1F4XL

Crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
210
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGTVTTSNYANWVQEKPDHLFTGLIGATNNRAAGVPVRFSGSLIGGKAALTITGAQTEDEAIYFCALWYSGHWVFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTNPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY S-20-4, FAB FRAGMENT, LIGHT CHAIN
publication title Crystal structure of an anti-carbohydrate antibody directed against Vibrio cholerae O1 in complex with antigen: molecular basis for serotype specificity.
pubmed doi rcsb
total genus 48
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4xL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4xL01
3CU7A 4JFDE 3M8OL 3NZHL 4PJHF 1KXQE 3QIBD 5GHWH 3V7AG 4Q9RH 3BP7B 2MOVA 2AXFB 1JIBA 4NOFA 2PCPB 3C2AH 3HE7A 1L7TL 3BVNA 4K8RD 1Q38A 2FO4B 3RWHB 1MJUL 2DRUA 3X3FL 4RWHA 5L88L 4NM8H 5ILTH 1QP1A 1Q9KA 2YD4A 4X83A 1YN6B 4NZTL 1OGAE 3ARTA 5BJTA 1MRCH 2JK5B 3VXSB 3QUKB 5EULV 1DBJL 3T2NL 5T3XE 5FYLD 1BAFL 1FIEA 1X5IA 3HMWL 5IB5A 4JRYA 3EDEA 4PJAA 3MR9A 4YR6B 2XA8H 4QHNB 5E8EB 5FOBA 5EIIA 3O9WD 4ZAKC 3VFRB 4M1DL 4TNWK 3U2SB 2A6JA 3FQXB 4PP1C 3UPRA 1PKQE 2WWKT 2R2EB 4I77H 1IM9B 2Z92A 3F12A 5C9KA 5GJTH 2V17H 1RUAH 1XIWC 4HUKB 5ERWB 3E8UH 4JZOA 4F33A 5T3ZD 3IDYB 1DQJA 4EN3B 3FT2A 4YHKH 5LG1A 3P0VL 3T0EA 5IP4A 1U3HC 4IRSB 2Q7YA 4KZEH 2J5LC 3IFNH 2XTLA 2GHWB 1BD2A 2Z93B 4MDJB 4PBWD 3QPQD 1RU9L 2DN7A 3Q6GH 1YA5A 5CBAB 2Q86B 4F9PC 1IAKB 3KPSE 4PJXF 4JQIL 2D0GA 3VE0B 3O2DL 5C07E 4OCWL 4KU1A 4EN3D 2VAAA 4IIQC 1Q1JL 3T4YA 4UIKH 2CO6B 5EU6D 1BGXH 4QYOB 2GTZA 3MSPA 2R0LL 3K8KA 1G7LB 1S7WA 3U7WH 2BNUA 3WLWD 2AK4B 4GBXD 2EDTA 1VEPA 4OZ4B 5KSVB 4M6NL 1KN4H 1P6AB 4ZFFB 1IILE 3BZEB 3TIEB 3FN0L 3GMRA 5C6TH 1C08A 1FPTL 1RUQH 4YX2H 3MBXL 5GS1C 1C16A 3KLAA 2X1QA 4QRTB 3O3DB 1MRDH 2X4OA 3VRJB 3CAFA 1T22A 1OTUC 3P30H 5FGCB 2NW2A 3D3VD 3V0VB 3JV6B 2VQTA 4BH7B 5BVPL 5DRWA 3U9PH 4P23D 2BNRB 1RJLA 2AK4D 2CR6A 3G5ZA 4X5WA 1SVCP 3QUMA 4OAWA 4RMTA 4EVNA 1U8QA 4P2RE 3BQUB 3WDHA 4P2YA 1WEJH 4OUUB 5A1AA 2FZ3A 1OQXA 1P7QB 2C4FU 5I8OL 1CFSA 1NMCB 1S7QB 1EO5A 3O6LH 1KEGL 1SJHB 1PX4A 5FV2A 4JY4A 1E0OB 1EEUA 1YEJL 4I9WD 4KY1H 4GMTH 4L4VB 2IMNA 3HI5H 4WHCA 4ZS7H 2NX5D 4P9HL 1MHPH 4JDTL 3UDWC 4G8GA 3BHBB 3QDMD 5DR5L 5GZND 4P4KD 1I9RH 3LD8B 5CGMA 4OF0A 3R0MA 4Q0XL 3BQUD 4DFIA 2PW1B 4ZTOL 2VQUA 1KJVA 3T3MF 3NCYS 3V6OE 3HZVB 5L7XH 3VXNB 1D5MA 5FCUL 5TE7H 3G6JF 2HKHH 3RY5A 3A6CL 5F70A 3VXMB 3EOAA 3O6FC 2HJLA 4LCCC 2ZOLA 5EUKB 1FYTB 2FIKA 3PWPA 1ZVYA 3OZ9L 3S34L 3MLSL 3NA9H 2PR4L 4LCUA 3VDAA 1AI1L 4EOWH 2P5WB 4WFED 6CGTA 5ID0A 3KYKH 1QVOB 3VXMD 4TSBL 3W9DB 3S3SA 2ATKA 3SJVB 1AR1D 2APBA 3MJGX 4P57B 5HDQL 3SDAC 3VFTB 4F8QA 4NJAH 1ZT1B 2BOBB 3DRTA 3QQ3B 4GKZB 4U2YA 4YO0B 3DO3A 1FYTD 4JFDA 1VGKB 5DO2C 3ZKND 1LE9B 4PJ8A 4NQVA 2F53D 4MD4B 1F4XH 1T66D 4JLRA 3T08A 3JVGA 1EAPA 1BFSA 1JF1A 1NGWA 4PJ9C 4KPHL 3PHOA 5J13B 4AT6A 5GGVH 4HUVB 2YHGA 3P4OA 4Z0XB 5FA4B 4NP4H 4HK0B 4OV6F 2W9EL 3L7EB 5FECA 2D4FA 3ZKSD 3STBA 2V5TA 4LQ1A 4C58B 2AERT 4LAJH 2QHRH 4DEPB 2J2ZA 4N8PA 4YWGH 3F7VB 1IC5L 2PTTB 4JO2L 1CTOA 1X5LA 4GRMB 2QSCH 4P2QD 1I85C 4CMMA 1CFQB 5KW9L 5T1MB 2D9QB 3ET9F 1S7RB 3B6SA 4XXCC 4Y5XB 5D5MF 4Y2DA 1WSST 3WN5B 3L5XH 4GO6B 2P43B 4XWOC 4NOBA 1NCUA 1A7RL 4PRDA 4K7PH 3M8OH 3NZHH 5KVMC 1EO8L 5KS9E 5I0ZA 3F6LA 4F80A 3HNVL 4F7CA 3GSOB 4TUKL 4LAQL 1GC1C 4LGPB 1MFDL 2BNQE 3I6KA 1CXHA 4F58L 5I8KH 3ULVF 1MJUH 5C09D 5EZOL 1G7IA 1IGML 3BEVB 3FAWA 1P4LA 5T1LD 1JYNA 3RX8A 2AV1B 4X9FA 2QQLL 2R56H 5LAXA 4G3YH 1DBJH 3T2NH 2R2BA 4EDXA 3OKKA 1SMAA 4GMSL 3NTCL 4PRIE 3B9KB 4OKVB 3HMWH 7FABL 5DRZB 2X40A 1BF2A 4YDVB 4N5EC 5AZEL 4MVBC 1ZVSB 4N5UA 3QO1B 4LASL 2V2WB 2GITB 1M6OB 4M1DH 3BYYA 2AV7B 5FDYA 3T1FB 3MA7A 3U0PB 3F5WA 3VXUD 4YGVA 1P7KB 1TLKA 2H45A 1D5BB 1NCAL 1GZPA 2AJUL 4L1HA 1DR9A 1MAKA 2VDNL 2YPKB 3BYTA 1QRND 2CMRL 1U42A 4Z7VF 3LPWA 5SWSD 5C0CA 2B1HL 4J3VA 2I9LA 5FUOL 2IBZX 1S7TB 4KKCC 1AP2B 3HAEB 3KPRD 4LNVA 3MCLL 4JN2B 3U6RA 1FVEA 4P46A 4U6HA 5EUOE 3P0VH 2EYSA 1FC1A 1EV2E 3D85B 2FR4B 1IL1A 2UWEE 4I3RL 3TLRA 1RU9H 4PGEB 4ZUSA 3G5XA 3SKOB 4R26L 4W70A 4D0CA 4JKPL 4JQIH 4ZUUA 1ZLWH 3M17A 4JHBA 3WNPA 5CEYA 1LEIA 2LQRA 3O2DH 2WBJB 3ULVC 5GS0H 1Y6KR 4HWBA 1KBGL 3IDNA 2WWMC 4QRPA 1Q1JH 5C0FB 5I1KL 3RWDA 1YEIL 2W59A 2GK0A 2Z0BA 1JVKA 2R0LH 3D85D 1ZA3A 3FOMB 1E28B 3KG5A 5JDJA 2CGRL 5DEFA 3WUWG 3KDMB 2VABA 1PG7W 4M6NH 4A6YH 5BMFL 2YBRA 3FN0H 1FPTH 3MYJA 3MBXH 4LDOB 2WBJD 4U3HA 3DURA 4ZAKB 2FATH 1ZLUH 2JB6B 1P84K 4H1LB 1NCDL 4L9LC 3L1OL 1OP3K 3TO4B 3WKML 3L3JB 4M7KL 5JW5A 5DMGC 3ZYZA 5BVPH 5E6IC 2H2SD 2SEBB 1IAII 2IGFL 1MFEL 4NZDA 5C3LD 1NCBL 3MJ9L 5JOPE 5IMLB 4PJEF 4LBEB 1N59B 5F9WC 4A6YB 4QHKI 2FH6A 4NNPL 5EZJA 1R3LA 1FZMA 5I66A 4ETQB 1MY7A 1KEGH 5HGBB 3EDFA 2R8SL 1KELL 3ECBB 1YEJH 3FTGA 1UVQA 4LOUC 1HNGA 1S9VA 4P9HH 2WW8A 3ZHDA 4KI5D 3WHE0 2Z8RA 3OR7B 5M95B 5IFJA 1H3VA 2NW3B 4DKDC 3OAYK 1PZ5A 2EE6A 2R2CA 5DA0B 2N7BA 4ZTOH 4Y19E 1UKSA 1U3YA 3C6LB 4JKWA 1NGXB 2IPUK 5AYUH 2YZ8A 1X5JA 4QLRA 4E5XA 1HHHB 1S78C 5ESQA 5L8JB 3MRFB 5FCUH 1Q9LB 3FKUS 2FWOA 3M07A 8CGTA 3DPBA 3VGBA 1BLNA 1Q94B 