3WJJA

Crystal structure of iib selective fc variant, fc(p238d), in complex with fcgriib
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
212
structure length
212
Chain Sequence
b'ELLGGDSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Engineered antibody Fc variant with selectively enhanced Fc gamma RIIb binding over both Fc gamma RIIaR131 and Fc gamma RIIaH131.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjjA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjjA01
3VXSD 4M5ZL 1I3GL 5DRXB 2UZIH 1C5DA 1RHFA 1R5IA 5FO9A 1DBMH 2DM7A 2FH6A 4L4VD 1JI2A 1MWAA 1KTRL 3K4AA 4E41B 1TLKA 3U4EA 3OGOE 3WKML 4OFVA 2FX8H 4OZIE 4EN3B 1GAFL 4XH2B 4P46D 1XF2B 1G7HA 1BD2D 2DQEL 2VZ1A 2XQBH 4BH8A 5E2WH 4XAKD 3DX9A 3HPJB 5CSBA 4IMKC 3ROOA 1NUNB 2IQAA 4FXKB 3FQUB 1RVFH 2H6PB 3WIFA 2C3XA 5E6IA 4HWNA 1ES0B 4PB0L 3O6FC 1ZVSB 4NRYA 4XPTL 1I8MB 3JZ7A 2PKDA 2CDFA 4OCXH 5BZWA 2Q7NA 3MV01 2YPKA 3CFJB 2NY7H 1KB9J 1IGJB 4IOFD 3ARBC 5GRXG 1SQ2N 5EOCL 3V2AR 1C5CL 3SDAD 1DN2A 5C7XL 43C9B 1I3UA 3WIIH 1R5VA 5CCKH 4Q9CA 1M1SA 3ARSA 3B5TA 3HAEA 2DQUH 2FZ3A 3T3PF 4ZYKB 4PV8B 5LCVL 4PRBA 5IB1A 2E5EA 4ZODA 4FFZL 4GQ9H 4YIQA 4XT1C 5F1IB 4WWKB 1BEYL 4PRNA 1F4YL 5H94B 4R6UA 2AKRB 1U3HA 2D4DA 4A6YB 5HYQB 1UC6A 3PWLA 4Y2DB 1A7OH 1C12A 1KACB 3SDCC 1XGTB 2DAVA 3IDIB 1N5YL 1BMGA 5EZJB 1EJOL 1EEQA 1BZ9A 2FL5B 4XBPB 1UKQA 4XVSL 4K71B 3UTSA 1ERNA 3I2CH 3LKOA 3TO2B 3QCTL 5ID1B 3QUZA 4NM4H 1G9NH 4ONOA 3OB0H 3L3JA 1IVLA 2EDTA 1LVEA 2IH3A 3O4LD 4PFEA 5FDYA 3TFKD 2ZUYA 5DD5H 1NCCH 2FSEB 1YEDB 5JQ6H 1TJIH 1RUKL 3L3GA 4P2RE 5FB8A 4CU6A 1ULVA 3O3BA 5E7BA 4JRYE 4JO3H 1GGBH 4F9PA 3KYOA 4M3KB 1FAIH 2YMXL 5JOFA 3PQYB 3TZVB 1AGCA 1YY8B 2D7TL 1BIIB 3ARPA 4YFLI 1T0PB 4ZSOA 4QRPA 5I76A 3W11D 4AM0B 2HN7A 3BWUC 4FQQB 4QRSA 3HHRB 3VE0B 4IIQA 4MCZB 4NSKB 4S10A 5FDWB 3ULUL 4PBWD 1HIML 1X7QA 1R3KB 4PTTB 4MDIA 4O9HL 3QH3B 1HNFA 1CDJA 4U1SB 1UB6A 1FYTB 3MYJA 4N9OB 3KJ4B 1EMTL 3RWJA 1QVOA 1KTLA 4PJ8C 4OQ1A 4K7FB 5E5MB 1TQBC 4FQIL 3T09A 5IQ7L 1ZXQA 1UWEL 1XGQA 4YHLL 3J7HA 2OTUB 5C0AB 3DX8A 4OCSL 5F7NC 4XWGH 3ES6B 4UIKH 3MCLH 3RTQD 5MHSE 3RDTC 4FOMA 1KC5L 3PJSA 4B7IA 5ESVA 5CILL 2VLJB 4YHOL 4RFEB 1TDQA 4NCC2 2FD6H 5FYLH 3QXVA 5EIVA 3RY6C 2R1YB 1Q9KB 4LCWA 2EO1A 4X6BA 4TSCL 4UV7L 3V95A 4PJBE 1JTPA 4NQDA 4X6CF 4YBLC 5SWSE 5T1KA 2IG2H 4EOWL 2AJXH 2X2YA 4G9FA 4HIJB 3H0TB 5T3XL 1DSFL 5A2FA 5EIIB 4ZO6A 4P2QA 5CD5C 4XP1H 1WT5C 3TESA 4XNXL 2DM4A 1VGEL 2F19L 4L4TD 1T6WA 4BSJA 3HC3H 1XEDA 5HHVH 4F15B 1HHHA 2AQ2A 2WWKO 3BD4A 4JQIL 2OXHA 2I60L 4KI5D 3PIQB 2CDEA 4GH7B 2UVFA 1QSFA 5EUOA 3WXWL 4RRPG 3PGDB 1KJMA 5J9PA 5BV7C 1H0DA 3VXPA 1KCRH 1F4WH 3LEXB 4L3ED 2CGRH 3EJYC 1FVDB 3BSZH 1KXTB 3PL6B 4HV8B 5FUOL 4GAJL 4NQVA 2QADC 5EZIH 3H2WA 5HHXH 3LDBB 4JRWA 3JV0A 1IQWH 2EIDA 2NNAB 3E8UH 3PGFH 1M05A 4EI5A 3HG1D 2OL3A 3BH8B 1A7PH 5HYSB 1P6FA 3I85A 3CSPA 3WL9A 3X11B 3QXAA 4A6YH 1UGNA 3FB5A 3BWAB 4YAQB 3DVGA 2IQ9H 2GK0A 2R56L 2ZUUA 5TH2B 4WI9A 1WV7T 3QWRD 3O3DB 3GMRB 3IJYA 5JW4R 1U6AL 3BP4B 4DFIA 5EBMA 3MRHB 4NP4L 1B0RA 4R3SA 2VZUA 3SDYL 2CO7B 2A74B 1FVEA 2IAND 3LY6A 2P8LB 5CJXA 5IESH 5DHVB 1PYWA 3MOQA 3LIZH 1E4KA 4OZHF 1BVLA 4YLQT 3TWCL 3U1SH 3VXSA 4GRWE 3WBDA 3WUWA 2QQKL 2Z31D 5D96C 5F89A 1FO0B 4HGWA 4CAGA 1QFUL 1WICA 3FHQA 4ZFOA 2YXMA 1CT8A 1RHHA 2VITB 3U6RA 3QDHA 3V5HB 4CADB 3W9EA 1QFWI 4OLYL 4WFFD 1EUUA 3ECBA 1CE6A 4AG4L 4XBEL 4P46A 5E95B 1MFDL 3CLFL 3KYMB 5DHYA 3MV9A 4I0PD 3S34H 1FNGA 4YHKH 5JORA 3RWGA 3JSSA 3MLRL 2VISB 2FO4A 5DRZA 4JFHE 2ZG3A 2HLFD 1XGRB 1SBBA 1A22B 1J12A 4AIOA 5IMKB 4Y7MA 4R2GB 3FQXB 1D6VL 4PLOB 1FSKC 4OFKA 5J0BA 4OD1H 3PNWB 2IBGA 4D94A 1T1YA 1JZ5A 4D0BA 1YMMD 3ARED 5IJVA 2D03L 1EDQA 1W0VA 3MJ9L 4MQ7A 1NGQL 1YEJL 4WTWA 2NXYC 3BPOB 3WFHA 3FO0H 3WD5H 3QI9B 3ARUA 4TSBH 4PRPE 4ZOAA 3CXDH 3SDAA 1MHHB 4P4KB 4Y1AB 5M94B 3LKQA 4RMTA 4DGVH 3M17B 3LKNB 4DEPC 3HZYB 5C6TL 1INEL 2LAAA 4UOJA 4GKOA 3PWPA 4RFOL 2Z0BA 3O3AB 1QBML 4XNQB 4YJZL 3WKNA 4PJAA 4PIRF 3SQOL 1T7ZA 1BQLL 1FIGL 5MERA 5E56A 2A6IA 4XBGB 3SCMD 5CMAA 3VWJD 5FF6A 3MUGA 2FB4L 2WMPA 1JGEB 4PY8J 5EBLB 4NT6B 2ARJQ 4U1KB 4MB5A 5JIHA 2X4NB 2R29H 3TH4T 4F9LA 3UZEA 4KJYB 3TA3D 4Y4HB 1E28A 4HS8L 1HN1A 3Q6GL 1V7MH 4PREA 3F7VA 2ATPB 5BO1L 4M61A 1OTUC 3V4VH 4K3HA 2BOCB 1NAMA 3WLBA 3IU4H 4C56B 1XH3B 3QRFM 4UOW1 3MODL 3BAEH 1KIQB 2HH0H 1XCTA 5GS2H 5ISZD 1HYSC 2HTKC 1M7XA 1RK1A 5I8EB 2NY6D 3FL7A 5ADOH 4IOIB 4NKDA 1L6ZA 1J9CT 2LE9A 2EICA 1NMAL 4MDJA 2CUMA 1OLLA 1TVDA 2FEEL 2I26N 2J12B 1J1XH 5GS0L 1MVFA 1JNJA 4PJDE 4F8QA 2FBOJ 1QNZL 3L7FA 3J8F7 2ADJB 3N85L 5DURB 2D31A 1J8HB 1AO7D 3S6CA 3U0WL 4ZFFB 1YN7A 2JTDA 1JPTL 1XMWA 5DT1H 3UPCA 5FYJH 3BN9C 4OCRH 4X4YB 2EDWA 2HKFH 5A3ID 5DHVH 2XV6B 2MQ0A 4DKDC 3UBXB 2BSRB 2UWEA 1XZ0B 2E8YA 4NJAH 5DVKA 5CEXB 3RTQA 5IB5A 4TTGA 4L8CA 2W0FB 4RZCA 3BZDA 1FO0H 4HWEH 5EPMB 5F1KC 3DYPA 5C0BD 3W9DA 1NMCB 3HS0A 3MLSL 4MJ2A 2NY3B 5D7SH 5E8NA 3RJDA 3LCYA 3JWOH 3P73A 5ILTL 2B4CL 1EZVY 1AGDA 3D0LB 2A6DB 4PJFA 1CYGA 2P24B 2DLHA 1F58H 2ITDB 4ZUUB 2R2BA 1T5XB 5D1ZC 3L3KB 2W91A 5DSCA 4OT1L 2QHRL 1F13A 1TQCB 4HUMB 3G08B 4K2UH 5DMGD 