3VRLF

Crystal structure of bmj4 p24 capsid protein in complex with a10f9 fab
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords A10F9 Fab heavy chain
publication title Structure of the HIV-1 capsid protein p24 in complex with the broad-spectrum antibody A10F9
rcsb
source organism Human immunodeficiency virus 1
total genus 50
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07654 C1-set Immunoglobulin C1-set domain
F PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vrlF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vrlF01
3S4SG 1I1RA 3MRBB 1HXYB 1RMFH 3M1BB 3EJYD 3EYUL 3L5XH 4TNWK 4Q9QL 3B2UD 1ES0B 5FV1L 5F6IB 4MVBD 3B3IB 5IEKB 2EDLA 3ORJA 5T1KA 5DR5H 5LGJA 5JMRA 4I9WE 4P2QD 3GB7B 2GTZA 4FFYH 3FB8B 3T0EE 3MREB 5I15H 3NMEA 4ZPVB 5DTFB 1NDMA 5DEFA 3O2DA 3A67H 3CSYB 4PP2A 4U4BA 4D0BA 5ICZA 3RP1A 1AD0B 3D6GA 3GSVA 5E5MB 4L3EB 4MA7H 1DBJH 3E2HB 4Q6YA 4RMUA 3T8XB 1AXTH 3MLWH 4L4TD 4O4YH 2WWKT 1UB6A 2NNAA 5IFHH 5D7LE 4L4JA 3LOWA 4PRHB 2BOCB 4U1KB 2NW2A 2F58L 1C8PA 4K94C 5TQ2H 1VEMA 4QT5B 4B41A 4D8PB 3KYNB 1QG3A 4RQQB 4GT7A 5C9JA 1YEEH 2XZQL 3V5KB 1A6WH 1AGCA 4LPUA 4NDMB 3ARXA 4PJIE 4QHLB 4AY0A 5KAQG 2VISB 5CJ5A 1SVCP 4IOFC 5ITBL 2X4RA 3IF1A 5HHVH 1FGNH 3ECBA 3WUWA 1IEBA 1J18A 1NKOA 5C70A 4XB7A 3DRQB 4IIQA 4E42B 3PNWA 4MNHB 4PGJA 1S7XB 3AC0A 1BZ9A 1S9WB 1KPUA 4GLRH 2X1PA 4HUWA 2NXZD 5GPRA 5BRZE 4L8DA 3IAPA 4MCYA 5IB2A 1F11A 5JNYA 1WV7T 4CDGC 3BX7C 5FYJL 2Y07L 4KQ3L 3VXNA 4HUKB 3LPGA 1EAJA 2AJVH 1IGFH 1ZA3B 3LKPB 3LKNB 3ARBC 1TJHH 5TGBA 5I15L 4G9FE 3GMQA 2IEPA 2BNRB 3B5HA 4K23H 5FIEA 3QIUD 4LLVA 5HGAA 3O6FC 5D96B 3U4EA 3C08H 4L8BA 4MA7L 2H32H 4P2OA 3MBEB 2DJUA 5JHLH 2VZ1A 4X6BA 5D70H 1OTUC 4GXVH 2J8HA 5A3IC 2D4FA 4RIRA 3O3EB 1CGSH 5TQ2L 5C09E 5CKGA 4YDLC 5IIEB 1XR9A 1YEEL 1HH6B 1A6WL 5CJOH 3T4YA 4G6KL 3I3DA 2VN7A 4HKZB 3TCXA 3BO8A 4ZQKB 1SVZA 2GJ6B 32C2A 4QF1A 4UTBL 4Y4KA 5I0ZA 4U6XB 1YQ2A 4AENB 5HHVL 2Y5TA 1T66D 3HR5A 4PY7A 3KPRE 1T1YB 1HNFA 3EOBA 4HPYL 6CGTA 2GAZA 4QRRB 4PY8J 3I75B 4GRWF 4CDHA 4FXKB 3WJLA 1G9MC 5FHBH 4NPYA 3AVEA 5K93A 3LN5A 4O02H 5CCKH 1IQWH 4Z8FH 5ILTH 1FVCB 3VXSB 3RL1B 1LO3H 2A0LC 4NOFA 1YQVL 3SDXE 5K9KA 3ZYZA 3C5SA 5L2JB 43CAB 2GIYA 3C09B 1GIGL 3TNNB 2MQ3A 1MCIA 3WSQH 2VDMH 5EZIH 3BW9B 3BPOC 4HHAB 4OB5H 2V9RA 4JVWA 1LEKB 1I1AD 5C0JB 1N0LA 4WNQA 2YD6A 2VXVH 1FV1A 4HUNB 2W60B 5FKAA 5IB5B 3FQUB 3WN5C 1NBZB 4B0MM 1D6VH 5JHLL 4YHPA 3E3QC 3VXMA 3QG7H 4Y4HD 3ULVH 4DFIA 5JOFA 1YMMD 2HWZL 2FLRT 3UTTE 1E4XH 1IC7H 5CBEA 5HHOA 3SKMA 2HT3C 2Q20A 4GAYB 3FQRB 4OV5A 1N64L 5C07A 3S96B 3H6JA 4X4YB 4ZFGH 3WLWC 5CJOL 3V5DA 1DSFH 1VDGA 2R1WA 4FNLH 1OARL 2MSPA 3MLZH 4JFQB 5IBLD 4H1LH 4XCEB 4M5ZH 3MROA 4Z7WE 1X4XA 1UM5H 3W0WB 3LEVH 4YHNA 2WQRA 3TZVB 4M4PA 4PJEF 5I74B 4PJBA 1QSVA 1FPTL 3K1KC 1ZGLM 2LE9A 1B0GB 5J8OA 4FXLA 2YD2A 3DRTB 5FHBL 2P47B 3VDAA 4HQQL 4O02L 1IQWL 1KNOA 1LO3L 1ZVHA 5F96L 1B4JL 2CSPA 5JORB 3VA6A 5H94B 2P46B 4RWYH 3JV4B 4X6CA 3PV6A 4XP6L 4LSVL 2BVUA 2N1KA 5KJRH 4XTRC 2BC4A 2IALB 3G6JB 4R0LA 4JPIA 3BP6B 4WFFE 4XVTH 3QWQB 3WSQL 3V7AG 4OZIE 1S9VB 2D7TH 4M7ZC 3NACL 2ADJB 5AUMA 2V6HA 1YEGH 4Y16C 1R5VB 2VXVL 1BD2D 2KUTA 1F4HA 3CLEH 4OKVB 1G6RB 4HK0A 3MLPA 2FIRT 5BMFL 1EEUA 3QG7L 5IW3A 3MZTA 3ULVL 1T80A 2SEBA 2E7BA 3L95B 4OGYH 1J0YA 4TPRL 1U58B 2F54D 5ANMB 2P5EA 2XQBH 3VXQA 4LCWD 5IB3B 3ROOB 3ET9F 1D9KD 4PTTA 5BS0D 2OZ4H 5BVJA 1M6OB 4Z7VB 4IRSC 2HRLA 4N68A 3DIFA 1T03H 4K3EL 4WJ5A 3QFDA 1OM3L 2PTUA 4UDTB 5HGDA 3ARBB 3LEVL 5DC0A 5L6YL 5DRXB 5GS1C 3AS1A 4KXZH 2PCPA 3V6BR 5TDNB 3FKUS 2EDWA 3F7QA 4JZNB 3QDJA 2YD5A 2AXJA 3O6FB 5DJXA 2R39A 3QNZB 2IAMB 3VGBA 1GJIA 3IDYC 4XNYL 4HGWB 4CUCA 1RURH 3KLSA 1F4XL 3DETC 4UT6H 1FYTD 4NQXA 4QHUB 3SY0A 5L2KA 2Z35B 2C7UA 4N0YH 4Y5VC 1SJHA 3OB0K 4YDJB 5ADOL 3IXTB 3X13B 5T1LB 1XGRA 2WBWB 5BV7L 2DTMH 1XGUA 4MNQD 3HAEA 5KVMC 1IM9A 1DL7H 1T2JA 4BKLA 1ZHBA 3RGVA 3RFZC 4HH9B 4OGYL 4MJ6B 1B9ZA 4YE4L 3UDWA 1MFNA 5JW5B 4P48A 4XVJH 2XQBL 5D2NE 5J7CC 1E4WL 2AW2A 1VFAB 3MZGB 2YPKA 5JDSB 4ZOCA 3GZKA 3HCVB 2J5LB 2APVA 4DZ8B 3W2DH 2E7LC 4PLKD 1T7WA 1YPZB 2NY5H 4G9DB 2OL3B 3DX7B 4U2YA 4X8XA 4YHYC 5E6IA 4XAWH 4OCXL 2R2EA 5ALBL 5F71A 1FC1A 5B4MD 2DL9A 4J23A 2JELH 1XF4B 4V2CB 3LSOA 1QSEB 4Q9CA 5CJXA 3DX6A 5DI8B 4N1CA 3TBWA 1FL3B 4DZBB 2FECI 5AG9A 2BJML 1W72B 3MRJA 1JI1A 1R5IA 4WTWA 1BBJA 4ODUA 1EMTH 3MV11 4M5YH 3WN5B 3BUYB 4PR5A 1GC1L 2V9QA 4O00A 4U1GC 4ODBD 3U0TB 3VFMA 4NO0B 1CLOH 4ZDHA 1WWWX 2F8XC 1F3DH 3WFCH 3CMOH 4UT6L 3DI3B 4KKCC 2XACC 4DKFL 1QSFD 1R3IH 2Q1EA 1H3WM 1MOEA 3IDUA 4B5EA 2DTML 2K9UA 1NMCC 4FQQB 2Z92A 3KNBA 4IOIB 2VE6A 3QI9B 3DV4A 4HKBB 3N85H 2Q7YB 4F57L 1UACH 1JV5A 1AQDB 5C0AD 1N8ZA 4R7DA 4X5WA 4CN4A 4PTUB 5J1AB 4G8FA 4HMCA 3QIWA 4BFEA 2YOCA 3GK8H 4IEFB 2X1QA 1Q9KB 3LKQA 4OF6A 5KAQF 1F4WH 5DA0B 1BFSA 2VXQH 1GZQA 4YIQB 4WFHE 2DQIH 5ID1A 2HJFB 2XG5A 3BIKB 4S0TD 5FB8A 3SDAD 3SE8H 2NTSP 5IMMA 4JFFE 5BZWA 5EPMA 5CLTA 1H8OA 3ROLA 5I8CB 3MLSL 3Q1SL 1XCQA 4OLYL 3OKNB 3I3EA 5E2UH 4I0PB 1FO0B 3VGAC 3H9HB 4C57C 4OZHA 2X6MA 3NIDF 4EI5A 4M7ZB 3EJZD 4C83B 2GUOA 1NCWH 5KSUA 3U2SA 1KCSL 