4XNYH

Crystal structure of broadly and potently neutralizing antibody vrc08c in complex with hiv-1 clade a strain q842.d12 gp120
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
234
structure length
234
Chain Sequence
QHSQVQSGTQIKTPGASVTLSCGTSGYDFMESLINWVRQEIGKRPEWLGWMNPRGGGVNYAQRFQGKVTMTRDVSSGTAYLTLRGLTSDDTAKYYCVRGKSCCNGRRYCNGADCFNWDFEYWGQGTLVIVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160,Enve
publication title Maturation and Diversity of the VRC01-Antibody Lineage over 15 Years of Chronic HIV-1 Infection.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 40
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xnyH01
4OTXL 5TF1L 5ITBH 1QPPA 2F8XC 1IT9H 4H0IA 1A6WL 1RJCA 4GAFB 1M05B 1EBAA 4LFHD 4HH8A 2YN3A 2QQNL 1YA5A 1S9YB 2BRRL 5I1CH 3VD9A 2C3HA 1NCTA 2NXZB 1AD0B 3O6KH 4MJIA 1CE6A 1WZLA 1JHKL 4UTAH 1GVIA 4L5FH 4IJ3C 4XCYA 3HG1B 4HUUB 5MI0C 5C0CB 2QBWA 1T5WB 3O3EB 4YDJA 5BS0D 5I66B 3PL6A 2BP3A 5CFHA 2HFTA 1RFDH 3DHJA 3X3GH 4S0SD 3A6BH 4MJ6B 3KS0H 3SPVB 1BF8A 4P3CL 4TOYH 5HYSA 1H8OA 2BHZA 3ARWA 4OB5H 4G8FB 5KSBF 1E6JH 4GFTB 2A1WH 3GJFK 3TWCH 3UAJD 3NTCL 4BH7B 3RWGB 4Z7UE 2EDWA 3MLWL 5I8OL 3V8OA 4X4YA 4QXUH 4J3WA 2R0KL 2VZUA 2GTZB 3MLXH 5ICXA 4ZOEA 5DMIL 1BZ7A 5FA4A 3MSPA 3X12B 3LN4B 4RRPA 1E6OL 4NJAH 4UOW0 5FO7A 4F15C 2PXYD 4JN2B 3U36B 2AV1B 1G9ML 5J6HA 1B0RB 1A7QH 2DQEL 2R2HB 4HJGB 5LXGL 5E9DB 4QRRD 3AMLA 4HGWB 5ANMB 2F19L 2GJ6B 4U6VH 1QO3B 3SGKC 2IADA 2HT4D 7CGTA 1WGOA 4I77L 2XTJD 3FTGB 3TPUB 3QUML 4G6MH 5DDHB 2IAMB 1QFWM 2JCCE 3AFLA 4XTRD 3I6LD 1MVUA 1TCRB 4K71B 4KTEL 1HOCB 5E2WH 1FVDB 1H15B 4EKXA 2C4XA 4MA3B 3O8XD 4DCQB 4G9FD 1KYOK 1XGTA 2AJSL 3LRSB 5EA0L 2A9ML 3ULUF 2VDQL 4WNQB 2W9EH 4KDWA 4KH2A 1IAMA 4YBHA 4RMUA 4EIGB 2FEEL 3TYGH 5J13B 3G5ZB 3TNMB 3GO1H 3JV6A 5DVOA 1CLYL 3QUXB 5I19L 2XWBA 4HIEA 1OT1A 3B9EA 3HZMB 1D5BB 3GIVB 4PJXE 4NT6A 1UWEL 1QD0A 4YHKL 1CXLA 4XCFH 5DSCB 2VYRE 5E6ID 3WIIL 3L3IA 1P7QB 5T1MA 1FVCA 3FFCB 4ELKA 4FNLL 5T3ZL 1IGIH 1M4KA 4NCDA 1HQRA 1KNOB 5F93C 3Q6GL 2APXA 2WK2A 3RVXC 2IH1B 1SVCP 3EO9H 1JE6A 2XRAL 5LGHL 3RP1A 5I73B 4Z7QE 4YHOL 3HE6A 3ARFC 3D25B 4K7PH 4E41A 3MRJA 5JA9A 1D7FA 3BZDA 5BJTA 4Y19A 3TN0D 1JYWA 4YFDB 1MCPH 4PG9A 4OZHE 4N90E 5D7JD 4Y16B 2GCYB 2OM5A 3DPBA 3IKCB 1ES0A 1UVQA 2Y23A 2VDNH 1FNFA 2YXFA 4PJAA 3NFSH 3OG6B 3TBYA 4QRRB 1CZ8L 1QLFA 3WJJA 5C7XL 2DI7A 4IRZL 4Z0XB 5T1DL 5GXBB 3S88H 1AKJD 2Y36L 3HUJB 3ZHKA 3OWEA 2FL5B 5ERWB 2AXGA 2P7TB 4U1HA 2FGWH 3IJYA 1FE8H 3TBSB 3WN5C 3TJHD 2AJ3B 4MAUL 1KIRA 3GMQA 5AWNL 2I9LA 4GSDL 4XCNA 3RKPA 4NOBA 3VWKD 1WT5A 3MBXH 4KROD 4Q0XH 5DR5L 2HFFB 1OW0A 1N26A 2BDNL 4PV8B 3T0AA 3C5SA 4X4ZA 3G6JA 2MKLC 4AK1A 3MV9B 4I0PA 1WFOA 3MC0A 5C0AD 4AEEA 2IG2H 3HNVL 1JV5B 1TIUA 4XPHH 1DVFC 5FECA 1BMGA 1AI1L 3KXFD 4KKBD 1XF4A 3BKYH 4HX1A 4P4RA 5ESQA 1HHGB 3UTSE 4FQQB 1ZLVK 1H5BA 3TC9A 5SWZA 4BSWA 4KK5C 2UZXB 1LK2A 2DQFA 4KUCF 4UMGA 5MEQA 4I18C 4HD9A 1U3HA 1J7VR 1M6OA 2YK1L 1N6QL 5MEPB 5MHSD 2YPVL 1J1OH 4XPFH 4JFZL 5DJYA 4U1SB 1KV3A 4G8IA 3OHXA 1RZJH 1WT5C 4JFED 3GKZA 1KN2H 5MENB 5GS3A 1MREH 4XPAH 3ILPA 3W2DH 4DGYL 4HKXB 4KK9D 1EHLL 5CCKH 1PGRB 3F12B 4DUWA 3LD8C 4I9WE 4PJIE 4HUWA 1JNNL 1MHEB 1U91B 1UZ8A 4AM0A 3HMXL 3QUYD 3OJDB 5IQ7H 3RVWD 2RCSH 1I4FA 4GG8B 4EBQH 1QKZL 4L8BA 3FN3A 3B6SA 5MEOA 4S1QH 1A7BA 1XGYH 2VB5A 2H41A 5C2BL 3JVGA 2IANA 3GSOB 3P77A 1NLDH 2R56H 2X9YA 4L9LB 4QT5A 1JRHI 3QHZL 3R0NA 4DJMA 3DGCR 4UOJA 4M93B 3SO5A 5AG8A 1MJJB 2QSQA 1QFWI 4PRHB 2I9TA 4WGVB 4Y2OA 5AAMA 1J05B 5EBWA 4MB3A 5AYUL 5GHWH 4ZS7L 3SE3C 5H35A 5A2JH 4I13B 3ZE2F 4O5LH 3DETC 3HPJB 3QEQA 3P11L 3CFEB 2XT1B 4ZUVA 1RULL 3ARBA 3PWUA 4JM2D 2A0LD 1J5OH 3BH8A 5DLML 2H26A 5D2NA 2YWZA 4Y89A 2EC8A 4N9OB 5CKGA 3GBLA 5ACMA 4JG1H 4ERSL 1S9VB 1H3WM 1MNUL 2XQYK 5C6PB 4RFNC 2B0SH 4R7DA 4CADB 4GW1A 3MCLH 2DJSA 4HWZB 4FZ8L 3LKOB 3L5JA 5EC1B 4ZS6D 3DVNA 3B9AA 1CFQB 3RFZC 1RJLB 3IB4A 3FONB 3HZVA 3KNBA 3MOBL 4OCWL 1CLOH 2OXHA 3I75A 4TRPH 4CGTA 3HMXA 4OLVL 4XH2B 5DJAB 1C16A 2H9GA 4MNHA 4HGMA 1B4RA 2NPLX 4Z7WF 5JTWA 1AO7D 1TDQA 4HJ0C 3VJ6B 3H3KA 4OZIA 2X1OA 3P9LA 2P5WD 1HCVA 3GDBA 5B38B 4D3CH 3PE9A 5FUOL 4FFWD 4XMPL 3CPLB 2ITCB 3KPPA 1UWGL 2VDOL 4LLQA 2FATL 5JNYB 1IQWH 3V6ZA 3MRCB 1SMOA 3JTSB 5HGHA 4HBCH 4PJ9D 2G5BA 4O4YH 4YQXL 4MLIA 3BRFA 1FQ9C 1DL7H 4OZGF 4GRWH 4XMLL 1W0VB 3O2DA 4OFYA 4PB0H 4LNRA 4ZXBD 5DRNB 3O3AA 4YGAB 4K3JL 1OHQA 3QXDB 3W9EA 4WWKA 3GM0A 3NBNA 2G2RB 2NY0C 1OAXH 2NYYC 4J3XA 2DWDB 3DUHA 2FR4A 2QHLA 3R06A 2VLLA 1AE6H 2JKXA 3QWRD 4J8RB 2MPAH 2A6JA 1ZLWK 4D0BB 1MUJB 3F58L 3M1BB 3KYMB 2EC9T 2J8OA 2LAGB 4LLVA 3FCTA 1CLCA 4NN7B 4OUUB 1CD1B 4JZJA 1I9IH 2A73B 5LAXB 4X6DA 5BMFL 4N0CC 1B9ZA 1NDGB 4HUXA 3ULUH 4NQED 3BHBA 4U6TA 2B4CL 2BVPB 4WV1B 3UYOD 2LU4A 1JTPA 1JYXA 2YD9A 2EDBA 2WV3A 3ARRA 4HMDA 5FGBA 3C5JB 4GRLA 5I1KH 3TA3B 5CZXC 1UXWA 4JPIA 5C3TA 1F8TH 4OZHF 5FB8B 4L8SA 5I1LB 4KKLC 4P2QD 4W4OC 5E9DE 2ZCHL 5EOTB 4LSUH 2GJ6E 5I16A 1FH5H 4PFEA 3MGOB 3K1KC 3M8OH 3VRLE 4FQXD 4HWBL 1DSFH 1INQB 1AR1D 5A2FA 4OZFA 1QVOA 2X44D 5CSBA 3C6SB 4G6AC 5E6ZA 4B50A 5LWYH 1HYRC 2W0LA 2B8OT 4AT6B 1RK0B 1A7NH 