4MXVF 1VDGA 3MRKA 4QRRB 4F7EA 3G5VB 4MA7H 4NOFA 2OL3L 5TF1L 3AS0A 3PWUB 5DFVC 1ZHBA 4UTBL 2FBJL 4JY6A 1YUHB 3FZUC 2Q8AL 4BELD 4I3RH 4L4TA 4OF5A 2Y07L 4OZ4A 2EYSB 2R2CA 1JNNL 5MI0C 1G6RB 4WFGE 4PJXA 5ID0B 4LF3A 3SGKC 2ZNXA 4OZFB 1KEML 5KVMC 2E9BA 5IT2H 2H1PL 5DQDH 3MROB 4N1CA 2VDQH 3UTQA 5L2JB 4FXGA 1TZHB 5TE6H 1IL1A 3UTPD 2VLLA 1LEKA 4L3EA 5KANG 1KCKA 1WBZA 4NO0A 3OKLB 1DANU 1VA9A 4ELMA 1P7KA 1KBGH 5DD6A 1UKTA 1SVCP 4O4YL 3RUGF 5IVXA 3FQRA 2DI7A 4JPKL 5J13C 1Z9MA 4JHBA 4JQVC 1F00I 2PYFB 2IAMD 3HNSL 1CDYA 3QDGE 4NQEB 3CPLA 4ZFOL 4TTDC 5LG1A 4JFOA 2B1AH 2BNUA 2A6KA 3PWJB 5L2KB 1NBZB 1KB5A 1J86A 3KPOB 2APFA 5IGXH 1LEGB 4ZOBA 3CFBA 3ZDYF 2ZWLT 5CZXD 5ACLA 3QWRA 3MRLB 5LKNA 3ARDC 5CFHA 2DD8H 3GSNB 5MHSD 1CICC 1YMHB 4V2BA 1ZTXH 3D18B 5CGMA 4KHXH 5CGYC 4G9FE 3I9GL 3IF1A 2IANA 4PJ9A 4N5UA 2BVEA 5FYLE 2CDGA 4BA8A 1JRHL 4N9GB 2SEBA 3KS0H 3H9SB 3AVEA 1GIGL 5T33H 4Z5RB 2X4UA 2Z31A 1KIPB 1EO7A 2UZYB 5MEOA 5C3LD 2AEPH 4H5SB 1OW0C 5E1AA 2GITA 4JCMA 5KSBF 1PW3A 1Q0YH 5HDQH 3QNYB 4Y5VA 5EH1A 3SOBH 5D5MB 1AY1H 2RAMA 1CDGA 3GBML 4YDJB 5D1QC 2E7LC 3DUSB 3UCRA 1S3KH 1U42A 3VI3F 4U6YA 4I0PA 3CU7A 5D6DC 3NAAL 3TIEB 2WINA 4JKPH 1JPFA 2FWOB 2XN9E 2OJZL 2JELL 4XVTL 3TH2T 3GBLA 4XC3H 2Z91B 4WUKL 3UTZA 4R4BB 3RVUC 5E03A 1Y18B 1U8KB 2HRLA 2JCCF 4GKNB 4LRIC 1CF8L 2XZZA 2AV1B 1QTYT 5DEGB 5F7UA 2JKXA 4POZC 1L4IA 4EIZC 1YMMA 3LQZB 5I8CA 3MOBL 5C0JB 3DYMA 5JW5B 1SBSL 1DL7L 3T1FB 2EH8L 3KVQA 1T0NA 2EE6A 3G6AA 1YYMH 2VQ1A 4UBDD 4NUGL 1NAML 1FCCA 2BFVL 2BRRH 4Y0GA 4RBPH 4RGOH 4MLIA 1A3LL 3QFJD 4OD2A 2ESVB 4HIXH 2I25N 4LVHB 2C4FU 1OTTC 4I48B 5I9QC 5IWLC 1G6RH 3WFZA 1C5BL 1X5YA 4XP9H 3SCMA 3N1MC 1N59B 3MRJB 2DQDL 3VWJA 1S9YA 1P7HL 4OZFH 1HKLH 4TUKH 3DLQR 1P84K 4PGEB 4W4OC 1FRGL 3G6DH 3P0YH 4NUJB 4HFUH 2W60B 4KQ3H 4Z76A 4GG8B 1I4FB 2KPNA 5F6HI 5DEZA 1OARH 3BJLA 3TA3A 4DOHB 4PS4L 2EDBA 2ICWB 2RR3A 3TNMA 5FUCE 2ED7A 5F96H 4KZEL 1W72L 1X5HA 1NC4A 3VU2A 3KYKH 3A6CL 4JO2H 2G5BB 4ALAH 4J6RL 3E3QC 1JFQH 5HYJB 4FNLH 5ISZA 4X80L 3L5XH 1T66D 3T77B 2IGFH 1JF1A 1GC1L 3QCUL 1IGMH 1U8MA 5J3HC 3U9PL 4XPFH 3GSUB 1MHCA 2DLFL 4AENA 3FAWA 1X6LA 5D7JD 4XNUL 3KHOA 1CLYH 2AJYH 2GK2A 3MXWH 4GAGH 5C0AE 2WZPD 2YN3A 1A6VH 4QT5B 4EJ1C 4U6XB 3GSNH 4XRCA 1AO7A 3ZDZE 1GOHA 3NH7L 1T0MB 1AGBB 4HWBH 3KPSB 3OPZH 5L9DL 1NCDL 5DWUL 5ESAB 1KCVL 2VLJE 1RURL 3DI3B 3AXLA 3ZTNL 3ABZA 5D93C 2WWMC 1AQKH 4FXLA 3VA2C 4YEEA 1W2KT 1IM9D 3QHFL 1H8NA 4GG6B 2AK4D 4OZGA 5INCB 4NHCH 4LIQL 5DJAA 4B0MM 1ZKAA 1N5AB 2VXSH 5FHBL 4YBQC 4IRJA 4MCYB 5C0BA 3OXRB 4NC1C 3GHEH 3TCLB 4PG2C 5DJ8B 2AJVH 4Z7UB 3QUMB 1CWVA 4X6DE 2PN5A 4XXCA 3GZKA 1DN0A 4HULB 1AXIB 2YA2A 1XF1A 2VDPL 1Z3GH 4YDIH 5HHNB 5EO0A 1YY9C 1R0AL 4Y5YB 3RKDD 2D9QB 5F7WC 4NZRL 1BLNA 3CK0H 4UUJB 2VSDA 4G8FB 1DQLH 5E99H 1I7UA 1CDBA 3O41B 5A16B 1YEFL 2YPVL 4UOW0 3FT2A 1PG7H 2FLBT 1U8HB 2Q76A 2UVEA 4K3EL 4KDWA 4ODVH 4U3CA 5IVZA 5K59F 5CWSB 3PUCA 3EDFA 3O2DH 3ZMRA 1NJ9A 3MA7A 4AJ0A 2X1XR 3S5LB 4PRHB 1FQ9C 3W39A 1P1ZB 2FIKB 4CNIA 3IAPA 1YQVH 5JPMB 2JJSC 5CUSL 1MCFA 5CZKA 3VRJB 3QRGH 1T7VA 3PDDA 5IROC 2BVPA 2HFGL 1FNEA 1IAII 3INUH 4MLSA 3KLSA 1V3LA 5JOPE 4JRXA 4S1RL 3UBXG 3IJSA 1BFOA 3DV4A 4FTVA 4WO4B 1RZIB 5I1CH 4LU5H 3IJHB 4IOSD 3MR9B 4P49A 5KVEH 4GS7B 2JK5B 4J23A 4WU7B 1G7IB 4X8XA 4YXKH 4N5EC 2NX5D 2HVJA 5F3BB 4P59H 4U1NA 3PDOB 1ZT7A 2GUOA 1XCQA 1WAAA 3MLWH 4POYA 1OY3B 2EIZA 1DBKL 2PYED 1Y6MR 3UTTD 4MXWL 4QYOA 3GMNA 3HMXH 3UDWA 2BVQA 5L8JB 5F7DA 3WXVL 1S7RA 5FYJE 1SEBB 4DUVA 2V7HA 3ARZA 4HK0A 5T1MA 3VH8G 5I16B 4EZMA 2AJUL 4JFPB 15C8L 3F6IA 4D8PA 5DYOA 4ZDHA 5J89A 3ELAT 3EOTH 4PTUA 2X9XA 5BVJB 1CBVH 4PJCB 5JLZA 3I75B 4ODTH 3U83A 5AZ2H 2GY5A 1R24B 2ZCKL 5I0ZA 1FN4A 5CBEB 3SKOB 3QCVH 1KTDB 1D6EB 1N8ZA 2BCKA 3BPLB 2H45A 1CGSH 1CE1H 5I6XC 4M62L 2XTJE 1UM6H 3D3VD 4X5WB 5IJKC 2DLEA 4G42B 5I1IL 5KSAB 1AQDB 1L0QA 4HBCH 3RPKA 2DBJA 2F53B 4AH2A 3OB8A 2MOVA 4LPTA 1TCRA 4H25A 4TPRL 1H15A 1A14H 4KDTA 2ADFL 1HXYB 3V6ZB 4R7DB 3IETA 4Y8AA 4WFGD 2ITCA 4QHKI 3CDFA 1FFQA 4UNUA 3FB8A 3MRRA 3HNVH 1L7IH 3ZL4L 2VUYA 5F7FA 4UT7H 3RRQA 3S36L 3X3FL 4F7PB 3O9WB 1JHKH 2ZJSH 2RQ8A 3BZFB 3FONB 4Q9QH 4HHAB 1DR9A 4XNMB 1H3VA 1LGVA 2D3VA 4OCYL 2EEBA 4MQTB 3C60C 2J1KA 2VLRE 3LS5L 3T3MF 3QUMH 3QJHA 3S35X 2AXJA 1S9KC 5T1LB 1D5ZA 1LO5A 1K6QL 3KPLB 3NBNA 3KS0J 4GKSA 3Q1SL 1J1OL 5ITFA 5BRZA 1CG9B 2BVOB 4O2CA 1HK6A 2VXUL 5DTFB 1IGCH 4WW2B 4JN2A 3RNQB 3S3JA 4RNRB 1MIMH 1NDMA 1ETZA 1Q9LA 3OKYA 4NRZB 2JJWA 4YQXH 3PP3K 2P43B 5C0DB 3QFJA 1J0JA 3MO1A 4G8IA 4LNRA 5E8DH 3QXDB 3QAZC 3IRPX 2UUDH 4OIAA 3VGAC 5I30H 3STZB 4HWZB 1MCWW 2M2DA 3SDXA 1U2CA 1X3DA 4ISVB 1EXUB 1QLEL 3WS3B 2VDOH 1N2RA 4DGIL 3V4UH 1RULH 2BSTB 3LZFL 4KK5C 1CGTA 1LO2H 5JIPA 2AQ1A 3P4MB 4LCYB 1NQBA 4E41D 4X4MA 5J8OA 5FYKU 2XWBB 4QXGH 5I8OH 1I7ZA 3OAZH 4HQQH 4EN3D 4U7KA 3MRFA 5JZ7D 4WU5B 4LSTL 2E6JA 1H8OA 2R1XB 4G80A 4UV4H 3MACL 3G5YB 4K94L 2ZSVB 1JWMA 4X99A 1G7QB 3VRIA 3DO7A 3ULSA 4Q7DA 2Q6WA 4MSWB 1J8HE 1LNUA 4AIXA 5HY9B 2IH1A 1XF3A 1YEIH 3KPRB 4HZLA 1TPXB 3KPPB 1X5IA 1N0LA 1TJGL 2X1QA 3RWFA 1AD9B 5CZVL 3BE1L 1SJHA 1WVZA 2X4OA 4OLUH 5I1EH 2Y06H 