3WJJA

Crystal structure of iib selective fc variant, fc(p238d), in complex with fcgriib
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
212
structure length
212
Chain Sequence
ELLGGDSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Engineered antibody Fc variant with selectively enhanced Fc gamma RIIb binding over both Fc gamma RIIaR131 and Fc gamma RIIaH131.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 36
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjjA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjjA01
3FTGB 4RGOH 2R8SH 1F8TH 3VDBA 4PJCB 4ZTPH 5FB8B 5DUMH 3WS6C 1JF5A 4F7CA 1BZQK 4AEHH 4OZFB 5E2WH 4IRJA 4NYLA 5EDXA 4LQFH 3SKNB 3MRLB 1UB5A 4OB5H 1EHNA 1CS6A 1HH9A 4F7PA 5DRXB 2FBJL 4OZIB 2Y25A 2AW2A 2XOTA 2LFGA 3T1FA 1NBVL 2X1OA 1MJ8L 2PTTB 1BFTA 3GJEA 4K71B 4EQ2A 1NAMA 4I0PA 4UB0H 4BJLA 4NQSB 3ME0A 4PJ9A 1FC1A 4G6JH 5J13B 3B2VH 1A6ZB 2VXVL 1HH6B 1F2XK 4AIZB 4OTXL 4KJWD 4UDTA 2HT4C 5MHSE 5FOJA 2OTUB 1I9EA 1XFPA 1YN6B 1KXVC 4ZUVB 4JRXD 1ZSDA 1YYLL 1ZHKB 3ARRA 5GZOD 4TTDC 2VZOA 3QXAA 5JLZA 3N1QC 1URLA 2W0FB 1YQVL 3IETB 1S5IH 1DUZB 2JTDA 1AGCB 1MLBB 4APQD 3EJZD 4LLYB 2F8VA 2P7TB 4UDUB 4TSBH 5SWZA 4R90H 4R97B 3TYGL 4X7SH 3UTSD 1M6OB 1HXMA 1NDGB 3NCFB 4XP4H 3UEZA 1YDPA 1IAKA 2B0SH 3EOAB 4HUWA 1J05B 1CICB 1OB1B 1JGUH 5F7EL 1DEEB 3MNWA 4HLZH 4U6HA 1TZHA 1GVIA 5AZEL 1L0XA 4GRWF 4FXGA 3QEHB 4LIQH 5F1NA 2XG5A 2BSSB 2R4RL 3QPQD 4I77L 1R5IB 5IMLB 25C8H 3B3IB 4YHLH 5AZEH 1FZMA 3AREC 5HGHB 3G6AA 4Y5VB 2DKSA 5GRZA 3E6FB 4QRUB 1F3JB 1EHLL 1ZAGA 3I75B 1NMBL 3Q3GB 3B8SA 4NQSA 3SJVB 4U1MB 1CDYA 1X5AA 1S9XA 5B21A 4PRPE 4R90L 4WI2A 1I8LC 4I2XE 4ONGH 5GGVY 4M62L 1E6OH 3GM0A 2R4SH 3KWWB 3EGSB 5DRXA 1X7QB 3ZO0A 3E3QE 4KGJA 3TBYA 3TA3C 1XGRA 1DL7H 2A0LD 2YUXA 3T0VA 3RGVA 4FABH 4FQ2H 1X5LA 2GQHA 3G08A 4ISVB 1QEWB 4HWZA 2J1KA 2CH8A 4LPVA 1KFAH 4IOIB 1BVKA 4JGJA 5DC0A 4JFDE 4UQ3A 1KT2B 3S5LB 4Q9QH 4LKCB 3HZKB 4GKZB 4QRTB 3NVQA 3RQ3A 8FABA 4ZODA 3ARED 2YS4A 4HHAA 3QUMA 3BSZL 3CSPA 3VXMB 4NN5C 1JUFB 5KVMC 3LRGA 2XZQH 4JFQA 3MRPA 3V5HA 2JIXB 3MGTB 1WZ1H 1ULVA 1C5CH 4PV8A 1L6XA 3MRDB 5INCB 4AG4H 4Y4HA 2JF1A 5L2KA 1KPRA 5ISZA 3AY4C 4FN0A 4Y5VA 4WI9A 1FZOB 5D7LB 2X6MA 3UTSB 4RQQB 4GH7B 3HAEA 5DUML 2C4FT 4RGOL 2R8SL 5EU7E 1YEEH 4M5YH 5K9OA 3QUYA 4OQTA 4KUZL 3ULUF 1II4E 5D7SH 1T5WB 7FABL 5MI0B 4HDIB 4CVXA 4YHKH 1HK6A 1VFOA 5GGTL 3T4YB 4MQSB 1I3GH 1IRAY 5FYLL 3ULVL 4NC2B 3E2HB 5J56B 3O9WB 2CUMA 3DX7B 3CFCL 2Q76B 3F7QA 4HKXA 1OM3H 4P4RB 4Z7VB 3ZDYE 4U1IA 5DC4B 1WBXB 1UWGL 1J8HD 2VL5A 2YPLB 3DV4B 2Y07L 4G6AD 3TJHD 4PJIA 1IT9H 1QRND 3RIAK 4NC1E 4AT6A 4QYOA 4O02L 4XC1L 5CLTA 5D1XA 2ZPKH 4MX7B 4UTAL 4GKSB 1RFDL 5TDOA 1WIOA 1BFVL 4R4BB 4MA8H 1IGCH 5IB4A 5D2NC 4U6XA 1VCAA 3DYMA 1N5YH 4I18B 1XR8A 4KGLA 4QOKA 3HI1A 4YXKH 4P46D 2F53D 3ULUD 4ELKB 4WHDA 4WV1C 1AD9A 5DQJA 2P24B 3E0GA 1RZFH 5CBAA 3TPUA 1GC1C 4AENB 4YFEA 4NKMB 4NZRL 3QFJD 5K59F 1M7DA 4PJHF 3MRCA 3WHXA 5C9KA 3VWKB 1D9KA 3QHZH 4J1UA 1CFBA 1SY6A 4LCUA 3RWHB 3BZFB 1JPGB 3SQOH 1RY7B 3OMZA 3OB8A 4OF7A 5IB1B 2BOCA 3LRSA 1IM9D 1KENH 4G6AC 4C4KO 1BF2A 1TETL 2CKBB 1T83A 3O6FB 1T0MB 2AV7A 4XH2B 5H35B 2BNQD 4M8QA 4BQBA 4M6NH 1X5FA 3ARBD 2X41A 3WD5L 3KG5A 5C2BL 1JNNL 1SM3L 4YAQA 3LEYH 1YY8A 4XAWH 3BIKA 1P7HL 4OM0H 1BIIB 1F4XL 2BVQB 3AM8C 1JHTB 2UWEA 4IHOA 1D5BA 1LO4H 4X4YA 3PP4H 1W2KT 3AC0A 3ZYZA 1EGJH 1Q0XL 1WWWX 3QDJB 3REVB 3HI1B 4PG9B 4OLVL 3FRUA 1BGXH 2LU7A 1A6UL 2IF7A 4O2CA 4UT6H 1T1XB 3KJ6H 2B1AL 2R1YB 3ZE1F 2KZ1B 1F4WH 5GGRA 1GH7A 1NKRA 5CJ8A 5HHME 5E1HB 3MV01 1TJIL 4HKZA 4JHAH 1HNFA 2IH1A 3MREA 3U2SB 5DI8B 3VFGH 4N9GB 1RVFL 2EE9A 3WIIH 3OJ2C 2XKNB 3UYRL 3QISA 4JPKL 3H9SA 1UWEH 4JKPH 2PW2B 1ZT4A 5LAXB 5I15L 1TVDA 4IDJH 4NN5B 3C5ZB 4NQDD 2IALB 1T03H 1OTSD 1X5XA 3VD5A 2X05A 4HW6A 1IC7L 4EOWL 4E41E 5DMIH 5JOFB 1JYVA 2NW3A 1BJ8A 1E4WH 2R1XA 2VZVA 2PYEA 1DLHA 4YBQC 2FX8H 3RVWD 4QEGA 5C0GA 2WBJC 3IVKB 1DQJB 3G04A 4CMHB 4X7CC 2Z93A 4L4JA 3L9RB 5B38G 3LVEA 4M61B 2DJ4A 4HUXA 5TFSH 1ZLSL 3O81A 2HJLB 4CVUA 4OIBA 5JXAH 5C07B 4A2MA 5D9SB 1IZJA 5L9DL 3O45A 4PTUB 4PJ9D 3Q6FB 4KRLB 5EUOA 3FRPA 3R1GH 4M5ZL 3ALPA 1JI1A 3IDJB 1FO0A 1NMCB 2F74A 1H0DB 4GSDL 4N68A 2NY1D 3JUZA 4KKBC 1RIUL 4LOUD 4QWWC 4FQLL 4QF1B 1OTSC 2BFVH 1KLUA 3GNMH 4QRPE 3VFVB 2DI8A 5J6HA 1JHKH 2H2SD 1BWMA 4KROD 3F6LA 5M7QA 2NY7L 4NYLB 5HYQB 3P0YL 2NW2A 3EYVA 4YBQD 5JXAL 3H3BC 1M7XA 1RIVL 3NACL 2ED8A 2FATH 3WUZA 1I7ZA 3PXHA 4LSQH 3E1F1 5DJ2B 4D2NA 5C0RL 5F1IA 4H25B 4IRSD 1OTTC 3MLXH 5HHVH 5E4EB 1N7ML 1NLBH 3BXNA 1QLRB 3GBML 5DHVB 1C5BH 5SWZE 4TUJB 4WUUB 2X7LA 3VDAA 1ZANL 1FVEB 4MZ3A 4P46A 5KVGH 4OKVA 1YEDA 2F8XC 3LPGA 1QNZL 4PJ5D 4EQ3A 3VWKC 1BBJA 2GUOB 2NY1C 2WIMA 4KY1H 5HJ3A 3NCJH 3OJDA 4HXBL 3EFFB 2D0GA 4HKBA 4LVNC 3VWJB 3BKCL 4I3SH 3BHBB 2BNRB 4Z5RB 1ACYH 2CJUH 4KROC 5TF1H 2HKFL 5DJYA 4XB7A 4D3CH 3FQNA 3WN5A 3RDTD 5F3HB 5ISZD 4P9ML 4PTTB 4NFBA 3QSKB 4G8GD 3AROA 4JEGB 3FOLA 1WTLA 4OCSH 2HTLD 1CU4L 3PJSB 5FO9A 3O4LA 4N1EA 3MCLL 3TO4B 1EBAA 3LS4L 1SY6L 4H26A 4U6TA 2OP4H 1PQZB 4M7ZC 1GZPB 4OLYL 1WBZB 4G5ZL 1WIUA 2B4CC 5L8KB 4G43A 1T22B 3ARUA 