1ZS8B 4KUZH 4JZJC 2DYPB 3WDIA 4WFED 4UQ3B 5I74B 1IGTB 3V7AG 2HVJB 2P24B 4XNXL 4S2SA 3QPQD 2M1KA 2R4RL 3A6CL 1J12A 5ACZA 1E4WL 1IEAA 2Q86A 3FQNA 1YPZB 1FN4A 4N0FB 3VFGH 3WIFB 5TE4H 4GRWB 3MRGA 3UP1A 3D3VA 5K59E 4LSVL 4FFZL 1I1YB 3SE4A 3LZFH 1A6UH 2VR4A 5DURD 1OB1B 1U42A 3MLPA 3QDMD 2JJSA 4P3DB 5JIHA 4JZOA 3MREA 2HJLA 5E99H 3FRUB 4NHUB 3WE6A 1U2HA 5J4MA 1F11B 4MA1C 2DWEB 1CFVL 4JRYD 3ZE1F 2IALB 3MJ7A 4HS3A 2D7TH 5B38G 3MLTA 5F72S 3HA0A 3T77B 2J8HA 3GJFH 3BO8A 3KPSD 5DK3A 4IBLT 4G6FB 3PWPB 4UT6H 2GAZB 2RQ8A 1QNZH 4JFQB 5DO2D 3G6DL 3CLEL 3FMGH 1FBIL 1ZV5A 3GBNL 3QDJA 3VFPA 4AH2B 1XZ0B 2ZCKL 2Q7NA 3T65B 1KTLB 5HGAA 4PBXA 3LAFA 1GRWA 5DMYA 4QRRE 1JZ3A 1EPFA 3VGHA 2EDKA 5JDJA 4LKCA 3CXDH 5EH1A 3KPMA 2XIDA 4GXVH 2EYSA 3Q3GB 1CDGA 3O2WH 2MCPL 3HUJE 3R1GL 4N0UE 3PGDB 3I6LE 2GHWB 4PGDA 2B4CC 3FZUC 3BEVB 3HC3L 1T1YB 2VZVA 4X6CB 2APFA 2VLJD 2VAJA 2E6PA 3AS2A 4APQA 4DVRH 1KIQA 2XPGA 2B1HH 4PRAB 5L8LB 3F7YB 3LQZA 1ZHBA 3PHQA 5IW6A 3BP4B 5IVXF 3FN0H 1M05A 4JGJA 1S9YA 4LLUB 1SY6L 4KKCC 5K9OA 4JO3H 4O2FB 5GSVA 3SGJA 3DSFH 4M43L 3ZTNL 3MV9E 5HXMA 2E9WA 4IOIA 4U4BA 5E2UH 1UM4L 3OKMA 4H25A 3S4SB 2NXYC 5ENWB 4HUNB 1WVZA 4PD4K 5I8CB 3L3JB 3HG1A 5FM8A 1HEZA 4JG0H 3ALWA 3C2AL 5C0CA 3IFLL 3EYOB 2EXYC 3O3EA 4LSSH 1K6QL 2Z35A 2AP2A 2N56A 2FEEI 1QRNB 2VDPH 3WSQL 3CH8A 4J1UA 1H3GA 1I9RH 1NAKH 4MJ6A 3SPVA 1FC1A 4G8GA 4UTBL 1H3PH 3HAEH 3VXMA 5T33L 3BD4A 2R2CA 1WEJL 1FORH 4QRPD 3SKNB 4G8FA 3N9GH 3ULVD 43C9B 1CICB 3O6FA 3GJFB 1LQSR 1TFHA 2KH2B 3QEUB 5T1KD 4RMQA 3MRNB 4NN5B 4ONFL 5F70A 5E4IA 4PD4J 4F7TA 3ARDB 1FAIL 4R9HA 1IM9D 5FEBA 5MENE 1VGEL 5ALBH 2W65B 2C1OB 3U2SB 3M45A 4XWGH 3QJHB 4KY1L 4RZCB 4ZPVA 5F9WB 4D9QD 1PKQA 3SGJC 4UV4L 3U36A 4Z95H 3DGGB 3BIAX 1B0RA 1FLTX 2R2HA 4N0RA 1PBYA 4XRCA 4LCUB 3GIZL 4LHJB 4LPXA 2X4PA 2VZOA 1VFMA 5ANMA 2HH0L 4R97C 3W11D 1LO0L 1MCOH 2NY1C 5C09B 5C07D 2VLKD 1JUFA 2IAMA 3MACH 5GQBA 4XNUH 3OXRB 3QIUB 1AIFA 1GJIA 1XF5A 4RFOL 2EICA 1TCRA 5I75C 4F57L 4A6YA 4JLRA 1H15A 3B9KB 4Y8DC 2X1PA 4NNPL 3U9UA 5IFAH 3VD5A 4N1CA 1EX0A 4ETQB 1XR8B 1KCVL 4B5EA 3TNMA 4Y5YB 4AEFA 4NWTH 5ADPL 1P7KB 4OCXL 3V7AE 3SDDA 2NY3B 3L6FB 3VRIB 3MV01 4P23C 5I9QB 1D5BA 2PYEB 5IB1A 1VGKB 4UIMA 1CXKA 1EEYA 1EZVX 2J6EH 1MCJA 4WHDA 5GIRB 3LH2L 2VSCA 1ZGLA 1KXQE 1T3FA 1U8LA 4AG4H 1JPTL 1M71B 2NNAB 5BVJB 1ZLVH 1ROWA 3FFCA 3EGSA 5DD5H 5HDBE 5TQ2L 1BAFL 4QRQB 1S9KC 2EKJA 2KUTA 3IDNB 2IMNA 1R24A 3EKCA 3QAZC 2IH1A 4NSKB 4JVUA 1UB6A 1MQKH 4Y4FD 3D25A 1U8IB 4P4KA 1YMHB 3QT2A 5D1XD 1GYAA 3KPNB 5KSVB 5CSZB 1Z9MA 5T5FL 2BCKA 5EU3A 4UOW1 3NCCB 3IKCA 3W0WA 1IKFH 1F3RB 4U1NB 4BFIA 1F4WH 1PX3A 5ADOH 3C6LB 3S4SG 3NFNB 3JV5A 1PJ9A 4IDJL 4DZBA 3ULSB 2BC4A 1AXTL 1OAUH 4NM4H 5EO1B 4RMRA 1AJ7L 4Z0XA 2J5LB 4WFFE 4XWOD 3IF1B 4U1LA 4JO4H 2VC2H 1AH1A 4D0CA 2FL5A 2F54B 2BY0A 1ORQB 1AGEB 5ERWA 4HXBL 4YHYB 2K7PA 2P7TA 5A43C 3BZ4A 4NZUL 1J8HD 1QFUH 1BD2D 4MAYA 4LSRH 4URTB 4D9LH 4U6XB 3DJ9A 4Y1AB 3PQYD 4LF3A 5TF0A 1N5YH 2UY7A 3BKMH 2V5TA 1E4XH 2VLME 4TNVK 2OYPA 1KXVC 1QYGH 3HR6A 4P4KC 4PLNC 2V2TB 4X99B 3WFHB 4DAGH 5E56A 2EE6A 2FX7H 3BWUC 3GSXB 4MJ5A 1KLUB 2ITDA 2UYLA 1I1FB 3OQ3B 4NYLA 1JPGA 3ZTJH 5SV4A 2RAMA 4NDMB 3PP4H 4LL9A 2R23A 3MPCA 4I5BB 3GMMA 1NMAL 5FYLL 4ENED 2CH8A 5EFIB 4ZO8A 5FDYA 1JV5A 4P2RD 3DBXA 2PR4L 5GGUB 3O6LH 1RZFH 3OX8B 1OTUD 1QBLH 2PUQT 1SYVB 5DZNA 2X41A 5F1SA 4X7EC 4PLKC 2OR9L 4MHHG 2NY7H 1FYTB 4IRSD 1WBYB 3QI9D 3ROLA 3IDIA 4S1RH 1KGCE 3HB3C 3EZJB 5TGBB 3QQ9C 1C7SA 1T0MB 3BEWA 5DS8B 1OAZL 3TYFA 3PDOB 3UJTL 3KVQA 5MEPA 3VXRD 5C0IA 5ETUA 3ARZA 4G43B 2G75B 1BFVH 1J0YA 3F7VB 4MX7B 3O41A 2A6IB 3BKCL 4F37F 4G8EB 1EJ6A 2VR5A 4WTXA 1U8JA 4QHLB 4N5EC 1ZA3A 3QRFM 3BESR 1MH5A 1MHEA 4M9PA 1YPZE 2O5XH 5EOCJ 1UM5H 3I85A 4ELME 1UKTA 3RWJA 1QHPA 2IQ9L 3QDGD 3MZTA 4KDVA 4Z7NE 3CK0H 3UEZA 4NQDD 4RCAA 5I1EL 3P0YL 4NHCH 1MJ8H 1C5BH 3PGFH 1UYWH 5E8NB 3H0TA 5EORH 2EDFA 4D0DB 3GSOA 1Q9WB 5F9JB 2OTPA 2X4QA 1CXEA 2OX5A 4Y4HD 5FGCB 5JO5A 2CDFB 1AC6A 1NC2D 4WJ5B 3QCTL 5F1IB 2FO4B 4PRHA 1ZLWH 4X0KB 2R69L 3PIQB 1IAIL 3L5XH 1Q9OB 2Z31A 3TNNB 3HPJA 3CFEA 3WD5L 5IHBA 5GJTL 1A9BB 4PRPB 3K2UL 4XP1L 5HI3C 2C3GA 1CTNA 4LCCB 3SO3C 4GQ9L 5BRZA 1XCTB 5FOJA 3LB6C 1S9VA 2YC1A 5DJ2B 1ZGLM 1JGUL 4JVPA 3REWB 2FJHA 1KEMH 1FLRL 4P2QE 4CADA 3BSZL 4NKOB 1YN7A 1KUMA 2BSSB 1AQKH 3QQ4A 4U6YA 5IESH 1G7PA 3TIEA 3VXUD 2ED8A 4NGHL 4MJ2A 3AB0B 1OAQH 2P42B 4YHZH 4X6CE 5D70L 4Z0BH 5D5MB 1MRCH 4FQ2L 2OI9B 4D8PA 1AP2A 3DMMC 1P53A 1S7WA 1WIUA 1ITCA 4M1GL 1LEGB 1KT2A 1A3RH 4ODTL 5ICYA 3NMEA 1VADA 3H9SB 5FYJU 1WBZA 1F58H 1P2CB 2Z31C 1CFTB 4PP1C 3CPLA 4YXLH 3FOMA 4LNVA 5H37H 5IW1B 3U0PB 1FJ1B 3BH9B 5I1GH 5DQ9B 5HYEA 4NJ9H 3UTZA 5T1LD 1VA9A 3NPSB 5HVWA 1TZHA 3MRMB 1MCLA 4M03A 2VDML 3T0ED 4MXVF 4NZRH 1NCWH 4X6BB 2D7MA 1OGAA 1JFQL 3DURB 4TTGA 4ODXB 3WNKA 2UZIH 4KTYA 2WWMC 3ORJA 1NC2B 4CMMB 1AGBA 1QRNE 5DK2B 3SJVD 1Y6MR 2FJFB 1CFNB 2WUBH 4XHQA 2MQCA 3IU3B 2V9TA 1HYSD 4D0BA 1MUJA 1TJGH 4YDLB 4NQCA 2YR3A 2IPKB 1HINH 4GMTL 5KSUB 1ZVSB 4OUUA 5KZCD 4OT1H 5SWSA 2VDRH 5KVDH 3BZFB 2LV4A 1KB5H 4OQTH 3VCLB 2VLRD 5J1AA 1CDIA 3U6RB 3HE7A 3DO7A 3PWJA 4UINH 3U48A 