3WJJA

Crystal structure of iib selective fc variant, fc(p238d), in complex with fcgriib
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
212
structure length
212
Chain Sequence
ELLGGDSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Engineered antibody Fc variant with selectively enhanced Fc gamma RIIb binding over both Fc gamma RIIaR131 and Fc gamma RIIaH131.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjjA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjjA01
4UDUB 1JI1A 3P73A 3T0XA 1CIUA 5E8PA 1JYWA 4HKZA 4Y4KC 3TNNB 3TZVC 1BIIA 3D6GA 4X7SL 5T3XH 4H0HB 1YNLL 3QUMH 3TYFA 1T0MB 3ARGD 4E41A 4YBHA 2NY4B 1G6VK 3CJJA 4H1LA 2CKBA 4IHOB 4DFHA 4HKXB 1NBVL 4NWTL 1UWXK 4KKLC 1CLCA 1CG9A 4BK4A 2XACC 4HUKB 4FFWC 4JQIH 5ERWA 4KVNL 3RY6A 2YMXL 2J6EH 4Q9RL 1NKOA 3SKJL 3GBMH 1NUFA 5EU3B 3CH1A 1S7SB 3BDYH 3MXWH 1CLYH 3OKLA 5F9DC 5DJ0B 4KZDH 2NMSA 5FYLL 3OZ9L 2XNAA 5B39A 3U0TA 4PJ5E 3DHJA 2ED7A 4LLYA 2R69H 2IALB 4UU9A 1OAKH 4Z76A 1V7NL 4R90L 3K2MC 4JFED 3WJLA 1TLKA 1IQWH 5M95B 5IB3B 5E2UH 1U8IB 5T5NG 3BQUB 3ARFC 3E8UL 4OF8A 5HY9A 4P4KB 5IGXH 4PJHE 4NNYA 3BAEL 3O3EB 3L3DA 3O81A 3MRPB 5JW3H 4M62L 3V6FA 1OAXL 4QOKE 2DMCA 3QA3B 4PG2C 2O5ZL 3V5HB 5CEZE 4OCMC 2GYSA 2PUQT 4TPRH 1N4XL 1X5KA 1EEYB 4RBPH 1FNGA 1JWUB 5BXFB 4M9PA 4RFEB 4BSWA 4L3EE 4XBPB 2PO6A 4APQA 2ICWA 4RGOL 5EO0A 2AJYH 1DCLA 2PCPA 5IG7A 1P7HL 2C9AA 5JZ7D 5IMOA 3CLEL 1L7IH 8CGTA 4ZUWB 1TITA 2NY5H 4HH9A 1AQKH 1W2KT 1F13A 5CIPA 1MY7A 4S1SH 3UTZB 2GKIA 2FBJH 3MRLA 3O4LB 1ZS8A 4ZYKB 2NXZC 4QRPB 4EN3A 3UXFA 4JG0L 4NQCA 3L3OB 5E2WH 2KDGA 2YD5A 3DYPA 4AEIL 2A0LD 4CKVX 2WAHA 1JE6A 2MPAL 1G7MB 3GJFA 4M7JH 4OCSL 1DBKL 4MMZC 2D31B 1A2YB 3G08B 2H8PB 1U95B 4XMPH 3RU8H 5JW4N 2HJKA 1IT9L 3VXPB 4MCZA 3LH2L 1YMHB 1JRHI 2JE8A 4P5KA 1E4XH 3HNVH 4HK3N 1B88A 1XCQA 4R2GC 3RWEB 2IPTH 4L4TA 4PUBL 5CEZH 1FVDA 3MX0A 1BGXL 3PWNA 2I60L 3ZDXE 3TH3T 3UZQA 5EZLA 4X5WA 2I25N 4U05A 3IJHB 5IT2L 3RGVA 4R0LB 3RWJB 1AQDB 3QUZA 5DF0A 1N7MH 4GH7B 3U83A 1U8QB 3QIBD 4AH2A 5MP6L 2JJSA 5DURD 1DSFH 3RVTD 3VFPB 5IM7B 2XFXB 1E6JH 2V5RA 3FB6B 3LS4H 5E8EB 1I75A 4LCCA 1MI5B 3JTSA 1MFEH 1AO7B 4F9PC 2P1YA 2VDNL 3SGEI 2Z91B 4WUUE 5CJQL 1KLUA 2KZ1B 3UAJC 3KLAA 5K33A 4UINL 3QFJE 2FIKA 1BIHA 3UO1H 5GRVL 2ZKHH 3P4NB 1G7LA 5DJCA 3WEXA 4OF6A 1FZMA 3ZSSA 1HHIB 2XWTB 4M7LH 3LKPA 4Z7WE 5D1XC 2BZDA 1HZHH 1CR9H 3FHAA 2H3NB 1DN2A 3QDHA 4OV6F 1RQ5A 4ISVB 2D7OA 3S7GA 1OSZA 1NCNA 3BPLB 3WXVH 3WIFB 1N0XL 2LTQC 4M93C 4KZEH 4BYHA 4L9LC 4TYUA 2BDNL 1JMZA 5EU6D 4NGHL 4QRRA 1RURL 5C9KA 3MUHL 3QPQC 2YPLB 3W82A 4ODHH 4K94H 4GXUM 2BSTA 3UMTA 1LEIA 3JV5A 4IOFC 2GUOA 2K1MA 2WM0A 3W2DL 1VKXB 2NX5D 1PEZA 4PP1D 3MRHB 1JGEB 1UJ3A 3TN0A 1CLOH 1QLEH 2D7QA 4HDIB 1FNEA 2BX5A 1LEGA 1UB5B 4XPFL 1EAPB 4JFXA 1KN4H 4LLQA 3GIVB 3L6FB 1EAJA 4Z9KB 2ATPB 5GGVY 4JFOA 5IJVB 1YDPA 5E1AB 1CFSB 1H3PL 2VLRD 1MFBL 1F90L 1JPSL 2FL5A 2EYRB 1B0GB 2SEBA 3RL1B 5HHOE 4J12A 4OZFA 1IL1A 2RFXB 2X4RA 3O8XA 3S4SB 1VGEL 3HI5H 3Q2CA 2V6HA 4MZ2A 4K3JH 4K55A 3T3ME 3MRGA 1GGIH 3KWWA 3PWJA 1TTGA 1QYGH 4KRMB 4CW1B 1T1YA 2CJUL 4P2QD 3EOAA 2Z35B 4NJAH 4LRIC 3V6ZB 1RZIA 5BVPH 1BOYA 2PYFA 1XF4B 2H2PC 5F7HA 5EU4A 2R2BB 3UTPD 1MHPH 1ZHKA 2BCKA 2FHFA 3W9DB 2QQKL 1NJ9A 5JIIA 1T2JA 1U3HA 5EZJB 4OB5L 2BOCA 4TRPL 5GGTA 1FC1A 3W0WE 5BW7C 4XVSH 4NQEB 4CVZA 1G6RB 5CEYB 4XC1H 3T8XB 4O58L 2APVA 3V0AC 4WU7A 4XMKL 3TH4T 4NRXB 4QXTB 2HMIC 1H5BB 3MNVB 2WZPD 5L2JB 5EO1B 4YDIH 1A64A 2X5PA 3NBNA 1IGJA 1KJ3H 2ITDA 3OKYA 3E2HB 1IQDB 1OLZA 4MSWA 3D85D 3MCG1 1IGTA 2AABL 4UI2A 1JZ2A 1J8HB 5DVLA 4YGAB 5ANME 3H9HB 4ZOBA 1CQYA 4Y19E 1YN7B 2R0WH 3UBXG 3FQXB 1G7QA 1DFBH 4PJCF 2YUXA 1LO3H 2KUTA 3EHBD 4LKCA 4WU5B 1ZGLM 3WD5L 2WINA 2OK0H 5ESAB 4TQEL 5CMAA 5BVJA 1K85A 4HIIA 2JF1A 3QXAA 2Y72A 3BHBA 4NKDB 3BEVB 3HLAA 5DUPH 3O3BB 4P2OB 3TPKA 2X40A 1SYVA 4AIZA 5I16A 2VDML 3NIGE 5H8DA 5F6IB 3EOYG 4R7DB 2PYEB 1H8OA 2CLVA 2ZCHH 2ICES 3MUJA 2E7MA 4L9DA 4XP1H 1MLCA 4K71C 4UAOC 4Y2DD 1NEUA 5BOPA 5IV2A 1TNMA 3BPOB 1MFDL 2CD0A 4Z18A 1N5AA 1NCDL 5LXGL 3QNZB 3BI9X 1CXKA 2YD8A 4JM2D 3MGTA 2XXCB 4PR5A 2IBGA 3RWFA 3RHWF 4O2EA 1Y18B 1J12A 5EA0H 5T1LD 3INUH 4ODTL 2X4UA 3WLBA 1H9VA 4DJMA 1JWMB 1UFUA 1F4YL 1J1PL 9CGTA 3WFCL 4JFPB 3VMOA 4P46D 3SDAD 3GB7B 3KR3H 1KPRA 4L8BB 1D9KA 1J88A 2UY7A 5H35B 4MA8H 5HYJD 4OGXL 1J05A 1IAII 3MLUL 2ITCA 3UP1A 4Y5XB 3RTQD 1C16A 4L4VD 3QWOA 1JF5A 2BFVL 2CR6A 1EUUA 3R0MA 4GXUN 2WUCL 3QEGH 5ILTH 1IC7H 3L5WB 5ITFA 4Y89A 4PJGF 3FO9A 1KJVB 2OM5A 2FIRT 4XHJC 4O2FA 2VOTA 3PGCB 4FQJH 3G6DL 4PV8B 4ZFGH 3RFZC 1JNHB 2OXHA 2HKFL 1L0YA 4TUOA 2XXMB 4IOSD 4RFOL 4WY7H 3IDIB 4YNYB 5DEZA 3IFLH 2GT9A 2HT2C 1OVZA 4P48A 3O3DB 1LK3H 1IEAA 1MQ8A 5HD8D 2PF6A 3EO0B 1EBPA 5IBTH 3P4LA 5IEKB 2VR9A 4NKOB 3V4VH 1NFKA 1I7UA 5EC2B 4WENB 1G7JA 5D1ZD 4X6CE 2JIXB 3MRFB 3V4UL 5HDBF 1J0ZA 3EDEA 1FO0L 4LPTA 5FXCH 2APTA 1D5ZA 1JHTB 3IDUA 1S5IL 2EIDA 1S7VA 5AAMA 5E5RB 2P5EE 4OLWL 3EYOB 5CZVH 1UH4A 5C0GB 3QQ3B 3B9KA 2QSTA 1CK0L 1IBGL 3JWOC 3ARGB 4J3SA 4I0CC 4DEPB 4LPVA 2R2EA 5JPMA 5TH2A 3SGKA 5KVDL 5D2LE 2R0KH 1BFOA 4JRYE 1HSBB 3L3KA 4JFDA 1C1EH 