The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
226
|
structure length |
196
|
Chain Sequence |
SKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDENKEKPFVVTPPLFRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIPPDVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLARNVSWRIINDQGGLDRLYSKNVT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Chaperone protein caf1M
|
publication title |
Hydrophobicity and rigidity of binding segments enable CAF1M chaperone to act as assembly catalyst
rcsb |
source organism |
Yersinia pestis
|
molecule tags |
Chaperone/structural protein
|
total genus |
36
|
structure length |
196
|
sequence length |
226
|
ec nomenclature | |
pdb deposition date | 2008-07-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00345 | PapD_N | Pili and flagellar-assembly chaperone, PapD N-terminal domain |
A | PF02753 | PapD_C | Pili assembly chaperone PapD, C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |