3DWTA

Structure of cabbcii-10 nanobody
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
125
Chain Sequence
VQLVESGGGSVQAGGSLRLSCTASGGSSYSTFSLGWFRQAPGQEREAVAAIASMGGLTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCAAVRGYFMRLPSSHNFRYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAbBCII-10
publication title General strategy to humanize a camelid single-domain antibody and identification of a universal humanized nanobody scaffold.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system
total genus 32
structure length 125
sequence length 127
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dwtA00
2HYMA 3H9HB 2ADJA 4U31A 5DQDH 1MAML 4Y5XC 1RZJC 3F5WB 5BVJA 2ADFH 4HQQL 1U6AH 3AS3A 4NNPH 5FECA 3PWJB 1TNNA 1OVZA 1C7SA 4LPWA 3SE8L 3L7EB 5D1ZC 1JFQL 4K3DH 1WJ3A 3EGSA 3DECA 3MRHA 5HVHC 1MJ7H 4Z6AT 4HWEL 3D85A 3V6OE 1JYXA 3GMLA 3VXMD 4DKAA 4FABH 2JB5L 4OGAC 3IXTA 1ZLWH 4GKZB 4L3AA 4MZ2A 1BJMA 3VFWB 4KPHH 1KF9B 3HNSH 2DL9A 1TCRB 3BH9A 2OK0H 4PG2C 5AYUH 4PJ7E 1CICA 5E2JA 2YRPA 4C56E 4PJBB 3WEXB 5BVPH 3OR7A 5TGBB 1A5FL 1CQYA 3SKOA 3PGDB 1EHNA 5DLML 4L8SA 4X4MA 5F70A 4XWGH 2MPAH 4MQTB 1HEZA 3BEVB 5HI4C 3O3EA 1ADQA 1GL4B 1R5VB 3QQ9D 4U6VL 3VXUE 1Q9OB 5HYJE 4IRSA 1U8KA 3DRTB 4FZEH 3BKJL 1BZ7A 2GEEA 1YQ2A 1BVLB 5IKCA 3WKMH 4R3SB 3C6LA 3B8YA 4XBGA 2P7TA 3VGFA 4R4BA 5L0QC 4HGKC 5FYJU 3DURA 1I3RA 1XGQA 3CFEB 3FO1B 3P4MB 1G9MH 3AMLA 2FLBT 4G42A 4PJHB 1LO0H 5FKPA 5FYLE 4F37K 3TN0A 3RA7H 3MXWH 1OGTB 2UWEE 1MH5B 2VAJA 3V95A 4BH8A 3VFRA 1G7MA 4NJ9H 4LVEA 4Z7WF 3WFDL 3PHSA 1LE9A 3LD8C 4HJGB 3UTSB 4I9WE 4PJEA 3PV6B 4K71C 1CU4L 1PG7L 3PNWB 4NO5B 4IOSD 1N59B 4NM4H 4JM2D 5HHOA 1YEHH 3ELAT 1L0QA 5C0BA 1MEXL 3VMPA 4P9MH 1BQHA 4YHNA 4V1DA 3DV4A 1YQVL 4XVSH 3BPCB 5DDHB 3AFLA 4G9FA 1RZ8A 4X6FA 3BGAA 1OCWH 2C26A 1NKRA 1MFCH 1UADC 4OZGF 4IOFD 3P11L 4YHMH 35C8H 4NQVB 1WSST 1HSAA 4ODUB 4ZS7H 5JMRA 4X4ZA 3C5JB 1XF2A 3ZE2E 2E7BA 3HFML 4P2QA 5KSAB 3U4EB 5M7QA 3OJVC 2J4WL 1QLRA 1DQDH 1Q72L 2YRZA 2IQAB 3U0WH 1SY6A 1IRAY 1MUJB 1BZ9B 3BEWA 2AV7B 3FB7A 4X4ME 2VMFA 3CC5A 3ULUC 2ZUUA 3QPXH 2W1NA 4UQ3B 4K3HA 5F7MC 3CSBA 2BVQA 1NJ9A 3V52L 5D2LB 1QEWB 1V3LA 3I84A 3EYOB 2D31A 4PBWD 4CU6A 3MLWL 4OLVH 3QDMA 1F4WH 4L4VD 3O6MH 3BP4B 1KPUB 4WTXA 3U6RB 2YXFA 4H26B 2EIDA 4LIQL 1JWSB 2H2PC 1U58A 1RZGA 4F9PA 5EBWA 4NJAL 5EIQA 3BE1L 4UNUA 3TO4D 5FOBA 2HFEA 3QNYA 1GXEA 4FTVB 3OJ2C 5C0AB 3HZMA 3UTTB 4C57C 4P59L 5FB8A 3P4NB 3FRPA 5DVNA 3QRFM 4P9HH 1MCPH 1E4WL 3GB7B 4LSQH 4Y4HB 2Q7YA 4Y2DA 3HG1A 5F96H 4PJEE 1P5UA 1FC2D 4WNQB 2K1MA 3RQ3A 5TDPA 4B7IA 5HHOE 2E7MA 3KYNB 4JDVB 5C0BE 4BQ9A 1HYRC 1YZZA 4QHNB 5GGSY 5BMFH 2A6IA 3OJDB 1S3KL 2V2WB 3CUPB 4V1DE 5TE7H 1F58H 1UM6L 4WEUD 1L6XA 2ZSVA 4G9FE 3RIFK 4HHAA 3FFDA 4FXKA 5E24E 4ZAKB 4R26H 3WLWC 4TSBH 4U1NA 3TYFA 3PHQA 1BX2A 2D7TL 4UT7H 4QTIH 4YQXH 3GIZH 2YZ8A 1ES0B 4MAUL 4NNPL 5CWSA 3EFDH 1MFBH 1IKNC 2A6DA 4YHPA 1P7HL 2IAMD 3I3EA 4KHTL 4Q6IA 2XXCB 1WFUA 4P2QE 2LV4A 3QIUC 3RZCB 1RZIA 4JQXC 2H6PA 1EBPA 3S37L 3V8CA 5BZWB 1AE6L 3MBXL 5D2NC 5GRZA 1K85A 4FABL 4YR6A 3N85L 5GJTL 4PJFA 4UIMB 1TMCB 3HNSL 3WO4C 2Z4QA 1CG9B 3NGBB 5AYUL 4CMHB 2NCMA 4R90H 1B4JL 5D7JB 