4NQDA 2QQQA 4Y19A 1SM3H 3VXPB 3S88H 3WFHB 3BGMA 5FUCC 1E6JH 1UM6H 3X3FH 4KFZC 1A4KA 2P5WD 4U6YB 1U8PB 2F53E 3ULUE 1NGZB 4QRPD 4KHTH 5GRJL 2JE8A 4Z6AT 1W0YT 3OG4B 4LSUH 1MY5A 4Y5XC 5CIPA 2YKLH 1JK8B 2P42B 2Z91B 4ODWA 2JIXD 4RGND 5IG7A 3HUJA 5IB3B 3RVVC 1Q9LA 4LGSB 5EORL 1KENL 4KVNH 3I50L 3PL6D 3OKEA 2VXUH 2NXYB 3ARFD 2W0FA 3TT1L 2Y6SD 5I8EA 5EWIL 4DQOH 2YK1L 1T21B 3BP6A 2FHFA 3TCLB 4G9DA 5J1AB 3GK8H 3MRHB 1FNEA 4V1DD 1KCRL 4HLZG 3RKPA 3EYSL 4XPTH 2IGFL 2X7LB 2MJWA 4HS3B 5MEQA 3GJFK 4NRXB 1P9MA 1FFPA 1HEZB 3DRTB 1CXLA 2R23B 3EDFA 3QI9A 1ZLVK 4PRNB 1JUFA 5DK2A 1KN2L 3C60D 3P11H 4WWKB 5ALCL 3VXMD 5HI5C 1R5WA 1RK0A 2X1XR 5E8EB 1UFUA 2HAZA 4P5KB 4PGZA 1D6EB 2IQAB 1CD0A 2GJ6A 4HX1A 4LGRB 5EU4B 1QSFA 4FQ1H 1CBVL 3ESUF 3TWCH 3DSFL 1GGUA 3X3GH 2XQYG 4KRNA 2Y6SC 1BFOB 2I07A 1C8PA 3TA3B 4N5ED 4HS8H 5DK0A 3PV6A 1JK8A 2LU3A 1JGEA 5IVXA 3RBSA 3I9GL 1Z0MA 3ZDYF 1UH4A 5JMRA 4U7MA 3BP7B 3WFHA 2EDJA 2BVOB 5EUKA 3TNMA 4O5LL 1JWMB 5DXWA 1MCLA 1WLHA 4ZNCD 1N0XL 1TNMA 4ZFOB 1SMAA 1TCRA 1RJLA 3DHMA 5FCUL 3H7BB 1E27A 4RNRA 3KPSA 1AP2B 1VEPA 1YJDL 4P9HL 2KKQA 4LPCA 2V2TB 5IW6B 4TQEH 5L0QC 2VH5L 3H8NA 4YUEH 2XTJB 2F54A 5KVFL 3ET9F 2ENYA 2ADJA 5CSBA 1CIDA 3P77B 2VISA 1CXEA 1TJHH 1JWUB 2OJEB 1EUTA 3D18B 4Z76A 3HRPA 3KYOA 3WO4B 4HK0B 1J86A 1YYMH 3D85A 1LO3L 4I0PC 4NOFA 2NNAA 4K7PY 4LCWE 4XC3H 1IJ9A 4RZCA 4L8DA 4XP5H 3VXOA 1J10A 1MJ7H 4FFZH 4ZFZA 2X4SB 3WS3B 2V2XB 2PYED 3D9AL 4PJEF 2HT2C 1B88A 2WP3O 2P5EE 1OHQA 4MAYB 5AWNH 4ORZC 5DJAB 4MD5B 4G7VL 1MI5E 4JB9H 4ODSL 4XBGB 4JPWL 4NUJA 1YN7A 1CGUA 1GIGL 3WL9B 2E8YA 1OCWL 3T4AB 4I48B 1D9KB 3OZ9H 1KEGH 3RVXD 3O3BB 2Y7QB 2JCCE 1X5ZA 3ARGC 1HHGA 2XTLA 4XP5L 4ZD3H 4Y4HC 3QG6B 4FMKA 4L4VE 4WV1B 2R56L 3I75A 2BVEA 5F21B 4HPYL 4Y2DA 3P77A 5F88A 1BF8A 1TLKA 3HE7A 3QQNA 5EOCL 4P0DA 1TJHL 4KRMB 4H8WH 2DLTA 2P24A 5T5NF 1C16B 3QDGA 4HFWA 3KWWA 2A6IA 1DQDL 3S96B 2Y9RT 1EAJA 4GW5B 3UBXG 1FRGH 3FB7B 4U3HA 3CVHB 5FO7A 1JL8A 3AMKA 4DN3H 5IW1B 1RSFA 4I2XB 4OLZL 1F3DJ 3ES6A 1U8LB 1AO7B 3QCTL 1G6RH 4FQXB 3JWOC 5EH1A 1RJZA 1OAUH 4JDVA 1F11A 2O5ZL 3D1MC 3UPRB 4LLUB 1CE6A 3HS0B 5J12B 2BMKB 5JOFA 2IAMD 1RUML 4NQUA 3QAZB 4G6ML 4JFFD 4QO1A 5I9QB 3VRJA 2AJUL 1N6QL 4G3YH 4GRWE 4XNYH 5HYSA 3ZL4L 5EUOF 3P73A 5MP6H 3V4UL 4Z0BH 1T3FB 3H3PH 3HA0A 3JVGA 5C0IB 1U3YA 3EFDH 2A74B 4YE4H 5JW3H 4G8GB 4B5EA 3BIKB 3V6OA 5HHMB 3S4SB 1KJ2H 3E2HC 4RFEA 1G9ML 1MI5D 2RQ8A 2C3XA 4UT7H 4XNUL 4ZFOL 3RZCA 5C7XH 3P0VH 3VA2C 3TC9A 5IB2A 4XCCL 3RI5K 1L9MA 3O0RL 4Z0XA 4AEHL 1DQTA 3HPLA 1IQDB 5CINH 2WBJB 2PTVA 1MFEL 4X9FA 3IS0X 5DD0L 1CE1H 5F96H 4UINL 1A6TA 1MFDH 5J6GB 3WO4C 2YZ8A 5EBLA 3X12A 4XX1E 5T1LA 4J3OC 5HGAB 3IFPB 1G7HA 3RNQB 1QRNA 2KUTA 3ARGA 5JNYB 1IAMA 3PWJA 1K9TA 4ODXA 1OSZA 4OZHA 2P44B 4MVBC 2Z31D 5FKAA 3MSPA 1KN4H 5BS0E 2XWTB 4V2BA 5DHYB 1HINL 4HZLA 2YK1H 4FFZL 4NQXB 5KN5A 1Q9WA 4NZUH 4XGZB 1ZA6A 4XC3L 3V8CA 3DNKA 3VXUD 5MENA 2O93L 1U8OA 4BFBD 1MIEH 4RMTA 4LSPL 1BJ1H 4IRJD 2E7MA 1MELA 3QO0B 2C4XA 1IKNA 3P73B 1EFQA 2Z93B 4LSUL 1IKFH 3BIAX 4LP5A 5LKNA 3DMMA 3VXSB 3K81A 4XMKH 3S4SA 2AXFB 5EZJB 3W2DL 2A9MH 4CVZB 3ZYIA 5E2UL 2ZG3A 4DOHB 1CE6B 3UPCA 5I1GL 3RZCB 3HLAA 3LHPL 3TVMA 1S8DB 3I6GB 1ZHLA 4RX4D 4ZO7A 1PW3A 3VXRB 5AG8A 5DDHB 3WDHA 4NGHH 3QRFM 2I27N 4HC1L 3PWUA 2XICA 3S4SG 1MPAH 4JZJB 1OB1A 4F9PA 3CSGA 3C5JA 3MLUH 1OGAB 5E2JA 1NFDE 4JM4L 3QIBA 3QEHA 4R0LC 2ZOKA 3QFJB 1RPQA 4OIIH 2YMXH 4Y8DC 3UZEA 3BVNA 5IMLA 3VXRE 1WC7B 1KTLA 2FWOB 4QTIH 3FONB 3MLZL 1X5JA 3HUJF 1BQUA 4U1GC 5FGSA 1Z0NA 1JNLL 5IF0B 3PGFL 3N85L 4YFLI 5HYJA 1CBVH 3MV7D 5AUMA 3QUZC 1U2HA 4QTHA 4PJ5E 1TVHA 2DDQL 4Z78A 3QWRD 3O4LB 4AQOA 1XIWA 3FQUA 4AZ8A 1YPZE 4BH7B 4HIXL 3GMNB 3R8BB 3QFDB 3HMXH 1AKJA 5JW5A 2DQEH 4LCYA 4GBXC 4QGYA 3ULSB 3OKKA 3K46A 1HSBB 5C0FA 3OJDB 3OAYK 4Q6IA 3QNYB 4JFEB 2H9GB 2DQFA 3VWJA 1T7XA 5DGQA 1CD9B 3INUH 4WO4C 1BD2B 1OAYL 4JDTH 4IOIA 4WW2C 1YNTB 2J2ZA 2DD8H 4CJ1A 1S78D 3OKLB 1BOYA 2BC4A 2IGFH 2NY7H 1CFVL 3RKDC 2OBGA 5KSUA 5CIPB 1HDMB 4EN3C 1IARB 2H32B 2FIRT 2YA0A 3BYYA 1JWSA 4DK6A 4ZAKA 1Q9LB 2DN7A 4JGMA 4P48A 1ES0A 2X4NA 4FQLH 3VE0A 5ALBH 2VLRA 3QZWA 1F58L 3P4LA 4JKWA 2K7PA 1NJ9B 3VI4E 2RFXA 3O11A 1RUPL 1NDMA 4U7SA 3IFNL 4XCNA 2VWEC 5IF0A 4MJ5B 5FIEA 4UT9H 4ENED 2A9NH 5TQ0L 1X5YA 4YDJA 5C07A 1LO0H 2Q6WB 3VFUB 1OAKH 2J6EA 3V4PH 3CXDH 2V5RA 1MIMH 4JLRB 3BDXA 3N0PB 5IG7B 2WIIB 5CEXB 1JV5B 2YD6A 4QRQB 4RAHA 2Y5TA 2BSTB 2VC2L 3OKEB 1TZGL 3UXFA 3VXUE 1G1CA 4B7LA 3MRNB 2EKJA 3QI9C 1H0DA 3VRIA 1YDPB 1NBYB 4NKDA 3EHBD 1PDKA 3RWEB 3C5SA 1G9EA 3FZUD 1FG2B 5I15H 3VG0L 2HRLA 1KB5B 3G5YA 1MEXL 2YUWA 1BBDL 4EDXB 1MCSA 5BZWB 1RJLB 4UOW0 1U91A 2RHEA 3K74B 4N8PA 2JCCF 4RRPG 5CCKL 2CRIA 2VXTH 4JHAL 3HMWH 5EU6B 1NFDA 2NTFA 1OARL 4AEFA 3E6FA 4QRUA 5J3HD 2AABL 4X9GA 2Q20A 2R39A 2WWKT 1QOKA 3MGOA 4H25A 3BPNC 2LVEA 1QNZH 3ZKSD 4HWBL 4OZGF 5ISZE 3U9PL 3AAZA 3UTTA 1WGOA 1V3JA 4GRLB 1LILA 5DQ9A 4PJBB 5JORA 2QR0A 4OQ1A 2KDGA 3FB5B 4WU5B 4X6DF 2APBA 3DGGB 4BQCA 3BAEL 1QSFB 2J88L 2GAZA 3HC0A 2R2HB 5E94B 3O3UN 4AQ1B 4WFFD 4F33A 1KCLA 4I9WD 3VE0B 2XFXA 3S7GA 4MNGB 3WIHL 4N8CL 3V2AR 1VHPA 1QTYT 2X4UB 