5HYSA 3VG9B 3U7AA 2EC8A 3DV4A 5IIEA 1AGBB 3GJFK 3HS0A 4OUUB 2A73B 5JOPE 3DROB 5D93B 2BNRD 3S9DB 3RDTA 4TSBL 5I2IB 3PIQB 4K8RD 5GJTH 2CDGB 3GSQB 4MB3A 4Z0BH 3BH9A 1SEQH 4M1GL 1Y0LB 3O0RH 3BJLA 3UZEA 4AT6A 1BVKA 1RUAL 1LD9B 4IBLT 1WEJH 4A6YB 3LKQA 4JFEB 1UEMA 1U91B 4OM1H 1HSAA 1E4KC 1PQZA 4XPHH 5E24E 4O9HH 5KJRL 4HC1L 1NC2B 2AGJL 5D71H 2VR4A 3SDXA 5LGJA 4RNRB 3OR6B 1A6UH 2AXFA 2FWOA 4YX2L 3HMXH 4L8CB 2XWJA 3STZA 3Q6FB 1IGCL 1EZVY 2A6DB 5F21B 5I1EL 1MCNA 2JB5H 5IEHA 4BH8B 1WCBB 1T0PB 5INCB 1FQ9C 1CCZA 1A4JB 3ZLQC 1TQBB 4OKVA 4HGMA 4Z78A 4TUJA 2I9LA 3T0EC 3BH8A 4LHUG 4W6XB 5CJOL 1SYSA 5HJ3B 4FTVD 4ZS7H 1A6AB 1HOCA 2R1YA 2C3HA 4LAQH 5F97E 3T77B 2OCFD 1W72B 5DA4A 4DQOL 4V1DA 4LASH 4ZXBB 3VFMA 4OLXH 1MRDL 2X1QA 4RA3A 2GJ6E 3MV7D 5CP7A 2NY2C 5EWIL 3ARTA 3O41A 2JJUA 4NRZB 3QDAA 3THML 1F6AB 1XGRB 1JZ6A 2DYPD 5HVHC 4U1SA 1UCBL 1GPOL 2X10A 1VA9A 2BVUA 5KSAA 5DJ8A 1S7TA 1D5BB 1U93A 5D7IE 4XGZA 4KAQH 1S7RA 3VFGL 4XP9H 4IIQA 2IBBA 1WT5C 1K2DB 2IAND 1MJUH 2P7TA 4WI7A 4FQLH 2VXVH 2YPVH 5GGUA 1K8IA 2MWCA 3ET9F 3ESUF 4YUEH 4GKNA 3RWCB 5DRNB 2J8UE 3IU4L 1ZGLP 3CFCL 5TQ2H 1FAIH 1A21A 3JV4B 5BS0E 3VXRE 2YD2A 4JKKA 8FABA 5FYKL 3GMQB 3ILPA 5BV7L 4OT1L 2CGRL 3Q48A 3MYZA 4Y4KD 5HXMA 1I7ZB 3TZVD 4PGJA 5CD3B 2Z92A 4XRCA 4QXGH 3HAEA 5FGBA 4ETQB 1NBZA 4HK0A 3WSQH 3N06B 4CADB 3OXSA 3QIBB 2FR4B 4P3DA 1S78C 2NR6C 3QUXA 4KKLD 5DURB 5FO7B 4UB0H 1QUNA 3OKDA 1ZV5A 4FFWD 3O9WB 4KVCL 5TJWK 3T2NH 5HI4C 2FZ3B 3DV6A 3C2AH 3VWKA 5D6DA 4PJDE 5I71B 4PJBF 1YJDC 5F88B 1AGFB 3GSUB 4KJWC 1MAJA 3B6SB 1NMAH 3KPQA 1FPTH 1FIGL 1VFUA 1CXFA 4MA1B 2P43B 1JP5A 1UM5L 4Q6IC 4KPHH 2VLKA 1FYTA 4LCYB 1UWGL 3UTTD 1ZGLB 4E5XA 2MNUA 2BNQB 3NCFB 1EERB 3MV8E 1UXWA 1GC1L 1M05B 2JELH 4JDVA 1C12B 3VFNA 4D9RD 5ICZA 5HHPA 1U58B 1RZ7H 1M7IB 3OTTA 1E4JA 5FO9B 3ARFD 1JBJA 4DKDC 1SJHA 1VEOA 2XRAH 4KQ3H 5GJSH 1NUGA 4RIRA 2XPGA 2QSCL 2BMKB 5J06A 3ZKSD 2R8SH 2BSSA 1DQQB 1DBMH 1XH3A 2F54A 2RHEA 1MEXL 1GZQA 1P69B 4HUUA 4J23A 3L1OH 1HQRA 2NX5B 2X4SB 1QSFE 4OI8A 3VH8A 5I9QB 3WE6B 2NZ9C 5J9PA 3IKCB 1OW0A 2OTUA 3KYAA 1G9MH 1KTKE 3G5ZB 4PJ7F 5I1GH 4GAYB 2R2HB 2J2ZA 3GZKA 4PJ9B 4Y16A 5TGBA 2VLRB 3DI2B 3U1SL 1MLBA 3HUJB 1BD2D 5TF1H 2C1PB 3R8QA 4X6EB 3F7YA 3LKSA 4XVTL 2NXZD 5L2KD 5E6YA 3CDGA 4K2UH 5EU5B 4X4YA 1K4DA 4JKMA 4OKDA 3NOIA 4B41A 4P2QB 1MWAH 4HV8B 3IDYB 3GMNB 1RK1B 1L6XA 2GJJA 4YAQB 3I50L 3FRPA 2LU3A 4JLRA 5EU6A 5ICYB 1INQA 3P9LB 1BAFH 2XA3A 4MLIA 3L3JA 3RQ3A 3TVMA 3BD5A 4NYLA 1U8JB 3OJMB 3MA9L 4KI5F 3BPCA 3SKUD 4JHZA 3CXDL 2I9TB 4BFIA 3X13B 1LE5B 4YDKH 3T1WA 1M4KA 1S9YA 3B2VL 5D96B 2Z4QB 4OAWA 1T1ZA 4OSUL 5EPMA 1T1WA 5BZWA 3L7FA 3ZL4H 3VFTB 2RAMA 1U8KB 1AFVL 2YKLL 4I3RH 5I19H 3BP6B 5D2NB 3N1QC 4JKPH 1GGUA 3H3PH 1KYOK 4HFWB 3UJIL 2C4FT 3L95A 2DLFH 3Q0HA 1A1NA 4WWKA 4LQFL 1AGEA 4X5XB 5B3JF 2ESVD 3U0WL 1NGYA 1WLHA 3SDCB 4KUZH 3HE7B 5LQBH 3KPSD 4J1UA 4NJ9H 3UAJD 5CP3H 4Z7UA 2BSED 3IS0X 5EOTB 3UDWC 5KVGH 1RY7B 1UQSA 2IQ9L 4XT1C 3CZJA 1G0DA 1HCVA 3ARVA 5SWQA 1J0KA 4WHYH 1R3JB 1CU4H 3PWUB 2WV3A 5D1XD 1MCFA 1AJ7H 3BOVA 4ZUUA 2A77H 3DX6B 1RD6A 5F6HI 4DVBA 3UTQA 4WHYG 3LQAC 2RJMA 5DQDH 3MRNA 2ZPKH 3NCJL 1P4IH 2D9CA 4Y2DB 5FO8B 3RJQB 3NFNA 3HZMA 4YHPB 3SPVB 4HS3B 1DANT 1UZ8A 2QQLH 4PRPD 5DA0B 5H37H 2PTTA 3QPQD 5AG8A 4G9FE 1LO2L 4NDMB 5C0BD 3ARDC 3VE0A 4U1IA 4IOFD 3ZSTA 5JXAH 1KJ2H 2O5YH 3D85A 1FG9C 5H37G 5C09E 1QBML 3PWVA 5T1LB 1R6VA 1LNUB 3RWHB 5J11B 1T2QH 2GY7B 3WUWA 3KS0J 3K1DA 1YEGL 5D1QC 4W4NA 3EDFA 2J3SA 4P46B 3SDAB 4M5YH 4XNMB 1F8TL 1MJ7H 5T1KD 4NN7B 4FABH 3KS0H 5GS0L 4K3HA 3LHPH 5HYJB 1N3NB 2D7TL 4QYOB 3RTQB 2VZUA 4OM0H 3BEWA 4WJ5B 3V7AG 4HEME 2XQYK 3VXOB 4OI7A 1DLHB 2V5YA 3BT2H 3C6LC 1KT2B 3VDCA 1B4JL 2ED9A 3PWPE 5T3XL 3QUML 2H2PD 5IQ7H 1QLRB 4JM2A 1J5OH 3SCMA 3KYOB 5KS9F 1GRWA 2HFTA 3CFKB 4PJ7A 4PPTA 1RULL 3BW9A 4J2XA 2J6EL 1BF2A 4Y8DC 4O51B 3AY4C 4K3EH 3EIFA 3T1FA 3WFBH 3MXWL 1CLYL 4ELMA 1K4CA 3SBWA 1NLDH 4KZDL 2HMID 3QWRD 1UACH 2EDKA 5E5MA 3P4OB 1IC5H 5DYOA 1DE4B 1SJEB 5FIEA 3CDYA 3EYVB 3IT8D 2ENYA 3IXTA 1IQWL 1S7QB 3DX8B 5E2UL 3AU1A 5E2JA 5JXEC 3MCKB 1ZT4B 1CDUA 4PRDB 1KCUH 2YN3A 4R3SA 1D7FA 4ZMAT 3RIFK 3MJ9H 2B4CC 5JW3L 2VIRB 3TBYA 2IH3A 2ZSVB 4NN5C 5IBLC 4Q9QH 2BNRB 1Z9MA 4TPRL 2E9JA 2OTWB 1TJIL 1OLLA 5EH1A 1E28A 1R5IA 2Q8AL 2XI9A 4MNQD 4GKSA 3V0WL 4P59L 4U0QB 2FJHA 2R29H 1JZ3A 3ZDZF 2AJYL 1FFPA 3C5ZA 1TJHH 5D1ZA 1NCBH 3G6AA 1UH2A 4ZD3H 1L7IL 1TCRA 2NY5L 1AQKL 2J8HA 4YDLB 4LLWA 3IYLW 1AXSB 4S1SL 5HGDB 2CXGA 5CBAB 1I4FA 1YN6B 3QI9C 2A9MH 5E2WL 4W6WB 1A4KB 5E7BA 2N7BA 4I2XA 1HIMH 4U6XA 4M7JL 1A22B 3PP3K 4NM8H 4QEGA 2G5BB 4XMPL 5ACMA 3RU8L 1GSMA 4LLDA 2ZCKH 3H7LA 3NIFE 3HNVL 1Z3GH 25C8H 4BSVA 2IPTL 5SWSA 1REIA 1H3VA 4G80B 5CEZL 2GIYA 3ZYJA 4P4RA 3C5JA 3C8DA 4RRPG 4QHKJ 1BQHB 1H3GA 1JYXA 1R3LB 5C0NC 5FA4B 3HG1A 1ITCA 5C0IA 4XHJD 3L9RB 3MV7B 5GRJH 1YC7A 1U92A 3QNXB 2GEEA 1T1XA 1N7ML 3LS5H 2E3VA 4PD4J 5HPMB 1QBLH 5F3BB 1DSFL 1H15A 2DBLH 4U7SA 2HT2D 3HRZB 3MLXH 3LS4L 4FFVC 5IMLA 2AV7B 4WV1B 5E8OB 1MFEL 3GMOB 4PJXA 4WW2F 3UROR 3PHQB 5C6TL 4NQDD 5EIQA 2FECI 2IANB 3DX7B 3MRJA 1I3GH 4I8DA 1A9EB 1KB5L 1FFOA 