4NCDA 5E8PB 5C0CB 5IESH 4BSWA 4DGYH 2DF3A 1PG7W 3PIQA 3D39A 4HEPG 4NWTH 5INDA 1G7LB 1Y6MR 5E94A 3KPQB 4R9HA 4FQIH 4JHAL 2A83B 1R24A 4P5TD 1NCDL 3I6KA 1JK8A 2DBJA 3B9KD 5E6ID 2DWEB 3OKDB 5CFHA 1LO3H 1OARH 4UTBH 3D25B 4M7JL 3RU8L 3FQUA 3NACH 3CH8A 1FSKB 1XIWA 1RVFL 2RFXA 1MCBA 4PR5A 4AMKL 5DRXA 2HJLB 4PLOB 3VWKB 5T3XE 1ZWIA 4GRMA 1ETZA 3EDDA 3HG1E 5E70A 3TNMA 2P45B 4Y8DC 1VESA 4QXGH 1R3HA 2XYCA 3RA7L 1M05A 5K9QG 5I1CH 3R1GL 1YC7A 1LE5B 4B7LA 4BM7A 5IB4B 3DVFA 5IEHA 2NY3C 3C09B 2WUCL 3QJFB 1G9NH 3IAPA 2ICWJ 1U42A 4UDUA 3MLZH 4OCWH 3NCJL 5SWZD 5GGSA 5C8JA 3B6SA 4TSAL 1H3PH 4ERSH 3T4YA 1U91A 3GNML 2G5BA 4DZBB 5C0JA 3H6JA 5CD5C 3F7QA 1OM3H 1TITA 2AP2A 3GKZA 2XN9B 4HKXB 2B0SL 1O5DT 4ZFOA 4XVSL 5E6YA 5JR1H 3AROA 2V5SA 2C3XA 1N0XL 1Z6JT 4UNTA 5DMYA 2JJUA 1CL7I 1T66C 3V4VL 2MCG1 4Z77B 3LRHA 3VDBA 5I19H 1CGSH 2D7OA 1RZ7H 1HXYA 4MA3A 5C0GB 3KXFB 4PJFE 3K4ZA 1DLFL 3ZDXE 4G6JL 1B6DA 1I1CA 4PYHA 2AXJA 5HVHB 1RIHL 1DQDL 2QQNL 2AVGA 3VJ6A 5I8EA 5B4MD 1X44A 2DQGH 4UT6L 3D39E 2GTWA 4D9RD 5JW3L 1SJEB 5B8CA 3C2AL 4PRDA 5LGHH 4P4KA 2P8MA 2W59A 1WZLA 4CAGA 1PZ5A 3F6LA 2IANA 4GW1B 1A7NL 4XMLL 5D70H 4WWKA 1A1NA 3UJTL 1MCQA 2VJXA 1MVFA 5I1LB 5D8JL 3ILPA 5F7DA 5E6IA 4U2ZA 3SCMC 5EZLB 2CRZA 1UB5A 5HDOA 3ZT6A 3HC3L 4TUKH 1D6VL 2V2TA 1EO8H 4KDTA 4NRYA 1QVOB 5KVEH 4KZDL 4ZOEA 1HH6B 1OAXH 4RAVA 1AC0A 1KJVA 4OZIA 3ET9F 1ORQB 1P4IH 2VL5A 4OLUH 4PS4L 5FYKU 3MLRH 4HUKB 3FCTA 4JFXB 1BOGB 4PRID 3OR6A 5ID1B 1FZJB 2AXFB 4JKPL 1TQCB 4K71B 3PG2A 3TF7C 2IPUG 3HE7C 4L29B 4U33A 2WUBH 4BH7A 5ELIA 1CD0A 1K6QL 2YC1A 4Z0XA 3AM8A 1ND0A 5CUSH 1T7XA 3EFDL 4GAGL 1C5CL 1YPZA 4JFOA 4JG1L 4PRBB 2BY0A 4YDLB 4P46A 3ESVF 4KRNA 4R4ND 4M8VA 2HVKB 2NY1B 1T7YA 1ZMYA 1EHLH 5CP7A 4FQXC 5ECJE 2FIKB 3OKKA 3P4OB 2IGFH 3D3VA 1BF8A 2GIYA 1JGUL 2V2XA 1KCVH 3MLUL 1A6TB 2IANE 5IESL 4GQ9H 4MQSB 1G9MC 2OR7A 3U4BH 3MBEC 3VFSA 2BVOB 1KGCD 43CAB 4JFYB 2B2XL 1WC7A 3K80A 2NXZD 4AM0B 5IQ9A 3S36L 1CDIA 2EO9A 2KBGA 5CEYA 1DZBA 3AY4C 2N56A 3VXOB 2X4NA 2BVEA 2H1PH 2AEIT 4XGZB 4G8FB 1AQDB 1J1XH 5M94B 1M7DB 2J6EA 2ZKHH 3OTTA 2XICA 1ZHLA 3MO1B 1NCCL 5AEAA 3RUGA 2ITCA 3DI2B 4OZIE 2UYLA 1F11B 4YE4H 1OLLA 5TF0A 3IU3B 1IC4H 3QQ3A 1FFNA 4U6YB 5AG9A 3OKYA 5GGQH 1PLGH 2FDBP 5DS8A 2EEBA 4N1CA 5JA8B 2RB8A 4EUPA 2WW8A 3L3OA 3DX8B 3OF6D 5DZNA 3TBVA 3RY4A 2WK2A 1KC5H 1NGQH 1IKFH 3EW3B 4R6UA 3PQYA 5J89A 2NR6C 4NT6B 3LRSB 3BSZL 4OLEA 5A2LH 3CFCL 5D7LD 1FNFA 1R3JA 3LCYA 3QP3A 4XCNB 4HUUA 2IQ9H 5DQ9A 4DZ8B 3KLDA 1YPZE 4LMQI 1NFDA 3PJSB 3QBTB 3B2VH 1NAMH 4JO4L 1AGBB 1PKQB 1PYWB 3WLBA 1M71A 4LOUD 3UAJC 3L5WB 5GHWL 1S5HB 1WBZA 1HILA 5D1ZD 3ZYIA 4JFHD 1LDPH 3ZSSA 4M93B 5FXCH 3VGAB 1BJ8A 4JPVH 1CGSL 1P2CB 2A38A 2VISA 3ZMRA 3D69B 2UY7A 3WE6A 1JF6A 3B9EA 4J23A 4JFPB 4OCNC 1U2CA 3GMRB 5JHDD 3QIUB 4Z7OE 4OGAD 5DEFA 3D3VE 3QSKB 3WIHA 1FBIL 2CJUH 4L1DA 4ZPTB 1J05A 5HYEA 5DJXA 3MGOA 1U3HB 4YK4C 3D2UD 3MCKA 4HZLB 4GAYB 5KW9L 1MVUA 4LNVA 5J1SC 1ZEAH 4KTDH 3PF2A 4P2RB 3QG7L 4KFZC 1MJUH 4FFVD 5DJ8A 4N0UA 3IRPX 5INCA 5LGHL 4AEIH 2QHRL 4M1GH 3AU1A 1E4XL 4P9HC 1PX4A 3TZVB 3RPKA 1DSFH 2C4XA 4GRLA 3OHXB 4OCRL 4S1QH 2F19H 3BP6B 5L88L 1OSZA 4LCUB 4QRRA 3RUGE 3O9WD 1LEIA 1NSNH 5D1XB 