4Y16B 3UTOA 1WIUA 2FSEB 4UU9A 4YXHH 4HXAL 3O3UN 4Y5XC 5FCUL 1AH1A 5DRWB 2AV7B 3U7YH 5J13C 1DBKL 1JF6A 3PL6A 1FL5B 3HZKA 1OAUL 2DL2A 1TETH 5DUML 1IL1A 3CMOL 3BJLA 5H35A 4LBEA 3K8MA 2YS4A 4OF5A 4PJGE 4RMVA 1JGLH 4XPAL 1DQQA 1WZ1H 4WUUB 3BP7A 3T0EA 1Q0XH 4Q58C 1PYWA 4LCIH 4IRSB 3LQAC 1RHHA 1U6AL 3VI4F 4K7PL 2ZG1A 1EFXB 4GQPH 4NGHL 1RZGB 1JWUA 2GTWA 4U0RC 4F7PB 5FYLH 3W39B 4TQEH 5C0GA 1ZOXA 4P9HC 5D7LA 1UB5B 4P5KA 1KGCD 3HI6H 2YUWA 1ETZA 2VQTA 1N6UA 2DQIL 2ICWA 1BQUA 3CC5B 3IDYB 3B6SB 4J3UA 4TVPL 1E27B 5HYQB 3L3HB 5I0DA 4RZCA 2DLFL 4S1RH 3QIBC 4HS6A 4UOJA 4GUPA 1X7QA 1G7JB 1EX0A 4FN0A 4NKDA 4M1DH 4Y5VB 3T65B 2XNAB 1TVHA 4JDZA 4POZC 4PRNA 4BYHA 4GSDH 3VXRD 4GRWE 4HMDA 4LVOC 2XYCA 3ZYIA 3KYMB 1F6AB 4KK6C 5CJBA 2EXWC 3IAQA 1DEEB 3U1SH 2AK4D 3UTPD 2Q6WB 3U7YL 3V7MA 5BRZA 1UCBH 1XF2B 1TETL 3OXRA 2VDRL 3Q6FB 3RWHA 1F6LL 4Z78B 3GRWA 1HHIA 5GHWL 3RKDD 5SWZB 4X6EA 2LQRA 1MCJA 3TT1H 2OJEA 2BOBB 3MLXH 4G9FA 4P5MB 5DJ8A 4LCIL 4H8WC 4XP9H 1ZT7A 4YHYB 3OBAA 1L7TL 1U3HC 4ZOBA 1EUTA 1HNGA 4B50A 1YY9C 4POUB 5IM7A 1NAML 1XIWA 2MCG1 5CWSA 4U3CA 1NUFA 5CEZE 1EGJH 1A2YA 2P5WE 3F58L 5DDHA 2WBJA 4TQEL 5J11B 4XPBH 1CICC 4C54A 2FLBT 3B9AA 3O3DA 5FYKH 2ADFH 5DD3H 4GMTH 2AJSL 5CZKA 5C09A 3ZE1E 3VWJD 4QHKI 2BVEA 3D39A 4NQDE 4U1GB 3KVQA 5J6GA 4YDVB 3FQTA 1RJLA 5HI4C 2BVPB 1CCZA 4HZLB 5C0BE 3QEQB 2EYSB 2H6PA 3OXSB 5CZVL 3B4NA 5E8NA 1J1OL 2CJUH 5DYOB 3BEVB 4KDVA 3ARPA 4PPTA 3KPRA 4PJEE 1PG7X 4PJ8A 4MLSA 1JZ6A 2XG4A 4GSDL 4PRHD 1NMCB 3RPKA 4KDWA 3QHZH 1G9NH 4X7TA 5T3XE 1NBYB 4LHUD 1T6WA 3U1SL 4N90E 1OQXA 1T6VN 3H9ZA 1INDH 5IEHA 3QUKB 3SDXA 2A38A 1LEGA 1XGTA 4ZAKD 1PZ5A 4L5FH 1LNUB 1CN4A 1JWMA 1JCKA 4M1GH 2DYPA 1FAKT 5GGSB 5DD0H 1TZHB 1FG2A 1RUML 4XNZC 5ECJE 2CRZA 4OQTL 2VLLA 2XWJB 1A64A 5TDOB 4PRAB 5ITFB 1K6QH 4FZ8H 1V3MA 4NO3B 1EAPB 5J1SC 1N0XH 3FAXA 3P3YA 2ZUQB 5SX4H 1KT2B 4QHMB 2VLRD 3VGAB 3ZT7A 2ZKHL 4OZ4A 2WANA 4OJFH 3GSOB 4JE4B 1LD9A 3QJHA 3UTTA 1ZGLP 3TT3H 1T4KB 1SBSH 5KW9L 4Y5XB 2BVQA 3WL9B 5J13B 1RZFL 4M3KB 3IETB 3FQNB 1WT5A 1HEZA 5E8PA 1FZOB 4MQ7B 5DMGD 3TFKD 4NC2B 5IROA 2QJDA 4N8PA 4ZFOL 5B38G 3BWAA 2GI7A 4WDIA 3CVHH 3DMMA 4Z7WA 3O45A 3N9GL 2FYYB 2IG2H 2X9WA 1IQDB 1MI5E 4FTVD 4FZEH 5C2BL 5MHSD 4E0RB 2HN7B 3QHZL 2OS7A 4U0RB 1MCFA 2FBJL 4I1NB 3ILQC 3PABA 4MAYC 2FR4B 4XNQA 3ARDD 4P3CH 2J6EH 1X5XA 2V17H 4MWFA 3E0GA 4K9EL 3K8KA 1RIHH 2XQYK 4U7KA 4WHYG 3S5LB 2AQ1A 1KIQA 3JVGA 4OZIA 5IESH 3PP4H 5F1NA 4OZGB 4FZ8L 3NTCL 5I8EB 2OM5A 1N0XL 1DFBH 2MPAL 3N1QC 4LHJB 1A1MA 4P2OC 2Z31B 1KG0B 4YBQD 4XH2B 1ZAGA 5FKPA 5L0QC 1AXIB 4XCNA 3TYGL 5H8DA 4OJFL 4PJ7F 3NAAH 3U0WH 4FMFA 4D0CA 3WDJA 4NO5A 4LVOB 2GK0B 2Z8RA 5TDPA 3K8LA 5HHNA 2FX8H 4I3SH 4U3HA 1EO8H 4XC3L 2CDEB 3OF6A 1F6FB 3B9EA 3O6ML 4JO1H 3UPAA 1DBMH 1YYMH 1H15A 5DZOA 5KSAA 4EDWL 2IPTL 4Y4KC 3ZO0A 3MRQB 4LNVA 1G7IA 1OGAB 1R3LB 1IRAY 4OCSH 1GRWA 2VQUA 1KPVB 3WJLC 4ZUTA 3FT4A 1MAML 4MSWB 2PYEB 2EDYA 2CKBH 3GMOA 3W11C 1T0PB 4L8SA 4LASL 1UWGL 4MXVF 1U3HB 4P2RB 1QEWA 4WFGD 4RMRA 5FDYA 3ZKXC 4G8GE 1JRHI 3UXFA 4R97C 1P7QB 5EUOE 5IVXB 3PWVB 3JV5A 3BHBB 4R4ND 5HVHB 2ZUWA 3TVMD 1MFBL 1CICB 4Y2DA 3X3FL 3U0PA 4NYLB 3ULUF 4NRZB 2DKMA 3OZ9L 2R23B 5CGTA 4UQ2B 1QFUL 4JAMB 5M7QA 1BFOB 4HWBH 4O9HH 4GW5A 3TYFB 1WFOA 1K2DA 3ZT6A 4DGIH 1MCOL 3P9LB 3K80A 4DQOH 1A6TB 1NCDH 3WHXB 4QXGH 5E6YA 4KK5D 2ZOKA 5DHVH 1OTSC 2VL5A 3TBTA 1P6FA 5KVGH 4M62L 3ULUH 1EO8L 4XT1C 3V0VA 5D2NA 3CFBA 2CLZA 5T1KB 1DBML 3VD3A 4GRLD 3BOVA 2C3GA 5LGJB 3ZHKA 5GGTA 5HHME 3WNNA 2GTZB 4XX1G 3TV3H 3VFSA 1LDPL 5DC9B 4G7VL 3A0OA 1NDMB 2B1AH 5DEFB 4XNZB 4OZFB 3NIDE 4PP2B 5D1ZD 5SX5H 4D0BB 4OUOA 5J56B 3GSVB 4IS6A 3V0AC 2OYPA 4FFVC 3BN9D 5DLMH 1AJ7L 3I50H 5GGVH 1UB6B 2NNAB 2NW2B 4NJAL 4JRYE 1J8HE 4FP8L 4R0LC 5C08E 4NWTH 1W2KT 5C9JB 5C2UB 1AGCB 1CGWA 2Q3ZA 3IDMA 1ZXQA 1GGIL 1E6OH 2OXGA 2X4RB 3WUWB 3ECBB 2HKHH 3P4NA 3VI4E 1IEBB 3MOBH 4LP5A 5TQ0H 5EZOH 25C8H 3ES6A 2A6JA 4P9ML 3MCLH 4IIQB 1TDQA 3PNWB 1I75A 2IAMD 1G7LA 1BZ9B 3BKYH 1M7DA 1KPUB 4P2QE 2I9TA 4HUWB 1FH5H 3N1PC 3OB8A 1TNNA 4L8DB 2E9JA 1CZ8H 3U4BL 4MCYB 4AIZA 5IB2B 2YA1A 3O6KL 4TOYL 5F7HA 1F11B 5JNYB 1A7OL 1CTOA 1T22A 3IT8D 1HK6A 3L3OA 5C6TL 1EVUA 3VXNB 4JFFA 3MLUL 3WIHA 5CILL 5I8OL 2EIDA 1I7UA 1QKZH 1E28A 4RAVA 3SKJL 3TV3L 3S88L 4LU5L 3CCHA 4L4TE 2NY3D 5TGBB 1OAZL 3BESR 1DQDL 1PAMA 5E00A 3DXAD 4RFEA 3VG9C 4LLVB 5HGAB 5DO2D 4HMEA 3HR6A 3U4EB 3GIVA 5JR1H 4L8BB 2AP2A 3QUXA 4P2OB 4MCZA 1JWSA 2IPUG 3BIBX 4EBQL 4X6BB 4WUKL 3I50L 4RCAA 3QEGL 5DF0A 3O9WC 4IMKA 5L0QB 4RIRB 5IP4A 2JJTA 4F37F 3GJEB 4FMKA 3ZKND 1I7ZA 2HTLD 3QO0A 5CJQH 1A7BA 4NWTL 1XR9B 4G6AC 3LB6D 4PJGA 3FRPA 5IHUH 3T4YB 2OP4H 2DIAA 2DKSA 4X6DF 1E6OL 3BO8B 32C2B 4QF1B 1FGVL 4K07A 3D0LA 4Y4KB 1MHEA 4MXWL 4H0HB 2HKHL 1WCBA 1BF8A 3HR5B 4PY7B 25C8L 1MREL 5C86A 3EOBB 4G7YL 3RGVC 5F3HA 2GAZB 3SE4C 3KYOA 5I30H 4NM4H 4NPYB 2EDEA 3UDWC 2QBWA 3LN5B 4NQVA 3C6LD 1FH5L 2VMFA 5DRZA 5F3BA 5I1HL 4WGVB 1NCCH 4P4KD 3BGMA 1RV6X 3MRHA 1OT2A 1S9KC 3RAJH 2FEEI 3OG6B 1BMGA 3C5SB 4YC2C 5GS0H 3ZKXB 4HK3J 4R97B 5CGYC 3BP4A 5E6IC 1KTRL 4YXKH 4KRNA 5B39G 5F9DC 5CJXC 3GSXA 3HZVA 1X5IA 