DGCR 4JPIA 5EORL 4RRPG 1Z9LA 2NY3D 3TFKC 1GIGH 2FLRT 4L8CA 4M48H 2P45B 4PS4H 1AKJA 1JGUL 4IOIA 3NIFE 4U6VL 4YE4L 2DL2A 3P77A 4XI5C 2FSEA 5SWZA 3DXAA 3BYTA 1HIMH 2X41A 5CEYA 5FOBA 1G1YA 4C56D 5GJTH 4GG6E 2IPKB 1Q72L 3HC4L 1DQJA 1ZGLB 1WTGT 4TUKL 2VE6A 3CH1B 1T66C 3WFBL 5D1QA 5ESAA 5IMMB 1TJHL 2D7TH 2WWKT 3TT3L 5B39B 1A4JB 2R0ZH 3MXWH 2VDNL 5DTFA 2M26A 5GS1C 4P9MH 4WWKC 4FQCL 1UCTA 4MD4A 5E4EB 4JVWA 1JYVA 4UT7L 1NCNA 4L3EA 1DVFC 4IIQB 5IFHH 1IGJB 1NC4D 3VD5A 3PL6D 4UT9H 2VC2L 4ZAKC 5HDQL 4M62H 5E6ID 3LH2L 25C8L 2DQDH 3IDXH 4JG1L 2AJVL 4YO0B 5ANMB 5M7QA 4MD0A 2A0LC 3PP3H 2GJZA 5IK3A 4DVBB 4JDTH 3QAZB 1KT2B 4KQ4L 1BQUA 4PGEA 3MR9A 4ODUB 1FO0L 4O4YH 5C09E 2HKHH 1WJ3A 2R2HA 2APWA 4R3SB 4NFBA 1ZGLA 4QOKD 1NSNL 2FBOJ 4JFED 3EHBC 3KPMA 4NQDE 2V17L 5B39A 1WWAX 1IT9H 5KVFH 2BERA 4U1HA 2VDLL 1SMAA 1I1YB 1SHMA 5H94A 4JRXA 3UC0H 2AJSL 3B9KC 3ARVA 5IJKA 3Q6GL 4ELMB 4PBVC 1MF2L 2W92A 1IGJA 1BZ7B 3RWGB 4JKPL 5F7EL 1F3RB 5SWQB 5ANMA 1AGCB 3U2SA 4HXAL 2CLRA 3ARFB 1KT2A 2B4CL 3BP6A 2H2SD 2AJ3A 4QHMA 4HULB 1IFHL 3CXDH 2IBGA 2UWEF 4ZPVA 1PKOA 3V5KA 3RNQB 2CR6A 3F62A 5IESH 3UMTA 4PB0L 4Y8AA 4PJCA 2Q1EA 1HH6A 3GMQB 2ARJQ 3GSQA 5EOCJ 2ZOLB 4TQEH 4CMHC 1OQXA 3EOAA 3G5VB 4Z0BH 1JZ7A 5GRJL 3OKMA 5T5FH 1WZMA 1WZ1H 1DL7H 4C58B 3BP7B 3CZFA 4OAWA 1EHLL 2AGJL 2BX5A 4GT7A 4JO3H 4JY6A 1I3GH 2ICWJ 4Z7VA 3AAZB 4NRZA 1BZ7A 5M94B 2VXUL 3L95A 1LD9A 4PREA 3SJVD 5C9JB 5SWQA 4HS6A 4P23B 2Z31D 1NMCC 4QRQB 2W0LA 4BH7B 3O2DH 5EO9B 5EBLA 2IPTL 4PJBF 3GNML 5E5RB 3SDCB 4U1JB 1S7VA 3TJEL 5E9DA 4OIBA 4XCCL 3U1SH 4JFQB 5E5UB 2ZOLA 1OCWL 1KN2H 1FG9C 1CD0A 3BP7A 4J12A 4YDVA 4L9LB 4AT6A 3HI6H 5DK0A 4YK4C 2FRGP 3GBNL 4PLNC 3ULVC 3SQOL 4OGXH 3JV0A 2BCKA 1NGZB 4OLYL 4RGNB 3R06B 4OCMC 2YR3A 3TESA 5TH2B 1VERA 5B3NA 2O5ZH 5T3XH 4JJHA 4AZ8A 4P23A 4PJBE 1N2RB 3TYGH 4QRQA 1NAKL 4JY5H 2ZCHL 2NMSA 4NGHH 5CZVH 4Z9KB 5TDOA 5EO9A 5EWIH 5GGQL 1W0WB 2C4FT 3G5XB 5IVXF 3ULVE 5ICZA 3HZVB 3VFUB 1HN1A 1OGAD 4YBQD 4D0DB 4HEME 4U1JA 3GJFH 3NH7H 4NZJA 3RI5F 2DYPB 3PXHA 4KPHL 5IGXH 3KDMB 5EZLB 4OTXL 1U42A 4MLSA 4PJFA 1F4YH 5GS0D 2DJ4A 5EBGA 4CBPA 2AJYH 4TSAH 4Y4FA 4JFHD 1ZV5A 3HZYB 1MLBB 2RGSA 5FUZH 1NGZA 3I3BA 3R06A 1I9EA 4QRPB 1IGIH 5FA3B 4NQEE 4CADA 4LVEA 4YHZL 1CFNB 12E8H 2IQ9L 4X7SL 5E7FA 1I9JL 1OP5H 1A2YA 2D0HA 3GK8L 2XZAL 2H8PB 5FUOH 4OLUL 5FO8B 1NH6A 2E27L 3V7MA 