3VRLF

Crystal structure of bmj4 p24 capsid protein in complex with a10f9 fab
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A10F9 Fab heavy chain
publication title Structure of the HIV-1 capsid protein p24 in complex with the broad-spectrum antibody A10F9
rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system/viral protein
total genus 50
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07654 C1-set Immunoglobulin C1-set domain
F PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vrlF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vrlF01
3GNML 2O5YL 4G8GA 1KELH 1Q9WA 2HLFC 2WINB 4YDJA 4QXGL 4K9EC 3SBWA 1P53A 3X11A 2PCPB 4AG4H 1DBAL 3HUJB 1GPOL 3KYKL 4JFPA 3IRPX 1U93A 4M5YL 4RFEA 4X7FC 3I50H 4LLWA 1RZIB 5BRZB 5ENWA 4IS6B 4HPOL 3EO1A 5DURD 3D25B 1MRFH 2APTA 5I1AA 1QFWI 3C6LD 1RZGB 3S5LA 3V7MA 3VXRB 2F5AH 4AENB 1AGCA 2DQCL 5D93C 1DQLL 3QDMB 4NRYB 3ILQD 4U6YA 5EU4B 4KDTA 1AO7E 3Q5OA 4Z9KB 1RURL 5T3ZH 1VADB 3QUKA 4GJTB 2X70A 1F97A 4RFNC 1FJ1B 5TQ0H 5K9KA 4G8EA 5L7XL 2X10A 3GSNH 3CU1A 1MAMH 5JIIA 5LCVH 1NGZB 3FMGH 5EZLB 4N8CL 2VLJA 2R1WB 3L95B 3P11L 4R2GB 3MRBA 1IEAB 1A7BA 2A9NH 3F6LA 4UV4H 1SVZA 4FQXB 2B2XL 3OKOB 1T22A 4Y4KA 3MGTA 4PJEE 1P69B 3FJTA 4KMTH 1AQDB 2H2SD 1EO8H 4PP2A 3GSOB 3X13A 3IETA 4PRID 1DUYB 2X44D 4RFOH 5F9AC 4KK5D 5CP3H 1T0NB 5F6IB 4K7PX 4CJ1A 3H9HA 1KTLB 3LSOB 4NPYA 4MAYA 4N0RA 1GGIL 1A22B 3F12A 3MLYH 3VFWB 3LN4A 4P49A 2IMMA 3HE7B 2WWKO 5E8EB 5J6HB 5F7LB 5EUKA 4ZO7A 5J89A 1E6JL 2BJML 1T5WB 4X8JB 3LKRA 2NXYD 1JGDB 3DX8A 5JLZB 2BOBA 3IKCB 1IC7H 5DFWH 3GMQB 5IT2L 3OJDB 5BV7B 1ZLUH 4NUGH 1DQMH 5E8PB 2AEPH 4HS3A 1ZLSH 2GKIA 5FUOL 1NMAH 2GW5A 5F7YC 3S36X 3U0TA 4BSVA 5IVZB 1EERB 3U4BL 3KWWB 2JF1A 1DCLA 2NY4B 3DJ9A 3N9GH 4QHMB 1AR2A 3GKZA 5KJRH 2FO1A 3HE6C 3VRLE 3BUYB 5FGCE 5D7JD 4CBPA 5L6YH 4OZGF 1U3ZA 1OCWL 5IV2B 4HLZH 3KHQA 1JGLL 4PJIF 3FO2A 5TF1L 3D5OF 3PGCA 1HH6B 4NZTL 4GOSA 4KJYA 3MYJA 1G7IA 2Q8AH 4NM8H 1T04A 5CGYD 4X5WB 3P9MA 3BMVA 1NSNL 5GGUA 4X6CB 4X7TB 1TQBB 4O2FB 4XPHL 4WJ5B 1FVCA 3SDDA 4IHOA 2ZCKH 4Q9CA 3C60C 2IBGA 1XF2B 5CWSB 3O2VH 3BDYL 1M1SA 4OF0A 4YHIB 1RUMH 1KULA 4GLRH 1Z3GH 2LFGA 3RWCA 1OPGH 4NQEB 1G7JB 2P5ED 1HEZA 4I0PB 4XHJC 5E8DH 1G6RB 1HOCA 4EUPG 1J1PL 1I3VA 1NGYB 1RUQL 1JNLH 3F8UB 3O3BA 5IFAL 3F7YB 4GBXB 2E6PA 1G7HB 5BRZD 3TPKA 4JZOA 3VFMB 3SE8L 2D9QB 1AGDA 4HFUH 4ODUA 3TVMC 4JFDE 2IFFL 2DWDB 2V2TB 4OZIB 1MFDL 1RUPH 1JPGA 1RZJC 2ATKB 1GH7A 4XP4L 1KJMA 3DOSA 2YBRA 4PD4J 3PQYE 4Q9BA 3P4OB 3C2AL 1EFQA 12E8L 5DC4B 1RZFL 5K59E 1T83C 4RMVA 5EU7C 4DW2H 4JR9L 3CSYB 3S5LG 4M1CC 1S7SB 4NHCH 2K9UA 5LWYH 3LRSB 2I9LA 2P5WB 2C1OB 4I2XE 4FFYL 4R2GD 4K9EL 4X0KB 3VXMD 2C5DC 2WSKA 1QQDB 2Z31B 4G43B 4NQTA 3B9AA 3DSNA 3BXNA 5DC0A 4KI5C 4E42A 4OBSA 1F2XK 2UV3A 2AJ3A 1EX0A 4XBPA 5IQ7H 1SEBB 2VDQH 4HBQA 4GMSL 3H3BC 1F2QA 4NDMB 1KCVL 5F8RC 4W4OA 1A64A 5EOCJ 1A8JH 3L3IB 3LN5A 4PJ8C 2HVKA 4NC0B 4H8WH 1AGEB 4BFBD 4P3CL 4FFVC 2Q6WA 2P8PB 4Z7WF 3O45A 1D6EB 4Y16B 1YDPA 4NUJB 1OLZA 3L5WA 1UZ6F 4WTZG 4H26A 1CBVH 5IVXB 4XVUD 4OBRA 3I6LE 3LPWA 2VISB 1ZHBA 5KAQF 2EDWA 5EC2A 4K94C 5FUCE 3PIQB 3RGVA 3CVIH 5IB1A 3MACL 2DDQL 2NY4D 1EA9C 1J87A 1IE5A 4PR5A 5FGBC 4AH2B 4JRXE 1F4AA 2N7AA 2VR4A 3OPZL 4DAGL 1KB9K 1X5FA 5GGQL 5LJYH 3ZKXC 2VIRB 35C8L 3HR6A 5CD3B 1YQ2A 1TVDA 3MREA 5HGBA 4NO0B 4ZOBA 3DSFH 1O7VA 4X6DB 3X3FH 2XOTA 4XAWH 2A0LD 4OLUL 5CBAB 1FZOB 2V9TA 4V1DD 4GRLC 4M7KH 3EJYC 1HWHB 1J8HD 4J1UA 5F7KC 1PZ5B 4LKXA 4ZFZA 5KZCB 1J5OH 4UV7H 5T3ZE 4WY7H 2JLLA 2P49B 1UM4H 3L3DB 2GUOA 1P7HL 5D2LB 5IBLD 4Z7QE 3RX8A 2UY6A 5FUCC 5L2JB 5C07E 1MCOH 3RWIA 2LVCA 3CH1B 4NQED 4NYLA 2OZ4L 4ODTL 1GIGL 3O0RL 2X4PA 2EYRA 2YA2A 3JVGA 1CCZA 4PTUA 4I77H 5ID0B 1NFDE 3TCLB 2B4CC 4LIQH 5CJ5A 1TDQA 5EFIB 3TBTB 3ZTNH 3W81A 1NQBA 4FQHB 3BPLC 4JKMA 2XA3A 1I1AA 3QWRA 1PFCA 2YKLH 2ZCHH 3V95A 3OJVC 2YRLA 1IGIH 3K0WA 1FYTD 2Y23A 4E0RB 4DN3L 1ROWA 1ZGLM 2B1HH 3MNVA 4UBDD 3MV7B 2VWEE 3UJIH 3UPRB 4APQA 4LSVH 2UWEB 5E2TL 5MEOA 2J88L 4JFHE 2ZUTA 5LGKA 4I18C 4OUUB 3WIFB 1KACB 5L0QC 1C8PA 1U8PA 3Q2CA 4M6OL 2IH1B 4CADB 3QUXA 2P5WD 5MEPB 1QSFD 5TF0A 1YA5A 5JOPD 1HDMA 3IFNH 2Z31D 4YWGH 1IAKA 1YNLL 4OLYH 1PDKA 2J8UB 5C08D 4WHTB 3SGJA 2XPGB 3VXSB 4PRPA 3WNLA 4WUKL 3QIBA 4PG2C 4BFGA 1N6VA 3HI6H 1KG0A 1TNNA 1Q9OB 3SO3B 3SDXE 4YC2B 1U6AL 4WHCA 2GTZA 5BQ7A 4U1IA 3QP3A 3MO1B 4HAGA 4DUVA 3K8LA 1GHFH 3NCJL 4O51B 1F4HA 5KSVA 2QQQA 1DDHA 3GBML 3EJZC 1CIUA 2IADA 1VPOH 5JR1H 4KGJA 3WUZA 4C58B 1VSCA 5LG1A 3K4ZA 1DUZA 1RZJL 4U4BA 2CK2A 5BXFB 4YBHA 3IT8D 1ZWIB 1IM9A 1CGYA 1YNKH 4FQQA 2NXZD 2IAMB 3CX2A 4WFHD 2K1MA 3SKOB 1BVKA 4JAMB 4MA3A 4XMPL 2BSRB 4TUKH 4JY5H 4OSUL 1XEDA 2CKBA 4YR6B 4NGHL 5SX5K 2ATPA 2CKNA 4JM2C 5CSZA 1X5HA 2HH0H 2W9DH 5M7QA 4G8IA 3QIUA 4NHUB 1MJ7H 4MNQE 3RWGA 1KCUH 4PJAF 1V5JA 2BERA 1LGVA 5BVJB 1TFHA 2X9YA 3ZE1F 4N1CA 1T0PB 4XWGL 2P44B 1BGXL 1KTDB 5KSBB 15C8L 3UYPA 5HI5D 3HZVB 3NZ8B 4KK9D 1IGTB 5IR1B 4HUVB 1MCWW 5I76A 3L7EB 2VDLH 2BY2A 5GIRB 4E41D 1JNNH 1FNEA 4L4VD 4NQDB 4PJ7F 2ORBH 2IPUK 5E08H 1QYGL 1MCFA 3BQUB 1JTOA 3O3AA 5DS8A 1VCAA 1Q1JH 4UTAH 1FO0A 4PJEB 1A6UL 3C5ZC 2R0WH 3ILPB 5IVOA 1EUTA 3WS6C 3TYGL 4HQQH 4K94L 1EEYB 4XAKE 3O3UN 4TNWF 4Z95L 3K1DA 3UTQB 3KPNA 1TPXB 4YAQA 5AUMA 4I8DA 3S34L 3N1GC 1NFKA 2ZSVA 3CGTA 4Y4HB 5GGRB 5FV1L 5FO8A 3G6JA 5EUOF 1Z0NA 4PIRF 4GRWF 2H32B 3S4SA 3S37H 4U6HB 1Q0XL 4IOSD 4LCIH 4JHAH 5IOPB 1F3JA 5A43C 3QDGD 5JIHA 1VFAA 1Q9LA 5IGXL 3D69A 4ONGH 3RVUC 2PXYC 1TVHA 5ESQA 2H9GB 3WXVH 2HLFD 1DSFL 1LEKB 5I2IA 5IROC 2MOVA 5FOBB 4KVNL 2VL5A 3QCUH 1MCDA 3FQWB 4YBQD 5FGCB 3QUYB 4UDTB 1DLHA 1PYWA 1KN2L 2QHRH 4L4TB 3VGAB 3UYRL 3ARFB 4JM4H 4FQLL 4Z6AT 2Z9TA 1PG7X 4J4PA 4XNZC 2CXGA 3MNZA 1NGPL 1X5KA 3KLHC 5A2LH 1J12A 3MOQA 1ZTXL 3PWPB 4MDJA 4P2QA 4ZAKA 1WFOA 3IDJB 43C9B 1H3WM 4LCYA 3VXSD 1A9BA 2B4CL 1U8QA 4W68A 5ALCL 4PB0H 2PTTB 4D2NA 32C2A 3WV0A 4ZPVA 1CG9A 3SO5A 5D6DA 3ROOA 2R2EB 1JP5A 4XMKH 1FL6A 1YNTB 1SM3L 4HUWA 3ARQA 1IM3A 4JQXA 2OS7A 1K3IA 3BJLA 3MFFA 4S2SB 4H8WC 4EDXB 4LQFL 4Z7NF 4R6UA 3I6KA 3O8XA 5K9JH 3ZE0F 2NR6C 4CDHA 1RHHA 4X99A 3H7LA 4QRQA 2IAMD 2VLKA 3VRJA 5T3ZL 1AP2B 4RGNB 2W0FB 3O2DH 5TQ0L 3FOMA 2XTJB 3E6HB 3HS0A 4FQJL 4U05A 3STBA 2E7CA 4OQTA 3ZL4H 3R0MA 3TIDB 1MAML 5LCVL 1KNOA 2BHUA 4QNPE 1JF1B 1YEKH 5GS2H 3FMGL 3HI5L 4HJJH 2OL3H 1XF1A 1OAXH 3RP1A 5J0BA 4JJHA 5DD6B 2AAVA 1S5HA 2A9NL 4Q9RL 3MJ7B 3QWOA 2VAAA 4A6YL 3IXAB 1DBBH 1AO7D 2CIKA 4LIQE 1DFBL 5TDNB 4HIEB 1B9ZA 1IC5L 1EO8L 2OTWB 3PQYB 4JG1L 4Y0GA 4YNYA 4RFOL 3IDUA 3HA0A 3OKDA 5C6WH 3FCTA 3RZCB 4R7DB 4JKPH 2P7TB 4B50A 3QEQA 3ARBC 4XC3L 3MLYL 2D7TL 4D0BB 25C8H 5E9DE 4XVTL 3TFKC 1ZT1B 2V9RA 1PQZA 1S9YA 3HE6D 2H1PH 3ULVH 1J1OH 3K8KA 4PREA 3MLUL 3PJSB 5DJZA 4CGTA 1DQML 5TFSH 1NMAL 4PRNB 4KZEH 1CDCA 2X09A 1G7LB 1X5YA 3HMWH 1I7TB 2DYPA 2G75B 1EZVY 1ZT4B 4PJHF 4OZFB 5K9OA 5KJRL 5A2JH 4Y4HD 2ZUWA 5T3XL 1I3RB 5HY9B 5SWZB 1AD0A 1QNZL 1ZVHA 3NA4A 3FQRA 2FHBA 3QUMB 3DURA 2B1AL 3HPLB 3SGKA 3BPNC 3W0WA 4PJBF 1A7RL 1ZKAA 3ARSA 3FB6B 3U30C 5MEQA 3B9EA 3BP6B 1J11A 4NJAL 4LSRH 3MMEB 4K07A 4PJIA 5B8CA 4L4JA 3UAJD 2JJVA 3MODH 4XHJD 3VXUE 1RULL 1J10A 3ARDA 4HT1H 4TULL 2H8PA 4DK3A 3QUYD 3LHPH 3KYNA 4M6NL 1EDQA 4N1EA 1UA6H 5HTSA 3IJSA 5C0DB 5E95B 4UU9A 3GM8A 1RUML 2A9ML 2AXGB 3O2WL 1WEJL 5CJXA 4MA1C 4OCRH 5E70A 3TVMD 3BZFA 2NW3A 5GZOD 5IW3A 2NTFB 1JYWA 2R4RL 1S7RA 4GMTH 5E8DL 3HLAB 3CC5A 4U6TA 4QCIA 2HFEA 2C3XA 3MRIB 5IK3B 3VMOA 5ID1A 4X4YA 3C08H 5AYQA 3ZO0A 3KYOB 3FB8B 1BQHG 5DRXB 4WO4A 1OARH 3GSNB 4ZTPH 4HFUL 4M1CD 2VKXA 4GS7B 2UY7A 1OY3B 2Q1EA 3LS5L 1KB5A 4DWHA 4NRXB 2WANA 4FXKA 4S1QH 4F7TB 3EFFB 1RUPL 4Q6YA 4UI2A 1JPFA 3PWUB 3V7AE 1MLBA 4MLIA 4M7ZC 3VGBA 5JW3H 1NFDB 3H3PL 1NLBH 3IF1B 2MPAH 3RVVC 1A47A 1BBDL 4OGZA 4FABL 4FNLH 5KN5B 4OGYH 1XAUA 2NLJB 3VH8G 4MD4B 3V6FB 1F3DH 2X4SA 2AJUH 4M1DL 5GGSA 1SEQH 3DMMB 2EE6A 4JFDD 4NKDA 5C0BB 3WYRA 3H0TB 1JPTH 3BZ4A 4NQCA 1CT8B 2AEQL 4YBLC 1QUNA 2F15A 1WBZB 2UUDK 4ZUVA 5JW4N 4ENEC 1NKRA 1MHEA 5D1ZC 5DA0B 4FQXC 5KVDH 4W81A 3OKLA 1T2XA 5IQ7L 3PQYD 1EVTC 1LMKA 1UWEH 4LKCA 4UUJA 3QEUA 4HPYH 1W8NA 4Q2ZA 4HK3N 2ERJB 5F7NC 4KJPC 1MCPH 1QRNA 2DQJH 2F58L 3LZFL 4TVPE 4H8WL 5GSVB 4KHTH 4XB8A 4TUOA 3P2TA 5I1JH 2FX8L 2J5LB 4P9HC 4PRHA 5I1IH 2EXYD 5CIPB 5IW1A 2G2RB 5FA4B 3QFJB 3PABA 3CX5K 1BM3H 3D39A 4GT7A 4WGVB 4LRNH 1CBVL 1LO5A 2G5RA 3SE3C 1WJ3A 4I5BA 3IYLW 2C4XA 2WAHA 3X12A 4DTGL 4MJIA 2GK0B 4TYUA 4LASH 4K2UH 4MQ7A 1HKLH 3GB7A 1HHGB 1UYWH 1WT5A 3CVIL 3LQMA 4JY6B 3QXWA 2OQJB 3L5XH 2O5XL 1X5JA 3QUZA 4GRLD 4MCZA 4O9HL 2ZUQB 5HDQL 3EJYD 5H94B 4Z7UF 1M71B 1L0XA 1S9XB 4U1NB 3GFUA 3DV4B 1LEIA 2D4DA 4JRYA 5CZKA 1KLGB 1U8JB 5ABDE 4KRMB 1WFTA 2O5ZL 1OM3H 4P23A 5T1KA 3I6LD 5E94A 5F72S 5B39B 4XAWL 2NYYC 5E4IA 4NKIH 1KBGH 1ZANH 4LMQE 2P4AB 4P2OD 4ZTOH 4B5EA 1U8LB 1T2JA 4M7KL 3A6CH 4JRXD 4MDIA 1QLRB 4QHUA 1BIIB 2ZSWA 2X4OA 1J5OL 5HVGB 2WBJA 1IGYB 2DD8H 4G9DA 3MLWL 4H1LB 1PG7W 2BC4A 2VLRA 3TM6A 5F96H 4X7DC 3BO8B 4ZUSA 4L3CA 1IAIM 1XCQA 4AIZB 2R0LL 4HK0B 1MCOL 4OGXH 4PJ5E 3TBYB 4P4KA 2VZSA 1C16A 5DHVA 3AAZA 4QT5B 3DX6A 4WWKA 4I77L 3GHEH 3HMXA 3SGEH 3MRNA 4AIXA 1S7UB 1T1XB 1CXIA 4LIQL 5F7DB 5AZEL 4XVSL 5DRZB 4QXWA 4MJ5A 3BRDA 1A3RH 2VDMH 1MH5B 5T3ZD 3UPCA 2F74A 1FG2A 1QFWM 4PGDB 1VESA 2R69L 5FO7B 4DEPC 1BVLB 1LNUB 4OLVH 3UTOA 1QLEH 3MRFB 3OKMB 5EO0A 5C07D 1UVQA 1IGIL 3HRPA 3OAZK 5F9JB 2B1HL 2NX5A 4ZXBA 1KC5L 3UJIL 1MHCB 4XXDB 4K3JL 5EBMB 1KEGH 1JIBA 3QNXB 1CDJA 4LDEB 2HRPH 3ULVE 2Y06H 5GISL 5DEGA 3JV6B 3SDYL 2WBKA 4KK6D 4O58H 1QFHA 4QOKB 3S96B 4YPGA 2XQYG 2HFGL 1OF2A 2LABA 1WBXA 2QSVA 3NZHH 4OFYD 4IRSC 2F9BT 4WUUE 1QFUH 4X5XA 4OLYL 1P5VA 3O3DA 2OLDA 1MCCA 4HZLB 3VDCA 4GXUM 1HN1A 4XPTH 3PWVA 4QRSA 3VXPA 4JFHD 3WN5B 4GO6B 1NAMH 3UBXI 3EYFB 1VKXA 3K46A 5C0GA 4Y4FC 4FFZH 2D7PA 2AEWA 3BP4A 2VUOA 4LOUC 4LVOB 1VPOL 5JR1L 2ADFH 1DBKH 5ACZA 5I8EB 3MROA 3NN8B 3H3KA 3MV9B 4TN9A 4IRJB 4GXVL 4HUXA 5C09A 4JZJC 4FXGB 5C0EA 3ULVC 3LEVL 5SV3A 1NBVH 4M6MH 1F4XH 3V0WH 5D96C 4NWUH 3SQOH 2PYEA 1FN4A 3F5WB 3P9WB 4U0RC 3HKFA 1EXUB 5EOQH 5EU6B 1DE4B 2HH0L 3G9AB 2W9DL 3SE9L 5SWQA 5T5FH 4XP6H 5DUBB 1MJ7L 4XT1C 1KCUL 3NFPB 4OD1H 4JZNA 5JHDB 1IRAY 4YHZL 4P4RB 4MJ6A 4OCYL 4ETQA 1CL7L 2BRRH 5AD0B 2F8VA 5SX5H 4PJAA 