3Q0HA 4TVPL 2W60A 1SJHB 1FVDA 2O5XL 4KUCD 2X40A 3VXTA 2PXYC 3RZCC 5DR5L 3BEVA 5KSAA 4QRTA 3ZE0F 3VXNA 4F9PC 4YHZL 1JVKA 5GS0C 3PXJA 4P2QE 2AJZB 1I8KA 3GSNL 2H3NB 1NSNH 3SQOL 2A6JA 4MNGE 3SGJC 1L0YA 2HN7A 4XPBH 3I3EA 4JQIH 5L2KB 2F54B 4P2OD 4KJWC 5ERWA 4DAGL 1YEFL 2NY5H 4LASL 4MD5A 2DQTL 3LQAL 2CUIA 2VDMH 3QA3A 3IFLL 3IJYA 2EE6A 3AAZB 5EULV 5ETUB 4L1HA 3UTTB 5HHQB 4F7TA 3L1OH 1RZKC 5SWSB 1BVKB 3JV4B 1G0XA 5DJDA 3DGGA 3P4MB 1J1XH 4RFOL 4C54A 4L4TB 4JFFA 5E94A 3VMPA 5A16B 2YBRA 1S7VA 1J0ZA 2GJZA 4WUKL 2IH1B 3MREB 3U2SA 2PXYD 2MSPA 2H32H 4JFZH 4YHNA 2Y07H 4IIQA 5EBWB 4JRXB 4PB0H 4Z7VA 1B0RA 5CD5C 4I4WB 3D48R 5KSAD 1AGEA 4N5UA 4QHLA 2YD4A 1HI6B 3RHWK 4JN1H 3WV0A 3QG7L 1GXEA 1OP5H 3O3DB 5D5MA 2ZP0T 3RY4A 2GAZB 3HC0B 4QXTB 5FGRA 4NHCH 4GXVL 4MSWA 4P4KC 4XZUB 3FJTA 2ICEB 3FB7A 1YMHA 3SGEH 4F58H 4R7NB 4Y4FA 5BVJB 1JFQL 4ZO9A 5BOPA 2EEDA 1GZQB 1A6UH 5E2TL 2E27L 4J7RA 4UZGA 3ULUL 1UZ6F 2DQJL 1F4YL 2KZWA 2ATKB 2VSDA 2LABA 5D7SL 1CWVA 4O2FB 3VG0H 2IQAA 5J1TC 2R9HD 5HHMD 1AC6A 3S9DB 3MFFB 1FFNB 4XAWL 3F5WB 4Y4KD 3S35X 3V6FA 4HIIA 2V5YA 2C7UA 5KSBE 3CLEH 4HG4K 4O58H 2AJZA 4AG4L 1YUHA 5JIHA 3T3MF 1KIQB 4OZHF 3SKNA 1NCWL 5F72S 2XZQL 1XGQA 3FAXA 2ADFL 4YR6B 5C07D 3V4PL 2XWBB 3AS0A 3L1OL 5F89B 5LWYH 1VGEH 5F7KC 1DVFC 2QHRH 3SJVE 1A2YB 2BJMH 3IAQA 1OTUD 3JTSA 3GI8L 2A2QT 2C3WA 3TO2B 5HGAA 3BKYL 5DEFA 3GSUA 4QHMB 2R0ZL 4PG2C 4A6YA 1YEIL 1LO2L 2FDBP 2ESVA 1KFAL 3MRBA 1VFBB 4LEOB 2K1MA 5DJZB 2GFBA 4PY8J 4M48L 4YHOH 4LCWD 3DLQR 2WBJA 5IMOA 3WNMA 4ZPTA 1LDPH 3O6ML 4POZC 5EU3A 1QQDA 2AJYH 3EJYC 4P4KB 4NQCB 2R9HC 1BAFH 1W72H 1ZMYA 2Y06L 3EO9H 1Q72H 5DR5H 2XPGA 5T1LB 4CNIB 3PQYB 3S35H 4F7MA 3BKML 4GAJH 3PNWA 5KOMC 5SV4A 1BVLA 5ILTH 3G6DL 3EYOA 5C0EA 1WICA 4PJIF 2XRAH 5FKAB 1LK3H 1DBJL 2VXSL 1V3LA 4PJGA 4LKCA 3QAZC 3U46A 4BSVA 1N5AA 1RFDH 5BV7C 1BZ7B 5IESL 2DIAA 3PDOA 4O02H 2N56A 4KQ3H 4XC1H 1BQLL 4P2CG 3K8MA 5T5FH 1J9CT 3R0MA 4JQXC 3BMWA 4X4ME 1CXHA 4U1NA 3NZ8B 5DJ0A 4I77H 1H3UA 3NAAH 3PHQA 4L4VD 5BS0B 1HCFX 2Y23A 4KI5F 2YWYA 4M6AA 4KJPD 5ENWB 2H26A 3CK0L 4ZUUB 1UKQA 2C26A 4CADB 2IH3B 3RL2B 3TJHC 1EX0A 3GI9H 4K3JL 4N8VA 3PGFH 1ZWIB 5GS3A 5CEYA 5JR1L 4X7SL 1GZPA 4PY7B 2ZUWA 2PYEB 4CKVX 1AXIB 3NABH 3WFEH 2P45B 1UCTA 1XF2B 3VI4F 1VKXB 1Z9SA 3T4YA 1QFWL 4M1CD 4P46C 2WUCL 4Q0XH 4DZBB 4PJFB 4GQ9L 4XPAH 5J1SC 3V52L 4J3WA 4BA8A 3GSOA 5GGVL 3CH1A 5IHZA 3O9WA 1B4JH 1KNOB 3WEXA 5DA4A 2XKNA 4JO3L 3T0EA 1TZGH 32C2B 1HH9B 4F7PB 5FA3B 3VGEA 1PG7L 4JO4H 1WZ1L 4P23A 3OG6B 5I1CL 3T77A 1GOFA 1W0VA 4HC1H 5FK9B 2WBWB 3QH3A 4S1DC 5F6HI 1SEQH 2LE9A 1I3RA 3BP5A 2ZSVA 3ESVF 2EEAA 4Y16B 4QNPE 4MAUL 3ECBB 4PJ9B 4AEIH 4JANB 5E00B 3SE8H 4UNUA 4XTRC 5I2IA 3MUHL 4P5TD 5I18L 1FC2D 4JRYA 3KPLB 4P2RE 2C3VB 5C0CE 3WLBB 2ZUUA 1YNKL 3MRDA 4OF3A 5SX5K 5AYUL 5C0AA 4CW1B 4TVSa 4M1CC 4EXPX 2VLKA 1R5WB 4NZUL 1U92B 5I73C 4RIRA 2X89D 15C8L 4RMSA 3TO4C 2V5SA 2XI9A 3OKOB 4FS0A 4ZYKB 1D5MA 1BD2A 5ECJE 4XXCA 3TLRA 2C1PA 1NL0H 1I85C 4LCUB 4WWKC 3RWGA 2B39A 2BSRA 4JFEE 4K94H 2ZZUT 3L5JA 2NX5A 3S98A 1I8MB 1B2WH 1E28A 5CZXC 3SGDI 1WBYB 4S1DD 3WUWG 1EHLH 4GRWH 2F58H 1NGWB 4BH7A 1MVUA 1CL7H 5TDNB 5EO0B 2H41A 2YPLD 2PW1A 4KZEH 2OQJB 1ONQB 1X5GA 5FK9A 5JPNB 4XXCC 3OR7A 3SDYH 4PJXB 3MPCA 2CKBH 1K4CB 3SJVA 1BZ9B 3PP3H 3WJJC 1ZT1A 1JNLH 5JOPD 3IU4L 3VFOA 2DYPA 2JB5H 1FBIL 5I16B 3IT8D 1KJVA 2A83B 4HFUL 4GBXB 4O00A 5J13C 4H26B 3WNNA 2WBJD 5EU6A 4WWKD 4G3YL 1S5IL 5F9WC 1MCBA 3WS6A 3B9EA 2BVPB 1KCVL 1U8QA 3SDXE 1JN6B 1IGIH 3LSOA 3UTPE 4L3EA 2AK4D 3GKWH 4KK6C 3BE1H 5J11C 2RJMA 3NGBC 3KPNB 5FKPB 1OAUL 1NDMB 3EZ8A 4ZDHA 5IWLA 5JHDA 1TIUA 3EAKA 1G6RL 1T1YB 1AO7D 3MOBH 4BKLB 4UTBH 2CGRL 3UYOD 4PGBA 4YPGA 3B83A 5D2LF 2GT9B 4NDMB 4I0PB 5DDHA 1T1ZA 4HWUA 2CR3A 4TSCL 1A7QH 3CMOL 4LQFL 4WI6A 3SEPA 4E41B 5MEQB 5T3ZE 1INDL 4PR5A 5I8OH 5KTEL 4JJ5A 4GRMA 2H1PL 1RZ8B 4X7TB 4K7FA 1T1WB 4L3AA 1T2QL 4WWKA 5I1AA 3EYUH 4TNVK 2DI7A 4XVUD 2Q1EA 3MLVL 1J5OL 5IQ9B 3KPRE 1J11A 1OLLA 4LBEB 5KANI 3HFML 43C9A 4AMKL 2EYRB 4OCXL 3O2WH 1D5ZA 3FFCB 4Z7WA 1J12A 3GMOB 2PYFA 4KJYA 4S11A 1T21A 5EOQL 4JPWH 3CDCA 2EKSA 2HLFC 2UV3A 3ZKMD 4WFEE 2CXKA 4YX2H 4CMHC 3KPNA 3F58L 4F15B 1AE6L 3KYKH 2ED7A 2FNBA 2KQNA 3G5ZB 4EVNA 4NRXA 1SYSB 5LQBL 4RAVB 4XCCH 3VFPA 2ZOLA 2R1WB 2VDPH 4PGBB 3A6BH 2G5BA 3MRIA 4IS6B 4R4FH 2EC9T 4Q6IB 2JELL 1AO7A 1SHMA 5EUKB 2MWCA 1CLCA 4QOKB 4C58B 2OJZH 2PKDA 3WFDH 3ZT6A 2YC1A 4WGVB 4HK3N 4OZ4B 2D7TL 4ZDHB 1QFWI 1MJJB 2AAVA 1CF8H 4Z0BL 1ITCA 1NGPH 4LSTH 3QNZB 2AJUH 3BN9C 3RAJH 5HVFB 4LFHG 5GGQH 1M71A 3C2SA 3FN0H 1J1PL 1OPGH 3SO5A 3F7RA 3SGKC 1A6WL 1DUZA 2ADJB 5I76B 2O5ZH 2A74A 4M03A 4UDUA 2MQ0A 4CN1A 3V95A 5F7WC 3HR6A 1N0XH 2RFXB 3IGAA 2FB4H 5D2NE 4N0RA 4ZQKB 4XNQA 4N0YH 5I66A 8CGTA 4RGNC 2IQ9L 3CFDB 5DJXB 4FQXC 2I5YL 3TBVB 5F3BA 4JO1L 1JCKA 1VSCA 4DK3A 5TQ2H 3HNSH 3B9KD 1KIRA 5T3ZH 1MH5A 5I71C 5DMGD 4Y5XB 5D7KD 3OHXA 4W68A 2APFA 5AEAA 1IGJA 5FGCE 1F6LL 4PJ5A 1Q9OA 1NMAL 5FYJE 2LTQC 1CT8A 5B39A 5F9OH 4ZD3L 5JDSA 4OZHB 5E5RB 4DW2H 1HE7A 3LKNB 5EZIL 1KT2A 3IDGB 2GY5A 3H2WA 1GRWA 4HK3J 1NCAH 2YA2A 5TE4L 1SEBB 2NLJA 5FECB 4PJGF 3I2CL 4ODWB 