2DDQH 3MNZA 3N9GH 4NQED 4NQCA 5DVLA 3L95A 4MJID 3FT3A 3MFFB 4NUGH 3TFKC 4PV9B 4PJGA 5FGRA 2JIXD 2X40A 3X3GL 1P4IL 3N0PB 2XZQH 5DEGB 2ZG1A 1T1ZB 3PQYE 2FD6L 1MFDL 4PRIE 1K4DA 5CP3H 1IJ9A 1LO4L 5ESQA 5F93C 3INUH 1WZMA 1M6OB 1O7VA 4DW2H 1TVBB 4F9LC 1XH3A 1MHHA 4BZ2L 1WITA 1H3VA 4O02H 5ITFA 2AJZB 2ZCKH 4FZ8L 4ODSL 3L3HB 5IW3A 3ZE1F 3DSFL 1Y18B 4J3SA 3MV9B 2AEQH 2AEWA 2Q6WA 4MNQB 4I0PA 3KNBB 5CLWA 1AQKH 4CVZA 1Q9LB 3U79A 1FNSH 1G7QA 2YXMA 4FFZL 1EHLL 2PXYC 3DGCR 4X5WA 4OD2B 2DM2A 2K7QA 4RMUA 5DI8A 4K9EL 4JQVA 2F15A 4XCYA 4DGIL 1SEQH 4RAUA 4X98B 5IFJA 3ARUA 1SYSB 5I6XB 1ORSB 3WFZA 4N0UE 3L3IA 2FJGB 4I3SL 2EDJA 5CS7A 4HH9B 3VGHA 3D2UA 1G6RA 4GQ9L 4EJ1C 1URLA 1A3QA 2EE6A 2FL5B 4HWBL 2HLAB 2ZNXA 1NH6A 2G75A 3S4SB 5JPNB 3BJ91 4XNXH 2Y25A 1KYOK 4QRRE 2CDEA 3QDGA 2H2PD 1CFQB 4C58B 1AJ7L 1G9NC 4NN7C 2DTSA 2WBWB 4NQCE 4LPYA 2NW3B 4KMQA 4H0HB 4XPAL 4XPGL 2X4TA 3O9WA 3ARYA 3DNKA 4PJGE 3VMOA 4UU9B 3SCMB 4S1RL 4GG6B 4HUNB 4H1LH 1JF1A 5T1KD 4NQEA 1A0QH 5LBSH 2EDNA 5KZCB 3BWAB 5HGAB 2GCYB 2BY2A 5MI0C 4XP4H 1QSFA 4W6YB 1PLGL 3KPTA 1BD2D 4N8VA 3HZVA 3CDCA 5T33H 2AEPL 1CBVL 5D7SL 1EXUB 2WWMC 1HSBA 2HN7A 3AXLB 2EC8A 5FK9A 1KC5L 3MUGB 1NGQL 5CSZA 3NABH 3UTOA 3X14A 1MFAL 2F53D 4WHYH 5FGCE 4GXVL 3ARDC 2F5AH 2IQ9L 2R1XB 3WUWA 4RDQG 3HE7B 1NAML 3VRIB 1AP2A 2IEPA 1JVKA 2W60B 3JTTB 4WDIB 3SGDH 5IV2A 1GOHA 3RNKA 5ID0A 5TPWH 1FH5H 3GSWA 2X7LA 2Q76B 1SJXA 4YXLH 2ARJQ 4YBLC 4JPVL 1WIOA 3KPSD 3FFCD 2FATL 3JV6A 1NGXB 4X8XA 1N5AB 4K3EL 2HFTA 4TUJA 3T0BA 4GKNB 2GAZA 3HR5A 4U1SA 5D4QA 4GT7A 2CJUL 2EDLA 3PWLB 4PRNB 1U92B 4JFZH 1W0YT 4U4BA 4JFEB 1W0VB 5FGBC 4D0CA 4PRHD 2NNAA 1G7JA 4L5FH 4Z7NF 1GGIH 4YDKH 1LO5A 1CXEA 2BNRA 2VLJD 1DSFL 2QSCH 1AFVH 4D3CH 2OR8A 4PGBB 1QTYT 4S1QL 2VNCA 2QADC 3C9NA 5ANMA 5DUML 5DF0A 4F7MB 4NQEE 3DETC 3H3KA 3V0VB 2WM0A 3FL7A 1QSFE 4NZJA 1NGWB 5GRJL 4PTTB 2FBJL 5DTFA 3CX2A 4WI6A 4ELMA 2PTUA 5D6CB 2NY3D 1RJCA 1TJHH 1PY4A 5AUMA 3VMNA 5D5MB 1YEKH 1RZFL 3LHPL 1K2DA 5HYSB 3GSOA 2P8PA 1BD2A 2Z93A 3VXNA 4WU7A 4JPKH 4XB8A 2W91A 5CD5D 5EU5A 2VLRD 5T5NF 3WDIA 3AVEA 4JZOA 5JDSA 1KXVC 4OBRA 1EAJA 3LV3A 1R6VA 3TV3L 1WBYA 5D6DA 4MAYB 4PB9L 3V4PH 2HAZA 1REIA 2IBZX 1FGNH 3VRLF 1JPFB 2XOTA 3QDHA 1MHCB 3QQNA 4HCRH 3VD7A 4K7PX 3ZKND 4Y5VA 4LEOB 3WXVH 5KTEH 5LWYH 4Z7VB 4RQQB 4LLDB 4FS0A 1G0DA 4HS8H 5I0DA 4G7VL 2ID5A 4F57H 2CMRH 1G7IB 4H20H 5E4EC 5B39B 2DQEH 1NUFA 1IAIH 1QR4A 4J8RA 3TWCL 3MJ6A 3IDXL 2ESVB 4DFHA 2X70A 4KQ3L 3QNXA 4GOSA 2MCPL 4O51B 1HHJB 1W8NA 1BVKA 2JJSC 4RSVA 3ARGC 2QR0A 4R4FH 4G3YL 2Y9RT 4JLRB 1CS6A 4MS8C 1A6AA 4U3CA 5IT2L 5I1HL 1T89C 2BNRE 3QWRA 5KOMC 3BW9B 3QDJB 2M2DA 2Z91B 4ODVH 1YUHB 5FDWB 1L7TH 1DEEA 1X6LA 4S0SD 3VFVB 5ANME 5HXMA 3KGRA 4KZEL 2CGRH 4KKCD 4D9QD 1A7RH 3K1KC 4ELME 3FTGB 4JAMB 1D5XA 4K07A 1U3YA 4LLQB 3DUSA 1JN6A 1UXWB 4KRPC 4AYFA 2DQUL 3SOBH 2BCKA 3ROLA 3BZEA 1BD2E 2H41A 5SX5K 4Y4FA 3C6SA 4JRYB 3C60A 4OF0A 5EFIB 4ODTH 1OW0C 2BNUB 1HCFX 5IFAL 5B22A 1S7XB 5E00B 4LSTH 2FLRT 1K3IA 2JJTA 3ISWA 4N9GB 1SEBB 1IBGL 1CGTA 2R56H 3AB0C 2F53E 1GZPB 4QEGA 1CFVH 3QUMH 1Z3GL 3WIIH 3SGEH 1HXMA 2DM7A 4XZUA 2FH8A 1ZHKB 5IFHH 3GSXB 5K59F 1FZKB 4I5BB 4AEHL 2PR4H 5KANG 3WDJA 3WD5H 4LKXB 5C9JB 5TDOA 5TPWL 2P4AB 1A6VL 1N64H 3L5IA 4YXLL 1IT9L 4IS6B 4Y4KA 3LN5A 3PL6A 4ZXBD 4I48B 2DWDA 1QG3A 1CDHA 1U3ZA 1NGZA 1YJDH 3F6IA 4G8GD 4FQXD 5J4MA 2ORBH 3OZ9H 1NLBL 4XBPA 4LSUH 4M43L 4ENEC 3MRJB 5ICYB 1QFOA 2PXYB 4OUOA 3BGFB 3RHWK 2XZAH 1DQJB 4CMMB 1HQ4B 2VZSA 4QHUB 5DJZB 3ROOB 4HDIB 4MD5B 4PLKD 4P5KA 5JORA 3HPLA 3UTZA 4S2SB 2DQJL 4NQTA 5F6HI 3DHMA 2OQJA 4O5LL 3MBED 3BQUD 1M7IA 1QOKA 4BQ6A 1JZ3A 1ONQA 1GGIL 2VDKH 2VLJE 1ZT1A 4E41A 1PG7X 4I18A 3LSOA 1DQLH 4KV5F 4F7EA 1HZHL 1CK0L 4KUZH 4YX2H 1EFQA 1AGFB 3GJFB 5IJKA 4MJ6B 3K1DA 1TZHA 3N06B 1GAFL 2DMCA 1Q9KA 4NPYA 4MNGA 4NN7B 1J7VR 4AEFA 4RBPK 3UJJL 1T83A 5EPMB 1ACYH 4RGNC 4LCWA 3ARFB 5C0EB 1K8IA 4M62L 3L3DB 3ME0A 1KTRL 3E6FA 4LCCA 2APXA 3KJ4B 2HKHL 3TBWB 1UM5H 1MHEB 3V5HB 4EQ2A 5A16B 4X4YB 1YNKL 2XQBH 2EXWC 3RX5A 4HWZA 1OP3H 1S9VB 1MCRA 1P1ZA 1KSRA 4HUWA 2UZIL 2NR6D 3T0VA 3MRGB 3SJVB 4AT6B 4F2MB 3I9GH 3ULVH 1B0GB 4WGWB 3WS3B 1MCNA 3ARPA 2C3WA 1FN4A 3UAJD 4BELD 4W6XB 3L3KA 2A74B 3WXWH 3UMTA 3T8XB 4PJIF 5E9DB 2ICEB 1INDL 2FHBA 5SWQA 1DBAH 4ZUTB 5LWYL 5C71A 4FFWC 5FO8B 1JTPA 3MYJB 2CR3A 4OIIH 4GJTB 3T77A 4ZXBA 3QH3A 1PW3A 1FAIH 4JG0L 4YBLB 2DQEL 1T5WA 4X0KA 2XQYG 2JJWA 4G8GA 4X7TB 4YFDB 5EBMA 4LIQE 2B1HL 3FOMB 2PO6D 4LL9A 4LCYA 4LNRB 2ZZUT 1DBBH 2C1OA 1WIUA 4PGDA 4UAOB 1P9MA 5DK2B 1NL0H 4GAJH 3W82A 2XTJE 3JVGC 12E8H 5KVGH 2Z31A 4E41E 3O8XC 3TH2T 1H3GA 2YSSB 5B3JF 1RUML 3M8OH 4X9HA 4XTRC 3S96A 2E7CA 4S1SL 4HIEB 4U6XA 4XPFH 3BQUA 2GY7B 4XPHH 1L7TL 1I8KB 3O3DB 4E42B 3KDMA 3RWIB 2YUVA 3M07A 3OKLA 4YIQA 4JVWA 4MNGE 1RULL 1ED3A 1WCBB 2IBGA 3KPRD 1IGTA 3C5ZD 3DVGA 3UBXB 5DT1H 4LCWE 1JGEA 3P0VL 1XF4B 1J8HB 1EZVX 2XZCL 5FUOL 4TUOA 2H3NA 1YEDA 3BDYL 2Y6SC 3VXSB 1FNGB 2DQTL 3MJ8B 5TE6L 2GJ6B 1GGTA 1KPVA 1IGJA 3K46A 1T0NA 2CO7B 5JW4Q 2IFGA 4EBQH 1EUTA 2J8UB 5I1EH 4ZD3H 5EU4B 1RIUH 2PYEB 3P73B 4XP9L 2DLFL 4YDIL 3VD9A 4YUEH 4WFGD 2MNUA 3L9RA 3ZL4H 2VDML 4QT5A 4DJMA 2GQHA 3S4SG 4QRTA 1VGEL 4ZO9A 1T2XA 1KJ2B 2A6KA 2OM5A 5DD6A 4NC0B 2EKSB 4KK5C 1TDQA 4NQSB 2VRAA 3HCVB 2Y07L 5CAYB 5T1LB 4NCC1 4ZFFA 3WSQL 2AGJL 3T0EA 2CKNA 2O5XL 3ETBF 4HPYH 4KVNL 4U1MA 1YEJH 1ZHBA 3VG9B 2PTVA 4G8GE 2XFXA 3KAAA 4FQ2H 6CGTA 3BHBB 5MEQA 1U8IB 1A4JA 3OZ9L 1QSZA 5E6ZA 4J3OC 5D96B 4OD3L 1U93B 2I60L 2H8PA 2AS5M 1EEYB 1U41A 4OLWH 4BQCA 5JOFB 2BSSB 2AK1H 1R3KA 2PO6A 4KQ4H 2HTLD 3ECBB 1F6AB 4I4WA 1LHZA 4EN3C 4HWNA 1RHHA 3ARGB 4S1DD 4ZQKB 2IPTL 2ZCLL 5TE4L 1JNLL 3G5VB 4DN3L 4MWFB 1ZVSB 2VDKL 4IHOA 1QP1A 5FEBA 3EO9H 5HDQH 1QRND 3SDCC 5DUBA 3O2VH 1JWUA 2YD5A 3TYGH 1EMTL 3MGTB 3AREC 3RL2B 1WWBX 3SGDI 3RDTA 4M6ML 1CF8H 5IVXA 4XPTL 4K23H 1NCTA 4NKIH 3WO3B 3DGGA 1K4CA 3IVKA 4UDTA 1ACYL 4X6DA 1G7HB 1N8ZB 3OKMB 4TRPL 1VFBB 4HKBA 4UINH 1KCRH 2I5YH 4IMLB 4JZNA 2W9DH 3VWJA 3QG6B 2XQBL 5JXAH 4GS7C 4ZUWA 2VWEE 1LQSR 2BRRL 5HBBA 2XZZA 1YYLH 1P4BH 1OAKH 2E8ZA 1F3DJ 3VI4E 4YHYC 3MRRB 5F1IB 3BKYH 3ARDD 2AXGA 1UGNA 5DJDA 3QFJB 3T0EE 1CZ8H 2BXYA 1T7WA 5F9WC 1UEMA 5TH2B 1C12A 3WXWL 4U1HB 1Z0NA 1HHIA 3LMJH 3NZ8B 5AWNH 4PB0L 1YNLH 3KS0H 4YNYA 3TT1H 1FPTH 1GZQB 4EDWL 3G5XB 1S9YA 4FQCH 1FAIL 1P7QB 3FB5B 3I85A 3MRCB 5C0DB 3VDCA 5HYSG 1DQML 2J5LB 1AXTH 1H3XA 1IAKA 1KIQA 1LEGB 5HSFA 5FIEA 4KXZH 3OAZK 1I7ZB 2COQA 2OL3B 1YNTB 4FXGA 1J86A 2DMKA 5E1AB 1HINH 4XVTL 4HBQA 4RMTA 1LVEA 5J9PA 4LLWB 3M8OL 4UTAL 4MDJA 1R5WA 4Y5YA 4AIOA 3HUJF 4MLIA 3OXSA 2NY5L 2XG4A 3ZE1E 5IB2A 1EHXA 5I66A 5IVXE 4MDIB 3CFKB 3S5LB 1KTLA 5EUOA 1MREL 5GJSH 2QADD 2XQYK 4PJDB 1S7SB 2NY0C 3RAJL 2FRGP 4X6DE 2FHFA 1NBQA 2VQTA 1FHGA 3DETD 5B39G 2FIRT 2EC9T 5DT1L 1JNNL 4WHDA 2YA1A 1HDMB 2X4OA 1KIPA 4NQXA 4FQJH 3UP1A 2ATPA 3DMMB 3ULSA 1TPXC 3NPZB 1N6UA 1E28B 1XF5A 4UOW0 1F90H 4WFGE 1IAII 5L2KB 4L9LC 4YUEL 3L5XL 4ZUSB 2BNQA 3LN4A 4JFQA 5EB9A 2IPKB 1MJ8H 1DBMH 2Y4SA 3MLVH 2IALA 3SKNA 4DWHA 1BIIB 1YJDC 2ICES 3EAKA 2VIRA 2E6PA 4OLZL 4YPGB 3NCYP 2OI9B 2AQ2A 4G8IA 1ZAGA 3SKJH 3UTQB 1MCHA 2X4SA 3QUYA 4NUJB 3I6GA 1NBYB 1YMHA 1XGPB 4XMPL 3AUVA 2GYSA 3HB3C 2UUDH 4KVCH 3P40A 4ZUUA 5C3TA 2XNAB 4WVRA 3QQ4B 1RJLA 3QI9C 4X5LA 2VZVA 3GIVA 3X11A 3HHRB 4DGVH 5E2TH 4KTEH 1D6EA 5J11C 2AK1L 1EJOH 4WUKL 3H9HA 4P57B 4KQ4L 1QLEH 1OL0A 4DKEL 4QGTA 1B90A 2JB6B 4MS8D 1RMFL 5EO9B 3F5WA 3L6FB 4DN4H 4WUUD 3PWJA 1A7OH 3P30H 3L7EA 4LDLB 5CGYC 3MV01 3T2PA 5HDQL 3F8UB 5EUOE 4B53A 4Q74A 1UB6B 3NAAH 5D72L 3QEUB 3SGEI 2A0LD 3HS0B 5KSAD 2YA0A 4ZFGH 5IW1B 4RA0C 1CDBA 1KN4H 1U8JB 1N0LA 3TYGL 3LQAL 4LHUB 1BEYL 5GGTL 4DK3A 1MCWW 5DMKB 4XHJD 1CF8L 4GKZA 3VFWA 5HHME 4NKIL 3W2DL 1TCRA 2OX5A 2YBRB 1OAUL 4PJBA 3WEXA 2BSRB 2BX5A 3LQMA 4KRPD 3ULVC 4NC1C 5TGBA 1WZ1L 3RVXC 2EE2A 2GJJA 2ZUVA 4CRPA 2BNQE 3PGDA 3JWNC 4UV4H 4XAKD 2XY1A 2W9DL 1U95B 1P6FA 3BEVA 5IHBA 3MV7B 3GJEB 1R5VA 2D7NA 1Q9OA 5KSBB 3BZFB 2J2ZA 3DRTA 4JB9L 1VEOA 4JO3L 2X4RA 1P4BL 1OAKL 4WEBH 1BVLA 2DQCH 1MFEH 3AAZB 4R3SA 1J12A 2D0HA 2AJXL 1BIHA 3VW3H 3VXQB 3UTTD 3QISA 3FT4B 4IDJL 3CFEA 3P4MA 4F3FB 2R0LL 3MOAL 4HLZH 1RFDH 4PJHA 3T2NH 1NC4D 3HMXH 3A6CH 3QIWC 1DUZB 5AWNL 1OGTA 4RWHA 5E2WH 1MH5A 4FOMA 3TT1L 2HA1A 4YFLF 1U2HA 4FQCL 1ZHNB 3QHFL 4HJGA 3UTSA 3CMOL 3ESUF 3PV6A 4HWBA 4L3EB 3PNWA 3QUXB 2AI0L 4NO5A 4ENED 3DVIA 1UA6H 2ZUXA 1N59A 4HK3J 5E56A 3TVMD 5GGVH 5E08H 4ONFL 3KYAA 3GGWB 1I8IA 2OMBA 1TLKA 2W0KA 1HINL 5I8KL 1FG2B 3BPCA 3SQOH 5DDHA 4OTXH 4YGVB 1H5BC 2ZOLB 1DE4B 1MI5B 4YFLI 2ZG3A 2NYYC 4FG6C 4ODUA 2X4PB 3C5JA 1CFBA 2YUZA 1S8DB 4Q2ZB 7FABH 5KSAA 3U4EA 4U7SA 4WW2B 1T1YB 5JPMB 3CDGB 4PJBE 2IQAA 4HGMA 2P5EB 4TULL 4RGND 3AREB 1OF2B 1MUJA 4FQJL 1BZ9A 4D0DB 2AV7A 4MA8H 5C0CD 2GSGB 1CDJA 3KJ6H 4EIGB 2FX7L 4UQ3A 3S9DB 1WGOA 3W0WD 5LXGL 1PQZB 3THML 3O6FD 5D2LA 4PUBL 1QEWA 1SYVB 3I50L 2EXWD 3EYOA 3E8UH 2VZOA 3GRWL 1FFRA 1T03L 4GS7B 3BP4A 1DBML 1KPUA 3MFGB 3F7YB 4H26A 3U6RA 1X5AA 4PV8B 4RMWA 1JWSA 4ELKB 3CJJA 4PJHE 4PY8J 3DV6B 3WV0A 2F8OA 3P3YA 4FTVA 1QFPA 2Q1EA 5C0AA 4KH2A 4YHLL 1UH4A 3UTTA 3UBXG 3SKJL 3P4NA 3CSGA 2YOCA 5I1KL 5F9WB 3GB7A 5D7KE 4Y4HA 4EXPX 3UTSE 3RBSA 1FV1B 1MWAH 3H9ZA 4LBEB 4WNQA 4XH2B 1FL3B 4XCCH 2M26A 4JDVA 2ICCA 4QHNA 1CN4A 1NMAH 4GLRH 4QO1A 1CLZL 3OJDA 5TFSH 2V2WA 3CUPA 1UJ3B 4HXBH 4F15B 4DGVL 3T0DA 3P0YH 4XNZC 4ZAKA 5CSBA 2H32H 3LIZH 3O8XD 5F7KC 4LAQH 1ES0A 2WWKT 2CKBH 4N8PA 2BVTA 5ILTH 1CLCA 1YMMB 4HIIB 3OB0K 4F58H 4LSSH 3NAAL 3RZCA 3VG0H 1ZGLB 5BZWA 4BQ8A 3RTQC 4JJ5B 1KN4L 3H9YA 5I18L 2NLJB 5EIIB 3V6FB 3U7YH 4UIMA 1SM3L 5BRZB 1H15B 2V17H 2Y6SD 1CG9A 2EDOA 5ISZD 2EYTB 1SJVA 4F33B 4EI5C 5D2LE 1ZLUK 1DANT 3KPLB 1KBGL 1AGEB 5D7JA 5E8PA 3QEQD 1CYGA 4UV4L 5C0CA 5ADOH 2NY6C 2LTQB 1NDMB 4I3GA 3BDBA 5BO1H 4HD9A 1LILA 5IVNA 2OCFD 1G7LA 3CDYA 3KPQA 2A83A 3MOQA 4LRNL 1X5JA 2W9LA 4P3DB 1LP9B 5GSRB 3GDBA 4OAWB 3EHBD 3G04B 4WFHD 4WEBL 2DWEA 3OKDA 5EN2B 4FTVE 2BVYA 3D25A 5C0AE 4TVPL 3UTTE 3LKOB 3CZJA 2OJZL 5K93A 5A2IH 4RX4A 3BWUC 5CJQL 2HJLA 3VWKA 1RURH 4Z76B 5C6TL 4LQFL 3SDXF 3A6CL 2DL2A 1LE5A 5IB4A 4HC1L 3EYFB 2OP4H 1EBAA 3QJFA 3GSVB 1YEIH 2P49B 3UYOD 1P6AB 3TA3B 1UA6L 3LEVL 1T21B 5F7LB 3QI9B 4KK9C 2XN9A 1A6WL 3DTXB 4HKXA 3Q5YA 5KS9F 4EN3D 3MNVB 1U8HB 5B38B 3DXAB 4OTXL 1NC2B 4DEPC 3MLTB 3G6DH 2W65B 5FYLH 1JI1A 3DRQB 4Z77A 5HI3C 3SE3C 3G9AB 3MJGX 5JNYB 1KJ2L 5A40E 5C0GA 5HHVH 3KXFA 3WFBH 1JZ6A 1XFPA 4LU5H 4NBXB 5MENB 1BLNB 3VFNB 1N26A 5E8OB 5JIKA 4YHZL 1IC5H 2AV1B 1KULA 5C0CE 3GO1L 1FP5A 4OD1H 1P53A 2ZJSL 4OM0H 3FQXB 3T4AB 5DZLA 4CVWA 1AO7B 3BFOA 1SJEA 2B5IC 2XWTB 3HC4L 2FB4L 1Q0YH 4OCYH 3QXDB 1OQOA 3E8UL 2BDNH 4LRIC 4GW1A 4KXZI 4UB0H 5AZ2L 4F7PB 4Y19D 5B3JE 1OAZH 3NFPB 4WCYL 5I1LA 4M5ZL 3ARBC 5F72S 3RIAK 3O4LD 1IE5A 5I1IH 4OF8A 4KROC 2XKSA 3GK8H 2EH7L 5EZLA 3S5LG 1MF2H 3SY0B 1CIUA 3P9LB 5MERB 1UKTA 1KN2H 4BFIB 4PJ8C 3WHE0 1QVOA 2CUHA 3JV4B 4TOYL 4JFFB 2O26U 1H3TA 1OP9A 1HH6A 5IBLC 1ADQH 3SKMB 3EYUL 5JQHC 4UV7H 2B20A 1C5DB 2GTZB 2VL4A 1ORQA 4WY7H 5MEPB 1KELL 4XCCL 1KB9J 4PGJA 4JFXA 1NMAL 1BOGA 4JRXD 1YYML 2R0KL 5ID1A 4CU7A 1OAQL 1FZJA 1N2RB 2AXFA 5DHXB 3E2HB 2WZPD 3WYRA 2FO1A 4L29A 3KWWB 4G6KH 2AW2A 3BUYB 1UJTA 3U1SL 1X7QB 3IFLH 4G6FB 4FHBD 4R0LC 1H5BB 3SDAC 3TT3H 3SDYL 2HVKA 4BK4A 2NY0D 3DVNB 2WBJC 2VDLL 4FNLH 2FIKA 1NMBH 3P4OA 1MELA 3VI3F 1U3HD 2WIIB 4XWOC 4X7CC 5KVFL 2E7HA 2G2RB 4MJ4A 1XZ0B 1UWXH 2K3TA 3P9WB 4YBQC 5EA0L 1A6TA 5ADOL 1J8KA 1R5IB 2WSKA 3TM6A 1KCSH 4YZFF 2BVOA 4JPWH 43CAA 4JFYA 2EH8L 4PJXF 1L7IH 1QFUH 2OL3L 4AM0A 1TJIL 5HPOA 3HI6H 1JRHL 1NMCC 4YC2C 4G6MH 4P2OD 4RMVA 2NMSA 3BMVA 3VXOA 3BKCH 5D1XD 4XGZA 1SY6H 1AQDA 4G8FA 3VGBA 3P9MB 1M7DA 1IAIM 4LHUG 3MO1A 1X5GA 2JCCB 2AK4B 3CVIH 3QXVA 4RFOH 4TTDC 1CFNA 2WWKO 1RU9L 1F11A 1WTLA 1CI5A 2BY3A 3QA3B 1IAMA 3IU3A 3HE6D 4U6YA 3H9SB 4WI8A 3UPRB 2DQDH 4JREC 1WVZA 1AHWB 2JTDA 1FYTB 3DX8A 4JN1H 15C8H 4NZTL 2QL1A 1NFIB 1IILE 5FCUH 1F8TH 5C9KA 4NT6A 3LRSA 2XWBB 5EWIL 3WS6C 3MRLB 4XCNA 4YHKH 1I1AB 1UZ8A 5E2UH 2FNBA 4KAQH 4DZ8A 3MACH 3PJSA 5T3XH 1AGBA 1L9NA 1PKQA 1PYWA 3L5WA 1ZE3C 1H0DB 4MNQD 1S5HA 3RVUD 4K3JH 3O6KH 4PJCB 3X17A 3LB6D 5C0NC 4QKXB 2WLZA 4JFDD 1P2CA 4ALAL 3D69A 1CXLA 4NQDB 2F5BL 3WFBL 4JFPA 3GMRA 3LZFH 4M7LH 4XRCB 5I73B 1F3RB 3BT2H 5MP6H 2E9WA 5D93C 4Y16C 4ZPTA 1CD9B 4MCZB 4QTHB 1U3HA 3ULVD 4HZLA 4GAYA 4N0RA 4NO3B 4RFNC 3MGAA 4PREB 3PWUB 4P2RA 2FX8H 4ONHB 5EU7C 3ZTJH 5F9OL 1JMZA 1E4KC 1WWAX 2CIKB 2W0LA 2NY6B 4L1HA 3TZVA 3DOSA 2PW1B 5L7XL 1TQBC 5BJTB 3F7VB 3OHXA 2K7PA 3JWDH 3GHEL 3O4LE 1KB5B 2HMID 3BP6A 5I30L 4FMFA 4LCUA 1QBLL 2BC4A 4PJ9D 5D1XA 4GXUM 4DTGH 2Z8WC 4KJQD 3ZYZA 5D71H 1T22B 1I7TB 4R7DB 2X2YA 2VC2H 4MB3A 2YD9A 3MFFA 3PWNB 3QIWD 4LHJB 4XMKL 1MJJB 4PV9A 3CLEH 1ADQL 3KVQA 4UV7L 4Y8AA 3LQZB 5EU6D 1YN6B 1FFQA 1F4YH 5DEGA 