3L3KA 4ZUTB 1UCTA 4OQ1A 3DYPA 3VFRA 5GZNC 2VDLL 1RFDL 1OTSC 1JNNL 3WJLA 2FL5A 4P9HL 4KDWA 4Q74A 1U9KA 1AR1D 4ZQKB 5JQ6H 3HZKB 1GGCH 5DMIL 1Q1JL 4PJ7A 1HSBB 2GITB 3QZWG 1EIBA 3KGRA 2IBZX 3E3QE 2R0WL 4Y5YC 3OG4B 3WHXB 2DMCA 3U7YL 3FTGA 2QSTA 4HQQL 4AM0B 1IEHA 2XKUA 3SJVA 3LD8C 5CKAA 1SJVA 1IGCL 4X6CF 2KQMA 4GKZB 3RWDB 2FJHB 3RVUD 2PXYD 3GBLA 4R90L 3EOYG 1QR4A 4HH9A 3QCVL 3TZVA 3FQUA 4N8VA 4DZ8A 1ZE3C 3FFDB 1INEL 3TWCH 1H0DA 1CICD 2F53A 1FRGH 1D5MA 4L29B 3LB6D 3M45A 4M1GH 5EUOA 1U3HA 3WFHA 1JFQH 2DJSA 2E6JA 4ONHB 4PJFE 4TVPL 2QKIA 4PJXA 3BKMH 4XAKD 3WLBB 4TRPH 3S35X 1FNGA 4DKEL 1IAOB 4ONGL 3LQAH 3O9WA 4YHKH 4L1DA 4U1HA 4RAHA 4DN4L 1OAKH 5CCKL 3GJEA 3BIKA 5JORA 5D5ME 3QCUL 2HFFA 5F7FA 5I19H 3HC4H 1GYAA 1U92A 2EYSB 2BHZA 4J3UA 4PLKC 4OZIF 4OFPA 4JM4L 1XT5A 3V0VB 1FP5A 2MJWA 4GG8B 1SBSH 3V5KA 3U2SB 4ONOA 4S10A 1UM6H 3CVHA 3CU7A 2DTML 4JHWH 2OXHA 3KPMA 2V5RA 4OFVA 1CFSA 1DBMH 2XWBA 4JLRB 5LAXA 4JCLA 5C0AA 3B43A 4M93B 2NR6D 5ICXA 5L2KB 4F7EA 5EOCH 4ZS7H 5AAWA 3IDYC 4QHKI 2D3VA 5CBEA 3W11D 3I6GB 4XMKL 3ZMRA 1CR9H 3SO3C 4EI5C 1L0YA 1XF3A 5C71A 2O93L 2HWZL 1N6QH 3QG6B 1XIWB 1N5AA 3ECBA 5FB8A 4G8FA 3UTPE 4EJ1C 1OOAA 5BS0E 5K9JL 1NFIB 1I8MB 2EKSB 3PGFH 4LSTL 1CL7I 2EZ0C 1A9EA 4JG0L 4MJ4A 4QEGA 4WU7B 3REVB 4C56E 3ARGC 3IDGA 5H35A 3CMOH 4DGYH 5TDOA 3OKEA 1NLDH 5I9QC 5JOFB 4FA8A 3PV6B 3U82B 1S9WA 2JIXD 1HYSC 1CFNB 1K5NB 1YEKL 4U1GB 4HWNA 3RY6A 2VE6B 1FVDB 2LQRA 3GSRA 4WW1B 3D3VB 1A1OB 1WCBB 4QTHB 4KK8C 5HI3C 5HHNB 3O6FA 3L3OB 3TFKD 5AZ2L 4K55A 1DBBL 1OQXA 3CDYA 4FOMA 1I1RA 3REWA 4XRCB 5TGBA 2ILLA 1JL8A 2YD6A 1MPAH 4JKPL 4H0GA 4WEUD 2BCKA 5CZVH 5MERA 1PKQA 1HQRA 5C0CB 1H15A 4ODVL 2ZOLB 2YPLE 3ZSSA 2H1PL 4LPXA 2JB5L 4X6DF 1A3QA 3ULVL 3SDCC 2FWOA 2HKHL 1R3HB 2BNUB 4WIQA 5I8CA 4XCEB 2BSTA 3QEGH 3U9UA 2YXMA 5I8KL 3U0PB 1YEJH 3CDFA 4KZEL 3JV4B 4XP1H 5EZJA 4RMWA 3BT2H 1MJJA 3RWFA 1U8OB 5E9DD 2YPKA 4XNMB 4XCNA 2WK2A 4PJHA 5D2LF 2ICCA 4MXWH 5HI4C 2UZIH 1MRDH 2WNGA 4YXHH 2QADC 4YFLF 1JN6B 4QXTA 4JFYA 3DVIA 4HFWA 5F9DC 4LSRL 4PJBA 1P1ZA 4N8VG 1Q8MA 2FIKB 3RTQB 3GMOB 4PRBB 3KR3H 3R0NA 4BFEA 3MODL 3TO4B 3TIEB 1ETZB 2G5BB 3LHPL 4XH2A 3PWNB 3THMH 1CS6A 3ZSTA 5DJDB 1YY8B 3QQNA 5KS9E 3AREC 1BQLL 4HWEL 3UZVB 4YHLH 4L9LC 5FYJH 4OM1L 5DYOB 4OCRL 4NQSB 3T4AB 3WS3B 3CDCA 4MLSA 5DUPH 2V2WA 5MI0B 2X9XA 1IARB 5CLWA 4GMTL 5D7IE 2HP4A 3OF6D 2JJSC 4U7KA 2Y6SC 1LO0L 3VRIA 3VXUD 1NMCC 3OZ9H 1MI5E 3O4LB 1ADQL 2HT4D 4UILL 1GC1C 4MQXD 4YH6A 3C08L 3MRGB 2IQAA 1HXYA 1P84K 4JGJA 2HKFL 3RVVD 5DZOA 1QA9A 2V6HA 2CSPA 4G8GB 4V2BA 4YHOL 1K4DA 2PW1B 4YDJB 3X11B 1OARL 2CH8A 4ZTPL 5HYSG 2CUMA 1KGCD 2V7NA 5GRVK 3SKJL 1X44A 2AQ1A 5DFVC 4S1QL 1P4BL 5I30H 3MLRL 4JFPB 3TJHC 1K6QH 5BO1L 2OL3B 1U93B 3NCCB 3QULA 5IEKB 4JKWA 3MXVH 4LLWB 3U4EB 2F54E 2DQUL 4PJGE 5D1ZD 1R5VA 2IG2H 5ADPH 2EXWC 4OF8A 5HHVH 4OGYL 5I1AB 5IQ9B 3PNWB 3S5LB 1JVKA 3IDIA 3VFOA 5DK2A 3VXQA 3NFSL 1WK0A 3LKSA 4NWTL 1UCBH 1NAKL 3WD5H 3GZKA 3C6LA 5SWSE 4V2CB 2ED9A 1JI2A 4UINH 4F7MA 1FYHB 3SY0A 4G8EB 5K9KB 2GJ6E 4U1SA 1VFBA 1QRKA 3ZDYE 2RFXA 4DZBB 5C9KA 2LAGB 4S1RL 3V5DA 3OJMB 3LMJH 5EIQA 5IMKA 1UWEL 3O41A 2V17H 3UDWC 2Y4SA 3DGGA 1INDH 4HPYL 5C0IB 1BWWA 4N0FA 5CP7B 3MRBB 1JGVH 1I1FA 5GS1A 1YEIL 2DQJL 2Z8RA 2UUDH 1W8OA 1T22B 5HGDB 1I85C 2EC9T 5BJTB 5I1JL 5I71B 5I1IL 3DRTA 5FCUH 1G9MH 4PP2B 3MC0A 3X13B 3ELAT 2GIYA 2CLZA 2RQ8A 4WU5A 4BH7A 3QEHA 1BFSA 4MNHA 4Z0XA 3H9HB 3NH7L 4JQVC 1ITCA 1EEZA 4MAYB 2D9CA 3HI1A 2DKSA 4G7VH 4PRIA 3F12B 3LN4B 1YJDC 1K8DB 5IHUL 1QBLH 1OQOA 4C54A 5CFHA 2VRAA 1HKLL 2NYYD 5C0FB 3T65B 2X41A 3RI5F 4TVPD 3T2OA 5KVMC 2VC2H 4PJEF 4X4MA 3L5XL 5EA0H 4GG6B 4NSKA 4EVNA 2R1YA 4HS3B 1BZQK 2XA8L 1MNUL 2FATL 2R1XA 3MLPA 1JWMA 1OM3L 2RCSH 3G5VA 1RAMA 4Z7UA 2DL2A 3VDBA 5A1AA 1Z9MA 5EBLB 3MOAH 3RL2A 2FD6L 4NKIL 1T80A 3CK0H 1MFAL 1MSPA 2L7JA 1CQYA 1WZLA 5KOVC 4RQQB 5JTWA 3RTQD 1UM5H 2GAZB 3CFCL 5D7JA 5C86A 4XPFH 3KPTA 2A74B 2BNRE 1B2WL 3O4OB 3DLQR 2VXVH 3HZYA 4LRIA 4P5MB 4Z18A 3SOBL 4KJYB 1ZVSB 1G7IB 2HTKC 3MYJB 5DWUH 1T04B 4PV8A 1AC6A 3M8OL 3STZA 1KIPB 3P30H 4G6MH 1D9KC 1H8NA 2CD0A 1FVCB 3SDDB 4IHOB 3H2WA 1JNJA 4C59B 4IRZL 1NEZA 2XRAL 3EDJA 4KQ3H 1B0RA 3KVQA 5DI8A 1A1MB 1IFHL 2XG4A 3LCYA 3WKMH 4CVZA 5D6CB 1BZ9A 4MB4A 3BP5A 1HEZB 2HFTA 1HOCB 1FBIH 1P2CA 4PJ5D 1R3IH 4TNVF 5GS2D 2QQNH 2EDQA 4RAUA 2WINA 1AY1L 3O3BB 1KJ2A 4OFIA 3HAEG 1TZIA 2PCPA 4JVUA 3HUJA 4AMKL 3RVWC 5JUEH 1IEBB 1KEGL 1AGDB 3QRGH 1KPRA 5T33L 4ODUB 3DXAE 3HG1E 2Y06L 3LN9A 4S1DC 3CFJA 4P9ML 4XXCC 1Y6NR 5KANG 1RZIA 3MUZ1 5BRZA 3ESUF 4KPHH 1JPGB 4IS6A 3HC0A 5FF6A 4Y4FD 4ZUWB 3D25A 1KJMB 1CDIA 4MJ2A 3DMMC 2D7QA 2DQFB 3V6OC 1RZGA 2DIAA 4TUJA 4AENA 4LOUD 4TSBH 1BD2B 1QFUL 2DQIH 4O5LH 4OD3H 1DEDA 5EU4A 3D18A 1IKFL 1RZKH 1X4YA 1YPZF 1GC1L 1J86A 4NN6C 4XPTL 1VADA 5KOMC 2Z4QB 2I9LB 2Y9RT 4WDIB 1FJ1A 1NAML 4ELMF 3ULVD 2V9QA 1RZ8A 5J3HD 5TE4H 3TT1L 5DD5H 2D03L 5EZLA 1OAUH 4IMLA 3VG9C 4ZNEE 1AXTL 3L95A 5ISZE 5IUSA 4O2EA 2ESVE 2AJ3B 4XBPB 5F7HA 4WUUD 4XWOC 2VQTA 2ARJQ 3OKOA 4UQ2B 5HDOA 4YDKL 2HJKA 1LE5B 4XHQA 5DVLA 5K59F 3OXRB 3KDMA 3UBXG 4XP9H 3CFBA 1AQDA 3LN5B 2HVKB 4PJCE 