3UROR 1KPUB 1W0WA 4KVCH 4MJ6B 1MI5D 3G5XA 2JJTA 1EEYA 4OZGB 4GG6B 2FJFB 3WXWL 3TIEB 1UACH 4MDIB 1U91B 3RU8L 3QCVH 3IFPB 3TF7C 4Y1AB 5CIPH 5SWSA 1FYTB 4EBQL 3P4MA 3AS3A 3KDMA 1EMTH 5J1AB 1EAPB 2IADB 5GXBB 4TSCH 2VERN 3IDGB 2E6QA 4OF7A 3UJTH 3ARUA 1RZ8B 7CGTA 1MH5A 3L5XL 5KANI 1FYHB 4Z7UF 4JQIH 3MLWH 4YX2L 3MLVL 5EZIH 3STLA 1BPVA 3PGDB 1UCBL 4QRPA 5IB3A 3SE8H 1CFNA 4G6FB 2R56L 3HR5B 1ZANL 3E2HC 1YMHB 3LZFH 1WAAA 1T2QL 3U4BH 1NUGA 1GPOL 2A6JA 2H8PA 1BF2A 4MXVF 1KPUA 1I8IB 1CU4L 4L8BA 4MJ6A 1ZLSH 5EO1B 1MCWM 4WWKB 3HNSH 3MX0A 1KJ3H 4LSSH 1U91A 3MA7B 1OARL 5B8CB 3LPFA 5B38A 1D5BA 4KTDL 4XAKD 1JGVH 4OT1H 1VSCA 4JZNB 3UJIL 1T0MB 4MDJB 5J1AA 4NQDB 1EAPA 2IADA 1HHHA 1A7QL 4M6NL 3HMXH 5L9DH 3BN9D 2IGFL 4ZXBD 3IXTA 5KTEH 3QIBB 2FH8A 1UZ8B 5I74B 2R8SH 3CAFA 3DYMA 3MUY1 5HYJE 1DBJH 3B2UD 4HAFA 1BF8A 4LGSB 3DSFL 4EOWL 1AKJD 4JJ5A 1CDBA 3L3JB 1XR8B 3DROB 4HMCA 2LU7A 2LTQC 2CD0A 3WYRA 4MAUH 1SMOA 2PR4L 4FQHA 4MXVE 2HN7A 4RDQF 5SWZD 4R26H 3DXAD 3MUGB 3D0LB 3WKMH 1DR9A 1SEBB 5F7UA 1H8OA 1YDPA 2YBRB 3L6FA 3V7AE 4LEXL 1FNLA 4S1DD 4WCYL 3LDBC 3MRBB 2AEQH 2OZ4H 2HT4D 4D3CH 1I8IA 1MY5A 1R24A 4K2UH 5EO1A 3SKMB 2X4OB 1URLA 2Q76B 4MSWA 2LE9A 5F21B 5LVEA 3MA7A 2GK2A 8FABA 4KJPC 4OZ4B 4AQOA 1HHGA 5DJ2B 1RZFH 3CSPA 2FX8L 4JZNA 4HUXB 4JE4B 3LEXB 1BZQK 3PDOB 3RVUD 4JLRA 5IQ7H 5JXEA 1EJOH 3EBAA 3HC0B 3EYVB 1TNMA 4M3KB 2YD8A 4P5MB 3O2DA 4P57B 4JFXB 3RZCB 3VXQA 3VXTB 3L3JA 4JHZA 4J2XA 1MFEL 1PSKH 3GSWA 3SDDA 1RJYA 4RFEB 3O3BB 4UILL 3V0VA 1NKRA 1YYML 4MHHI 2Z8WC 5HPOA 4QHLA 5D7LE 1Z5LB 3LB6C 1QP1A 4Y88A 3DETC 1GGBL 5TPWH 1MCWW 4Z7WE 2LU4A 2PO6A 4HWNA 4TN9A 4MX7A 3MJ8A 3P4LA 1CQYA 1T0NB 4JO2H 3MLSH 4LCIH 4F9PA 4MVBC 1CXKA 2Q76A 1CDCA 3DO7A 1JZ8A 4DEPB 2EZ0D 3BPNB 5DJ2A 1XEDA 3THMH 3LEXA 3CVIH 1NAML 2VQTA 2MSPA 4OQ1A 3PDOA 2K7PA 1X4ZA 4XAWL 4CMMB 4EIZC 1LMKA 3AFLA 1T03H 3EYVA 4LF3A 3WFHA 4Z78A 4S1QL 1KIQA 4GMSL 1X5ZA 1I8KB 2DQEH 2Q7YA 5CSZB 3PHQB 4AK1A 1G7MB 5F7NC 1XZ0B 4LPUA 3GIVA 3SKNA 3T3MF 1TCRA 2V7NA 3GJFA 1I3RB 5EDXA 4F37F 1SY6L 1QLEL 5ENWA 3MNWA 4OI8A 2XTJE 4RX4D 1HE7A 1J8HB 3IDYB 1XGPB 2QADB 3DIFA 4CN1A 5JPNB 3BRFA 3TZVB 3HLAB 3RVXD 4V1DE 5LGJA 1OVZA 2HVJB 4F37K 2BRQA 1BBDH 1T1YB 4YK4B 4G9FA 2DTML 1ZT7B 3EAKA 3P4NB 1TVHA 4WENB 1BEYH 4LLUB 3OG6B 5JHLH 1KNOB 4FNLH 1A6AA 4MS8C 2P8PA 2FX9L 2VH5H 2JIXB 2ZUQB 3QDAA 1SEQL 1OAXH 