2R39A 3WHXA 1QR4A 3UO1L 3MRBA 1CFVH 1FV1B 1EEZA 1WC7A 3W5NA 5EN2B 3P77A 1J0YA 4FTVA 4FFZH 5A1AA 5EBMA 2CO7B 3GO1H 4M7LL 1T04A 4L29B 4N9OB 4OIAA 4AQ1B 4XBGA 4Y4KB 3VXTB 3TZVB 3EYFA 4RMQA 1HZHL 1CR9L 1OD9A 2NY0B 1DR9A 2CKBB 1R3HB 1TVBA 4KUCF 4GQ9H 1U2HA 2K7PA 2FX9L 2X70A 5DMIH 1EX0A 1FFQA 4JFHD 4NZUH 4HC1A 3WXVL 1HKLH 4JFQA 3GMPB 5ERWB 3MSPA 5KS9A 4X4XA 3TIEB 1D6EB 1R5VA 1FL5B 1SBBA 2DYPA 4ODHL 1NFIA 3LN9A 1CDCA 3KPMB 1HH6A 5IVZA 5C0AE 2FECL 1JZ4A 4X6DE 1DUZA 4NKMB 1CLOL 3O2VH 3IXAB 4JKLA 5GISH 4H26B 1CDYA 1KN4L 4ZOEA 1RI8A 5CEXA 3BE1H 4Z76B 1FDLH 1YMME 4HIXH 4D9LL 3UTTB 5MENE 1IC4H 3QCTH 2DS4A 2DQFA 3K7UA 4WFGE 5C0DB 5D7KE 1ZHBB 5GRVK 2CDEB 5DK2B 4WGVB 3HI5L 4RWYL 1KPVA 5HSFA 5HYFA 2BHZA 1GGIL 3ARFB 2E7CA 1VACA 2UUDK 2IPKB 2VRAA 2PXYC 1QYGL 3CAFA 1PDKA 1JPST 2L7JA 4NJAL 5BVPL 1AXTL 3F65A 4S2SB 4QRUA 1E6OH 3BZ4A 2IPUK 4HMDA 2DQEH 3T0ED 3LPGA 3QG7H 4IRSC 3FZUD 1MHPL 3WYRA 3FONA 4XCYB 3SY0B 4LKXB 2V17L 4PRHB 3VA6A 4KV5E 3ECBA 4X9IA 2DQCH 3P9MA 5CS7A 4XVSL 2BHUA 2VZSA 3PGDB 4XC1L 1YYLH 1D5IH 1UWEL 3MFFB 5CIPB 4JHBA 1BD2B 1M7DA 5IF0B 4MCYB 5BV7C 1ITBB 4GO6B 2NY2D 4NQCB 1INDH 2NXZB 5EFIA 1TQCC 2H1PH 4LVHC 4YDIL 1KJ3L 1SJXA 3IGAB 1RK0A 4TOYH 1NBYA 1NGPH 5FM8A 1YEDB 3PQYE 2XKSA 1JPTH 3DXAD 3EFFA 3WFZA 1NFDF 5J1AA 2YXFA 1AHWA 2HTLC 4QWWC 1FZOB 4R4NC 2HJKB 3WHE0 2A2QT 4J4PA 2P46B 1QO3A 5IMMB 4KC3B 5CSZB 2R0WL 2ZOLA 2XA8H 3CD4A 4LSSH 4U3HA 5E03A 5HDQH 1DFBL 3V8OA 1LO3L 1PYWB 4MXVE 4PP2A 1XGPA 3QFDA 4R2GB 1XZ0A 1MELA 3RX8A 2OK0L 4HGWA 4FG6C 2XTJB 4LIQL 1XGUA 1U8LA 1WBXA 3UTSE 3TBVA 4HUXA 5DQ9A 2AXGB 2JJWA 3KPTA 5E94B 3UJJH 4E42A 3BN3B 4Z7NF 5IW1A 2C1OA 1VGKB 1HI6A 3HMWL 3PDDA 5J6GB 5D4QA 1CDIA 2ZCHL 3RNQB 2IF7A 4PRIE 1S78D 4U31A 5FM5M 5IOPB 2Q1EA 1ES0B 2YSSA 5F7EH 4H8WH 4I18A 4MNHB 2AEIT 3V8CA 5FV2A 1KULA 5HI4D 3MGAA 2E8ZA 4WW2A 1WBZA 4X83A 4DZ8A 3EZJB 4PJFA 1DQDL 3KYKH 4H20L 3KPSB 4KJWD 5EA0L 5HGGS 2ZUWA 3OJDA 2CDFA 3INUL 5EC1A 1EMTH 4J6RH 4OBSA 3WEXB 4NBXB 2C5DC 5ADPH 2NY7H 4MJIA 1L7TH 4YPGB 5EZOH 4ONHA 3C9NA 4OF5A 4JVWA 4MB5A 1ND0A 2W92A 1NC4D 5D1XB 3R0NA 3P0GB 1ZVSA 4ZO6A 5DEFA 2B0SH 2EKJA 5DMGC 1JMXA 4M6OH 2ARWA 5IB1A 4P9HH 4NRYB 4MNGE 3EYSL 5MHSD 4JRXA 1FG2B 1MHEB 3VMNA 1W0YT 2LTQB 2VLJD 4M93B 1B0WA 3LN4A 1U8OA 3BKYL 5ILTL 1IC7L 5J12C 2P8PA 5ID0B 4L9LB 3OF6A 3BRFA 3CVHH 1LEIB 3G9AB 1IZJA 1B0RB 2FATH 3HNSH 4FQJL 5SX4I 4UT6H 5IW6A 4PY8J 3MODH 1FNEB 1LVEA 2QQNL 2NZ9D 4W4OA 4WY7L 5M7QA 1W0VB 1BP3B 2ESVA 4V2CB 1DN0A 3IFLL 4YXKH 1DQJA 1B2WH 3BZEB 3VRIB 1YDPB 4GG6B 2F58H 3D18A 5JW5B 2GJZB 1LK3L 5F9WC 3WNOA 1HEZA 4Y19D 1BZ9B 1MUJA 5T1KB 1UA6H 5AYUH 5IBTL 1Q1JH 3VRJA 1JNLH 3CC5B 2M1KA 3TIDB 5FCUH 4U6TA 1OHQA 3N1MC 4JZNA 3PWLA 3QDMD 5INDB 4F7EB 5I76A 3QHFH 2CQVA 2P45B 1K8DB 2OJZH 1FCGA 2PYFB 3BO8A 5I30L 4AEEA 1ZWIB 2VITA 3EDDA 43C9B 3EZ8A 1ZHKB 3B9VA 2BCKB 3VU2A 1FVCA 1MCSA 2JTDA 5C0BA 1BOGA 2R0KL 4JY4A 1C1EL 2V2TB 5L7XH 3QIWC 3ULVL 1QEWB 4PB0H 4FQQA 4EI5A 3EGSA 3IAPA 5JLZA 1PFCA 4NFBA 5CWSB 2CRMA 1F4AA 3B3IA 5GJTL 3D39A 3WS6A 1JIBA 3BWUC 3DX9B 4PJHF 5KOMC 1CT8A 1FHGA 1SEQL 5DVKA 1WV7T 1U3YA 2P47B 1JGDB 3FB5A 4JHAH 3QHTC 1IGTB 3NZHL 4NC1C 1I3UA 1WEJL 2JCCB 1WIOA 4MA3B 1RZJH 4YLQT 4XPHL 4O9HL 4HUWB 2FX8H 1SHMA 5E56A 2R23B 4NIKB 5D71L 2NLJB 3BIBX 4OIIH 5GIRA 1A6UL 2APWA 3FO1A 2DL9A 2X6MA 3P2TA 4UOJA 4FA8A 1XEDA 3HMXL 1FZJB 1U8NB 3RIAK 3F12A 2IG2H 5C92A 2V9RA 2C3WA 1IGYA 2JB5L 2JLLA 5CMAB 3O4OC 4I3SH 3RVWC 4PJAB 5HI5C 4J3OC 5A16B 2FLRT 2XY2A 1I9RH 3W9EA 3QQNA 4WHDA 5GS0C 1X7QB 2HFEA 3ARXA 2HWZL 1GXEA 1QSED 4WEBL 5IV2B 4K71B 3TWCL 1KCLA 1N5AB 2Z0BA 3AUVA 1SY6A 4UBDC 3U36B 4LASL 4ZO9A 4OQ1A 4NZDA 4OLXL 3OB0K 3IRZA 1Q8MA 2XIDA 4IOIB 4U1MB 3ARDD 2EYTA 4XPGL 4O2EB 3SDYH 2VKWA 4YWGH 2BERA 3J7HA 5L0QC 3AAZB 4Y1AA 3QUMA 3NGBC 4P57A 5TQ0H 4Z8FL 3ZDXF 1ROWA 1T21B 5D1QD 2WWKO 1GGYA 5F89B 4OD2A 3RJDA 5TE7H 4N8CH 3F5WB 2X09A 4KAQL 2WK2A 1TZHB 4XP9L 5GZNC 4U1KA 1EIBA 1D9KB 1G0XA 4RISH 1MJUL 3JUYA 1WZ1H 4JDZB 4FQLL 1OAQH 3VFUA 1JHKH 2YPVL 4G42B 2J6EA 4CGTA 2ZUXA 4YUEL 3E6FA 3IJSB 4JVPA 2CRZA 1A6ZB 5I6XC 4MNQA 1FAIL 4XCCH 4O2CA 3S96A 4X9BA 3C6LD 1GIGH 4G8IA 1IE5A 2GITB 3MOBH 5SWZD 4G8EA 2P24A 5MERB 5DHYB 3WSQL 3AMKA 2AEQH 4XWOC 4GKZB 1AGCB 5F7YC 3LKRA 4LU5H 3GUTA 3PDOA 5FKAB 4XZUB 1IVLA 1PZ5A 4KMTL 4EUPH 2DJ4A 4KMQA 3O4LE 3T2NL 1Y6MR 4QRPE 5JR1L 5BO1H 5IB2A 3PABA 4NQDB 4MD4A 4EUPG 4RDQG 1EA9C 1PY4A 3K80A 3TO2A 1TZIA 1NMAL 4G6AC 3V2AR 1IM9A 1CDBA 3BMVA 5DEGB 2BRQA 4KPHL 1YYML 1S7VB 2F5BH 1EUTA 1G7PB 4LCWD 2FO4A 2JELL 3BP4B 2A6IA 2H32B 2IBZY 4ZO7A 4RZCB 1V3JA 3B83A 4G8GD 4HQQH 1RZ7L 4G3YH 1QQDA 2NY5C 3BMWA 5DJ6A 3TV3H 5JPMB 2FHCA 2Q86A 5JXED 4NSKB 3OQ3B 4J7RA 5E5UB 1W0WA 2XRAL 4KQ3L 4HKBB 4PJ5A 5GJSL 4Z6AT 2AJVH 4RAUA 1WK0A 2FH6A 1UT9A 2R8SL 1YEIH 1DBML 1FZKB 2GJ6D 2F74A 3F8UB 5DRXA 1C08B 3S5LG 5IBLD 2X9XA 5CHNA 3L1OL 1AD9B 4X98A 2R0LH 1EO7A 3T3MF 3OX8A 4KK8C 4U6YA 3ROOB 4Q58C 3BP7B 3OHXA 5F7FA 1VFMA 4MDIB 4PJHA 1MI5E 1AO7E 5FYJE 2DKUA 4G43A 1CFTA 4GW5A 4JPIA 4QOKA 2VWEE 5DUMH 5KSUB 3PV6B 5IR1A 1FRGL 4OD1H 3BIKB 5C9JB 4ZTPH 3BXNA 5D5MB 5K9QG 5KAQG 1HHHA 4PGEA 