4OZGB 3U46A 3SE9H 3W5MA 4ODXA 5ETUA 1IKNA 3PQYA 2W60A 3QDGB 4QHKJ 3TA3D 2L7UA 3RWCA 3VFNA 1ZS8B 2IANA 4LVOB 4BSJA 1TNMA 1AXSA 5T1KD 1ZK9A 4PGDA 4OCSL 3OZ9H 2BY2A 4HIIA 3QI9B 3QBTB 4HPOL 4ODWB 2PR4H 4WEMB 5CP7A 3ZDZF 1AI1H 5C0RL 2HN7B 3WJLC 4DUVA 3C8DA 3V5DB 4OQ1A 3MRLB 1MAJA 4TSBH 4KRMB 5JNYA 2D2OA 5HDQH 3F65A 4ZYKA 1K9TA 4F7TB 2VISB 1D5ZA 5ENWB 4ESKA 3AM8C 3O11B 4JFEB 2PO6A 5HY9A 3NCBB 4JVUA 4DZBB 1CICD 1XAUA 4WUUE 1N7ML 3P77A 4ELME 3QI9D 2Z4QB 1DFBL 2YD6A 1F00I 4HWUA 1MAMH 1PJ9A 4CADB 3SPVB 1RSFA 4KPHH 1EFXD 1T80A 5DRXA 1BVLB 1K3ZA 3WFEL 4HXBL 5F6IC 5IMOA 4JREC 5GS2D 1INEL 4WU5A 4BFGA 5F93C 3VFWB 4GRWE 3T2QA 4XVSL 4F2MB 4XHJC 5E8NB 4TNWF 1IC5H 4JO2H 5KAQF 4F7EA 5KW9H 1MPAL 4E0RA 1JI2A 4WO4B 1LP9F 4F37K 4G42B 3K8LA 1A7RH 5GZOC 1NDMA 4ZFOA 2LU4A 1EO8H 4LCCB 4FQJL 1F3JA 5I8EB 5C0BB 1YNTB 2DF3A 3OKOA 1MHEA 1N0XL 5D8JH 3HNVH 4TUKH 3WMSA 1MFDH 2MCPL 4F58H 3OL2A 3JWDH 5DURD 1IGMH 5EZOH 1U8IB 4XGZA 2JJSC 1JFQL 1JPGB 2HWZH 2QQLH 4G8EA 1KCVL 1LO3L 4XT1C 2E3VA 5D71L 4GMSH 3NTCH 3UZQA 3MV8E 4JDVB 3DO7B 7FABH 1KJ2L 3DSFH 3SDAB 1MCHA 5DJ8B 3HC4L 5FKPB 5AZEH 3BKJL 4XH2B 3DXAB 1IGTA 4NJ9L 4ONHB 4KQ4H 3QHZL 4G7YL 5DLML 43CAB 1HK6A 4YDIL 1EUUA 3SGDI 3ILPA 5HHMB 5HVWA 3AFLA 3C60C 1NCAH 5FA3B 5L0QB 2AJUH 3FO0L 5F3BB 3OG6B 2Q6WA 1JGDA 4W4OA 1QA9A 2ZG3A 2D7MA 5JXAL 2CMRH 1NFIA 1T7VA 1D3CA 5IJVB 1S5HB 5MENE 1HH6A 5D93B 4PR5A 4NFCA 2H32H 4K94L 4FTVE 5FUOH 4ZTPL 4LSQH 4H88L 4PJ5A 3PL6B 4JFPB 5CP3H 5TF1H 4GSDL 5IT2L 2GYSA 5BRZE 3AREA 3MOBL 3I6GA 2X70B 5DUML 5HI3D 3S88L 3G6JB 3B4NA 5I1CL 4I3RH 5F1NB 2VLJE 3I02A 5INDA 4BKLB 3V7MA 3FRUB 2D03L 4N8CL 1YEEL 2VMFA 4R26H 4KTDH 3WUWA 4HWZB 1F4AA 3HN3A 5CSZA 3MOAL 2QLVB 1EJOH 3SE3A 5EN2B 5GS2H 3QXDB 1L0XA 1KBGH 1ONQB 1MHHB 2P48B 3MCG1 5ITFA 2MQCA 3OJMB 1KV3A 2Z8VC 5I1KH 2KPNA 4NUJB 1YEIH 4NRZA 4FQXA 3DYOA 3GI9L 5ALBH 2CGRH 4GKSB 3FFCA 1PG7L 3FHQA 4XCNA 4S0SD 4EBQH 2CIKA 4TVSa 4Z7UF 4GG6B 3I9GL 4X6BA 5CEXB 1A6ZB 4Y4KD 3QUXC 4MNQD 4YHPB 4U2ZA 1G9MH 4E41E 3ARFD 2LTQC 1Z9LA 1VDGA 3VWJC 1PD6A 2HLAB 3RVVD 3I6LE 3DIFB 3T0AA 4QRRD 5HBBA 5GSVB 4YFLI 3EO0B 4MA7H 3STLA 3L1OH 3WKMH 1HXMA 2W0FB 3DUSA 3R4DA 2NY6C 4M7KH 2H26B 2UUDK 5SX5H 3IJHA 4IMLB 3TF7C 3BKYH 2Q3AA 4L8DA 2YWYA 4JFZL 4U1MB 1NCBH 5E8OB 4DGYL 1SYSA 4WI6A 2GT9A 2ARWA 3CX5K 1B0WA 4XB7A 3ARVA 3BD3A 1T0MB 3D25A 1I9EA 1N5AB 1J18A 4YHZL 3SKMA 2R8SH 5C9JA 1KELH 3IB4A 5JLZB 4P4RA 3VGAC 4PUBL 3PP4L 4U6TA 2KKQA 7CGTA 3S96A 1F11B 2ILLA 3NCCB 3H6JA 1QSFD 4MDIA 1T0NA 4PS4L 1FNAA 3IU3B 3P9WB 3IXTA 5HI5D 5C0IA 5INCB 1IE5A 3E6FA 4L3CA 3TN0A 5KSBA 3TZVC 1FQ9C 2EDQA 4D9LL 1OSZA 2J8UF 2P5ED 3MO1B 1TCMA 1CD8A 2A38A 3T77B 3V2AR 2E9IA 1RK0B 3UTPE 3WEXA 2VXVL 1RMFL 1W0WB 2BHZA 4ELMA 5HYJA 3MLUL 4WWKD 2NYYD 1FZJA 4R90L 5BVJA 1QBAA 4D0DA 1BQHA 1FVDB 4L3EE 4C83A 3RZCA 3CVHB 4TNVK 1EAJA 4ZXBC 1HHIB 2P7TB 4B7IA 2OTUA 1H0DB 4OCSH 3B5HA 5J11B 2XICA 5F1IA 2VN7A 2QL1A 3SGKC 5EC1B 2ESVD 4HPOH 2VR5A 4L4TA 4Z0BL 5C0RH 1X5XA 3KXFA 2ORBL 4NO0B 5LBSH 5GRJL 1KT2B 3U30B 3O3AB 1TTUA 1WZKA 2W0PA 3V79C 2F54E 3HS0A 1NANH 5F7YC 3OB8A 1QFOA 3WHXB 4M1CD 4PGBA 4OB5L 4X80H 1ZT7A 3NABL 3BD5A 3EKCA 4K3EH 1IZKA 1CVRA 1OTSD 2YXFA 4YHYC 1N7MH 1Y0LA 3GKWL 5EA0L 2MNUA 4RAHA 1DFBH 2WLZA 2EZ0D 5D7SL 3RKPA 1XR8A 4HG4J 4XC3L 1FFQA 2G75A 3BMWA 5DJ0B 4LSTH 4R7DB 3V52L 1SJVA 3EYVA 3HG1B 2R9HC 3REVB 3WFEH 4HXBH 5A2JH 5F9JB 4N9GB 4H8WC 1F6AB 1INEH 5J6GA 4UI2A 4XVSH 2LE9A 4Y4HD 3V4VL 5ALCL 4UUJB 1ZA6A 1MPAH 4XP6L 1WBYB 4XAWL 1G7MA 2MHAB 4OZFB 5L2KB 4X6CB 5I6XC 4HX1B 3X14B 2ATPB 1RUPL 2NY5L 1N0LA 3PJSA 5HYQB 4NO3B 4FQJH 3HG1D 4NQDE 4P5MB 5C1MB 3F7PC 1N0XH 4M5YL 2MCPH 3P0GB 2HMIC 5DVMA 5MENA 4J6RL 4YIQA 1PEWA 5DMIH 1U2CA 2LFGA 3S5LB 4YGAB 1CG9A 5I9QC 4FTVA 1HSAA 3T0DA 3Q48A 4M8VA 2XTJC 3K81A 4JFQB 1KCVH 1LO3H 4KQ3H 3TT3H 3FL7A 2F74A 1LK2A 4X7CC 5L2KD 5D71H 1ETZA 2CK2A 3HC0A 4QXTB 4PGCA 1FFNA 1N6VA 8FABB 5IESL 3WDIA 4YAQB 5H94A 5IBLD 3HC4H 4RA0C 1I8LC 3QRGH 5HHOB 1XGUB 4OGXL 4NJ9H 4G7YH 4KRPB 4I18A 5DLMH 4K55A 1FE8L 4PJFA 4YDIH 2EIZB 1BQSA 3A6BL 1AJ7L 1BFOB 2BOCB 5FYJU 5DJAA 1H8SA 5DXWA 2NCMA 1OP5K 4ZNEA 1HEZA 5DI8A 5JXAH 5DT1H 2XZAL 4B41A 5KVDL 5DGQA 1X7QB 1NGZA 4TQEL 5F6IB 2VRAA 3BZFB 4JREB 1SBSL 5JXEA 3NCYP 2YKLL 1OT1A 3B5TA 4RGNE 5FYJL 4K94H 3I75A 3P3YA 4I0PA 4XNUL 2H9GA 5DC4B 4ZTPH 5I71C 1OCWL 4H88H 3BGMA 3FONB 5CZVL 1CGUA 5IT2H 3C5SA 3MOBH 4M7ZC 3N9GL 4LRIA 5DUMH 4AY0A 3TFKC 2ZSWA 3S88H 2IBGA 1L4IA 5I1CH 2ZSVB 1S9YB 1WAAE 2D03H 4LPUA 3ARRA 4N8CH 1S7UB 3MNVA 3RGVB 4KTYA 4FG6D 3M1BB 5E8PA 1EFQA 1KF9B 4EEEA 5KG9B 5I76A 3DUHA 3Q6FB 3TCLB 5J9PA 1KCSL 1JRHI 5F1SA 4RX4A 3MOAH 2QEJA 3WBDA 5I1IL 4NBXB 3AS2A 2PNDA 2D7NA 3O3EB 4LEOB 4OFYD 1BQLL 4PY8J 3O4LD 1ES0B 3MGTA 3BP6B 3GI9H 1ORQA 4FA8A 1PG7H 2CXKA 4HJ0D 4TUOB 4Y0GA 3RAJL 4CVXA 1YPZE 4PJBA 2XY1A 3D0VB 3T3PE 3RGVD 3QIUA 1I7RA 3I9GH 4XAKD 4CBPA 4HG4K 4POUB 5F89B 4TN9A 5KANG 4L8SA 5TDPA 1MCDA 1GYAA 2FL5A 5DFVC 4O2FB 1XMWA 1T2QL 1S9WB 1JTTA 3C60B 1KIPB 1OF2A 1QSEE 2BVQA 1JZ6A 1DVFD 4QGYA 5HVFB 3MV7E 3DHMA 4U6YB 1WCBA 1TJGL 4OGZA 4B7LA 3SDCD 4PGZA 5D6CB 5IK3B 2YRPA 5FFLA 4JFZH 3R06A 4U1NB 2VDPL 