3ISWA 4KC3B 3TWCL 4RMQA 2NY4B 5GRZA 3D39A 3AU1B 3OKEB 1TQCC 2YKLH 2MKWA 1D5IH 1F4XL 4M61B 3T3ME 5JW4N 5EFIB 3FO9B 5BCAA 5HVFB 1JRHH 1OD9A 2I60H 3GHEH 2VL5B 1I8KA 3MV11 3QNXA 4IOFD 1J5OH 4FS0A 1R5VB 3GSNL 1IKNC 5ALCL 3MJGX 4FP8H 2HMIC 1PEWA 2NYYD 3ARFD 4PGCA 1NBYB 1J8HA 1CTOA 1XGPA 5J12C 3TZVA 3QDMA 3HLAA 2CPCA 3CPLA 4YAQB 3VG9C 5I1EL 2L0DA 1T1YA 3C2SA 1KJMB 1U92B 5HVHC 1KG0B 4FQLL 2YHGA 3P30L 4UUJB 4L29B 4QRRD 2EDXA 3G5ZB 3MV7E 1CLZH 3H3PH 1E4KC 5EIVA 2X1OA 3I50L 1G6RL 3KYKH 5C0RL 3H9HB 2P8MB 3R1GH 2A83B 2EYTB 2GJ6B 5I1HL 5D6DC 3T0BA 4WV1A 1DBKL 2AJXH 1IEBB 1R5VA 1RI8A 3EOTH 2YD7A 4P23D 1GRWA 1VADA 4M1DH 4R8WH 4NP4H 1E28B 3S7GA 3U0PB 1TTFA 3N85H 2VLME 5EBWB 2KPNA 3SGKA 3HMXA 3VFSA 5TFSL 4H1LH 3SDCD 1JV5A 5JDJA 3C8KA 1A7NH 3ZYJA 5HHME 1J0KA 3EDDA 4UUJA 5D1ZC 3TIDA 2CJUH 1DQLL 4OIAA 5CJXA 3CVHB 4K23H 4L1DA 2IF7A 4MA7L 5B4MD 4DKFL 4YHLL 3BGFC 3HKFA 1XF5A 2E9BA 3CDGB 3IF1B 3NCBB 3C09B 1A14L 3PV7A 1P4IH 1M7DB 3D18A 1RUAL 4BQ6A 1D6VH 5E8EA 4WI8A 3H9HA 4LNRA 4RGND 2GJ6A 2OZ4A 2EIDA 4FQQA 5DSCA 3S37L 1TETH 3NACH 1ADQA 2G9HB 1LE9B 4G8FB 2MJWA 2FECL 4L8SA 4UTAH 2XKNB 2BRRH 3AREA 4M7LT 1E28A 5GRUL 1QSFA 3U0PA 2CMRL 1DN0B 3QIWB 4RQQA 3PHSA 1BAFL 4XB7A 1K6QL 3MUJA 2RBLA 4HS3A 4HFWA 4FQIH 3HNTH 5HHOE 2ORBH 3MRNB 2DYPD 5HXMA 1ED3B 2EICA 4CJ0A 1PX3A 1G84A 4IDJH 2AP2A 1T3FA 4FQ1H 3CDGA 3IF1A 3U9UB 4XNYH 4CL7A 5I1DA 1Q94B 1JHTA 2DJSA 5MERA 1MJ8L 2CKBH 2AJUL 1QRNE 2VIRB 1QLFB 1G7HB 4QRPD 3NCCB 5IBTH 3ARDA 3T8XA 4G42B 3C2AL 5F71A 2JB5L 5EU3B 3QT2A 1XGUA 5DT1H 1MWAH 1AXTL 4UV7L 4HAGA 1RURH 4WFHE 5F3BB 3QDGE 5D7LB 5JOPD 1DN0A 3LS5L 3QIWA 4NT6A 4RZCB 4Z7WB 4KXZH 3GB7A 4L3AA 4YDLC 5LAXB 4JGJA 4F33A 2NLJA 4LOUC 1OOAA 1T1WB 3CMGA 4I13B 4Y1AD 2IFFL 1AO7E 1FYTD 1XF4B 4HIIB 2EH8H 5GRVL 2IALB 5TE4L 5EIQA 4XI5D 3MGTB 4PTTA 5JOFA 4UIMB 1Q94A 2X4SB 2EE9A 1GGIH 2BSED 4W70A 2OL3B 1L7IH 5DJYA 2VIRA 4X6BB 1QLFA 5F1SA 1CTNA 4K94L 2F19H 4N0YL 4PG9B 1T66D 1LO4L 3LEVH 4G6FD 4LLMB 1J0HA 1RUQH 3AM8C 4JDVA 2R69H 1N4XL 2ENSA 3BT2H 5JO5B 5BRZB 4HUUA 4NZDA 3V0WH 3OBAA 5F3BA 3QIUB 4OIIH 4L4VB 2XTJB 4RZCA 1V3JA 4V1DB 5LAXA 3IDJB 4WWKD 1EVUA 2ZG2A 3BZDA 3O3UN 4OCXH 3JVGA 4R97C 4D9QD 3E0GA 4JPVH 1JWSB 4RAUA 2CRIA 1L9MA 2HA1A 4WW1A 3U36A 4C59B 1TJGL 4S1SH 1XF4A 4HIIA 5K9QI 4NQDD 3P9MA 1UA6L 1KB5L 1X5AA 2FIKB 3BJ91 5GISH 2B1AL 3O0RH 5EBMA 4RWYH 3AUVA 3QIBD 3V0AC 3X12B 4A2LA 3VXUB 1KACB 1L0QA 1OAQH 1KCSL 4R7DB 3MJ9H 2C5DC 3VFGH 3ZYZA 2OL3A 4U1MB 5IB4B 4JCLA 4XPAL 4IMKA 1MIMH 4PG2C 1IAIL 4Q9QH 2VO5A 4ZNCD 4JFPB 4PG9A 1U95B 5I6XB 2BNQE 4JB9H 1JWMA 2Z92B 5GHWH 3VGGA 3SDYH 3NMEA 1E6OL 5BRZA 3L3KB 3DWTA 5CMAB 4EQ3A 3QIUA 4NWUH 1H0DA 1MHHB 5J13B 1UH2A 3IDJA 1JGEA 2W07A 1TQCB 2P44B 3KYOB 3KPLA 1JWSA 4O5LL 4TUJB 3BFOA 1CFSB 3C08L 4NQXA 5JXAL 1H3PL 2DTSA 3LKNB 4ODSL 4X9BA 4NKIL 4Y5XB 3KXFB 2X2YA 3MV7B 3RWHB 3S96A 4DGYL 1S9VB 1VFMA 3NABL 2E6PA 4K71C 3X12A 4ODTH 4XNQB 3VXUA 4U6XA 2FWOB 3B2VH 3QZWA 5E8OA 3FO2B 2XY1A 4HS8L 4P4KB 3RZCD 4LSPL 5JIPA 1R3LA 1T83A 3VFNB 3VRIB 4H1LA 5DVMA 3RBSA 2BXZA 3DMMB 3O9WB 3UYRL 1JGUH 4U6VH 2NW3A 2BC4B 2ILLA 1PY4A 4NN5B 3SGEH 1DSFH 3REWB 3VFVB 5CMAA 5DRNA 4O2CB 4DVRL 4X7CC 4IMLB 4IOSD 1U8HB 5D8JH 3LQZB 3NVQA 4OFYA 3D9AL 5DUBB 1I4FB 3T0DA 4POUB 3QEQE 4YFEA 1JTOA 2VDPL 3W82A 1CF8L 2DLEA 4UAOC 3K0WA 1WZLA 3P0VL 1CLYH 4GRWF 5I17B 3WV0A 1D5XB 5L0QC 1TJHH 2HYMA 5I8KL 4W6XB 3GMOA 4X0KA 3KXFA 2Q20A 2W9EL 5SX4I 3OB8A 4NOBA 3RQ3A 2VDOH 4WHDA 2G5RA 4ZS6C 3RUGF 4WO4B 4XPTH 1KFAL 2XI9A 1ERNA 4FQCH 3RJQB 4K7PH 3FO2A 1K4CB 4ZFFB 2LV4A 4N90D 5FV1L 4CW1A 5CGTA 5DURB 3IKCA 1MVUB 1M05B 3O9WA 4R7NB 4U1NA 1UJ3C 3GBML 1QSEB 2BC4A 4JG1H 2B5IB 2R0WH 5FYLH 1J8HD 2IANE 1WFOA 2QADD 3D69B 3EDEA 3TZVD 5KN5B 1YEKL 3T2PA 4IMLA 5E2TL 1U8HA 4ZS7L 4GRWE 1M71B 1W72L 3VGHA 5DUBA 3ULVD 4O2FB 1JL8A 1R3IH 1CGVA 3BW9A 1A4KB 5BO1H 5DD0H 5HHOB 4DK6A 4BKLB 2CKBA 1U8KB 1UQSA 4I18B 5I17A 1D5XA 2JIXD 3RUGE 3LN4B 4WTWA 1WBYA 5GSRA 2EDKA 3FHAA 4PLJD 5DHVB 1XGYL 1MRCL 1MRFH 2NY4D 1UWGL 3RTQC 2QQKL 3MACH 4FN0A 4G80B 2AQ3A 4OD3L 1WGOA 1AHWA 2YSSB 4K8RC 2AJSH 3BWAB 4HWUA 1QRNB 1K4CA 1KEGL 3FT4A 1I9RL 4RGOH 4JRWA 1MF2H 1JPTH 2PCPB 3GGWB 3OHXB 3RWDB 2C4XA 4R7NA 3IAQA 1UC6A 5IV2A 1QSEA 3EO9L 1CVRA 1Q9LA 2Z8SA 3D69A 3PGFL 5HI3D 1MY7A 1U93A 3VG0H 5KN5A 4I0CC 3TBWA 3WIIH 3F6IA 5F7MC 2VRAA 4UU9B 4O2FA 3IU3B 1WBZB 1OSZB 1U8KA 1D9KC 2WK2A 5DC4B 1KC5H 1UXSA 4PB0H 1AO7B 4X7DC 2DQFA 3LN4A 4LASH 3VDCA 1T89C 3CFDB 3KPOB 1VFBB 3TNMA 2FJGB 2R1YA 4DGVH 5DA0B 1EHLH 1DUYA 2YSSA 3JUYA 5HGDB 4AEHL 4KUZL 2H3NB 4YDLB 4BFIB 1G9NH 4ZNEE 3Q3GA 2WWMD 4UV4H 4KZDL 1YEHH 4LLQB 2PCPA 3B83A 3EO1A 1N8ZB 4OZFB 5HYEA 5DD6A 4K9EH 3QXVA 4JVPA 1PY9A 4A2MA 4GXUN 2XRAL 1ZAGA 5BQ7B 4YGAB 5IMOB 5FM4A 