2CIIA 3QI9D 4L3EA 4PJCB 1I9EA 5ITBH 4K2UL 5IEHB 4PS4H 2BY2A 3H7BA 4E0RA 1D6VH 3TPUB 1MWAL 2G75A 1T89A 5EUKA 4L8DB 2LU7A 4OQTL 2UYLB 5JPNB 3K74B 5AUMB 3CVIH 3T0EB 2NY3C 5DD6A 2CPCA 3EO9L 3SKNA 4NC0B 1P53A 5I0ZA 4P49A 2YPLE 3MV01 4QT5A 1VFAB 5IQ9A 4KJYB 4U1GB 5C0ND 4YDKL 1HK6A 5TDPB 1DDHA 5B4MC 1SBSL 3VXQB 2G60H 2A1WH 2NY2B 1E4KA 3HPLA 1G9NC 4MD5A 1CL7H 1CFBA 4U1HA 3ZL4L 4JKPL 5HVHB 2RCSL 3DXAB 3H3PL 5DLMH 2OXGA 2XWBA 5F1IB 4A2MA 4XGZB 4FFVD 3KPRD 1UZ6E 4PJ8C 5LAXA 1MAMH 1CE6B 4X0KB 1IEHA 1KENH 3QIUC 3NIGF 4KQ4H 3U0PB 3S8WA 3AFLA 3L3HA 4KUZL 4DAGL 2O61B 5LQBL 2HVKB 3H9SD 2NTFB 4OFDA 3D0LA 5E8NA 5GRZA 3VFRB 5KVGL 5GSRA 2AQ2A 1JZ8A 5IP4A 1EPFA 4WFEE 2VXTL 5CILH 4PJGB 2W0PA 4FQ1H 1FJ1A 5A2KH 1PX4A 3MRKA 1AJ7L 4YEEA 1NBZB 1WFTA 5DT1H 2A77L 4MQ7B 1U8HB 2R1XA 1H8NA 4WUUA 3MOQA 5ACLA 3OXSB 1ZKAA 2OI9C 5IESH 4NQEE 5DQDL 2VJXA 2ZPKL 5HBBA 3QFJA 1P4IL 5D7LD 5HDOA 2J5LC 2V2WA 3X12A 3ARYA 3K4AA 3QO0B 1OCWL 3QUKA 3GJEB 2GCYB 4P9ML 3DV6B 4ODXA 1CXHA 5DQJA 4Z7WA 4HS8H 3ZT6A 1T4KA 4F7CB 5JXAL 1KJ2L 4B0MM 5I1AA 3X14A 1KFAH 1UENA 3X3GL 1RZKH 5JORB 3CFIC 4F7MB 4GUPA 3K8KA 4NFDA 1GVIA 3JWDH 1J8HE 3S6CA 4E5XB 4Q6IB 2DRUA 1UXWB 1MVUB 2H6PA 4Y7MA 3G6JB 5FK9A 4M5YL 3VFNB 1CD9B 2F8OA 1LO0H 4GMSH 5ID1A 1MJ7L 4CBPA 4L4JA 3C60C 4Q2ZB 5ICZB 2Y06L 4NT6B 1T83A 3PHSA 3PJSA 1UG9A 1ZK9A 5D6CA 4WW1A 2EZ0C 2OR7A 2V7NB 4OM0L 3FQRB 1P7QB 4RIRB 4RSVA 1JN6A 3GSWA 2BSSB 2PXYD 2VLJB 1EVTC 1OAUH 3BT2L 3QSKB 2UWEF 4QHUA 3OAZH 3N9GH 4H5SA 5FOBB 1A6TB 5HHOA 4YHYC 2PYEE 4JAMA 5TDNA 1G6RH 2VXSH 2Y25A 5IQ7L 1QFWH 4BFEA 2AJXH 4NQSA 3O6LH 4IRSD 4UZGA 3GKZA 4X6CF 3UBXA 3RX7A 4C4KT 5JHLH 1IAIM 1QA9A 3HE6A 1QHPA 3FTGA 4S1RH 5FYJU 5TGBB 5C0EA 1OP9A 5DUBA 3VA2C 4JREC 3B5HA 3G5XB 2VAAA 4J3VA 4K3EL 2Z31C 3WFBL 4ZFOA 5I0DA 5JUEL 1DBAH 2A6JB 1NLDL 4DVRH 3NVQA 1AKJD 1MOEA 1NC4A 2OZ4H 1UACL 4XVUC 4X4YB 5E4EC 5A2LH 4XNYH 2CK0H 4BKLA 5DS8A 3FQNB 5B8CA 5DO2C 1LK2A 5I8CB 4I0PC 1BFSA 4KTEH 3W0WA 3KPLA 1QBBA 3SN6N 4JY6A 5ESQA 1FN4B 2GK0B 2HTLD 4QWWD 4R4ND 1Z5LB 3V79C 3CFJB 2IWGA 4Z7QE 2W65A 2VLME 2QLVB 3K2UH 4HS6A 2O26U 3ZT5A 3MJ9L 4LSDA 5F3HB 1MREL 4FG6D 1ZHNA 1MVFA 5T3ZE 4Q9QL 5CFHA 5GHWH 3MFGB 3TO4A 1PG7X 4JANA 4OAWB 5ANMA 1VHPA 1CE1H 4QNPF 3CSPA 4Y19A 1T1WB 4N8VA 3HC3H 3V6BR 2VDLL 3L3GB 1IKNA 1TJHL 5K9JH 1NCBL 1MH5B 4ONGH 4ZD3L 4OZIE 3IU3B 5DJDA 3ROLB 1HXYB 1N8ZB 2E7BA 3CPLA 3U7WL 4GAJH 2A9ML 3MBEC 4XC3H 4ENEC 5EUOB 1UEYA 5ICXA 5IWLC 1HIML 4QXUH 3RA7H 3A6BL 3D0VB 1F4XL 3I2CH 4NM8L 3VDBA 5GPRA 5SV3A 1RZ8B 5IKCA 3GSXB 2ZCKL 1KLGB 1Z3GL 25C8L 5DMGD 4U3CA 5GS2D 4DZBA 2C7UA 2DL2A 5T3ZH 3AM8A 4PV9A 4LGSB 1QSEB 4RBPK 1MCEA 4OZHF 3V7MA 2NYYC 4D8PA 1N2RA 3LEXB 4FXKB 1NEZB 4JDTL 4FXGB 1Z9SA 5GRJL 3ARDB 4K07A 5FKPB 2W0LA 3QJHB 2W59A 3G5VB 4TTGA 4PJBB 1IARB 1AGDA 3F7RA 4PGBA 3GSNB 3GKWH 3ULUC 4JFEE 4LPYA 5C08D 5DRZB 2DBLL 3MLXL 1KTRL 5D1QB 4F33B 1J0JA 4IRZH 2XQYG 5KSVA 1LDSA 3IDNA 1B4RA 2ZCLH 2NW2A 3ULVC 4QTIH 1I3GL 1HNFA 4F9LA 5I1LB 4CJ0A 1S9VB 3WS3B 5C0FB 1A9BB 3EOBA 5C0CD 2NTSP 2EDHA 4LVNC 1CFVL 2FJFA 2MCG1 4F37F 4NO0D 5ETUA 4FFZL 1P9MC 1I8IA 4JO1H 1S8DB 3DIFB 3RNKA 4YHLH 2HJLA 1QPPA 3GO1L 3Q3GA 1KG0A 2HG5B 3C6LB 4UV4H 4DCQA 4PJDF 3HZKA 4YIQA 1BBJA 4ZAKA 2EIZA 2FNBA 3SCMB 1T22A 4GQ9L 1TZGL 4X6CA 1HKLL 1NL0L 3BPNB 5GGSA 3S35X 5FB8B 4CUCA 1BWMA 3W39A 4QTHB 3D9AH 4M7LT 3QEHA 3QIWD 3A6CH 2P5EA 4HSQA 3C09C 5GGSY 2E6PA 3WIIH 4WFHD 1EZVX 3ALXA 4HJGA 2FHBA 4LHUA 3CZFB 5GISL 3U4AA 3T0AA 3FQWB 3TBWB 3BE1L 4JRYA 3DVIA 5J57B 1IC4L 1VB9A 3QCTL 1MCOH 5HI3D 3IXTB 1T3FB 4L8SC 4N0YH 4HIHA 5BZDA 5FDYA 1HNGA 5AD0B 4G8GB 1XIWD 3FRUA 3D2UD 4AIXA 3AS1A 2P8LB 2Q76A 4X6FA 1JK8A 1M71A 2YHGA 4KMLB 4XNQA 5KSBB 1CTOA 2ZJSH 3QRGH 5EOQH 1ZLSH 4KROC 3S36H 4HZLB 2XG5A 4YQXH 4XP4H 1ACYH 4JFZH 4N68A 5HGHA 4PREB 4RAVB 3HPJB 2AKRB 1X5LA 4NN5B 3RVWD 1FNLA 1I8MA 5CGMA 5HHNA 1W72H 5HI5D 3QG7L 1HINH 4Q6YA 3ZE0E 5B22A 1I8KB 1FE8H 3WFHB 5GS0D 2DQCL 5CJXA 1FFPB 4JPWH 2Z8SA 1PKQB 2Q8BL 1I1FA 1KEMH 5C8JB 3WLWC 3MA7A 1G7IB 4UBDD 5HGBB 4PRBB 4KJPC 1L6ZA 2X4PA 4M1DH 5HDLA 3AXLB 4X7CC 3EFDH 4QHLB 4XCNA 3QI9B 1KBGH 2BNQE 3F7VA 1J18A 3KYNA 3ZDYE 2VDKH 2X89A 1KB9J 4TOYL 3EW3B 1NGPL 4LAJH 2ADGA 1DVFC 1JPTL 2DLIA 3WXWH 4K9EL 5DSCB 1I9JL 2AP2A 3MRCA 4EDXA 2ATKA 4YFDB 1LP9B 5HYQB 2DF3A 2PW1B 2GJ6A 2XA8L 4LSSL 4HW6A 5HDQL 4FQIH 4IRJC 4KK6C 4CDHA 3VFSB 4P4RB 1HHKA 5KVFH 4NUJA 1RIUL 3QQ4B 4M00A 1Q9OA 2NX5E 3KPNA 4QY8B 3D48R 3HC0B 2G9HA 4NUGH 1FO0B 4NM4H 3FFDB 5E6ZA 5D7IA 1KNOA 2OJEB 5D7JA 2IFFL 1ZT1B 3MMEA 4HHAA 1YY9C 4H25A 1T1XB 2X1PA 1WZKA 2X4TA 3UJJL 3HZVA 5CGYC 3FO2B 2E6JA 4YFLI 1FFNB 2HA1A 2Y36L 2CLZA 4XWOD 2XY1A 2YBRA 3TFKC 4WFGD 2VLRE 1BZ7A 5F96H 3V52H 5HPOA 1YZZA 2RGSA 1B3JA 3HUJE 4JJ5B 5F70A 5F7EL 3FB8A 5BS0A 3LMJH 3KPRB 2B1AH 3REWB 3VXRA 2W9LA 1MPAH 5IROC 1P5UA 3L5IA 4OCWH 4ZUSA 5KBNC 3KYKL 3P0VH 5C0JA 3H9SB 4G6AD 3CIQA 1LO4L 2AI0H 4P2QE 4P2OC 4J6RL 2RR3A 1UYWH 5BCAA 4FZ8H 5F6IC 1LMKA 3CMOL 1T04B 2NY7L 3QEQD 1L7TL 3B5GA 3D3VD 3UTPE 4OF7A 2BVPB 4IM8A 2YA0A 2B0SL 1OGAD 4M6OL 4NNXB 4PJDA 4ZFFA 4P9HL 4JG1H 5CINH 2C3VB 3M07A 2WUBL 5TPWL 1BVLB 1LHZA 