2F74A 4BFEA 1A1NA 2ZUQC 1FC2D 2YMXH 5DEGA 3QNXA 3HZYB 4YUEL 5E1AA 4P57B 1UB5A 3KYKL 2EKSA 1FGNL 3AS1A 3TA3A 3GGWB 1ZEAL 4NBYB 1IFHH 2XA3A 5HJ3B 3ZMRA 3PDDA 1R3IH 4HKBB 2EDOA 15C8H 2HG5B 2LQRA 4NN6B 1GCFA 2VLJE 1IC5L 3L95B 4JO1H 1YC7A 4NKQB 5D1QD 4L4TB 5C09E 2V7NB 5A3ID 1GGIH 3WHXA 1CVSC 3SE8L 3BN9C 1J0ZA 3GSNH 4GG6B 3VGBA 4E0RB 3S3JA 1INDL 3CZFA 4XXCC 2DQHL 5DZLA 5KSBA 1ZS8A 1SBBA 2DQTH 2Q76B 2YZ8A 4XI5C 1I7TB 3BRDA 2P24A 4C54A 4RGMB 4F7CB 5JXAH 1CL7H 3B9DA 2VABB 3VWJC 3DX7A 3HE7C 3LHPL 3V4VL 5F96L 4JRXB 3DYMA 2DQUL 1WCQA 5HHQA 5GRJL 3NIFE 2QHRH 2AKRB 4HK0B 4N0FA 2XQYG 2ZNXA 4FQ1L 4L4VB 2PYEE 4JM2F 1DQMH 1WAAF 1WLHA 3FJTA 3UTQA 3STZB 1MPAL 2H1PH 1OB1A 3QQ3B 4JFFD 1LK3H 3O4LA 1ONQB 3SDYL 3O4OC 2XNAB 3WDHA 1U8OB 4KPHH 4QRPE 4QRTA 1OP5K 3ULVE 3K1DA 5HVHB 2M2DA 4QF1A 1XIWD 3LEVH 4RIRB 2IALA 1JNHB 5HVFB 2DQGL 2VE6A 1Y0LB 4P0DA 5M94B 3D85A 4KAQH 3UTTB 1KB5B 4AL8H 1V7NH 5EN2B 4PRDB 1A21A 2VTFA 4MD5A 4XHJC 1YEGH 3SDCB 2NY5L 1A8JH 2UWEF 1A6VL 3JWOL 3S97C 4PV9A 3CSBA 3T65A 5C70A 5CZVL 4GOSA 3RPKA 1Q8MA 1FP5A 1ZKAA 1NL0L 3ARVA 2VL5B 4YC2B 1JHTB 2MJWA 3D0LB 4F80A 1OF2B 12E8L 3Q3GA 4PB9H 3WL9A 1R3LA 2YXMA 2VIRA 4R2GD 3HR5A 5C07E 2ATKB 1R5WB 1YJDL 3RY6C 2WBWB 3NACH 3AREC 4XXDA 2D03L 4MDIA 2FX9L 3I3BA 1GAFH 2I25N 4JFPB 1QBBA 3T0DA 4Y1AE 5A16B 1DQLH 1RIUL 4PJ8B 3GSNB 2VXUL 4WEBL 5FDWB 5KVEH 5DZOA 5IBLD 5B22A 1OVZA 3BGAA 1R0AL 1FL5B 1FV1B 3I6GA 4E5XB 2DOCA 5FF6A 3VW3H 3BP4A 1I3GL 3IKKA 5DT1H 1DVFD 4Z5RA 3FB8B 3CDFA 5FYKL 1TPXB 3B3IA 1EEZB 2ZKHL 4O2FA 4DEPB 4POZC 4B41A 4LARH 3DSNA 3D2UB 1BREA 2X42A 3LKRA 5IG7B 1T2QL 2YD7A 1BZ9A 1EJOL 1KELH 5I8CA 5TQ0L 4YLQT 2ZP0T 4JQIH 3EYOA 1BFOB 3GSRB 2GK0B 2DMCA 4F2MB 1BQLH 4OF8A 2R9HC 2BVQB 1FYTE 2W0KA 1CN4A 2GT9A 2XN9D 3IAQA 3KPOA 1H0DB 1EHAA 1UG9A 5T3ZD 3RWDB 5TE6L 3I50H 4JB9H 3GJFA 5J06A 3GSWA 4GBXC 5EO0B 3WUZA 3MRNA 5H37G 4HQQH 1U2CA 2EECA 3NVQA 4Q2ZA 4YBQD 5I0DA 4YDIH 1FYHB 3HHRB 3D39D 4ODVL 2C1OA 5LQBH 1X5AA 1IGCH 4ZOCA 5MERA 3MGTA 5FHBL 4FABL 1S7SB 1MLCB 4IMLB 4JO2H 4YWGL 1R3JB 3GNML 5F9OH 2R4SL 3E8UH 1GPOH 3VFVB 3PGCA 4TNWF 3QUZA 2X10A 4BJLA 2A9NL 2PTTB 5TFSL 1XGRA 3V4UH 4L8DA 1EFXA 3LSOA 4WY7L 1JZ5A 2QR0B 2NY5C 2Q8BL 2DB8A 1RUKL 1DE4A 3OXRA 5FM5O 1DFBH 3UPCA 2V9QA 2PNDA 4GKOA 4X9IA 5FGCE 4ZTOH 3PWLA 4PGBA 4M48L 2HYMA 1LNUB 4K3EH 5TDPB 2RIKA 2W0FA 2ICEB 1CGWA 5CGTA 2PKDA 1YJDC 2GJZA 3KLAB 4QHMB 1XR8A 2E27L 3L3HB 3BAEL 3SKMB 7FABL 3B2UC 4PRPE 2EH8H 5B8CA 4NFCA 4ZUSB 1EVUA 4LCWD 5KW9H 3QNZA 5JW4Q 1CIUA 4M6NH 3WEXB 4TVPH 3CD4A 4MA8H 5D6DC 5IJKA 5D7LB 2DLFL 1DQDL 4C58B 2NNAA 2FBJL 3IGAB 4HLZG 4MS8C 1HXYA 2JTDA 1V7ML 4QRQA 3INUL 1D5XB 3SKJH 1TVBB 3MBED 3QO0B 4XZUB 3MJ9H 4IHOB 5IV2B 2D31A 3HAEA 5JOPD 4M4RA 3S7GA 1G84A 4DGVL 4TSBH 3RVTC 3QUKA 5D5ME 2W59A 3Q0HA 1NJ9B 1SJHB 5ESAB 3VXTB 1OWRM 4J23A 3KPNA 2FEDD 4U0RB 1RHHB 3LMJH 5CSZA 2D4DA 3U7YL 1PX4A 3RWFA 1FZKB 4NO2B 1A7OL 5KSAA 4H26B 1UJ3C 1BPVA 3DRTB 5EIIA 2AVGA 2WSKA 5ISZD 3QDGE 3NFNA 1BJMA 1F6AA 3GJEA 5EO1A 2AK4D 5IJKC 4JDTL 1AFVL 5FKAB 4ODBD 1BIIA 2ICWB 3O6MH 3LKSA 1RIHH 3C8KB 2F54A 3Q5TA 5JORA 4KI5D 4NRXA 4CDGC 2CDGB 3MV8B 4GUPB 1YUHB 4WCYH 4XCCL 3IU4L 4GW4A 1JPFA 4NP4H 1DBKH 4HDIA 4XCEB 1KTKE 1Z9LA 5IMLA 3RWCB 3VFNB 5GPRA 4U6HB 3RTQD 1D6EA 2Z9TA 4MSWA 2PW1B 4XVTH 2VISB 4L9DA 1N2RB 3AY4A 2HJFB 4HKZA 4Z7WA 5EU6D 3ECBA 2WUCH 3T4AB 2M8XA 3STBA 3THML 2V7HA 3TVMA 3ULVF 1KLUA 2P8MA 5EUKA 5D1ZB 2Y1VA 1WUNT 5BZDB 4MXQD 2GW5A 3GKWL 4NDMA 5KSAC 5ICZB 4FZEL 1KIPA 5D7IF 1JGEB 4I5BA 3CVIH 2Z8SA 2Q6WB 2I5YH 4KKLD 5JW3H 1A1MA 4KQ3H 1MI5D 4HIJB 1AHWA 5JHDD 3OX8A 4PR5B 3WNPA 1IAII 4I3RL 3VXUE 5DI8A 4OZGA 4LCYA 3FAXA 4OLZH 3ELAT 4M7KH 5CIPH 1LE9B 3GSQB 2QV2A 3JSSA 4BK4A 1Q72L 5DRZB 3X14A 3VFSB 5JXEA 4C56D 4JHAH 2X40A 1DDHB 2D2OA 1DLFL 4WU5B 1T0MA 3QIWD 4J2XA 4Q9CA 4WFGD 1INEL 4RGOH 1JVKA 2SEBB 3TV3H 1FL3A 4G43A 1MF2H 4G42A 4GG6E 4FTVB 5I2IB 4MX7A 3BE1H 3RL2A 4IS6A 1KG0B 2ZPKH 3TFKD 4AIXA 4R0LA 3AY4C 3TH3T 5KN5B 1QBMH 4NKMA 3G5XA 4CNIA 2GITA 3QDAA 3S37H 1NCDL 1CI5A 3CFJA 3HRPA 1A47A 1NFDF 5I6XB 5IQ9B 1P5VA 1NBQA 3EIFA 5BO1H 4JRXE 3T0EE 1UT9A 1N7MH 3ALPA 4V1DD 1CR9L 4L4VE 4J3VA 1WC7B 5IHUH 3EYVB 4K7PY 1KJMB 1TVHA 1BLNB 2DF3A 1TNNA 4FQJL 4PRIA 3WFCH 2QQLH 1GZQB 4OZHA 1DUYB 4BFBD 2AAVA 4D0DA 3MA7A 4HIIB 2AEWA 1K8DB 1H3UA 4OAWA 3ARGB 5F9JA 5JXEC 3C60B 3LCYA 1A3LH 4FXGB 4K8RC 5F1IA 5K9QI 1R5IB 4NUJB 1G1CA 4ZDHA 5TDNA 2P5EB 1YY9D 4JFHE 5HHVL 3D0VB 2BFVH 3WJLC 5IFJA 3TNNA 3M07A 3UTTE 1PG7X 1BEYH 1G7LB 1NC4D 1MFDH 2E7CA 1A9BA 4Z7VB 3O45B 2VOTA 3DX8B 1NMBL 3A67L 1UKSA 5C0BB 2CRIA 2H3NB 1E27B 4UAOC 5DJ2A 3W81A 4HWEL 1RVFH 2EYTA 3V52L 5H2BB 1QSFD 3P4NA 2XXMB 1TITA 4UU9B 5LBSH 3OB8A 4FMKA 5DD1L 5CIPB 2O5YL 3MRHA 3CFDA 1VFBB 3BGMB 1RSFA 4X7CC 1FDLL 3SBWC 1NGXB 2DL2A 3SKUD 1GGCH 1QLRB 5GJSL 1FZJA 4K94L 4XPGL 1LO5B 2B7DT 3RKDD 2H2SC 1BBDL 5IKCB 1LEGA 3WHE1 5DGQA 1CFSB 4YO0A 1I9JL 2X05A 3H9SA 2IH3A 4KKCD 5LCVH 5CWSB 4CVXB 5JIPA 4ZFZA 3G04A 4YHLL 1PVHA 5AYQA 4GXUM 2Z8RA 5IW1A 3BH9A 4JY4B 1FGVL 4P2OA 3BW9B 4TSCH 4EDXB 3QNYA 4FFYH 4NKDA 3QWQB 3G08B 4HPYH 3JV4B 5FGSA 4I2XB 1DBAL 1YMMD 2E9BA 4IRJC 