3LKPB 2OP4L 1KJ2L 2FJHA 5E7FA 4O2EB 3M8OL 4JANB 4M48L 1D9KB 2ORBL 3HE7A 1FCGA 1P4BL 5F9WB 3RWIB 4DN3H 1U8JB 1F4AA 1ZEAH 5J12C 4PGDB 3K1DA 2I5YH 2VZOA 4GLRH 4M02A 4PV9A 2OR9L 3RHWF 2EDKA 2OZ4A 5AWNH 4MA3A 1FNLA 1NFDE 5F6IB 3O6KL 1Q94B 3FO2A 4Z7VE 1ZLVK 2AK4A 2F15A 5J57B 3CVHL 2QSVA 4C58B 4JDVB 4TUOB 4U1LB 2DQJL 5IFAH 1DUZB 1IKFH 4YDLC 3QIWA 2H32B 1ZLUK 5JHLH 1A6UH 4R90H 3FN3A 1YECH 3GO1H 4MVBC 4Y2DD 1W8NA 1WWBX 3FJTA 5HGDB 1QO3A 2EDEA 5EU7C 5EU3A 2EDLA 4QRRE 3P0VL 5L8LB 4WGVB 3EYOA 3DIFB 3BJ91 3CLEL 1MHPH 1G1YA 3EDKA 1ED3A 3QDAA 3RQ3A 1CXEA 3V6BR 2Q3ZA 4KRLB 4MD5B 4N1HB 3GNMH 3GI8H 3X14B 2F54D 1NANI 5TE4H 1ZLSL 2EDXA 5IHUH 4S1QL 1IBGL 3SKJL 1AD0B 3ULVF 1F45A 1QFWM 2P5EE 4KY1H 3UO1H 4UNVA 2GJZA 3BFOA 4YNYA 1OSPL 3PXHA 5B39B 3PQYD 2H26A 3Q48A 4ONHB 5BS0D 4L1DA 4WI8A 3L9RB 4FP8L 2DBLH 1ZA3B 2NTFB 3ZE0F 4XCNB 6FABL 4GUPB 2BVYA 5K9KB 4X5LA 5KS9A 1CU4H 1KNOB 4GRLA 4F37K 1KLFA 3B2UC 4APQC 5EC2B 4KPHL 4NQEE 1GZQB 1FZKB 4HX1B 5DJZB 1IZKA 3V4PH 5DVNA 1FYTD 4O02H 4NZTL 4N8VB 1KYOJ 3KPNB 5B21A 2WK2A 4KU1A 5EU6A 3Q3GA 4RRPA 3I3BA 1KXQE 1A6ZA 3QIBA 3S9DB 5BW7A 4P23C 4P5MA 1I1AC 1JHTA 4W4NA 2PYEA 3UJJL 4RMUA 2WWKT 2XPGB 1P4IL 3LRSB 1N4XH 3UTTA 4I8DA 3DSFL 3FT3B 3ZYZA 3E6FB 3NCMA 4M8VA 2VLJD 3LS4H 4MNGB 4LSSH 2EKJA 2DWDB 4G3YL 5H2BA 3CC5B 3KWWA 4RAVB 1E27A 2GAZB 4KJWC 1HSBA 3BP5A 1PQZA 1U3JA 4WI5A 2NY5L 1BZ7B 3NZ8A 4NQXA 1KPRA 4P5TB 4X6CB 5DS8A 5LQBL 5TFSH 4HKXB 4KKBD 3MYZA 5I19H 1Z9SA 5HI4C 4UDTB 1HZHL 2Y6SD 4J3WA 1XF5A 1HSAB 3E6HA 4Z77B 1ZGLA 3GMMA 1MSPA 5GGRY 2Z8VC 3BKYL 4HWUA 1ROWA 3SE4A 3B5HA 1MHEA 2VN4A 5D5ME 3VXOA 5F9OH 2VZTA 5H37H 5IW3A 1AFVH 4CDGC 2NY0C 2YC1A 4D9LH 3Q5YA 4HIIB 1YA5A 3D3VA 1T22B 1WEJL 2XZQL 5I73C 1DE4B 5GRZA 5LGKA 2AJZA 5LWYL 5JQHC 1HHJB 3H3KA 3MMEA 4ZPVA 3ULUC 4JRXE 5D70H 4MJ4A 4FTVE 1IFHL 2IBZY 3DUUA 1F6FB 1WC7A 3PL6D 4ZO9A 2PO6D 3DV6A 4OZIF 4ZPTB 1MCIA 3GRWH 3SKMA 3RPIA 1FZMA 2EC9T 1MCKA 2GKIA 5IQ9B 4DAGL 3GSWB 4TQEH 5GS2D 2ZPKL 35C8H 2RCSH 3AU1A 4NQSA 3U7WL 2H32H 5I1HH 4U7MA 5BVPL 5KVDL 1UM4H 3SDDC 4HUVA 2X4TB 5F7EH 5DK0A 1RQ5A 5TGBA 2IWGA 5ANMB 5C2UB 2QQLL 1A2YA 3W5MA 5CBAA 2Z8RA 2ESVE 2NY1C 4Q9BA 4QGYA 4DGYH 4Y19B 5IG7B 3GKZA 3QO1B 3G04A 4Z0BL 5HHPA 1URLA 3T0EC 4RISH 2L7JA 2V2WA 3QYCA 4C4KT 5FYJD 4EQ2A 4I2XA 1OF2B 1RZGA 5D2LA 4TRPL 2ZCHL 3VCLB 4QTHA 2VJXA 3RGVB 4W6WB 1GPOL 3GGWB 4KROC 4LPXA 4N0FB 4MNHB 3MNZB 3KLHD 1NMBH 1ZHKA 5I0DA 3HNTL 4DZBB 2WUCL 1G7MB 3S4SB 4E41A 5H35B 3QB7C 3HI1B 4EN3A 4YHYB 3LH2H 2OZ4L 3C9NB 2FGWL 1UZ8B 4JJ5B 5DMIH 4ZFZB 1V7NL 3DMMB 5FM5M 3K0WA 4PJ7F 4UMGA 3RDTD 1VEMA 4R2GD 1XIWC 4FXKA 4EXKA 3FQUA 2QBWA 2H6PA 3D1MC 4YK4B 1BX2A 3ORJA 1ES0A 3T1WA 1ZVSA 3VA6A 4OGAD 1S7XA 4KVNL 4U1MB 4M1DL 3KPQB 3MRCB 1F3JB 2OMNA 3C6SA 5IMMB 4ORZC 3KXFE 2JE8A 3O8XA 2GJ6B 1IEHA 4N0CC 4TULH 4HF5L 3QI9D 4NYLB 5IF0B 5M95B 4Y1AD 43C9A 4KJPD 3HR6A 1GZPB 5I1KL 3KDMB 3MGOB 2A2QT 2X6MA 3FB7A 3D25B 1JGUH 4ZYKA 5I15H 3SE9H 1GHFL 4S0SD 1WISA 1R3HB 3MFFA 2E9JA 3VD7A 1ONQB 2RCSL 2X70B 3DURB 2UZIL 3EZ8A 2DKUA 5F1IA 3MBXH 5H94A 4M6MH 1MQ8A 2X7LA 2AKRA 5EA0L 1Y6NR 3CGTA 1DBML 3WFBH 4Y2DA 2AP2A 4TNWF 1XGTA 1FZOA 3IDIA 2R69H 5E8EB 3L3OB 1B90A 3ZDXE 4P2CG 3MLVH 2P42B 4CMMB 8CGTA 4IHOB 2OJEB 2Z92A 1U93B 2FL5A 3PWNB 5C0RH 4U1IA 3JXAA 2FX8L 1BVKA 5D7KD 5DMYA 3MLXL 2K7QA 2AEQL 2DQIL 3D0VA 3RWEB 4Q2ZB 1S7WB 1JGVH 2F54A 1HYRC 3M1BB 2XQBL 5E2WL 5LAXB 4PJBF 4C56D 4L9LA 3RY4A 1MLBA 1BWWA 4GW5A 2W59A 4M7LH 1RZ8A 3SQBA 1UB5A 4M5ZH 3ARFB 3QUXA 4ESKA 4IS6A 1U3HC 1I3RB 3MZGB 4HIEA 4B7LA 3PQYA 3V52H 4L8BA 4KJQC 3BIBX 4OCXL 3LN4B 4QRUB 5BS0A 2GI7A 5D2NB 2XNAB 2IPUK 5CINH 2NY7L 4FQQA 12E8H 3QEQE 4MCZA 4NSKA 3HC4L 4RMWA 2PTTB 4LDOB 3V8CA 5DURD 1J8HD 3LV3B 4ELKB 1AKJB 1EHAA 2NY2C 5B38B 2DQEH 4J4PD 3WIIL 5CCKL 3U46B 4QOKE 3QUYC 1FYTA 5LXGH 2YEZA 2DQUL 5FO7A 3H7BA 3TN0B 4YO0A 3LKSB 1F2XK 2KKQA 4C83A 2OTUA 3VXUA 2R2HB 3V0WH 4DKAA 5JPNA 1HOCB 2R0WH 3ES6A 1HI6B 3OJDB 4N8PA 4OF3A 2IADB 5TE7H 1A7OL 1IAMA 1Y0LA 1S78C 2EXWD 4RFEA 2E9WA 1J5OH 1KIRB 4IIQC 5FUZH 5IMLB 2O5YH 4J3OC 5EORH 4NN6C 4RDQF 4I3GA 1CN4A 4YPGB 3I2CL 5CP3A 4NM4L 1G9NL 5B39G 1JWUA 1JZ2A 1DQTA 2IF7A 5B8CA 2OX5A 3STLA 3RHWK 1DLFH 1NCCL 5DD5L 4BK5A 5JQ6L 4QRRD 1TJIL 3BHBB 3QIUC 5EIIA 2FEEI 1RFDH 3MGTB 4LVOC 2V5TA 2V9TA 3UAJC 4JO3L 1GGBL 2F53E 4D0CB 1J0ZA 1FAIL 2KZ1B 1JGDB 2MMXA 1UEMA 3GSVB 3PG2A 2OYPA 4Z9KB 4BSVA 5F93C 3QFDA 4F7MB 3N1PC 4F7TB 4N8VG 4YGVB 4GRWF 4JM2C 4KRMB 5DUPL 1IAOB 3PIQA 3BUYA 3TO4B 3ARBA 5GS0C 3VFPB 3C5ZB 4OI7A 1MOEA 1DDHB 5KS9E 3QA3B 3ZKSD 2APVA 4FHBD 2O61B 3IVKB 1LP9F 1FC1A 3BZ4A 3VFOB 4ACPA 2PO6A 2PXYC 2ATKB 1K4DA 3RUGB 2PCPB 3SO3C 4UIKL 2YHGA 3MCLL 4KRPD 4CVUA 2E7CA 4AYFA 4NQED 4LCCB 1F4XH 5DRWA 4OIBA 1X5KA 3SDCA 3X11A 4YR6B 1X5XA 3BWAA 3TJHC 1XGYH 5L2KD 2VWEC 2FD6L 2IPTH 5FYLL 3L5WB 2OS7A 1Z6JT 2V9QA 5TH2A 5INDB 2ARWA 1U36A 5IBLC 2YD5A 3GMRA 4NQCB 2IG2L 2VH5H 4XTRC 3TP4A 3S35H 2AJXL 3BP6A 3RZWA 4TYUA 2L0DA 5E70A 4QHLA 4JG1H 2A74A 5DD0H 3R4DA 1TMCB 1AGEB 2ZOLB 2P8LA 2NYYC 2JJVA 4XP1L 1QOKA 5ACMA 4EI5C 3LEYH 1OWWA 4FZ8L 2EYRB 3NOIA 3H9SD 4ZFGH 3BRDA 4OLVH 2HJKA 4JY4B 