3CX2A 4ERSH 3CVHL 3MV8A 4LRNH 4WCYH 3KNBA 3ZMRA 2NQCA 2FATL 3HNSL 2HN7A 3X11B 3MODL 1V7MH 1NCTA 5T1DH 4FHBD 5D2NE 4KK8D 2Q3AA 4JFFB 3LRSB 4M7KH 1ZT7B 2DQUL 3CFBA 3CCHA 4YXKL 5KANG 4LNRB 3IDMA 1JYVA 3K8MA 3IDXH 3I9GH 2F58L 3CSYB 2Q7YB 4Y5XC 2DB8A 4JFYA 2MQ0A 1UA6L 4MJ6A 1Q9LB 2GFBA 3FHQA 1Q1JL 1S9XA 5AYUL 5ENWA 3ZE2E 1JNLL 1KPVB 4CJ1A 3NCYS 5F1OB 43CAB 5FCUL 1NBQA 1K5NB 1QSFA 3DECA 4FQHB 4WDIA 4LDLB 2HKHH 3MRQB 3VW3H 2IPUG 3DUSA 1X5HA 2VH5H 4XAWH 3HI1A 4GS7C 4KTYA 2PXYB 1HHGB 1I85A 1U3ZA 1CWVA 3QHFL 4NO3A 1WZMA 1MCKA 1F3JA 1XGQB 4HUVA 3B2UC 4ZQKA 4U7MA 4IRSB 2VDOH 5IMKA 3O3UN 1CICA 4XNXH 3E0GA 1OT1A 1B6UA 4WEMB 2XZZA 4U6HB 3IETB 4PB0L 5CP3A 4FZEL 1QP1A 5FUZH 4U0RC 1MFCL 5J1TC 4K23H 3SGJA 5B4MD 4P0DA 5BV7B 1HHJA 1AKJB 1TTFA 1AR1C 1X4XA 1OGTA 2MKWA 1TQCB 4WIQA 4LVHB 4X6BB 5I8OL 4IS6A 4CVUA 1HKFA 4JHAL 1J7VR 4R4FH 4GRLC 3OKEA 1KIRB 3NIDF 4PYHA 1RZJL 4KWUA 4D0BB 5HYJE 4JEGB 4PJ8D 5FEBA 2PN5A 2FX8L 1QO3B 4LARH 2ZOLB 3QIUD 1KCVH 4OIIL 5D93C 3MLVH 3IKKA 2B20A 2L4OA 2Y1VA 2IG2L 4NKIH 3QG6B 3M8OH 4EBQH 4M61B 4G7VH 3TBVB 4I3SL 1A1MA 5JNYA 2VTFA 2J4WH 5DQ9B 3WUZA 4JR9H 2YPKB 4QRSA 1QLFA 4WGWB 5MEQB 4HWUA 4TULH 5FGRA 4X7EC 1T6VN 4XVJH 2XICA 4I0KA 4OZ4A 3SKOB 3W81A 5DR5H 5EOCJ 2WP3T 4LMQI 4R26L 4CN4A 5HHQB 3RWGB 2BP3A 1HH9A 2YD9A 1OP5K 3IFPB 1TETH 2XKNB 4G6JL 2PTVA 2IAMD 1KLFA 3BYTA 3AS0A 3OKNA 4HBCH 4WEUD 1MCIA 3NIFF 1YNTB 1GAFH 2FYYA 3BGFC 3SKMA 5EORL 1XGYH 3IJYA 1TQBC 3SDYL 3UEZA 1NGZB 3MJ8B 2CLRA 2ICWI 5C1MB 5F8QC 5TQ0L 3FT4A 5D70H 4ONHB 4MWFA 5TE7L 4N8CL 3WFDH 5DEFB 3WN5C 4HXBL 4G9FA 3C60D 1F02I 1WZ1L 4X8JB 1XR8A 1AIFA 3TBSB 2EIEA 1JHKL 3VXUD 4HXAH 5JO5A 4ZXBC 5C09A 3D5OF 3MLZH 2BSRA 2EZ0D 3BKJH 3DTXA 1BEYH 4MQTB 1FNFA 2IADA 3EYUL 2BNRE 3GRWH 1JPFA 3FFCD 5F7KC 4J3XA 1ZLVH 5J12B 4LSQH 2X4OA 1MJ8H 1MQKH 3UPAA 4XP6H 3MOBL 2QR0A 4YR6A 2AK4B 4LCUB 4C83B 3N85H 4OLVL 3QQ9C 2IQAA 1E0OB 1ED3A 3U9PH 1DN0B 4PGCA 2YA1A 4LU5L 4CU7A 1GZPB 5C08B 2JB6B 4XMLL 5I8EB 3LV3A 2V2XB 3V6OE 5EB9A 1VERA 2EE6A 4HPOH 3V5DB 3VRJB 4AZ8A 4MB4A 2H9GA 5BO1L 2FH8A 3PWPA 2Z31D 1J9CT 3DUUB 4ALAH 1K6QH 4QRQB 5C0CB 4NO0B 1MRCH 4XVUD 1I1AA 5E8DH 3RL2A 3MJ6A 3NABH 1A7OH 1U8MA 3VXNB 5DO2D 4I0PD 5H2BB 4YDJB 1DZBA 1NLBL 4JZJA 2WBJC 3DUHA 5IK3B 1ZVHA 3VFWB 1CBVH 3UC0H 4MHHG 4X6DF 1UVQB 2CIKB 1FVCB 1FL6A 2R1WA 3OKOA 3GMMB 3F7PC 4OGAC 1YPZB 3MNWB 2COQA 4K8RH 4YK4C 4AMKL 3UYRH 2ZSWA 4R8WH 3VFOA 4WHTA 2NNAB 1YEIL 1P4LB 3MV7E 3QIWB 3EGSB 4IMLB 3U9UA 3MC0A 4DGYH 5JLZB 3KLSA 2OS7A 3TT3H 4OD3L 1JNNH 1V8HA 2Z8RA 3S37H 1CT8B 4PFEA 3RPIA 5FUCC 2YK1H 4FN0A 1A6WL 3GMLB 5K9KB 3STLA 4MAYA 3I6KA 3MRIB 4FP8H 4KDTA 2IANE 4RRPA 5DUML 1NFDB 4PRAA 5EIIB 2AJZA 4OD1L 4LL9A 1N64L 1GGBH 4ZTPL 3DVGB 1M6OB 2F5AL 2X44D 2W60A 3FO1B 4NHUA 3D2UB 2Z93B 4KK9D 4G9DB 4ENED 3MBED 5ITBL 3QXDB 5I9QC 4PS4L 3ZKXC 2H26A 1KIQA 5FV1L 5ACZB 3NN8A 4LP5A 5C6PB 1D6VL 3C8KB 1T5WB 3L3IB 3O4OB 3OB0H 2NXYB 2OP4H 1FLTX 1MJJB 4F3FA 1QFPA 5JDSA 1TMCB 3CVIL 4PJ9C 2DTMH 4OGZA 4IJ3C 3KPOB 3OL2A 3BUYB 3P11H 1EO8H 4R6UA 2GSGB 2JK5B 1JGUH 2DM7A 2ZUYA 1MSPA 4XH2A 1Q94B 4K7FB 2WWMC 2NYYD 4M8QB 1HYRC 5I1DA 2GAZB 1KTLA 5IB5A 3TNMA 1RUQL 4GXVH 3NA9H 3ORJA 3CFDA 2BY1A 2G60L 3V0VB 5BOZG 3NPSC 4MXVF 3UTTE 3DBXA 1CL7L 4UTBH 5I1HH 1JV5A 5L0QB 3IDJB 1XIWA 3NGBB 5HHMD 1AD0A 3ULUD 3VD7A 1RUKH 1CGSL 3HNTH 4GRWF 1QTYT 5DJZB 1MAML 5F7DA 3PE9A 3FOMB 1KENL 3GI9H 3ULVD 1WCQA 3L5JA 4KQ4L 2EDBA 3WIHH 4N0FA 4ZSOB 1P7KB 3WDIA 4P5TA 3LSOA 5D96C 3T04D 3ZHKA 1DEEB 1EFXD 5JOEA 4TVPD 1Q0YH 5I6XB 5LBSH 5F8RC 1QFUH 3OXRA 2I5YH 4FQ1L 5DTFB 4WO4B 3VGFA 2Y7QB 4PRHE 5D2NC 5DT1L 4NNPH 1RZGB 1TNNA 3N1PC 4F7TB 3QHZH 4Y5VA 2DD8H 5FECB 1ZSDB 4NO5A 3MGOA 2V7HA 5FYJD 3EJJX 1D3CA 2Z9TA 4UQ3B 5CJBA 5CBEA 5IJKA 3SDCC 4HMCA 3TESA 2HLAB 5TDOA 5MEOA 1BD2E 3QUYA 2CUIA 3EO1A 4M43H 5IB2B 3PABB 4NQCE 3GGWA 3PHOA 4G7YH 4HS8L 1LE9A 1A1OB 1NSNH 2HRLA 4JRWA 3D25A 5C3TA 2A74A 3C5SB 1QFWI 5L2KE 1TZIB 5EO9A 4MQSB 1EXUB 4WNQB 1KFAL 2R4SH 3JV6B 1A6PA 2EDQA 1RZKL 1IM9B 1A0QH 1IAKA 3NFPA 1MF2L 2ORBH 2MCPH 4ZFZB 3JWDL 3ZE1E 3FAWA 4UNUA 4M6AA 2Q6WB 2ICCA 3QEQB 3X3FH 1LO0L 3D3VB 2Y5EA 1HILB 4N0RA 3TM6A 1A7QH 5C0AA 1OGAB 4JHWH 4I5BA 4X6DA 3SDDA 2ICWJ 3U2SB 3Q6GL 4YBQC 3HA0A 1D5MA 2XTJE 1BQLH 4LEOA 2IMNA 1OAUL 4ZODA 1YMMA 3FN9A 5MENA 4KROD 4MJ2A 4PTUB 1UH3A 4ELKA 3N9GL 4GAFB 4K9EC 2YRPA 2VXSL 2PR4H 1QFWL 1RFDH 3IVKA 1O7SA 3O6LL 1GGTA 4S10A 4NN7C 4LBEA 3FT3A 1KN2L 2BHYA 1UKTA 4G43B 1CFTB 4X4ZA 4OF3A 1JZ5A 5IR1B 2VZ3A 4LQ1A 3L7EA 3OR7B 3WLWD 3KPSE 4FQCH 1DBAL 4KJPD 4DVRL 3BGMB 3GDBA 1LILA 4AEHH 5CAYB 2EDOA 2OZ4L 4DN3H 1BLNB 4P23C 1P2CB 3MUGB 3DURA 5IFJB 5AWNH 3TA3C 2YD1A 2DIBA 2CK0L 3X17A 2DIAA 1DBBL 4GRMA 2KPNA 1CFNA 1DQLL 4KTEL 3FKUS 2E7HA 2HVJB 1DVFD 1MCWM 4ODWB 2VE6A 3NCYP 5I66B 4RWHA 4NQED 2NY3B 5E6IC 1CD1B 4ODUA 5EBWA 1HDMA 4IRJD 4KK6D 3K2UL 3GHBH 5BMFH 5IQ9B 4OFYA 3MYJB 4PB9H 1KB5B 1WWBX 2XZCL 1BBDH 3BD3A 3PQYA 3U6RA 2ZG1A 4YXLL 3KPPB 3QXUA 1KF9B 5GHWL 3O2DH 3UTOA 4YGVA 3BKML 4OZGB 5C0RH 2FRGP 1CE1L 1YY9D 3MROB 1N6QH 3AREC 1K3IA 4U1HB 5E9DD 3SE4C 4GG6E 1A8JH 3SE3A 2EXYC 4PG9A 2BY3A 3I02B 3QNYB 