3UJJH 1T0NA 2Y07H 2Q6WB 4MAUH 2ZUVA 2E27L 5FYJE 4XBGA 1YDPB 5EOQL 5GZND 4DGVH 4HULB 1KOAA 3T0EC 4HF5H 3L5WB 4G6AC 4H26B 3VFWA 3HE7A 5J6HA 5E8EA 4F15C 5BOPA 4OD1L 3MCKA 1QVOA 7FABH 4TSAH 1CI5A 3CZFA 5CEYA 5EC2B 1JGDA 2BRRL 2XY1A 3IKCA 1HE7A 2BY1A 2H3NB 6FABL 4GXUN 3RGVB 2WUCH 3GJFH 3OJDA 5IB1B 4N5EC 4W6XB 5T1DH 1A02N 5I8OL 4PR5B 2AK4E 2C4FT 3V6ZA 5IVZA 3LPFA 4N5UA 4KKCC 1MFNA 4PB9H 4TOYL 2DRUA 4J3VA 4QHMA 4HUUA 3GI8L 5JQ6L 3MREB 5HGBB 1GGCL 1Z5LA 2VR5A 3BUYA 2X4NA 4NNXA 1Q94B 3BIAX 1MUJA 5GJSH 1CN4A 1UENA 5EORL 5KTEL 3MLVL 4MA8H 3RVTC 2X4UB 3MCLL 3BSZL 4M7LH 2DQEH 5FHBH 5CD5D 1NUNB 3EZJB 1HH6A 2HTLC 1JI1A 4J1UB 5J6GA 4ZFZB 4HWBL 3K3QA 1WWAX 4V1DA 1RUAL 4X6CA 3TWCL 3AMKA 1WICA 3MPCA 4WJ5A 3V8CA 3BD4A 4NYLB 1ZXQA 1N7MH 5I0ZA 5CWSA 2BHYA 2HLAA 4PTUB 2DM2A 2A77L 3BKML 4NQEA 4TRPL 4FHBD 2A38A 4YHKL 3V52H 4GW1A 1OAKL 1S3KH 1G6RA 1S78D 1H8SA 2VH5L 3X14A 2GY5A 2NNAB 4M3KB 3QAZB 1MFBL 5I19L 2VDRL 3F7YA 5F97E 1G7HA 4Z7QF 1WISA 3H9SE 1CDHA 3PDGA 2Y1VA 4EI6A 2GCYB 2YN3A 1XGUA 4K3DL 4EI5D 1KPVA 1SBSL 4APQB 1SMAA 2DWDA 1GOFA 5MEOB 2V2TA 2ZP0T 4OZIA 4MHHI 1UM6L 1NGQH 3F58H 1NFDF 4JHWL 3UCRA 1MRCH 1KCRH 1DBML 4I3RL 4EUPH 1BOGB 4DJMA 1MIEH 1MFEL 3BE1L 5I74C 4Y2DC 1U8PB 3NAAH 3P4OA 4IJ3B 2FBJH 4JVPA 3ZKNC 1CGWA 2W65A 1WZMA 3E2HC 1CR9L 3P0GB 1D5BA 2WW8A 5C2BL 1A7QL 3N1FC 1HDMB 4L3EE 4RMRA 5ELIA 1DQTA 3EYOB 3EBAA 2GEEA 1HYSD 3LRSA 2E7MA 2P5WA 2C1OA 3X17A 4PRPB 1QSFA 3FQNB 3KG5A 3QIBB 4Z7WE 1EHAA 4LVOC 2QSQA 4ZFOL 1KG0B 4ZD3H 5HYJE 2Z31A 4WI5A 4KK8D 1HSAA 4G43A 2Q3ZA 3NTCL 1MCNA 3LPGA 4M03A 4M00A 1M6OB 2GTZB 4Z0BH 5C08A 4X98A 3ISWA 5F1SA 1A7NL 5FXCH 3WKNA 4XX1E 5DUMH 3T3PE 1WWBX 1DDHB 2PR4H 1SEBA 3MV8E 2N56A 2VXSH 1NLDL 1E4WL 1OB1B 3JWNC 5AEAA 3QDJE 4OFDA 3S97C 3TGXA 4FQQB 1JHKH 1ES0B 3BPCB 3QPXH 4UAOC 2XI9A 4Z7VE 2O61A 3U36A 4J3SA 2OI9B 1F90H 3EYQC 3UTPD 2P8PA 3UTTE 5DVOA 5BS0D 3S3PA 1GRWA 1F4YH 3AS0A 4YDLB 3SDXF 4NKMB 4C56D 5A2IH 2F54B 2FO4A 4YK4B 5IM7A 2ITDB 3KXFE 3QQ9D 3KPOB 1W0WB 3EHBC 5DJ8B 4E9LA 1I1YA 2VISA 4ODSH 4G8IB 3QIUB 3VI3E 2J6EH 3RWGB 3BRGC 3VGEA 3PIQA 4ODHH 2AJXH 5TE7L 4N0UE 1ORQA 5CZVL 3TYFB 1RD6A 5FM5M 3X3GH 1I1CA 4AH2A 1LE9B 4KU1A 2GJ6B 1GGYA 4GSDH 4X9HA 5ADOL 1KIRB 3FRUB 5D2NE 3OSKA 4X6EB 2YPVH 5CD3A 1FNEB 2ZPKL 4RDQG 2X5PA 1ITBB 3FQXB 3QEGL 3RNQA 4WEBH 5DGQA 4X6DA 1YEJL 2PO6C 3H9YA 2QADD 5DS8B 4UT7H 3JXAA 5CINH 2JJWA 5F44A 4E41A 3FN3A 2X89D 2YC1A 3BT2L 4L4VA 4KROC 4DKDC 1FZOA 4F7CA 5EWIL 2B0SH 2NY2B 1U3JA 1B4RA 4HXBH 3MJ6A 2YPLD 3OHXA 1PZ5A 4MXWL 2NW2B 2UZIL 3L3DA 5D2LA 1XGYH 5L2JA 4YAQB 2ARWA 1E4KA 3A6OA 3W39A 3CLFH 5FO8B 3KR3L 2P1YA 3G6JB 5CSBA 4BZYA 2WUBH 4JPVL 3GMLA 3S4SB 1IGML 2Y6SD 3QI9B 5EFIA 3TBTA 3WCYA 2V5MA 4XC1H 1BZ7B 4FQHA 5D2NC 1EGJL 3INUL 4JGMA 4WI7A 8FABB 1Q0YH 3D69B 2BDNH 4EN3C 1TVHB 4YHLL 2AS5M 2DMBA 4HKXB 3JTSB 1CFVH 5ESQB 1TCMA 5FYJL 3QDGA 2IBZY 5I2IB 5IBTH 1T7XA 3K7UA 2VL5B 5DUPL 1Q9KA 4E0RA 4JPKH 1PYWB 3OKNB 3NACH 2XXMB 1ODAA 3TJHD 3UPRA 3VD3A 3BWAB 2VDOL 3NA9H 3BEVB 4LSUH 2FEDC 4YO0B 3WIHA 1MELA 3QH3A 5A3ID 2A6IB 3WIFA 3PG2A 4MDJB 2HVJA 4ZAKB 4K3EH 1DBJH 3ET9F 2IH1A 5FK9B 4YX2L 3QO0B 1A9BB 5MEPA 1U8QB 5I30L 1IVLA 1XIWC 1OTUC 4GAYB 4ZPVB 4WFGE 2XQYK 1CG9B 4LCCC 3ROOB 1Z9SA 1FL6B 2J8UA 4WHTA 2XPGA 3VXSA 1MI5D 1NUGA 1MWAL 1AI1H 1LO2H 4Z8FH 4XNYL 1Q9OA 1UJ3C 3CIQA 1FL5B 4HUMB 3I6KB 3O8XB 4O51A 4FQPA 1DANU 1RHHB 3MRCB 3ZZ1A 4QRQB 3BKJH 1HHIA 5ICYA 2VLKB 3OB0K 4OZHE 2MSPA 1NC4B 1AHWC 3RWEB 1CXHA 3G5XA 3FOMB 4ODBD 1KNOB 2IAMA 1GGBH 2F54D 1RJLA 3TA3C 2A83B 3KPRE 4KHXH 2V17L 3BP7B 2ZUSA 3U7AA 3AB0B 3Q6GH 2Q8BH 3AU1B 1S5HB 3K2UL 1HI6B 2AVGA 1QKZH 3QWOB 1FGNH 2BVTA 2CIKB 2Z93A 5SWSD 5IP4A 3TJEH 1WTLA 4YNYB 2LU7A 1ERNA 2GJ6D 4Q97A 2CK0H 1OAQH 3FCTB 5BVJA 1X5LA 2DKUA 4G9FB 2JJUA 5C70A 4QNPF 3QEQB 1NMBH 3HZVA 4G7VL 1CXFA 1IGTA 3SDAC 4HUVA 4JVWA 4NO3B 4I9WE 3VG0H 1PQZB 4H88L 3ULUC 2YD4A 2EEBA 4LLUB 4M62H 1AXSA 4HG4K 3FFCE 5FM4A 2OZ4A 3FAWA 3BQUA 1MF2L 5F1OB 5DJZB 3HE6A 2EDJA 2XN9E 3P0VL 1H5BA 4PJEA 2UVFA 2RCSL 3ALXA 3ILPA 1C5CH 2JELL 1JYXA 3BPOB 2HTKD 4GKOA 3SGDI 2EDBA 3QISA 4K8RH 5I6XC 5K9OB 2QR0B 1L9MA 4O4YH 1LO3H 1AD0B 5H2BB 5EU3A 5JW4R 3VFNB 1D9KD 3UTQA 5J57B 4D94A 5LKNA 4MQTB 1ZHNA 2V5TA 2QQLL 4RRPA 4Y4HA 2YWYA 4LNRA 3W0WB 4N0YH 3QI9D 4OZGB 5C3LD 1S7XB 4M7JH 5J06A 1ZLWK 4LHUB 5MEQB 5I1CL 2VXVL 5DJXA 1ZGLP 4LP5A 3UC0H 1F11A 4PRAB 5DDHA 1I8LC 1NL0H 4PJIB 3TN0C 4U6HA 5DSCA 1A7OH 1F58L 2YN5A 3PXHA 5HYQA 5IWLC 3ZHLA 4U2YA 2H8PB 3AY4C 1L4IA 4CVWA 3QIWC 4PUBL 2H9GA 2YA0A 2H6PA 4QWWC 5FOBA 1H3GA 1BLNA 4M4PA 4UU9B 3QUYA 4UDTA 2BNRD 3RVWD 5J1AB 3BZFB 4LFHD 4L4TA 3AC0A 4N1HB 5A2KH 5EULV 4NP4H 2VDPH 4UIKL 3ARFA 1A14L 1G9EA 1R3IL 4QCIB 1DJSA 2CRIA 5AYUL 4NNPH 2NY0C 1PEZA 3TVMA 3RWHA 3IDJA 3B9KC 1NANH 43C9A 1CDBA 5JUEL 3GIZH 3QRGL 2PTTA 4WVRA 4HHAB 1YMHB 5CAYB 3AVEA 1T83A 1TETL 2IPTL 2FECL 2UZYB 3QPQC 3ZYJA 2EIBA 4EDXA 1NC4D 2DQIL 3JSSA 1TZGH 4YGVB 5C8JA 1A0QL 3K1KC 4OD3L 3OTTA 4HWZB 4XWOD 2ZG3A 3V4UH 1S7TA 1CFTB 2X4SB 2V5SA 5L8LB 2W0FA 4U1JA 3DXAD 4NKDB 5TQ2H 3BZ4B 3OXSB 3RX5A 1JF1A 4ZUVB 5TPWH 1WIPA 3UTSE 3L1OL 5IFHL 3T04D 