1P1ZA 3O4LD 5I17A 4RGNC 4MHHI 5A2KH 3SKUD 1WZMA 1FV1B 5F7FA 5FKAB 4R2GD 5ICYA 3O3BA 4PBVC 1WWCA 2V2XA 1TPXC 4YHPB 5I1EL 3VXMB 2DQUH 5C0IA 5JOFB 3U36A 1MJ8H 3V7AE 3GO1H 2MOVA 4NZRL 1NUGA 1EFQA 1HSAA 5CBEB 5HHOB 2VH5H 4BK4A 5CJQL 3SKMB 5F7EH 1LK2A 1LEIA 3PGFL 5DMIL 4OV5B 5C07B 4O58L 2CUIA 1JNJA 5IHUL 4MXQC 1WLHA 2R1WB 3O41A 4U1HA 1KIRA 3MV8D 3QNYA 4ZO9A 1ACZA 1QYGL 3MROB 4F7MA 2V7NA 3WE6A 1RVFL 3L7EA 4PJBB 4ENEC 3QIWC 4J2XA 3CFEA 1BJ8A 2Z8VC 4JY4A 1Y6NR 3RX7A 2C3HA 1FFQA 7FABL 1NUDA 3MXWH 2RB8A 2P5WA 1I9RH 1KNOB 1NCCL 2M26A 2YPVL 3ZDYE 1GZPA 1X5HA 1CT8A 2EO1A 4ZXBD 2YA0A 4X6CB 4ONGH 3NA4A 3PV6B 3KPPA 3U6RB 4YHLH 1MIEH 4NQDA 5EC2A 3NIGF 3VWKD 2BC4B 5IMLA 2YD4A 4NIKB 4R0LB 3ARUA 4JPIB 3DWTA 2APFA 5KS9A 5C0BA 2MCPH 4K8RH 5KZCB 2W0KA 3DROA 4EI5C 1YC7A 1I9IL 2ENSA 3CPLA 1L6ZA 2QQLL 3BZDA 3OAUL 5AUMB 1YMME 4PJEA 3CX2A 4BELD 3VRLF 3MPCA 3L3KA 4HK0B 1ZE3C 3WYRA 1CGVA 3PL6C 3TWCL 2SEBB 1AQKL 2VDNL 3KS0H 1NH6A 5DQ9A 5HI3C 2W9LA 3U83A 1CFVH 2P5EB 3VXQB 1S7UA 2EKSA 2R69H 2NY7H 3D2UD 5EOQL 2LTQB 4PTTB 3T0EC 3RI5K 5E24E 5BVJB 3MR9A 2R0KL 5FUZH 2IFFH 4NZJA 3DIFB 1XGYH 3UTQA 1UT9A 3H9SD 2W0FA 4WJ5B 3QFDB 2YXFA 4HJGB 4FQLL 5HGDB 4P5TD 5D8JL 1XF1A 1IAIL 5J57B 3SE9H 5EIIA 2PCPB 3WFHA 3QQ9D 2WINA 4PJ7E 2A77H 1RI8A 1SHMA 3GSNA 3ARYA 4TN9A 3G5VA 3UTSD 3VG9B 5DJXB 1I9RL 1ACYH 2RR3A 4KROC 4ONGL 2OK0H 1UKTA 4F15B 3BFOA 3N1FC 3WXVL 1T7XA 3SY0B 5L2KB 4HF5H 2C7UB 3DUHA 1BD2E 4Y88A 5D72H 4WI5A 1TJIL 1SJHB 3LN9A 2MCPL 1BM3H 3NFPA 3L5JA 1OQOA 1KLFA 4JM2C 1BP3B 2Q8AL 4M6NL 1ZLUH 1MI5A 2F54E 3HAEB 3QAZC 1IM9B 1LDSA 4QY8A 4LCWE 4PV8A 1XZ0A 5I8KH 3ARFD 5BS0E 4BKLB 1ZHBB 2H2PC 4IDJL 3RGVB 3MRNA 1TZIA 4LLMA 2B20A 1IILE 2JTDA 1J1PH 3SCMA 1CFVL 4KMTL 1FAIL 1A14L 1IARB 3QDHA 2YPKB 1X4ZA 4PJ9A 1H3XA 1T2XA 3KPTA 3DUSA 4YZFF 4Y0GA 5E6IB 4LIQH 1ZEAL 5SWSD 3KLHC 1XIWC 3LSOB 2YKLH 3DX6B 4XGZA 4L4VD 3DVNA 5EULV 3TBWB 5IKCA 2HTKD 5HYSA 3OGCA 3RWIA 4RGNB 4MNGE 3MRJB 1FYTE 1R5IB 1BBJB 1TXKA 4XPGL 4ODUB 4PR5B 3CFDA 1TPXB 2HFGL 3VFMB 2H2SD 1T0MA 4ZDHB 2DKUA 4BQ6A 2X42A 5HDQH 1G0DA 4MNQE 4KPHH 5E99H 4HF5L 4M02A 1KB9J 2P8MB 5D72L 5MEND 3ZKSD 4X9GA 1MCPL 3CDYA 1KBGL 3B83A 2X9XA 1LO2L 4PJ8C 3FN0L 2XKNA 5F72S 1F3JB 3KNBB 2Z92B 4PLJD 2VE6B 3DV4B 1ZMYA 1JV5B 1A9EB 2VIRB 1N8ZB 4R7DB 4X5WB 1TQBC 5I8KL 3SO5A 5DQDH 4G8FB 3QIWB 2V5TA 4QXWA 5I2IA 2RAMA 3VFUA 2EICA 3LKQB 1PDKA 2A83A 4G8GA 4WTZA 1GZQB 5IBTH 5EUOA 1S7QA 5HTSA 4HFWA 5BO1H 1J1PL 1RU9H 5GZNC 5ID1B 2BZDA 1ITBB 5IMMB 3GMNA 5BZWB 4P59L 5EPMB 1X5ZA 3S36X 5C8JA 5IB1A 1CL7H 1A7NH 3D69A 3ROLB 1JZ3A 2NX5D 1XCQB 3BSZL 5E2VL 1A0QH 3JTTA 4BZ1H 1ORQA 1RZKL 3S35X 4OZHB 4NHUA 4EI5B 3GM0A 1RSFA 2XRAL 1HI6A 2GUOB 4AIXA 5KSUB 3QFJD 4RFOL 2EE6A 4BUHA 3U2SB 1NBQA 3VMPA 4LDEB 2W9EH 4UU9B 1QNZL 3TBVB 5EU4A 2GSIA 1QSFE 5JXED 1WT5C 5GS2H 3PL6B 1OD9A 4I2XE 3HZKB 1PKQE 3AS3A 4ODHH 5CSBA 1IL1B 3LMJL 5IROC 5H35B 4LBEB 4GG6F 1T20B 2ZJSL 3B8YA 3HNTL 4KPHL 6FABH 3DGGA 4K55A 5L9DH 3DMMC 1DQQB 1HHGA 2X1OA 5C0AE 3BP7B 1RZIA 3T0EB 1PYWB 2VWEE 3H42L 1RHHB 2NMSA 2WAHA 4F7TA 3CDGA 2BNQE 1NCAH 3QDMD 3RDTA 2DQGH 1OHQA 2GTWB 3G6JF 5DQDL 2AJXL 1PGRB 1Z3GH 5C0GB 2ZNXA 5D7LB 4R90H 2IJ0C 5DVKA 2CLRA 4S2SA 3RVWC 4P5KB 1ETZB 1KENL 4JRYA 1J8HA 1RU9L 2ICWB 3HMWL 5C08A 2WNGA 3JVGC 4KROB 3DOSA 4PB0L 4X6DE 5ENWA 1JGDA 4RZCB 5IWLA 1QBAA 4HS6B 3V79C 4GUPB 1X7QB 3S37H 3QXVA 4J8RA 1A0QL 1AR1D 4NKDB 3NN8A 4KJQD 1E4KC 3QYCA 5JW4M 1H5BA 1TVHB 2VLJD 3RJDA 4JDZB 4PRNB 2Q8BL 2FX7L 4X6FA 5ETUA 1SEQH 4GLRI 5C92A 1C5BL 1KTLB 4DVRL 5HYFA 1DQLL 4Z18A 2W9EL 3GGWA 3QAZB 1KB9K 4P2QA 1LP9E 3MUY1 1U8MA 5KSAC 3P73A 5BRZB 2D4DA 4KK8C 2OQJA 1G6RH 4LFHG 2BHYA 5EORH 1JZ2A 3OXRB 4KRPC 3K4DA 2QSCL 5D1QB 1HHIB 6FABL 4PGBA 4X6EB 5L9DL 1Z9SA 2XN9D 1UZ8A 1Q9OA 2OJEB 4L4TA 4G9FB 2X1XR 5DJ8B 4PG2A 1KFAH 1ZT7B 2UYLA 4L8SC 3TJHC 4UB0L 1KGCE 5IM7B 2OI9C 1XIWB 3F5WA 5CWSB 3DYPA 4XBEH 2XZZA 3DO7A 4X9BA 1BVZA 3L6FA 1Z3GL 1A2YB 5DDHB 2WBJB 4R90L 3O3DB 1ONQA 2E9IA 5C09B 5IGXL 5I1CH 2OR9L 1PEZA 4ODTL 1H8SA 3D39B 1S9YA 4PRID 5F7DA 4RNRA 2R0WL 5J6GB 3F65A 3FQTB 1RJLB 1TJGH 3H3PH 5LXGH 3VXRE 4PJDB 3S37L 5DJDA 4K94L 2AK4E 3UTPE 1CDCA 3KPRB 1NL0H 4JPWL 3RY4A 2I07A 4PJ8B 4HDIB 4WHCA 4XHQA 1SEQL 2IBGA 1OT1A 1JNLH 1JP5A 1SYSA 1YPZF 5D6DA 5DA4A 2KQNA 3GNMH 5FM5M 3FZUD 5D2NC 3EGSA 1TQBB 2MTPA 5IEHB 3SDXB 1G6RL 1LEGB 1XGTB 1PZ5B 5HVWA 4FA8A 3QDGD 5EBMA 4KKAC 5T1DL 1JWMB 1H3TA 2DYPB 1G9MH 3QIUA 3NIGE 1UA6L 1FG2B 1ND0A 3Q3GA 1EV2E 2I5YL 2VLLB 3P11H 3DARA 5BVPL 3C2AL 4J1UA 2G9HA 2EDRA 2ILLA 4GMSL 2OL3H 1U91A 3VRLE 4P46D 2JB6B 4OZ4B 5D7IE 1E4XI 4NNPH 4RFNC 2R8SH 1LD9B 1W72H 3QJHB 2DQCH 5D4QA 4WV1A 1CS6A 2BVQB 1H3GA 4JFZH 1B6DA 1HEZB 1HE7A 4JPKH 5E8PB 4ZUSA 4JY6A 4K2UL 4TSBH 4PRHE 3BWAB 3D1MC 3DMMB 3GDBA 4Z7WB 3O45B 1XH3A 1NL0L 1UG9A 5J4MA 3CVHA 5EO9A 5FF6A 1MCDA 1TITA 1JNLL 4LEXH 4NM8H 3HC0A 4MDJB 5B3JF 5MP6H 3G5XA 3PABB 3RHWK 2AXFA 2ZCKL 4XNQB 5D2LE 1TZGH 5IHLB 5I1KH 4GO6B 4ZPTA 1G9ML 4MWFB 2R9HC 3NFNA 2VLRE 4RX4D 2HLFC 3I6LD 1MY7A 1AC6A 1KIQB 2J6EA 4OZFG 4YPJA 4OZIB 1FIEA 1WISA 5F1NB 1IBGH 4Y4HA 1BWWA 1KN2H 3LEXA 1A1MB 3QUXC 1YMMA 3MUGA 4LIQE 5IF0A 4IMKC 5FKPB 2DM2A 5HGBA 1FO0H 2JJTC 4XCNB 5T33L 5KVDH 4XC1H 3UC0H 4TSAL 1N59A 4D0CB 5GRZA 4NO5B 4XNXH 5TDPB 3DJ9A 2P7TA 1GXEA 2DQCL 4FXGA 4QHKJ 5HHNB 4YEFA 2W0LA 3RPIA 1UKQA 4LSQL 2X4NA 4JFZL 5JIPA 1H15B 5H37G 5KSAB 3KWWA 1BOGB 2H1PH 4DGYH 1T04A 3RGHA 4KRPB 5E7FA 3WUWG 1FSKC 4WI3A 2R4RH 2CR3A 4YZFE 1G7IB 1DTUA 4XVSL 4OCLC 2WLYA 4KXZI 4PJAF 3HC3H 4ZUTB 4KKNA 3GMOB 4PJ7A 1CQYA 5JPMA 4L8SB 1FORL 4KJYA 1KYOK 4LEXL 4NM8L 2CKBA 4AQOA 2OI9B 2NY2D 1QEWB 4O2CA 2KH2B 5MP6L 1A6AA 1TZGL 1F97A 2FEDC 4PJFF 4Y2DB 4C58B 3U0PB 1BD2A 2CRYA 2FX9H 1QBMH 1JPTL 1BF2A 1RFDL 1ED3A 1KCUL 4YX2H 1QFOA 4GW5B 1M7XA 3MBXH 1KN2L 5BOZG 4XZUA 1K2DB 3T04D 2F54A 2NZ9C 4Z76A 5T3ZL 3GM8A 2L7JA 1C16A 3OAZK 1PEWA 2ZP0T 2R56H 4LCWA 2AI0H 1D9KA 5BS0A 2ZOKB 5GJTL 2VL5B 2QQQA 3TBTB 4RSVA 1A5FH 1HKLH 4N5EC 3GI8L 4N9GA 4NQED 1WIOA 3V0VB 5D2NB 1YECL 2CLZB 2Q87A 1PG7W 1Q94A 4NUGH 1JE6A 2ZUSA 1AD9A 1NGPL 5F1IA 3PXHA 2PO6D 2G2RA 3OKDA 3VFSB 4MD4A 3V6ZA 3S34H 4NKQB 4R8WH 2EH7H 4MMZC 5TFSH 4KGJA 3MYZA 1KEML 3KPNA 4IS6B 4TULL 1NAKL 4MNGA 2BNUA 1G84A 1CWVA 1FYTA 4PJ5D 4LARH 1YDPB 2O5ZH 4HPOL 3HNVH 2LABA 2C1PA 1YNKH 5C7XH 4RFNB 3RKPA 1P5UA 3CIQA 4GG6E 2HRPL 4MNQA 3IDMB 1EJ6A 2XWBA 3GBNL 4WCYL 2WWMC 4G6JH 4ORZC 1A6VH 2UZYB 4NQTA 3P4NB 1KV3A 3BPCB 2NYYC 1JFQH 3ES6B 2A6JB 5DJ6A 4ODXA 5FGBA 1VENA 3WFEH 3G6JE 1G7LB 2R56L 1DUZA 1M7DB 1QRND 2I9TB 1WGOA 2P8LA 3IU3A 5EO0A 2F74A 3PQYD 4AIZB 4DCQA 4YH6A 4OCWH 1T22B 2AKRA 4TVSa 4UT9L 3L3OB 1OB1A 2W91A 4HC1A 4JFFB 1I7UB 1E28B 3CMGA 3EYVA 4RAVB 3WKML 3CCHB 5IOPA 5LGHH 3D18A 4XCFH 3G04A 2HFEA 2EH7L 5E00B 4RFEB 2ICES 3EDKA 2RCSL 5HD8D 3QSKB 3GIVB 3OKLA 3QUXB 4MCZB 1JWSB 2DQEL 4KVCH 4Z5RA 1TLKA 1KCRL 5E8OA 3RIAK 1QSFA 5HI5D 2IBZX 3IFNH 4I2XA 1YNKL 1I7ZB 3QO0B 1PKQA 2BY2A 1INEL 1P4BH 2DQDL 5EO1A 5D5MF 5GRUH 1OAQH 1MCHA 3I9GL 1OLZA 4PJGB 4ALAL 2H41A 5C0AA 3NA9H 2H26A 2AJYL 3D0LB 1MHEB 3PHOA 4HLJA 1FSKB 1WCBB 4FHBD 2DDQH 1JFQL 1HXMA 2BNQA 4ZS7H 2C3VA 3WFEL 5CLWA 4NCC2 5F3HB 3MLVL 5FO8A 5E94B 2DWEA 3C9NA 3R1GH 4YUEL 3KYOB 1JL8A 3SDAA 4YK4B 4OZGF 4NQVB 3SCMC 3LQAH 4Q0XL 5DRZB 5F3BB 2XZCL 2NTFA 2DQTH 3BGMB 3MRHB 1OP3H 3AMLA 1G7MA 4P57A 4PJ9C 4EN3D 2UWEF 1C1EL 4RISH 3OR6A 4QOKD 3DXAE 3BP4B 1FFPA 1I8KA 5TF1H 4X6DA 3N06B 2NY5C 1YEIH 5EU3A 3HZVB 1P1ZB 2UVFA 1XAUA 4MQXC 3ARGD 5I17B 3LRHA 4LCCA 1T83A 4OFIA 4U05A 5D7SL 4UV4H 1DJSA 2HYMA 4F7EA 2X89D 5ICYB 1GAFH 3O3BB 4LSRH 4GRWB 4F8TA 2AABH 3VGGA 2V2XB 4KVCL 1MRDL 1MWAA 5D7KD 4O5LL 5C0IB 1LP9A 5CIPA 3U36B 2J3SA 1QSEE 1RIUL 4OD3H 2F9BT 2IMNA 3THMH 1WAAF 1HSAB 4QTHA 3K74B 4WO4D 1D6EA 1LK2B 4QO1A 2NLJA 4OLXH 1LEIB 3HLAA 4LSSH 4DUWA 3C2SA 1RZ8A 3BT2H 4OGXH 3G5ZA 4U1HB 3H7LA 4HUUA 2NY0B 1CLCA 5IVXF 1KIRB 3QNYB 1MCLA 4HFUH 1I3GH 1S78C 2V7NB 3WE6B 2DDQL 3ARVA 3L7EB 3VDCA 5HVGB 4WWKC 4GW4A 4Y19D 3IU4H 3CFEB 4JY4B 4K3DL 3OL2A 1W0VA 1JYWA 1GOFA 4BJLA 1EH9A 3QA3A 3MGOA 1IEAA 4XMKH 3MC0A 2XA3A 5FM4A 2P5WB 4M1CC 4H8WH 2WLZA 3BEWA 4OSUL 2ZG2A 1GZPB 1CT8B 2HT4D 3O4LE 4YGVA 2APXA 1OAKL 4NQCD 3NH7H 3KPPB 4HKJA 1A3LL 4NQDB 2DJ4A 4NKIL 5EC2B 5IMLB 4P9HL 3RL2A 3UCRA 3VXRA 5KS9B 5C0BB 2X4OA 3DROB 2XZAL 4NO2A 3CPLB 2HT2D 4UTAL 4BH8A 2AK4A 4M43H 4PJEB 1C08A 5FDWA 4W6WB 3SDYH 2E6QA 3L3KB 4LSRL 4YQXH 2OTUA 2XKUA 4MD5A 4X80L 3BH8A 4YEEA 3P30H 5B3JE 5DQ9B 3THML 1L9NA 1Q72L 3MV8E 2QADC 5LJYH 1S7UB 2EKSB 4OLXL 1OWWA 4CU6A 3MR9B 4JQIH 2FECL 2Y7QA 2X4TA 4AG4L 1OF2A 4RGOH 3UTQB 1T2QL 1QVOA 5CSZA 5SX4I 3RDTC 2VZVA 1U8NB 5IEKA 4HFUL 1AKJD 2D7NA 5IFAL 1VESA 4YHZL 3UO1H 4ZNCD 1IC5H 1PX3A 4R26L 5EIIB 4R3SA 3WFHB 2WZPD 3O2DH 2WINB 5LVEA 4LL9A 2FO4A 4OZFH 5D7IA 3VWJA 3GSNB 5ACMA 2EC9T 3G5VB 4BK5A 3VW3H 5DTFA 4GAGL 3EOYG 5F6HI 3UBXG 5D1QD 4D9QD 2RFXA 3P4OA 5KVEL 2R1XA 4OFYD 4E9LA 2XTJD 2KZ1B 3NH7L 3GSRA 4K7FA 3CH1A 2VAAA 4AH2A 3EJYC 4PRHA 1FVEA 1H5BC 2EDBA 3TH2T 4Y5YA 1KJMA 2X4UA 3NFPB 4PJAE 3LS5L 4MVBC 4ZFZA 4LHUA 4D8PA 1OTUD 3MJ8A 4GBXD 4HZAA 4O2FA 4WY7H 4M43L 1JPSL 5C0DA 1M71A 1MI5B 2OX5A 4ZAKA 4OCRH 3GMLA 4QY8B 1S7WA 4PV8B 1XZ0B 5ADPH 4JFXA 2FD6L 3MRNB 1CDUA 5E2TH 1TZIB 4P3WA 4DN4H 1OY3B 4LLMB 5JMOC 1V7MH 4HGMA 4LLUA 3H9SE 5HY9A 1V8HA 1MCSA 1MHHA 3SCMB 1T1WA 1A4KA 5D2LA 3OJDA 4PJFE 4PYGA 1A6UL 1S9WA 3FN9A 4Z7NF 4PJ9B 1JNHA 2VLRA 4YHOH 1JHLL 4LPCA 5DWUH 3HMXL 3DUSB 4XMLH 4F9LA 5DGRA 1NEZA 1J0IA 1IC5L 4XGZB 1G7HA 3KPOA 3DVNB 2BDNH 5IKCB 5HYSB 3OGCB 3RWIB 3K4AA 4DAGH 4X7SL 4NFDA 4L29A 3BPNC 4OLVL 1Q9WA 4PRPB 4YWGH 4NNYA 3CFDB 2HH0H 3F7RA 5IMKA 5C0RL 5EA0H 2J88H 2DM3A 4TUKH 4ODVH 4L3CA 2VSDA 4FTVA 2NXZC 1QP1A 3CXDL 5I1JH 3UJTH 1EHLH 2XKNB 1AFVL 4NQSA 5ESAA 3WFBL 4WY7L 1NFKA 1JGVH 2VUYA 1P6AB 4G3YH 3FO9A 1KJVA 3B9KD 5D6DC 2WIIA 5I76A 2FGZA 3RTQB 3ARDA 2QEJA 5GISH 1IC4L 5ADPL 2DQJH 4HUXA 1JMXA 2VDOH 5E2TL 3D85D 5I2IB 3WLWD 3VFUB 3N50A 3IDIA 4JPVH 2A83B 4G8GB 2P48B 5EUOB 1S7QB 3QIUC 3GIZH 4HFWB 4M6MH 1CE6B 3T4AA 5SWSE 3TO4C 3W5MA 1UKSA 4AEIL 3GMNB 1D5ZA 4L4VE 2GY5A 3G6DH 2W59A 5E0QA 5C8JB 5IB1B 1UC6A 1I3VA 3D69B 4G6FD 5DWUL 3CLFL 3LZFH 1XEDA 2R0LH 2UZIH 1SY6L 3LS4H 1ORQB 4DKAA 1RQ5A 3RNKA 4NHUB 3WNMA 1ZTXL 4DAGL 4JO3L 4JB9H 4U49A 1FZMB 4WV1C 5EU4B 4G43A 2GSIB 4JY5H 3RWCA 4XTRD 3V4VL 1T66C 5T3ZD 5MENE 4PUBH 2BX5A 1MHPL 5FK9A 1OP5H 4BA8A 2GKIA 2QADB 5HHMB 3DGGB 2IWGA 4KQ4L 1HHGB 4Q9BA 4RAUA 1RZIB 4YFLI 1YEJH 1CLZL 1MFCH 3LQZA 5CSGA 2A73A 4F7TB 3CDGB 2PUQT 4YHIA 3RDTB 2NW3A 3TVMA 1CBVL 4LQ1A 1BOYA 5EOCJ 5DUBB 2W92A 3T0BA 2KQMA 5CD3A 1JNNH 1MJUH 4JPVL 2CQVA 2CLRB 4S2SB 2PR4H 5LGKA 4F8QA 4M6ML 2NX5E 1F45A 4JRYB 4PP1D 4OF8A 1J8HB 2G75A 5TPWH 5D5ME 2DMCA 5C08B 4GOSA 3ZHDA 3Q5OA 4GG6A 4W6YB 2QQNH 3EHBD 3G9AB 1CDBA 4Y4HC 4TNVF 5ENWB 3QFJE 1JGDB 1MRFH 5E2WL 4M7KL 3BP5A 2VC2L 3LZFL 1CFSA 4M7JL 4F58L 2R0LL 3MOAH 3NN8B 1H5BB 3NABH 2UV3A 5HHQA 1EEQA 4X6FB 5ETUB 4LF3A 3G6JA 4I0CC 4XP1L 3VD4A 1FJ1A 4JB9L 2BVYA 1WIPA 2UUDH 4NZTH 15C8L 3DETD 3GGWB 5EOTA 2BCKA 5DXWA 4P2QB 3ARQA 3CH8A 3P73B 1WWAX 2E27H 2OQJB 4PUBL 3JSSA 2UWEE 4HUMB 5K9JL 3AM8A 3HPJA 4ZODA 3OV6A 4NWUH 4H0GA 3HI1A 1BGXH 5D1ZA 3QDME 5A16B 3GMMB 4PGBB 1RK0A 1UZ8B 1Q9OB 1QACA 1U8OA 4IMLA 2YEZA 4U7SA 4L4TB 3C60D 2BVTA 3ROOA 2UYLB 1FRGH 4KRLB 5HVFB 4KI5F 2BVOA 3F5WB 3DO7B 2YD8A 4OLWL 3L6FB 3QXTA 5B39A 4JR9H 1JPFA 5CAYB 1MJUL 1WAAE 1KB5H 3OAYH 4APQD 4WW2F 1ONQB 2N56A 3BPNB 4JKKA 1FDLL 4AJ0A 4YDIH 4ZSOE 2A6DA 1UXSA 2VLJE 1S9YB 5F7DB 4RNRB 5E2JA 4ONHA 2YK1H 2IAMA 3EIFA 3EYOA 5IB4A 1A6PA 4ODSL 3EDFA 1X4YA 4HGKC 5DJDB 4FQJH 1N5YL 2NXZB 2O5XH 1NFIA 3VD9A 3NABL 1D9KC 4C4KO 2I07B 3DUUA 4YBLB 2E6JA 4MAUL 1NCTA 3HB3D 2HG5A 4YDJA 2MJWA 1SYSB 4NZTL 3V8OA 1NJ9A 3HAEH 5C0FA 4NSKB 5EZJA 1VGEL 2P24A 2XN9E 3B5TA 4BQBA 3EGSB 1RJCA 1H3PH 4PD4J 3M8OL 5EBMB 5BQ7A 4XPFH 1RZJC 3DXAA 4NWUL 4PLOB 3QIUB 3STZA 1J5OH 1FG9C 3NCJH 2D2OA 1BVLA 3RU8H 4J1UB 1J8KA 2G9HB 4M8VA 5F70A 2JCCF 2DJSA 3BQUC 4MGXA 5TE4H 1JK8A 1U91B 3HCVA 3MLRH 5C71A 5J1TC 3D9AL 5HGHB 3FCTA 4LHQB 4PRIE 4X99A 3D48R 4WHTA 3KJ6H 3QHFL 1QSEA 1EHXA 2FIKA 4JDTH 4WV1B 1QO3A 2IH1A 4JGUA 2W07A 1BJ1J 1KUMA 5T5NF 4ZUSB 4PBWD 1MJJA 4JY6B 3RA7L 4Y2OA 3U9UA 4JQXA 5F9WC 1TMCB 4ZD3L 1CR9H 3TPUA 5FGBC 1CE1H 2LU7A 1JRHL 1CU4H 1YEHH 1XH3B 3BD4A 4P4KA 2W9DH 3CVHB 2YMXL 4KJWC 3AGVA 1FN4A 5EO9B 5FF6B 5GIRA 2APWA 3QDGE 4PLKC 3TN0D 1BBDL 5B4MC 3HC0B 5FXCH 4LSTH 4OZHF 2LVCA 4HT1H 1C7SA 1IZKA 3O4LA 1OVZA 2H45A 5J06A 2AXFB 3AXLA 4TTDC 1GYAA 2Y5EA 4ZPTB 1I1AB 4UILH 3WD5H 2FGWH 2YRPA 4FQCH 1U8HA 3NFNB 4YGAB 4G5ZH 2NY6D 4JKMA 2MFNA 2R29L 2HKFL 2DIJA 1KJ2L 4Y4HB 4UZGA 3LEXB 1YMMB 3VRIA 3MUGB 5EFIA 3N0PB 4MA3A 1S5IH 5HDLA 4AEHH 5HGBB 3GSUA 4OLZL 1VFBA 2YRZA 1FE8H 3NPSC 2MHAA 5AYQA 4FABL 3EYQD 1KACB 2P7TB 4PJHF 4X9HA 1RY7B 3QIBD 1HQ4A 3AFLA 2YD1A 3MV8A 1SM3H 4P23C 2X4NB 1EK3A 2B0SH 3KWWB 1LO0H 4POZD 2VWEC 1NFDF 4LAQL 1TTFA 3OJVC 1CFNA 1CR9L 1C12A 5E08L 2YBRA 3WKNA 2VQ1A 4W68A 4KWUA 4LSDA 3SDAC 2GT9A 3IFOA 4KJPD 4ZXBA 4PD4K 1QR1A 1MVFA 3PWUA 2EIBA 5JPMB 3R0NA 4KJYB 5JUEH 1IAMA 1BFVH 2R0ZL 3VWKA 1DLHA 1RUQH 1RJYA 3VGEA 2IH3A 2I60L 4O2CB 3I6LE 4UINL 4LSTL 5KG9A 1IGIH 2Z91A 5GS0C 4HIXH 3EJZC 3JV0A 1A6AB 1QLEH 2NY0D 2EC8A 1K5NB 4FQCL 3QWOA 3WLBA 1BD2B 1RAMA 5KOMC 4G5ZL 4LCCC 1UB5A 1T83C 4LAJH 4PJAA 1ED3B 3FRUA 2FBOJ 1U36A 3BKCL 3ESVF 4XZUB 3IKCA 2DQHH 2FHFA 4FQ2H 5GS3A 4XRCA 4ELMF 1A22B 2F54B 5FUCE 4Z76B 1C16B 2XA8H 4KY1H 4LCWB 3D2UA 1U8PA 1DQTA 3MLYH 1DN2A 1D9KB 5BS0B 1VA9A 2HA1A 4N9GB 1OTTD 4HEME 5D7JC 5HI4D 3H9SA 4GQ9H 1SM3L 1J11A 4KRMB 1Q94B 4PJFA 3FJTA 4P5TA 5AWNL 4OQTA 4O51A 1AD9B 3SGKA 5F1IB 3VXTA 2G2RB 1BAFL 3NCFB 3OKDB 3V6ZB 3GRWH 1XF2A 3V0WH 3ZHLA 2F19H 1NC2D 2CRMA 1CXEA 1YNTA 3BKJH 1IGCL 3KPNB 3LH2L 4MNGB 4QXTA 2BNUB 12E8H 1CFTA 4PJDF 1FYTB 3T0WA 1P2CA 3WXWH 4OBSA 1RUQL 2PTTA 3FO0L 2K1MA 2C1PB 4JFED 4E41D 1QLEL 4HXBH 2EH8L 4MNQB 4XHJD 1AY1L 2CGRH 3K81A 2XWBB 3AROA 3QXDA 1MLCA 2NY4D 2DAVA 4F80A 3HE7D 4J3TA 3SDXF 3ARFA 1KEGH 1AE6H 1MCWM 2DM7A 5F9WB 1TENA 4ODXB 3ZTNL 3PWLA 2FEEL 4NQEE 3RKDC 4YDVA 3VFTA 1UQSA 5EZLA 3K3QA 3J8F7 1CDYA 4HZLA 4KY1L 3RWEA 1DUZB 3AREC 1YEDA 3MLYL 3HG1D 2HLAA 5FM5O 2P8LB 3NFSL 5DYOA 3IU3B 5JXAL 2B4CL 5I75C 2IADA 5EO0B 4MJ4A 2F74B 3MRLA 4N8VA 4DCQB 4XNUL 1J05A 4PGEA 2I9LA 3HE6D 2AKRB 2BFVL 5SWSA 3WFDL 5DFTA 2VLKD 5HHXL 1PD6A 4PGZA 5F6IC 1OB1B 4L4VA 1OPGH 5LBSH 3QQNA 2VZSA 3EYVB 3INUL 3RVVD 3WIFA 4KHXL 5IOPB 2EIZA 3D18B 3V0WL 4PJ5E 2J12B 3G04B 2HFEB 1LNUA 1KELL 1HHJA 1NDGB 1NMAL 3VWJC 1MAKA 4JN1H 4UV7L 3ILQD 4ERSL 3OKLB 4MAYD 3X12A 3CDCA 2EZ0D 4Z5RB 3LIZH 4FG6D 3WXWL 1JPGA 5E8OB 1QSFB 4DGVL 5F97E 5MENA 3F6IA 4I2XB 2ORBL 5DJZA 3NPSB 1PKQB 5TE6H 1IC1A 5EO1B 4JHAH 1N4XL 4Y5YC 2WUBL 3D87B 4HWEL 1Z5LA 4MJID 3GSOA 1VHPA 4CADA 1C5CH 1LILA 2H26B 1QRNE 1NLBL 1T4KA 4LLAA 4EUPA 2PW2A 3PHOB 1KEGL 4ZAKC 1Q0YH 1OGTA 1AE6L 2EDKA 1CFQA 5KANG 1HXMB 1NGXA 3O6LL 2C3VB 3PQYE 3G5YA 4EJ1C 1TTUA 5FO8B 2DWEB 2CUMA 3C9NB 3SDAB 3RIFF 3ZDXF 3CX5J 5E1AA 4FQ1L 4HCRL 2FYYA 2NTFB 4LNRA 4OF0A 3V4UL 2YD3A 3G08A 2NX5A 1G7MB 4P57B 1X5LA 5D5MA 3OR6B 1S5HA 4JG1H 1FFPB 1I8KB 4F9LC 5LBSL 4X6DB 3QFJA 1F90H 5EU3B 2ID5A 3W11D 3IDXL 3MV7D 3RTQD 1CGUA 2A74A 4LCCB 5JXEA 3CXHJ 2EEDA 3K1DA 5DC4B 3BKMH 4F7EB 1UM4H 4NN5C 2EECA 4HLZG 5DMGC 3TFKC 1J0HA 1MWAB 4Z6AT 5E9DD 3QJFA 1LP9B 5CIPB 4GAJL 2B39A 3L1OH 4Z7UF 1UWXH 