1CGXA 3VA2C 4KH2A 4U1IA 4L3EA 4DGYH 1BX2B 2D31A 3Q5YA 2JTDA 3E2HC 4MNHA 1ZOXA 5DMYA 2C3GA 4Y16D 4MAYD 5DUBA 2R1WA 4IDJL 4YHZH 1FNSL 4ZG1A 1IEAB 1MELA 1S7XB 5CGYD 5A3IC 4ZD3H 2R23A 4PUBH 3PP4H 3DARA 1LO2L 4JFYA 2APFA 3GK8H 3C9NA 3ZKQD 4AIZB 4K3HA 4OCLC 4PS4H 2WBKA 2F54A 4POZC 3CUPA 5CHNB 4NQED 3OKYA 4KK8D 1NUNB 5DJCB 3VMOA 2YUVA 4H5SA 4RBPH 3ZHKA 1I1YB 3IDXL 5BS0B 2FX7L 1A9EA 2NY4C 5DVNA 1LNUB 4D9LH 1PG7X 2F5BH 2E7BA 3O3BA 3TH2T 4G9FA 1RI8A 3VDBA 1KSRA 5IVZB 3LIZL 1RMFH 1U95A 1XEDA 4FQCH 5BV7C 1J8HD 5E5MB 4BFEA 3CXHJ 3WFZA 3MLUH 3V5HB 4EIGB 5IB4B 3LKNB 5B3JE 3DMMA 5TDNA 4AH2B 3SCMA 4CL7A 2AK1L 2E7LC 5D1QC 1FV1A 1NFKA 1T1WB 3VWJB 2A83B 4JRXE 4KGLA 1QFPA 3DX8B 3QDJB 2OTPA 3AMKA 4M7LT 3GMNA 3W0WD 2PYEA 4F37F 2QR0A 1GHFL 4CRPA 5GRVL 1CIUA 4X7TB 2H8PB 5GRJH 3ZKMC 1TJIL 5M94B 2NY6B 4IOIB 3GSRA 4IS6A 5IOPA 1HQRB 4WEBL 1UQSB 5HYIA 3NPZB 3D1MC 1BWMA 3IRPX 5FYJD 1KULA 3IS1X 1WWBX 5C08D 5FYKU 3O45A 1R5WB 3VXPA 3KYMB 1JN6A 2EDOA 3U82B 1KPVB 4OB5H 1IGFH 1K8IA 3RJQB 1DBAL 5C0DA 4P59L 2Q87A 4MWFA 4PG9B 2B4CL 1XGTB 3VGDA 3QEQE 5KTEL 5EA0H 2R0KH 2OJZL 5D7SH 3ZDXE 5FYKL 1CE1L 1AFVL 1HHJA 3VJ6A 4EI6B 4PGJA 5ESVB 4WVRA 3V52H 1FZKB 5ESAA 2EH8L 3PGDB 4LLVB 4A2LA 2VZ1A 1U91A 4IEFB 5F88A 1FJ1B 2OZ4A 3TZVB 2I9TA 2CKBA 1B9ZA 4OLVL 3V4VH 4RNRA 3LEVL 2DYPB 5EPMA 2BVTA 5FYLE 1K85A 1AGEB 5CBEB 4XP6H 4U49A 5HJ3A 5ADPL 3H9ZA 4XAWH 1DLFL 2DQEL 2ARJA 5AD0A 1BPVA 2VUOA 3ULSB 4ODSL 2C1PA 5TH2B 4DKEL 3LEXB 3BZ4A 1RUPH 2NY5H 3EYFA 2CSPA 4Z7UB 5C0ND 1OW0C 2YA2A 4JFOB 4ZXBB 4M5YH 3INUL 4XNQA 3FFDB 2XWTB 1ZT4A 2OL3A 3QG6A 4J6RH 4CN1A 1P53A 4ZFZA 2ZJSL 3MXVL 1QO3B 1X6NA 4R96B 4C4KO 4AM0A 1BOGB 1U8MA 1D5XA 2J3SA 4EI5A 1S9XB 4HKXB 3AROA 3ALXA 3ROLA 5BOZG 4YE4L 1TDQA 1U8LA 3IJSB 5IESH 5A16B 5T3ZE 1NCTA 5CJBA 3H3PL 3OHXA 3CFKA 1WAAA 4K71C 3KS0H 4ODVH 3HPLB 4GG8B 4HUXA 5BZWB 2IWGA 2DQUL 1Z5LB 5HPMA 1FNEA 1JWMB 1A14L 4ONFL 4YHYB 4UNVA 1WWCA 1FE8H 2O5ZL 2BSRB 3ZE2E 1AJ7H 3QNZA 1UB6A 5F9DC 1MIEH 5I1LA 1GXEA 4KKBC 3IFOB 2P4AB 1RZJH 3LQZB 3TYGH 2VKWA 3U4BL 5JO5A 5FGSA 3QUZD 2XZAH 1Q9OA 2XOTA 5KVDH 1VGEL 3HZKA 3QUYD 5KSAA 1I1AA 4JY5H 2VZUA 3CXHK 2EIBA 3LB6D 4TQEH 4KJQD 3U9UA 1I4FA 2YKLH 3HPJA 3BE1L 5EU6E 5FYJH 3GJEA 1CCZA 1OCWH 3UTTB 4JQXA 2EXWC 5CZVH 1T6WA 3QDAA 1FSKC 4NHUA 4PY7B 4P46C 4ELKB 3N9GH 5I1EL 4XBEL 4N1CA 4O5LL 4HXAH 4NO2A 1MH5A 4QOKB 3SE8H 1FO0B 1U41A 1FBIL 2O61A 1G7HB 2K3TA 3WKNA 4P2OC 4HFUH 2NY0C 2JJUA 3C5JA 3GDBA 1YY9C 5F7FA 3DSNA 2XV6B 1F13A 4J4PC 1KCSH 3BVNB 3CSPA 2CPCA 2QQNL 3ULUD 3K3QA 5SV4A 1ZV5A 5I1IH 2OQJA 3D3VE 1OB1A 5I9QB 2Y6SD 1M05A 4HJGA 1Q9KB 1YMHB 2AK4E 3BZDA 3TBSA 2XTJB 1T83C 2NQCA 4P3CL 1ED3A 3RAJH 5DVLA 5IB5B 5MEPA 4PJAB 3MR9B 3BPOC 1F5WA 2WP3O 3MV11 4H20L 4ZUTA 5HYSA 3HE7D 2OXHA 1UXSB 3NIGE 5EIIB 5FOBB 4I9WE 5AAMA 3EZJB 5FYKD 4C4KT 2NX5E 1QFWI 2G9HA 5EU4A 3V5KA 3QDME 3FJTA 5IUSA 1FL6A 4KZDL 2CH8A 4AQOA 3UPRB 4JR9L 3V6OC 5DJYB 5A2FA 2YA0A 4CKVX 1PFCA 2XACC 1TJGH 4FP8L 5B8CA 3KPOA 3GGWA 4TNVF 2Z92B 1IGCH 3F12B 1BJ8A 3VXQB 2VDPH 4JRYD 4OM1L 2AEPL 3P4NA 1X5FA 3ARBA 3DECA 1JGVL 4JZOB 4Z78A 5KS9F 4F9LA 2VZVA 3B2UC 5I71B 1NH6A 1DQJB 4WI3A 3FT2B 2OJEB 3WFCL 4IDJH 4JRXA 3RX7A 3T0EB 5KANI 1FNSH 2Q7YB 4PIRF 3TEUA 5ITBL 5GGRA 1UWGL 2R4SL 1N5YL 1IT9L 4X9IA 4HKZA 1CFTB 2P1YA 4FS0A 5CJXC 3VH8B 1FFRA 4S1SL 3RWEA 4Y4FC 1MNUL 1PLGL 1BECA 1QLEL 3U0TA 1AHWC 3GO1L 5CZXC 4WFEE 1LMKA 4FN0A 3IDXH 4KRLB 2FX7H 1XR9B 5DHVH 2GJZB 3VXME 4HH9A 4Z7WF 2JJTC 3EGSA 3V8OA 3QQ9C 1RZKC 3BO8B 2Z35A 3T0ED 3LIZH 4KJWC 3QEQA 3MCKB 3EOBB 4YHLL 1BD2D 3SBWC 2BNUB 1AE6L 1FYTE 1V7NL 3MRIA 3RVWD 3QIBA 1NUDA 5D7JA 1WIPA 2AK1H 4OZHE 4WW2A 2Y5TA 3HC3L 1R24B 2XPGA 3L6FB 2F53E 3QIWC 3BUTA 3GMMA 1C16B 3KLAB 5E7BA 3VGFA 1UYWL 5AZ2L 2X4OB 1UZ6E 2DD8H 1V5JA 3FQRA 1T22B 2ED9A 3D9AH 3PDOA 5TQ0L 1FLTX 2WM0A 3DHJA 3GSVA 5EUOF 3L3KA 2EC8A 2D7TL 4DUWA 3SE4C 3AB0C 3QNYA 2UWEF 4KMTL 3KLHC 4X5WB 1RJLB 3G5ZB 1F90L 3QUMB 4OAWB 1U8QB 1FP5A 3C08L 3HRZA 4P2QE 5SX4H 2WP3T 5GXBB 3FB8A 1M7XA 3WS3B 4CDGC 3O9WA 1NEZB 1DBAH 4KKLC 4P59H 2FZ3B 4RFNC 2B4CH 3E2HB 5FK9A 1CD1A 1CFSB 2WIIA 1CGYA 3B9EA 2X7LA 3SQOL 3P73A 1ZLVH 3UEZA 3OF6A 2OJZH 3RKDD 5C8JA 5GGTL 4JY4B 4WFFD 5FYKH 1W72L 3T0BA 1DJSA 1AFVH 4M93B 3FZUC 4G8GB 3MJ7B 1OLLA 5C09E 4PV8A 5IR1A 3ZHLA 4PLJC 2EH8H 1YEKL 3IKKA 3OJDA 3NCJL 5AYQA 3OGOE 3RNKA 4WJ5A 1KJVB 3BIAX 4OLVH 4U05A 1E4JA 1EH9A 3GMOA 1LDPL 5F7MC 5ADPH 1DLFH 2DQEH 1D5MB 1JE6A 1KYOK 3LRSA 1B2WL 2X42A 4DKEH 3EOAB 3AXLA 2HJLB 4YFEA 3GSWA 4G8GD 1LGVA 3GJFH 1I7TA 3WFHA 5D7LB 5DHYB 1I7UA 1MHCB 2DMBA 3INUH 4KUZL 4HKBA 3VXUE 2XYCA 5LKNA 4JM2D 2ZJSH 3RDTC 2G2RB 2HFGH 4Q74A 4LCUB 1PVHA 1QRNE 1KCLA 4QHLA 2ADJB 1YJDC 2X4QB 4X4XA 2AEQL 2NY3C 1RZIA 1IARB 3NBNA 5SWSE 4X6DF 4YE4H 1NDGA 4UQ3B 3H3PH 3KPRE 1UB5B 5DJZA 1BBJB 4JFDB 2DQUH 3PWPD 3EYSL 3IGAB 4AENB 2AJ3A 4ODTL 4ONFH 4OD3H 5MEOA 2DDQL 4L5FL 2O26U 3MNZB 4I2XE 2O5ZH 5F1KC 2HT2D 4PP1D 4JLRB 2YOCA 4QCIA 3EDKA 4UDUB 3MRNA 3QWQB 5DUPH 5C0JA 1JF1B 4LHJB 3GEWB 2IMMA 1NGWB 2OI9B 3U4BH 3FHAA 4G6AD 5FUCC 1U92A 1VGEH 3P4OB 2J8HA 4QY8A 3VFVA 3CXDL 4YK4B 5FECB 2H2PC 4DW2L 3ARGA 1NC4D 3BE1H 1AD0A 