3T65B 5DQ9B 4MAYB 4P2OC 2DL9A 1JK8B 1AIFA 3RZCC 1OGTB 5SX4I 2VITA 4EDXA 4Q9RH 2B2XH 1EA9C 1S7UA 5EZLB 4CADA 5KSBB 1KCRL 1F4WL 7FABH 4DVBA 2CGRL 3LB6C 1AR1C 1OTSC 4KGJA 1CFTA 2MQCA 3PV7A 3BSZL 4YDKH 4Q97A 1YNLH 2B0SH 2L4OA 3F5WA 4JZOA 1DSFH 5IFJA 4H26A 1T4KA 3HLAA 3KYMA 4IRSB 4KXZH 1LE9B 4S1DD 5HHXL 1BBJA 3RL2B 1IQWL 1IJ9A 1IAIM 3E8UL 2V6HA 3PGFL 2A73B 4X4XB 3U48A 3RDTA 5IMKA 1A7PL 4JFDB 3MBEB 3FQXA 4WUUA 4A6YL 2GIYA 3ZTJH 1AHWA 5IEKB 4LLUB 5J11B 2Y4SA 5C6PB 2JCCB 1F02I 3RY6A 2Q3AA 2IQ9L 4MXQD 2CIIA 1II4E 4OV5A 1CZ8H 3WO4B 2YD3A 1OP3H 4LLYA 1S8DB 2VABB 2PF6A 1MRFH 1I1FA 2Z4QA 3QI9A 4P46C 3FO9B 1JRHI 4GRMB 3BDXA 3BO8B 1MHHA 2BP3A 4BKLA 4PJIE 4Y1AA 5EBWA 5IM7B 2D7MA 4ZMAT 4HKBB 3MLUH 2PW2B 1L0XA 2V5MA 3LKNA 3HZYA 5TDNB 5IESL 5IBUG 1OQXA 1WT5A 4LSVH 1MQKH 1XF4B 2HG5A 3LIZL 3MUJA 4XNQA 1F11A 4RIRA 4PUBH 3U1SL 3S4SG 4PJ5B 2FX7H 5TQ2H 2OBGA 3FCTB 3MRIB 3IDXH 3QQNA 4Z6AT 4K7PX 3D39A 4JPVH 1F3RB 1JGEA 4WHYG 2OLDA 4BJLA 3QDJD 5DEFA 1DVFC 3OAUH 4NP4H 1WSST 1CI5A 3IDGB 2WBJB 3SDYH 2OR7A 3SDAC 4KJYA 4HUKB 2R0KH 2W9LA 3ARRA 1TZIB 4YHKL 4NHUB 3FKUS 1FJ1B 3QO0A 5DJYB 5H8DA 3EJJX 3VFVA 5HYJD 3HZKA 1VPOH 2QQKH 4OD1L 1JE6A 4YH6A 5EO1B 1EHLH 5T5FH 1O7VA 1S7SB 3RA7H 1T7WA 5LGHH 1E4WH 1JGLH 3U9UB 1TFHA 1NC2B 1IGIL 4OKDA 1ZVHA 1U91B 1MRCH 3QEHB 3FO0L 3WD5L 1T21B 3QISA 2VL5A 4F9LC 4TSBL 4MJIE 1ZA6B 3CXDL 4F2MB 3CLFH 3O0RH 3G5XB 5CGYD 5GZND 1HINH 3VRLE 4J4PA 4ZFFA 3ZSTA 2J8UB 4DGVL 4LPVA 3IDYC 2ZUXA 3DRTB 4ZUWA 3KPSD 3IXAA 1NLBL 1KB9K 4PGCB 3GIVA 4X4YA 4MNGE 4JAMB 1YJDL 2P5WE 3SY0A 3THMH 3UBXA 5GGSB 3GMQB 5F71A 5CEXA 1HE7A 1SEQH 5I1AA 4XMKH 5E1HB 3QNXA 4X6CE 4MD4B 2ICCA 1G9EA 3W11C 3SGDI 3UC0H 5ADPH 4L29B 4WEBH 4R26H 3OR6A 5C9KA 3Q0HA 3FOMB 4L8SB 2R29L 2AAVA 3D0LA 4YC2C 2P24A 4ZXBB 4CMHB 3ZLQC 3VXQA 4MJ6B 1V7ML 4ZUUA 3V4VL 1T5XA 4HS6A 3OKMA 3IU4L 5GSVA 3REVA 5C3TA 4PP2B 3D2UA 3BAEL 2HH0L 5I18H 3G5VA 3RVUD 3SQOH 2R2EB 3VH8A 2NMSA 3PWUA 4XZUA 3L5JA 2AXHA 2CLZA 3RTQC 3CCHA 5ADOL 3NMEA 5L0QB 2A9MH 1GC1C 2BNRB 4PRHD 5B38G 4QXTB 1LDPH 1IGYB 1J1XL 1KCSH 3P77A 3MROA 1MF2L 4HT1H 1GGUA 3ROLA 5L2JA 4BQ8A 3WDIA 5BXFB 2P7TB 4H1LB 1JN6B 3Q6GH 5BO1H 4WO4D 2Y5EA 1BAFH 5GS1B 5DT1L 5FYJL 3OKLA 1T1XB 3REWB 2HKFL 5DK2B 5IUSA 3WNLA 4X98B 2VB5A 5ANME 4PJGA 3ARDB 1NGWB 4MHHI 5T1DH 5IBTH 4NJAL 4GMSH 2PYFA 4Y19E 4U05A 5HGAA 1FO0L 4HWEL 1H3TA 3BPNC 3P4OA 4W68A 2QTEA 4LKXB 2E6QA 1I9RL 3MSPA 5KVFH 5D7SL 3PWJA 4KI5C 5L2KA 1NBZA 3KPOA 2G9HA 4Z8FH 1U2HA 1T04B 3JWOL 2OI9C 4JG0H 2IEPA 1LEGA 4JFFB 4AEEA 3BH9B 5DZLA 3GSOB 5CEZD 3BQUC 1F58L 4Y88A 3VD3A 3I6GB 3GMOB 1FE8H 1A9BA 3HCVA 3BGMA 5C07D 43CAB 4HWBA 3T4AB 4K2UL 4OM0H 1ND0B 1CDHA 4MA7L 3HUJE 1ZHNA 1MAMH 4H88H 4I3RL 1AE6H 1AXSB 4QTIH 4Q74A 1OSZB 3SJVB 4FQ2H 4KDVA 3SKNB 4HUUA 3HZVB 4P3WA 4ZAKC 3H3PH 3DVFA 3U36B 5IT2L 5DQDL 1NGZA 4H5SA 2VDQL 3P4NB 5KSAD 5TE6L 1KFAH 5E4EC 5B3JE 5F72S 1CLCA 1RZKH 4YDJA 3MCKB 3HZMB 1KBGL 4ONFH 2BSSB 4GW4B 4Z7QE 4E0RA 3CMGA 2C1PB 3X17A 3VXMB 3DWTA 5D9SA 5TJWK 4UTBH 3GJFK 1MFNA 4I4WA 4RGMC 3GM0A 2JIXD 5E2TH 3I3DA 2Z91A 4LCUB 1PKQE 1BJ1H 3O9WD 4ODBD 4R4BA 2CR3A 2Z31C 4GKNA 2B1AL 1U3ZA 1YZZA 4M6AA 1WBYB 3H9ZA 3LQZA 1VGKA 5T1LD 2NLJA 4YHPB 4LSUH 3T1FA 4BYHA 5HI3D 2DD8L 2BOBB 2RFXA 3SGJA 1NFIA 3RWDB 1ZTXL 1EGJH 2V2XA 4KHXL 1CFQB 4I0PC 2I07A 2WP3T 3ZDZF 2HP4A 4WI3A 2HLFC 2ZUQB 1QLRA 4LQFH 1HHIB 3WDHA 5I71B 3KYNA 1FDLH 3KPTA 1EX0A 3UPRA 1ZWIA 3DTXB 5T33L 4Z7WE 4O51B 3I6LE 4U1HB 5TF0A 1K8IB 4U2YA 2PW1B 3TVMB 2VXTH 1GOGA 4PJAF 5HHOB 2AEPL 3AREC 3MUY1 4DWHA 5AZEH 4WRLA 3FT4B 3ZT6A 1Q0YL 1M7DB 5HDQL 3QDJA 1AY1L 4H1LH 2HFFB 1I4FA 4X6DF 3WE6B 4JB9H 3GB7B 5B4MD 4HLJA 4JFEB 3RWCB 1FFOB 5IHBA 2XY1A 2ICWA 3C5JB 3QPQD 3EO0B 1YC8A 3HMWH 4JKPL 4ZUTA 3K80A 2WIMA 3S37X 4QRQB 1VFMA 5D2NE 4LLWB 4Y16B 4PLJD 3FTGB 4XC3L 5HYJA 3UEZA 2AERT 3V7AG 3QUKB 4ZTOH 1VACA 5GGTH 3SCMC 5D93B 3VWJC 4X8JA 2ZG1A 3KPRD 5D7LE 2B20A 4IBLT 1D5XB 4N90D 4P5KB 3K7UA 5ETUB 3DSNA 4RX4D 2ZZUT 1NGYA 4LEOA 1YYML 1G84A 1FV1B 3TA3C 5HDOA 2XWJB 1BFTA 4POUB 1D9KD 3A6OA 2BRRL 3QG6B 5F7LB 5I66B 4RGOL 3KPSA 4HD9A 4XVTH 5FA3B 1WJ3A 4HIXL 2Z93A 5F9AC 2XFXB 3K8KA 4GG6A 2NY6C 3VG9C 4X5XB 1X5JA 3HE6B 1KIUA 3IKCB 2FJFA 1G6RL 4XP9L 1N5AA 4P99A 2J6EH 1A0QL 3MV7B 1HKLL 1SBSH 1DL7H 1RZJH 5IFHH 1QEWB 2CSPA 3D87B 4Z7UA 1FGVH 3G6DL 1VFAB 2ZP0T 3P0YL 4LLQA 4HFUL 4MXVE 3LD8B 4QRTA 4KQ3L 3WFDH 1KELH 1XR9B 2E7LA 5D1QA 1OARL 3N1QC 5EWIH 3VXRE 4TUJB 4EBQH 4Y2OA 1FZJA 2Z35A 5F96L 3IFNH 3KR3H 5A3IC 3KYKL 4JO2L 5A16A 4ALAL 1P69B 4FNLL 4QXUH 4I18C 3L5XL 4HAFA 1EHXA 4K94C 2IGFL 1DBAH 5C86A 5CWSA 1C16B 4LVNB 1IGML 4LRIA 3V0VA 3QHZH 5LGJB 1FL3B 1TITA 1CL7H 4PRHA 1KGCD 1RJLA 4CUCA 2FIKA 2IPKB 2CPCA 3P0GB 3FQTB 4GKZA 5JXED 3VRJA 5HHMB 4G6JH 3F7YB 1OM3H 1CLYL 2G2RB 2AJYL 4XXCC 3MXWL 4GAGL 3EOBB 1A6VL 3RUGE 3GSNL 1DQQB 1E6JH 2Y5TB 2C1OB 2ZOKA 4HWBL 4WO4A 1RZIA 5ALBH 2CMRH 4PRID 3GKWH 3FFCA 3OPZL 3MR9A 5DMGC 4X7SH 4WEUD 1AQKL 4NN5C 1G7IA 1WCBA 5I74C 2JB6A 4NRXB 3PDOA 4DKEH 1WBXA 4NHCL 5DVOA 2A83B 5IWLA 1U92A 3CDGA 3BPCB 2VXSL 4HCRA 1LO0H 2DLFH 2KUTA 3TCXA 3GJEA 3GUTA 5EUKA 1ZOXA 3ETBF 4RGNB 