2FJFB 5HD8C 3AUVA 4NNPL 4P49A 3IDYC 2DYPD 3SDDC 4L8DB 1HHHA 3EO0B 3K8KA 4ZSOB 3MR9B 3ARQA 4QHKI 4U1HA 4P2RD 5BVJA 5HBBA 1HN1A 5I8EB 1WSST 4LRNH 3B5TA 3QUZB 5E8NB 2P8LB 4FQXD 3QDJD 4QT5B 3BDBA 3QEQD 3MCG1 4UOW1 5I75C 4WU5A 3EYSH 4NN7B 5FUOH 4EI5B 4ZQKA 3C6SA 1D6VH 3LB6C 2XNAB 1HILB 5F71A 2HFGL 1I7UB 5GS2H 2LAGB 3ARBB 3F65A 4N0FA 1DLHB 3PJSA 4PPTA 2Q7YB 1VADA 3GO1L 3RTQC 2VN4A 4ODUA 4HWEH 5ICYB 1JPTL 5I76A 5T3XH 3MXVL 3CDFA 3HMXA 1ZS8B 1UYWH 3O9WD 1JGVH 3QB7C 4MNQB 1MWAB 1T5XB 4XT1C 4LMQI 1Z3GL 1LP9A 2P5WB 4YXLH 3SGKA 2HT3D 2R2BA 5E8OB 1FQ9C 3MRMB 4XNMB 1V8HA 4LVNB 4U1JB 4UBDC 1FLRL 3QIWB 5E1AB 5F3BB 2B5IB 3GHBL 3IXTA 1C16A 2Y1VA 1DQQA 1G7PA 4LRIA 3LS4H 3PWLB 1QR1A 1QRNE 1YZZA 1XR9A 5HGDA 3KPQA 3DX9B 3MFGB 3CVHA 4A6YL 3LB6D 2FR4A 2G75A 2CKNA 4LLVB 3IJYB 3NIDF 1UXWA 4Z7WE 4X7EC 4P9MH 4XBEL 1JWMA 1LE9B 1T6VN 3HG1B 4D3CL 3RTQD 2VABA 2HKFH 2CJUL 3CFEB 3D39D 1ITBB 4MXQC 5FM5M 2J4WH 4LNRA 1HOCA 2W9DL 1AKJD 3GBNL 4Y4FD 3BW9A 1IGTA 3P40A 3VH8B 4FA8A 1OSPL 4N0FB 5H8DA 4PJ8D 1IC4L 3MUZ1 4IRZH 4ETYA 5J6GA 3LKQB 3MCKB 2CRYA 3UTTD 3L6FB 5DVOA 3RTQB 1FFOA 1DDHB 1N59B 5CS7A 4P2QD 3NTCH 5C09E 4E5XB 4PJFE 2VR9A 4UILH 4O2CB 5DLML 2EXWD 5JHDE 5IM7B 3FQXB 1KN2H 4NQDE 4FTVD 1OLZA 2VLKB 1A1NA 2ARJB 1U93A 4AJ0A 1A3RL 4G7YL 5IFHH 2IPKB 2BZDA 4M7LH 2A73A 4TULH 1A1MB 2CO6B 2J4WL 4KMLB 2VDLL 5BW7A 4NBZB 2H6PB 4U1GB 3WLBA 4DVBA 2R29L 1KCRH 2ITDA 5IB1A 1Y6MR 1QHPA 1Y6NR 2X4TB 4MAYA 3CH1B 2R2EB 5ESQB 4Y4FC 4ZS6C 1P6AB 3V4VL 5E5UB 32C2A 2NW3B 3T3PF 3U0TB 3HB3C 3ILQC 1LEKA 2QKIA 3OKYA 3MRNA 3B5GA 3X11B 3QRGL 3LKOB 4P3WA 3WSQL 3OXSA 1XR9B 4J4PC 5FHBH 2OR9L 4X6CA 3MNZA 2UYLB 2FR4B 4N9GA 1ZTXL 4EDXA 3SDCB 2OR9H 2QQKH 3QZWG 2PW2A 2C4FU 3GSWB 2OJEA 3VMNA 4OLYH 2E9BA 2DIBA 3OJVC 2R1YA 1QBML 5F44A 2LTQB 3MRQB 5FA4A 3RY5A 1RJYA 2ERJC 2VZUA 3HCVB 1QYGH 1HH6A 3MRGA 4IMLB 4JPKH 3WKMH 2A83A 4OF6A 5C6PB 1A02N 1NGQL 1ZT4B 5LAXA 2X4TA 5ITBL 1MCOH 4PJGB 5BRZB 1G6VK 4HXBH 1TQBC 2FL5B 4X98A 2V9QA 3CIQA 5CSGA 4TTGA 2QKIB 4BSWA 2IPKA 5IIEB 4P5KA 2VDKH 3HI5H 3BXNB 4PRHB 1LP9E 4OLVH 1B6UA 1NGXB 4OLXL 1B4RA 4MCYB 4YHPA 4JY6B 1HHGB 2VZ1A 5HHPA 3ARWA 1PYWB 4ELMF 12E8H 1ROWA 2GCYA 1N3NA 2CIIB 1F4XH 3LCYA 5CEZL 1W8NA 1BBJB 3MLXL 4M7JL 4KV5E 4G9FA 3LEYL 5KW9H 3X14A 4X4XB 1BOGA 4MJ6B 1QKZL 1HQ4B 4GG8B 5I1JL 4IRJC 1YEJL 4XNZC 1R3HB 4LLQB 1ODAA 2JCCA 3BPOC 1I7ZB 3CLFL 2HA1A 4E41A 1Q94B 1U8IB 3QA3B 5GJSL 2EC8A 4MS8D 1I4FB 2BFVL 3MRKB 3EDEA 2DBLL 1FL6A 3IRZA 1R3JB 2DWEA 4R4BA 5K9QG 4OD3L 2AJSH 4NO0A 1FE8H 3BUTA 4Z7OE 2NW2B 4BZ2L 1TITA 4TUOB 4WFGE 1F11B 3FN9A 3TBYB 3WJLA 3F8UB 3SKUD 4NRZB 3MOQA 1D5XB 1A5FH 2B20A 5DQJB 1UA6L 3ZDXF 2JKXA 2FL5A 1ZHNA 4G43B 5IOPA 3QEGH 1VGKA 4PRIB 3NOIA 4LCWA 2R69L 4HWNA 4QLRA 3WHXB 2VISB 1JYNA 4YEFA 3TCXA 2FD6L 3G5YB 4F9LA 3FQNB 3WN5B 4HH8A 2J6EL 3G5ZA 2OTWB 3LV3B 1BM3H 4G8GA 2NY1B 4HKJB 4X6EA 5KAQF 4C4KT 4MA8L 4L29B 1T04A 6CGTA 5HVWA 4UTAH 5J9PA 2CLRA 4MXWH 1S8DA 3I6GA 4KK8C 3CSYB 3MLSH 4JO2L 4FG6C 2BDNH 3VGGA 4IDJL 1MCWW 4CU7A 1D6VL 2BNRA 1BPVA 4GMTH 4OZ4A 3QUXB 3PG2A 4YAQB 5A2IH 2YXMA 3CVHL 5D71L 4B50A 1NBZA 5CP7B 1TJIH 4LRNL 4PG2A 3RP1A 4J12A 3RWIA 1ERNA 1IZKA 1CI5A 5BJTA 5FYLH 1WV7T 3QDJA 1P53A 1KB5L 3GHEH 6FABH 3I02B 1OW0C 3MLVH 1J5OH 3JXAA 2FO4A 2X4PB 1EBPA 2NY6C 1CG9A 5CZKA 1T2QH 4OKDA 5HHXL 2P49B 4PJ5B 3PP4L 5L6YH 1JHLH 1LO4L 2NY2B 3M07A 3U7WL 3QBTB 3BEVB 3ARYA 4Y2DB 4YQXL 2IBBA 1AHWA 4HMCA 4F7CB 1RUAH 4LEOA 2WUBH 4U1SB 1UB6A 1Y0LA 3KXFB 2HH0L 5EBMA 3HZMB 2G9HA 3C2AL 1DZBA 1UB5B 3LQAC 3AREA 4ZUVA 2Z91A 3WXVL 4L3ED 4WHYH 4DFHA 4KK9C 4Q6IC 3OHXB 1YECH 4ZSOA 3U7YH 3ULSA 3ARSA 5CGTA 2P43B 2R0KH 1MOEA 2ESVD 3IDUA 1DN0A 2E7BA 4PY8I 4P5TA 3W9DB 3MRHA 5DWUL 1KJ3L 1ACZA 2CLZB 4PRBB 5ANMA 2J8UA 1NC2B 4FMFA 2PO6C 5DSCA 3OKLA 1REIA 1TTFA 4JAMB 2XA8L 5CILL 3TPUB 1RURL 1Q8MA 1JPST 1W72B 4TSAL 2HJLA 1IE5A 4ZAKB 3QI9D 3UJJL 3BZDA 2VE6A 5AD0A 1SQ2N 5I6XB 3ZTNL 3EHBC 1KIRB 3R06B 3WKNA 3BVNB 2VDRH 1E4KC 4JHBA 1NGPL 4ONHA 3MV9B 1CDGA 1HXMB 1NDGA 5TJWK 4LHUD 5D5MB 5EZOL 4EI5C 1Q38A 2CDFA 1HILA 4N0UB 3O6FC 1MF2H 1FZKB 4HPOH 5BV7H 4XPFL 3EOTH 4R4FL 4ZUTA 1I7RB 2VDOH 3RWIB 5IT2L 1BIHA 2FEEI 4PREA 4WFGD 1VKXA 4JLRA 1K6QL 1AD0B 4KQ4H 4PRPB 5EFIA 4JHWL 2PO6D 1FZMB 4K9EC 5HGHA 5IHUL 3DO7A 3G5XB 4GFTB 4QRPA 1CL7L 4R6UA 4YGVB 3U9UA 1FVCB 2ADGA 3OR6B 1MRCL 4OFYA 4P2QA 3ZHLA 4GW4A 1MREH 2P7TA 3CVIH 2DLGA 3SKJH 2IBZX 4Y1AB 1IGML 3NFNA 4DKDC 4TUKH 1I3GL 2DI9A 4YC2C 5DT1H 5DJ6A 5EU6E 5I0DA 2JB6A 4HUNB 3ZE1E 4JM2D 4HULB 7FABH 3ARDC 1GC1H 3QUXC 3VFPB 5I2IB 3FT2B 4FQIL 5FYLE 4NP4H 3RZCD 1YEEL 3DIFB 1K8IA 2ICCA 3GB7B 1PKQA 4GAYB 3T1WA 2I60L 2XTJE 5C0ND 5EN2B 1Z9MA 2Q3AA 3VFRB 4MAYD 3QJFB 4I0CC 2QQNH 5F6HJ 4E5XA 1CLZL 5DC9B 2VXVH 1NAMH 5EBGA 2ZCHH 2FH8A 5L0QB 3TVMB 3L3DB 4I3RL 5K9OB 3L3HA 4UUJA 2EDNA 2GITB 2Z92B 4P2OC 2WBKA 3JV5A 3RNKB 5JQ6H 5D7KE 4ZPVA 4I3RH 5BVPH 2XFXB 3SO3B 3EGSA 4EBQH 3CFIC 4X7DC 3RJQB 1T0NB 2ZCHL 2VO5A 1MCNA 4MDIB 1N59A 1SJHA 3K8LA 1JMXA 3IF1A 1JP5A 1T89C 2J3SA 4XCFH 3OKDA 1KEMH 4P2QB 5E2VL 4HWZB 2BCKA 3CD4A 5DRWB 4PJ7B 3QUXD 5DVKA 2VL5B 2YPLA 3IKCB 2R4SL 3NABL 3U1SH 3RX5A 