4LCIL 1F3DJ 4NO5A 2BVOB 1A47A 3PV6A 4K7FB 4N0RA 1U3HD 4PJ8D 5TF0A 1T3FA 3D6GA 4CMMB 5IIEA 5I1EH 4XBEH 4O5LH 3CDYA 4OSUH 4Y2DB 4JKMA 5CLWA 1AIFA 2NX5A 1FBIH 1XGPA 2CDGA 3MBEC 3TH4T 3Q1SL 1R3KA 4L8CA 4TULL 3MLXH 2IG2H 1PKQB 3NAAH 1IGIH 3OR6B 2FYYA 1IBGL 4FXKA 1U8HA 1L7IH 2APWA 4H1LG 4N8VG 2QQNH 3I6KB 4M03A 1G7IB 3LQAC 3UPCA 4M8QA 1P4LB 2J8OA 4KUCF 5MEQA 1U3ZA 1A4JA 1JK8A 1HYSD 5DC9B 3GNML 4P3CH 4OZIE 2CLVA 4EDXB 3OKKB 1KIQA 3ZE0F 3LS4L 3RU8L 4K71B 2AEIT 1FCCA 2HTLC 5LWYL 1R5IA 4Q6IA 4UV4L 4JY6B 1IZJA 1G1CA 3KPSB 3VFOA 5KVEH 4N0UE 2FHFA 3RUGA 4CJ1A 5C07B 1AO7A 4X6EB 1A4KA 4NQXA 4M61A 1IAOA 4HD9A 4MNGE 1FCGA 3MA7B 3F5WB 4KI5E 4YGVB 1DQQA 1G7JB 1HILB 4JR9H 4U1GC 4IRJC 4M4PA 4JPWL 1MSPA 1SJXA 2ZUQC 5CZKA 1CK0L 2IFFL 2WNGA 5C0AD 4OM1H 4DK6A 2AEPH 1CLZL 5C0CB 1A3RH 1JGVH 4ZO9A 4WI8A 4G6KL 3MUZ1 3PXJA 5IMMB 2VIRA 3RBGA 3U6RB 5HHNA 3WFCH 3UCRA 3WS6A 4P46B 4HUUA 4FFZL 2EYSB 4P5TC 5ITBH 1UWGH 4PJDE 1N5YH 3K4DA 1IT9H 1HSBA 4ZUSB 3O2DA 3NIDF 3G5XB 4XI5C 3ROOA 2NY0B 1VA9A 1MNUH 4ZUUB 2IF7A 1QLEH 5CEYB 1LEIB 5C0CD 3L3DA 5TJWK 3GO1H 3OKMB 5L9DL 4YDLC 4P2RB 3PWLA 5DZLA 2VITA 2PYFA 3V6FB 3IDNB 3PE9A 4U1KA 1QR1A 4JDZA 3RWDB 4KK5C 5TQ2L 2GK0B 2QBWA 5DEFB 4HQQH 1AE6H 1V7NH 4DN3L 3VFPB 5E4EB 1A6PA 3HC3H 4NHCL 3BPOB 3JTTA 2YBRB 2A73A 2RQ8A 1T7WA 5B38G 1DSFL 3RVTD 3MYJB 4QXWA 4WW1A 4OGAC 4Z7QF 3DURB 3OB0K 3WLBA 3RFZC 1TVDA 1KGCD 3ULVL 1DBBL 5AZ2H 1MJ7L 1G6RB 4QRPD 3WNOA 5BXFA 3GIZL 3HKFA 5F96L 5GGRY 4RCAA 2X4TA 5TQ0H 2DLIA 3VG9B 1EO7A 3OAUL 3VFSA 3B8SA 4S10A 4D94A 4KMTH 1F90H 1QFHA 4Y5VC 2HG5B 1NAMB 2DQCL 3ARDC 2ZOKA 4S11A 2K7PA 4ZFOL 1DN2A 3U0WL 4UTAL 2N56A 1YNKL 4V1DA 3WDJA 3F8UB 4WHTA 1CT8A 2ZPKL 3SDXE 2L0DA 1R3LB 3WUZA 2NY2B 3SQOH 5I66B 4WTZG 4PJ9D 5GGTH 4AMKL 3FTGB 1UVQB 1W72H 1QRNA 3LKSA 1W0VA 1S9VB 3RA7L 1ZTXL 1FN4A 1M7DB 1WUNT 2DKSA 3LN5B 1PZ5B 1YEKH 3GB7A 3NCJH 1OTTD 1GAFH 3L5HA 2J6EL 2VH5L 5GSRA 5IB3A 1UEYA 4R4ND 4FQQA 4FFWD 4E5XB 4X5XA 5ESQB 1LDPH 1R0AH 4XWOD 5EFIA 4X6DA 4I2XA 5CJ5A 3VD5A 1B2WH 1BLNB 3VCLA 4ODXB 5ETUB 3PQYB 2W60B 1M71A 3RBSA 1WFNA 4OT1L 2XN9A 3RWCB 2GY7B 3VFNB 2IANB 4WI7A 1X6LA 3UTQA 3QIWB 2OR8A 4OIAA 3DLQR 3H0TA 4PGDB 3ZZ1A 4M7LL 4HIIB 1AGFA 2YSSA 3QCTL 3DVGB 2AEQH 5F71A 4HGMA 1VB9A 4YFDB 2Z31A 2WQRA 3BN3B 3G6AB 4PJCE 2ZG1A 3ZLQC 4FQPA 4JKLA 3PQYD 4N5ED 1TZGH 1D5ZB 1NBZA 4OF3A 3BIKA 1S3KL 4AG4L 2IAND 5HY9B 5GJSH 5KS9B 4PJ7A 3C6SA 4JAMB 1KTRL 4RFNB 1I3UA 3FRPA 3QXTA 2DDQH 4J3OC 4L5FH 5K9KB 1CBVL 1X3DA 1MCOL 2BNQB 2Q8AL 2HVJA 1J12A 1D6VL 2BHUA 5HI4D 1EPFA 3VI4F 3VWKC 3SDDC 4C54A 5AUMA 3GRWL 1MLBA 1KLGA 4O00A 5DRXB 4MS8C 4IOFD 3CXDH 5IMOB 1EEZA 4PRIB 1GRWA 4WU5B 4DW2H 4FQ1L 2PO6D 4HK3J 4KKCD 4NKMA 1Q72L 3RWIA 4EXKA 4QWWD 1TCRA 2R0WL 1QG3A 3PF2A 3U7YL 1H3WM 3CJJA 1KTLA 5D2NA 5DJXA 1NBYA 4JEGB 4RZCA 5KVFL 1Y18A 3Q1SH 4MNQE 1MCLA 4TULH 1WC7A 2XA3A 3CFBA 1GVIA 3OKOB 5F44A 1FH5L 3UAJC 4F7PA 4CAGA 3ULVD 1CFNB 5ADOH 4N90D 1ZVHA 4QRRE 4R8WL 1XF3A 1EHAA 5JA8B 2WWMD 2XKNB 4YZFE 2UVFA 3RDTB 4XGZB 4OIIL 5GGVY 1G0YR 4G8EB 1WCQA 3QFDB 3GHBH 2XNAB 4YPJA 1AGBB 3GNMH 2V2TA 4GG6E 1X5GA 5EUOB 1YEDA 3TA3A 2UWEB 1E4XL 2EDFA 2FJFA 3RU8H 4K23L 4MXQC 5LWYH 5T1KA 1QYGH 1HDMA 2IAMC 4UV4H 2IBZY 1JV5A 3U83A 2R1XB 5CWSB 4MSWA 1T2JA 1YUHA 1DE4B 4GRLC 1IC4L 1QSFE 4MQSB 3ILPB 5HYFA 3TNMA 1EHXA 5DMGD 1MQ8A 3BP4A 1AKJA 2J1KA 1JWSA 3MRCB 4WIQA 2YD8A 3QXVA 5E6ID 1C7TA 2Q6WB 1JGDB 3VFGL 2H32A 1QA9B 3UXFA 1ZLWK 1D6EA 4JPWH 5J89A 4KDTA 1CK0H 2IFFH 1A0QL 4GKNA 1KPUA 5CP3A 2P5EE 1CLZH 3L3IA 3LV3A 3WSQL 5H2BB 4G6KH 3TWCH 2UY7A 5GRUL 3KAAA 4PJ5B 1JZ2A 3DYPA 4X4ME 5D9SA 3I6GB 5J57B 4FFZH 4R4BA 4X7SL 2EDBA 2AKRA 5INDB 2BC4A 1EFXA 5FV1L 3RVUC 2VZ3A 4FFVD 3VGGA 1XF4A 5D1XA 1HOCA 1YC7A 3E0GA 4G80A 3WUWB 1ZE3C 5IF0B 3MRHA 1TXKA 2ESVE 2BK8A 4OF8A 2MJWA 5FIEA 5CSZB 1ZLUK 3QEHA 4XVUC 2NY1B 2AXHA 4PJ5D 4YNYA 4EDWL 5ITFB 3ARED 5TQ2H 1OAQL 2KBGA 3SDXA 3FQUA 5HGAA 1VSCA 4MQXC 4FQXB 4PLOB 5D2LE 5FO8A 4XP9L 1A6TB 4Y1AA 1ORSA 4M4RA 4DN3H 2B5IB 4F15C 4XCNB 1MWAL 2HTKD 4HHAB 2CIKB 3QG7L 3RRQA 4NHCH 4X6BB 1GOFA 4LKCA 1DSFH 3L9RA 1DEEB 4JB9H 3UX9B 3JWOL 3BKCL 3ULVH 1EVTC 4X0KA 2NY1D 1DBBH 1TTFA 1MJ7H 3EUUA 1KCUL 3RVXC 3C5ZC 3GIZH 4ODUA 4NN5B 5F96H 3STLB 3K46A 1T6VN 4PJGE 3OAUH 4LDLB 5EOQH 4DK3A 1B4RA 4IRJB 2GTWA 2RFXB 3FFCD 2FDBP 4QO1A 1GIGH 1WICA 4AQ1B 2X9WA 4L8DB 1ZANH 2BP3A 4WFGD 2CDEA 2DQCH 2GT9B 3U0WH 3ZKXC 4UTAH 1YNKH 1S9KC 1KNOA 2ZPKH 4JZJA 4JANA 4U0RC 3D25B 1MI5D 4APQC 4NGHL 3SKMB 4G8FA 3X13A 3O8XC 5C9JB 4AMKH 2A9ML 3HG1E 3IVKA 4P4RB 1GOGA 5KOMC 1GGYA 3S96B 1UM4L 3RA7H 1ZTXH 4Z77B 5ICYB 5FHBH 1PY4A 3IXAA 1T0NB 3NFSL 5FGRA 4OF7A 4LMQE 4XPFL 4HIJB 1RVFL 5I1DA 5C0IB 1VFAA 3E6FB 3DYMA 4I4WA 5CUSH 2DLTA 2Y4SA 4L3CB 5AAWA 5TDOB 4RISL 3O41A 5GGUA 3TN0B 1CYGA 1UXWA 2J6EH 2VH5H 4WHYG 5L2KE 1Y6NR 1OSZB 3MUY1 3O2WL 3WEXB 3SO3C 3KLDA 1QZ1A 4ELMB 5HYJB 2VKXA 4LCWA 1FZJB 3G6DL 5BVJB 4Z76A 1SVZA 1BQHB 3FCTA 3KJ4C 1UG9A 2HA1A 4PJIE 1WQVT 4C83B 4PBVC 4OT1H 5D70L 2JB5L 3RZCB 1DBML 1QNZL 3JV0A 5GIRA 3T2OA 4LKXA 1M7IA 4HS3A 4D9QD 4J3UA 2GJ6A 3TN0D 5F1IB 4N0YL 4RGNC 4X6FB 3QCTH 4GRWB 5I19L 2EDNA 3KXFB 4MCZA 4ORZC 