4HPYH 3TFKD 2GTWB 4N5UA 5C6WH 5K9JL 1JJUA 2MFNA 4YDVA 1R5WA 4LSPH 3UTSA 4PJ8B 2HJFA 1WFUA 4R4BA 1I7TA 4JN1H 3QIUB 3QISA 1JHLL 2AK1H 2QJDA 5DRWA 4GAJL 3CVHA 4HAFA 3R8BB 2G2RB 5LCVH 4YO0A 4PRIA 4P2OD 4N1EA 3RA7L 1I1RA 2BNUB 3DGGB 3PUCA 4TSCH 2D0HA 3I2CL 1QHOA 2ZOKA 5FDWA 1OARH 4RDQF 4HKJB 3QDJD 4GBXC 4YPJA 2EYSA 1CYGA 4Q0XH 2OI9B 4N9GA 5GGVH 5T3ZL 5D9SA 4UNTA 4D0CA 2J5LB 4Y4FC 3GI8H 1E27B 1ONQA 5IFAL 1S7XA 1M7XA 2E9WA 3P4MB 4JCLA 4MNGA 3GKWL 2JCCE 3S35L 5F1SA 1HE7A 2W9EH 3WL9B 5FK9B 1BHGA 1F58L 4IRZL 3OKKB 2B5IC 3RZCB 4YBLC 2ZCLL 3AROA 4KY1H 4QTIL 3E6HB 3C60B 5C2UB 1ZE3C 1I1YB 1OWWA 4XB8A 4WW1B 4EZMA 3VXUB 3V5KB 3WNLA 4XXCC 3U30C 3QDGD 3I3BA 1WIPA 3LQZA 1S3KL 1F11B 2YN5A 5IUSA 4MJ5A 3I6GA 1TFHA 1MCWW 2IH1B 4JO1L 4PJAE 3FFCB 1OT2A 4YHLL 2WMPA 3C6SB 4P2RD 5MEPB 4UV4L 2FGWH 2DLEA 3K4ZA 4LEXH 1NCCH 5C2BH 3GM0A 4YHYB 2IAMA 3H3KA 2FO1A 5KAQF 1CFQA 1TTUA 3B2UD 1BX2A 3PV7A 5GS1A 4ORGB 3BN9D 4LSTL 1XF2B 5DUBB 3D9AL 2HT3C 1R24A 2VAAB 5GGRA 3A6CL 4JREB 4NQVB 4HIEB 1NDMA 1QPXA 3SJVD 4FMKA 3UX9B 4XPBL 3KLDA 4MA7L 2Z31B 1OTSD 5I74C 4QHNB 5GGRY 1UXSB 5DK0A 5JIKA 1RUPL 4PD4K 1AR1D 1IEBB 4BKLB 2NY0C 4UIMB 3QEUB 3RRQA 4CU8A 3AC0A 1JPGA 5J13B 5E4EB 1RAMA 3H0TA 1MCOL 4PJIB 1IGMH 4U1LB 4I0PB 3DMMA 4N0YL 4GRLD 3GK8H 5FA3B 3RY6C 4UT9L 5D8JH 5J3HC 2HFFB 1QR1B 4HWZB 1ORQA 5ALCH 3EKCA 1QNZH 2DQDH 4Y4HA 1EHLH 3IFOB 4FFYH 1F97A 3QRGL 1ZLSL 3S36L 4YQXL 4WI8A 1ACYL 3O6FA 1OL0A 2I07A 2XOTA 3PL6A 3MACH 4JANB 4YHIB 1Q9WB 3VXSD 3FQUA 1W72L 3WJLC 1T7WA 2ARJQ 4BZYA 1ADQH 1HINL 2ADIA 2W38A 4UILH 4UDUA 1NCAL 4DTGH 5IFHL 4EKXA 4XWGH 1FE8L 4HUMB 4ODSH 4JPWL 3IF1B 4JVUA 1NC2D 2O93L 2XQBH 3TNNA 4NQDE 1KEML 2MKLC 1T0MA 4ZDHB 1AI1H 4Y5YB 4IHOA 4KTDL 3P30L 4HKXA 5KTEH 3V4PH 4KJQC 1RJZB 1OSPH 5ISZD 1XR9A 3MBEB 1KBGL 4QRTB 1DL7L 4DKAA 1R0AH 3MZTA 5A3IC 2P49B 3BWAB 5KG9B 3VJ6A 3WXWL 2PO6C 3ZT7A 2AJSH 1BJ1J 1S7SA 1OF2B 5JQHC 1CTNA 5DJ0A 3S97C 1U8PA 4EUPA 4JFHE 4FQIL 1BJ1H 2IALA 3ARBA 4ZXBD 5E2TH 4JO3H 1BFVH 5KVFL 4EN3C 1IM3B 4X99B 3FQTB 4QCIB 3M45A 3BX7C 3OWEA 4LFHD 4MX7B 1YA5A 4RGMC 3PGFL 5IB3A 4NUGL 3BRDA 1U8IA 4L3AA 4NM4L 2CR3A 4OI9A 3BQUA 3MLPA 1AC6A 4P4KA 3QQ9D 3BISA 4PGBB 4BQ9A 3O3EA 2AXJA 4ZPTB 5IW3A 1CDJA 3MRPA 4NP4H 3G5YA 2IBZX 1BREA 2YUZA 3PP4H 5F96L 3V52L 5HHMB 4C56B 3QA3A 3MLWH 2OR8A 5A2FA 4Q7DA 3V5HA 4GFTB 4FNLL 3LMJL 1T6WA 5BXFA 5D5ME 1MPAL 2P8MB 4L3CB 1S7WB 3S5LA 4RFEA 2XTJC 4OCWL 4PJCE 2ARJB 5IVXB 4M7ZC 1ZA3B 2H32H 3RGVC 1RIHH 1U9KA 3K46A 4N5EC 2AI0L 3QUZC 5DJ2B 4LVNB 3JWOH 4M5ZH 2VQ1B 4FZ8L 3DRQB 1EFXB 3MQIA 2Q20A 1FAKT 4ZUWA 2JJSC 4YE4H 3O11A 3T0EE 4EI6B 3UTZA 3O4LA 2UWEB 4DCQB 2WBJD 4ZYKA 4QRPA 1P1ZB 2EIZB 4JZOB 4LCCC 3L3OA 1JGLL 4V2BA 1C7TA 2W0KA 3O9WD 4HIJB 4JG1L 2RIKA 4F58H 4NPYB 2BXZA 3DSFL 4OGAD 5GGSB 4URTB 1HYSC 1G7MA 3AGVA 5BRZD 2D31A 5ABDE 3MV9D 1A2YA 3G08A 4ERSL 2F8VA 3QULB 1U95A 1SVZA 4LRNL 3MCLH 3VXPA 1J1OH 3C09B 2BNQD 4FOMA 3RWEA 5T1DL 1Q38A 5JHDD 2DWEB 3LCYA 3DXAE 5HVWA 5DJXB 3IDXL 3I9GL 2A38A 3BFOA 1B6DA 5IBUB 3IJHA 4ZUVB 2E27L 4R0LA 4L8SB 3RWJA 2BC4B 1AQDA 2LVEA 1I7RB 5DJYB 1MIEH 4NZTH 3BVNB 4PLNC 2HKHL 2R2CA 4X6FB 5FYLE 3VW3L 2I26N 3OPZL 3VFPA 5IM7A 2XFXA 1FCCA 1UJ3C 2VH5L 4XAWL 3TN0C 3FB6A 2M8XA 3FOLA 5E8EA 4PJGE 1MI5A 1AO7A 3MR9B 3B9AA 4KROB 2BVQB 3O3AB 5HHNB 2BJMH 1Z0NA 1YY8B 4JPKH 4PJ9D 2X42A 2VDOL 5IB4B 3O8XC 1EJOH 1A7PL 1NANI 5DXWA 3U46A 3VFVB 4WUKL 1HHIA 2XWTA 3M1BB 1T0NB 1G7HB 3CFEB 3CH8A 5ELIA 2WWMD 1YNKH 4OUOA 3Q1SH 4DW2H 3VDAA 4OLZH 3H9ZA 2H3NA 4K23L 4K3GA 2DM2A 4NWTH 1TXKA 4Z7QF 1MFAH 4ISVA 2GW5A 3OKMB 4KVNH 2DQHL 3G6JE 5DZOA 3SO3C 12E8H 2ADGB 3CU7A 1L0XA 4BFBD 1P6FA 4Q9BA 3ZO0A 4XXDB 4DGVL 2YPLA 5HHXL 2JKXA 1U3HC 1DVFB 4FQXB 4NWUH 1VKXA 3MRHA 1JGEA 4MMXC 3OZ9H 4LARL 5MHSE 1ETZB 1C5CL 4HDIA 3ARUA 2VDRL 1UB5A 1EAPA 4D3CL 3MLVL 3GSOB 2VLJE 3GIVA 4IRJB 3L6FA 3RWDB 1IGFH 4NKIL 1V7NH 1RZKC 5E1AA 1CFSA 3M8OL 3KPNB 2EYRA 1B0GA 4EBQL 4G7VL 1DUYB 4OZHB 1H8SA 2RFXA 4OZIF 3S4SA 3ZYOA 4HHAB 1OWRM 5B21A 4JR9L 4CNIB 3HZVB 3HRPA 3M17B 1DANU 4Z5RB 3VWJB 4TULL 3TCLB 3BAEH 4XVJL 4UT7H 4X9FA 4HWEH 1U6AL 5E9DB 5L8KB 5KVEH 1OAXH 4AEFA 3SDXF 2OSLA 2Z35A 2UY6A 5KN5B 1YJDH 1ERNA 2F15A 1TETL 3V6ZA 1FP5A 3SDCD 3HE7D 5DMYA 2XN9D 1XF4A 1L9NA 2QKIA 4I9WD 4KXZI 2R2BA 4HBCL 2AV1B 3W9DA 1GAFL 3QDME 4LLVB 1XGYL 1CVRA 5EZJA 5M94B 1RJLA 1G6RA 5D70L 5CEYA 3T8XA 4CMHC 2R0ZH 3OV6A 1RU9L 2YD7A 4RFNB 3IFNH 1EHAA 4NRXA 4QXTA 5D7SH 5FGSA 1H5BA 4JG0H 1BJMA 4Z0XB 3WFDL 2BVOB 3MNVA 3QDJB 5HHVL 1ZLUK 5L2JA 5EO1A 1MCPH 2E7LA 3MLZL 3BKJL 4YBQD 1T66D 1DBKH 1IQDA 4P3CL 4AENB 2EH8H 1J8HA 3GRWL 4OJFL 4XI5C 3RIFF 3H9HA 4KRNA 2OZ4A 3GSVB 1I8LA 1T7VA 2DDQL 2HN7B 1OTTC 1MQKL 2B1HH 1YN7A 4YHOH 5DWUH 3N85L 1MWAB 2CRYA 3FQXA 2EDDA 4WU5A 1S7UB 4PUBH 4ONFL 1U0QA 1YEEH 2W0FA 1BGXH 3U9PL 1D9KC 4NKQB 3LPWA 2ZZUT 5ESAA 2VSCA 4O4YH 5T1MB 3REVB 4N8VG 1AR2A 2F19H 4HPOL 4NKDA 1NGWB 2GFBB 1AE6H 3O3BA 3R4DA 3ZKMC 4P2OA 4ZOCA 5FUOH 2VZTA 3VI4F 5HGAB 3QRFM 5EUOE 3MTRA 4R7DA 2PYEA 2NW3B 3MRMB 4ALAL 4OCXH 2DJSA 3MBXL 3QDGB 4P23D 3TA3D 5E8DL 3QO1B 4GS7B 3QNZA 2VDNH 4NO3B 3K4DA 1CXLA 4P2RB 5CJQH 2HAZA 