2R2BB 3SGJC 1EDQA 3QXUA 2SEBB 1JPST 4UU9A 2IPTH 1EH9A 4X98A 1WBZA 3ZE2F 3I02B 2YK1L 3G9AB 4WI7A 2DRUA 4PTUB 4U3HA 1KPRB 1IC5L 3BEVA 3KS0J 4HIHA 2EXYD 1OCWH 4WW2B 3CFDA 4HGWB 3BRDA 4E0RA 3V5DB 3U0WL 3HI1B 2RJMA 5HGDA 2DAVA 4MNHB 2H3NA 4UQ2A 1KJVA 3SQOH 1G7QA 5I1IL 3BDBA 2G5BB 1CK0H 5JW5A 3VWJC 2EO1A 3EYSL 4OFKA 1OPGH 3RY6A 3PWPB 2GT9B 2D4FA 3QULB 2ESVE 4BQCA 5T1DH 4I0PB 2MHAA 1NBVL 3S5LA 4XCNA 1KTDA 3ZKXC 1E4XI 4F7CA 3WIHL 3ZE2E 1K5NA 2PW1B 4IS6A 5IMOA 3AB0B 1R6VA 4PUBL 4JFDA 2SEBA 4PGJA 3GKZA 3CH8A 3QCTL 3BDYL 1U8IB 3LS4L 3I02A 2EXWD 4JG0H 2FDBP 4PTUA 4OD1H 4KPHH 3T4YA 4LRIA 5HHPA 1YZZA 4OTXH 4WW2A 1UB5B 1HOCA 1A1MB 4J1UA 3HMWL 4Q6IB 4D9RE 2C1OB 4OFDA 2G5BA 5JDSA 1KN4L 1FO0B 5DUPH 1HHIA 1V3MA 3H3BC 3PWPA 4QTIL 4HW6A 3QULA 4M4RA 3KYMB 1I9JH 2FX7L 1I8LA 5D7LD 4HXBH 5EC1A 5F9AC 4HUWB 3L7FB 3QJHB 3GK8H 2BNRE 5BV7L 1HI6B 2E7CA 3UTZA 4KZEL 3QEQB 3TN0B 3B9EA 4AENB 1U8IA 4JFOB 1WSST 2CLVB 1MOEA 3R4DA 2YMXL 1D6EA 1S9XB 5JHDE 4HIJA 4LQFL 4PRIE 4EBQH 1HH9A 1T7WA 1U3HA 5HGBA 3MJ7B 5FDWB 3AY4A 4CGTA 3DETD 1CG9B 3NA9L 1A1MA 4MNGE 3MRFB 3ARTA 4Q6IA 5E2UL 5FYJL 1OF2B 5MEQA 4M7KH 4MVBD 3RKDC 1I7UA 1YJDL 2VDML 1NCTA 4XCFL 1FO0A 3ARBB 3I6LE 2BVPB 3QWRA 5JA8B 3PV6B 3QUYC 4JAMB 4LRNH 5BRZD 5T3ZL 4DTGH 1MAML 2C4FU 2R56H 4B41A 4BJLA 3QIUD 4L4VD 5IW1A 2XTJD 2WV3A 4WRLA 4ZPTA 6FABL 1GPOH 2GITB 4V1DD 4HWBL 5F9OL 4DZ8A 1ZK9A 1K85A 1ZHNA 1IM3B 4YNYB 3MGOB 1QFWM 5D1XB 3ECBB 5GGVL 5F7YC 1ZLWH 1OGTA 35C8H 4JFOA 2G60L 5C07E 3FCTA 3GBLA 2XIDA 1E6JH 3S3SA 1UJ3B 3BUTA 1W0YT 3TO4B 3UJIH 3VI3F 1RK0B 3EYFB 2W0FA 5D4QA 4GKZB 4NM4H 4ENEC 1CG9A 2QQQA 1Q0YH 1IKFL 4Y4KC 4GAJL 4NC2B 3U9PL 1OF2A 3BJLA 1KLGA 4YQXH 4P2RB 4EOWH 3IYLW 1OP3H 3ARBA 3ARGB 4PJ5A 2DM4A 2FD6L 1IM9B 1JWUB 4M7LL 5CEXA 5CKAA 1J8KA 4ZTOL 2R0LL 2OTUB 2GK0A 1RIVL 4OFYD 2DS4A 4LEXH 4WCYH 3QQ9C 4AEIH 3C9NA 4KDVA 3SO5A 4CVWA 3W2DH 3ECBA 4O58L 3VI3E 3W0WB 3Q1SH 4O51B 1NGWA 5EU6A 1FL6B 2X09A 3MPCA 3KXFD 3MV7D 4X99B 4MXQD 4L4TE 1RHHA 5TE6H 3T0VA 3EYFA 3LKSB 2R4SL 4NKDB 1EHAA 4F3FA 1KELH 2ATKA 1MCJA 4P4KD 2ED9A 3NFSL 4JM2F 4RFOL 5EZOL 5F9JA 1ZA3B 3Q48A 1S9WA 2PTTA 3O9WD 3DMMD 3JWOC 1JI2A 3JWDC 4LVNC 1FNEB 2D9QB 1X6NA 3ARGA 4BZ2L 3U30B 4Y16C 4OB5L 1L9NA 1P84K 1IM9A 2FECI 3SO3C 4U3XA 1QFUH 4JM2C 2Y6SC 3LHPL 1WT5C 3I85A 3IDMA 3PGCB 1S5IH 4M1CD 4BZ1L 3H9ZA 1GGBH 2VR9A 5IHUL 1FORH 1KCUL 1OAYH 2C1PB 4P49A 3W0WA 4YHKH 1IC1A 5DVKA 1BQHB 1H3UA 4PGDA 4I1NB 2WSKA 1AD0B 1NAMH 4BELD 4QHKI 4WO4D 5C0EB 5C08E 4E41B 1RMFL 4EI5C 4DFIA 2O93L 3E8UL 4V2CB 5DURD 1ZA3A 5D70H 3NCYS 3QA3B 1QSED 1FNEA 1IAKA 3LMJL 3I6GB 3QI9B 1NMBH 4PJHB 3HPJA 1ND0A 2NY1C 2Y9RT 5T1MB 3MRIB 2ID5A 1TLKA 4D94A 3RWEB 1R3JB 4ONOA 3K2UL 5MENE 2BDNH 1RIHH 3MBEA 4Z8FL 4KK5D 1HSAA 5HHOD 4NYLB 1IQWL 1QO3A 4PJDA 5DZOA 2DTMH 1UM4L 15C8H 1QD0A 2F53A 4BFEA 4GSDL 3VWJB 1S9YB 2QSCH 3DNKA 3CMOL 5JNYA 4GAFB 1CE6B 3WNNA 2J5LC 3QHTC 4NCC2 1AD0A 3E6HB 3TWCH 1I7ZB 5I19H 2Y06H 1MCHA 1QRND 2XICA 3PXJA 3KPQB 1TZHB 3BXNB 5HHQA 1ORQA 1M6OA 4N0UE 1VA9A 1TZIB 2APBA 3QI9A 3RIFK 4YDKL 3EJYD 2BY0A 4F80A 4WFHD 4EN3A 2QTEA 3PUCA 4Q0XH 1EBPA 1W0VB 1T2JA 3RWEA 4HV8B 3MOBL 5C0BE 2HFGL 4Z7QF 3QDHA 1AXIB 2J6EL 5MI0B 2GSGA 2HFEA 4NYLA 3OKLA 4RSVA 3F7VA 1P7QB 4PP1D 4OFIA 3KHOA 3DTXB 3FT3B 4FQLH 1AO7D 3ZHLA 5MHSE 1X5JA 4X80L 3TLRA 4APQB 2L7UA 4PJGE 4W68A 1BVLA 2JELL 4ZTPH 2E8YA 2E9WA 1JTPA 3UO1H 1CE6A 1IGYB 2P5EE 5I2IB 3MLUL 4HLZG 4NO2B 1MCEA 4GAYB 3E6HA 3V7AG 4PRBB 3QHZL 1IMHC 4X6CA 1NBZB 4MNGB 5FB8B 3KPQA 2D7PA 1IAII 3L3IB 4QXUL 4RISL 4LPTA 1LO2H 2ZG3A 3P73B 3N50A 4IHOA 1DBKH 4EDXA 1FZOA 1INDL 2ZUTA 1YUHB 5T1LB 5IMLA 4L4JA 1W0VA 5E8NB 1PG7X 1VACA 5DMKB 5I1JH 2VABB 1HEZA 4NRYB 3TA3C 3INUH 4WUUB 4XMKH 1JK8B 4RDQG 2Q86A 3RJDA 2F15A 1P7QA 3U7WH 3NTCL 4CDHA 5GRXG 5AD0A 3DTXA 3FT3A 3BPCB 1KCKA 3GSOB 4D9LH 4NZRH 3VGFA 3QUKB 4XVUC 5GRVK 1IGYA 2YD5A 3QUYB 5I2IA 4MNQE 4RIRB 4NO2A 1MNUH 5GZOD 4PRBA 4N0CC 1WF5A 1RUAH 3WN5C 5KANG 2VAJA 2R29L 3EUUA 3MUZ1 4NJAL 3P73A 4J3VA 1A7BA 4MJ5B 4OM1L 4I0PD 4GRLB 2OR9L 3WFCL 3LKRB 3QO0B 4LU5H 5GRUH 4K7FA 1YEJL 5E8NA 1FAIL 4Z95H 4Z6AT 2W38A 3PHOB 4NRYA 5E8PB 2F74A 3VJ6B 3KPNB 5GZND 3VD7A 4WUUA 2A74B 5AZ2L 3W11D 4ZQKA 4I8DA 1YNLL 1IJ9A 1GHFH 3EIFA 4XTRC 4G6AD 3EYQD 4OCSL 2PYEE 3ZE1F 2VUYA 2W65A 3BZFA 2A73B 1CCZA 1CFTA 4NO3A 4QHUA 2EYSB 5AZEL 1I1FA 4RIRA 4F57H 5FYJU 4B7IA 4YUEL 1DVFA 3I3DA 1KEMH 3T3PF 1IARB 2FGWL 2XN9E 2RQ8A 5AUMA 4BSWA 2AJUH 1QHOA 5HYSG 4DN4H 2ZUUA 3HE7C 5EIIB 2BVQA 5DRWB 3AS2A 4IRJC 3C60C 3BKML 3MRPB 4JFYB 5FV2A 2J4WL 3O8XB 2DN7A 3MOAL 4MJ5A 1UZ6F 3I84A 4UV7H 3RVVC 1C12A 1LGVA 1OAZL 3QO0A 3NPSC 4MCYB 3R0NA 4U1LB 3LS5H 3PHOA 1RFDH 5HHNA 3VJ6A 3RGVB 3QEQD 3TN0D 1NAMA 2A74A 4OCNC 3MNZA 1T6VN 2NXYC 3MRMB 