2Z31A 2HVKA 4QTHB 1EJOH 2UWEA 3NIFE 5TE6L 1D6EB 1P4IL 2NLJB 4JHAL 3UJIL 3K2UH 4UMGA 5AG8A 3HLAB 4X0KA 3JBG7 3QDMA 1RZ8B 3G5ZB 4QWWD 3ETBF 1H9VA 4HUUB 4R6UA 2J4WL 1NBVL 1F8TH 2JCCE 1DDHA 4XNMA 4EQ2A 1C5DA 3ARDC 2OMBA 4GW4B 4Z7QF 1W8OA 4R4FH 1W0VB 5GJSH 1I8MA 4QOKE 3QA3B 3MGOB 1IZJA 1IEAB 1CXLA 1WAAA 3BEWB 4YBQC 4MSWA 2CIKA 3EFDH 4YGVB 4MZ3A 5EN2A 4HS8H 2HJLB 4ZSOA 4M9OA 4QRQA 1D5BA 4HKJB 4JG1L 2VLJA 3CFCL 4ZS6D 3PWNA 3RL2B 3VXRB 5GSVA 5DT1H 1GH7A 2X4OB 3MNVA 1MSPA 4A6YA 3LCYA 4NO2B 1MFAH 3QUZB 5D7KE 5AAWA 5EOCL 4BH8B 2AK4B 3S37X 1PFCA 1C08B 5FDWB 4C4KT 5BJTA 3BKML 3M45A 2WUCL 4YLQT 1IGTA 4LPTA 2Z8WC 2OTUB 3X14A 5E8DH 4MD5B 1Y18A 3BH8B 3L1OL 2XN9A 1NC4D 5FCSH 4U1IA 1CDJA 1MCQA 2KDGA 3RX5A 4J6RL 2J1KA 3LVEA 5E6ZA 3JWOC 5F21B 3TGXA 1AHWA 5I1GH 1CLYL 5I75B 4XCCH 4LSPL 2Y7QB 2X4TB 4Y19E 4MQTB 4WU7A 3AU1A 1OF2B 4FQPA 5DK2A 4LPYA 2X70A 1QVOB 5CSZB 2LU4A 1LE5A 4LQFH 5GGTH 2Q86A 1F8TL 4R4NC 3MMEA 3TVMC 3O0RL 4I3RH 3QXAA 2NXYD 1JF5A 4R3SB 4DTGH 2CRIA 4R4FL 5GJSL 2FO4B 4HG4K 4NQCE 5D7IB 3VWJB 2A1WH 3TZVC 4WTZG 5DZLA 5I74C 5J9PB 4PRIA 2HJKA 1MNUL 4ZUWA 4PJHE 4OZFA 4NFBA 2RFXB 3P4OB 3R0MA 2IGFH 2ZPKH 2R1XB 3UYRH 4HS8L 5SV3A 4OTXH 3CXHK 3TP4A 3GSRB 4K7FB 3CH1B 2VAAB 4KK5C 1I9JH 1NFDE 1ZLVK 4AH2B 3QDJD 4JKPH 4FQXD 3VFRA 1FVEB 3RY6A 4Y5YB 1KJMB 1WJ3A 4WENB 5MERA 2X4UB 1RIVH 4X98A 1Z9MA 4ZFZB 3RWGA 1CIUA 4LHUB 3MJ8B 4QHNA 4O2FB 5LWYH 3O9WD 4X4ZA 5C0DB 1M71B 4JO4L 4KAQH 1T0NA 4ZAKB 3HI5H 4M61A 4JKWA 3GMLB 3QDGA 1S7WB 3UYPA 4JFXB 4P0DA 1BJ1H 5E8DL 3AM8C 4G6AD 4FQIL 3VG0H 3QWRD 4Z78A 4LRIA 4PJXF 3WMSA 4LLUB 5D1ZC 1X5KA 5HY9B 1MHHB 1T1WB 1A4KB 3KHQA 5D2LB 3OJDB 1RMFL 2QHLA 3BN9C 3L5XL 1DQJB 1JNHB 3WHE1 1JIBA 4P46A 5DEZA 2VLRB 1BIIA 3LPWA 5DUPH 2IAND 3MACH 3F8UB 3WIHH 2C26A 2FO1A 3QPXH 5K9OA 3P9WB 5DR5L 4D9QE 1NEZB 4HV8A 5AZ2H 4ELME 4I3RL 3CZFA 2DLGA 1G7HB 3KPOB 4PJGF 1FL6A 1GC1C 1NQBA 2XTJE 1T7ZA 2VL4A 1DLFH 1HYSD 2M8XA 4FFYL 3HN3A 4NRXA 4M6AA 4G6MH 4L29B 2Y06H 3HS0A 4NN5B 3UZQA 3TESA 3OKEA 1Q9WB 3A67L 3QUYD 1FC2D 1CXIA 2DRUA 4NNYB 2ZPKL 3MCKA 3UYRL 2B8OT 5IMKB 1DBJL 2IAMC 1AXTL 3B2VH 3QCVH 3MLWL 4OTXL 3H7BA 4O4YL 4L3CB 1I9JL 4FTVB 2CK0H 2PKDA 5IFHL 3FFCD 3IJHA 1J1XH 2VDLH 3GJEA 3P9MB 5J89A 5DVLA 1A4JA 4YR6A 4NQSB 5ESAB 2JF1A 4HUVB 1QRKA 2Y36H 3D39E 2L7UA 3FO9B 1KJVB 2WIIB 5I76B 3S9DB 1GGUA 4OCYH 5C0ND 2IQAA 2W65A 1I9EA 3ARDB 1WFTA 4PJDE 3OKMA 4J3SA 1VGKA 4ZTPH 3WO3B 1KXTB 2N4IA 2ZCHH 4HUXB 5LCVH 1FGNL 1U92A 4RX4A 3FFDB 3IDIB 5BZDA 3C5JA 4KHTH 3P4MA 4JFHE 5DO2C 3T4AB 4KZEH 3MV01 1RK1A 1D5ZB 3EFFA 4GKNA 1TQCB 2J5LC 3WIHL 2HTLC 1HH9A 3U48A 3RNKB 3UAJC 2Z93A 4CGTA 3FHAA 3LB6C 1ZANH 2J8UB 5KOVC 2AJVL 1IGFL 2ZSVB 2DF3A 4LKCA 5CEXA 5F6HJ 5T1MA 1TJHL 4Y1AD 4G43B 3TNMA 5IFJA 3RWCB 4K23L 4CNIA 4GRWH 3CU1A 1GOHA 2VN4A 5FK9B 3C08L 4RDQF 5IT2H 2NPLX 1OLLA 5D70L 4GXVL 1JJUA 1U8JA 5C6WH 5JPNB 1A7RH 2CK0L 4RAUB 1FVDA 2AEQH 4OF3A 1ORSB 1CGSL 2A6KA 1UWEH 1FBIH 3LQZB 3UPRA 4GFTB 1UGNA 3ZE1F 2A73B 5C9KA 5LQBH 3CVIH 4HSQA 4P3DA 4YHIB 4NC0B 2CXKA 2NW3B 4OCYL 3TVMB 1G6VK 3QI9C 2XFXA 2D9QB 5KS9F 5LCVL 2O93L 5KBNC 5CD3B 2GCYA 4GJTB 5CEZH 3RWFA 2G75B 3X3GH 4KZEL 4GG6B 1S7SB 1Z2KA 4EDXA 3S97C 1NPUA 5CCKL 3QRGH 4Z8FL 5ILTL 3BP5B 5BV7B 3C87A 3RVXC 1CFSB 3I2CH 2R15A 3U6RA 5T3ZE 4CU7A 2C9AA 5HHQB 4NQEA 1ZANL 3K0WA 4LF3B 1ROWA 2VO5A 4I0PC 3BISA 1FJ1B 3PV7A 2QL1A 2VDML 4X9IA 4GRLB 5EZIL 1NMBH 4OB5L 2W0PA 5EOTB 3ZDXE 2BCKB 1AGDA 5AYUH 2PO6A 5F7KC 4PRDA 5T3XH 2DLIA 3HPJB 5B21A 1O5DT 3MOQA 4BFBD 1D6VL 4JM2D 3HI1B 4OUUA 5D1ZB 1I1YA 4F33A 3SOBH 1RK0B 4LGPB 1U8OB 1E4XL 4IMLB 4QRPD 1VFOA 2YEZB 1IC7L 1VPOH 3ZLQC 5EU6D 2CIIA 4ZXBC 1FBIL 4PJ5A 3P0VH 3DLQR 2EC9U 4NCC1 3CVIL 4PS4H 2JE8A 4WFED 4EIZC 4ZFGL 2DQFB 1DSFL 3QCTH 2BVOB 2EDFA 4FNLL 1J9CT 2CDGA 1HIMH 1NLDH 3MLZL 1SJEA 1SYVA 1AC0A 1ZKAA 1DBBH 5DSCA 1L0XA 5B39B 3FO2A 4M5ZL 1LO4H 5HDBF 1ULVA 4HJGA 4J12A 1JPFB 1CGYA 1UM5L 4Z7UE 1U9KA 2YZ1A 1Q8MA 1MLBA 3GSNH 1LMKA 43C9A 5DD1H 4DOHE 4HLZH 4RMQA 2A6DB 1KB5A 1UXSB 4C55A 1SJVA 1X6NA 3WO4C 4OD2A 2F53D 3BDYH 4ONHB 3EYOB 5IB4B 1QRNA 5KVFH 1VERA 1N6VA 4RWYL 3BGAA 1MAJA 1MPAH 4WGWB 1NFIB 1PG7H 4Z7QE 1MCBA 4BH7A 5KJRL 3DUUB 3PQYA 2ZUTA 4XVTL 2HG5B 1ZHNA 2D7TL 1NMBL 4QKXB 1NJ9B 2RGSA 3DI2B 3QG6A 5C0FB 3MJ7A 4LVNB 5AYUL 5IVNA 5EZJB 2P24B 1CVRA 1YEGL 2A6IA 2AAVA 4DFHA 4P5TC 4WW2A 3UPCA 5C6PB 3QRFM 1XFPA 2NY3B 1YYLH 3P40A 5T3XL 3SGKC 3CLEL 2RIKA 5BQ7B 5FYKU 1EPFA 3DXAB 2HP4A 1OSPH 3ALXA 1EVTC 3STZB 2XWTA 3MCG1 1AO7D 1BVLB 2ATKA 5DJYA 4XP5H 4EI6A 5CFHA 2I26N 2OZ4L 1JK8B 1JI2A 3A6CH 4IRJD 4Y8AA 1T03L 1BEYH 3FCTB 5ESVA 2UY6A 4X99B 4RRPA 1LO4L 4WHTB 2GJJA 2FIKB 4AIOA 1QO3B 1K9TA 4G8IA 2IH1B 4KH2A 3AS2A 5J11C 5L8KB 1MCCA 4YBHA 3T2OA 1KLUA 2OBGA 4PLNC 5GQBA 3U4AA 1MJJB 4EIGB 4OCMC 3BDYL 2PYFA 3U46A 2A9MH 1A1NA 3MJ9H 3U9UB 1ZLVH 5EUOF 3TPUB 1RURL 3QXUA 3UTTD 2JCCA 3PJSA 3C6LB 4P4KB 1R0AH 3STBA 1FN4B 1FP5A 4N0YL 2WBKA 2VRAA 4EN3A 2P8MA 5GIRB 4QOKA 3S98A 3SQOH 5FM8A 3EO9H 5LG1A 1F3JA 3L5IA 5GRJH 5DVOA 5I19H 4JQVA 1A9EA 3JV6A 3O4LB 4HWUA 1QR4A 2HTKC 2VIRA 3AXLB 3BVNA 1DL7L 3ARGA 5EU7E 1A7QH 1NGWB 5GRWA 