5HYJD 4OZFH 3RY6C 4H26B 2W9LA 3HS0B 2WIMA 1CDCA 4XPHL 4N0CD 4Y4KA 4Y5VB 1REIA 1D5IH 2CLZA 3RZCD 1S3KH 4AG4H 4LLMA 4PGBB 4M3KB 1ZT7B 3D5OF 3T4AB 2E7HA 1QLRA 1GGIH 3U79A 2RAMA 2WBWB 2VYRE 1CBVH 4QRRA 1AXTL 4Q2ZA 3IAPA 1CLOH 2Q8AH 1GPOL 4L4TD 2PN5A 1BOYA 1D6VH 1U2HA 3KXFD 2V5RA 1XR8B 3N85L 5JW4R 1O5DT 3IDIB 2G75B 1A6VL 3GRWH 3QH3A 3EYVB 1KTDA 1G9NL 4IOSD 5B3JF 3MV8B 1AGDA 2VNCA 2DJUA 3HI6L 4N0FA 1T03H 5CD5D 4FQ1H 5J6GB 3O4LE 1O0VA 3BKML 3OGCA 2VJXA 4Z9KB 3H9HA 2DI9A 2R39A 3MOQA 1I8KA 4MQTB 1ZA6B 4J3TA 4KKAC 1G7MB 3FO2A 5GS3A 5GPRA 4D0BB 5E0QA 3E6HA 4XAKE 4WFHD 3HUJA 1NANI 2EYRB 2PF6A 4HUNB 1T5WA 4XP4L 5HDOA 3PJSB 2JLLA 3O4OC 3P9LB 3SY0A 4ENEC 2EYTA 5J0BA 1J0HA 4LLWA 3W11C 3MV9A 1FH5H 2FLRT 4R8WH 2GUOA 3BOVA 3S37L 5MENB 2P5EA 4YIQB 4HLZG 3RNQA 4DFHA 1XCTA 1CG9B 4OIIH 4FTVB 1IQWL 1HSAB 2JCCF 5IMKA 2NTFA 2IPKA 4WWKA 1K4DA 2J4WL 4J3SA 4X4MA 2H41A 2F74B 1S7VA 3CSYA 1ETZB 3ZDXF 2AW2A 4PGCB 3X11A 1E4XH 3QUXD 4UTBL 2DLEA 2VLJB 4ALAH 1H5BA 1MRFH 1MJ8L 1FL5A 4K23H 2NXZC 4R2GC 3UP1A 5A43C 3PWUA 1UCBL 4RWYL 3AS3A 3MMEA 2ESVA 4I18B 2UY6A 4UZGA 3WIFA 1FZOA 3CFEA 3MLPA 1IC4H 4BELD 5ACMA 1LILA 3KPMA 5DJAB 4LVNB 4NN7B 3ZDYE 5I15L 2V9RA 3RI5K 3VWKB 3VFGH 4NQEE 4C56D 1HEZB 5DI8B 1X5ZA 1RURL 5I30L 2QQKL 3S3JA 5EO0B 5J1TC 5D2LA 4PTUB 1WIUA 1A0QH 1AQDA 1NGZB 4QF1A 3SN6N 2DWDA 3KVQA 4R4FH 4G5ZL 2MPAL 4GKOA 2AQ3A 4F9LC 3I75B 3QAZC 2UYLA 3LPFA 1J8HE 2H9GB 3P0YL 4I0PB 5GRUH 1TPXC 3WL9A 1UADC 4E41B 1QPPA 1T5XA 2PXYA 3MRMB 3C5SB 5EC2A 5EOCL 4X7SH 2ZSWB 3L5IA 5EU5B 2HRPL 3JV5A 4BSVA 1J0YA 3BPLC 3MNVB 2DL9A 2DLGA 3GZKA 5I76B 4GUPA 5KVGL 3W0WE 5J9PB 5JXED 5JIPA 2DLHA 1T1XA 2EDEA 5F97E 4I5BB 3U1SL 4K07A 5FGBA 1MREL 4I0PD 2P44B 5DVKA 3TVMC 5E03A 4EDWH 1E27B 2I26N 2X89D 5JOFA 2X1WL 4HAFA 1TMCB 5FYJE 4BZ1L 5C08E 3MGTB 1ORQB 5I2IB 1FNHA 5JMOC 1MWAH 4CVXB 3V4UL 3PXHA 4WENB 4PJBB 3QG7H 5I75C 4XNZC 3QIUB 1I7RB 4K8RC 1P2CA 4KGJA 1CQKA 1I9JL 1OT2A 1TZHA 2XQYG 1NFDE 5TDPB 3CZJA 1FHGA 1QRKA 5DHXB 2FL5B 4ZDHB 2A74A 4EUPH 1UENA 3JWOH 3BKCH 5KJRH 5F3HA 1KXTB 4GRLB 4R0LC 1CL7L 2OZ4L 4Q7DA 2OTWA 1MLCB 3VA6A 2XZCL 5IVXE 3CDGA 1OF2B 2VL5A 4NKDA 3R1GH 1WCBB 5LCVL 2PW2A 1RZFL 2WUBL 2HFEA 4U1IB 4L3EB 4PJIA 5DK0A 2D31B 3CFCL 1V05A 5E2JA 4MNHB 5E9DA 3HMXL 5DUBB 4NGHH 2R1WB 3GBML 1UJ3A 5J8OA 5J3HD 5KN5A 2A9MH 4U0QB 3EDJA 4OQTL 1UM4H 4JFYB 1U8PA 2D3VA 3C9NB 3GSNL 2H1PH 2F58L 2X4NA 4XPFH 1FG2A 1L6XA 1RVFH 2F54B 5IWLA 5IEKA 3V4PH 4RISH 1NUFA 4H5SB 1UFUA 4HMEA 5LGKA 2UZIL 3S4SA 2ZUSA 4LRNL 5EOTA 1A9EB 4W68A 5JDSA 4LMQI 1NGQL 3NIGF 4XCYA 3IYLW 1WTLA 4G9FB 3O2WH 3LRGA 2DJ4A 5HD8D 4NRXA 2ZZUT 4LSSH 1EHLL 3G6DH 2CDFA 2VDQL 4OLXL 3D69B 4F15B 3EYOB 2KH2B 4UOJA 3SCMB 4NWUL 5LGJA 4U1SA 5D70H 4X98A 3CH8A 2JB5H 2QSTA 1T89A 4OD1L 3MA9L 2LVEA 1DBMH 1QNZH 4RA3A 1UWXH 4Q9BA 5C6WH 3IDYC 4EN3C 3GMNB 5F7LB 2PYEB 2EDLA 2QR0B 5I19H 4G9FD 3LPGA 1C8PA 2W07A 5CLTA 2R29H 3KNBA 2F8OA 4U4BA 5BV7L 5BW7C 4LIQL 4GBXC 4IS6B 5IOPB 3DMMD 5GHWL 1HXYA 4XPHH 4Z7OE 4Q9RL 3LQMA 2HVKB 1WT5A 3C2AL 3O6ML 4M02A 2WSKA 5E1AB 4HV8A 5DTFA 1JN6B 2R69L 1CI5A 3P2TA 4XXDA 2BSED 1K8IB 4NQDB 5C0DB 3H8NA 4MWFB 3HE6D 3KPTA 3W2DL 4NYLB 3GMPA 4HULB 5D7IE 2PYED 3AUVA 1MRCL 4PG2A 2M2DA 1IEHA 3VD9A 1DVFA 3RIFK 3QISA 5C2BH 1UGNA 4FZ8L 2V2XB 1J0IA 4S1QH 2NXYD 3BEWA 1L0QA 3N85H 5F7HA 3SDCA 4P23C 2A6IB 2VR4A 3ULUE 1V3KA 4RMVA 1O7SA 3FO9A 2XA8L 5I16A 3JTSB 3WCYA 1U91B 3HI6H 2B0SH 1HKFA 4OZHF 3VRIA 3BKMH 4Y16A 2I9TB 3MRJA 4MAYA 2WANA 2CKBB 4RNRB 4AIXA 1FFPA 5AD0B 2A6DA 2LAGB 3T0VA 1H8NA 3FO1B 2P49B 1DN0A 5GZNC 2E9BA 2FGWL 3BZ4B 4XP4H 4UU9A 3EYFB 4P4KC 5F7DA 3TBWA 4I77L 5HHPA 4XRCA 3NOIA 5GJTL 4OCRL 1RUAL 2QJDA 3K74B 4NQEA 3BQUC 3RL1A 5FYKE 5I1AB 3VXOA 4V2BA 5ISZD 4XNQB 4H8WH 1VPOL 1ZT4B 3S37H 2OL3B 3TJEL 1NMCC 3EO1A 4XCEA 4AM0B 1IQWH 1U8MB 3BISA 1D5XB 3IFNL 1J8HA 4HZLB 2J4WH 4JRYE 3TESA 3NIFE 4CU6A 1YMMD 1FO0H 3NA4A 1U8LB 2PCPA 4HFWA 4KJPD 3LD8C 3OHXB 3CFKB 1MJ8H 1VACB 2MTPA 4HUXB 2VXSH 3QNXB 1UCBH 4RWYH 2XY2A 5HPMB 1YN6A 1QPXA 5FEBA 4LSVL 4UIKL 2DB8A 3BSZL 4GW1A 1CFVL 3ZE1F 1UB6B 1MFBL 1FFOB 4G6JL 2HJFA 3AU1A 4EI5D 2DS4A 3EHBD 4H25B 5I15H 4YPGB 4NT6A 5E70A 1AR1C 1UT9A 5JO5B 5C08A 1Q9OB 3HZKB 5HVHB 5KSAB 1I1AB 3U9UB 1I4FB 3VFRA 3DROA 3ZKNC 5DMKB 2ID5A 4G5ZH 1OD9A 1YPZB 3HPJB 2MPAH 4NZRL 3T0EE 5E95B 3BWUC 3ME0A 1BD2E 4PB0L 1T66C 1N6QH 4NHUB 5CMAA 1ULVA 3ZYJA 3EJJX 1X44A 1MH5B 3GM0A 2A2QT 1IM9A 2ZG2A 2HRPH 5ABDE 1DQLH 1LEGA 3S37X 5IVXA 5DS8A 3O4OB 3ETBF 1QSEB 5IV2A 3C5JB 3OKLA 3MV7B 3RTQA 1I1AD 3FMGL 3S35X 5KVGH 2W1NA 4UIMA 5JW3H 1VFMA 2NY4D 4IMKA 2JJVA 3U1SH 1U8NA 2X4RB 3TBVA 4IRSA 2OQJB 1OB1B 1MREH 1BZ9A 1I9IL 3O6LL 3ZYOA 3V6ZA 1M05B 1CIDA 3SGJC 4KY1L 1DCLA 4KROD 5C0EA 5KZCD 5CBAA 1MHPL 3ISWA 2X4PA 1RHHA 3V4UH 1I7ZA 1DBKL 3MUGA 4R2GB 1I9JH 4ZUTB 1A1OA 4HIEA 3D39D 4WFFE 2YPLD 3I2CH 1AH1A 5EO9B 3V5KB 3DVFA 1CL7H 3WN5C 1FL6B 2HKHL 2XZCH 1N4XL 3JV4A 1V3MA 2H3NA 2QTEA 4P5KA 4YHOL 3TIEA 5B8CB 3KPOB 3GGWB 1LD9B 3LZFL 4H0IA 4NC2B 2VLLB 3P4NB 2PTVA 2FSEA 4RGOH 3VRJA 4TPRL 4LK4A 3QAZB 2W65B 2DBLL 3NA9L 4XVJH 5J4MA 5IW1A 2VDLH 3V0VA 3DI2B 3HMXH 3JV6A 4EOWL 4JRXB 1JTOA 4G8GE 