1G0DA 4LU5L 1CGSH 3VFTB 3DURA 5IMOA 1BWWA 2MQ0A 1JMXA 2APBA 2Z4QB 5ALCL 3G5VA 1BM3L 5DD0H 5IOPB 1ZT1B 2XQBL 5DK2A 2N4IA 4WEMB 2OJEB 2LTQB 1M7XA 3IU3A 1OP5H 3ZYZA 4JHWL 4EEEA 1I85C 2CIKB 3MRDA 1YY8B 1WZ1H 1A4KB 1ZT7A 5KSUA 1KENH 1HIML 1MAMH 1JNLL 4F9PA 1YC8A 4J4PA 1D5MB 3VCLA 4ZAKD 2DBJA 3DYPA 3DECA 5KANG 4WI8A 1NGYB 2CSPA 2A83B 2NW2B 3UJJL 5IVXA 3HZYA 1T04A 1XH3B 4ISVA 4P9ML 2IQAB 1JGLH 1OQXA 4K23L 4OLXH 3WKML 3MRBA 1FNGB 5TE7L 3T2OA 4EUPA 1C5CL 4AIZB 5IHZA 3QCVL 2VXQL 5BQ7B 5E2VL 4KC3B 5HHXL 4ETYA 2X4OB 1L9MA 1QQDA 4POUB 3JWDH 4L4TA 2PCPB 2XKSA 4RSVA 2V7NA 3VG0H 4HT1L 1TJHH 5DC9B 2OTUA 1JN6B 3B43A 3MXVL 1RJZB 4QHKJ 4JFYB 4X80L 1EK3A 4K2UH 1I7TA 2Q8AL 4P23D 1UZ6F 4F9PC 4XP5L 1MRFL 3MRPA 4X7FC 4NRZA 2VABA 1A6ZA 1YMMB 3ZHLA 4GKZB 2AEQL 1NGZB 3KWWA 2AKRA 3CH1A 2R2EB 5DMKA 4C4KT 4K94C 5BZWB 4U1GC 4Y4KC 1FIGH 4JCLA 1ZWIB 2EEBA 5ITFA 4LEOB 5D7LE 3KPLB 4QXWA 3STZA 2JIXB 4ZSOB 3KPRA 5FUZH 3UBXB 1IAOB 2FRGP 3Q1SH 2Q7YB 1J10A 3IFOA 3QQ3A 1C1EH 1W0WA 1BZQK 1F00I 4Y5XB 2XN9E 3T2PA 3BPCA 2ADGB 2FIKB 3QEHB 5CP7B 1CGTA 5MP6H 1ED3B 2IBGA 1MCFA 4RIRA 3DI3B 1JNHA 1QZ1A 2PO6C 2JB6A 1Y0LA 3HZKB 2XZCH 4EVNA 5BV7H 2BNRA 1YEJL 2FX8L 4RMSA 1HXMA 4PY7B 3D39E 4R8WH 2VITB 1HILB 4MVBC 5JHLL 3MLVH 4RX4A 4O9HH 1ZT4B 1ZTXH 4WHYH 5ITBL 2K3TA 1FZOB 1IL1B 1DBMH 2GY5A 2F53D 1IGJB 4EI5C 5I1CL 2OL3H 1PG7H 4S1SH 5IBTL 3O6KL 4CU6A 2GTWA 4DUVA 1X6LA 3ZKMC 3AMKA 4MDJB 3VI3E 1R5WA 1D9KC 2NR6C 3BQUB 4KVCH 5KAQG 1EGJA 5JPNB 1TQBB 3MV8E 4WI7A 3X11A 3SCMB 2NX5D 1XT5A 2CGRH 4NQSB 3X3GL 1DN2A 3A6BL 3EW3B 4G7YL 2H6PA 3UYPA 3GSNA 3ETBF 4Q7DA 5I76B 1N8ZB 1S7QA 1UQSB 3IDXH 4OD3L 4PJGB 3SKOA 4NQUA 2A1WL 4G6JH 1F3DJ 1T1ZB 5DUMH 3TWCL 1VFUA 1A5FH 3S8WA 3STLA 4OCYL 4P5TD 4PRNB 4LKXB 3MRKB 5I18H 3H9HB 4R4NC 1U41A 4YNYB 2ESVB 4QXUL 5C08A 5E08L 3RUGB 4PJBB 3I84A 1SHMA 1NGPL 3QIBD 4NJAL 2PTUA 3NIGF 4PLKD 2AJXL 4TVPE 4RMWA 3VI4F 4LSPH 3CC5B 3BD3A 3BJ91 3G9VA 3GUTB 1U8MB 4KRMB 4F7MA 2YA2A 3HB3D 1T7WA 1XCQB 3SDAB 3O2VL 1U6AL 3U4BH 1BFOA 1NCNA 3GSRA 3HI1A 2GK0A 4JQXC 1VFAB 2Q3ZA 4XB8A 5IFHH 4GMSH 3HCVA 3P30H 3G5YA 3MLRL 4BK5A 4PGJA 4X9BA 4YAQB 2BVQA 4BQBA 4RGNC 1NANH 3BYTA 1W72L 4M6AA 3WFBH 1ACYL 4FN0A 2E7MA 2EXWC 3PWVA 2AQ2A 5FK9A 5BS0A 5E2WL 2YUZA 1Z2KA 4WUKH 1CU4L 1MFAH 1VSCA 4LBEB 3WXVL 3UDWA 5CAYB 4N5ED 5JUEL 4YEEA 4QTHA 3BIKB 1T22A 2XFXB 3OKLA 5FO9B 1U3ZA 2VZ3A 4X4MA 3TYGL 1MCRA 1XGQA 2C5DC 3AS3A 2WBJB 1T21A 3IFNH 3QO1B 5CUSL 2VUOA 5JMOC 4AYFA 1MWAH 2X89D 3CSYB 3WO4B 1GGBL 2IBBA 3UBXG 5JQ6L 1OTSC 4KI5E 1NBYA 3GBML 1R3JA 2DQDH 4XCFL 4F58H 1ZXQA 3UCRA 3I3EA 1FNSL 4WI3A 4Z9KB 3EYQD 4JY6A 2PXYA 3QCUH 1IGIL 5J13C 1MEXH 4K9EH 1JPSH 5L2KD 3QUXC 3EO9L 5EU6E 1LNUA 3HMWH 5HI3D 2P5EE 5DJZB 3HS0B 5HHOB 4HZLB 1KOAA 1LO3H 1MSPA 4OCRH 1RZKC 2XG5A 5TDOB 4QHMA 3LB6D 4NO5B 3MRIA 1DN0A 3SKMA 1TZGL 4B7LA 1MI5E 4OF6A 2CXKA 4Z7VE 1W72A 5JHDE 4YXHL 3O8XA 4G9FA 1NAMH 2VDNL 1PW3A 4OCNC 3QSKB 4WW2B 4DGIH 5EUOF 1T5XB 5GS0D 1F45A 3FO0H 1VHPA 3OKKA 1A6AB 2VL4A 2I60L 4F7PA 2A77L 4LRNL 3I02B 4PJ7B 5FYLD 5KVMC 2B2XL 4C56E 1FFPB 5CJ8A 2AJUL 3VXQA 4QXTB 1ETZA 1TVBA 3QO0A 1KN4H 5IVNA 4HKJB 4IHOA 5IV2A 2WP3T 4Y16C 3TZVD 1FRGH 4LVOB 5HHMD 1FE8L 3RZWA 5D2LB 4NZTH 3DUUB 4Q6IB 5E6IA 4LPTA 1J1XL 4X98B 2X5PA 5CEYB 2HLFC 5EU4A 1JF6A 4P3WA 4XVSH 5HYFA 1AXSB 2AJVL 2HT4C 2AW2A 35C8H 1RK1B 5EZJA 3GSUA 1JYNA 5CBEB 4HXAL 1JK8A 3K80A 2ARWA 5JQHC 4NFBA 4UT7H 3MBXL 4XTRC 1P5UA 1NKOA 3QZWB 4UIKH 4Z76A 1N64L 5CJXA 1E0OB 1IM3B 5D96B 1KC5H 3QFJD 4XP4L 3O8XC 5EOCL 1LP9F 2CDEB 2YPLB 1MWAB 3GMNA 1BWMA 5DRWB 3S5LB 1UH2A 2XZQH 4I2XE 2WWMD 3TN0A 2MNUA 1X7QB 4JGMA 3U30C 3GHBH 5GGTH 5D7JA 4UB0L 2E7HA 2DQIH 2EE2A 1GH7A 4OIIH 2CDGA 3DV6B 1EDQA 2Z92B 3I2CH 3EOAA 5E8OB 3LIZL 2BNQD 4L3ED 4BQCA 1AKJA 4ZNEA 2OJZH 3GI9H 5F7DA 3ZYIA 5JW4R 1J0IA 4KMTH 4F7EA 5F3HB 5GS2D 1QSEB 2HJFA 5GZND 1QFWH 4XPFL 3ES6B 4WHYG 1K9TA 4O02L 5AEAA 5IWLA 3ARXA 4P46B 5DD3H 1KN2L 1PD6A 4FQCH 5ICZA 5GS1C 5BW7C 1G6RH 1CD0A 1JGEA 2ADIA 3NIDF 1QSFE 2AQ1A 1LE5A 3VWKA 1VERA 5J12B 5ABDE 3TO4B 2Q20A 4I48B 4XPTL 5CINL 5E0QA 4A2MA 3GK8L 3OGCA 3FO1B 3GMLA 1KCRH 2HVKB 3KYNA 5JW4N 1NGWA 1LE9A 4HC1A 3VG9B 4P59H 1XGUA 3NPZB 3WIHL 1HZHH 4EN3B 3MUY1 5C0AA 4WO4B 4LVHC 1HHHB 3MJ9A 2R8SL 5E8PA 4LDOB 4LASH 1DDHA 4S11A 2IMMA 3NGBB 1NLDL 2X4UB 2R56L 2X09A 3KXFA 1S5IL 4ODHL 3PABA 4HMCA 1HCFX 2VMFA 4QOKB 2CUHA 2RFXB 3FO2B 4FTVA 5I2IA 2OR8A 2IFFL 4N0YL 3T2NL 3VWJD 3MRRA 4XBEL 4OSUL 3UJIL 1Y18B 3VE0B 5BOZG 5KN5A 4PJHF 3EFFB 3RU8H 1MJ7H 3TJHC 4O5LL 5E94A 2ADFH 1SM3L 1YMME 1J5OL 3B2VH 4JKMA 4ZOAA 1JHLH 2V5MA 3ZKSD 3CU7A 3OF6D 4M93C 2LVCA 3HPLB 4HEPG 3O0RH 4JFEA 3EYVA 3UXFA 4KROC 1KJMA 2X2YA 1BQHB 3SN6N 1BLNA 5FYKU 4KWUA 5F3BA 4CDHA 1AR2A 1WFNA 4DN4H 4BUHA 5HYJB 5GRWA 2GSIB 3X13A 4V2CB 4HFUH 4BQ9A 1CLOL 4RQQA 3B5GA 4L3CA 4YHIB 2XKNB 4KKBC 4WU7A 3V8CA 1A7RH 1UC6A 3BT2L 3HLAA 5CJQH 1WBXB 4XHJD 3TPKA 5KVFH 3NH7L 3QZWG 2V2XB 1IQDA 1JCKA 1T1WA 3O45A 2HA1A 3DX8A 4EQ3A 1IQWL 2JB5H 5C0BA 4JM4H 3U4EB 4DK6A 3S5LG 2P1YA 1E27A 5DQDH 2VRAA 1F90H 1DCLA 1DL7L 4NQTA 5KTEH 3GSVB 4JM2A 4PB0L 1WAAA 1AY1L 1J87A 1KJ2H 3FB7B 1GHFL 2VXSL 