5CUSH 4JFDA 5AWNH 3OKLB 4Y4KC 3IB4A 4D3CL 1I8KB 4UUJB 3QEUB 2ZG1A 1SY6H 2QLVB 1YQVH 2ID5A 3AROA 3OKYA 3IXAA 1Z2KA 4EXPX 4XP9L 3PQYA 1TJIL 1OAYH 3UJJL 4P2RE 2WLYA 4TUOB 5J12B 2X2YA 1QBBA 4MA7L 1QFWH 1NCDL 4HEME 4MAUL 4N5ED 5IW1B 3SCMB 4IIQC 3WFDL 4QGYA 2P7TA 3VXNA 1R24B 4HF5L 3D39B 2OM5A 3EDKA 4KKCD 4D0BA 5ISZD 4KVCL 1LO5B 4Z7WB 5HHQB 2ESVD 4I5BB 5FGBA 3DRQA 2A6KA 4TSAL 1NCAH 2Q76B 4MJIB 3QB7C 1U8IB 3DYMA 4MQ7B 3ZHDA 3PHQA 3SKMA 3GB7B 4XMLL 1NCBH 4QRRE 2WUCL 1WAAA 3PJSA 2YSSB 1F00I 1S8DB 2J12B 4M61B 3QUZB 4PRNA 3OB8A 4X9GA 5FYJD 4PB9L 5J13B 2HTLD 3MCG1 4KGLA 1DLFH 2G75A 1ZT4A 1LEIB 3GKWH 4D9LH 1I3RA 4P23B 5T1KB 4GRLA 4LHUD 4OD2B 4P5TB 1B90A 1FNFA 3QUMA 2LU4A 1A6VH 3KXFB 2XT1B 1ZS8B 3DGCR 4MA8L 5K33A 4KY1H 4NJ9H 1H3TA 2MKWA 1MVFA 2AK4D 2DQEL 3ULUL 2I07B 4MDIB 4WRLA 1MHPH 2ED8A 2ZSWB 1KENH 2X4OB 4P2OA 4QF1B 2WBJB 4N0UB 1W72L 4RZCB 4OM0H 2YXFA 2VLRB 3NFNB 1TJGL 4PLJC 4WCYH 1AQKL 4JRXA 2VDNL 4ODWA 4ZUSB 4L3CB 1XCQB 1N4XL 2KKQA 5JDJA 4P4KB 2DI8A 1N7ML 1TQCB 1C16B 5DHVB 1KLFA 2YZ8A 3RAJL 2B5IB 5IEHB 1KEML 2IALB 4WWKB 2DN7A 1SBBA 2AXGA 3TPUA 3MRNB 1XZ0B 5E5UB 1UH4A 1C5DB 3V52L 4Y5XB 1KIUA 2NY1B 1S3KL 2F74B 1LWRA 3HLAA 1FG2B 4JFFE 1CTOA 1KTRL 4KRPB 3B2VH 3MRIA 4Y2DD 4TPRL 5IK3A 5EO0B 5CJOH 3KYOA 3ZKND 1PX4A 2OK0H 3FB8A 4BZ1H 3GNMH 2E7HA 5DRXA 2O5YH 2NX5B 1P9MC 4ZXBB 2MHAB 3B9VA 3GSNA 3VFGL 1PSKL 1XGQA 1TENA 5C07A 4DKFL 3W5MA 3KYKH 1GPOH 3EFFA 1MRCL 2FEEI 2W9EL 4M5YH 3J7HA 3PWUA 5DEGB 3MRPB 4UT6L 2AABL 2I60H 1MIEL 1YYLL 1FAIL 1NFDA 1Q72L 4HPOH 2FBJL 3MRJA 4PG2A 2NZ9D 4R7NA 2ZG2A 5KN5A 2NLJA 3H9SD 4EEEA 2DQCH 3HNTL 4MD4A 1T21B 4X5XB 4WHYG 2Q86B 1DQLH 5CP3A 2C26A 3LQZB 5D7LE 2JE8A 3ZKSD 5KSAB 1CZ8L 5D1QB 1EAPB 3PWVB 4ZD3L 4F37F 5IKCA 4QRSB 4OFYA 4R97C 1WBZA 3OG6B 4QRUB 3EYQD 5L7XH 1NDMB 5FHAL 4Z0BL 1VKXB 3ULVF 5C0GB 4YHNA 2EYTB 1CFBA 4W4OC 5DUML 5FOJA 1MCIA 4N8CH 4S1SH 3ZYZA 3GGWA 3MBEB 5ACZB 4MXQC 3EHBD 3P11H 3GJFB 3SCMD 3MZTA 1JRHL 4L3ED 4HGKC 4BQCA 4B41A 2B2XH 3QPXL 5GSVA 2ICWJ 5C09B 2BVYA 4LVNC 2WQRA 1F90L 7CGTA 5HYJD 1QSEE 3BYYA 1F4YL 2G2RA 5FA4A 3L9RB 1QZ1A 2KZWA 3MRLA 4H25B 4CN6A 3IFOA 1GGIH 3MV8D 5C9JB 4ODSL 2EDFA 1CIDA 4K8RC 3QDJD 2PO6D 4ODHL 1E6JH 2AJXL 4MJ6B 2OQJA 3X3GL 5EBWA 4KROD 3L3KB 2DF3A 2EDEA 3KPSE 3FO0L 3UTTD 4HW6A 3DX9A 1M71A 3VFRB 4U1NA 5FUOH 3KXFD 4PRDA 4QHKJ 5B39A 5C0RH 4MXVE 4QTIH 4OZFG 5CINL 2ZJSL 4XCCL 2X4RA 3DWTA 4LDOB 1U8LA 3QXDA 1KCSL 2LTQB 1OCWH 3OAUL 1ZLVK 3MJGX 1CLYH 3LKOA 2G9HA 3CXHJ 3FTGB 4IM8A 1BIIA 3VWJC 4ZOEA 5TF1H 1OVZA 3FT2A 3U0WL 3PP3H 2I5YH 1MVUA 4NZTH 5GRXG 3H7BA 4CVXA 5DLML 5CZXC 5HVFB 4HUNB 4EN3D 2FGWL 3TZVB 4HH9B 2A1WL 4DZ8B 2DOCA 1H0DB 4XPHH 3WDJA 4QT5A 4AT6B 4JFEE 2NY1D 1D5MB 2PXYA 1PG7H 4YJZL 2XICA 2EH8L 4KRPD 4ZFGL 4LVHB 1L6ZA 1S7UA 1T1XA 5EUOB 1FPTL 3BDYH 5DRZA 1I1AC 5E8NB 1CICA 3WFHB 3QAZC 4GRWB 4XC1L 2FEDD 2XN9B 1MH5A 4LPWA 2QKIB 2XZQH 43CAA 1NCUA 1KLUA 2WWMC 4PGDA 3VW3L 1CFVL 1OL0A 5FO7A 1LNUA 4XPAH 5IBTL 3OKMA 5JORB 1MFCL 3V4VL 5I73B 1RUQH 5MENE 2B39A 3QQ4B 4APQC 5F9JA 4P57A 3NACL 5TDPB 1U92B 5IFAH 5GSRA 1FIGH 2JB6A 2MMXA 3NA9L 5F9OH 1Z9OA 2Z0BA 3QNXA 3SE8H 3V5KB 4LU5L 1DN0B 5DJ0B 2W1NA 3QUXC 3IVKA 1C5BL 1JRHI 4HKZB 3CVHB 3JV6A 4PJFF 3KPMB 3UO1H 1CFSB 2XWBB 5C0AB 3C2SA 4NT6A 4XP4H 1XR9A 3MUHL 3R1GL 5D1QD 5A2FA 5D5MF 5CBEB 3C2AH 4R4FL 1LDPH 3VWKD 3T0WA 3CCHB 5DMYA 12E8H 4LCUB 4WI8A 1BEYH 1RZFH 5DJ2A 1XCTA 4HZLA 4JR9H 2DS4A 3VD9A 1XF3B 3DBXA 4R0LC 5I15H 1NC2D 3WN5A 1N5AB 5GRVL 3MBED 3ECBB 2APWA 4FFYH 4G8FB 2DLFL 4K9EH 3T2NL 4JFOA 2R29L 3MYZA 1A9EB 5DMGD 1G9NC 4K7PL 5FKAA 4Y8AA 1T7WA 4LLYB 1PLGL 3IDGB 4OCXH 3BESR 5I8EA 4WFGD 1G7QA 3MV9A 2OI9C 1KYOK 3ZT7A 3OKEB 2APFA 1JUFB 1S9WB 4WW2C 3GHBH 4FXGA 3RIAK 4XNXH 2VLME 5EN2A 3Q6GL 3D48R 3RQ3A 1T7ZA 4P3CH 2YUVA 3SDAD 1K9TA 2JIXA 3QIUC 1QKZL 4JPIA 1EXUA 1DE4A 4LGPB 3E6FA 3LDBB 1D7FA 5K9QI 3S36L 1CD8A 5DUBA 3REWB 5E5MB 5TGBB 3AS2A 3DUHA 4P5KB 3VFPA 1OAQL 1ZMYA 4YXLH 1U2HA 1N0XL 5SV4A 3PHSA 4F9PA 2F8OA 4HLZG 3VFVA 3KPRD 2BCKB 1NMBL 4WGWB 3MACH 2DDQH 3N0PB 4ZOAA 1PKQB 3BISA 3VG0L 3OPZH 1T1WB 1DVFD 2BXZA 3UTSB 2BNQB 1SJEA 5GGQH 4QY8B 3C09C 2MCG1 1PY9A 2AXJA 3MQIA 3RY4A 4ZQKA 5I8CB 1F4WL 3HZKA 3D1MC 2BSTB 2EDTA 1HSBA 2GITA 3U9UB 5FYKU 4QHNB 2WZPD 5B39G 2WM0A 3P4NA 1NBQA 1UG9A 5HGHB 2P43B 2JKXA 3IGAB 5EZJB 5C6PB 5JIPA 5HHXL 4AM0A 1YUHA 4K8RL 1J0YA 2YPKB 3HPJA 4I9WD 3SE4C 2YWZA 5ERWA 2M1KA 5IJVA 3U9PL 4XCNB 4ZDHA 4KZDL 3FFCD 4GKZA 4PJHB 3RWDA 2FJHA 4M5ZH 5FIEA 2I24N 2P47B 2VOTA 4KRNA 4H1LG 4OLWL 3V8OA 4M7JL 4QWWD 4YHPA 3PHOB 1UXSA 2XN9D 1T0MA 4JFYB 4L29A 1F13A 4PJBB 1NL0L 2Z91A 1GIGH 3IAPA 3O0RH 2A6DA 1J05B 1J0IA 4U1KB 3RVXC 4PY7B 4ONHA 3WO4B 1IAOA 4X6BA 2ICWA 2NY0D 1ZLWH 1D5IH 1ZT7A 4C4KO 1QBAA 3B9KD 3S37X 3BI9X 1AKJD 1CQKA 3I9GL 1S5IH 3J8F7 3NPSC 2YS4A 2PN5A 4FFWD 1EPFA 4PTTB 4J4PC 4NP4L 3F7QA 4L5FL 4YHYB 3MX0A 3V0VA 2R9HD 5HGAB 2Z92A 3F65A 3VRIB 1MY5A 4ONFL 1P7KB 5IHZA 1WIOA 4HXAL 3FKUS 1KSRA 2IQAB 4JLRA 1V8HA 3OF6A 5L9DL 1JE6A 5D6DC 1K4DB 5CJQL 5KS9F 4L8SB 1C08A 4M6OH 3A67L 2R15A 3CFIC 2DIJA 2V7NB 2ZWLT 2WQ8A 3TC9A 4YZFE 4NN5B 1YNLH 2K7QA 5DGRA 