3MV8E 4XNUH 1I9EA 4EVNB 2AJVL 2B7DT 1K9TA 3T0BA 1T80A 3VFWB 5DZOA 2QQQA 4DN4H 1Z3GL 1T2QH 4X9GA 4YDIL 1INQB 4WV1B 2GSGB 4HEPG 3BD5A 1DLHB 3OB0K 2YXFA 3CK0L 4JFPA 1NCDH 1DQLL 1QPXA 2F74B 4PJEA 5E99L 4KQ4H 4BUGA 5BVJA 5C07A 1QSEE 3SGEI 4PJCA 2YPLB 4QXWA 4V1DD 3I75A 4JZJB 2R23B 5C2BH 1HWHB 3VXNB 1PG7L 3IGAB 4CVWA 4ODVL 4JREC 2X89D 3CH8A 5C08B 2IAMC 4OFIA 4LIQH 5KSBE 2EC9U 2DIBA 3O2DL 1X4XA 4H1LG 1ADQH 2AJSH 3O11A 4J3UA 5EU5B 3UDWC 1YQVL 4OJFL 3U0PB 3EFFA 5DQJA 3QRGL 5JHDB 2D0GA 5CZXC 1LK3H 1IC5H 3INUL 4X5WA 1K3IA 4MD0A 2CK2A 2FCBA 4NKMB 1XT5A 3VJ6B 5I1CL 4LU5L 2NW2B 4XCYB 1OP9A 3W81A 3ZE1F 4R7DA 4HJJH 4U49A 5KVEL 3BEVA 2JCCE 4YXKL 1NEZB 1ZT4A 4P59L 4E9LA 1P7QA 4WHCA 4OZIB 4PJGE 3MLWL 1CXKA 1UXSA 2JIXA 5F7MC 4OB5H 4F7PA 3ARGB 1N6UA 3BZFA 3FQNA 3FONA 2N56A 1J05A 5EOQH 1CIUA 3HMXL 4PG2A 4XNMA 2D7OA 1NGXB 1JL8A 1MI5D 3TBTB 5GGUB 4MNQA 3MNVB 4JFXA 4P4RA 3VFNB 3VGAB 2ERJB 3KPLA 3MCG1 3NCFB 2UY6A 1OAXH 1KEGH 4KDTC 1CG9A 3EOTL 2ZG2A 4Y19D 1B6DA 1CBVL 5DTFA 4WW2A 2WNGA 4FQ1H 1UJ3C 4ODTL 5DJDB 1H3XA 4S2SA 3RL1B 2XKUA 5J6HB 1JPST 2I9TB 3BZEA 2CLRA 1WZKA 2GT9A 3QCVL 3ULVH 4MXWH 5HGHB 3CJJA 1F6LL 1NFDF 3RBSA 1CGSL 3RGVD 1T1WB 4Z7VF 1CE1L 1FL5B 4ISVA 2VMFA 1KT2B 1EXUA 3QQ4B 5IROA 1UM6L 4YWGH 4HDIB 3NIDE 1S9VB 3ALXA 1T83C 4HBCL 5EDXA 2BSTA 3EYFB 1HHKB 5DLMH 1BJ1J 3V6FB 1A14L 4UBDC 4NQTA 2EYTA 2VR4A 3PV6B 5MENB 4U4BA 2APXA 4WFEE 5M7QA 4BQ9A 3IDJB 2CD0A 2GYSA 1DTUA 4WU5A 4ENEC 3HNVL 1L7IL 1J1PH 4UT7L 2R1XA 1LK2A 3BIKB 2F8XC 2P8MB 3X12A 3N1GC 1JHKL 2IJ0C 5JMRA 1G7QA 3DMMD 2ZJSL 3X3GH 4DKFH 2VKWA 5BZDB 3BT2H 3CDCA 4Q9QL 1LHZA 4PJ7B 5EFIA 4MSWA 1X5GA 2AXFB 3OKNB 3V8OA 5ABDE 2J8UE 4UU9B 1YEGL 3KPRA 1NCWH 2AV7B 3QUML 3PGCB 1OB1B 4JRYB 4LKCB 5AG9A 1AD9A 3QDME 1PLGH 5AYUH 1LO3H 1IGCL 2GJ6D 1Q9OA 3LKPA 4YDVB 4O2EA 3QQ3B 1M6OA 1D9KA 3FRUA 4HLZG 1OD7A 2QSCH 3RWIA 4YQXL 1U8JA 3QSKB 5GGVY 3ZL4H 4PGDA 1FPTH 1PX4A 5E8DL 1MCPH 3GRWA 1DQJA 1QBLH 1T66C 1ZAGA 3VI4E 5I30L 2IPUG 5DRNB 1P2CB 4R0LB 2J2ZA 1I8IB 3WJJA 4TUOA 3RNKB 1OT2A 1DUZA 2H2SD 5J1SC 4G43B 3PWVB 2H32A 2VDOL 1YN6A 4U1JA 3BYYA 1EFXB 4XGZB 4OZGF 4N0UE 5I1DB 3V4UL 5HGDA 5D7JC 1KG0B 1LO2L 1T1ZB 3DIFA 2X4RA 4X6EB 4L3CB 3IXTA 4QXGL 5I8OL 1MCEA 2BNQB 4HQQL 2AS5M 1YPZA 3T8XB 2DN7A 1J88A 4MHHG 3X14A 3C6LB 4UV4L 3EYVB 5C09D 4R7NB 2AK1H 4PJBB 1PVHA 2FYYB 1AD0A 2DM2A 3ARFD 3I50H 5I2IA 1U58B 4KZDH 3C60A 4CN4A 1YEIL 5B39A 1YNTB 1KLGB 4ONHA 1PY4A 5D5MF 1WTLA 5JXEA 3L9RA 4G6KH 5EOTB 5FA4B 1EAPA 2B5IB 5GIRB 4OLUL 5I1EL 4GUPA 2Y06L 4JDTH 5I1JH 5IEHB 3RKDC 5TPWH 4DN3L 1G9MC 4LSTH 4EI6B 1MLCB 1ZEAL 3K46A 4PRIA 5DJZA 2I5YL 5T3XD 4D9QE 4N8VA 4Y8DC 4EUPB 3WN5B 4ETQA 1FNSH 3O4OB 2A1WH 2NZ9D 1D5BB 3TBVB 1A4KB 2QL1A 4RFNB 5ALCH 5IFAL 5ERWA 4IJ3B 1FORH 4KROD 4JQXA 2GEEA 2XPGA 3VFMA 1A6UL 4R90L 1YECL 3GO1L 4Y5XC 4X7CC 5FAAA 2PETA 5DR5H 3I6KB 2DWDA 2E27H 3AY4C 3EO1B 3CC5A 1MHPL 4FS0A 3O6LH 1RJZB 3DRQA 2DMKA 3OKOA 4TN9A 1U95A 5FGSA 2Q7YB 4QHNB 3VMPA 4LVEA 3GNML 3GI8L 1BZ7A 1I1RA 1G1CA 3SJVE 5I73B 4V1DA 4GOSA 5TE4L 4HKXA 3HTLX 5IHUL 3L95B 3MLZH 2Q86B 2CJUH 1HSAA 4Z77A 5BW7C 3QT2A 4HAGA 2X89A 3GJFB 1A47A 1MCOH 3UO1L 1QG3A 1GL4B 2HWZH 3FMGH 2MCG1 4MGXA 2K7PA 1QRNB 4XNZC 2MQ3A 1KSRA 2DBLL 4NDMB 3OX8B 5DFWH 4G8GA 1WZLA 3LQAL 1T22A 1U8LB 2D0HA 3VXME 2FR4B 2FJGB 1HCVA 4GRWB 3TBWB 3TO4D 1PEZA 3ZKND 1CU4L 5JR1H 3C5ZD 1HHJA 3VFSA 3H9YA 4R97B 4HW6A 3B6SB 3WNKA 4M93C 3V4PL 4WW1B 4O02L 2QLVB 4P9HH 3WNPA 2CH8A 2VYRE 4R4ND 5F6HJ 3WHXB 2Y36H 1LP9B 2ID5A 3D85B 2HFEA 3SGEH 3T3ME 1T2JA 2YRZA 1SY6A 4OFYA 3GSWA 4U1GB 1N4XL 3JV4B 1A6AB 3MRGB 4WDIB 4YHIA 1RUMH 4BFIA 1RU9H 1MI5A 1E0OB 4RCAA 3LS4L 2COQA 3W2DH 4LSSL 3GMLB 5FCSH 4DK3A 4XXDA 3V6OE 1HEZA 2IFFH 2F5AH 1NCNA 4K3JH 4LL9A 3S96B 4QHMB 5J1TC 2FHCA 2V7NA 3NPSB 4NQCD 2VERN 5IG7A 4NZTH 4I3SH 5JDJA 5TFSL 4HS3B 1MNUH 1G9NC 5I19L 3S88H 1C8PA 5HHOE 1TVBA 3E3QE 1CD1A 2VZVA 1YEEH 4PRPB 1XR8A 1OF2A 1TCMA 1A6WH 1TXKA 1GGCL 1MELA 2J5LC 3CZFB 1CFSA 3N50A 5F9OL 3T2NH 3RGVA 4OZHA 4QO1A 1AFVL 3I02B 3NGBC 4D9LL 5A2JH 4MAYD 3WFCH 4MNHA 1HHGA 4AT6A 1NEZG 5D7IA 3GSRA 4CL7A 2X4SA 4G7YH 4XWOC 5D70L 2NY5H 4DZ8A 3CH1A 3S4SA 3V79C 2EZ0C 5F44A 4GW1A 3ZDXF 2BY0A 1JZ7A 1B4RA 1E4XH 1JNHB 4YHMH 4EUPH 1MWAB 4IRSD 2H41A 3GRWL 1OGAA 4A2MA 1I1AA 5ECJE 5TDOA 4TQEL 35C8L 2J3SA 4XHQA 1G7HB 4JFDD 5I1HL 4XCCH 3MBED 3S37H 4EDWH 4BH8B 4P2YA 1UM4L 2VZ3A 3DX9B 1ZHLA 1R6VA 5F7EL 5C1MB 4K3DH 3ROOB 4LRNH 3KPQA 2IQAB 5DUMH 3O45A 4NO2A 5E6IB 4DGYL 2N4IA 2CUIA 1N26A 4QCIA 5FYKH 4NRYB 2J88H 2DRUA 3C5SA 3WIHH 3ESVF 5B3NA 1JMXA 3A67H 2CDFB 4EN3C 4NYLA 3L7EA 5IF0A 4RISL 5JZ7C 4JKMA 3BGAA 2YPKB 1C1EH 3MGOA 5HVGB 3ZKQD 4ODXA 3D25A 4FQHA 3GJFH 3IRZA 1JF6A 5DK3A 5J06A 1B4JH 4XB7A 3C8KB 2B1HH 1ONQA 1R5VB 1FH5L 5JO5A 2NW3A 2BMKA 4PJ5D 3HAEB 5F88A 5D1XB 2FZ3B 2VXVH 3MRQB 1R5WB 4PRBB 1NMBL 4Y4FB 5GS0D 4LEXL 2CLVA 4YIQB 4GRWH 3DGGB 4PRNB 1BOGA 1U3HB 2OJEA 1GOFA 3PWLB 4Z0BH 3IAQA 3BGFB 3KAAA 3ULVE 4M00A 2WBJD 5C0IB 1TNMA 3U79A 3LH2L 5HPMB 2W0LA 2DWEA 3RWEA 5LAXA 5DMIL 5C09A 4LSRL 1G0DA 2KL6A 3F7QA 3LKOB 3ZE0E 3QUZB 4ZQKA 5BQ7B 2RJMA 2M8XA 2DF3A 3L3JB 4H20L 