5DJ6A 2OP4L 2BNRA 3D2UB 4IDLA 3CFDA 4HCRL 5GGRB 3QUZA 4LHUD 4MXVE 4OQTH 3B9KC 4LP4A 4HKZB 1VERA 4PYGA 4HLJA 3GSNH 5I74B 4PRBA 3MGOA 2F58H 2V5MA 4OUUA 4RAUB 2RJMA 5DHVA 3RWEB 3DX7A 1I3VA 3U0TB 3ARBD 4PRAB 4DKFH 1N64L 3HR5B 2UZIH 1T4KA 2YK1L 4LRNH 4AEFA 4P0DA 3S98A 2Q8BL 1JHLL 2Z35B 4KMLB 3QEQB 1OP3H 1M1SA 1M4KA 3F7QA 1EHLH 1IGYA 3SKNA 2VDQH 1VADA 3MRIB 4OLXH 3QIBB 2A6KA 3PWPE 4ONOA 1IQDA 4NWUH 4WW2B 5I75B 4LL9A 2Y5TB 4XNZB 4Y5YA 4JM4L 2P47B 3MA9H 4PRPA 2DQFB 4EXPX 5L2JA 4QXUL 3HZVA 3PWJA 1A7NL 3CH1A 3GMMB 2ED7A 2M8XA 15C8L 1EVUA 2JIXA 1U58A 32C2A 4J1UA 4PREA 1WFUA 1JHTB 1E4KC 1RZKL 4Q58C 3GSVB 3L3KB 5BV7H 4LIQH 4K7PL 2XIDA 2FX8L 3QNYB 4OV5A 3MFFB 5D7JD 1CU4L 4HPYL 4MB4A 4PJDF 4QRQA 4NNXA 1RJYA 3O6MH 3OAYH 1IM3A 3HRZB 3GMQA 5D1ZA 5I8KL 2R69H 2WBJC 3O9WB 3DRQB 4O9HH 1ZHKA 5JHDD 5FK9B 1CD1B 4I48A 5GISL 3W2DH 2WIIB 1HH9B 2HFTA 3EYQD 2X7LB 4KKBD 4ZQKB 3P73B 2R56L 5C8JB 4JFXA 4G3YL 4OZGF 4FZ8H 4YO0A 1P5VA 4BM7A 2H2SC 1YN7A 1VFBA 2XZZA 1KB9K 5IR1B 1DUZA 4AEIL 1HZHH 5BZDB 4OI7A 1URLA 2R1YA 1BJ1H 4MD4A 5CIPH 3RNKB 4WJ5B 4WNQA 2OYPA 3GSUA 3GMOB 1FNLA 3OF6D 3RI5F 2MFNA 3TO4C 4X4YA 3GJFA 3LRSB 3OXSA 5FA4A 1JBJA 1TTGA 4P2OD 3AXLB 2FGWH 4KI5C 3VD4A 1YY9D 1G0DA 3GSWB 5SX4I 3MREB 1TVHA 4OCRH 1LE5A 5ID1B 1I7TB 4DZ8A 3F7VA 2PTTA 2A9NL 4HKBB 1VPOH 4Y5XA 4BSWB 3TJEH 2A77H 2EECA 2CUMA 5EU6B 2E9JA 3PHQA 2BFVL 3K1KC 4X4XB 4U3XA 1CD0A 2X6MA 3GHEL 3L3OA 4NKIH 4GBXB 1NDGB 2F19L 1MEXL 3TA3C 2BMKA 4GS7C 3NPSC 3BEVA 1U9KA 3FT3B 1MFCL 2WMPA 5IROC 3C6LC 5GS0L 5MEOB 4NPYA 3IDJA 4YEFA 4LSVH 3BSZH 3G5VB 1CFVH 1RULH 4QCIB 1AQKH 1P69B 1MFBH 3D3VB 3WNLA 1MCQA 3MRNB 4G6JH 3UMTA 1JGLH 1YJDL 4OKVA 5C0JB 1A7PL 3LSOA 1S7SA 5EIVA 4P23B 5F7NC 1LEKA 5C0CE 4D9RD 5DDHB 1U92B 1ZGLP 3VFVB 1VCAA 4QY8B 4OFDA 5IJKA 3QO1A 3GSQA 1BZ7A 4LVOC 5AG8A 1GCFA 2GITA 1CICC 1AD0B 3WFBL 4NZRH 3VRLF 4BFIB 2FATL 3QI9C 4PB0H 1T3FB 2XQYK 3RJDA 1C5CL 3ESUF 5IIEB 5IG7A 3MLYH 1F8TH 2OM5A 2DOCA 2NX5B 2CDGB 1XGPB 4P48A 1R3KB 3QDMB 2DLFH 3SGEI 4L8CB 4P4KB 4PFEA 2R2HB 2IH3A 1KGCE 5ICZA 3UROR 2FYYB 3FMGH 4PJCF 4FXKB 4OFKA 4U6VL 4QRPE 3N50A 1U8HB 4JN2A 3ARGD 5JMRA 3BXNA 3QXAB 4M8QB 2FR4A 1I9IH 3WXWH 5MEQB 3FT4A 1BM3L 4PGEA 1U8OA 1KPRB 1JK8B 2BJMH 4DUXA 4X99A 2CLVB 1U3JA 4UNUA 3W9EA 5IW3A 1DBKH 2RGSA 1IAIM 1R5IB 3O3UN 4JM2A 2FECL 4YQXH 5ANMA 5AYUL 3VFOB 1X5HA 4KAQL 3FOMA 4O4YL 1E28A 3RUGB 2DJSA 4NQXB 1FDLL 1IAOB 4WO4C 4XNXL 1DQQB 1UH3A 1N4XH 5CAYB 3SE9L 3KLHD 4PRNB 3RWGA 1QTYT 2ADIA 5HDBF 4GAYA 4YHOH 3HZYB 1I1RA 5EG6C 3LZFH 3R0NA 1I8MB 4ZAKA 2VL4A 4OZHB 2GFBA 2JB6A 3BRFA 3SDYH 4TPRH 5C0GA 1U93B 2HKFL 3UPAA 2DBLH 2F53B 4KWUA 4GLRH 4RDQG 2VIRB 5HHNB 3QA3B 3L3JA 1TQCC 4HUUB 1AO7D 1ITBB 4YZFF 3ARQA 5ACZB 1G6RH 2OP4H 4L29B 4O51A 2DAVA 2SEBA 4HCRH 3BH8A 1H8OA 1XIWA 1HSBB 3H3KA 2AAVA 4PLJD 3ROOB 4EIZC 1J9CT 4LBEA 4GG6F 4LARL 1N59A 1NC4A 2DIJA 3OMZA 5DJ2A 1NAMH 3VFMA 4WV1C 1N64H 5HGBA 1U3HA 3PWLB 2VITB 2YK1H 4P2QB 2PYFB 3ECBA 5GRVK 2F15A 2FB4L 2C7UA 4U1KB 1RUKL 4JDZB 4ZUWA 3RIFF 2Q8BH 4MD5A 1JHLH 1MAML 3PQYE 5CFHA 2ZKHL 2APTA 5L0QC 4PJHA 2UUDH 2NW3A 2IANE 4F9PA 4G8IA 5DGRA 3P11L 2NPLX 5D93C 4JM4H 5GS0D 1CLYH 3BW9B 1KACB 2A73B 5C09B 4IIQA 4QXUH 4FQLL 4WW1B 5IB2A 1A7NH 1A7OH 5T1LB 3WLBB 5B4MD 3PL6C 4J8RA 3MRFA 15C8H 4R7NA 3TBTA 5SWZA 4AL8L 1RJCA 2HRLA 2DMKA 2VOTA 4UILH 5BXFB 1H3XA 1W8OA 3D18B 2X4TB 1C12A 1RZKH 3REWB 3VFSB 2FX8H 2EDRA 5CS7A 4XPAH 3H42H 1NBQA 1CU4H 4HPYH 4BZ2L 5D8JL 5GS1A 4GJTB 3ARFC 3ZTJH 4UBDC 1KENL 4HS8L 5DK2A 2QADB 4UQ2A 3JWDL 4ODWA 4HS6B 5GGTA 4V1DB 1CT8B 1W72A 3V5DA 2HWZL 4NRYA 4QRSA 4L3AA 5GISH 3VXUB 4ZOAA 4KHXH 5JW4Q 5JZ7D 3MV01 2K7QA 3O81A 1VFOA 5DFTA 4XNYH 2JELL 4FZEL 4F7TA 1QRNB 3LKSB 3ULVE 1W0VB 4BH8A 4N90E 2OK0L 5C0AA 3DSFL 4L8BB 3MLZL 5SWSB 1YDPA 4AEIH 3G04A 2B7DT 4F7MA 4QTHB 2DM7A 2QADD 4KQ4L 4KDWA 3KPRB 1G7PB 4V1DD 3PIQA 3CIQA 3RPKA 5IB3B 4CADA 4XBPA 4AJ0A 4NQCA 2O93L 2C3VA 4X5XB 1T7ZA 3UDWA 1U8JA 5EFIB 1XGRA 4I2XB 2NZIA 2GSGB 3F6IA 4ZODA 4EKXA 2Z9TA 3MACL 2XG4A 4PJXA 4GQ9L 4PJGF 1M71B 5HI5C 3HNTL 2APVA 2XN9B 1GZQA 1YQVH 2V9QA 5E8NA 1SJEA 3UTQB 2A9NH 2YD2A 1G84A 3L5WA 3SO5A 3H0TB 4LSQL 5DD1L 5TF1L 1AGFB 2YSSB 4K7PX 3P4LA 3O6FA 2BVEA 2X05A 3T04D 2N4IA 4QGTA 2BFVH 5DRNA 4OD2A 1QEWB 1X5KA 4W81A 3GHEH 2GJJA 1F3RB 4LCCA 1IMHC 4XPTL 1YEGL 2F19H 4RRPA 1MEXH 4KTDL 5HGDA 3BN9C 2XWBB 4MCYA 5KSUA 1NBZB 2XN9D 3BIKB 4R6UA 1QHOA 3L7FA 5MP6L 1MFCH 4GH7B 2ITCA 1EJOL 4PJ7B 12E8H 3C6SB 3UC0H 1CD9B 4OFIA 3ARWA 1JGUL 3B3IA 4K3GA 3MRDA 1BQUA 4CVZB 4HGWA 2RCSH 2PKDA 4X6CF 4JDVA 1YJDH 3KYOB 5ALBL 5FO9A 3QXUA 3CFJA 1A7PH 4BUHA 5ACLA 1FIGL 2Z31D 5TE4L 1MLBB 1KLGB 4EBQL 4K94C 4XH2A 1T7XA 4OZIB 5MI0C 1RIUL 2YRLA 4QXGL 1A1MB 4PJ5E 1G9ML 43CAA 5HHQA 3WFBH 1QOKA 1OTSC 1F58L 5J11C 3RWIB 3BGAA 4QNPF 1A02N 3L3HA 4N8VB 4P5TD 2EZ0C 2V5YA 3BGFC 4PJ9A 5F3BA 1C5CH 4N0UB 4MA7L 1A2YA 4QHMA 4OKDA 3PNWA 5DJXB 1NBYB 3U30C 2EO9A 1S5HA 4MNGB 3MGAA 1HIML 4TUJA 3BKYL 1MCKA 1WV7T 2Z8WC 3ARSA 2AXGA 3CFBB 4FNLL 1S5IH 3IJYA 5JOEA 4F7PB 4U6VH 4JQVC 1I85A 4Y4HC 1XF3B 1WBZA 4XC1H 2ZWLT 4XXCA 1IKFL 5FGBC 3G6JA 5F1NA 4BKLA 3FFCE 3TIDA 1BM3H 5EZIL 1Q0YL 