5CZKA 4C57C 5C07D 1JRHH 1UC6A 2X1WL 3H3BC 1ORSB 4LP4A 1QSEE 3GMRB 1JWMA 1P84J 4KK5C 4K8RL 4JFPA 1QVOB 4M4RA 4R8WL 1KC5H 3CUPB 1UKSA 3GB7A 4OV5B 1IFHL 4L8BA 4FRWA 4Z7OE 3SJVB 3ELAT 4PJBE 1DBJH 4BA8A 4JM4H 1YECH 4U0RB 2NCMA 4ZNCD 1JNNL 3S37L 1N0XH 4PBXA 2EDJA 2P5WD 3B9KC 4ESKA 3ARED 4P5MB 4WTXA 5MI0C 1OTUC 4DUWA 5E4IA 2EXYD 2HRPH 3L5WA 1KJMB 3SGKC 1KACB 3CXHJ 1KJVA 2VAJA 4Z77B 4FP8L 3ZHLA 3MJ7B 3OJVC 3W2DH 4MDJB 3PGCA 3SGEH 4GRLB 4PV8A 3MREB 5JW4R 1JNHA 2DTSA 5CLTA 3ZE0F 4ZPVB 3IDIA 4YNYA 2LE9A 2MSPA 3RDTC 4EVNB 4D0DB 1XF5B 3OGCA 1KJ2B 2YEZB 1OP5H 3O3DA 4FXLA 3OJ2C 3VXMB 1Z6JT 3KXFD 3LQAH 3EO0A 5SWZE 1J8KA 1A1MB 5IEKA 3W5MA 4B5EA 5I1IH 1I3RB 3WMSA 3RWIB 4NKOA 3LEVH 2OP4L 5EC2A 3VXSB 1OD7A 4OZIA 2FX7H 2DTML 4GBXD 2JIXA 3MRFA 5DI8A 1RJCA 2OL3B 1EO8L 4JO4H 4ZS6C 1JHTA 2CJUH 4NHCH 1JGUL 3EYOA 3GSNH 3NCBB 4Y4FD 5C0GA 3QQ3A 4XP5L 4PTTB 3L5HA 4YHMH 3ARGA 4DOHB 3ZKNC 4GXVL 5J0BA 3U7YL 5H94B 5ISZB 3BGFB 1HSBA 5F1NB 1MHCB 4UTBL 3UPRB 5I1HL 4LCWE 1JCKA 4O58H 1AGBA 2GQHA 3FN3A 2A73A 3DROA 3CMGA 4ZUTB 3HNTL 4XMKH 4G8GE 2HP4A 2Y5TB 5I2IA 1T5XB 4G9FB 2QHRH 1FGNH 2CDGA 3GSQA 3WN5B 3FCTB 1CGVA 4PLJC 1XF3B 3WIHL 1N59B 1F4WL 1UKQA 3DOSA 4IEFB 4U1GC 5DHVB 1Y0LA 5KSBE 1LD9A 1TENA 2A6KB 3HUJF 4JFEA 1Q0YL 2GY5A 1U91A 4RX4D 4DUXA 4JO2L 1QFUL 3TCXA 2FD6L 1PSKH 2I5YL 2VABB 4S1QL 5KSAC 5B38B 3NTCL 3OR6A 4RNRA 4R97B 3SGDI 1AXIB 1Q9KB 3MNZB 3T4AB 4L8CA 3QHZL 3Q6FA 2DD8L 4IIQC 1HCFX 3T4YB 1PKQE 4O02H 4BH8A 2X4QB 1WCBA 2HLFC 1T03H 5INCA 4GOSA 3P9WB 5DD5H 4KU1A 4Z7UF 1A4JA 2HT3D 4M43L 4M6MH 5B3JE 4LDEB 4G7YL 5JMRA 1NSNL 4F8TA 5HJ3A 4WI3A 2VO5A 5CD5C 1A6AA 1XCTB 1FORH 3KDMB 4NOBA 3TYGH 2ADFH 5FGBC 2WWKT 1OM3H 4UV7H 3RL2B 1SVCP 1MFDH 1W72A 2NY0D 4YHNA 5LXGH 1LP9E 4CMMB 2NY1C 4ZXBA 1F4HA 1HQ4B 3QUXC 2WBJB 2B4CH 1FL6B 4NRZA 1A7QL 4O00A 1F6AA 1JL8A 1XGRA 4JHWL 4ODTH 4XCEB 2G5RA 3VWKC 5D6DC 3QYCA 2VXQH 1BQLL 2DM4A 3WFCH 1YEFH 5BRZB 4YK4B 3MV9B 1UB6A 4F7PA 3U9UB 3ETBF 1ZA6B 1H3WM 1W8NA 4CVWA 1K2DA 3P0YH 3ZE2F 2VISB 4N0UB 5I1CH 2EH7H 3MLUH 2PR4L 1RFDL 1II4E 4NO2B 1OB1B 2BFVH 5JHDB 3RWCA 5DRNA 4PYGA 3JV4A 3KPRE 5AZ2L 4LF3B 3GMQA 2NZIA 2D2OA 4JGUA 1I7ZA 5CD3A 4KKBC 1C5BH 2HKFH 4RA0C 4ETQA 2YWYA 1L0QA 1DLFL 3H9SE 4CADA 3QIBA 2FR4A 4AEHL 5T5FL 4KJQD 4DN3L 5AWNL 1X5ZA 2H26B 1OW0C 3O9WA 1VFBB 4JM2F 5A3ID 4ZNEE 3ZKXB 5F7UA 2FZ3A 4UDTB 4PRHD 1KIPB 3GNMH 5F88A 1AGFA 2Y9RT 3GSUA 4J3UA 3B6SA 4Y16C 1IAIH 3V4UH 5IHZB 4IJ3B 5D7LE 1LO5B 5DVOA 4ELMF 3GHBL 4LCYA 5BMFL 1ZGLA 3OAZK 2BNQA 1WBYB 4XH2B 4PB9L 5E95B 4I48B 1M05A 4NQCD 5CZXC 4NZRH 1C12A 4M1CC 1CGYA 1F5WA 4RCAA 2KQMA 5IB5B 1KTLB 3O2DL 1M7IA 4MD0A 5F9JB 1RVFH 5C0RL 5FO9A 3QXWA 4JFFE 4UUJB 1MHHB 3NPSB 4BH7B 4U1NB 2BMKA 1AD0B 1DQQA 1O7VA 3NH7H 1KEGH 3TH2T 3TVMC 1WQVT 1ZANH 4TSBH 2YD4A 2X7LA 2NX5A 4LSPL 3UYOD 3WE6A 4R2GD 3IKCA 4JN1L 4HG4J 3U48A 2OBGA 2XTJD 1X3DA 3G5ZA 2AK1L 2QSVA 1RUAH 1A3RH 3RGVD 5LCVL 4GAYA 1BPVA 3QUZD 4Z95H 4PJ9A 2AJ3B 2VLRA 3WJJA 5KJRH 3HUJA 2E9BA 3FT2B 2AGJH 4BZ2H 2C1PA 3GSRA 5F72S 2MHAB 4X6EA 1S9WB 3E3QC 5FHAH 5ALBH 1CXEA 1IGCH 4WWKC 5E7FA 3MGOB 4WI9A 4Q0XL 5BJTB 5LVEA 4LLMB 5EU5A 3QH3B 1JNJA 2CUHA 4P2QA 1HYSD 3MLTB 4HV8A 4WI5A 3GMNA 1BM3H 1RK1A 4PJEF 3GI8L 2XN9B 5EBLB 5CJOH 1PY9A 5GGQH 5ICYA 3P9LA 4HGKC 2CXKA 4Y0GA 2N1KA 2ADJA 5GXBB 5I8KH 1I9IL 2I9TA 4DQOH 3X13A 1JF1B 1LE5A 2JJTA 1CLZH 3MOAL 4JB9H 3EDJA 2Z4QA 1MCJA 1XGTB 2WBWB 1YQVL 3BP5B 1JI2A 2YC1B 3THMH 4QRRD 1QD0A 2VB5A 1UCBH 3VFTA 1U8KA 3BP6A 3QZWG 7FABH 4HFWA 4IMKA 4F15C 4WHCA 5DJAB 3TN0D 3RIAF 3KAAA 3T65A 1ZVYA 1NGXB 4JQVA 4X5XA 4MS8C 2FGWL 5E0QA 2APXA 4PGDB 5C2BL 1AY1H 1RUML 4LEXL 3KJ4C 3HE7A 4XB7A 3SQBA 4PJXF 4G8FB 3IU4H 4LBEB 3FT3B 3CFCH 3R1GH 5EOTA 4BZ1H 2DAVA 3O8XD 3GHEH 1TVHB 5BV7H 2DWDB 1R3JA 2UVEA 3PWUA 3U4EA 3L7EB 4NCC2 1SY6L 2OYPA 5LGHL 3DX6A 4B7IA 4P2CG 2PNDA 1FSKC 2N56A 5DMKB 3H42H 5FF6B 4W6YB 4Y2DA 4P23B 5FO8A 3TA3B 4KVCH 3GEWB 4G5ZH 3B43A 3SPVA 3VI3E 4HS3A 4ACPA 5B3NA 2D4DA 1IGML 1QKZH 3SCMC 1NCWH 4NDMA 1U3HD 2HTKC 4RMSA 5AAWA 3BPNC 3RPKA 5C07B 2R4RH 4JQIL 4JGMA 5T1LA 2Y6SC 1HDMB 1LNUA 3RWHA 1AP2B 5E6IB 3GBML 1QNZL 4F2MA 1S5HB 3SBWC 1OAZH 3NACH 3BDYL 1EHLL 4FFYL 1FNSH 2WIIB 4P46A 3SDAA 4XNMA 1SQ2N 3U6RB 2AK4E 4YEFA 4AM0B 2WBKA 4YGVB 5DD0H 5CUSH 4IDLA 3MACL 2R69L 4L5FH 5HYJA 3G04B 4HX1B 1N3NA 1OAKL 3DVNB 4QYOA 3SE8H 1F45A 1ADQL 2FSEB 3RTQA 4Z7VB 1TJGH 4KRPC 1MNUH 4L4VA 4UILL 5C08E 2P5WB 4DTGL 1GHFH 4KH2A 3AREB 4XWGL 2C26A 3VXOA 3RUGB 5EULV 1DLHA 2AEWA 3NA4A 4QHMA 4YDVB 1KT2A 2XQBL 1NDGB 5IGXL 4GRWB 2DKSA 2VL5B 4KI5C 4PRNB 1AI1L 1RHHB 5C0CE 1MCRA 4YXHH 3MRRB 3GRWA 1QLRA 5KTEL 2ICEA 3MO1B 3V4PL 3KYOA 1OSPL 4B50A 3D69B 1R3KB 1U42A 3CFKA 1SEBB 1R0AL 4PY7B 1E4XI 3O6KH 3DNKA 5GS2H 3KXFB 3DI3B 4O51A 1FVEB 3C5ZC 5D1ZC 4XVTH 3MZGB 4EDWH 1YPZE 2EYSB 4GBXB 2EDNA 4NQXB 3ZHDA 3P4OA 4N9GB 2FJGA 2D7NA 2AQ1A 3DO7B 1DE4A 2AXHA 4JN2A 4U2YA 1SJEA 5E2TL 4S0TD 3EYVA 2FBJL 2X05A 3HC4H 1S7QA 4WFHE 2B2XH 4XI5D 3DX8A 4Y4FB 1V05A 4PJEA 5FYKU 3FB7B 4GSDH 1OTTD 3MCKA 1ZT4A 3MRDB 4PRDA 2GTZB 3QWQB 3O45A 2ZWLT 5JIPA 4NP4L 1D9KD 4K7PH 3TBTB 4NC1E 1NFDE 3GM8A 2VIRA 