3OGOE 4KK9C 1VFBA 5C0DA 3UPRB 4MJID 1L7TH 1Q9KA 1EBPA 3QUYC 1OAXL 1AGCA 3V5DB 3UC0H 1TZIA 5HY9B 1UH3A 3IJSB 4I3GA 4CVWA 2MPAL 3R8BB 4X7TB 4O00A 5J6GA 2D9QB 4WI2A 4PJGE 4YBLB 4LGRB 4JKWA 3VXOB 2DLTA 3T08A 3RDTB 3U7AA 3RZCD 4PS4L 4PJEF 1AQDA 4QYOA 2VH5H 4NFDA 2ESVE 3Q6FB 4PRBA 1AO7A 2ZG1A 3RUGE 4PJBE 2EC9U 2P5WA 5GZOD 3QR2A 5F71A 2UWEA 3JV4A 5FA3B 5J9PA 3VH8B 4MCYA 1LDPL 4H5SA 4EDWH 4KZEH 4R90H 4P5KB 1YECH 5IR1A 4JM2C 2A0LC 4NO0D 4M3KB 4PJ9A 4IJ3B 4XNQA 3MNZA 3C08H 1FH5L 2QSCL 4OTXH 4WV1C 5TF1H 2NY2D 4PJCE 4ZMAT 3MUZ1 1A6WH 1K4DA 2V9RA 1DSFL 1A4JB 3L3GB 2DJUA 3KPTA 4ZXBA 2QQNH 2BRRH 4O2CB 3RWEA 1BVZA 1KJVB 1JHKH 4WDIB 3RX8A 1A7NL 1P9MA 4JFDB 4BKLA 5I71C 3EO1B 3CX2A 2A83A 1YEHH 4HLJA 1WQVT 5JMRA 4WGWB 4MNGE 4OLUL 2X70A 3IXTA 1PDKA 2BSTA 3EOBA 4IM8A 1LWRA 4XBGB 5E6YA 1T03L 3KJ4B 1F3DH 1BQHG 4F15B 4P3CH 4NQEA 4FXLA 1FCGA 3GMRA 2DICA 3MO1A 1ERNA 1CE6B 1MJUL 3LZFL 2NX5E 4PJ9C 4OKDA 3MR9B 5DJCA 3NTCH 4XCYB 5I74C 4M1CD 3RWHB 4MNQD 1MFCL 3L5HA 5I8OH 3KJ6L 4YDJB 5IROC 2R0KH 5E99L 3PL6B 5INCA 1ADQL 4EZMA 5DMIH 3VMOA 4ZYKA 2HKHH 3ESVF 4ZXBC 5F21B 1E6OH 2Y9RT 3S36L 1RJZA 5HYSB 2F8OA 4M5YL 2VQ1A 3RJQB 2DQEH 4FQXA 1P9MC 4UT6L 1CBVL 1QNZL 1JNJA 3FMGL 4X6FA 1CXHA 1EZVY 2F19H 3H7BA 5C92A 2NY4B 1NGZA 4I77H 4X4YB 4QY8A 2R2EA 5FYJH 3QUMH 5BZWA 5ICXB 4KK6C 4OI9A 5FA4B 1BZ7B 4RISH 2F5BH 3OZ9H 4JCMA 1WTGT 2UUDK 3HNSH 1G7QB 4Y19D 5FO7B 4ZSOA 2HT3D 2EDQA 4YEFA 5J6HB 2AJSH 4UNVA 4PJ7E 2VDQH 4O2EB 4G9DA 4IMKA 4Y5XA 1IBGH 2ADGA 3QEHA 2X4NA 2IADB 1UXSB 5D2LE 1CLYH 1RAMA 4H8WC 3GFUA 3HZKA 3QDMA 4LQ1A 5IUSA 1MVUB 4PY7A 1FAKT 3ZLQC 4YHKH 3WFZA 4HJJL 1HILA 4N8CL 3WIIH 3ZSTA 1P4BL 5B3NA 1AR1C 4JRYA 3CXHJ 2ZSVA 3MXWL 2AV7A 1IL1A 8FABB 3V7MA 1IGJA 1RZGA 3VH8G 4QKXB 3KPSA 2WQRA 2YPLE 2WIMA 3JV6B 3T4YA 1OAYL 1H8NA 5C9JA 3KDMB 3Q6GH 1TTUA 3EYFA 5DMJB 4HIEB 1CGXA 2E3VA 5GRUL 4BZ1L 4NT6B 1NCCH 3QPQC 1K85A 3R0MA 4YR6A 5JPNA 4G3YH 2FGZA 3L3IB 4YFEA 3KHOA 4HFWA 1I9RL 1I1AD 4ELKB 5GGVL 3ULVL 1Q94A 1HQRB 1S3KL 3S35H 3WN5B 3V79C 5I0ZA 5SWZD 4LHUD 4NC0B 4B7IA 3N9GL 1BECA 1T1ZA 4HGKC 3SGDH 4E42A 1QSEE 3C9NA 5C7XH 3HE6B 3SE9H 1ZLUH 4IRZH 1U3HD 4E41B 3MRJB 2QJDA 3L7FA 4OGZA 4ZTPL 4Y5VA 4XWGL 2FYYA 1UVQB 3D9AL 4PJAB 2FECI 3TBYB 1LP9B 5AWNH 3VD3A 1H3VA 2IBZX 4GSDH 1CICC 1QLFB 1XGPA 2OS7A 4GJTB 3ABZA 3EFDL 2LU3A 4QRSB 2I26N 3ARSA 1MCOL 1S9XA 4ZO6A 5DR5H 3MACL 2BDNH 4XNUL 4NC1E 2IJ0C 3HTLX 5HGDB 4KJWD 5F9WC 4H0HB 4M5ZL 5B3JE 3IJYB 5HYSG 5KS9F 1KIRB 3GMQB 2I9LB 4FXKA 4XCNB 1T6WA 2HN7A 1AI1H 5EOQL 3RAJL 1DEDA 2AQ3A 3QFJE 5F1NA 4YDVA 4BYHA 1YEDB 4Y5VC 2OL3A 2JK5A 3OBAA 1U8NA 4RRPG 1O7SA 5T1KA 5D7IA 5C6TL 2ICCA 1UM6L 2YEZA 4QXGL 3T8XB 2YK1H 1YNLL 4I0PB 1N6QH 1IM9A 2FLBT 3TH2T 3TCXA 5FECB 4AG4L 1J9CT 1XFPA 3SQBA 3WS6A 2YPVH 1XF4B 4D9RD 4L3EE 4P4RB 3TLRA 3L3KA 5HYJE 1H5BB 4BSWB 1A2YA 1LO4L 1NLBH 1UGNA 3VRJB 4DGYH 2NY3C 1LK2B 2DQFB 2QADB 4U1IA 3U46A 3BP6A 4S1DD 5JR1H 1M6OB 6FABH 1MQKL 1JNNH 2VDKL 5HHOA 2RJMA 1B2WL 3HMXH 5C07A 1MFNA 1XR9A 2VLKA 3AGVA 5EU5B 1T0PB 3QDHA 4NO5A 1QKZH 4PJCF 4CL7A 5DJYB 3ZDZF 4JHZA 1CF8L 2CD0A 1FVEA 4G8IB 1X5LA 3OHXB 1IKFL 3ULVC 3GMOA 3FT2B 5C2BH 4XVJH 3FN9A 3ILPB 1NFDA 1T5XA 3MNVB 3AS0A 5EZIH 3VDCA 3L5WB 3QHZH 4N90D 2P47B 3QJFA 3MOAL 4HUWB 4X6EA 3I02A 5FM5M 1UZ8B 4AM0B 3T2QA 4JO4L 3V6OE 1I4FB 2XZAL 5AYUH 3E2HC 3O2DH 4XNMA 4YX2L 4ZS7H 3BVNA 2H2SD 4L8BB 5F7HA 4LQFL 1GXEA 5MEOB 4JREB 4D9LL 4EOWL 3DUUA 4Q6IA 4X98A 2IANB 3TCLB 2RHEA 4QT5B 3OKYA 1AXSA 4ERSH 4PJFE 1MNUH 4CN4A 3W11C 4OUOA 3RGVD 2I9TB 1ZVYA 4DAGL 3O9WD 4FZ8H 2FX7L 3BWAA 5H35B 4Y4FA 3QEQB 1JYVA 4JKPL 2XWTA 1ZHLB 3MOBH 5FV2A 3ARBB 3PWUB 3BH8B 3FQRA 1CDUA 5D2NB 3O6LL 4OLVH 1JZ4A 3JTTA 3MFGB 1F4XL 2X4RB 3EDFA 5BVPL 1QBLL 4Z7OE 1M1SA 2DBLL 2NY7L 5EU7E 5E4EB 2Y07L 5FUOH 4S1RL 1UWGH 5M7QA 2VDOH 2FATH 4ZPTA 2NY0B 3UTSD 2YBRB 3HZVB 1S8DA 1H8SA 1S7VB 4KDTA 1X9QA 5IB2B 1A6TA 4YZFE 3U7WL 1C16B 2VZTA 4XNZB 1J8HA 4MNHB 1BD2A 1BFVL 2YUWA 4OZFH 2AJZA 1EA9C 4XMLH 3UYRL 3OAZK 4AEIH 4XBPA 3PQYA 4OZIB 4JFDE 1DJSA 2LAAA 4K3JH 3RBGA 4PJEB 4JR9H 1NAMA 3QG7L 2YA0A 3KPPB 1HHJB 3ZKQD 4ACPA 1HNFA 4LLQB 4UDUA 5D1XC 4OD1H 3V6ZB 1IGMH 3TO4A 2BHYA 5HGHB 4PUBL 2G5BB 2HTLD 1D5ZA 4G6KL 2L4OA 3CK0L 3F58H 4MJIE 3RGHA 2DTML 3MV7B 4HG4J 3WYRA 4NHCL 4EN3A 3DIFA 1C5BL 4YHPA 4L1DA 5BMFH 4OV5A 1HHHA 3O3AB 4P2RA 4K55A 4EI6A 3W9EB 2X4UA 3D3VD 4WWKB 2B4CH 5JLZA 4XWOC 5CD3A 3P40A 1TTFA 1UACL 2J88H 2FR4B 3R06B 2VLLB 4DKEL 2XWJA 4IRSA 3LN9A 1Y18A 4PGEB 2A6JB 5IHLB 1KLGA 2AJYH 1A3QA 3L5XL 2CIIA 2ED7A 1O7VA 4UI2A 4UQ2A 5F7FA 4LLVB 2V6HA 3FCTB 1H9VA 3OR6A 3QB7C 4V2BA 4JZJB 1J0KA 4X6DB 3VXSA 3RL1A 1KTDA 3VXRA 3K4DA 4HUXB 4OGYL 3ARYA 5J0BA 3BHBB 3HN3A 3ZE0F 1X4XA 4CU8A 2DS4A 4JN1H 5EB9A 4XP9L 4UDTA 4JPVL 4HWBH 4OI8A 2OBGA 4PGCA 3RNQA 2DIAA 2A74B 4GRLB 4JZNA 3VMNA 4GKNA 1CQKA 3LKQA 1UXWB 4JPIB 1L7IL 5IESL 4L8SB 4ENEC 4XNXH 2DM3A 1G7HA 3V6FA 3ZHDA 3H6JA 5I16B 2GQHA 2R4RH 3A6CH 3EYUL 4NQDA 1XF2A 4Y2DA 1OTUC 1MRCL 1Q0YL 5I1IL 4YK4B 4OZFB 1A3RL 4HS8L 3QI9C 4M8QA 4EI5D 4FFZH 4NBZB 4Y4HA 3RX5A 3QHTC 1G6RA 5B3JF 5E95B 4S2SB 5D9SA 4H1LH 1X3DA 1GC1L 1D9KD 3VGEA 5ACZB 2NR6D 