1I3RA 5K9OA 2ENYA 3IFPB 4Y2DC 2E6PA 4OD3H 5EZOH 3L3GB 5FB8B 3LN4A 4QRUA 5DJ6B 3WV0A 3ILQD 3O3BB 4LQ1A 1NC2D 3MRDA 5JOFB 4X0KB 3CUPA 1AGCB 4TULL 4K71C 3BVNB 2G60H 2EIEA 3TM6A 3EYSH 4RBPK 4ZSOB 1A1MA 4QRPB 3T0EA 1YDPA 1DEEA 1NCUA 5B38A 2HN7B 5I1GH 4QRSB 4IIQB 5KS9F 1IEBA 1JGUL 1NUFA 5I15L 3SE9L 3LKSA 8FABB 4NN6B 1I9JH 4MDIB 4B50A 4LOUD 4O5LH 3RWJB 1QVOB 3GSXA 3MBXL 3QNZA 4M6ML 1HI6A 1D5IH 3OJDA 3WFBL 1XGQB 1MCWM 3DX8B 2R69L 1UWXH 4F3FA 3QDGB 25C8H 3MLVL 1G6VK 3L1OL 2Y9RT 5C0RL 4YXHH 5ESVB 4U0QB 3CFKB 4YPGA 4ZXBD 2AGJL 3NIGE 1YPZE 3KJ4C 1JGVL 1MWAH 1P6AB 2DOCA 2VE6B 3F6LA 4LAQH 1UENA 2YUWA 3CDYA 4LCWB 5JHDE 2YZ1A 1CLZL 3R0MA 4X6BB 4BZYA 4P0DA 4M7LL 1XIWA 2DLIA 4NQDB 5T1KB 1Q72H 5IR1B 3MGTA 5ENWB 1Q38A 3ILPA 2MJWA 3MGAA 4G9FB 4UQ2A 5EA0H 3QWOB 4FRWA 4OF6A 3V52L 2VDMH 1U8IA 2BNRD 4OAWB 1TVHA 3NFSH 5CINL 4K23H 4HUXB 4YGVA 3SO3B 12E8L 5GISH 3DXAA 3TO4A 3TPKA 1ZVYA 5IB2A 2P8PA 3MLXH 1J87A 1NCBH 4MZ3A 2NQCA 5C0CE 1HHHB 2AEQH 2DQIH 4L3AA 3NA9H 3QA3A 5EO9A 1FLTX 5LXGL 2CDEB 5C70A 4KKBC 4PB9H 5B8CC 1QSFB 5CJOH 2Y6SC 5EUOB 1WIOA 1KJMB 4FG6C 2VDLH 3VFOA 4LSDA 5J9PB 2QR0B 1OAUL 1H0DB 1LE5A 3VXPB 3V0WL 3JTSA 1UCBH 2R0WL 3BW9B 4LARH 3RX5A 5FEBA 2PCPA 2HYMA 3S36X 3HAEH 5TE7L 1KYOK 3B8YA 2XN9B 4BZ1H 4LCCA 5IV2A 4F15C 1JTOA 3P30H 1M05B 1J5OL 1R3IH 4HMCA 2XZAH 1DVFD 5FUZL 3HC4H 4XCFH 2OK0H 4HH9A 4JFFD 2O5YL 3WL9B 3GHBH 5EORL 1HH9A 2DMCA 3FB5B 5F7KC 4HJGA 4NQCA 3AROA 2ZUWA 4RA0C 4PGZA 3DVGB 3VFUA 2GK0B 3PL6C 4NNPH 3BMWA 3OHXA 2JJTC 2PO6C 4NOBA 1DLFL 3LDBC 2WLYA 2ZOLA 4PY7B 5EBMB 1RFDL 4PJIF 4K8RH 1B0RB 4R3SB 2EYRA 3M45A 1FVEB 5IHLB 3UP1A 5DJ2B 5MENE 5FECA 5F9JB 4O00A 4KKCD 4JKWA 3SJVD 4KV5F 1PYWB 5D2LF 5DQ9A 4MAYA 3UTOA 4G7VH 5GRJH 3DX7A 5C92A 2V5RA 4WEMB 1BVLB 4NN7B 3MJ9A 5BMFH 2HT4D 1JJUA 1ITCA 3WUWB 4JM4H 5HXMA 3FN0H 3H9HA 2IC2A 4LPWA 1UQSA 5F89B 4HGWB 4OGXH 1MIEH 3QUYA 4PJ7E 3N9GH 1CT8B 1V3MA 3U6RB 3GBNH 3W9EB 1X5LA 5TDPB 3MQIA 1SJEB 3ECBB 4KRNA 4P46B 4IDLA 5DHYB 4NWTH 1I7TA 3MV9B 1BQHG 4JFDA 3ME0A 3MBEA 1F4XL 1FNGB 5ITBH 5JORB 5CP7B 4PLKD 1KJ3H 5DRZB 2VOTA 5DUPH 1XGYL 4KMQA 4WNQA 2IPTL 3KLHC 2EDDA 3EGSB 2XKNB 3K2UH 2PUQT 1SM3L 3WS6A 3KNBA 1JPGB 2GFBA 2XZCH 4U0RB 1S8DA 4NKQB 2VH5L 5K9JH 1T1YB 3S35L 4WTZA 1FGNH 5IJVB 4JG1L 5DD0L 1H5BB 3B8SA 1NL0H 4HFWB 3SPVB 1W0VB 1V8HA 3QIUA 3BKCH 4HKBA 4CRPA 2PW2A 3VRLF 4PJHA 3LEYL 2O5ZH 1ODAA 4R2GC 1OPGH 4H0HB 3LKQB 4LHJB 1AHWC 4EXPX 4ZFGL 1IC4H 3BDYH 4OLVL 4PJ5A 2BNQE 4QHUA 1LD9A 4OGAC 3FCTA 3DI2B 4JM2A 3PWPB 3TVMD 5HHOD 1T5WB 4Q9RL 2EEAA 4PJAB 2B2XL 4NIKB 5D7IE 1NSNH 1WWAX 3OF6D 2UZXB 3BPOC 5MERB 7FABL 4U2ZA 4ZNCD 3QI9C 4YDKL 5CMAB 2MPAH 2V5SA 2AI0H 2EKSB 1UACH 1YNLL 2WBJA 3MUGB 5FF6B 3TNNB 2B0SL 3I84A 4X6DB 4JFED 1BWMA 2PXYA 4KJPC 3W0WA 5HD8D 1A1NA 3GMPB 3G6JA 4HC1L 4FZ8H 4MS8D 4Y16D 2YD4A 1E28B 2OTWA 4KTDH 2VXQH 4PREB 4DTGH 4M61B 2C3HA 3FAXA 1S7SA 5E9DE 1AC0A 1CLOH 1XCTB 1WZ1H 1YC7A 2VLME 1RK1B 3LMJH 1CZ8L 3TIDB 5IB3A 2ZSWA 3GSQB 3BQUD 2A6JA 3VD9A 1MRFL 4NCDA 3QEHA 3BIAX 4MDJB 4Y4HC 1LQSR 5C0FB 3MOAH 1BBDH 3T4YA 2R4RH 3MLUL 3VMNA 2UUDK 3L7FB 5BV7L 3FRPG 4LSVL 1MQKL 3U7YH 4BQBA 4JAMA 4PUBL 1RAMA 1YN7B 1NAKH 5FYKE 3UXFA 4Z78A 5GGSA 3HE6D 2FX7L 5TQ2L 4P2OA 1CQKA 3IDXL 4ZAKD 1QSZA 3RZCA 4OQTH 3MV7D 4JPVL 3BKMH 3M07A 3B3IA 3UJTH 3MC0A 4MWFB 5IB5B 3OAUL 3AGVA 4L8CB 4ZD3H 3OAZK 4L8SA 4RZCB 1MFCH 3UBXI 3W9DB 3EAKA 3BP7B 4G9DA 4HGKC 2R0KL 4J4PC 5SWZE 3TYGH 3EJZD 1QRNE 1AGDB 1ZANH 3TYFA 2XY2A 3LPGA 4PP2A 4AEIH 1VPOL 2R2EA 1HILB 1EHLL 1GH7A 4L5FH 5T5FL 3ULVD 3RA7L 1FNFA 3HUJF 4L4VA 1EAJA 3MRKB 1KPUA 2BNRA 5LGHL 1N64L 1NMCC 1E4WL 1JGLL 5IK3A 3OGCA 2EXWC 4QXTA 1ZHBB 4J12A 5HHMD 1LP9E 5CJQH 1GGTA 1MRCL 4KVCH 1RJYB 1ZSDB 1A7NH 1FLRH 4OZ4B 3BPNB 1MCBA 3O0RL 2FO1A 1BD2A 4H1LA 4LF3B 1HINL 2XTJB 2X4QB 5KN5B 1OD9A 2RIKA 4W81A 5GS1A 5SV3A 5F8QC 2OI9B 1TQCC 3B9DA 3H3BC 4YUEH 1KTKE 2NY4D 5B3JF 3UTQB 2DLTA 5DK2A 4C4KO 1IL1B 1IILE 1T6VN 2VLLB 1LEKB 4L3EB 3THML 3HPLA 1DFBL 4Z7QF 5IW1B 4NO0B 4ELMB 3LEVH 1P7KB 4U6HA 5L88H 1SEQL 2CKNA 4X9BA 4XMKL 1EO8H 1IC1A 1TZGL 5HYFA 4JHZA 5GGTA 5IVXB 3E2HB 2LABA 4GMTH 4RGND 5ADPL 3UC0L 1IGIH 3KJ6H 3BI9X 4CJ0A 4DCQB 4WEBL 3WHE1 4M7JH 3MNWB 1AR2A 4QY8A 4R26L 1DVFA 2FDBP 5FO8A 3CPLB 4IM8A 3GSOA 4JFOB 2BNUB 1V05A 2VLRB 4FN0A 1KB5B 1U8OB 2IBZX 3PHSA 1NLBH 3CFBB 1J0YA 5MP6H 3RGHA 2YPLD 2VLKE 1U8NB 1YJDH 1EBAA 5I18L 5E4EB 1Q9WA 4NM8H 3TJEH 4UTAH 4KRPC 5C08D 1X9QA 2BDNH 2DIJA 2A9ML 3TPUB 2IANB 4PJ9B 1LDPL 2CDGB 3MPCA 3SKNA 1KCSL 2J6EA 3GFUA 4O2FA 5JHDD 3HZVA 4Z7WF 3VGFA 1VKXB 4XPBH 1CK0L 1J18A 5IVNA 2YRLA 1PBYA 4HT1L 5KZCB 2DQGH 2UYLA 4KKNA 5JIIA 2NXZB 3U0TA 2DMBA 5CAYB 1BAFL 4X9IA 5MEOB 4KI1A 5E1AB 3O4LA 1I9IH 3MCKA 3HZMA 3LN5B 4GW4A 4YFLF 4Y5VB 2CXGA 4UIMA 5T1DL 4LLAA 5IBTL 1QHPA 2VDNH 4GMSL 4AK1A 3EYUH 5DDHA 5K33A 3ARGD 3LSOB 3MXVH 4U6YB 4I0PB 2WINB 4YGAB 1JPFB 2HAZA 2P46B 3VWKB 5KVFL 1CTNA 5D71H 4Z8FL 4JG0L 4MMZC 1KN4H 3UTZB 2MTPA 1MF2H 4YHPA 3TBSB 3KPMA 4YXLH 2BOBA 5GRWA 1FE8L 1DQDH 1YMMB 2H3NB 3Q6FB 4S1DC 3JV6B 1W72A 1CFQA 4OM0L 2NR6D 4M43H 3G6AB 3HRZB 1FC2D 2VQ1B 1MAML 4XCEB 4H88L 4XVUD 1HHIA 