2OX5A 2VWEE 4WFGE 2EXYD 2X2YA 1JPTL 1KB5L 4PJEE 1OP5H 1TQBB 3DOSA 3EOTH 3TA3B 3QDHA 4GS7B 3UJTL 3NPSB 4PJDB 2FJFB 2FH8A 1MI5E 3X12A 4AZ8A 5T1KB 2MCG1 4NUJA 5F21B 2GAZA 1JV5B 3NFPA 4KAQH 4GXVH 2AABL 4UB0L 3LQAH 1YUHB 4D2NA 4O4YH 3LKOA 2XKSA 5CD3B 1S8DB 4GKSA 1FDLH 2RR3A 4XNXH 4LLUA 2XKUA 3ARPA 3BP4B 1AKJB 1JWSB 1WGOA 2H32B 4MGXA 4YHPA 4XPGL 5IBLC 1CXLA 1HNFA 4GKNB 1KPUB 1OGTB 3L3IB 1DQTA 2XI9A 3LV3B 1CICB 2ITDA 3CMGA 2C26A 2HKFH 5GSVA 3GMLB 5EZLA 5IGXL 5D9SB 1ZSDA 2W0FA 1ZGLM 2YD5A 1BQHG 2E27H 5LBSL 4R4BB 5CCKL 2Y07L 4TVPL 2AKRB 4HF5H 4U1MA 3GBNL 1T04B 1AKJD 3SEPA 1EFXB 5E8OA 1K2DA 5MERB 5FM8A 1J5OL 4D9QE 2OXGA 5KSBE 4LARH 3ZDZE 3UZEA 1OWWA 3MRHB 1T0MA 4X80L 2YWZA 3NZ8A 4KRPC 5E99H 4K3EL 5D5MA 5HYJE 2FB4H 1C1EL 4YNYB 5B38B 4LPVA 1RUKH 4G9DB 4S1RH 1ZMYA 3FQUB 3SDXB 5HGAB 1MJJA 2ZKHH 3HR6A 3IU3A 5FO8B 4LSTL 5AWNL 4POYA 3TCXA 1N3NB 1NGPL 1QACA 4FG6C 5KAQG 3I3EA 3P11H 5D1XD 2OR7A 5IHLB 4LKCB 1HN1A 2FGZA 1H9VA 1YZZA 4ISVA 3L9RB 4L4TE 5DURB 3LKRA 4FQLH 3MO1A 5FCSH 2ENYA 3KXFE 4GW4B 3OJ2C 4X0KB 4AL8H 2J12B 2XG5A 3UTSA 4EUPG 4OGYL 2HH0L 3E1F1 4HJ0C 2VXQL 4F3FA 4PRHA 2GTWB 4Y1AD 5GGQL 5I8CA 1HHIA 3RGVC 5IB1A 4BZ2H 4LCYA 5IFHL 4LLQA 1WT5C 5IM7B 2P8PA 1KENH 4HS8H 3OAZK 2NY7L 3HB3D 4D8PB 3LKPB 3BESR 5DMIL 5GRZA 3WJJC 2NZ9D 1KNOB 4JZJB 1JNNL 5EBGA 4WFHE 4JANB 4L9LA 4NO0A 5DD6A 4DGIL 5FO7B 3GFUA 2CRMA 2DWEB 2D4DA 1A7BA 3O3AA 1CN4A 1TQCB 3FQTA 4G8FB 3X13B 3OWEA 3SDDD 4KQ3L 5E6IA 3TT3L 3IVKB 4Z7VA 2JELH 4FZEH 5K9QI 1WZ1L 1B3JA 4MS8D 2VO5A 3GM8A 4P3DB 4JN1L 4XTRD 3WHXA 5HYEA 2OK0H 3MLZH 2J6EA 1PX3A 3LEYH 3QRGL 3S3PA 4PJCB 5I1DB 1VFAB 1U8KB 4I4WB 2OMNA 1JJUA 3O41B 1W0YT 4WV1B 2Y1VA 5E1HB 3OKEB 1UXWB 1VENA 5A2IH 4MAYC 1H15A 1BIHA 1DUYA 3I3DA 5C71A 3MPCA 5ICXB 5CGYC 2CJUH 3UYRH 3FB5A 4LCWB 5A40E 5I17B 3NCFB 3MACH 2W91A 4Z76B 3DVNA 5DT1L 4GQ9H 1MFAL 3HNTH 4HH8A 2FJHB 3G5YA 4KK8C 3C8KB 5E08L 5GIRB 4CU7A 3A6OA 4HS3B 3BD4A 4UUJA 1WBYA 3TYFA 3QQ4A 1E4WH 5DD1H 2MHAA 4OZFA 4C56E 3VI3E 2F5AL 3K8MA 3X14A 2UVEA 4RQQA 1JP5A 5HYQA 3PP3H 4MCZB 4MD0B 1FVCB 4LCWD 3RWFA 4XPTH 4P5MA 1MCIA 1YEGH 4B0MM 1NCWL 4Y4KB 2WUCL 4S1DD 4MNQB 5BOPA 3ARFB 2CLZB 3Q5TA 3S5LA 4PBXA 4PJFE 3S6CA 5MP6H 3SKJL 4YJZL 1JMZA 1QLRB 1JUFA 3MYZA 1JGUH 2GJ6D 3STZA 4TVPD 4QRRB 3GRWA 4ZNEE 3E3QE 4YEEA 5EU7E 1FLRL 5CKAA 2EDJA 1HINL 4CVWA 1XF2B 1FIGH 4XBGA 3AM8A 5TE4H 3B9DA 2WINA 3X17A 4PJEA 1RIUH 3O0RL 4QXGH 3F58L 1KTDB 1T1ZA 1V7MH 1AGDB 1XZ0A 4N0FB 2EIZA 2QKIB 4JO1L 3NCMA 3OGCB 1F58H 5I1GL 1JYWA 1DEDA 1MI5A 1X5YA 3PGCA 4FFYL 5B39A 2VDKL 4U1LA 4UMGA 4OCYL 3E6HB 4IRZL 2NLJB 4HWEH 1X7QA 2O5YH 2Y72A 1HIMH 1QSFB 1T5WB 1CWVA 3SY0B 4ZO7A 5A2LH 4FNLH 3FAXA 1NC2D 3DVIA 3KJ6L 4RMWA 4LLWB 3B83A 3FONA 4Z7OF 2GUOB 1IKFH 4KJYA 1AC0A 3LH2L 4M48H 2P5EB 1R5VA 5D96C 4OCNC 5DD0H 3DNKA 2E6QA 3HCVA 4W6YB 5EZIH 1Q0YH 4ZOCA 2NTFB 1KJ2B 2IPKB 4WWKB 1K4DB 1S7UA 4PJBE 4ZD3L 1JPTH 4HIHA 1KB5H 5D7IF 2BHYA 3CSYB 4MYWB 5KG9A 3GK8L 3Q6FA 1WZLA 2F9BT 5C0NC 3X11B 4QT5B 3UJTH 1LO5A 4QRUA 1OSPH 1MY5A 3EJYD 3MV9D 3ULUF 2JJSA 3PWUB 1I75A 4CNIB 1KLUB 1V3LA 1MCPL 1MCWW 3MMEB 2ESVB 4UB0H 2AABH 1A5FL 3RVXD 2F5BL 5DC0A 1FZOB 3WYRA 3CLEH 5BQ7A 3CFEB 1INDL 3FN3A 4FQCL 1IC1A 1OAXL 1GGCL 3ES6A 2LU7A 3QQNA 4XPGH 5D2LB 5MI0B 2J8UE 3MROB 1AQDB 4QF1B 4O2FA 2DWDB 5FF6B 1A9BA 2B2XL 5TPWH 1CGWA 2UYLB 1G1YA 2WLYA 3NFNA 3C60A 1KIPA 1EEYA 3MLVL 3WL9B 5IGXH 5DEGA 3O8XD 1I8IA 3BGFB 4EQ2A 1D9KD 4KXZI 3VXTA 4U6YA 5CCKH 2Y07H 4TVPH 1GL4B 5CEZL 1KC5L 3GBNH 1UZ8A 1E4XI 4WUKL 3QUZC 3MQIA 4BSVB 3QUYC 1NLBL 4MJIA 1J5OH 3LB6C 3NIFF 4PJAF 4PJGB 4RMUA 4KJQC 1PGRB 1LO4L 1LQSR 1OAZL 4GUPB 5EBLA 1IGFL 1T21A 1T1XB 4Y4HB 3S36L 4G9FE 4OCMC 4FHBD 3DX9A 2HT3D 3H9YA 1LP9A 1RZGA 1C1EH 2R0KL 3S7GA 2PXYD 2B20A 1J1XL 2DQTL 1MWAA 2VSDA 3MRQB 5JOFB 3U36A 4AIZA 2LVCA 3JUYA 1KCRL 3N06B 5AWNH 3MRBB 1OD7A 5BO1L 1NGPH 5DJCA 4EUPA 1SY6L 4HIXL 1I1YA 4LNRA 1P2CB 3ZL4L 3ULUC 2PYEE 2A74B 1HHKB 1MQKL 5HXMA 4PPTA 4PLKC 5E5MA 5DZNA 4JE4B 4K3DL 1WIOA 4NQTA 1F02I 3CDGB 2YZ1A 3BDYL 3DETC 3QHFL 4OGYH 2VL5B 4NKDB 2HH0H 2VXQH 3FOLB 3BH9B 2YS4A 3OJVC 3QUXA 5GGQH 1RK1A 3O6KL 4NKOB 2PW2B 1T1WA 3QULB 3VWJA 5IFHH 2HFEB 2AQ2A 3HE7C 4CVUA 2NY7H 3QFJD 3UBXA 4PJIB 4URTB 2HLFD 5E5RB 2K9UA 1JNNH 4X8JA 1CDJA 3THML 4DGIH 5E9DB 2VLKA 2CRIA 1HQRA 1MCBA 1UJ3B 3QWOA 4C56A 5KN5B 3NMEA 5ISZE 1OLZA 1WZ1H 4I3SL 4NDMA 3FQNB 1OP9A 2AJSL 3KYMA 4JN1H 1U8PB 5EU3A 1EIBA 2X4NB 4ODVL 1QUNA 1FG2B 4PG9A 4M62L 4CN6A 3IETB 1EMTL 2FIRT 3S4SB 1AD9A 3H7LA 2Q76A 1YMME 1Q8MA 3QJHA 1MIEL 2DICA 5E9DD 2ZNXA 4ODHL 4ZPTA 1RZJL 3TYGL 1FZKA 4NRXB 1K6QL 2CDFB 1MFAH 4JY5L 3PWNA 4U1SB 4X98B 3TZVA 4ZUVA 5C86A 5E08H 2BCKA 2DYPA 3MRKB 1PY9A 2XFXB 4RGMC 5T3ZL 5FM5M 4KC3B 2C5DC 1P1ZA 3UBXI 2X9YA 4JFFD 5KOVC 2F5AH 2FHBA 3O4LB 2X89A 5TH2A 4HXAL 5H37H 3T0EC 3SE8L 3LOWA 4JO4L 3CNKA 3KNBB 4Z7UA 1JTPA 1ZHNA 2BSSB 3RVWC 1ZHBA 2IH1B 4HFUL 4DAGL 1NCWH 2NXZD 3FFDA 1KIRA 3VXRD 2EEDA 2X4SB 1A1NA 2WUCH 4GAGL 5DQ9A 2P8LB 4ORGB 3SGKA 3VDCA 2COQA 3SKJH 4MZ3A 1KLFA 4LSDA 3IFPA 3VG0L 1B0RB 1S9XA 5IKCA 5CEZD 1FRGL 3GMPB 5E4IA 1FLRH 3S8WA 2GCYA 1HINH 2VLRD 1DVFB 3DBXB 4N9OB 3HTLX 3BEWB 