1IEAB 2Q86B 3C5ZD 3FQNB 4I1NB 1FN4B 1CFVH 3MRGB 2R2BB 5B4MC 2CK0L 2CLVB 5J11C 5CBAA 5DF0A 1G7IB 2NXZD 1J0JA 1KB9K 3AM8C 5F7YC 3CLEH 3M17A 3EJZC 5DUBB 1U3YA 4JZOB 4MD0B 2WMPA 3GBNH 3HG1D 3MREB 4X5XA 3IJSA 5I17A 3EDJA 2ZCKH 1YQ2A 5C0CD 1TJGL 3WE6B 1QOKA 3RWIA 1HINL 5CEZD 3RDTA 5E03A 1QP1A 4HS3B 5KVDL 3MLTB 2ZJSH 1KPUA 3HI5L 1YN6A 1FFQA 4OQTL 2VR9A 3OKEA 1I7UB 3BO8B 4Y4HC 4E41E 4RFEA 1NDMB 2VN4A 3R1GH 3BMWA 4YDKL 1MIML 4Y19E 3WFEH 5FYJE 3HC3H 3QDJB 3VFPB 4FRWA 2QQKH 4PJAE 4HMEA 2IPUK 1BJ8A 2NZ9D 2EIZB 1NMCB 2DQCL 2UUDH 5HGAB 2CR3A 5F7EL 2NXYB 1IFHL 1C12B 1X44A 1OCWL 3H42H 3KPMB 3DYOA 2EYSB 4KKNA 5T1LA 5DC4B 3RIAF 2KBGA 3MJ8A 2DAVA 4JFXA 4PGDB 5E9DD 1GGIL 1SY6H 2GJ6D 4M43H 3ZTNH 4N68A 1UM4H 1T4KA 3HFML 4GAJL 4FP8L 4A6YH 3OXSA 4MZ3A 1L6XA 2IAMD 3SJVA 3BD5A 4APQB 5B21A 1EO5A 1YEKL 1KIQB 2XPGB 5AZEH 1F5WA 4XC1L 3UO1L 1TCMA 3LQZB 2Z91A 4NN6C 3VFWA 1KPVA 1OTSD 2ARJA 4N1HB 3PHQB 5JXAL 5FAAA 1K6QH 5IW6B 5IB5A 4MHHI 2P49B 4KVNH 5T3XE 4TSAL 3B9VA 4XBGA 4L8CB 3OB0K 5T33H 1J88A 5K9OB 3G6JE 5GSVB 1SYSA 2VLRA 1WEJH 3FT3A 4IOIB 1PSKL 3OKMB 2MSPA 1KJ2A 4OLEA 3G9AB 4H25B 3QUXD 3MR9A 2ZSWA 1T6VN 3RWHA 1HEZB 1GSMA 4ONFH 3MUJA 4HK3J 3SGKA 4EQ2A 2NCMA 1FAIH 2J12B 1SBSH 3CSPA 2NY1B 2Z35B 3KYOB 5SWZE 4JAMB 3T0EC 2ZUTA 4QO1A 4J1UB 4PJDF 3TGXA 1P7QD 1GC1C 1V3JA 2APTA 1AGFA 3LEVL 3LKPA 4KY1H 4G8GB 4OZFG 3VXMB 5I75B 3IFPA 4UV4H 2BHUA 3FFCD 3B5TA 4M6OL 1MCKA 1FO0L 1LO2L 5KVGL 5D1QA 3GIZH 1V7NL 3O6FB 4P99A 4Z77A 4RDQF 2R1XA 1HYSC 2VZSA 4JQVA 4F7TB 1C5DA 2EEAA 5E5UB 3IRZA 1LDSA 3BYYA 4ZPVB 1G7QA 4RFOH 4BELD 1PKQB 2B5IC 4X9GA 4F57H 5FFLA 4GLRH 4Y16D 4BZ2L 4X4XA 5JPMA 3PXJA 3DROA 2O5ZH 4MMXC 4NNPH 4O2EA 4XRCB 2VUYA 1YEFL 2HLFD 4OGXL 5D71H 5GGSB 5I1HH 1HKLH 2X4PB 3ZL4L 1P1ZB 1GAFL 5IF0B 5BOPA 1CT8A 1KCVH 1UXSA 5ADPH 4OCXH 1JUFB 2HFGH 1DQLL 4Y0GA 1C7TA 1AIFB 2IANE 5KVEL 4JFFA 4M7JL 1XF5B 5DJDA 2BNUA 4A6YB 2J8UF 3Q5YA 4JLRB 3ARFA 3CDGB 2B1AL 3LH2H 5D1QC 3T0VA 3DOSA 1YDPA 4UUJB 1QLEH 3U9UB 5A3IC 1XIWA 1JPTH 1WFUA 3F5WA 8FABA 4OV6F 4JQVC 5TQ2H 1BAFH 4WWID 3QPXL 2HJKA 3JWNC 2XYCA 1N5AA 4LPWA 3KDMA 3SDDB 1K2DA 5D2NE 4XPBL 5EUOA 2D4FA 1KELL 1FL6A 1FO0A 4D9RE 3T04D 4ODUB 3V9FA 5IB1B 4UIMB 43CAA 2BJMH 1EEYB 3MV9D 2ZOLA 3MMEA 1ZGLB 1T3FB 1U8LB 4HF5L 1TPXC 3EGSB 3IVKA 2PW2A 4OQ1A 4C57C 3WN5A 2DM7A 1R24B 4KV5E 3I50L 1KACB 3NA9L 1Z0MA 1UB6B 1F2XK 4LSTL 4XGZA 2I27N 2BSED 1K5NA 1G7JA 4P4KB 1KCLA 4OZIE 4TUOA 4YDIL 2VWEE 4BSJA 1XIWC 4HXBH 3GRWL 5LQBL 1HH9A 2DQJL 3QUMA 2BCKB 5EU3B 3W0WB 3GHEL 4BFIB 1I8MB 3FB5A 3OKNA 1LP9A 5MEND 1DVFA 4DZBB 4JO2L 1C08A 2BC4B 1QFHA 1M7DA 4MCZA 4QRSA 2DDQL 2HWZH 2WM0A 3IETA 4U1LB 1VENA 4D0CB 1JJUA 2C4FT 1T1XA 2VZ1A 5HGDA 3BZ4B 1DFBL 4I18A 2O61A 4MAYB 3OG4B 4R2GC 5F7KC 1NMAH 4LF3B 5FYLH 1FSKC 4ZTOL 4IIQA 3SDXF 4K3EL 2PR4H 1G9MC 1LGVA 3IDYC 4LCIL 4JPWL 4LVEA 3DUSB 2EIDA 2OR9H 3WV0A 4X6DE 1WWCA 4PRHD 1YEDA 1WCBA 4MJ5B 5IBLC 2ITDB 2EYRB 1IAKA 2UYLB 2F8VA 4NYLB 5IIEA 1JPGB 2NTFA 3SOBH 2Y5TA 3B8SA 3LVEA 2R23B 4TVPL 3T8XA 3ZDXF 3GMMB 4NO3B 4JVWA 4IEFB 3RVUC 5I1AB 1DANT 4U33A 3DBXB 4DK3A 1QFOA 4PTTA 3CGTA 1PEWA 3BDBA 2VKWA 4CN1A 2HT2D 4DUXA 3DX6B 4XX1G 3SKJL 5GGVY 4M7ZB 5D4QA 2R29L 3VRJA 1OM3H 3ROLB 3IDIB 4TSBL 4GS7C 1ZHKB 4OKVB 4RWYH 5FHAH 1DR9A 1SJEB 4P2YA 4Z8FL 2IC2A 3BEWB 3VFRA 4IIQC 1QHOA 2ZUYA 3TYFB 4AMKL 2IQ9H 2GYSA 1TMCB 3OPZL 5EU5A 5C0IB 5ETUB 3OAZH 3SE3A 3CFCH 3O41B 5I1EH 1R3HA 4PJHA 4U3XA 4HV8B 2GKIA 4HW6A 5A2IH 1EMTL 3FT2A 4QHNA 1U8JB 5C0JB 2GK2A 1MHCA 4LSQL 3MNVA 4M62L 5HDOA 3SO3B 2EDNA 3L5WA 1ZA3B 5F6IC 4YBQC 1MRDL 4YHNA 3IDJA 1MH5B 1OP9A 3QCTH 2YSSB 2H32A 1U8HA 5CLTA 3RWJB 3O6ML 4LCWA 3D3VE 4QCIA 2YHGA 4I4WA 1BGXL 3F62A 4WFFD 3C09C 4WCYL 3WD5H 5HHPA 3H0TB 5GJTH 1DBKL 2CMRL 4KRNA 3K2UH 4XP1H 2QKIA 2X4TA 4FQIH 3TCLA 2CRZA 4ZODA 3CLFH 2X4QB 5JO5B 1JGUH 1IGYA 1KFAL 3DMMB 3UTPE 1FLRH 3D1MC 3WFDL 4CW1A 3BSZH 1A64A 2VLMD 3P9MA 2Z31B 1V3MA 2R1YB 4JANB 5EWIL 1ZHLA 1B6UA 1E4JA 5JW3L 2VERN 3QDJE 4MQTB 5FO8B 5BRZB 5IEHA 3DXAB 4FQ2H 3QRGL 4GAYB 2YC1B 4RAVA 5D93C 1PKOA 2X4RA 3CFBA 2FJHB 4M1GH 4Z7UF 1FG9C 5ISZA 3D87B 2Y06L 1YNKL 3RIFF 1YN7B 2CLZA 2ID5A 3QQ4B 4U6YB 3TA3D 1G7PB 2AK4A 3TIEB 3TJEL 4JHAL 3H8NA 2YBRA 1BJ1J 1S7VA 2BOCA 1OAKL 5IB2A 1KGCD 1MF2L 4D8PB 1AP2B 3CNKA 3H3PL 1S7WB 4ALAL 2ZPKL 2VDMH 3MBEC 1KT2B 5ICYB 1VADB 1JFQH 1WBZB 4PJEA 2D0HA 4X7SL 2JCCF 3S37L 5L7XL 4UZGA 1HHJA 1HWHB 3FOMB 1Q0XH 3DTXA 2ZUQB 1Z6JT 1Z9OA 1N7ML 2FEDC 2DYPD 3UTZB 2X1XR 3U1SL 5JW5A 3HC4L 1TZHB 2Z93A 1KJ3L 4KRPB 4NUGH 4GMTH 3WFCL 3MV7A 4W4OA 1TNMA 1OGAB 3HG1E 5C0CE 3U9PH 3E6HA 5EIQA 2R0LL 4BSVA 1AGBB 4PJXF 4X5WA 4YE4H 5CEZE 1OTTD 1RZIA 4HIXL 4YUEH 3U0WH 5FXCH 4KI5C 4G8GE 5EC2B 4PGEA 5FUCE 2BFVL 1MCWW 2R0ZH 4NQCB 3MYZA 1I1RA 4KK6D 3QIWA 3BZEA 1BEYL 3LS4L 5SWSB 1JZ7A 3MROA 4WUUB 3ZDYE 3RTQC 5J1AB 3ARGC 3HE7B 3DO7B 3PWJB 2F74B 4G6FD 3PWPD 4Z7QF 1A1NB 3T3PE 2WQ8A 3O3DA 5DEGB 3QNXB 5E1AB 3QHFH 2A74A 3SE8H 5JOFA 1UB5B 32C2A 1ZVHA 2JELH 1PKQE 2DI8A 2EKSB 2GSGA 4MXQC 1INDH 5I8EA 2OTWA 4C59B 5CZKA 3CFIC 3P2TA 4V1DA 5ANME 2CXGA 1GGCL 2J2ZA 4XX1E 2DQUH 5GRJH 5GGQL 3D18A 1A7PL 1F3JA 3WHXB 4PJDB 