3QBTB 1ROWA 1BHGA 2XA8L 3RNKA 2Y7QB 1C16B 2DLFH 4UB0L 3SDAC 2XWTB 2R2CA 3VMPA 2A73A 3O4LB 2EYSA 3GSNB 3QJFA 3SO3B 3QDJE 5TJWK 2IWGA 3K2MC 4KJQC 2Y4SA 1FVDB 1ZLVH 5A3ID 3I3EA 1U0QA 3S35L 5I1CL 1G9ML 4HLZH 4QWWD 5C0DB 1UZ6E 4PJEF 3MXVL 5FK9A 1AY1H 5DRWA 4BYHA 3ARBD 3IJYA 2AERT 4N0YH 4LLAA 1YY9C 3DVIA 1LO4H 3O8XA 4JM4H 3UEZA 2X4TB 3ALXA 3MLPA 4P5TC 1YMMB 1NBQA 1SJEB 4CVXA 1U8PA 1QBML 4L3CA 3OR6B 1XCTA 4KK9C 4P4RB 4MHHG 4DFHA 1KTLB 4QXTA 5FKPA 5IKCA 4U1LA 4ZS6D 3A6CL 3RGVA 1G6RB 3EGSB 1RZGB 3BP5A 5D1XD 4M43L 4PJXF 1Y0LB 4OV5B 2UWEA 4G5ZL 4RBPK 1QZ1A 3MRMA 4UT6L 4ELKB 4Y4HC 4OQTL 5GSVA 1DBMH 4P9HC 3SCMC 2JE8A 5GS3A 1TIUA 2ADGB 1C16A 5DMGC 3TO4D 3TBVA 4ALAL 1I3UA 1O0VA 3LRSA 4OLZH 1TZGH 1Q1JL 4PJEE 3UBXI 3CFCH 1KB5H 3QUMH 4PJ9B 3BZEB 2Z35B 2P47B 3OZ9H 1FVDA 4OI9A 1FVEA 4XVTL 1SYSB 1U6AL 4FQXC 1NCDL 5D5MF 2X9YA 4P2RD 1RUKH 4Y2DB 3VFPA 1UB6B 3NGBB 1YMMA 4K3DL 1IM9D 4K55A 4KKAC 4M9OA 3UTSE 4PJXE 2HJFB 5J7CC 4NQSB 2GIYA 1KTLA 1ZMYA 5FYKU 2GFBB 4KHXH 1DFBL 2H1PL 1G6RA 3N1PC 3W0WD 4YXLL 3FN0H 3P9LB 1Y0LA 4OV5A 1SJHB 1FCCA 3RL2A 1H3PH 3X3GH 3TM6A 5HI5C 3JBG7 4HG4J 2ICES 4NQCB 3EDKA 4PJGB 1G7PA 1RU9L 4ODHH 3EZ8A 4NZUL 5DYOB 2C3VB 5AG8A 5CBEA 1IRAY 2HTLC 4WEMB 2P5EB 4PRPE 3NABH 3BZEA 1DANT 4I2XB 1SYSA 3LY6A 4MCZA 2Z4QB 4GQ9L 3SN6N 4R4BB 3OKNA 4TRPH 4RA0C 2F54E 3LRGA 1UB6A 2V5SA 4PR5A 1BREA 1MHPH 4XPGH 1YEIL 2HJFA 5TF0A 2GFBA 3TVMB 3D9AH 4G43A 2FR4B 5I15H 3QUZC 1CF8H 5IVXA 2WBJC 2YD4A 2ZZUT 1FNGB 4FFWC 4HKZA 4S0SD 3R8BB 1IGTB 3FN9A 4NQCA 1IE5A 5I8KH 5SV3A 3V5HB 1HKFA 1DZBA 2YC1A 3TJHD 1FGNH 3CSYA 4Q9BA 5IBUB 1EFXB 3DURA 3I9GL 3CLFH 4QGYA 4E41D 5HDOA 3FAXA 3EJZC 3MLZH 5CJ8A 1AXSB 1J12A 2I5YL 4QTHA 4I2XA 1QHPA 2Z4QA 1ZHBB 4C4KT 1PYWA 4OGAC 3GSRB 3LKQA 6CGTA 1FLRH 3QI9D 2DQHH 3P0YL 4GG8B 4JO1L 3K8KA 2XKSA 1AGEB 3ETBF 3RWCA 4KY1L 4QCIB 5TGBB 4MZ3A 1AR1D 1T21B 2AXGB 1CDJA 1AI1H 1ZGLM 5E2TH 1VESA 1W72H 4MGXA 3TVMA 2FR4A 1L7TL 4OM0L 2KDGA 3OV6A 1NEZB 2AEPL 3WN5B 3VWJD 1TVDA 1BLNB 2AXHA 3OJVC 3HE6B 2BSTB 1IGTA 5BW7C 2OSLB 3GIZL 3V5HA 4L9DA 3DV6A 4XP6L 5I8OL 1EFXA 4ETYA 2AJZB 1MRCH 1UWGH 2QQKH 5DZNA 3ZYOA 2BY2A 5E03A 4D9RD 5L8KB 2XN9B 3GM0A 3VWKB 1LEIB 1ZHBA 2K7QA 4Z7UA 3BZ4B 3FONB 1OM3L 1TDQA 1YEDA 2D03H 4KUCD 4GG8A 4L8DA 5DFVD 5C0CE 4TNVF 5IF0A 1Q9KA 5BJTB 1JJUA 4AMKL 4G7VL 5EC2B 5HYJA 4QCIA 1J18A 4MJIB 3B5GA 2E8ZA 