3LQMA 5D2LE 4M7KH 4ZUWB 2XN9D 5FHAH 4KROB 1OW0A 1C7TA 4MX7A 4GKSA 4ZUUA 4ZOCA 4LGPB 3BH8A 5B22A 4KI5D 1J1OL 1KGCE 4CU8A 4D0DA 2XQBH 4K7PH 1H3PL 5GS2D 1C1EL 3CX5K 4YHIA 3DOSA 4YO0B 1U3HB 2FLRT 1JGDA 4MZ2A 2EH8H 1SYVB 4KQ4L 3U4BH 1W8OA 3P4OA 4JZNA 4WDIA 4G6KL 5GRVK 4NWUH 4LIQL 2IAMA 1NEZG 4JFFB 3WMSA 1KTDA 2VDOL 1MHHB 3P0GB 3LEXA 2AK1L 2VLRE 3MNZB 4OUUB 5BV7L 1MF2L 4HEME 3S36L 3ZKQD 1VEOA 1UJ3C 1DBJH 2VXSH 3SDCA 5CJ5A 4YLQT 4Y4KC 2W0KA 4K94L 2P8LA 4U31A 4OKVB 2H26B 5FHAL 4HBQA 2ITDB 5KAQG 4HAGA 5F9AC 5IGXH 4PJDF 2C1OB 4ZS7H 2PO6A 3S35L 4GG6B 2GJ6B 4HX1B 5I6XC 4P4RA 2BNRD 1BAFL 1MJUL 5KG9A 1A7PH 3W82A 4XGZA 2W0LA 2GITA 4KJQD 1UZ8A 2I07B 4Q6YA 4XVSL 5EOTA 5AYUH 1RURH 2HWZL 4J1UB 4HS6A 1S9WA 4XCNB 2DS4A 3D2UD 3FMGL 4Y4KA 4XPGH 5F9JA 1MAJA 2AJVH 1IVLA 3FO9A 2BHUA 2FZ3B 4UB0L 5LVEA 4IHOB 4DN4H 1B9ZA 5IMMB 3RVTD 4PLJC 1AGFB 1CGSL 1I1RA 5I9QC 4F3FA 3N9GL 2FJGB 3SPVA 5JNYA 4MCZB 3O6FA 5HI3D 4F7TB 4X4XA 1RUKH 2E5EA 4YZFE 5TE6H 3THML 5LXGL 4Z0XB 3OKOA 2EXYC 1D5MB 5L8LB 5I30H 4OB5L 1T7YA 4PJGE 3JSSA 1NGXA 5E2WL 3ELAT 1I3RB 2N7BA 4F9LC 2FBOJ 5CSZB 1MHHA 2JLLA 3HE6D 5M95B 4L8CA 5HHPB 4HT1L 3MJ7A 5GRYA 3E8UL 3ZTJG 1JPGA 3HKFA 3TBSA 4ODVH 5IK3A 4GKNB 4Q0XL 2BERA 1GC1L 1GGTA 1WITA 4Z7QE 4GS7C 1BLNB 1U6AL 1FG9C 3FOMA 4WU7A 3MJ8B 4OGZA 3IRPX 3X17A 1C08A 3IDNB 4EKXA 2NR6D 3IDIA 2BHZA 4MYWB 3GI9L 4K3JH 5IIEA 3TFKC 3QYCA 1WT5A 4GXUN 4R7NA 2YC1B 4PLJD 4MNHB 2IPUG 1A1OA 3VFOB 3WHE0 3Q1SH 5FUZL 5IVOA 3CC5B 3F6IA 3TBTB 1M71B 3U46B 1C5DA 2BY2A 1VGKB 3QUYB 4C83B 3MOAL 5D6CA 1PBYA 3GIVB 3D3VB 1AHWC 4K55A 2GSIA 1IGFL 1SBSL 1J1XL 4KPHH 4RFOH 2ATPB 1S7RB 3UTZB 5BS0A 1LEGB 3PQYD 1YPZA 1V7NL 3U48A 2DKUA 1R3JA 2A77L 1CD1B 2DWEB 2NY0B 2NY5C 4OZGE 5GRXG 2D7MA 2NR6C 1ES0B 2DQTH 5B3JF 4IRJB 4OM1L 3QEGL 4F3FB 3KPOA 5F7FA 1U42A 5GS1C 3VJ6A 2ESVB 4DTGL 4WWID 5C0BE 3D3VE 3PL6B 1FNAA 2RCSL 3U0PB 5BV7B 3GJEB 3R4DA 2YPLE 1FE8L 5I8KH 3N1MC 2AJSL 4MA3A 4R9HA 1MCIA 2R0ZH 5HHOD 4NIKB 1YC7A 5T1MB 3BWAB 2PNDA 4R0LB 2M2DA 2BXYA 2ITCB 2R0KL 3UO1L 4AM0A 3S5LG 4IJ3C 2J8UF 3D6GA 3LOWA 3IAGC 3QPXL 3DBXB 3QFDA 1ZHBB 1JWSB 1YEJH 3J8F7 1QKZH 5I1JH 4PP2A 1G6RB 4LEXL 3ROLB 3WNLA 5E6IC 4YIQB 3B8YA 3RPKA 1XGYL 2F8OA 4Y16A 4KHXL 5CZXD 4ERSH 1ETZB 5FOBB 1PX3A 4NC0B 5GISL 2DTSA 3B4NA 5IEHB 3UTPD 4UV4L 1LE5B 3BT2H 1JIBA 4QHUB 5MERA 3D85B 6FABL 4QHKJ 1F3DH 4FFVC 4RFEB 1X4YA 1EV2E 2J7LA 3VXOB 3VXRD 5IHLB 5EIIA 1OWWA 4HH9A 4WEBL 4U6VL 4NQEA 5IQ7H 5MHSD 3GIVA 5D71H 43CAA 3CZFB 5EU5B 1K2DB 5LGHL 2YD9A 5I8CA 4KTYA 1MJJA 5E99L 3F7VA 1KB9J 4PJDB 4RAUB 5JA9A 4C55A 1U8JB 4PTTA 4DZBA 5D96C 4HG4J 2ICWB 4HV8A 1AIFB 3FO2A 4LARL 3AS3A 5E6ID 1P4LA 1D5BB 4EI6B 4WUKH 3TZVC 5HYIA 1Z6JT 3W11D 4WW2A 4K3HA 4YNYA 5H2BA 3JWDL 4PRPA 1OY3B 1RULH 2GI7A 4NNXB 3IFOA 5HJ3B 3ARFA 1CYGA 2QQKL 1NUFA 4R96B 5IJVA 1G9NH 1Q94A 4Y19B 5TQ0H 1ZTXH 2NY4C 5HHOE 2OZ4A 3TVMD 1K4CA 3LQZB 4YWGL 1Q0YL 1FSKC 2AEPL 3QO0A 4HJ0C 4LASH 4LSDA 3MV9E 4BQ8A 4DAGH 2OK0H 3GMLB 3HE6B 4LARH 3RGVD 5IEHA 4KUCF 4XPBL 2FYYB 3VWJD 1MFBH 2P5EA 3FOLB 1K3IA 4I13B 1D5XA 2E9WA 5ACMA 4OD3H 4S1SH 1S7WA 5A3ID 3ES6B 4LCCC 1FFOB 1TVBA 4WNQA 3EYOB 5GS0L 5D7LA 5CHNA 3GSRB 3BZEA 1FL3B 1XCQA 4ZAKC 3DO3A 5GJTL 5DJ6B 5KSAB 3L3DA 3NCYS 3INUL 4LRIC 5CZVH 4Y16C 4L8BB 3FKUS 1F3RB 1UT9A 1QD0A 1ZA3A 3H3KA 3TT3H 5FO8A 5KW9L 1KF9B 1A1MA 2Q3ZA 5LBSL 1IFHH 5ID0B 1EHXA 2J88H 4HJ0D 3TBWB 4QRPB 3FONA 3NTCL 1PZ5A 3LRSB 2OCFD 5DURB 4ZOEA 3W0WB 5IROA 2NY2C 2OX5A 3KLHC 4MLIA 2DJUA 4K3EL 2AABH 1ZOXA 5JXED 1DN2A 1Q1JL 3GMLA 3HE6A 2F9BT 4Y4FB 2BXZA 2D7OA 1NGQH 5FXCH 1WAAF 2OS7A 1CFTB 3HNTH 1BBDH 3WIFB 3OKKB 4OIIL 1U41A 3C6LC 1DE4B 3NIFF 4MXVF 3BP7A 2AGJH 1U8QB 4DTGH 2IANA 4U3CA 1XR8B 1V3KA 3QDMB 1J8HE 4HMDA 3MLUL 4FZEL 2OI9C 3GSWA 4PJEA 4GMSL 4FNLH 5IVXE 3CDGA 1QBMH 3BQUB 3D2UA 5KJRL 1P5VA 1FPTL 3EYFA 1LHZA 5HXMA 2IAMB 1I7TA 1VPOH 3KPQB 5GGUB 3QUKA 5DK0B 3LHPH 3LZFH 4PJHB 4B0MM 3WNPA 4OBRA 5DZOA 2A9ML 4MA1B 2YEZB 1F4HA 2ENSA 5FHBL 2G5RA 4QHLB 1OGAE 1CLOL 3LY6A 4ZFGH 5JQHC 3WSQH 1FNFA 1AY1L 4Z7QF 4CVZA 5ICXA 4XP1H 1DBAL 4MMXC 2Z8SA 3QFJE 1RMFL 4UQ2A 4BFIA 3MRMA 5DMGC 2BVUA 1FN4B 5CJXA 3VXRA 2A6KA 3V4VH 2VE6B 1KB9K 5HPMA 4JFQB 2VDNL 1AGDA 2IMMA 5D6DC 3KPPA 1CFVH 2VYRE 4FXLA 4OFKA 4JCLA 1NEUA 5IMMA 5E6YA 5IM7A 3CU1A 1JZ7A 1AXTL 4JQXA 2BNQE 5EO0A 2MMXA 3FFDA 5GSRB 3SDCC 3X14B 3HE7B 3MLPA 1Y6KR 4ORGA 1YUHB 4Z76B 2DQEL 2VNCA 5DLMH 4JG1L 1YEGH 1OT1A 1PAMA 1XF3B 1JF6A 4FTVB 3JUYA 4L9DA 4JPIA 4K2UL 4MJIB 4PS4L 1FAKT 2EYTA 2V2XA 5ACZA 3BPOB 3V6ZA 3T2NL 1MRFH 2XKSA 1H8OA 3HNVH 1A7RL 2HVKB 2VLLB 1RIHL 1FORH 1JPSL 2C5DC 3FRPG 3IDGA 2YPVL 5ICXB 5E7BA 2ZSWB 1OP5K 1A9BA 4E42B 5KSBA 1ZGLP 4ONFH 1MQ8A 4NKQB 4Z7NF 3PIQA 2JB6B 2O5YH 4BELD 3KHOA 3O9WC 4NUGH 1CIUA 1NFIB 3MC0A 1NC4D 4H0GA 4C56D 1BVZA 1ZLWK 2HT3C 5DFWH 5DQDH 1CFQA 4P9HC 1KIUA 2VIRB 4E41D 3O2VL 3GHBH 2CDGB 2Z9TA 1A6WH 4ZXBC 1J1PH 1OPGL 5DJXA 5FV1L 1NCDH 4C83A 1S9KC 3B9KB 4WVRA 2WANA 5I1GH 5KANG 4MNHA 3MV8A 1IEBB 4XMKL 2AQ3A 2I9TA 1CDUA 4WW1A 1CF8L 3SJVD 1RHHB 1IKFL 2EZ0D 4LCIL 5GGSY 1VERA 1DQMH 2EYTB 4J3SA 2FGZA 5HI4D 3MV9D 1JPTH 2AEIT 3G6JB 3RWJA 2IBZY 