2BSRA 5ILTL 4QNPE 4MQ7A 5K9JL 4HZAA 3AU1A 1MPAH 3CZFB 3QIWC 5KSBB 1P4LA 2JJUA 5A2LH 2XA8H 2XY2A 3SDYH 4FFYL 4HUKB 3DX7B 1MFEL 3KLHD 3TFKC 1CG9B 5HHQB 3BUYA 3OB0H 1VPOL 3MNWA 3MLSL 3N1MC 2D7OA 2DQGH 1K3IA 2R2BA 1CGSL 2R1WA 2CLVA 2CPCA 5DD6B 1G7IA 3UTQB 1V8HA 4TULL 1T2JA 3NCYS 1CL7I 4U2ZA 1OSZA 1U8KB 3AREB 2E8YA 5DUBA 4MD0A 5E8DL 5C8JB 3FFCE 3O4LB 4I3SL 5HYQA 1A6VH 2Y6SC 4QRTB 2BOBB 5CZVH 5DHYA 1XEDA 3EHBD 1NL0H 4QF1B 1DUZA 1QRND 1T0NA 2VE6B 2A6KA 3D85B 5IB4A 1I7UA 1VDGA 3LQAL 1NDMA 1YJDH 1K3ZA 2D03H 4J12A 1CICD 5EIVA 2FX9H 1YY9C 4MD5B 2LTQC 2XOTA 3MA9L 2E9JA 4HWBA 3W0WE 5DMGC 4PV9B 2F5AL 1MVFA 2EIZA 3ARDD 1X5JA 1RIUH 1U58A 2VXUH 4O58L 1C12A 4NKIH 4U7MA 2FB4H 4FQLH 2DKSA 1EIBA 3WL9B 1R3LB 2VIRB 1VEOA 3CVHL 3L7EA 3HR5B 3RQ3A 1I3GH 3WLWD 3JWDL 4PJIF 4G5ZH 4XXDB 5FYKH 4MDIB 1GL4B 3VG0L 3WBDA 1GOHA 5ID0A 2ZKHH 4QTIL 5DFVD 3MRQA 2Q3AA 4AQ1B 1RJYA 5HHNA 5C09D 1T2QH 1EJOH 4GBXB 3QIUD 2WINA 3HC0A 4LPCA 2LVEA 5F97E 3B9KD 3I6GB 5FF6B 3RKDC 1QSVA 2ZUUA 4H1LA 5H8DA 4Z5RB 2EDXA 3B3IB 4L8CA 1A1OA 1TJIH 1U95A 4ZAKA 5CKAA 1FNEA 1U92A 2YD2A 4XVUD 2C7UA 4K07A 4LEXL 3LKRB 1ULVA 5FUZL 5TE6H 1URLA 1BZ9B 2NY3D 1L0QA 1CWVA 2PYED 3WCYA 2PETA 4L1HA 2E8ZA 3DRQA 3KYOA 4C83B 3SEPA 2YPKA 4JAMA 4ODVH 1FZMA 4KHTL 1ACZA 5FHBH 4FABH 2GT9B 2MOVA 4KQ4H 3KPOB 5J8OA 4BZYA 5KS9A 5CD5D 3V4PL 3ZKXB 2X4SA 3I3DA 4R6UA 4YWGH 3GNMH 5DRXB 3GSWB 1ZTXL 5TFSH 4Q2ZB 4Z78A 1NCBL 1U8QA 4WY7H 3SY0A 4PBVC 3NZ8A 5EO9A 2Q8BH 1CDJA 1PY9A 2D7PA 3H2WA 4P23A 5MERB 5DTFB 3MGTB 4HWUA 5EPMA 1Q9LA 4ZAKC 2YOCA 4M48H 3L3DA 4NM8L 3A6OA 3RPIA 1UENA 4R96A 3C6LD 5DJXA 5DVMA 3MJ6A 4ORGA 5GGSA 3LQAC 1LILA 4J7RA 1U0QA 3PGCB 4OCMC 1P1ZA 1RZ8A 5IF0A 3QUZB 2E27H 1XGRB 3BAEH 2CGRL 4PJ5A 4L8DB 1EFXB 3LSOB 1SY6A 5CJBA 1DE4B 2F54D 2W1NA 1BHGA 4R3SA 2RBLA 3BGFC 1C8PA 3KS0J 4G6JL 3CDGA 3PWLB 4PGBB 5DUML 4Y1AD 2ICWI 1VEPA 4PRHE 4YIQA 2W0FB 4UUJA 2FBJH 3BQUC 5I1DA 2FWOB 1KBGL 2GJZB 4PJCA 3SCMC 4F37K 2C3VB 1X5KA 4LRIC 1KPRA 2IPUG 4HUMB 5JZ7D 5E5MA 5B8CB 4DGVH 3T3ME 3QNZB 1HSBA 5BRZE 4ODUA 5GGRB 2OSLA 5L88L 2F53A 2XTLA 1P84J 2XACC 2FNBA 4KTDH 4GMSL 3P30L 3U7YH 1MHPL 1HXYB 1A7OH 2UY6A 2D31B 3HAEB 5C71A 1N0XL 5TJWK 4K8RH 1FYTD 3FO9A 3QUKB 1MFAL 3SDAC 3LKNA 4JDTH 5ESVA 2ORBH 3IDGA 3VD4A 2BVOA 2A2QT 2OZ4L 4OJFL 1MCDA 3VRLF 3RWFB 3N1PC 2KL6A 4NZJA 5EBMA 4ONHA 3IU4H 4XCCH 3IFNL 4DN3L 5KSAB 2F58H 1I8MA 2CO6B 2H2PD 1MWAL 5EIIB 4W81A 2PTVA 1Z3GL 3LY6A 1YYLL 2VQTA 1HKFA 1F6AB 4HCRL 5E70A 3VXNB 2VKXA 3C2SA 4F58L 1U8PA 3GJEB 1QSZA 2FJGA 2UZYB 1KCUL 1BIIB 3LKSB 4BH8A 3THMH 3QCUL 1OGAE 5JORB 4NRXB 4YGVB 3EUUA 2B20A 5KANI 1A22B 4U1KA 3MCKA 4GW4B 4M6MH 1JPFB 1Q38A 4HDIB 2OMNA 3DX9B 1KCSL 2H45A 2X7LA 4N9GA 5K59F 5IMLB 4ODWA 5CP3A 1F13A 1D6EB 4ZFFA 4I3RH 4MSWB 3QFDA 4NRYA 1UEMA 5FV1L 4YXKL 4Z7WB 4ZO7A 4HKZB 2IGFL 3DUSA 4PP2A 3ECBB 2XICA 2V7HB 5GS0L 3TVMB 1DBBL 3FFDB 2AXFB 3NCMA 2P8MB 4K3DH 5EUKB 2EYRA 2NMSA 5HYIA 1X5ZA 1OGTA 1KIPB 1DLFH 4DGIL 4NO3A 1KCKA 3FO0L 1NCUA 4P5TC 5I1AA 1A1MB 4PRPD 1INEH 1AHWB 1A0QL 4RA0C 4OBRA 2HMIC 2EDLA 2AABH 4OZGB 5DI8B 3DX6A 2FH6A 4LCYB 1QR4A 3QIBC 4LIQH 1FRGL 5C0NC 4HHAB 2VXTL 4CRPA 1ZHKA 4NC2B 3X14B 1AD9A 4WW2C 1I7ZB 4OKVA 1XF3A 4DKDC 1SJEA 5DJ8A 1D6VH 4PJXB 4UV7L 1CR9H 35C8L 4OLYH 2V5YA 3HUJF 1FL3B 2MHAA 2P8LA 4FFVC 4FQHA 2BXZA 4G42B 3PHOB 4MD4A 3RL2B 5L2KA 4IS6B 4FQJH 1DTUA 4R0LB 3WHE0 4HV8A 3BDYH 5KSBE 1I8KA 4NKMB 3G5XB 4CNIB 2GITB 1T20A 5C0JA 5B4MD 3CFJB 3H9SD 2YRPA 3KGRA 4BA8A 4UAOB 1V5JA 1MIEL 2YSSA 3GHBL 5GGTL 3EJZD 4GRWE 4OD2A 5HHVH 5AG9A 4OIBA 1TVHB 4OIIL 3BXNA 4FQPA 4PRIB 3IDMA 4OZHB 4HUVA 5E7BA 3HAEG 3MA7B 5EZLB 3A67H 4OAWB 3B83A 3DMMA 3V52H 3EYQC 4WTZA 3U83A 4ZDHB 1LEKB 5TDNB 2YA1A 3ILQC 1B0WA 5IFJB 5DD1H 1EO8L 2O5YH 5DD3L 2R1YA 4JANA 3PWPE 5CHNB 1Z5LA 2VSDA 3ULUE 4CN6A 1FDLH 1QBAA 1HNGA 2KPNA 4Y7MA 5D7KD 5FO8A 4J4PD 3DXAA 1JWMA 3TT1H 4K94H 4XPGH 4GAYA 2EYTB 1HHKA 4ZQKA 4JDVB 1BBDH 1KCRL 3HI6L 1MLBA 1I9JH 3P4NB 4EUPH 4P59L 5SX4H 2WIIB 3AAZA 1RIVL 1I9EA 5GS0C 4YHLH 3MRHB 3CFDB 4U7SA 1QFPA 5C6WH 1FGVH 4ZO9A 1BFTA 3ZYJA 4LDLB 1FZJB 1P4IL 1DBAH 3W9DA 1T2XA 4L4TD 2BNQA 4L3EA 4YO0B 3TZVC 3N1QC 1B6DA 1ZANL 4KRLB 2IH3B 4MB4A 4XMKL 4WO4C 4HS6A 4ZFZB 3G04B 1JIBA 2AEPH 4ZD3L 4XAWL 5AUMA 2XQBH 3MUGA 4P2OB 3QNYB 4NKDB 4JHWH 3O0RL 2CKBL 4LVNC 5CILL 3LS5L 4JRXD 1T83C 1OT2A 1HHIA 1J1PL 4ZUWA 2RR3A 5IT2L 1JNLH 4LOUC 4DN4L 4L4VD 5IMOB 2E6JA 3KYAA 4DW2H 4OZ4A 3CFKA 3T3MF 1IILE 3G5VB 3UJJH 1Y6KR 2VAAA 3P0VL 5I15H 5FOBB 5CEXA 5IJVB 2AGJH 3VFMA 4P9MH 5EC2A 1PEZA 3GI8H 4K23H 3WKMH 3MRDB 1HDMA 1ZT7B 3UBXI 5TE7H 3H7LA 4XXCA 5KVFL 1C5CH 3VGFA 5HDBF 3GZKA 3O11A 4WUUA 2QSTA 4JFHD 3QCVH 5F1OB 1HI6B 3ROOA 1L0XA 5E2VH 3BP5B 1T89A 1X4YA 2JB5L 4JM4L 3VWJA 4LGPB 1RMFL 3UTTD 2OQJA 5DQDL 1OOAA 5GZNC 4BQ8A 5IVXB 1QRKA 1RUQL 2BVYA 4Y4KB 1T04B 4HT1H 4ISVB 3DVFA 4R26H 1W2KT 1AGDA 3SDCD 3MXVH 3MRBB 4DWHA 3RX7A 4EUPB 5IGXH 1K4CA 4X80H 1CK0L 1JWSA 2HRPL 3F7RA 3KR3L 5IHZB 2Q8AH 3OF6A 4U1MA 4XP5H 4U2YA 1XF1A 1MRFH 3LV3A 1EGJH 4QRUA 1VKXA 3IAGC 1QQDB 3V0WH 3UC0L 2AEQH 1DBJL 5IB3A 3TT3H 4PJDA 4OF7A 1AXIB 2PO6B 3VFUA 2OTUB 1T7ZA 3QULA 1OL0A 