1U8HB 2X89A 4R2GB 4XPTH 4D3CH 4OIBA 3MRRA 4XVJL 3VJ6A 3UBXA 1N6QH 2H2SC 2B2XH 4GKZA 3SKNA 3VRIB 3KLAA 5ICXA 3DNKA 4U1JA 5EFIB 4MA3B 3W2DL 3A6CL 5IW6A 4AL8H 4WO4A 2ZUQC 2NY5L 3GSUB 4GG8A 4XAWL 1EO5A 5JQHC 1VFBB 3SPVA 4PJXE 2JELL 2MHAB 3RVTD 1C7TA 4LK4A 4PLJC 1HQ4B 3MV8B 3WUZA 2H9GA 3PG2A 4UT7H 1QFPA 3TBVA 2AQ2A 4OT1H 3QR2A 3OJMB 4Y19A 4OGAD 1EMTL 1J87A 4D9RD 4M5YL 3ZYJA 1CFNB 4JHBA 3ZE0E 3E6FA 1C12B 2PNDA 1CLOL 2RQ8A 2YBRB 3WFCL 2VQ1B 4LSUH 2IF7A 1T20A 2ZNWA 3L3JA 1R0AL 2GT9B 3IFOB 1YJDH 4ZXBB 1QR1B 1R3IL 1MCEA 3OX8A 3PWUB 3QEUA 1JYVA 1PY9A 4NQCA 3SQOL 1EIBA 5JHDD 3S3SA 1DCLA 5IV2A 5SX5K 3VWKB 1DLHB 1FLRH 1RJYB 1GL4B 2IH3B 4PJHA 1B0RA 5KG9B 2EYRA 3N85L 5I19L 2Z91B 1UACL 4N0RA 1MFEH 2P42B 3GMPA 3O2WH 3PGDA 4WEBH 1U8LB 3UTZA 4LVEA 5IW1A 1W0WA 5ISZD 3QWOB 1NFDA 4H5SA 4HS3A 3GK8L 3WLBB 1F4WL 2VXQL 5JXEC 4D3CL 4JM4H 4WW1A 3HC4H 2YD9A 4MJ2A 4PJAB 1AP2A 3WO4B 3FRUB 4DW2H 1PJ9A 3IKCB 4XWOD 1JMZA 4XRCB 3LAFA 3SE8L 3QPQD 5JDJA 1KCKA 4AL8L 4X8JA 2Z31C 1U8PB 3D2UB 4HWNA 4TUOA 1GGBH 4JO2H 5E2UL 2YUVA 5CD5C 2M2DA 3H9SB 4NN6C 4YHKH 1NCWL 2IBZY 1AKJA 1KTLA 4PJFB 4P5TB 3O2VH 4YXHL 3QUZD 5L7XH 4O51B 4OT1L 1QD0A 3VXTB 3FT3A 1LVEA 3WIIH 2A9NH 2X2YA 1G7PA 4RMTA 2XKSA 4KUZH 4QRSA 3UTSB 5H2BA 5DFVD 5D1QA 4LSUL 3MTRA 4GAFB 5IJVA 4ELMA 5DGQA 1YNTB 2RHEA 5D6CA 1JGLL 4OFYA 4OFKA 1WZ1L 4YXLH 1AXSA 1II4E 4QXTB 1Q0XL 1CFTB 4XP4H 1EEYA 1P2CB 1PZUB 5FYJD 5DJ2A 3UX9B 4K7PY 1FLRL 1AR1C 3MRDA 3U30B 1JPST 2PTTB 1OOAA 1BFTA 1LO5A 1MFEL 4NBZB 4QXUH 3ZDZF 3BRDA 5GRXG 4GBXA 5FYLL 4C59B 3VGHA 1WEJH 5DJ0A 3HRPA 4ZFOB 5KSBF 5HVHC 1X5YA 3QXDB 1MLCB 4UBDD 4CAGA 4JM4L 3CSGA 3HI6L 4HIIA 3ARFB 4MQSB 4I5BA 1ZHLA 1CIDA 4DW2L 3PWLB 3KS0J 3WS6A 3FQXA 5FO9A 1UQSB 3VFTB 5EZLB 4S1RL 5EUKA 5KS9E 3RWEB 4PJDA 1A3RH 1YEDB 1AIFA 3CSPA 2HLAB 4HBCH 4M1DL 4MS8C 1AHWC 4QCIA 2IADB 1CYGA 3MRLB 4KKLD 2C4FT 4F37K 4HDIA 1Y6KR 4N8VB 1J05B 3HNSH 2I9LB 4PGEB 5SWSB 5K9QG 2CO7B 4L4VB 1N5AA 1NANI 1JGUH 4OLUH 2A9NL 1OP9A 2VDKH 3CFIC 3GI9H 5EG6C 1Y0LA 3GKWH 3WIFB 1UCBL 2EIZB 4K3GA 5A2JH 3FN3A 1HHJB 1HCFX 3BYTA 4ZG1A 1F4YH 4JFEE 3X12B 3TT1L 4E41E 1OAXH 1CDIA 3MLXL 3HKFA 2EDOA 1D5IH 1JPGB 4KTYA 1KJ3H 4XP9L 4CMMA 5MENB 4TSCH 1Z9LA 5DJZB 2AEPH 1A9BA 2JB6A 4PGCB 3RY6C 3I6GA 3CFKA 3B9KA 1EGJL 1RZ7H 4I13B 3F7PC 1Z5LB 5JA8B 4XPBL 4CADB 4R4BA 3FZUC 3OSKA 4LMQI 5FYKL 3ZDYF 2ADFL 3HG1E 5DD3L 4EUPB 4GMTL 2PW2B 2VSCA 4M3JA 5J6HA 3D85A 1OGTB 4XWGH 4DK6A 1CFQB 3WNOA 1NGXB 1ODAA 1CK0H 1OAYH 3T1FA 3UP1A 4CVUA 1FHGA 3G5YB 4LRIC 1ADQH 1IGMH 4QTIH 3D25A 4HIEA 2VLKE 2QQKH 4IIQC 3U7WH 2ED9A 5HDBE 2CJUL 1BLNA 4I4WA 5E1AB 4UNUA 2QR0A 4M6OH 2VXUH 4LNRB 5DD6A 1TVBA 3G08B 1T5XA 2NX5B 3B5GA 2BSRA 1EBAA 2OXHA 3EOTH 5D5MB 1YNLH 4CKVX 5IMOA 2J2ZA 4I77H 1S5HB 5ID0A 5IUSA 1KF9B 2Q76A 5INDA 1G9NL 3CK0H 4AMKH 3QFJB 5IQ7H 4MDJA 1INDL 4NKOA 4BUGA 1KIUA 4U6VH 4L5FL 3ULSA 2PW1A 5CGMA 1L7IH 3DV6A 2A74B 4PFEA 3G9VA 4M1GL 4HK3N 3C8DA 3ZSSA 5DD0L 2XXMB 1YN6A 4D0DA 4ETYA 4FS0A 4YO0A 1K6QL 2VDQH 1FNHA 3QJFB 4LKXA 5JW4N 4MJIE 2LV4A 1TIUA 3OR7A 2HVKB 3DX9A 4IDLA 2AEPL 2UWEB 2VAJA 4RWHA 4OD1H 4X0KB 4KTEH 3BIAX 1M05A 1U3ZA 4HJ0D 3QDMB 2R1YA 4M8QA 4NN6B 4NQUA 4Z0BH 1A02N 1AGBA 4LHUG 3HHRB 4PRPE 1T3FA 4Z95H 1S8DA 3BZ4A 4ZFFA 1TCRA 1HINH 2VITA 3LRSA 4P4RA 3TT3L 1SBSL 2LFGA 1DDHB 4XNMB 1C5DB 3ULVD 1BOGA 2X4QA 4N5ED 1OAYL 5CUSH 5CKAA 4M93C 1IGML 1I8MB 5TH2A 3CVHL 2I25N 4Q2ZA 3IVKB 4Z7UA 1Y6MR 4XBGA 3WCYA 3EDDA 2YSSA 2VXUL 4M6OL 2IG2L 4FZEL 4OAWA 3MV7E 2CIKB 5EN2B 2APTA 1YNLL 4ZSOB 4S1QH 4QRQB 1D5BB 5ABDE 4AEEA 2VLJB 3GBMH 1B0WA 1YEFH 3EOAA 3PWNB 4MD0A 5D71H 5GSVB 1NEZG 3MNVB 4A6YB 5JLZA 3HPLA 5E9DE 5FUCC 4CU8A 1L7IL 2AK1H 4P3CL 5TF0A 2J6EL 2V17L 2M1KA 5BJTB 1RIHL 2AERT 1IGTB 2QTEA 2JJSA 5IESL 3PP4L 3L3DA 3X14B 2CD0A 1Y18B 4XMPH 1DFBL 1ZLUK 3IJSA 5GGRY 3HZMA 2XN9B 4U1IB 2AJZA 3FONA 4PG9A 5F9OH 3BE1H 4H0IA 4S1SH 3C60A 2V5YA 1AHWB 2OJZH 4YDKH 5BXFA 1NGZA 3MYJA 4YAQA 1DEDA 3NAAL 3U0WL 5J3HC 2C4XA 3AU1B 4WU7B 5DK2B 3E6HA 2NY2C 1WICA 2X70B 2FX8L 4I3SL 4M4RA 3TCLA 1LE5B 2Q86B 2H8PA 1FIGH 4JO1L 3HRZA 3MMEB 3QUMA 1YYML 5E1HB 1RZJH 3KLDA 5C3TA 3QXAB 4APQA 5CUSL 3NCYS 2NY1D 1DVFD 4RA0C 2F5BH 2WP3O 4PRIB 1LK3H 4NZUH 2HJKB 4XXDA 3U82B 4OCSL 4ZUWB 1SQ2N 4JJ5A 1QFWH 3DYMA 4EQ3A 4KTDH 3LHPH 1ZLSH 2CKBL 3EYSH 4FFWD 4S1QL 3G6AA 4KVNH 1V3JA 3DSFH 2G60H 1VEOA 3T77A 1YEFL 1YDPA 3VFRB 1T1XA 4CW1A 5MERB 5HYJD 3VD5A 4X98B 3RWGB 2P1YA 2AK1L 4QHNB 1T0NB 4M61B 1JZ5A 3QDGB 1U2CA 1OCWH 3J7HA 3KXFD 4WU5A 4HWBL 4O9HL 3BPCA 2GQHA 4DGIL 1ZSDA 3BD5A 5F9OL 4AYFA 3MODH 1S7TA 4DQOL 5HYIA 4X9FA 3EBAA 4S1SL 1NCDL 4U1LA 4QXGL 4QRTA 4H1LG 4YDKL 1KCVH 3QQ4A 5M94B 4LP4A 2K7PA 4P46B 1BIIB 5KVGL 1HKFA 2LTQC 5F9AC 5CP7A 2GSGA 3ULUL 3DURA 4HC1H 4PGDA 5K9OB 4AK1A 4HV8B 1RZJL 3CZFB 1FL6B 3SDCB 3EDJA 3GJFH 3BGFB 4NRXB 2CXGA 1LK3L 2B1AL 3HS0B 2JIXD 4PJXA 3OKEB 1MJ7H 2KL6A 3L9RB 1NGYA 3MCKB 4KTDL 3LHPL 4N8CH 1F02I 2JB5H 3NBNA 4MQXD 3H7BB 4RA3A 1HOCA 5DLML 5GGVL 2G60L 1L4IA 4F15C 3IJHB 2P8PA 3TJEH 4HWZA 1RPQA 3TN0A 4KI5C 4Z0XA 1RUAH 1A4JB 4YR6B 3W5NA 1I7RA 2XY2A 3CUPB 2BHZA 3Q0HA 3SGEH 5INCA 2IQAB 4IHOA 