3SDCB 5IW6B 3IKCA 5BZWA 3O0RH 1Z5LA 3F58H 1JWMA 4HBQA 4LIQE 2BSRA 4JO1H 2UZYB 3G9AB 5I1GH 4Y16B 3MRJB 4MAYB 3QEUA 5I1HL 1JPST 1K5NA 1XF5B 4FFYH 3RKDC 3EBAA 2IQAA 1FFPB 2VDKH 3RL2A 4OCYH 4OM0L 2A6DB 3QZWA 3ZSSA 3CLFL 4IRZH 5F6HI 1DN0B 2AJYL 1BHGA 3K4ZA 3D87B 5F7DB 4UU9B 4NQSA 5HYSG 3TBWB 1IGCL 4XRCB 3D39E 3BP5A 4XPBH 3KJ6H 2YPLE 4NQEB 3ALPA 3RL1B 3VXOB 5D72H 2J8UA 3TVMD 3LH2H 4KDVA 5SV3A 1FO0A 3EO1B 3OKDA 3FQWA 1J8HB 3HHRB 1QFWM 2E7CA 4GAJL 3IDUA 3L95A 4G6FD 4M93C 3ARUA 4HFWB 2QSVA 2OS7A 3WFDL 5E2UL 3GIVB 5T1DL 4FABL 2YD9A 1JGEA 4JPIB 1UEMA 4JM2C 5TGBA 1T20A 5F6HJ 1NKRA 1MCPH 1YMHA 3W0WB 1A5FH 4YDKL 4GW1B 1INDH 3I50L 4AEHL 1EEQA 2HJFB 3AU1B 1OAXH 1I1FA 1GGCH 4S2SA 4CMHB 4NT6B 3V7AE 1MCCA 1I8LA 1OQOA 5C08B 3LN4A 1UXSA 1F42A 3T1WA 4DOHE 2QV2A 3DROB 2BERA 2B2XH 4U1JB 3TGXA 1II4E 1DQMH 3HE6A 3T8XB 3PGFH 3R8BB 5F72S 2HT2C 1HWGB 1NFDB 3MLVH 2DD8L 3VXSD 5CMAB 1NGYB 3K1DA 3D9AL 5DJYA 1Z6JT 3TNNB 3AAZA 5CEZH 6FABL 1KC5H 4G6AC 1YEHH 3SOBH 3VXQA 4WUKH 1LEGB 4XB8A 1NLBH 3IDGA 3LVEA 5DS8B 5IVXB 4U7MA 1CR9L 4Z5RA 5IV2B 3OKLB 4LLYA 3RTQB 1LO4H 1OAZH 2X5PA 4UIMB 2OJEA 3S36H 2GIYA 2D0HA 1U8NB 4PJ8C 3TBVB 4KTEL 1BZ9B 5D96B 1PAMA 4QHUA 3V6ZB 1CF8L 1RIHH 4NIKB 2CLRA 1J1XH 2DQTH 3JVGC 4WY7H 2NR6D 1CFTA 1BIIA 3VH8A 5C0EB 1KCRH 3B5GA 2OI9C 4MA1B 1IM9D 5I73C 2X4PB 5BO1H 2YUZA 1RHHB 3V8CA 5ISZA 1SY6H 1I7ZB 4HIXH 4YK4C 5JHDE 3MUGB 3RTQD 1XR9A 2GJZA 4TTDD 3ZL4H 4RFOL 1UH2A 1A1OB 4HIEB 1MQKH 2O5XL 3BO8A 2C1OA 3WO4B 1QQDA 4IRSD 3MCKA 3EOBA 4MJ2A 4K3DH 1TITA 4Y2DC 3GUTB 1HYSC 1YMMA 3ORJA 3RPIA 3JV4B 3BDYH 3QHFH 1L9NA 4M00A 3OSKA 1R24A 2VXTL 2H3NB 3L6FA 4P5KB 3GKZA 3O6KH 3HMXA 1ACYL 4K8RH 2VE6A 2FSEB 1WTGT 1R3JA 5IEHA 2HFGL 1VESA 4LGRB 3THMH 5IW1B 1GSMA 4OQTA 3KPPB 3B43A 4XCFL 5DJ6B 3GSNA 2HT4C 2QSQA 3CFDB 1MIML 4I3SH 1OPGL 1BBDL 3QUZB 5FUZH 5FYLH 3S36X 3QUYB 2AJSH 5JIKA 3WS3A 3B2VL 1NEZA 5HGHB 4PRBB 3MGOB 1UWXK 5DHVB 5EOCJ 3I85A 3DX7B 4N68A 5SWQA 4M62H 5HPOA 3HLAA 3OX8A 3PV7A 4UV7H 1EMTH 1VEOA 4LQFL 4M1GL 3OB0H 4OD3L 4MX7B 1T4KB 3GSXA 2FNBA 1CL7I 5DQJB 1PKOA 1XGQB 5DJDB 1NEUA 4LDEB 1F3DH 4M5ZL 5DUPL 1LWRA 4ODHH 5K9OB 2IC2A 3MJ7A 5J1AA 1OAUL 2PETA 2BNRD 1K6QH 1IGYB 5D7IB 4OLZH 3SKNB 1VADB 1E6JH 2A6KB 3DUUA 3H7BA 1IQDB 2EDHA 3H9SA 4Y5YB 4PRPB 2BVPA 1P7QD 4FQHA 5L2JB 4LSRL 2MWCA 3PWJB 5T3ZH 4J23A 2B39A 3CH1B 5E2TL 5E2VL 1W2KT 2JIXB 1KOAA 2VDRL 3ALWA 1U58B 4L4VD 4D9RE 32C2B 5EBMB 4OSUL 4J1UB 4PREB 4LPCA 4JO4H 4OTXL 2E7LA 5D1QA 3MLXL 5D7LA 5DHYA 2IG2L 4OV5B 4HUWA 1MHCA 3NAAL 1IGIL 4DAGH 1CZ8H 5IHUH 4QRQB 4K2UH 4NNXB 1RJYB 2M1KA 3HE7B 1IM3B 4GAGH 4TSCL 3RVTC 2G2RA 4FMKA 3GMQB 4PRPD 1L7IL 4MMZC 4XWGL 5D1ZB 3D39A 4BFBD 3CCHA 2YPLA 2ADJA 1ZHKB 3VG0H 1GH7A 2X4QA 2VZSA 4I48B 4YC2B 1FRGH 2JIXD 5T5NG 1X9QA 3ZTJG 4F8TA 5BJTB 2Z8SA 4UQ3A 2Y9RT 4JFXB 2EO1A 4RDQF 4JG1L 5E4EC 3T09A 1UB5A 1YN7B 5C7XL 1VFBB 1BBJA 3BI9X 4JRYB 1DUZB 5CIPA 3MZTA 3IGAA 4AENA 2VLMD 2R1YB 2EICA 3MNZA 5D1ZD 1CDYA 4F57H 5KVEL 1QBML 5GRXG 5CJQH 2I25N 4UDUA 5J6HA 2P5WD 4WNQB 4FXGA 3GSUB 5I1HH 1DANU 2A6JB 4OM0H 1OGAA 4UNTA 3VG9C 4UT6L 4X4YB 3GJFB 3CLFH 4LHUA 3SJVD 3OXSB 4PYHA 2P8MA 2ZCLH 2X41A 2AJYH 3D0LA 2BXZA 4LFHD 2BDNL 1P84J 1TVHB 1LE5B 1OTTC 2BVOA 1A3RL 4DZ8B 4K7FA 4F33B 4JFHD 4RGMB 3FB7A 4R4NC 5DQDL 4FFWC 1BVZA 2NY2C 4JVPA 4NM4L 2NNAA 3NH7L 3PHQB 1BD2B 3LN9A 1I3RA 4J12A 4GAJH 3W5NA 3ZMRA 1PKQA 2IEPA 1OW0A 2YEZA 3L3OB 3OR6A 4LSPL 1H3PL 1L7TH 2BMKB 2UZXB 3WFDH 5E2UH 5T1DH 2E8YA 3V0WL 4FABH 3X3FH 5L88H 4LSUL 4NCDA 3RUGE 1AO7E 3PABA 5IQ9A 4KK6C 4NZTH 1MVFA 3OQ3B 2VAAB 3IDJB 1YY8A 4NPYB 4A6YL 1JNLL 1MCWM 3T4YB 4EJ1C 4YDKH 3W39A 3I50H 5DYOA 2GTZB 4AEHH 1BAFH 1F2XK 1CDBA 1S7WB 4HQQL 2IADA 1S7SB 3LSOB 1LEKB 3S97C 2E5EA 4JCMA 1IKNC 4DTGL 3KWWA 4NUGL 3DX6A 2OSLA 4JY6A 3KPSA 4PB9L 3GSQB 1BZ7B 4Z7WE 3GMRB 2AVGA 1C08B 4X7EC 2D9CA 5C07A 4X6EA 5JHDA 5EB9A 4YBQC 1G7JA 2A0LD 1HILA 2OR9L 5HI4C 5IG7B 1JZ5A 1BJ1J 2NW2B 1HHGA 3B9KD 4TTGA 4DCQA 6FABH 2DM4A 5DRWB 1SEBA 3MRGA 2VERN 1PYWA 4IOFC 4EVNB 1CR9H 2IH3B 5ICZB 2PO6C 2FD6L 3AY4A 5IMMA 2RB8A 5FKAA 4M9OA 3BXNB 3QHTC 4QWWC 4KTEH 5FM4A 5HGGS 2X44D 5HSFA 4L1DA 1CF8H 3FT4B 1EHNA 3CDCA 5J56B 3AC0A 1U8OB 1UWEL 5CJOL 4P2OA 2BZDA 2Z91A 4X99B 3A0OA 1KXVC 4J4PA 3UJJL 1P4IL 4MA8L 2CRZA 3OKMA 4KKNA 3U4EA 3W9EB 4OCWH 3G9VA 4P2RA 3V6FA 1GAFL 5JTWA 4JM2B 4RFOH 5ANMB 4YFLF 2O5XH 1T83A 3MJ6A 1CVSC 5FUCE 3RGHA 3MRPA 4LP5A 4CW1A 1R0AL 3VFPA 1RFDL 2FEDD 4I8DA 1J0JA 4LPWA 2ICEA 3RWGB 2ADIB 2VXTH 4U33A 4GAYB 1CXEA 2ZOLB 2ADGA 4V1DE 2DMCA 4HC1L 2FIKB 1DDHA 1ACYH 3PWPB 2GFBB 1G6RA 5C0GB 1WITA 4HCRA 2OMBA 3ZSTA 3V6OA 2DKMA 4XCFH 5K59E 1JWUA 1AGCA 5ID0B 4O51B 1MIMH 3HA0A 3BH8B 1OPGH 1BBDH 1NAMA 2HG5A 1XIWB 2ATKB 5K93A 2BSTA 3HZMA 1TZGL 3B2VH 5AG9A 3DRTB 1A6AA 2DKUA 1YYML 3LS5L 5JIHA 3AGVA 1NC4B 5JHLL 5I8OH 4ZAKD 5DJ2B 4MQ7A 5GJSL 3C2SA 3VFMB 4NKQB 4LQFH 4M1GH 5IVOA 1U3HB 4PJ8B 4X6DE 4NQVB 2J5LB 5J12C 2C9AA 2C7UB 3JUZA 3B9AA 4ZUWB 3TO4D 4M5ZH 1EAPB 4MD5B 4XZUA 4JDTH 2XZQL 4J2XA 5CJXA 5DR5H 1FGNL 5CILL 1OAUH 2XN9E 1M7DA 4PJHB 3PHOB 4W4OC 5I73B 1IJ9A 2D7QA 4FFVC 4Y4FA 4AT6B 4Q0XH 3LN5A 1ZLSL 4G8IB 1XIWD 5IQ7L