1CD8A 1T1ZA 4LAJH 5KVDH 2GW5A 2R2HB 3HNTH 4MXWH 1JZ4A 4J4PD 3QUZC 1YEGH 3K2UH 4AL8L 5LJYH 2XKNB 1M6OA 1FNHA 2G5RA 1TVBA 4G6KL 3RY5A 4BUGA 4X80L 2AJZA 3IFLL 4DUVA 5JW4N 3L3HA 4O9HL 2PNDA 1Y18A 3U48A 3MV9A 5CJXC 2VSDA 1D9KB 5E5UB 4MNQA 1FCGA 3KNBA 3TNNB 3TT3L 1Q9LA 1PBYA 3GMNB 2HTKC 2MOVA 1KFAH 1J87A 5DK0B 3RPIB 4I77H 5C07D 5F7WC 1I75A 4JO2L 3DX6B 3MZTA 4OD2A 1GPOH 2WAHA 5AD0B 4PJ5D 25C8H 5EZIL 4C54A 3FAXA 4JFED 4X9BA 3X13B 4OT1H 4DKDC 4X98A 1T4KB 4P2RE 1SYSA 1ORSA 5IOPA 3V6OC 1MSPA 4GRWB 2FJGA 4M3JA 4HH9A 4WGVB 3VRJB 3QYCA 5I2IB 2VR5A 1CGXA 1JHLH 1GHFH 3B3IB 2FL5A 3OKOB 5K9JH 2HLAA 4EIZC 4OZFB 4NO0D 3S4SA 5JPNA 3PUCA 1QKZH 3DUHA 1P69B 2OR9L 1QFUL 4TSCH 1I9IL 2IWGA 1IQDB 3BD4A 4G6ML 1CFQA 2C7UB 5T5FL 1UQSB 2VZ1A 1TNMA 2NW3A 1QSED 5DHVB 3REVB 4Z8FH 4H25B 5HTSA 3S97C 1ZANL 1NCAL 4N68A 4PJ9A 3WDHA 4UU9A 3SCMA 5EBLB 4GG6A 1BAFL 4K2UL 5DSCB 4O2EB 2CXKA 4WO4D 4PJ8B 3BWAA 5HGAA 2GCYA 5LQBL 1WISA 3RBGA 1S7RB 2YD1A 1LNUB 3S3SA 2DB8A 5E4IA 3C8KB 4NNXB 1EXUA 2EDXA 5LCVH 5HI5D 3AXLA 2AERT 3KHOA 3TJEH 1RUQL 3MUGA 4UOJA 4P23C 1T20B 1DL7L 2J88L 4J4PA 4PJ7F 3D9AH 1UVQB 3KPOB 4FQQB 2R1XA 4KAQL 3S3JA 3MACL 4ONOA 3HE7A 1UWEH 1I9EA 1KTDB 3VRIA 4MNQE 3WN5B 2W60A 3JTTA 4WDIA 5DJ6B 2WMPA 4B50A 2Q76A 1KNOB 5TQ0H 4GMTH 4XP1L 5F7EL 3RI5F 1NGXA 1N5AA 4R0LB 3RTQD 1JPTH 2R15A 3SDAB 5JXEC 3LZFL 4GKNA 2ESVD 3T0XA 5ICXB 2EDWA 2W0FB 3V5DB 3OG4B 1I9RH 1WTGT 3PWLA 4HK0B 2WBJB 4LF3B 4CBPA 4PRNA 2VXTH 1U92A 4EI5D 3G6JB 2MMXA 4JFEA 2Q86B 1W0VA 5CKGA 3TH3T 2UWEF 2DJSA 1CICC 4LARH 1T6VN 4O4YH 3SDDB 1XT5A 4ONGH 1S78C 3RKDC 1WUNT 3TPUB 5B38G 4L8SC 3S35H 5I75B 2B4CL 1BFVH 5KJRL 1FNEB 1WFTA 4JKKA 4IRSC 5HVGB 4A6YB 4PGBA 1MQKL 2F54D 3MV8D 3VXRB 4ODWB 1V7NH 4GG6E 3C6LC 1IL1B 4F7MA 3EOTH 5IR1B 1F6LL 5HHNB 4NKMB 1AD9B 2FX9H 1PJ9A 3V0VA 4Q58C 5DUPH 1NGWA 4LGSB 4UZGA 4PTTA 3RX8A 3U4AA 3E3QE 5D6CA 3TN0C 2ED9A 4WO4A 5HGHB 1F4YL 4PRPB 4PRAB 1RPQA 5D5MA 4J3XA 3PWPB 3RWEB 2CH8A 4GBXB 4XC3L 4KK9D 4NKDB 2CDFB 4HXAH 1WV7T 4MAYA 5IBTH 4YWGL 5GGTA 5CMAB 5E8EB 1IGCL 2YHGA 4QRSB 1WAAA 1JPFA 4M7ZC 1MHCA 5HI3D 2X10A 4LEOA 3PDGA 4EUPH 4Z7VA 3QHZH 4RQQA 3L5HA 2NZIA 4LLDA 4LPCA 3H42H 5C07E 5BV7B 4DKFH 3K4DA 5DD0L 3FQRB 3H3PL 1G7IA 5B39A 4WV1B 4XNMB 3WNMA 3PWVB 1GPOL 3SDXA 3QEGH 3UO1L 5IMKB 2ESVA 4JFEE 2PYFB 4O51A 4X6CB 1HHJA 1BHGA 3WFCH 2Y06L 3U83A 4JHWL 4Y16B 1KJ3H 4PJAB 1GIGL 2VUYA 4DVRH 1F6FB 1OPGH 4JLRA 4PJEF 1D5ZB 1JHLL 4DAGH 3BW9A 1GHFL 5MEOB 3BPLC 2Z91A 1N6QL 3QCTL 1YUHA 5FDWA 1X4YA 1QKZL 5F7NC 3VFVA 3ARBD 1J9CT 3QQ9C 5E0QA 4J6RH 3VD5A 3WIHH 4X4XB 2R4SL 3T08A 3MV8A 1MRFH 4F9PC 1OGAB 2NTFB 3CSPA 4QOKD 3FTGA 4JAMA 4PGCB 3ARFD 4LLQA 1AIFB 5D1QB 1IM9D 2MQ0A 4LGPB 1UXWA 3I2CH 1BBDH 4UQ2B 3IXAB 2AABH 2RQ8A 4JRYA 5SX4I 4Y2DC 2H32B 5EFIA 2BNUA 1JV5B 1S7XA 3N1FC 1G1YA 4N9GA 1SEBA 3BN9D 4F7TA 2FECL 1IGIH 1FC1A 1GZPA 4GFTB 3SGKA 1Q0XH 3DROB 3MLYL 4OIBA 2RIKA 2ZG2A 1WAAE 3QUZB 4MSWB 1ZHKA 4JM2C 3GHBL 3GSXA 3ABZA 1UWEL 3BPNC 2AQ3A 1FZKA 4I5BA 4Z7VE 4HIXL 1MRDL 4LKXA 5C9JA 1MHPL 5HGBB 3SO3C 4JY5L 4IRJB 4IS6A 4QXTB 4I48A 2BOCB 5F89A 4R2GB 4DCQB 3SDXE 1AXIB 2ESVE 3QNZB 3PGFH 2XI9A 4WI9A 1QFWH 4QRPB 4TYUA 3L1OL 1LK3L 3GRWA 3IU4H 