2R56H 2F53A 2JELH 1YY9C 5BXFA 1MIEL 2M1KA 1H3PH 5T33L 4FQJH 4J8RB 1JV5A 2VXQH 4XVTH 4PYHA 4M8QB 2NZ9C 4LBEA 5TPWH 3TN0A 1TCMA 5E9DB 5GZOC 3MTRA 1WCQA 2ZSWA 4E42A 2J8OA 1RUQL 3OZ9L 1KEGL 5KN5B 4MCYA 4YHPB 5EC2B 4L4TD 2EKSB 5JW4R 3BOVA 1HHHB 3EO0A 5IMKB 4R0LA 2J8UE 3EJZC 1MNUH 5DD6B 3WE6B 5I1KH 3ILPA 3KPLA 3PWVB 4ZXBD 5FDWB 3O2DH 3KYAA 5T1DH 2G9HB 4G7VH 2WLZA 4NNPH 1SYSA 2XY2A 4I5BA 5HDBF 3V6BR 3OGCB 4DUVA 2XACC 3PGCB 1NCAL 2R0WH 1FDLH 4IMKA 1I9IL 4NSKA 1ZA6B 4M7LT 1WWBX 4HHAB 3QPQC 4UT7L 5F9OL 2AJXL 5CP3A 1ZGLM 5BVPL 1MI5B 4PRHA 1YY9D 2GSGB 1G9MH 1NMAH 3MCKA 4JRYB 4YBLB 3IJSB 2VSCA 2JIXA 3MGTA 5IB5B 4PD4J 4X6DE 3S37L 1ZE3C 3QXVA 1PYWA 2DM7A 4NCDA 2YD7A 2ATKA 4ODTH 4CAGA 5C09A 4JR9H 1TTUA 3V4UH 5MP6L 3OBAA 5DJAA 2UVEA 4B41A 4F33B 1KELL 2CDGA 1N6QH 3B43A 5TQ2L 3NBNA 3BIBX 4J4PD 3TEUA 1MFCH 5JUEH 4JPVH 3FQRB 4YGAB 5MEPA 3SGDH 4MJ2A 4WRLA 5IKCA 1EO5A 3DYPA 5E9DA 3K2UL 2ADIA 2IADB 4FQIH 5C08B 3TA3D 4NQDB 2J8HA 4YR6A 4U1KB 1U8JA 1K85A 5GZND 1A7OH 3TBVA 2CRMA 3OSKA 2Z4QA 4FRWA 1R3IH 4KK5D 3CSYA 3FO0L 2O5YL 3KAAA 1AD0A 3STZB 3M1BB 1AQKH 1K2DA 4WTWA 4P5MB 4R96A 5I8CB 1QFWM 4TOYL 1FBIH 5KZCB 5ACLA 4LPXA 2FECL 4IJ3B 1RK1A 2FEEL 3MACH 3MX0A 4DGVL 5EU7C 2Q8BL 3PHOA 4J23A 4Z77A 2XN9A 1U8LA 1MHEA 2OTPA 3TESA 1H5BB 4HPOL 4OV6F 1E4KA 1Z2KA 3O2DA 2R23A 2ID5A 5DMYA 3MLWH 3VFMB 1AE6H 3QZWB 2EICA 1A1NB 2ARJA 2VDRL 4JRXA 2CXGA 2W0PA 1N2RA 3MLYH 1KULA 3ZTNH 5E5MA 4LP4A 3RZWA 4U3XA 5AWNL 3W5NA 1FVEA 4DVBB 1HQRB 1RUQH 5CILH 3VA6A 1Z9LA 4GRMB 3BZ4A 3GJFB 4OSUH 3TGXA 2FSEA 4XVTL 2EDWA 3SBWC 3M17A 2IBGA 1LVEA 4YEEA 4E9LA 1KJ3H 1OAZL 2E6QA 5I1AB 3MRFB 2X9WA 4ZUSA 3MXWH 5F97E 5KTEH 2Y5EA 1I3UA 1DBAH 4WEMB 2YKLL 2ATPA 5DVNA 3W0WD 1A3LH 1NLDL 3L5WA 1JE6A 2X2YA 2H8PA 5FUCE 3IS1X 3MLRH 1YNTA 2DB8A 3DVGB 1KCSH 2UZIH 2QV2A 3F12A 4PJIE 5E56A 3ULUC 2MTPA 2JJVA 3DX8A 3T0WA 3VD4A 4AK1A 3MOBL 2EDBA 2F5AL 2FLBT 2V7NB 1D5IL 2YR3A 3B2UC 4QRRB 1XF4B 2Z8RA 3Q5OA 4I0KA 3VFMA 1IEHA 2P8PA 5IJKC 3KPRB 4D0DB 3ZHDA 5D7LE 1L6ZA 4O5LH 4PLNC 2A6DA 1ZLUH 1FG2A 1QFPA 1JGDB 4Z5RA 5M94B 4KZDH 1TTGA 1KCVH 2P1YA 3JV6A 4LSSL 1NUGA 5DD3H 3NFPB 1DLFL 5CJOH 1U91B 4PV9A 1U2CA 1K5NB 2YUZA 3VMOA 3WFEL 3HR5A 1FL5A 2HJFB 3QUKB 2JB5L 3K1KC 2G5BB 5K9KA 3DUUB 3L3JB 3DRQA 4PGDB 3E3QC 2BY1A 3ARBC 1JZ4A 4DKFL 4FFWC 5INDA 1KPRB 4GQPH 2WQRA 1ETZA 4PJEB 5HVGB 3FB6B 4N9OB 5ADOH 2FJHB 3UTOA 1ZANH 3RWGB 4RQQA 1NBYA 1Z5LA 5LJYH 1HKFA 5D96B 3GBMH 4ALAL 2ZUQB 5DO2C 4JG1H 1NLBL 2FEDC 4L5FH 2NX5B 1J0HA 1L7IL 4M1GH 3WUWA 3DVGA 1T66D 3RUGB 1WQVT 4XAKD 3GKZA 3NZ8A 4LSQL 1NGYB 3KYMB 1BOGB 4MJ6A 3QUYD 1G7LA 4LLYA 2HN7B 2HLAB 4Z9KB 5DVMA 4TPRH 3P0YH 4LHUG 1NL0L 2FZ3A 5D8JL 4RSVA 3VXTB 3BRGC 1U8IA 1EUUA 3FTGA 5EU4A 5CMAA 4PJCA 5FB8A 3LKRB 2YA1A 1VB9A 1PG7X 5LG1A 3T0BA 3WN5C 4OZFA 5JDJA 3WFZA 4K3DH 2FJFA 1MH5B 4YHOL 4BFGA 5GJSH 5JW5B 4XHJD 3CLFH 4XPHH 5ADPH 4ONOA 2WWKO 5EBLB 3X12B 3MO1A 5IJVB 3WEXB 3MZGB 5FAAA 4O2EA 1WFNA 3BO8B 3MJ9L 1J8KA 4K8RC 2AK4E 2IMNA 3S88L 5INDB 1VGEL 4PJAA 1NPUA 3T65A 2G2RA 2E6PA 3PWPA 3VFNA 3MYJA 5CEZH 5EBMB 1FPTH 1G7PB 2ZSVB 3EOBB 2X9YA 3WFBL 1M7DB 4MLSA 3MV8E 3WCYA 1CU4H 3T3PE 4FZEH 1IC7H 3OAUL 1XGTB 5K9KB 3V6OE 3O6FD 5DEZA 1M4KA 3LN4B 4NCC2 4KVCH 2BY3A 2DLIA 3G6AB 4KKBD 3VW3H 4LOUC 4QWWD 4LLWA 4JFDA 2OL3H 5I1HH 5ICZA 2CIKA 3TBTA 3BESR 2CO7B 3WIIL 1CICA 1T20A 1OAQL 4X98B 3P9MB 4HIJA 1I9RL 5IQ7L 3BPCB 5CP7A 3BRFA 1EO8H 1QPXA 1A22B 5I1EL 3LEXB 5DJDB 5F7LB 1K4DA 1PEWA 3OX8A 4F2MA 1INQA 3H7BA 1T7WA 4L4TA 3OAUH 1P84J 1JNHA 5KVGL 3QDGE 43C9B 4NRYA 4AEEA 3RWDB 4FQHB 5GGSB 2CDFB 4AL8H 1AGEB 1P7QA 5I1LB 4IRSA 3T0EC 3BD4A 3MYJB 3O3DA 4HBCL 4LLQA 2AERT 3HPJA 2HFFB 1M7IA 3VWKD 3AREB 3FO1B 3C5ZC 5C3LD 1CGWA 5IFAH 4MAYC 1CXIA 4LPYA 5T1MA 4R3SB 1PX4A 3E6HA 3DGCR 1JF1B 1OGAD 4JG0H 4UAOB 1TETH 4HQQH 4X5WA 2VDML 1MY7A 1RIUH 3MUJA 3MBED 2B5IC 3SPVB 2XQYK 3OB0K 4TUOA 4ZMAT 5ISZB 1FH5H 1KGCD 5DJZA 5HYFA 1MRDL 1TMCB 5CD3B 3HAEB 4NBXB 3MFFA 2HTLC 3QHZL 4S0SD 2VZTA 2OK0L 3VXMA 5CWSB 3DUHA 4OM1H 4X8JA 1DTUA 3VCLB 4YWGH 4H5SA 1EXUA 2BJML 3MRPB 4XWOC 1HSAB 3IVKA 3MUGB 2A77H 3GB7A 4JG0L 4U05A 3QCVL 3C08L 5AAMA 4KDWA 2D7QA 3RJDA 2E9JA 4HJGB 1IGFH 3I6LE 4KPHL 1S5HB 4M93C 1J87A 4GLRI 4TTDD 1UKSA 2APTA 4PRID 4Y88A 1ADQA 3PUCA 1FO0B 2AXHA 2ZUSA 4TVPD 3ULVD 3CZFA 3TNNA 4YBLC 3ARFC 4R2GB 2CLVA 5AUMB 4P57B 5J06A 3DO7B 4NWTL 4XNZB 1RVFH 2UYLA 3ISWA 5J57B 4FZ8L 1U9KA 4NO0D 5IB4B 3D0VB 4C57C 2BVOA 3G9VA 4XCYB 4U6VH 5HHNA 4XBEH 4DJMA 1WTGT 1A6AA 3VGAC 5E08H 4FFYL 2V5TA 4I9WE 2RBLA 3LKPB 1FNHA 1S9YA 2GK2A 4GLRH 5J8OA 1ZXQA 2B1AH 3C09B 4UT6L 3BDYL 3TZVB 1VFMA 3I6KB 1XF2A 4JRXE 5A43C 2OL3L 1CR9H 4AT6B 4NKDB 3DI2B 5HI5D 4WI5A 3VXQB 1EJOH 4Y5YC 4KMQA 1FNSL 2LQRA 4RGNE 1EXUB 1MCWM 1AO7E 5B3NA 1FZJB 1JNNH 4QT5A 2WZPD 4KJQC 5HGGS 4YK4B 3ULVC 4FTVE 5I30L 1G7JA 2NXYC 4QHNB 5EB9A 3O8XB 3PIQB 2AI0L 2VLRB 5TE6L 3THMH 2X70B 1GJIA 4RIRB 4OGAC 1A3QA 1WAAE 3ARBA 5TGBA 5CWSA 3W9DA 1CGSH 2AXGB 3MRKA 3OKMA 4RMUA 4DVRL 1HSAA 4AM0B 4YC2B 4MQTB 3L5XL 3RFZC 5HI3C 1GOGA 2HFEB 1A14H 1MAML 2V17L 1TPXC 2YRZA 5AZ2L 5MEOB 1BIIA 2BVQA 1AR1D 4YDJB 1HIMH 3GSNH 5HDLA 