1AE6L 4ZOEA 1AI1H 4XC1H 3RVXD 3T2OA 4QTIL 1IGTA 2V9RA 4XVJH 1I9RH 4FQ2L 4O51A 4CVZA 4M6OH 1NFDB 3X13A 1BGXH 2PW1A 4KWUA 3WNNA 4Z7VB 3H3PL 4MXQC 5CLTA 9CGTA 2F8VA 3WDJA 4JR9H 4HG4J 3UTSE 1KFAL 3OF6A 1M7DA 5GXBB 3SGJC 3SCMB 4HSQA 1F6AA 5MEND 1RZKL 2DB8A 2E8ZA 5I75B 4JFEA 3RWCA 4ONFL 4LHUB 4I9WE 4JFQB 3CX5J 2H9GA 3B9KB 4J1UA 4JY5H 3U4BH 1PZ5B 5I17A 2YSSA 3B2VL 4LLWA 4Y16A 5E2TL 2I9LA 5J4MA 1ZGLM 4HXBH 3TA3B 5E08H 1TIUA 4TSAH 2EDOA 4OGYH 1I1YA 3QUKA 1MCSA 1I8KA 3ESUF 1YEKH 2GQHA 4ZSOE 4QRPE 4UT6H 1NC4B 3JUYA 2N1KA 2ICWI 2P5EB 4I0KA 1NH6A 4P2RD 1F4HA 4JRYD 4LSUL 1JF1B 4UDUB 3BQUA 3R06A 1U8MB 5ETUA 4UAOB 3QEUA 5KTEH 1FFPA 3PF2A 3OKEA 1A5FL 1MHCB 1UFUA 4AENB 3WSQH 1KB5H 1HNGA 2XWJA 1EGJL 5IKCA 3DYOA 1FBIH 1T2XA 1MCDA 5C0GA 3ARQA 3HG1A 5FA3A 4LQFL 2EXYD 1L9NA 4PJHE 1FDLL 3NABH 2ED8A 4X5XA 3HE6A 4NZUH 4B53A 4ZAKA 2VXTL 3LKRB 1K2DA 1PEWA 4KKLD 5AZEL 1EFXD 1UA6H 4LCWE 4LLDB 4OZGB 1QEWA 5B22A 5HHQB 1VFAA 1U9KA 1A8JH 5EC1A 4NQDE 4IRJB 4JB9L 5GZNC 3GM8A 4TUJA 2C3VA 2VRAA 3HMWL 5FIEA 4P2QE 1HH6B 2HJFA 1DN0B 2FLRT 3G6JE 2VKXA 3C6LD 1ZT1B 1UYWH 5DD3H 3EKCA 1WCQA 2VIRA 3KG5A 4JDZB 4ORGB 5EO0B 2OSLB 5J6GA 3D69A 4D2NA 1WQVT 5SWSD 3S3PA 4ZTOL 5JW4M 1I7UB 1C16A 3SKUD 1FL6A 5GGTL 5ICXA 3MJ8B 2VN7A 1UJTA 5EN2B 2VWEE 4YHNA 3FT2B 1OP5K 2Q76B 2IPKA 1QSFE 4NC0B 5EUOE 5IVZB 4MA1C 3O81A 2VDKH 5FCUH 1NJ9B 3MA7B 3EOBA 5HYSG 4AEHH 1I7RA 3NCYP 4LCIH 5DJ0A 3W39B 4Y5YC 5LJYH 2C1OA 2XA8H 2BVPB 1BIHA 1QR4A 4CVXA 2V5YA 5DVMA 4JRXB 3IJSB 1BFOB 4FTVB 4D0DA 4NRXA 4Q6IB 5KJRH 4PJGF 2J6EL 5F9DC 3AREA 2HVJB 1ZE3C 4WI6A 4U1NB 4UINH 1RZJL 1ZT7B 2GUOB 4M6NH 5IFHL 3UJIH 2Q1EA 4I13B 5HYEA 5AUMA 1FGVL 2EIZB 3DHJA 4PP1D 3WFDL 1KELL 3RJQB 4L9DA 4QYOB 5EWIL 3VXTA 4WO4C 3MV11 5FYKD 2BVQB 1CXFA 4EBQL 2X44D 1CDUA 3ARWA 1VERA 4ENED 2F74A 3IFNL 3KR3L 4CW1A 4YFDB 2Z8WC 2V7HB 2YPLA 4Y4KD 5F3HB 4HK0B 1X4ZA 1A21A 1JIBA 5E2UH 4QXUL 3O2WH 1M71A 3VXNA 4D8PB 5DYOB 3IGAA 4F33A 4YX2L 1DBAL 3VXSE 4OIIL 2WLZA 1DANT 5C08A 3QHZL 5CD3A 3CSYA 4NKIH 2CR6A 5FGCE 1A0QH 4WGWB 3OKKA 1CL7L 4JFZH 4WI7A 5EU5A 1JHLH 1Q8MA 1QRND 4G6JL 5KVGH 1OM3L 1IGFH 3TEUA 2YD7A 4J8RA 2R4SH 4M8QA 4GLRI 1AJ7H 4LFHD 3LVEA 1N8ZB 2BCKB 4S1SH 5J56B 5JW4Q 1E6JL 3NIDF 4NKMA 3MV9E 5ALBL 2CMRL 3GKWL 4XCYA 4MYWB 4JHAH 1CR9H 4DVRH 4X7SL 4XAKE 1MFBH 1NEZA 2FIRT 1TCRB 4H25B 1X5AA 4DKEL 3D85D 4OZIA 1L0YA 3IETB 1MEXH 1ACZA 1LO0L 1SYVA 2HMID 4NKOB 3FB8B 4Z0XA 4JJHA 1NCTA 4JFHD 5IW6A 3U30B 1JVKA 2P48B 1ITBB 3WHE0 3VFNA 3F58H 5KSAC 3IFOB 5HDLA 4DN4L 4OBRA 1T2QL 2J8UF 3RBGA 1H9VA 2CIKA 4Z7NE 3PE9A 1JYNA 1UXWA 3DO3A 4AZ8A 4KQ4L 2XI9A 1FG2A 3QJHB 1D5ZB 1LO5B 4PD4K 3PWPE 3KXFB 3QEGH 5C2BL 4I18A 5EU4A 5BRZB 2X4PA 4PJAE 4JN2B 1UWGH 4PRPD 1NDMB 3O9WC 1GXEA 2ARJB 5GZOD 1Q9LB 1KN2H 1ADQL 2AJSL 3FFDA 5SX5H 4LLMA 5MEQA 3VI4F 5GGQH 3L6FB 5GGRB 1FL5A 3MO1B 4G8IB 4LNRB 3CX2A 1IC5L 1LK3L 1YEHH 4HDIA 2GTWB 5HI3C 1QR1A 2P49B 3SDXB 3DUHA 1HHKA 4PR5A 1KJ2A 5F1SA 5GHWH 4WW2C 2YRPA 3PV6A 1N2RB 1H3PH 4HJJL 3HA0A 3ARYA 4H8WH 3O4LE 3IDJA 4TNVF 1IZJA 3FB6A 1C08A 5HPOA 3BIKA 2P1YA 2D9CA 5ICYA 5IMOA 4OB5L 2P8MA 3CVHA 4JPIA 4W6YB 5C9JA 5KOMC 1I7ZB 1LWRA 1QP1A 4OJFH 5EOQL 2EDYA 1L7TH 1MRDH 4G80B 1MFEH 3JTTB 3MUZ1 4X99B 4P2RA 3VRIB 3DO7B 3ULSB 3L3HB 2Q6WB 4JRYA 2P47B 2F5BL 4LKCA 1UT9A 1LNUB 1OAXL 1KEGL 4XP4H 1QFOA 2X1WL 2IH1B 2DI8A 3H8NA 1XF3B 5BOPA 5B4MC 4HZLB 4FQ1L 2FRGP 1PY9A 4YDVA 3QPQC 3QQ3A 1HXMA 3IDNA 3RWFB 4LDLB 3OG4B 1RD6A 3QEQB 3S7GA 2X4OB 4PLJC 4OLZL 3WEXB 4YE4H 2DKSA 5E8OA 2IAMA 2FJHB 2UWEE 3ULVL 3HE7B 4QOKB 5DRNA 2JF1A 1CD8A 1F5WA 3EO9H 1N6QL 4PV9B 3RNKA 4XP5H 5D1XD 3P9MA 4NNYA 4MA3B 1B6UA 4CN1A 4YWGL 1TPXC 3FO2B 4LHUG 1S9XB 3EYQD 4Y4FD 2W65B 4PJFE 2W0KA 4R9HA 5DLML 2O93L 2Y1VA 3O6MH 4OM1H 3OJMB 3QIWB 4K7PL 1EEZA 1J11A 5MEPA 2DTSA 5HVHB 1D9KC 4L3CA 5F9WC 1QO3B 2OQJA 5EU3B 1OAZH 3T8XA 4OZFG 3EYOB 1J1PL 5AD0A 1A1OA 2HVKA 3T04D 1MJJA 5F6IC 3E0GA 3B4NA 4PJBA 5SWSA 2FYYA 3X3GL 4L4TE 4DKFL 4K8RD 3BT2L 1F90H 3WJJC 3V5DB 2EDHA 3C09B 4PYHA 1A3QA 4PJXE 1NLDL 3NCJH 3L3DB 2XG5A 3O3UN 4KI5E 4M7ZB 1NCWL 1QQDB 5L6YH 1BFVH 2GSIA 1OP3K 1KLGA 3Q5TA 4A2LA 1PLGL 5FA4A 2OR8A 5AYUL 1LO3L 4L3EE 5IEHA 3I3EA 1U8PB 1UJ3A 1B2WH 4ELME 5GSRA 1SMOA 2QSCL 1MLCA 5IVXE 1FPTL 4Z18A 4OKVA 4JEGB 5KS9B 1MCPL 1QLFA 4GRLB 1QBLL 3QG7H 3QJFA 1XGUB 2HTLD 5E0QA 5DHXB 3TBVA 1P9MA 4OF8A 1ZGLP 2YWZA 2E7MA 3VMOA 1YEGH 5EU6B 4NNXA 3Q3GB 1UZ6F 5JXEC 1A6ZB 1VFOA 1T83A 3GK8H 3QIBB 3PXJA 2YBRA 5A40E 1JHTB 4PGBA 2PYEB 3QQ9D 1Z5LA 4XWOD 2YK1H 3QDGD 4L8DA 3EO1A 3UTTB 3OXSA 4I5BB 2EZ0D 3HKFA 1RJZA 5DFTA 4XNZB 2Q7YA 1E6OH 2IANE 1TETH 4AIZA 5H2BB 3KWWB 5IB4B 3D5OF 4Y4KA 1KLUA 3NN8A 1HSBB 3BP5B 1PQZB 2AK1L 1P4LA 1V3JA 4P57A 2VTFA 2QSQA 2ZUSA 1DBBH 3NZ8B 4NQDD 3GJFA 4NQXB 5T1KD 1KPRB 5KG9A 4JQXC 4M93B 3I50L 2IMNA 4XNYH 1A9EA 4G9FD 2A0LD 4KZDL 1EO5A 1XF5B 3MJ7A 1ZGLB 3GMMB 4OCWH 5FYLD 1MVUB 3ZE1E 2R0LH 1IRAY 4G6KL 5JOEA 5FOBA 4WFFE 1RZ7H 3OAYK 1MHEB 4HXAL 4JDTL 5I1JL 2FJGA 3VXOB 2NZIA 2YC1B 2XT1B 5TPWL 2C7UB 2PTVA 3B6SA 4LSQH 3PHQB 4FZEH 4U3XA 4WW1A 1G7JB 1QSFD 2WP3O 1FNSL 1B3JA 4DQOH 2A1WL 4ZPVB 1ZLWH 4JPWH 5ALCL 