1IAMA 3O8XC 3QG6A 4R4BB 4KKLC 4UQ3A 5D7IF 1I9EA 4ZYKB 4TTDD 1FIEA 4DVRH 1JHLH 5HHOE 2A6JA 4WUKH 5DQJB 2YD1A 1NFIA 2EKSA 4NFCA 3EFDH 1U6AH 4UB0L 2P8LA 4AEIL 5DK2B 3V4UL 3VXQB 1QPXA 4GAFB 5IB2B 1MLCB 5D1ZA 5DURB 2W38A 5DEFA 3PV6A 1RZJH 5TPWL 3WNOA 3T0XA 4F7MB 4OV5B 2VMFA 2R0ZH 2IANE 1VFBB 2VE6A 2RFXB 3D3VA 4OI7A 1A1OA 1WCBA 3WL9B 3V5DB 4QTHA 1AXIB 4PJGF 3DGGB 4XMPH 1YQVL 4Z78B 1J8KA 4JO4H 4N0FB 2EE9A 1I1FB 1CVRA 4R26L 1OAYL 1OWWA 5E2VH 1QFWL 3DRTB 5FECB 3AXLA 4Q6IC 1F3DJ 1D5XA 2CLZB 4BZ2L 3UTSD 4BH7B 4CMHC 4MNHB 1G9NL 4Y5VA 4LAQL 2QJDA 3WE6B 5C0CA 1BGXH 3ZDYF 1BWMA 2HG5A 3DX7A 4PRIB 1L9NA 4WI3A 3EOTL 2CKBL 3GMNA 3KNBA 5E6ID 5LXGL 1IKNA 2BNUA 4RGMB 4P2RD 2I25N 2H2PD 1MQKL 4NSKB 4EVNB 2R1YB 1FC2D 2NXYB 1CFQB 3TH4T 3ZHKA 2NY6D 3GKWL 1JWMB 1U8OA 2GSGA 4WI6A 4D9LL 4Z7UB 4PLJD 2OTUA 1IGFH 3SGKC 3TYGH 1FNHA 3RL2B 3WJJA 5C6TL 5D8JL 4QRRD 3RJQB 4Z95H 2MCPL 2YUZA 4FRWA 5B8CC 4YEFA 1JN6A 4BELD 1ONQA 1MHPL 5D7JB 2D7MA 3ARDC 2J2ZA 4IEFB 4UNTA 3ROLA 3RTQA 3ZTJG 4OM0L 3HZYB 1FO0L 3QDAA 5HVHC 4LCWE 4OTXL 4WCYL 1ETZA 3KPSB 2G5BA 5I75C 1Q0XH 3PWNA 2X4QB 4L1HA 1B88A 1W0YT 1BQSA 5CJXC 1YY8A 2NY7L 3STZB 5IGXH 3VD5A 4FQ2L 2ICES 1JHTB 4NQCE 3LH2L 5DJCB 1NEZB 3DUUB 1E0OB 4NQSA 4U6XA 3T4AA 1KB9J 4MX7B 2DKMA 5DI8B 4JHZA 4CVZB 1BZ9B 1MY7A 1KN2H 3JZ7A 3BP5B 2EH7H 5BZDA 3L5JA 4TSCH 3B2VL 1UXWA 1UKQA 3UYRH 3DETC 1OSPH 4WO4C 1P2CB 4FQLH 5I17A 3RDTC 5MP6L 5JPNB 2OK0L 3D0LB 3QDHA 1ZTXH 3T4YA 2P5EB 3O2DA 4RAUB 1IAII 2PW1A 4BFIB 1KJ2B 4R4NC 3FZUD 1TZIB 5DF0A 3L5HA 4PRHE 4PJ5A 2B4CH 4ZUUA 5ALCH 2YUWA 2PTUA 1KPRB 5IEKA 2OL3A 4JO2L 3CFJB 2I60L 4JFFD 3U4EA 1SM3H 3P3YA 3HC0B 5FF6B 5CKGA 5HHME 5BVPL 1FC1A 1IC4L 2B7DT 3U7WH 2YA1A 5IQ9A 1I4FB 3PNWA 3QHZH 3B2UD 4TUJB 5EPMA 3RBGA 4JJ5B 2YD8A 4LQFH 4MXQD 1OGAE 3FO1B 2XNAA 1OAZL 4Y4FA 4KDVA 3D18B 4NN7C 1A4JA 1ZHLB 2VXTL 3GMPB 1TLKA 4FQJH 4JRYE 1RZ8B 4DZBA 4CN1A 5I1DB 3HI5H 1BQUA 4IMLB 4S1SL 1V05A 5C0IA 5CP7A 4O2EB 3V2AR 5E56A 3VXMB 1WSST 2CUIA 1KN4H 4K8RD 3I75B 4Q9RH 5HGDA 4URTB 2HJKB 4A6YH 1EEQA 5BJTA 5D7LD 3RHWF 1DFBH 2FJGA 3KDMB 1CGSH 1LP9E 3CFBB 1IC5H 2X05A 3ZDXE 5KVFL 1MCBA 4JG1H 4WUUA 3TNMA 3RBSA 3KJ4C 1I75A 2ENSA 4G6KL 4OQTL 3BGAA 4I3GA 4XBGB 2WP3O 3QA3A 1NCCL 3GM0A 1WT5C 2NCMA 2VITB 2CRYA 4XC3H 1A6WL 1ZVYA 4AY0A 1K8DA 2D7TH 4XVTH 5C0FA 3MCKB 1QVOB 5INCA 3T65A 2APBA 3CZFB 5CEYB 1FL3B 5GJTH 2MFNA 4GG6A 3MLUH 1QSED 3BH8A 4PJCF 3VWJD 5LBSH 3V6ZB 4YXKL 5EBLA 4Y5YA 5C0RL 3TNNA 4HUUB 2Y36L 1X5IA 4QTIL 1Z5LB 4XP5L 5T3XH 5IESL 2X4NB 3BYTA 3HB3D 4RQQA 1QNZH 4NNXB 1OP3K 2E9WA 2FR4B 5I16A 4BQ8A 1TMCB 2YR3A 1MUJB 2GAZA 3QJHA 2WBJC 4YIQB 1ZA3A 2DQTH 1CLYL 2B1AH 4BK4A 3KPSD 4EQ2A 1A7RH 1YC8A 3LVEA 4NO2B 2A74A 5DR5L 1E28B 3B6SA 4P5MA 1RUKL 1ADQA 2I5YL 4NJAH 4P4KC 1ZVSA 5J6GB 3T0AA 2WWMD 5D1XD 4KKAC 2B5IC 4V1DB 1BHGA 1RULH 1J8HB 4TULH 1KIPA 4M6NH 1PG7L 5JXED 4G5ZL 5EU7E 1MQ8A 1A1MA 2HLAB 4U2ZA 4RBPK 2A9MH 3O2WH 5E6ZA 1WEJH 5T1LB 1GAFL 5GGTH 2XZQL 5D6CA 5DXWA 5JW4M 1FCCA 4Y19E 4GW1B 2R4RH 3C5JA 4ZS6C 4XPAL 2HT2D 1WGOA 3KYMA 3X14B 5C7XL 5M95B 4KI5E 1R3KB 3NGBC 3WFCH 4JFED 1FIGL 1YPZE 4XGZA 3GRWH 4QGTA 3EYSL 4EI6B 5F9OL 4ELME 1IEBA 1XGUB 1KPVB 2QTEA 1B4JL 2PYEE 3EYUH 3K2MC 3LS5H 3WLWD 1FSKB 3DECA 4M9OA 1FYTB 4MMZC 3UO1L 4MWFA 4EI5A 5DQ9A 4ZUWA 2FHFA 2DQFA 5MEND 4XB7A 3H3PH 4BUGA 4HJ0D 1BD2A 1LDPL 4ZPTB 2W65B 1BBDH 3HAEH 1A6AB 5ANME 4FABH 1BEYL 1NBYA 4RA0C 1D5BB 4AJ0A 3W5NA 3JV5A 2VZUA 5D5MA 5I15L 4M1DH 2Z4QA 5B38B 4GUPB 2IGFH 4WDIA 1QSFB 1KB5L 2W0KA 2WIIB 2AEQH 1WWWX 4I3SL 5F8QC 1HSAB 1EUUA 5C08B 4X98B 4OCXL 3BZEA 1K85A 1QD0A 1UWXK 5JZ7C 3Q1SL 2FB4L 1BREA 4HX1B 2Z8VC 4UQ2A 3KLDA 4YFDB 1LE5A 3GHBL 5FYLH 3OXRA 4BQ9A 3BKCH 3HNVL 2F58H 4XNXL 3LZFH 2O61B 3K80A 3U36B 2YZ1A 3JUYA 2FX8H 3TEUA 3DVNA 3VFSB 1G7PA 1U91A 3KPLB 4MVBD 3G6DL 3T0DA 2NXZB 2PNDA 3PL6B 3MUJA 5AG8A 1KXQE 2FO4B 2LV4A 3BW9A 5IM7B 4YDIL 2F53E 5BS0A 3T3PF 1I1YB 4DTGH 4YXLL 4G3YL 5DMJB 4CVUA 3W82A 2H3NA 1ORQB 3WJLC 2VLMD 3CLEL 4F9LA 4UNVA 4Z7VF 5K9QG 5J11B 2O5XH 1E27B 4O9HH 5HDQH 4A2MA 1JGUL 4LSSH 4PS4L 1RJCA 3RKDC 5B3JE 4CW1B 3MUY1 3IFLL 5KBNC 1NUDA 2VZVA 2DMKA 2O5ZH 3G6AB 5BMFH 3OQ3B 3TV3L 3RNQB 1FZJA 1Q94A 1CGTA 4UOW0 3VI3F 4E41B 4W6WB 4HV8A 2QEJA 2YC1B 4L4VB 4HAFA 1NKOA 2X4UA 5DFTA 5HXMA 4F7CB 1W2KT 2BXYA 3OR7A 2KUTA 3RVXD 1H9VA 5T5NG 4D9RE 4LBEA 2BOCA 3OHXB 2X1PA 2BVOA 4M5ZL 3MLWH 4LLAA 5DA4A 1VGKB 2YPLA 2R0LH 5T1LD 1U3HC 3VCLB 1Z9LA 2FX7L 4ZSOE 3W39B 3QT2A 2NQCA 4N0CC 1QG3A 1M4KA 3MRKA 3O9WC 1HXMB 3S6CA 2DM3A 4IOIB 1I9JH 1T1YA 3GMLB 4L9LA 1RQ5A 4P2YA 1EBPA 4R8WL 5AZEH 1X4XA 4XVSH 5GS0H 1EFXD 1YEEL 1FLTX 1D5IL 3MLTA 3DHMA 1WVZA 2NNAA 2JJSA 1WBYA 1S5IL 2R69H 1FGVH 5C0JA 1C7SA 3QDGB 4UDUA 2JCCE 4NC2B 3WHE0 4FQ1L 1Q9KB 5EOTA 3LKQA 2I26N 5DJYB 1NAMA 2GCYA 1KC5H 4YDVB 1I9IH 3IS1X 3QO1A 4K3JH 3HMXL 1HILB 3AM8C 4O02H 4X4XA 3WEXB 3QH3B 5GISH 4P46C 1P4LB 3GSQB 1BOGA 5CMAA 2AJYH 1EAJA 2HVJB 4MMXC 1EJOL 3SDYH 1R6VA 4HD9A 2HFGH 5GHWL 1U2CA 4PJ9C 3CH8A 1R3JB 5JA9A 3EYOA 5D93B 5T3XE 4DVRL 1JHLL 2BY3A 4OT1L 3FQNA 2L0DA 2BK8A 5E0QA 1WLHA 2V5YA 4GW4B 5D7IA 3EFDL 4RFNB 5GRUH 1M6OA 3ZYOA 