5J0BA 2W65B 4UIKH 2EYTA 3OKMB 4BFGA 1VGKB 4WW2C 4I48A 3I3BA 4OLEA 2D03H 3PGCA 3HFMH 1U92B 4M7LH 3MOBL 4M93B 5BZDB 5TQ0L 5EZOL 3C5JB 1ZHKA 3MCLL 5I1IH 3MODL 3P4MB 2IANE 5HD8C 4YNYA 3ZDZE 2EDHA 3BKYL 5E94A 4DKEH 2ICWI 1Q38A 1RK1B 5KSBE 5E7BA 1RZKC 3S36H 3QCUH 3EFFB 4WWKD 1LP9F 4GKNB 2EIEA 5HI5C 1CZ8L 2HFTA 3V8CA 2IPUK 4HC1L 4TUJA 1HH9B 1ZWIB 2DMBA 2V2WA 2E7MA 4UIMA 4M1CD 2Z93B 3ESUF 4WVRA 3QIBA 3D3VD 3DTXA 1QKZL 4LKCB 2ARWA 4JG0H 5T1MB 5CEXB 1FNEA 4TVPD 3PP3K 3KPLA 3TNMB 5IFJB 2BXZA 1T7VA 3Q2CA 5EC1A 4CNIB 3EYUH 1MWAH 3EO1B 3RWJA 5JR1L 3P77A 5DURD 4DJMA 1HHKA 5CIPH 1L9MA 5GGVY 5BOPA 2VR9A 1U8JB 4ZMAT 1FVDB 2ZZUT 2LU3A 1F2QA 4ZO7A 1QOKA 2A6KB 2ESVD 1I8IB 4GKSA 3UPRB 4BZYA 4EN3C 2DIBA 2NY2B 2QLVB 5D9SA 4P3DB 4KK9D 5CS7A 2OP4L 3MV9D 4MJ5A 1MUJA 4ZOEA 4JREC 3U7AA 2XFXB 5D1XD 5JW4Q 5A1AA 3ARGC 2GCYB 3ALWA 3RWFB 4U1NA 3ARSA 1CXKA 3B9DA 1TVDA 3EDEA 5I30L 4NM4L 4EDXB 2XIDA 3BAEH 4H25A 1GSMA 5MI0C 3LKRA 1K4CA 3L5WB 1SBBA 5FYLD 3RAJL 4Y1AE 1S7RA 2P43B 5GS0L 4WO4C 2AVGA 4JRXD 1MIMH 5ITBH 4V1DD 3ZZ1A 4NQEB 4YXKL 3RZCD 1A47A 2Q7NA 2H3NA 4ONOA 2APBA 1XR8A 1T89A 2X5PA 4NOBA 1AGDB 2PO6B 2X41A 3QULA 2W1NA 1DQMH 5FFLA 1MWAL 3PWPD 4PRDB 2VXTH 2IBBA 2UVEA 3FOLA 4XB8A 1NC2A 5D7IF 4OUUB 1I1YB 2R2BB 2DQUL 5CP3A 4F33B 3RRQA 3HMXA 5FYJH 3C5ZD 1MJ8L 2Y07H 4ZO8A 4KQ3H 3WNLA 4XVUC 3GO1L 4C56D 1IM3A 2FHCA 1VSCA 4G8EA 2VH5L 5I18H 2CIIB 2HT4C 4PJ5B 5F7EL 2VYRE 3I02A 4P2CG 1JHTA 3WNPA 5EBLA 4JFEA 2FL5A 3KPSD 1ZLWH 4W70A 2CDGB 4E41A 1SJEB 1SYVB 3OKOA 3S3PA 1G0YR 1U8NA 5DSCB 3FO2B 4ZYKA 2HT2C 3H8NA 4HJJH 2EDDA 1MLBB 3E8UH 43C9B 3HE7A 1F58H 4WHYH 1KB5B 1J12A 3W82A 4WIQA 3BAEL 3MXWL 1JZ8A 4OD2B 1MH5A 1QRNB 4G6KH 3HG1A 4UTBH 5D2LF 1MIML 4HBQA 4YHLL 1MIEL 4BH7B 3PQYB 4U6YB 5FYKD 4MX7A 5KTEH 1ZHNB 3HE6A 4HPYH 4K8RL 4N0CD 4RMWA 4BFIA 2VLKA 4JFPB 3QG6B 3MJ7B 1X44A 1YEKH 3RUGF 2VLMD 2A6IB 3UJJH 1DUYA 1DQML 4QRPE 4WW2B 2BY1A 2VXTL 1HDMA 1X6LA 5EU6E 1YQVH 3DBXA 4WFEE 2DLTA 5F7LB 3H0TA 3PDOB 1GIGH 4MAYA 2XWTB 5D1QC 2X05A 1SY6A 3EAKA 4KU1A 3NZ8A 5DHXB 2ATKB 5I18L 1LQSR 5DJYB 2XTJC 2R69L 4EI6B 2NY7L 5EH1A 4OI9A 4HEPG 5FUZL 2IFFL 3IJYA 1XGYL 2CK2A 2CDFA 5ESVB 3TO4D 4MJIA 2F53E 4HJJL 3STLA 4J3VA 4GBXC 3E8UL 3SE9L 4MA8H 4G8IB 1F58L 2HWZH 3C8HA 3ZYOA 2WBJC 3QO1A 5JIIA 2A77L 5F9JA 3VH8G 1EXUB 1KLUB 3LKSA 1N64H 5F7NC 3U46B 2PYFB 4PRPA 1A1NB 1XGQA 1ACYL 1XF5A 4NUJA 4LCYA 1OARH 3WS6C 4HKXA 2D0HA 2OK0L 2JCCB 1AGEA 3MJ9A 3PJSB 3VFPA 4B7IA 4G80A 3WNKA 3TLRA 3FB7A 4JFYA 5C0CD 3QZWG 2K7QA 3AAZA 2COQA 1QPXA 4CL7A 4EN3B 1LHZA 4MB4A 1FPTH 5KTEL 3BMWA 2X09A 1D5XA 4QOKB 1BM3L 2EDNA 4A2MA 1BPVA 3IDJA 3RY5A 1NKRA 1YEKL 4OCNC 3B9VA 4JREB 1V5JA 4HQQH 3UJJL 5DMYA 1AO7E 1UJTA 3MV7A 4I18A 3ILPA 3JV6B 5F96H 1B4JH 2J8UF 3BVNB 4X7CC 3RTQA 3ARGB 5E56A 4JDVA 3ULVF 4XP6H 3SJVD 4U1MA 4LSVH 4Q7DA 3MUJA 3MRRB 1CE6A 5MI0B 3VJ6B 1BQHG 3UBXB 5E9DA 4H26A 4GKZB 4UI2A 3SKNB 3KLAB 5DJAA 5ICXB 3NACH 4U1JB 3MNWA 3T08A 5IW6B 4WO4B 2YXMA 2E8ZA 4GG8B 2ZOLA 4LIQL 1A1OA 1GGTA 4J4PD 4W6XB 3V6FA 3SPVB 5BMFH 2YKLL 2WM0A 3B9KC 4MA8L 7CGTA 4TPRH 1Z6JT 2H9GB 2UY7A 1FZMA 2NCMA 3BZFB 5MEPA 4Y19B 1TCMA 1D5MA 3E6FB 5F88A 4K3EH 3JWOH 5HDQL 4BSJA 1OM3H 3WHE0 3L3JB 3RBSA 5E99L 1JGEB 3OX8B 3CFJA 5L6YH 3QEUB 5E8EA 4NQCB 4M00A 2WP3T 5AD0B 2DICA 3MO1A 5IV2B 5E03A 4N8VG 4PJHB 2X4SA 1B0RB 5JZ7C 4ZTOH 2EYRB 3NCMA 3PIQA 4XNYH 1NUNB 3GMPB 3PGDB 4CMHC 4F2MA 3UTZB 5DUBA 5IW1B 1F4XH 1W0WB 5FV2A 4H5SB 1NFDB 5I66A 4HS3B 4PBXA 5IBTL 1JN6A 2F8VA 4WW1B 5BO1L 2GY7B 1AP2B 1J0JA 5ADOH 5GSRA 1NC4A 3IAGC 5BV7H 5DZNA 1OSZA 3A6BH 3FHQA 3ZT5A 1CL7L 1A7NL 3EJJX 4X8JB 4TUOB 2E5EA 4BZ1L 2YPLD 3PP3H 4D9RE 1BZQK 4OF7A 3JWDC 1YUHA 2HFFA 3BZEA 2CMRH 1AKJB 4YE4H 2PXYD 1UEMA 1F42A 1E4WH 4LOUD 3BRGC 4EUPG 3FT3B 4OBRA 4U1SA 5JW3H 1WITA 1G7PB 5I6XC 4NC1E 3QEHA 4QRSB 5JHDE 3JWOL 5H2BB 4ODHL 4PP1C 1FNGA 4OCXH 2FRGP 5ALBH 4Z9KB 5IJVB 4ELMB 5A16A 3GMMA 2L4OA 5D6CB 3EHBC 3ULUD 2XTJB 1AXSB 3CDFA 1EEYB 2BJMH 5ISZE 5DJ2B 4HAGA 2P49B 4LEOA 4FQXA 3MRDB 1NCNA 4DKDC 1NCAL 4ZTOL 3BI9X 1LO5B 1GC1H 2DQGL 3ABZA 4GBXB 3O9WA 1EHAA 5DVMA 2BRQA 5DJ0B 4F7CA 3BQUD 1WBZA 4TNWF 5GZOC 4DKFH 4Y2DC 4HIIB 1UCTA 4YDLB 4I5BB 1ZHLB 1K85A 3QWRA 2JJSC 1K8DB 2XY1A 4LLYA 5EIVA 1K3IA 3FQXB 5FO9B 3A6BL 5EUKB 4F57H 3V2AR 4ZOAA 3MRKA 2DI8A 4P2YA 3REVA 1AIFB 3P2TA 4PRBA 3C60C 1X5JA 4KUCD 4EOWH 2CLVA 4QCIB 3T0XA 5F1KC 1U42A 3SE4A 5DHYA 1N26A 2IANA 2CMRL 4JHWH 3CJJA 3OTTA 4OFVA 1ZVYA 2F8OA 5KSBA 4X7FC 1N5AB 3QT2A 4DWHA 4NSKA 2DWDA 1OP3K 4KJWD 5JW3L 3KPMB 1SMOA 3P0YH 1TFHA 1KJ2A 1RUPH 1Y0LB 4GRMA 3TA3D 1QBBA 4APQC 1WWBX 4Y4FD 5EORL 1VEPA 5FYJE 3VRJA 3MLSH 3Q1SH 5ERWA 1HSBA 4OLYH 3QUYA 4M48H 5J12C 4EEEA 4JVUA 3BPOB 4TTDD 1KCSH 1Q1JH 3MRCA 4HXAH 1XT5A 3FFCA 1G1YA 1KFAL 3IS0X 4CMMB 4U31A 5FCUH 1A9BB 5ESQA 1DBKH 4NT6A 2V5SA 1OAUH 3I6GB 3CFKB 3HB3C 4XBEL 5DUMH 1BECA 5HGHA 3B9KB 1IVLA 3K7UA 4H88H 5CZXC 3DSNA 4R4BB 4MZ2A 3NGBC 1UH3A 1ZS8A 4XPAH 4Q9RH 3GFUA 3SDCD 1J7VR 3AMKA 5J6HB 3D85B 5I1CL 4NP4H 2WIMA 4M9PA 5EBWA 1N7MH 3T1FB 1U6AH 4K7PH 1TJGL 3H3PL 3KGRA 5E4IA 4NGHH 5LXGL 1ZT4A 4P23D 3D25B 4HIEB 3ZKMC 5GGUA 1BLNB