5T1KD 4FABL 1RQ5A 1B6DA 5ALBL 4ZO6A 1OD9A 4YIQA 4IMKC 3HE6C 1U92A 4ODXB 1MCJA 3ARPA 1NCBL 1EH9A 4NKIL 3BKJH 4LSVH 3U0PA 1A6VH 3HUJE 1I1AB 1Q9WB 1S9WB 2P46B 4JY6A 4POUB 3L3KB 1I1YB 1T0PB 3BWAA 1P1ZB 3RDTA 3I3DA 2QQLL 3FO9B 4DGIH 3SN6N 3NPSC 1LK2A 3PGDB 4F15C 1LE9A 3ULVF 3FQTB 4J8RA 4L5FL 5GSVA 2NCMA 3HMXL 2FWOA 2DQUL 1KJ2A 4TOYH 4XXDA 4NJ9L 4PJAE 3QUXA 5DHXB 3U30C 3O6KL 3Q1SL 5CBEA 1AQKL 2NY3D 5HYJB 3O8XC 4K7PL 3KR3H 1AR1C 3JWDC 1RZ7L 2QR0B 5KVDH 3G04B 2APVA 4PJBF 5I16A 1CDJA 2D0FA 2R2HA 1GSMA 4I3GA 5D93B 4TSBL 2BVYA 5E8PA 2UZXB 4R4NC 2ARWA 1T7VA 2BSED 5GGUA 2DM3A 2IPTH 4M6OH 2HJFA 3ARFB 4R2GC 5J0BA 1ORSA 1C08B 1FAIL 3IDNA 4KRPB 5TDNA 4ZTOH 1NAMB 3PDOB 3NMEA 1VACB 1MLBA 2YEZA 1WC7A 1B0RB 1E4JA 1YYLH 1UM5H 1A6ZA 4XI5D 4M93B 4Z7WF 5IJKA 4LSTL 1JYWA 5CJQH 4WTZG 5JHLH 3RDTB 2AKRB 5D7IB 5C0JA 1MCPH 1LO5B 5HY9B 4MJID 2NY0C 3EYVB 2EO9A 2V5MA 2OL3B 5IQ9A 3GSNA 2WSKA 4JFPB 5SX5H 4WFED 1CLZH 4H1LA 4Y1AD 4KTEH 5DSCB 3QNYA 2QSCL 4JFEA 2XTJC 3QDMD 2K9UA 1FLTX 1ZVYA 3BZEB 1XCQB 5ESAB 4JJ5B 2HWZH 4LSPH 4L3CA 4D9LH 5C1MB 2XZCL 3SE9H 4S10A 3ZE0E 1A7PL 1HDMA 2DLHA 3ARGB 5HDBE 3UJTL 4OSUL 4PIRF 1XGQB 4BUGA 4LAJH 3CPLA 2IAMC 3T77B 3PP3K 3DXAD 5FYKD 2YSSB 5F93C 5KS9F 2Q8AL 2DD8L 3UTQA 4F57L 4CVWA 4LLVA 1UG9A 3GSUB 2VJXA 4QHMA 5TPWL 1AHWB 2IC2A 3HN3A 2AK1H 4ACPA 4QOKD 2NY0D 1INEL 2MNUA 3P4OB 1AQDA 4D9LL 5IHUH 4LNRB 1H5BA 3CH8A 3FB8B 1QLFA 2NNAB 2VLME 4YH6A 1YMHB 4YFDB 3UBXB 3P4NB 4TSCH 4NZDA 2Q8BH 1J0IA 4JM2B 3MRJB 3EOTL 3L6FA 3BP4A 3RTQA 1F97A 4QRQA 1J8HA 1KJ2L 4QY8A 4S0TD 3UYPA 3ARTA 4NT6B 2VIRA 2AS5M 4LSRH 3TF7C 4O2FA 1S7RA 2QSQA 3UCRA 2VLJE 3C8KB 3VXPA 3D2UB 3U1SL 1YPZB 3SHSA 3G6JF 3EBAA 5E24E 1I7TB 4TVPE 4ZUTB 3B9AA 5KSVA 3PE9A 5IHBA 3LDBC 4F2MB 2Z8VC 4JM4H 1IEBA 3TO4A 1A7OL 3JWOL 3RI5F 4XCFL 3L95A 4ZFFB 5GRUH 1FAIH 3QG6A 1G0DA 1IL1B 2XZAH 1MCKA 3SBWA 4WENB 3L7EB 3LN9A 5DJCB 4U2ZA 1FORL 3O41A 4Y2OA 3MUY1 4Z7VF 2XZZA 5I74C 4KRPC 4X6FA 3U7YL 3BPLB 1AQDB 1KELH 3BX7C 5FECA 5IMOB 1IC5L 2Q86A 3RWCB 3EOBA 5KSBF 1AR2A 4J6RL 1NAML 1T6WA 1M05A 3V8OA 3D39A 2DQUH 4WY7L 5C0FB 4ZAKD 3MJ7B 1KUMA 2A1WL 1YEGL 3QUZA 3IDMB 2DQFB 3C9NA 1G7IB 4R7DA 3MRRA 5ETUA 3AMLA 5CFHA 3HHRB 5FOBA 5IVZA 5C2UB 1XIWC 4I8DA 5FYJU 4F57H 4OJFL 3RVUC 4N90D 1OAXL 5HTSA 4RX4A 4IBLT 4R3SA 1Z9OA 5F1OB 4LVHB 3VWKA 4DGYL 1I8KB 4IRSC 4YZFF 3DIFA 4G8IA 3DRQB 15C8H 1P7KA 2LAAA 5D93C 2PN5A 2XZCH 3U79A 1TVBB 3VFRA 1DFBH 5JXEC 3TIEB 1RAMA 1JWUA 4V1DA 5CINL 2FJHA 4EN3A 1MCHA 4HGMA 3NFSH 3ETBF 5I1DB 3C8DA 1N26A 2BDNL 4NKMA 4JO2H 2AJ3B 1UJ3A 3LKNA 2ICEA 4RMRA 4ZFOA 1PKOA 3IXTB 3T3ME 4NFDA 2X42A 4GBXD 1PSKH 3V0WL 3R0NA 1KPUB 1NEZB 1LEGA 2R15A 4OD2A 3RDTC 2OMNA 4NHUB 4MNQA 4ELME 2FD6H 4IIQB 1UXWB 3TNMB 5JTWA 3PDGA 3NCCB 1UCBH 3RVUD 1YJDC 1CFSA 4XNMA 4KV5F 4PRHD 4U1JA 2JJWA 4YUEL 4P2YA 1TJGL 4HUUB 1CDCA 2V6HA 1ONQA 1YNLL 3I6KA 2QSTA 4EVNB 5D70L 5GGRB 5GRWA 1S3KH 3F7YB 4OLWL 4WW1B 4D0CA 5ID1A 2F19L 4BZ2H 5IW6A 1CR9L 1I4FA 4WJ5B 3BDYH 4OLZH 4XHQA 3BH8B 3RA7H 5BOZG 4YHIB 3MBXL 5JR1H 4W4OA 4UIMB 5F6IC 1PY9A 5JZ7D 1F6FB 1YECL 3U4EA 3FT4B 3ULVE 3TV3H 3H9HA 4H8WL 3C09C 3F7PC 5HHOA 5IBUG 2FECI 4NJ9H 1EEZB 1P4BH 1QQDB 3ZDXE 3X3GL 3TWCL 4NZTL 1ZEAL 2EDFA 1MRFL 7CGTA 1CQYA 1MAKA 3O3BA 3SDCD 4GKNA 3U7WH 4G8FA 4JVPA 3DHJA 5INCA 3NA9L 1JMZA 1BVLB 4LNVA 1AC0A 1FVDB 1BFSA 2JK5A 4OLXH 3AM8A 3IU3B 2R2EA 5ESQA 3STBA 5GJTH 4XBGA 1BX2A 1R3LB 3JWNC 1GIGH 3MRFA 4ZUSB 1U93B 2E6JA 2IFFL 3FT3B 4NKIH 1I1AA 2CDEB 4JFOA 3KPPB 1MUJA 1T4KA 3VH8A 3V7MA 4HGWB 4ODHH 1IGYA 3WKML 2DM2A 3BUYA 1HHKB 3ZMRA 4NQCA 1MLCA 4QXGH 4FHBD 5EO1B 1QYGL 5I1IL 1AFVH 1MJ7L 2CK2A 5B39B 2X1QA 4XCEA 2NXZB 1YEIH 3TT1H 2H45A 1MCFA 4MCZA 4YNYB 4UIMA 2ZUXA 5GGTA 5EUOB 4S1QH 2YPKA 4KVNL 3I02A 1G84A 4IRSB 1KBGH 1QA9A 4HUUA 3D69B 4QHNA 1QSED 1HSBA 1GOHA 1M7IB 5LWYL 3MNVB 4JHZA 4ZO8A 1AY1H 1CDIA 2ADFH 3W39A 2VQ1A 5GRJH 3VRJB 4QNPF 3DPBA 3GSOB 5IHZB 3ZZ1A 4FQQB 3CGTA 2W9LA 4K07A 3AFLA 1RJZB 1J0KA 2C9AA 4BKLA 3CSBA 5J11B 2IH3A 3RL2A 3HS0A 5KJRH 4RA0C 1G7MB 4XXDB 1CQKA 4URTB 4XWGL 1VACA 2EIBA 3D3VA 5BMFH 4ODUB 4IIQC 3MBEB 4LLDB 3QUMH 1U8NA 1RZJL 2R29H 5IROC 1I9RH 1A21A 4JQVA 3IF1B 1UEYA 2VDLH 5FF6A 2D9QB 1MWAA 1T5XA 4HS8L 4PP2B 3BT2L 1KYOJ 4G6FB 1EEYA 4UV4H 5AD0B 3MJGX 1QRNB 3MMEA 3AS2A 4L3EE 5EC1B 2B2XH 2CQVA 2EDTA 3TBWA 4MA7H 1KJ2B 5I17B 4Z7WB 2A0LC 5CKGA 2PYFB 3S3SA 1UM4L 1BREA 4U2YA 4FTVA 4MNQD 5ESAA 3LKRA 2GCYB 1AJ7L 4OZFG 1K8DA 1E28B 4OV5A 1GGIH 1ND0B 5CUSL 1MVUB 3CU7A 4L4VA 3GGWA 3KPSE 1XAUA 1D7FA 5KS9E 2EECA 1HQ4A 1MCOL 3RVXC 3HG1E 3CFBB 3WO3B 1OP3K 1IGJB 4EEEA 5B8CC 4DOHE 3BP6B 1WCBB 4LU5L 4JZJC 1FV1A 3QO1B 4Y1AA 2ZUTA 1QUNA 3PWVA 1YQ2A 1QRKA 2QHLA 4ETQB 1T7ZA 5GHWL 3DBXA 1CL7I 2XXMB 2PXYB 2QJDA 1DANU 2C1OA 2GK0B 1HHJB 2IALA 4LCYB 5D9SA 2IG2L 4TPRL 3GMQB 1SBSH 3X3FL 3P9LA 4QRSB 1E6JL 2DOCA 5JXEA 5C0GB 3OR7B 2Z31A 4KAQH 5DA0B 4YDKH 1E4XI 3T2QA 2FYYA 1V5JA 1BZ9A 2ARJQ 4LIQE 1QLFB 1NFKA 5C0CA 5F1SA 1SY6H 4P2OB 1VDGA 3DXAE 4P2RA 5FYKE 1TZHB 4JRYE 4ZG1A 3TA3A 3IDXL 2DYPB 1KJVB 1U95B 2QBWA 2NZIA 1T83C 3U9PH 1HYSC 1U8KB 5I1IH 4QRRA 4X0KA 5IR1B 4OCRH 4H88L 4JQVC 1LNUB 3KPMB 