3WHXA 5KSUB 4NZJA 3DJ9A 3D9AH 1FORL 3DUUB 1AP2A 1WC7B 1A6AA 5E94B 2B39A 3DV6B 3MRGA 2ZCLH 2XN9D 1YMME 1U8QB 5D7JA 1EEYA 1FZMB 1IM3B 5DR5L 1MY7A 2E27L 4JZNB 1SHMA 4FQCL 3ZO0A 1K4CA 1ZS8B 4M1CD 4BH7B 3O6LL 1KPVB 2FECL 1BQHA 1DQML 2H2PD 1BZQK 5DK0B 5TGBB 5I1LA 5F7YC 4HS3A 1A2YB 1IM9A 2ADIA 3MLZL 5CBAB 2CJUL 3WCYA 5HGGS 4ZO8A 1MCOL 2CKBB 1NKOA 4PRPA 4WWKD 1G9MH 5HHPB 3G04B 2YN5A 4PJIB 5GRUH 2HWZL 2V2WB 3FMGL 3OBAA 1RUPL 1A6TA 3QWQB 1WTGT 3D6GA 1FG9C 4HJ0D 5D2LB 3JUZA 4QTHB 5JR1L 2APTA 5LVEA 1G7PA 5BJTB 1PGRB 4G8EB 5LBSH 4XI5D 4P9HL 1IAKA 1ZHKB 5FKPA 2GJJA 1JNHA 2HLAA 4C54A 1S7VB 5HDBE 2Y36L 5ISZE 3RAJL 2LTQB 3IDMB 1VEOA 4RQQB 3PABA 3LOWA 1CVSC 2GTZA 3H42H 3S8WA 3TZVD 3RGVC 1N3NA 2DQTL 3MV9D 4Y5XA 1RUML 1RU9L 3W2DL 3LQAH 4F8TA 1FNAA 3AY4A 5HYIA 3MREB 2IFFL 2F5AL 2ICEB 1K8DA 4K3JL 1AO7E 1D7FA 1BX2B 5IIEA 3RU8H 4PLNC 4I3SL 4OGZA 1S7XB 1CFVH 1MUJA 4YHYC 1MNUL 2NX5A 3S88L 3C6SB 4PJDA 1AXTH 3L5HA 5ESQA 5C0AD 2DICA 3O8XB 4MJIB 3RI5F 1YEEL 4R4FH 4OZGE 1A6WL 3DMMC 5SWQA 5DJCA 3FO1B 3C8KA 1T3FB 2XIDA 5C0BE 3T2NL 5DXWA 1O5DT 4YK4C 3FB7B 5D1XA 2BX5A 3MRQA 3WFCL 1R5WA 3PWPD 4NFDA 2P5WB 4HPYH 3FRPA 4Y4FA 3MFFB 2DDQH 1UH2A 4C57C 4WHTA 1QRKA 4G7YL 3DGGA 4ODUA 3RP1A 2X7LB 3DGCR 3S5LG 3NFNA 4KFZC 1S5HB 3IKKA 1E4XL 3HC0A 5C0IA 4YHML 1C7TA 1FZOB 2YUZA 4FG6D 3C2AH 1JNLH 5HPMA 4NBYB 1VHPA 4GBXB 2Z92B 4RA3A 1GGCH 3QZWB 4U1IB 5T5NF 3NIGF 1YPZF 4MQXD 1BVKB 4XX1E 5ACZA 2CO6B 4JO1L 3SEPA 3D0VB 4XCCL 2F54B 3S37L 3CVIH 5BQ7A 4EDWL 4WI4A 2H2SC 2Q20A 5C0ND 4JVWA 1HKFA 4L9LB 3IFPA 1MLBB 4K3DL 5CLWA 4GW5B 4LRNL 1IT9H 5DUML 1RZ8B 2DM3A 1UB5B 4FQXB 3QUXB 5DJ6A 1OAQH 4IS6B 4NPYB 3UTPE 5DUBA 3MUHL 4HIEB 1K3ZA 1ORSA 2J88L 5FYKL 2EH7H 2JB5H 4X0KA 3WIHL 4L8BB 1WLHA 3A67L 3BVNA 5BS0B 2W38A 2MHAB 3K4ZA 4XPHH 2C26A 1C1EL 1GYAA 5D6CA 4TNVK 5JOPD 1WAAE 3WNOA 2CKBH 4J7RA 8FABA 4HH8A 1B4JL 3ARFC 2B1HL 2LFGA 3KLDA 1CQYA 4KK8D 3C87A 2Z9TA 4FQLH 2YEZB 2VXVL 5FO7B 5FM5O 3VFGH 3H7BB 3AM8A 4YO0B 2I24N 4B41A 3CZJA 4BSWB 4LSPH 4FFYH 3TT3H 4C83B 1BJ8A 4PRDA 3VXUB 5JPNB 5D2NC 3A0OA 4QGTA 1QKZH 4KXZI 4HIHA 3QDGA 3ZKXC 1B0GA 3F12A 1VADA 1JBJA 3WLWD 2E9IA 5CJBA 4H0GA 1Y0LB 4OSUH 3P4LA 3NFPB 2BC4A 2DJ4A 3CFKA 3K2MC 1Q0XH 5JUEH 1O7SA 2VE6A 2DQFA 4MJ5A 3TN0C 3RVWC 3ZE2F 2NZ9C 4KH2A 3VDAA 2W9EH 1FH5H 3QXWA 3G9AB 1PG7X 1N7MH 5DRXA 5IR1A 5ENWA 2VL4A 1JWUB 2YD2A 3EOAB 2AXGB 1QA9B 5B8CB 3QWOA 5C0EB 1TTGA 3STLB 5E24E 4OD3L 5EZOL 3HUJB 4LEXH 1QSVA 3V0AC 4OAWA 5L7XH 3HI6H 3EIFA 1H3WM 1X6NA 2G5RA 1WFTA 3EFDH 4HUXA 3O6FB 4HZAA 4BK4A 4LPUA 2G60L 1J0IA 4XH2A 3EYSL 4BSVB 3QFDB 1XF2A 3DX6B 2HRPH 5KAQG 4JGMA 2XTJD 5I1GL 5CEYB 4ODSH 3BUYB 5FV1L 3ARBB 4LSRH 3HPJA 1I9JL 2QR0A 2MKWA 1QFHA 3AAZB 1PD6A 4O5LL 5HBBA 3BW9A 4H20H 4NO0D 4JFYB 1D5IL 3BRGC 1I8MA 3BZ4B 4JCLA 2PO6B 5CKAA 4GT7A 2XN9A 1OP5H 1K4DB 3CFJA 4QWWD 1PKQB 25C8L 3MJ6A 1IGJA 3TO4C 5BRZE 3ZKNC 3C5ZC 4YXHL 5DRWB 2WM0A 3SDCB 4FFWD 4P4KD 3WJLC 2YD9A 2VLRD 1MWAL 1FFNB 3IS0X 4LAQL 4R4NC 3T0XA 2YD8A 3QFJE 4PV8A 1A6PA 3BXNB 5JXAH 3T08A 4MAUH 3A6BH 4PY7A 1Q72L 4LMQE 4WWKA 3F7RA 3BP6B 3SDXE 4QHLB 4A6YA 4K9EH 4AQOA 5HYQA 3ZYJA 5ICZB 4LCCC 2VDML 5DJ2A 5F9JA 4AL8H 2UV3A 4PJ9D 2QJDA 3NFSL 4JO4H 4K23L 3L1OH 5EZJA 4OQTA 4XBPA 5GISL 4Z7WB 4X4ME 4HKJB 3FOLB 4NGHL 3B83A 4X9HA 4Y4HD 5KZCD 1NCBL 3TO2A 2HJKB 2NXZD 1I85C 2AGJH 3NA9L 4Q0XH 5ID1A 5H37G 1SYSB 1AIFB 5D7IF 2N7BA 4PB9L 5CJOL 1A7QH 4EDXB 3JWDH 1CLZH 2VDLL 2FSEA 3DOSA 1YEDA 3CFCH 1S7UB 1OL0A 2EDJA 1N0XH 3OKDB 4XHJD 3K8LA 4DVBB 5TDPA 1UCBL 2KBGA 2Q8BH 4LARL 4GXUM 1SJEA 1CFTB 4PJ8B 3MZTA 3TZVA 1TQBB 1YY8A 3F5WB 4JZOB 5IFJB 1IQDB 1T4KB 3HLAB 4H26B 1BIIA 4BZ1L 1BBJB 3QPXH 3LHPH 4ONGH 4ZTPH 5DGRA 5CP7A 3P30L 4MAYC 3VWKD 4AM0A 5KSVB 1R3IL 3VE0A 4XMPL 2XZAL 5FDWA 3EGSA 4GXVH 4XCFL 3RDTB 2OK0L 5JIKA 2XKNA 4X7FC 2KDGA 4WUUB 2ILLA 1JUFB 1VFUA 3GHBL 1R3KA 4WIQA 4ERSH 1AHWB 4PTTA 3ZT5A 1JPGA 3QH3A 4U1SA 1QHOA 5CSZB 5D7LB 3OQ3B 5EG6C 2WQ8A 3IT8D 4K7FA 5E5MA 4NNPL 5TQ0H 1CGYA 1B0WA 2CIIB 4IRSC 4OV5B 1H5BA 1OAUH 4HFWA 3SPVA 2MSPA 1HDMB 3NCEB 4LLYB 4KGLA 5C0AA 5GRVL 2AK4E 4YBLB 1J8KA 1I1FB 4YBHA 4K8RL 4D3CH 2Z4QB 3WMSA 5CP3H 5A43C 4BKLB 3ZHKA 3MBEC 5EBWB 3H6JA 1KXVC 2VLJA 5J11C 5DO2D 1SJXA 2NY3D 2X1PA 2HG5B 2R1YA 4G7VL 4R8WH 5GRJL 1Q9KA 1F11B 3N1FC 4RIRB 4HPOH 1JTTA 1T5WA 5BMFL 2K3TA 2Z8SA 3WS6C 3WO4C 4JM4L 3FN0L 5E6ZA 4OGXL 1MIEL 4F57L 4KAQH 4HIJA 3N9GL 5CS7A 3D39B 3H0TA 2EKSA 3TNNA 3ULUF 4X6DA 1J0HA 2R0ZH 2VO5A 4LHUD 5BV7B 3GBNL 5DEFB 3GMPA 4CU7A 3B9KD 3ARVA 3VXRB 1CVRA 4OCLC 2QADB 4NWTL 4KMLB 2EEDA 5ITBL 3O3EB 1KJ3L 2F58H 1NC4D 3QO0B 3VFVB 3UZVB 2P5ED 1JV5B 5HJ3B 4TVPH 3HZKB 3K2UL 3PGDA 2EO9A 4UT9L 2YKLL 5CHNB 3TIDA 2XZCL 3GSQA 3LEXA 2J4WH 1FVDA 5K9JL 3L3IB 2WBJC 1FGNL 3PL6A 2MKLC 3CIQA 4LGRB 4HV8A 2JJTA 5C0FA 3EOYG 1NL0L 2NX5E 3BKCL 5EU6E 2NNAA 3MLTB 2A77H 2VL5B 4NC2B 2PYEE 3ET9F 2O5ZL 3BH8A 1AGFB 1OPGL 5HYSA 3UTTE 1X5FA 1IC4L 3BDYL 4YAQA 5D8JH 4ZUWB 1W0YT 2VNCA 3IXAB 1CXIA 3U82B 3GIVB 4JN1H 1PX3A 1MJ7L 3ILQC 3SY0B 1SM3H 1T89A 2B4CC 1NSNL 3O3DA 5D96B 3OV6A 4M1GH 3BP4A 3QZWG 3CMOH 4MWFA 5HVWA 3MRHA 2MPAL 5I1AB 2AI0L 4EIGB