2VDQH 2AXGA 2FEEL 1BVKB 4TNVK 2JLLA 3OXRB 3MRHB 1QTYT 4BUHA 1FGVH 3H9SA 3ILQC 4TPRL 1BFSA 1P7QD 5ICXA 3MRDB 3HFMH 4LKXB 4APQD 3HE6A 2OSLA 3PABB 3BISA 4NZTL 4TSBL 1R5WB 3SPVB 2NXZC 4Y2OA 3D6GA 2H6PA 3TP4A 3QDJB 4OZIB 3ULUF 5E2VL 3VWKA 1U58A 3DVGA 4KUZH 1LEIA 1CBVL 1J0IA 3KLDA 5IUSA 4ONHB 3I6LD 2VXQL 3ULUC 2ZSVB 5BJTA 5T1LD 1EVTC 2VXSH 2MMXA 4S11A 4ZD3L 1S7UB 5EOTB 3D85B 3F5WB 2EEBA 1J7VR 1BX2A 2D0FA 4WUUD 3RWFA 1KB5A 5I9QC 3QUMA 3KLHD 2MPAL 5J56B 3HTLX 3RKDD 3MRDA 4GUPB 4U0RB 4P3CL 3L5WA 4XP9L 1HQ4B 2RR3A 4ORGA 1P53A 1N26A 1MCSA 1F2QA 4AEFA 4HC1H 3GI8L 3QUYD 1S7RA 3ULUE 4JRYE 5DI8A 1KLFA 5D7SL 2ERJB 4YHOL 2BSRB 1HDMA 2CH8A 5KSBF 1CGSH 4XH2B 2Q8BL 3DI2B 4GXVH 5JORB 2XZCH 4OZIA 1QFWI 1V3LA 3GSUB 4XNXH 4NKOB 1RZJC 4PJIF 4EUPB 2YUVA 3OPZH 5DJCA 3QB7C 3T2OA 1NL0L 4GRLD 3S37X 3MQIA 5A2LH 2KL6A 2CRZA 4QXGL 4U1IB 4WFEE 2NR6C 4NNYB 1S7UA 3WIHH 4PJXB 3VXOA 3F5WA 4U6HB 4X9IA 3IDNB 5F1NA 1FDLL 5BVPL 3LD8C 2X70A 3KAAA 4QHKJ 3LS4H 4XP1L 5KSBE 2VLJB 1OTSD 2GTWB 4Z5RA 1IGFL 4XBPB 1D7FA 5K9QG 5HYSA 1PKQA 4X9HA 4AH2A 3S88L 2ZNXA 4XH2A 3CFKA 4PRPB 2RHEA 3ZL4L 2X05A 5J6GA 4NKOA 3IETA 4EUPA 4KDTA 4BK4A 3O8XD 5M95B 1QVOB 4NJ9L 4UZGA 4JFFB 5C0AE 2P24B 3X11B 4PFEA 2HH0H 4HX1B 4JPKH 3C5JB 5D2LF 5D7JC 1Q9OB 1INQB 1M7XA 2XKUA 4QT5B 4U1SB 4ZOAA 2A1WL 4JKMA 4NNYA 2EDQA 2J8OA 1MELA 1HXMA 5E00B 1UM6L 5LQBL 2ZCKH 1FZMB 1HHJB 1U8OA 3IDNA 3MMEB 4LGRB 5CGYC 4KZEH 5GIRA 1QBLH 5LWYH 2FZ3A 1F58H 2EC9T 3WJLC 1FPTH 5EA0L 1YY8A 5DHXB 4TUOA 4LNVA 3SY0A 4C4KO 2VLJA 1A9BB 1NDGA 3O4LD 4XBPA 5JQ6L 1B4JL 4QLRA 3MV9B 4LQFH 2F58H 2HG5B 3VXRE 1G7IB 2Y6SD 4G6MH 4LCCC 3WS6C 4NIKB 2JJSC 3DI3B 3NA9H 1GIGL 5DR5H 5JPMA 2UV3A 4M48L 4PS4L 3ZO0A 3QHFH 5D2LE 4XXCC 3A6BH 4WUKH 1W72A 3HS0B 2YPLB 4HF5L 4RMSA 4JFFA 4NNPH 3X11A 5DC9B 1GGUA 1HIML 3PNWA 4HX1A 4R4NC 2UYLA 5DVNA 2NTSP 1INQA 1JZ6A 2P7TB 3O6FC 2IH3B 1P2CB 5IMKA 2QQLH 4ZDHA 1XCQA 5E00A 1RJZB 1NFDB 4UOW1 2FYYB 1F4WH 3HG1E 2M1KA 1NCWH 5GGVH 1E4KA 5ESVB 2PF6A 4KKCC 4YBLB 1A1OA 2G60H 4YHPB 2IAMB 3WUZA 2R0ZL 4UBDD 3MXWL 5KS9E 3C6LB 1ZLUH 3RA7H 3VRLE 4PJ9D 4F58H 4P9ML 1Y6NR 2MOVA 3OF6A 2YWZA 1NANI 5D6DA 5ABDE 5LBSH 1CXIA 5H37G 1FN4B 3ROOB 3G5YA 3HPLA 5BS0A 4E9LA 5F7FA 4GBXC 3MCG1 3RIAF 5F3HA 2GTZA 4Z0XB 1KBGH 2FEDD 2IH1A 3WKNA 4OV6F 4Y2DD 1BOYA 3JV4A 2ARWA 2DQDL 3IDXL 4M93B 1INEL 1BQHG 1M7IA 3LN9A 4NM8L