4RDQG 4KKCD 1N0LA 1OARH 1X5HA 2EH7L 2D4FA 5H94B 2BVPA 3UYRH 5TF1L 3LD8B 2UY7A 1IAKB 3EOAA 4HUWB 1JTTA 4OCYH 4U1KA 2ERJB 5DURD 3BGAA 5I1HL 1UGNA 3N1FC 5IFHL 2DMKA 1MEXH 1A3RH 4JY5H 5GS1A 1Q9KA 2IANE 1FGVH 4YDLB 3PGDA 1DBBL 1LK2B 4QXUH 4PV9B 4X9IA 4U1LA 3EIFA 1XF3A 5F70A 5SX4H 4HT1H 4MWFA 1YEKL 1RZGB 2NX5D 1Q0XH 2Z35B 5BO1H 4TYUA 3OTTA 1P84K 3EFFA 4GRWB 3UROR 4ERSL 4BK5A 2BNUA 2X4RA 4ISVA 5DK3A 4KHXH 3QXUA 4PRBA 1XGYH 1GAFH 2UZIL 2V9TA 4WW2F 1P6FA 4Q97A 2BC4B 2FATL 4D8PA 2GJ6E 4GKZA 1HYSD 3MJ9H 4DN4L 4RMWA 3SGEI 4MVBD 1O5DT 1NCTA 1X7QA 4KKCC 3QPXH 3TV3L 2GW5A 2CK0L 2HTKC 2P8MB 2D31B 4BFEA 4RWYH 5DHVH 3MO1B 3HC4L 3V5HB 3RA7L 4B53A 1PQZA 1G7LB 4ZYKA 1NJ9A 1CG9B 1U3JA 2APXA 4JVUA 1HKLL 2F19H 1MFAH 5JHDD 4PB9H 5E6ZA 3EYFB 5EA0L 3MV11 4WHTB 1S9XB 1CD1A 2C7UB 1UB6B 1Y0LB 3KXFA 3CFJB 1OAYH 4PREB 3C6LB 1DCLA 3ZT5A 1RZFL 2Q86B 3GUTB 5TFSL 3VJ6B 2ZKHL 2X1PA 4P57A 4Z7NE 5DFVC 1S7UA 3WIFA 4YXKL 4EUPG 2LU4A 2D7TH 3BH9B 3D0VA 4IS6A 4OQTH 5GPRA 3U9UB 3SOBL 4HD9A 4UAOC 2W92A 4HKXB 3RWEA 1PSKL 3C5SB 1AI1L 4X9HA 1BFVH 4HWEL 1YMME 4FQCL 1A4KB 2EH8L 2HTKD 5ADOL 3ROOB 2Y36H 3MOAH 5HGBB 3P30H 4CVXB 2CD0A 4DKFH 4GW1A 1MVFA 2HFGH 4YJZL 3DX8B 1IEAA 4FFWD 1JNHB 5FUOL 4LVOB 3OXRB 4GW5A 4JFHE 5TDPB 3G5XA 2A38A 2GJJA 1SJEA 2YXFA 2P8PB 4YX2L 3UTQB 3KVQA 4PRIA 4G42B 1QZ1A 4FQXA 3VRLF 4U1IB 3ARVA 3EO1B 3DVNA 3O2WL 4PJCE 1S7TB 4X80H 4BQ6A 1WAAA 4KTDL 3KJ6L 5BZDB 3L7FB 4KKAD 5DUPL 3P9MA 1BGXL 5HVHB 3EYUL 3WFCL 3QT2A 1MPAL 4PJ9C 3M17B 4PRNA 3LD8C 3EDKA 1EAPA 4OM0L 3BZFA 1ZVHA 4PJAF 1RK0B 4WO4D 2DL2A 4RMVA 1H5BC 5JUEL 4MDIA 4NPYA 4WY7H 3OAZH 5D1XC 3MLRL 1D6EA 5E2UH 5D2NB 4EN3D 3W2DH 4J6RH 4NFCA 3OKDB 3V5KB 3DROB 3NA4A 5JIPA 5DF0A 2CKBA 3DTXA 2H2SC 5DRWA 3L3HB 1RUKL 2H8PB 4APQB 4AIOA 3UTTE 4BSWB 5JMOC 5I19L 2CSPA 5L2JB 2DJSA 2I60H 3HPLB 1U0QA 4QRRD 3RWHA 3MUGA 4O51A 3H9SE 1HHIA 1EVTC 4Z7UB 3CMGA 2NX5E 5C9JA 5I75B 2DWDA 3N1PC 4Q9QL 5IUSA 2DKMA 5ERWB 3KXFE 4ZXBA 1SJEB 1WEJL 4M6ML 4EDWL 4KKAC 5IFJA 4KK6D 4IOFC 3L7EA 4FQ2L 3Q3GA 1MCEA 4X7FC 3QWOB 1WVZA 4NZRH 5E03A 3O41B 4K9EL 1IGMH 3IB4A 4HIIB 3RAJL 1S7TA 4N90E 1MREL 4XBPB 3WDIA 4GS7B 1KJMB 3SE3A 2I9LA 1JZ3A 1IEAB 3RY6A 3U7AA 4UU9B 4ZSOE 4LSRL 1A6TB 4JCMA 1AGBA 4OUUA 2BVTA 2R1WA 3VXSD 1IGCL 3JVGC 4TNWF 5F6IB 2F53B 3FZUC 4PGDA 4IMLA 4HF5L 3QHTC 3S37X 2OR8A 2AEQL 4DZ8B 2ZPKL 3P0VL 3MLTB 1CFQB 2EEBA 1J0YA 1JGLL 5T1LD 3SDYL 1SYVA 4YHLL 3QCUH 1XT5A 3VXUB 3M45A 4QXTA 2AK4B 2DAVA 5FM5O 3ALWA 4YE4L 1CZ8L 5JW3L 2XG4A 1NFIA 1INEH 4XVUC 5J3HC 1H15A 1EMTL 4JFDD 4UIKL 3CUPA 3ZL4H 5HSFA 1J1OH 4XNYL 1P4IH 5EOQH 2B0SL 4G6MH 1A8JH 1NMCC 3PQYA 4F7MB 4ONHB 5MERB 3TYGH 2V9RA 4JRYD 3RWFA 1CCZA 4TSAH 1PZ5B 5SV3A 1YA5A 1T04B 5EZLB 1YMMD 4WV1A 5JW4M 4PB9L 5ESVA 4A6YB 4U0RB 4PBWD 4GG8A 3RL1B 3D69A 3SDXB 2O26U 3QDGB 1UKTA 4JPVL 3PL6C 4O51B 3MBEC 2H6PA 4Y4KB 1YNKH 4LHUB 1LP9F 4ONFL 4CMMA 2VWEE 4JR9L 1KLUB 2YPVH 4S2SB 3T09A 1ND0A 2MKWA 3QWOA 3DVFA 3NGBB 3PNWB 2MKLC 4I5BB 1RUAL 2G2RB 4KKLD 1ZV5A 4XWOD 5C6TL 4YQXH 3PGCA 1A64A 2DMCA 1BHGA 4H1LH 2D9CA 3C60C 4F37K 1FGNH 1JJUA 2EDLA 3QO1A 5DUPH 3FT2A 5TH2A 2B7DT 1R5VB 3VFVA 5J6HB 4X80L 3V9FA 4QXUL 2E7HA 1DBBH 3GSVA 2EIDA 1JZ8A 4KXZH 1OL0A 1CD8A 4PJXF 4RGMB 3U4AA 2DQIL 2MPAL 1YPZF 2CIKB 2OXGA 4LDEB 1AD9B 1R24A 1QACA 4OCYL 1I3VA 1JTPA 4P5MA 2R0LH 4HIJB 3Q6FA 2EH7H 3D9AH 3IU4H 3WBDA 3CVIL 5SWZB 5DZNA 1RK1B 4G6FD 5T33H 3TIDA 3PHQB 4YFLF 1XF5B 5EIVA 3VGHA 2VITB 1FNGA 5KSAC 3O6KH 5B8CA 3SCMA 3U83A 1ZGLB 4KKLC 1NBZB 4OFVA 3STLA 3LEVL 3DARA 4LCIH 3CC5A 4P4KD 3FL7A 4HEPG 5T5FL 4N8VB 4ODBD 1ORSB 2OSLB 4KQ3L 3QQ4B 5DMKB 5F7YC 3U0WH 1CTNA 2CUHA 2XWJB 2ZKHH 5D6CB 5GSVB 1B2WL 4GAFB 3LZFL 2DF3A 1MHCA 4L4TE 5GQBA 2Z31B 4LQ1A 1NCDL 3VRIB 3MRQA 2VLMD 4O4YL 2CRZA 3BUYB 5EA0H 1A1OB 3V6ZB 1W72L 1HKLH 1R5VA 3VFUA 4XCEB 4X9BA 4OGAD 1D3CA 3K4AA 1TENA 4RAVA 2DBLH 2MFNA 1CFTA 5EZJA 2AGJL 4U4BA 2OQJA 2BSTA 2GUOA 3DXAB 2ZOLB 3HC3H 4N1CA 4M48H 1IQWL 4YK4C 1A14L 1XH3A 4RWYL 2FCBA 4X6CF 4TRPL 4EUPB 4OCMC 1P7QD 4JJHA 1DN0B 1GPOH 3P9LB 1UXSA 4MB5A 4X6BA 1B0GA 5D7LD 4MHHG 1UJTA 1MJ8H 2IPUK 4QGTA 1DSFH 4NO0B 4JREC 5C71A 1SEQL 3MRLA 3DMMB 1FFQA 4FQ1L 3MGAA 5JPMB 3S3JA 3D3VD 4DUWA 1F00I 3NIGE 4M43H 1Y18B 1G6RA 4POZD 1VESA 4NQED 3L3OB 5DYOB 4NJAL 1S9VB 4LL9A 5J4MA 1NBQA 1DUYA 4K7PX 3ARGD 4WFHE 3K1DA 5J1AA 4EIGB 3ZSTA 4PJBA 5EOTB 1KIPB 4GQ9H 4XPAL 1EDQA 4HUMB 4JY5L 4Y4HD 4HS3A 4DFIA 3FQWB 1QFWH 3L9RA 2DQJH 5CZVL 2Z8WC 1GHFL 1QBLH 5F9JB 5ITBH 5E8DH 3RU8L 1KC5L 3BZ4B 1TFHA 3GJFA 1X6LA 4NQCE 2EDEA 1EEYB 1XIWB 3BJLA 3FQUB 5J9PB 5GS0H 4JY4B 3MYZA 4OGXH 3QQ4A 5DMKA 3O8XD 1U8HA 1EJ6A 5H2BB 3HUJB 5IB3A 5BMFL 3BWUC 4OI9A 1AKJB 5GIRA 4NRYB 1RZGA 4CN6A 3B9DA 4YGVA 4KJPC 5ANME 4ELMA 3C8KA 3NCBB 1BQHA 5F7DA 2DTMH 1LD9B 2HG5B 1N64L 1KXQE 1PFCA 2ICWA 2ZJSL 4EIZC 5FKPA 3D0LA 4H20L 4KHTL 3S8WA 1BD2D 1DANT 1CTOA 2W07A 4PP1C 5T5NG 3LS5L 2OTWA 3RY6C 2DLFH 1AP2A 4NN7C 4ZUWA 4QYOB 1A7BA 4N8VG 3FOMB 1G7QA 4JRWA 2KQMA 3G6DH 3OKNB 4G5ZH 5ILTL 2B1HH 3BKMH 4V1DE 3RIFF 4YO0A 43CAB 4FNLL 4YXHL 4GMSH 1HI6A 4NT6A 3NN8A 4L9LC 3IJSA 4WI8A 4WUUA 5CD3A 5EPMB 1UA6H 1TCRB 2VAAA