1C12A 3MGAA 2XY2A 5H37H 1MI5A 1F45A 4JREC 5LGJA 1T4KB 1HHIB 3BKYL 5ICYB 3RY6C 1OB1A 3OV6A 4QXUL 3BGMA 3G5XB 2R0ZL 1BFOA 2D31A 3OX8A 4FG6D 1N59B 3O6FC 3PL6D 3EO0A 3FT4A 1ES0A 3BPCA 1RJLB 1V7NH 2Z8SA 4GXVH 5HHOD 3LEVH 4JO4L 4F33B 2ITCA 4NZJA 4NKMA 2F54A 4PJGA 1A1NA 2ENYA 2ITDA 3R06A 5EBGA 4KTEL 3KPOA 1W0WA 4JQVA 3QXVA 5DJ8A 2Z93B 5E2VL 2FX9H 3SE9H 4IOFC 1I7ZA 6CGTA 4OZHF 3K8MA 1OGAB 2CDEB 3VI4E 4LQ1A 3WXWL 4YHZH 2IAND 3RA7H 5HSFA 1CGUA 5GQBA 4OCYH 4OJFL 3TYFA 1AO7B 3DARA 1CL7H 1OP9A 5SWSA 5ALBL 1LE9A 1AD9A 3KJ6H 3ME0A 1G0DA 2GJ6A 2R39A 2AJSH 1KIRA 2R2CA 3FHAA 3FRUA 1RFDH 4X6EA 3T8XA 1AXSB 4U1MA 1TTGA 1X5ZA 3FQXA 5F89A 5F93C 4P9HH 5DTFA 4ZODA 3FN9A 3HZMB 1HCFX 5DMIH 1XGRA 5I1LA 3HE6B 2MWCA 1H5BB 3NIFE 5DRNA 3U7YH 1IGFL 3SHSA 3V6BR 2E8YA 1X5GA 3ZKMC 4I4WA 2NW2A 1IGCH 2E9BA 3EOAA 5EU3B 1HQ4B 3T1WA 2K7PA 4R90H 1ZHNB 1GJIA 1NUFA 3QCVH 5DJ6B 4LNRB 1INEH 2IFGA 3CX5J 4IMKC 5DJXB 1XF5B 4PBVC 4HS6A 3EGSA 1F11B 3LS4H 2WIMA 5DDHB 4BQBA 2VDKL 3ARTA 5ETUA 5DSCB 3QI9A 2BFVL 2GJJA 3C60B 4NCC2 5FYLE 5HYQB 1BZ7A 3DETD 4TVPH 8FABA 3RDTD 4DKEH 1RVFL 4HKXA 2EDHA 3JTSA 4DN4H 2DM7A 2C3HA 5CCKH 4R4ND 2H6PB 2FDBP 1JYNA 1BLNB 5FO9B 1OP5H 5IW6B 3R8QA 4C55A 3OKNA 3T3ME 4LCWD 3BWAA 1AIFB 4ZFOA 2EH7L 4K3HA 4TSCL 3LEXA 3BEVA 5KG9B 1OSPL 4X9BA 4YO0A 3I3DA 4RMUA 2BNRA 2W92A 3BGFB 2A6IA 3U83A 4LAJH 3TVMB 3RWHB 4XXCA 2DTMH 2J8OA 4XCFH 4BQ6A 4BSWA 3DHJA 1CE6A 5FK9A 2EICA 3QO0A 3WNPA 3GI9L 5DMKB 3E8UL 4KQ4L 4GAYA 1JGEA 3MR9A 1ZSDB 4OB5L 2HWZH 3U7WL 3QHZL 1LVEA 4LPYA 1FL5A 2FRGP 4HGMA 3C6LC 5C8JB 3MRCA 4LSTH 4PRHD 4JG0H 1S7TB 4XPGL 4N90E 1QLFA 1NC4A 4U1JB 3RWEA 1IL1B 1FFRA 4JDVB 4HIIA 1YPZB 3JWDC 2HYMA 4JANB 4OCWL 2A83A 5GS1C 4ELMB 3BP7A 5HHMD 2C9AA 1M7IA 3DXAA 4JFDB 3NPZB 4PJ8B 1NBZB 1X5XA 3KLAA 3OMZA 3NABL 3AU1A 1ZLUK 1KN4L 1OGAD 1HI6A 4OFKA 2OCFD 2CRMA 5AZ2H 3M07A 1CGSL 2HJLA 2XKNB 3C6SB 1L7TH 4UOJA 2EO9A 5F21B 2VR9A 1KCLA 4G9FA 4KK5C 2OYPA 5DT1L 3VXNB 3GSWA 3IDXH 4I2XB 4NO3A 4ODVH 4LLUA 3DRQB 2A6KB 3S7GA 2JB5H 1I7RB 3PHQB 3SKMB 3CXDL 5ISZA 2HKHH 5GJTL 3ZKXB 2ESVA 2COQA 1IGJB 2JTDA 5I8KH 5LBSL 1R3LA 1L6XA 2NY3C 1N5YH 3UJTL 3BAEL 2ICEB 3DROB 3LIZH 4PJCA 4DVBB 4Y7MA 2QR0A 2VJXA 4KKAD 4GRLB 3LV3B 5FM5O 1XH3B 5H2BA 1WIUA 3VFNA 5GS0C 1QFOA 4W70A 1N64L 1MAJA 3P4MA 4XBEH 2DQTL 2VLLA 3S35L 2G60H 3JWOC 3PE9A 4HC1H 4OZGA 3C60D 2FBOJ 1S7XA 1EV2E 2GJZA 1H8OA 4LHUA 5BRZE 4EOWH 4GAGH 1JPSL 1VB9A 4PRAA 5DVNA 4P2OB 1OP3H 1FFNA 1EEUA 3VXRE 4S0TD 4ZS6D 5CGYC 2AK4A 3QNZA 4JRXB 3NCYP 4ODWB 3QDME 3QJFA 4EKXA 1DQQA 1DN2A 5KVGL 1J1XH 3S4SG 1HZHL 3KPPB 5GGVL 4WFEE 5TJWK 5FA3A 5IBUG 1BQLH 3OGOE 4HWEH 4C57C 3BEWA 3BPLB 3RU8L 1HYRC 1FNSL 3TPUB 5GGTL 4OM1H 4PLNC 5J1AA 1MWAA 2EC8A 5HDLA 4OI8A 5E00A 2JJTC 1LO0H 4JPWL 3WSQL 5T1MB 1KCKA 1OSZA 3BDXA 1ADQH 1OT2A 3WFCL 1EMTH 4PGEB 4UILH 2HN7B 3KLSA 3WFEL 1UEMA 3GRWL 2HKFH 2X4TB 4YHOH 5L0QB 1VEOA 4N9OB 2DQDL 1FNLA 3EYUL 1XGQB 5C07B 3SKJH 5JIKA 4HHAA 1P4BH 1YMHA 3MLRH 5BO1H 4Y19D 2BVUA 1DQDL 2CDFB 4F3FA 1E4XL 2DQUH 5D70L 4IBLT 4KI5D 4A6YB 1N8ZA 4YGVA 3MRJB 4HWZA 1WFUA 4R7NB 3BZDA 5HYIA 3NFSH 1CFTA 1FDLL 1CXEA 1DQJB 5CGMA 1IZJA 2IGFL 4NWTH 1NAKH 3CPLA 4PJ8D 3N06B 3OXSA 5IKCB 1UACL 3H9SA 4R2GC 4FFVD 4YHNB 3ALPA 4S1RH 2N7BA 1DTUA 4MZ3A 1I8KA 1TIUA 4JE4B 5I1GL 5DK0A 3GGWB 3CMGA 5FYLL 2CLVB 3ESVF 3TP4A 1YEIH 3V5HB 5F6IC 3BKCL 5F7UA 3BDBA 2FSEB 4D9QE 4OGAC 3ORJA 5DRWA 3CDGA 1EHXA 3SCMA 2XFXA 1AGFB 4L3EA 3HE7C 1N3NB 1C1EH 3B8YA 2N4IA 3T1FB 1R24A 4U3XA 3NH7H 4F7PA 5HHQA 4Z7WA 3MRLB 3IFOB 3JWDL 3VFTB 1A3LH 3SDXB 5DZLA 1NGXA 2Q76A 5BV7C 1D3CA 1U8IA 5IHUH 5B21A 2FYYB 3FOLA 3MV8A 2YSSA 3ZT5A 1S8DA 1FV1A 5EBWB 4M61A 1T89C 2NY4C 1TTUA 1A5FH 1JBJA 4GAJL 2PO6A 3DX9B 4LSSL 2XA8H 1MNUH 2AI0H 2FATH 3MLZL 4AEHL 2V7HA 4N9GA 3JBG7 4PRDB 5BMFL 3C5ZB 3FL7A 1TVBA 2FD6H 4OD2A 4P5TA 4RSVA 4ZO9A 2YD7A 5EO9B 1MFAH 4WTXA 3KXFA 3JV0A 2QQKL 5E24E 2X4RB 1ZS8A 4F58L 4G42B 3SEPA 3QXDB 4N0CD 4PBXA 5EIIA 1IT9L 1QBMH 2XV6B 3CFCH 4K7PY 5JW5B 2I07A 2G9HB 2P8MB 3LKOB 3MLSH 4MNQB 1U8MB 2D0HA 1TQBC 4QF1A 4N0UA 4RZCA 4J7RA 1B2WH 3FT2B 3NFNA 3SOBH 4LHUG 1MVUB 3H7BB 4CVXB 2MQ3A 1GSMA 5FKPA 3DTXB 5IBLC 3M8OH 5I1KL 3V4PL 4L3AA 4B7LA 5D2NA 4MXVF 3ZT6A 5IEHA 3FB5A 2IALA 3S8WA 2PXYB 4I0PC 3UX9B 4EN3A 5KVEH 1I9JL 1E4XI 4U3HA 1UT9A 1RIHL 4IRZH 2XRAH 4D9RD 1XZ0A 5GS0L 1IFHH 1C5DA 1CICB 4Y5XA 1S7WB 43CAB 3TBSB 5DHXB 1KLUB 4GBXC 4OF6A 4Y2OA 3NMEA 4P46D 2QV2A 3RJDA 1FGVL 4R3SA 1WZ1H 5E2UL 5KANI 3VD4A 1CLOL 3PDOB 4P57B 1HIMH 1AY1H 1J88A 2Z35B 4PJ9D 2MHAA 5GSRB 2JB6B 1I9IL 1MCKA 4Q0XH 2RHEA 4UBDC 2BZDA 4O02L 4AMKH 2ARJA 3MXWL 5T33H 1TCRA 5DEZA 4P9MH 3MRPA 4CU8A 1K8IB 3IVKB 2AJYL 5IVXE 3BX7C 5LQBL 1RK0A 4NOBA 3Q6FA 4NT6B 3FT3A 3DYOA 1XR9B 3M17A 5BZWA 3EJZD 1DP0A 3OAYK 1T21A 2Q86A 4RCAA 1WWCA 2Z31C 4PY8I 3LQZA 1XCTB 5DJ2B 1IQWH 1IKFH 4E5XB 3DBXB 5KSAA 2ADJA 1GC1H 2EDYA 5D1QA 3VGFA 1EAPA 2OSLB 3RPIA 4WTWA 4GFTB 3VWKA 4WW2F 4QRUA 3WO3B 1NDMA 5GRUL 3TT1H 2EYTA 1ZGLA 1H3VA 4JFOB 2KH2B 3WNMA 1PKOA 2NMSA 2D03H 1FH5L 1NC2A 2R56L 1EZVX 4JM2D 4M6AA 5FKAB 3MBEA 1AXTH 3GJFA 2CJUH 1G7QB 2ADGA 4Y16C 5T3XD 4YDKH 2ZUYA 