3MLWL 2ZSVA 1E4XL 4RQQB 5JQ6H 5E00B 2BNRA 4W68A 3C2SA 3R06A 4K8RC 1KTDB 2OTWA 3ULSB 2B5IB 3ZKMD 4YBLB 5FHBH 1HWGB 4KRLB 32C2A 1RIHL 1TCMA 1QRNB 4Q74A 5GSVA 3U30B 4U1JB 3UJIH 5F9OH 1JUFA 1KB9K 3HR5B 4LQFH 4G6FD 2VLLB 3V6OA 3DJ9A 4CVXB 4YE4L 1AXSA 5HGDA 3LN5B 2HT4C 4Z7NE 2F53B 1YN6A 2QTEA 1E6JL 2YWZA 4QF1B 4C54A 2ZG2A 1A4KA 4F58L 3LRGA 3JVGA 4QGTA 1QRKA 1NKRA 1WWAX 2GSIB 4PJFF 1OAYH 3F58H 1RJYA 5KZCB 3HZYB 2G5BA 1L9MA 3MCLL 2ZKHL 3P73B 1J1OL 5E8PB 3ES6A 3RZWA 2W1NA 4HKZB 3NCJH 1BIIB 4XCFH 4G80A 5I74B 3B9KD 3TYFB 2E5EA 4E41B 3T0BA 1BQHA 1OTUD 1R3LA 4H1LB 5FA4A 1EEQA 1HN1A 5J8OA 1NUDA 1B90A 3S3PA 3MV7A 1CG9B 4JQXA 4JFDD 1GYAA 3QNXA 4ZSOE 4XNZC 4NZTL 2H2SC 2FCBA 4KZEL 5HPMA 1YEGH 5F3BA 4K94L 3CH1B 3RDTD 5F6HJ 6CGTA 4NN6B 3OKLB 2VR5A 2VERN 2UV3A 4XHQA 2AV7A 1RPQA 4WV1A 5E8OA 2XNAB 1QLEL 2I07B 3GMOA 5B39B 3U0TB 3PHQA 5GS0H 4LLYB 2IANA 1WFOA 3DX7A 4UU9B 2BJML 1A9EA 2IGFH 4JPKL 1FV1A 2P42B 1CVSC 2BK8A 2IEPA 2AW2A 1EJOL 5EN2A 1LEKA 4ZS6D 4NQUA 3QR2A 1B4JH 5E99H 3WIHA 4K3JL 4L29A 2DN7A 4Y4KA 5HY9B 3VXTA 3TZVA 4NNYB 1OOAA 1YNKL 3Q1SL 4DW2L 3L3DB 1OP3K 2P48B 4OLZL 2D7MA 1R3HA 4LSVH 3V6FB 3ZKND 3BESR 3VRLE 1MFAL 1XR9B 3UBXI 3GMPA 3AB0C 2OMNA 1FNGB 3QEQE 12E8L 1RULH 3SOBH 3TIEA 1D6EA 3VJ6B 1FL5A 1EH9A 1SJVA 4BSWB 3D3VE 2PO6B 4APQB 4NWUL 3KPMA 2WIMA 2ICWB 3VGDA 3NAAH 1OGAE 3O6MH 4NKMA 5EO0B 2DQIH 2PCPB 4DN4H 1U8PB 4EIZC 4EUPB 3IXAA 5IG7B 5IMOB 4H26A 4PLJD 4V1DD 4GG6F 3ARBB 4HH9B 4HMEA 1IGFL 3UTTA 3MRLB 1ZS8B 4EN3B 4YZFF 1PAMA 5C0DA 1EV2E 1PGRB 1ZHBA 2ZUVA 4ZO8A 4LPUA 2XT1B 4OBRA 1JWSA 2CDEA 3PDGA 4RGMB 2VC2H 5DK2A 1OQXA 2LFGA 4Q9CA 5I17A 5BQ7A 3GJFB 5KSAD 1QFOA 1AHWC 3KJ6H 3ARFA 4JY5H 4UT7L 4C58B 4HWEL 2IPKA 4J4PC 3G5YB 5KVEL 4MCZB 1G1YA 3BKCH 4P5KB 1HWHB 1YJDL 2HLFD 4PG2A 1XCQB 1H3XA 4S2SA 1TJIH 4L4TB 1FVDB 3S5LB 2Q8AH 4Y2OA 3PWNB 4XCYA 5FYLD 2BVEA 3SY0A 4ZFOL 2GK2A 1LQSR 4LKXA 4PRHA 1NAMH 3V0WH 4P59H 5EU7C 5EZLB 5CD5D 4X5WB 4M7ZB 3RGVB 5DUPL 3QUZB 2Y07H 5EIVA 1N6VA 1GC1C 3PGDA 2DLHA 1MCBA 2R0ZL 3MFFA 3FAXA 3O11B 4AH2B 2NY1D 4GMTH 1BD2A 3CLFH 3QUXD 3IFNL 5IF0A 4MCYA 5D7SL 2NPLX 2OR9H 2NR6D 4XP1L 4I18C 4RMVA 5L2KA 4LCCB 3JTSB 3ISWA 1CIDA 3IGAA 1MCPL 3VWKD 1F3DJ 4WW2C 2JCCF 1YEDA 1KLUB 3NCMA 2EH8L 3KLAB 3WBDA 1FZOA 2FIKB 4OZGE 5JA9A 1F3DH 3MLSH 5JOFA 1G7LB 2B1HL 2VLKD 1FYTD 5CSZA 4YHOL 5DJCB 5IMMA 1PG7W 3KLHC 5DWUL 1FZMB 4LGRB 3FMGH 4LCIH 1PYWA 3LKPB 1BZQK 4FQPA 3WFEH 1YEEL 2AEPH 4R7NA 3KR3L 2DIJA 2CRIA 4O4YL 4EQ3A 4PJAF 4HEPG 4MA8L 2F19L 1OSZB 4ODBD 1AE6L 2AXGA 4KKBD 5E94A 5FUOL 1ACZA 1P7QD 1VGKA 5J6GA 1R3IH 3QEGL 4LPXA 4QRRB 3RNQA 2F54D 5JW4Q 2BSTB 4OCXL 1YEKH 2GUOB 3BDBA 3O2DA 5IOPA 3FOLB 1ES0A 5T5NF 4ZFGL 5ADOH 4F8QA 1UJ3B 3TN0B 3TJEH 5FAAA 4W4OC 3RVVC 1LEGB 4MNHA 5C6TH 3QJFA 2LAGB 4JFXB 2DI9A 4X7TA 4LLQB 4F9PA 5GRXG 1EEUA 1JRHL 1KB5H 4JFOB 3MUY1 4Y16D 3CGTA 3KPSA 4ZTOH 1EFQA 2FL5B 4TNVK 2SEBB 4OZFB 4RMTA 1ZLVK 1IL1B 3O8XB 2X4RB 3U46B 1A47A 3V95A 3V4VL 4YPGA 1KC5L 4HCRH 3MRGB 3P40A 3WDHA 3HN3A 3KWWB 4O5LH 2IC2A 5CZXD 1G9NH 5D1XA 4R96A 4M1CD 3PWJB 5L9DH 2RQ8A 1DBJL 4QLRA 4JM4L 1YECL 1T1YB 4NRYA 2FX9H 3EOAB 3L5XH 1RZIB 3LDBC 1FG2A 1MHEA 5CZVL 2VDQH 3TJHC 5EU4B 3SO3B 2HRPL 3DLQR 5ID0A 4L9LA 3LD8B 4PRPA 3WNNA 3TVMD 1NJ9B 1B0RA 1U3HB 4I1NB 2BOCB 3VXUE 4CVZB 4YHZH 4EI5C 1W0VA 1DQMH 4D9LH 4GKOA 4WI6A 3SE9H 3FFCE 2XKUA 4ONOA 3VRIA 4WU7B 3BZEA 4GG6A 5JW5A 2GJZA 3WS6C 3BSZH 1BZ9A 4Z0BL 3LQAL 5T1KA 1IGJB 4RWYH 5I1IL 3CC5A 3LEVL 2ITDB 3O0RL 3TIDA 2VZOA 2FX7L 4MSWB 4EQ2A 3EYQC 1ULVA 3BJ91 3CDFA 3T2PA 4OM1L 4WWKD 4JO4L 3DPBA 5INDA 3JSSA 2OSLB 4NHCL 4F7EA 1AXTH 5FGCB 1G7QB 4LRIA 1K8DA 3GSNL 4LIQE 2QKIB 4LKCB 2LAAA 4YHML 1ZWIA 43C9A 3F6IA 2WINB 1J1XH 1ZLUH 2V17H 5F93C 3ABZA 5BVJB 1NAKH 2EEAA 4HIIB 3QXAB 2NXYC 3BHBB 1RJLB 4QGYA 4PJIE 3HLAB 2V2TA 2WP3O 3HR6A 1SYVB 4AIZB 5I16B 5BW7A 3ARRA 1QEWA 1UWEH 3A67H 4X7DC 5GRWA 4J8RA 1Z0MA 4CMHB 2CLVB 4ZS7L 5CWSA 4XBEH 1MLCB 1FGNL 2QHRL 4LAQL 3QWRA 3Q5TA 3DX9A 4RGNC 1IMHC 3MGTB 1JGDA 4PR5B 3RWFB 1V3MA 2JCCA 3A6OA 4MA3A 5LJYH 4YHKH 4HUWA 5D5MF 2X4UB 1PSKL 4DGIH 2R23A 3WLBB 3LQMA 2NLJA 4MS8D 4Q97A 3EJZC 2OMBA 2LVCA 1FZJA 2W0FB 1U8NA 1PJ9A 4AYFA 1KPRB 4LIQH 4O02L 5I15H 1T03L 1P6AB 5D72H 4TNWF 1J05B 2MQ3A 5DD5L 2ITCB 2VXVL 4PJAA 3U79A 1C16B 4U7KA 4M6ML 5A16A 3QWOB 4B53A 5C86A 3HMWH 5TE6H 1IRAY 5TQ2L 5ITFB 1G84A 3FO9B 1FORL 1X7QA 4O2FB 4WO4C 3GFUA 3TYGL 2ADFL 1XFPA 3DRTA 4QXGL 4UV7L 1OM3L 5K93A 1QACA 4TUOB 1ADQA 3U36A 4G6FB 3SCMD 4M6NH 4DK3A 5FOJA 4IOIA 4U1MA 3H9YA 2HTKD 1DQDH 2GT9B 1RIVH 4H20H 1KELH 2B4CL 4UB0L 1IEAB 2R15A 2Y6SD 3AAZA 4Z7WF 2VXQL 3C2AL 1F3RB 1I7UB 1YEFL 1T21A 5I1JH 3IS1X 4M3JA 5DFVC 5F89A 5GZOC 4POYA 3I6LD 3F5WA 1G7JB 1FPTL 1TZHA 1UM6H 1GGCH 3P0YL 4JDZA 3SQOH 5I1CL 1D5ZB 2EH7L 3EYSH 4G42A 5F7WC 4AIOA 2D0GA 3IJSA 3JWNC 5HHME 3ULUE 4C56E 4KRPD 1X5YA 3B9KB 3BKYH 1A6ZA 5MI0B 4H88H 5SV4A 2R2EB 4K3DH 5TH2B 1KGCD 2N7AA 3ULVE 1C5BL 1BFOB 2GITA 3I3DA 3L3KB 4JFDB 5IVXE 5HYSB 5MERA 2QQNH 5DHYA 3DV4B 4KI5D 5IIEB 3HS0B 4OLEA 4GKZA 1AGCA 1U41A 1OPGH 1UJTA 1PEWA 1KCRH 3OGCB 5FKAA 4TVPE 3RDTB 4XZUA 1WIUA 4OCLC 3VD5A