3EOTL 1FNHA 2ZCLH 5BXFA 4PJ8D 3BMVA 4GKSB 3FKUS 1J18A 3NAAL 4DOHB 3ZTJG 2P4AB 3WO3B 3MRPB 4LMQE 4NRZB 1T89C 1A6ZB 2VDLL 2AI0L 1YQVH 3CUPA 1CG9A 3KWWB 3CH1B 1A14L 5CJOL 5DMKB 4QHUA 4LLMA 5IMKB 4KJPC 5C2UB 4JY5L 1YECL 5SWQA 5DD6A 3MLYL 4YBLC 4GXUN 1U9KA 2I07A 5ITFB 4HULB 1G1YA 1HN1A 1IARB 1YEJH 2FX8H 3KPRB 4TPRL 5I8KL 1OD7A 1U3JA 3EYSH 1D5IL 3ME0A 4I0KA 5J89A 2YUVA 1Z9SA 3HNTH 5JHLH 1CDCA 3D2UD 3RY6A 3IFOB 1U8KA 3AREA 3NCEB 3C08L 1W0WB 5C8JA 1ZA6A 1GGUA 4TNWK 3BPCB 1NPUA 3LDBB 1KIUA 2BOBA 4RBPK 2XXCB 4PREB 5J1TC 3V95A 3AUVA 5IBTH 5L2JA 1F4YL 4J3UA 5EZOH 2EDTA 2G9HA 2JB6B 2VXVL 4EVNB 4MLSA 2BNRB 2J8UA 2NY6D 3MLUH 4RAUB 1HXMB 5DGRA 5EU7C 1RZKH 3I9GH 2IBZY 1YEHL 1CXFA 3DV4A 5DEFA 3RZCA 4M1DH 3ZE2E 2EO9A 4G7YH 1N59A 5HPOA 5FCSH 4OD3H 2GTWB 5E00A 2Q87A 4MWFA 3S98A 4OCYH 2P8PA 5L0QB 2F54E 1IC4L 2GEEA 3UROR 2VN7A 2FLRT 2GI7A 3X11B 1YPZF 4RGNB 5E08H 4ELMF 4NO0A 1NGPH 2H8PA 4GRWF 4OBSA 2HKHL 3KJ4C 4WW1A 4Z7NF 2H6PB 2AJXH 5DYOB 1S7QB 1T7VA 3UZEA 3FT4B 4GBXA 4K3HA 3SKOB 4Z6AT 4LLYA 3TBTA 1F4HA 3O2VH 1U6AH 2OP4L 2P46B 3STLB 4Z7WE 3RHWK 3FQWB 5HDQL 3RVUD 3MLRH 1OPGL 3MLZL 1MCWM 3CX5K 3PL6C 4M7LH 5FYJL 5C08B 4M4PA 1JI1A 1S7XB 3P4MA 1W72H 3RZCC 1IAIM 4RISL 2F5BL 3OZ9L 1ACYH 3RRQA 1JF1A 1TETH 3HNSL 4NNYA 5HGBB 4EUPG 5I30L 1CU4H 2JF1A 4F7MB 3WXVH 5CGYD 3IS1X 5JUEH 3P73A 2VQUA 5GZOC 3HI1B 1IBGL 4OZGE 5BCAA 5D7LD 3ET9F 3UZQA 4C83A 3HCVB 3VGAC 3G5YB 2NY4C 5D8JH 1EXUB 3REVA 4KGLA 5TPWH 1MFBL 1PQZA 4XP6L 5CUSH 2NY6B 2Y72A 3CX5J 1GGBH 2OMBA 3PWVB 5JQ6H 4MNQA 5FK9B 5GISL 5BS0B 3SDXA 3GBMH 2HLAA 5DRXA 2NY2C 1RUAL 4OCSH 4NPYB 2DIBA 1A9EA 4XC3L 1JZ2A 1FNSH 1KYOJ 3BPOB 4QTHB 5I1JL 4X6CF 1T22B 5HTSA 5DQJA 1NANI 1FPTL 3TBVA 3OKLB 1EAPB 5T3XL 5JOEA 1PLGL 1XGQB 4F33A 1A02N 5DTFA 1T21B 3G6AA 5D6DA 3QXAA 1ZHNA 2MCG1 1NCCL 1NBYB 4TN9A 5IMMA 4LAQL 3FRPA 1ZOXA 4G3YL 2HFEA 2UVFA 4KJYA 4PRIE 1MCEA 4HPOH 3WKNA 1TZGH 3AXLA 4JY6B 2PXYB 1I3VA 2KQNA 2X9XA 4YXHH 3BOVA 3JWOC 3S35L 3LEXA 2BERA 3MV8D 3EJYD 1UKQA 1KSRA 3IT8D 1HSAB 4M1CC 3D5OF 2I60H 2V17L 3GEWB 2FH8A 4B53A 2A77H 4LRNH 1N4XL 3SE9L 2XTJB 2CRMA 2CQVA 2B2XH 5GGSY 1KEGL 3NZHL 4N0UB 2FWOA 2AJUH 1TXKA 2C3VA 3MRIB 1NFIB 2DMKA 1DN0B 5D7SH 1UJ3A 2HTKD 1IVLA 2YD5A 1PZ5A 1W72B 3O8XB 4OM1H 4G9FB 1X5FA 2NTSP 1J1XH 2AERT 5D1ZD 4KJQC 3GB7A 5GGRA 1NUDA 2JJTA 3OKKB 4O51B 4ZUUA 5IVZA 3U30B 1LD9A 2AJVH 1B0GA 3PV6B 4F7PB 3HE6C 2J4WL 5T5NF 4TVPD 4HXAH 1P69B 4HC1H 3VXQB 1N64H 1ETZB 4LIQE 1LEIA 5FKPB 1B90A 3P4LA 2HT3C 3IJHA 3PDGA 4OCLC 4XP4H 5EOCH 1RURH 5E6IB 5F89A 3EDKA 4HBQA 5EU4B 4ZFOL 4NWUL 1I1AA 3RHWF 3WJJC 4UB0H 3ZE1E 5EZJB 3WS3A 3GSUB 3H9SE 5J3HC 3MRLA 4PY8I 1JK8B 4LHUA 1G7MB 1L9NA 1QR1A 4FTVD 2DI9A 4ONGL 4Z76B 5GS1B 3MRFB 5LVEA 4PGZA 3LIZH 5DJ0A 4GW5A 3K81A 5ID1A 3GMNB 4P9HL 3WNNA 3VXNA 3LN5A 3KLSA 5HI5C 4G7VH 2DLEA 4X5LA 2JJTC 3TN0B 1EVTC 4KMLB 4LFHG 3ZO0A 5D7JB 4Z7UA 5C0EA 4O02H 4YGVA 4CMHC 3NIFF 4LVHB 1T66D 5B39B 1NLBL 3EOAB 5D72H 1OW0C 3NFPA 3LPFA 4ODSH 3DX9A 1AKJB 4AENB 5JR1L 2BMKB 6FABL 4I0PC 4XPTH 2P44B 5CINH 3GK8H 5F7DB 2IPTL 3ARGD 1ZLSH 3NN8A 3WLBA 4F7EB 3C60D 4PIRF 1I1AC 1YEEL 4JHBA 2J3SA 4WVRA 3WIHH 2P5ED 5D7KE 1H5BC 3FFDA 2AXFA 3S36X 5F88A 2R8SH 2CK2A 2JCCA 4XVJL 1BVLA 2ADIB 2QADC 2E6QA 1UH4A 1WZMA 5EZIL 5IVXE 1S5IH 4ODHH 1U3HC 4ZFOA 1LE5B 1EAJA 3VWKB 2W60A 3N85L 1S7RA 3OGCB 4KROB 4DFIA 5C0BD 2IFFH 1B4JL 4N0YH 3LEYL 3GMLB 4XBEH 3QYCA 3T2NH 4OSUH 4MGXA 3UJIH 5L6YL 3Q5OA 2GUOA 5DJ6B 3KYNB 3O2DL 1NGWB 1SJVA 1XGUB 1RUMH 5C0AB 4HHAA 3V5KA 1SM3H 5E8PB 1I7ZA 4DZ8A 4DFHA 4L4TE 5TH2A 3KXFB 4PJXA 3CIQA 5IK3B 2R0WL 3PABB 3L1OL 1YYML 1OQOA 4DTGL 2Z0BA 3U4AA 5INDA 1U93A 3WJLA 1NEZA 3PHOA 1MAKA 1RUPL 2NLJB 3MRRB 5E2TL 4NQVA 4KJWC 3VU2A 4OM0L 4Q9RL 1RU9L 4DOHE 1CDYA 5E94B 4H20L 5DFWH 4JREC 2CJUL 4HIHA 3JVGC 4J6RL 3RNKA 4ZUTB 3BT2H 5E24E 3TP4A 1MCSA 3RA7H 3ALXA 4JFEB 1QEWA 4R7NA 1RHFA 1NGQH 2Y6SD 4R4FL 4OI7A 3S96A 3NH7H 3KPRE 5F3BB 5HPMA 3SBWA 5EZLA 3V0AC 3QUYB 3X13B 1MCIA 3ARBC 4RQQB 4L3CB 5D2NC 3DNKA 4J3TA 4P9HC 4WU7B 4KKAD 3HLAB 3LRGA 1LEKA 2W9DH 4GAGL 2COQA 4AEIL 1AY1H 5DMGD 2BNRE 4PTUB 1GHFH 2VXSH 4S1DC 5CHNA 1IQDB 5E4EC 4JR9L 2EH7L 3SGEI 4K7FA 4Q9QH 1T1WB 5F6HI 2C1PA 3RGVA 1NBZA 2R15A 4OD1L 4L29A 1IGML 4Y88A 3T1WA 3O9WA 4ORZC 5SV3A 1DLHA 1X5IA 4JDVA 1WFTA 4IRJA 1O0VA 3S34L 4X8XA 4XNZC 2OK0L 1JGVL 5GRXG 1IC7H 3FOLA 4PLJC 1E28A 1PYWA 2WIIA 4JM2B 4PS4H 2VWEC 5B39G 1HE7A 4FA8A 5D6CA 1EV2E 4MA7L 1K8IA 5C0DB 3QEGH 3PWNA 1Q9KB 3VXPA 4RGNE 3BPLB 5K9KA 1AGCB 4QHKI 1I85A 1TZIB 3NABL 2J88L 3E6FA 5EDXA 4H8WH 1LDPH 1ORSA 3BI9X 3KPQA 2AJYL 1MCBA 2V5SA 3L5IA 3OJVC 1OLZA 5J6GB 1CTOA 3UTSA 1IKNA 1AQDB 2V5RA 5I71B 4QYOB 5KJRH 3QWOB 4WWKC 4JN1L 4PRBB 2QSCH 1AO7B 3CDYA 3RGVC 1SJXA 5C08E 3W39A 2P5WB 3FQUA 5AZ2H 3O9WC 2UWEB 5J9PB 4MCYB 1X5HA 4H5SB 1Q1JL 2GIYA 4ZFGL 5IR1B 4KHXL 4CVZA 2Q1EA 4UBDD 4YH6A 4PJ9B 5F1KC 4KK8D 3N1GC 4P48A 4G80A 4XAKD 4XNQB 1F97A 2JIXD 1YNTB 3MNZB 1IZKA 1GOFA 2G60H 5L9DL 2JJVA 5FOBA 4PJIA 4OLUH 5IJVA 4XNYH 2ED9A 3T1FA 5LGJB 4RBPH 1K4DB 3BP7A 1T03H 4ELMB 4ZXBB 4C4KO 5CLWA 5FGBC 2YD6A 4GRLC 3CAFA 4JFOA 3IXAA 1SEQL 5C1MB 3RWEB 3ZZ1A