1V7NL 2CLRA 3K81A 4M48L 1TITA 5EN2B 1P84J 2XQBL 2XIDA 3MRMB 3EAKA 3L9RA 4PGCA 3JTTA 1EVUA 2HJFB 2JIXB 1WZKA 4JPIB 2E27H 4H25A 3TBVB 2FX9L 5C9JA 3E6FB 1JJUA 1G0YR 1BBJA 5F1NA 3SDAA 4GQPH 3RA7L 3VFPB 2C3WA 3IFPA 3TF7C 3BVNA 3LRHA 4OZHA 3VFVB 1AGBB 2EEDA 6FABH 1T3FB 1W72A 3C5ZD 3KJ6L 4LLQA 2YHGA 3U1SL 5KAQG 5I8OH 3D2UB 2AJSL 5HI5C 4KK9C 4NM4L 3ZKMD 5DC9B 1SJEB 3KPRA 4RWYL 4BH8A 3PWLA 3BOVA 4TOYH 3DO7B 4CNIA 3GI8H 4R96A 3BN3B 4MNQD 1DVFA 4HIXH 1X7QB 1ZHKB 3MV7E 3CUPA 5E99H 1U41A 3EIFA 3P4NB 4HLJA 2UWEE 2WV3A 5IMOA 4JFQA 5EORH 2VXUH 3NCEB 5KTEH 3MLVH 4G80A 5BV7L 1YJDH 3MCLH 4PV9A 1YUHB 1A6ZA 3BPNB 3ZE2E 2QSCL 3BSZH 2V2XB 3HPJB 2DL9A 5ERWB 3U30B 4DKAA 5IJVB 3N50A 1E4KC 4ZDHB 4IDLA 3VU2A 4DQOL 4HWBH 5DQDL 1YN7B 1S7QA 5E9DB 1RUAH 4OLXH 4OZFH 4HZAA 2BRQA 1UADC 3Q3GA 4LLDB 4AT6A 4DFIA 4YHPB 2J8UE 2HMIC 1UXSB 3FFCA 1NJ9B 1T0MB 3AY4A 3VXSE 4OAWB 3LS4L 4FP8L 1U8KA 4U6VL 2Z91B 1CXKA 2A6DB 4EUPA 5E8NA 5D7SL 2XN9A 3EOBA 2A77H 5DK3A 2D0FA 3KLHD 4UT9L 1P7QD 3QR2A 4Z7OE 1OGTA 4KV5E 4X6BB 2ICWB 3H42L 2AXFB 3S3SA 3CFEB 1ZT7B 2VH5H 4P3DB 1LHZA 3P40A 3QQ4A 5CEXB 1MFBH 1XGPA 2VDRH 4YBQC 3NCBB 5TDPA 2IF7A 3B9KA 2DB8A 1AKJA 4WNQB 4UTBL 4K3DH 2RGSA 2Z92B 5FYLD 4Y1AE 1DN0A 5DJ0A 5JMRA 1WF5A 5IHZB 3MOBH 4MD0B 4HKZA 3FB7A 4XCFL 3N1MC 5GRZA 1YECH 3DV6A 4WWID 1CE1L 4I3RH 1G6RL 3VXUB 1MFEH 3BE1H 3ULSB 1C08B 1VGEL 3V0AC 4M7ZB 5F6HI 5HYEA 2E9JA 3ZLQC 3CCHA 4LCUA 1NCNA 5KSBE 5C2BH 1A7QH 1MCRA 4YC2C 3RL1B 3H6JA 4YHMH 4UQ3B 5HD8C 4U0QB 1PX3A 2A6JB 3HRZB 4NQDE 2W0LA 2R4SL 1LEGB 4YBLB 3NTCH 2GQHA 2P8LB 1ED3A 2J6EA 4XVJL 1M7XA 1JNHA 1A7NH 4LLYA 5D1ZB 2IAMC 3MRRB 4CMMB 4I0KA 5DEFB 4DCQB 3CSPA 1JUFA 1E4WH 3RIFK 3FN0H 3RY5A 4F37K 4CJ0A 4YZFF 4WTZA 1JTTA 1RIVH 5I18L 1FLRL 3ARBD 4WI2A 4PGBA 3D0VA 2VAJA 4IIQA 2IH3B 4YLQT 2FH6A 5L8JB 1L7TL 4N90D 5E5MA 4LF3A 1MHHB 1WTGT 4P5KA 3D2UD 3AXLB 1F02I 3P0YL 4NCC1 1D5XB 1K4CA 4Y5VB 5TE7H 2NY3D 3IDXL 3CZJA 1DEEA 2HG5B 2RB8A 1T1WA 3BQUC 5CIPH 3DX7B 3UTSA 2BNQA 3EW3B 3GMNB 5JNYA 4QY8A 3KNBB 5ADOH 3DVFA 5GS0D 1H5BC 1PVHA 2FJFA 2VQ1B 2ZPKH 1U95B 2VYRE 4QHNA 4L4TE 4RMSA 3VA6A 2C3VA 2VO5A 3GDBA 5HGHA 5EC1B 1N5YL 5E6IA 3IGAA 2IC2A 3GSVB 4UIMB 2ZOKB 3LIZL 4P2RA 2IBBA 4OIIL 3PWPE 2GSGB 2L7UA 5EWIH 1FCGA 1TPXC 1LDSA 2J7LA 3N85H 2OTUB 1T6WA 1X3DA 4Y4HC 1CF8H 1O7SA 1NGWB 3QG7L 4XBEL 1TXKA 3OR6B 2G60L 5LVEA 4JHBA 4HC1L 1QP1A 2R0KH 1VENA 2VQUA 5D9SA 2BVPB 2EDOA 3PHOA 4EOWL 1V3KA 2FLRT 4GAGL 1ONQB 5FGRA 1P4IH 4JN1H 3ROLB 2Y5TB 1A4KA 4QRRA 1J05A 1EBAA 4U1KA 4PY7A 4JPVH 3FONA 3UAJC 1IGMH 3G5YA 1J1XL 1D6VH 3QUYC 1EGJH 3INUH 4M9PA 3MSPA 4RGNE 5CJBA 1JCKA 1SVCP 4H1LH 3GO1H 4X6FB 3B4NA 4LLMA 2XTJE 3VGAC 1VEPA 4JKLA 4DEPB 3ARFC 2C1PA 3SGDH 4U6XB 4HCRH 4PTTA 4FMKA 5FUZH 3BGFC 3QXAA 1VFOA 3L3JA 5GZOC 1PBYA 3VXRD 5HGAA 1P9MA 2VDOH 1P7KA 2W9LA 3GK8L 5BZDB 3QDMD 3DI2B 4JCMA 1UXWB 1EMTL 5I17B 1L7IL 4WFED 1V3MA 1TZHB 1XFPA 4K3GA 4H20L 4XCYA 4H0HB 3T4YB 5DO2C 4JN2B 3T2PA 3WIIL 4L8SA 3MJ9H 1X4ZA 4YX2H 3VXTB 4PJ5B 4POZC 4ZUUB 4B7IA 2EO1A 1DL7L 1FZKB 1EHLL 4HMEA 3I02B 4YE4L 3DI3B 4IRSB 4R4BA 2AP2A 4ENED 4ZYKA 3BMWA 5DQJA 4FQXD 4PFEA 1MWAH 1CD9B 2P46B 1FE8L 3GIVA 4RGNC 4XNYH 3WIHL 4U7SA 3KPQA 1KT2B 1Q38A 4JFFA 5EPMB 3PGDB 2XTJC 1WAAE 4QYOB 2XNAB 5IB2A 1MLCA 1UH2A 1CU4L 4Y4FB 4KJPD 1A4JB 3LRGA 4F2MA 1AJ7H 5DVKA 5GRYA 4OGAD 4OV5A 1M7DA 1NH6A 1BIHA 3HE7D 1UKTA 3VMPA 5BOZG 4JKKA 5SWZE 3WL9A 4I48B 4JY4B 4JZJB 4RISL 1YC7A 4Z78A 4PGJA 5HPMA 4OF5A 5I0DA 3RZCC 5D96B 3K2UH 1JZ7A 1ULVA 1U58B 4U0RB 2FJGB 5IB3A 3IJYB 4M43L 3OGCA 5FECA 3MV01 4WUUB 1C1EL 2AJZB 3TNMB 2EXYC 4CU7A 4QLRA 4PGZA 3WE6A 5D7LA 5JW4Q 1U8HB 3IU3A 4Z77A 3QA3B 2AV1A 1A3LL 1HHKB 2IQ9L 3RRQA 1JZ3A 1GL4B 1OW0A 3EO9L 3EYVA 3LKNB 3GMRB 5J1SC 2GYSA 2VZ1A 5LGHL 4H88H 5INCB 4KXZI 2Q20A 4D9QD 4NQUA 1A5FL 1MIMH 1MF2H 4GW5A 2EIEA 1LP9F 1YEFL 3BH8B 5F88B 3ZDXF 1CFQA 2AI0L 5L88L 3P0VH 2B20A 4XPBL 4LGSB 4KTDH 3W9DA 3VMNA 4LPUA 1HCVA 2GHWB 2EE2A 2JELH 4Y5YB 1QSEA 3TNNB 4KI1A 1WC7A 3C8DA 3VWJA 3LD8B 4OLEA 5HVWA 1OTTC 4J6RH 4YFLI 5I16B 4P2OC 3QJHB 1QBML 1ZA3B 4FN0A 2X1XR 4GH7B 4I0PD 3MLSL 2Q7YA 2QQLH 4K7FA 3B6SB 2OR9H 3QNYA 5I1CH 4LEOA 5HDBE 3P9LB 1HH9B 2KL6A 4MD5B 1GZQB 2E7LC 3KPSA 4JDZB 5GGSY 5CILL 4GBXD 2CMRH 2X4QA 3MFGB 1F58H 4HIHB 3NCMA 2VERN 3HR5B 4HIJB 4O00A 5F3HB 2R23B 5DHYB 3V6OE 5C0BE 4PUBH 1RIUH 1JHTA 5D1XA 2X6MA 1NDGB 5KVEL 5DJCA 5IJKA 3QFDB 3DUUA 1BAFL 4MX7A 1HNGA 1KUMA 5I1EL 3ZTJH 1U3YA 3UTZA 5HYFA 5JXEA 3BUTA 4FQIL 3C5JB 4UIKH 2XKSA 1WZ1L 3KYMB 1A14H 3AMLA 4I1NB 5AAMA 5JPNA 5AYUH 4GS7C 3D0LA 2P5EA 1HIML 4BFIA 5ITBL 2XZCL 4Q0XL 3D9AL 4IRSD 4XGZB 1YEDB 3GSXA 3TBWA 3QFJE 1XR8B 4WV1A 4JFEA 3IDYB 3OAZH 4OIBA 1SY6A 3DNKA 1GZPA 4MWFB 4EI5B 5DQ9B 1TETH 4R0LA 5KSUB 4KK6C 2IPTH 3ES6B 2QL1A 1I4FA 4PJFB 3VGHA 3S88L 3T0EE 2BSED 2APVA 3GMMB 4JJ5A 3HCVA 4KI5F 3FO1A 4NKQB 1A0QH 3KYAA 1NBYB 1IQWL 5TH2A 1ZHLA 5D5MB 2VWEC 4MGXA 5MENA 4Y16D 1FFOA 3ARGB 2R2BB 3ARRA 3GMPA 3TT3L 3RNKB 1R5IB 3HHRB 2R8SL 3OAYH 5E2WH 2ERJC 5I9QB 5I1DA 3L1OH 4WW2A 5I66A 5IFHH 4N8PA 4Y1AB 3BZEB 4D3CH 2CJUL 3VXMA 4OCLC 2J5LC 2J4WL 1O0VA 3G08B 4U33A 4CU6A