3MRJA 5ICYA 4XWOD 2PXYA 1JPGB 2APTA 3FB8B 3JWDC 2IG2H 1DQJA 4CMMA 1HQ4A 3ROOA 4QHUA 4TVPD 5DJZA 4HDIA 2ARWA 1BFOB 4MD5A 3TLRA 4YBQD 5LGJB 3QXUA 1NAKL 1QBML 4S2SA 3ALWA 5EOTB 3BIKB 2VXQL 2MJWA 4HKJB 4OUUB 2P5WD 3IFNL 5C09B 2VN7A 1BFVL 1T5XB 2YK1L 1AGFA 3MV8E 3GJFA 4RMSA 4CKVX 4MJ6A 4ZODA 1H3UA 3O2WH 2VDNH 5DWUH 3LKNB 4XBEL 2UV3A 1T04B 4WIQA 5ADPL 4TTDD 1XIWC 5HYJB 2APWA 2D03H 2HJKB 5EPMA 4HUVB 1G6RH 4JRYE 2WQRA 3V0AC 3DX7B 3L3GB 3ARFA 2CQVA 5C0EA 4R8WH 3L3DA 1JIBA 4PBVC 5DK3A 4POZD 3TBWA 5GS1B 3EYSL 1MHEA 3S88L 3V5HA 5A16A 4X4YA 3O2DL 2CK0L 4PJFF 4TNWF 1WT5C 1ZA6B 2VLMD 1CT8B 1S9VA 1DBJH 1HIML 4OB5H 1YECH 3NIFE 1MCJA 2FEEI 2J6EL 1FVDB 3CXDH 3MRGA 3SJVA 3EO0B 4AT6A 4F2MA 3N1QC 4HXAL 4NYLB 4KHXH 5GZND 1B0GA 3WS3A 5EDXA 5IBTL 3K4AA 5C08D 2G60L 2VDRL 2A74A 1T2QL 3T8XA 5E9DA 2ICEA 4ZUTA 5HYIA 5C0ND 2EDRA 3Q1SL 2LABA 3QHZL 1HI6B 5DFVC 3IFOB 5FO8A 3IKCB 3HI1B 5JZ7C 3MYJA 3H42L 2R23B 3UROR 1EV2E 4H8WL 4JR9L 1NUDA 3B9VA 4FA8A 1MOEA 4X7TA 1JGLH 1RZKH 1EGJA 3FOMA 3MJ9L 4RGOH 1I3GL 3IJSB 2X05A 4TNVF 1X5XA 4LNRA 4OF7A 4OCXH 2AJVH 1ULVA 5DK2A 1LGVA 1FORL 2VH5L 5E8DH 4DAGL 2YSSA 5FGBA 1MCOH 5B8CC 3RWFB 3NFSH 4HIEA 4RISH 4XNYL 2IFFH 3O0RH 2J7LA 1J5OL 3DHJA 1I8KA 2C3GA 3O3DA 4E42A 3RWIA 1ACZA 3T09A 1T2JA 1KPRB 3O3UN 3OV6A 4HC1A 4WWKC 4X8JB 4KKBD 1UACH 2QQLH 3LRGA 1WCBA 4M6OH 3BH8B 3B9KC 5E6IC 5T1DH 3UBXA 5L2JB 3VFGH 4D0BB 1XF4A 3BZDA 1J8HA 3JBG7 1O7SA 3GBML 2OBGA 3VXSA 1FNGA 3MJ8A 2GJ6A 3MLSH 2X4UB 3I2CL 3HA0A 2HKFL 2J8UA 2AABL 5FUZH 3CFIC 3V0WL 5EU4A 2LAAA 2PYEA 3P73A 4JDZB 4LEXL 2NXYB 3SJVE 4OZFG 3A6BH 3BXNB 5E03A 4YZFE 1A3RH 4NRXB 2EIZB 3QFDB 1KJ2A 2YN5A 3NA9H 5KG9B 2APBA 2A9ML 4X7SL 7CGTA 5SWSD 2VLKB 2ERJC 1I85A 4UIKH 3AGVA 4NQSA 5E9DE 3HCVA 1NGYB 1DLHB 1FZOB 5T1LA 3B5TA 5I9QC 5FHAL 3NIDE 2NY4D 4WJ5B 1MAMH 3AM8C 4NN5B 2APFA 5E99H 4W4OA 3T3MF 2HTKD 1KB5L 3OB8A 4P46C 3SE8H 3MZGB 4QYOB 1JFQH 1UC6A 3BHBA 3NBNA 1DVFB 3PGFL 1U8IA 5IQ7L 2B1AL 3MUJA 3S98A 1W2KT 3IU4L 2Y5TB 3CFDB 4LLYB 2EIBA 1U93A 4OFPA 1I8LA 4TVPE 4HWEH 3GFUA 1EEYA 5JOFA 4JZJC 4OZIF 1T0PB 2BSSA 2JB5H 2DLEA 1AGDB 2JELL 1EO5A 4OFYD 1RK0B 3BPOC 4LDOB 3ECBA 4OBSA 5IVOA 1F6AA 3ARGA 3VXMB 4ZQKA 5J7CC 3UJIL 4E9LA 3G5VA 3RVWD 4XVUC 2OSLB 3EDEA 1PX3A 4MWFA 1A5FH 4GG8B 1ZVSA 2IBBA 3W9DB 4C56D 2NW2B 5DLMH 5F8RC 4OZHB 1T89A 4PD4J 5ITBL 2NTSP 1IGMH 1U8QB 2C3VB 3EDJA 4MD0B 3VXUD 1J8HE 5E8NB 1W8OA 3BKJH 5GISL 5CEZE 2KZ1B 4NP4L 3MGTA 1YY8B 5DJAB 3EFFB 3H0TB 3RL2A 1YPZF 3VXSE 5DWUL 2GJ6E 2V5TA 4MVBD 5EULV 4XT1C 4FQPA 4XVJL 2J8UE 1G7HA 1N8ZA 3OKMA 4Y2OA 1VFBA 3QIBD 1OWWA 5BS0B 2PYEE 2NQCA 4D8PB 4R8WL 5DMGD 1RUPL 2DI9A 3OMZA 4IMLA 5FM5M 3QG6A 5FYLD 5KAQF 2VLME 2L7UA 3J7HA 4YDJB 4QHMB 3U82B 4P3WA 4MXVE 4Z7OF 1QA9B 4OB5L 4BKLB 3WFDH 4X7FC 1CU4H 3MRRA 4KKLD 5ALBL 1PG7H 4I9WD 5F1IA 3MRMB 1QNZL 3OG6B 1CDCA 1FFOA 1BQLH 4M48L 3QFJA 3KPPA 1SVZA 2J8OA 1MEXH 5TH2A 1N3NB 1I1YB 4U1HA 1YQVH 4MGXA 3RGVB 2J8HA 4JM2B 3U0TB 5JQ6H 3NZ8A 2V7HB 1VACB 3BPNB 3BRDA 3ZKMD 3NN8B 4JGMA 1VA9A 1SQ2N 3LEXB 1KTKE 1GZQA 1F3JB 3IRZA 1LO2L 5CJOL 3G5XA 4OI9A 3P11H 1P7QA 3FB5A 3MRCA 2NY2D 5C0DA 1JGLL 3MOBL 4RGOL 1LEGA 3HFMH 3LPGA 1I7ZA 2J4WH 2OL3A 3LOWA 4PLJD 1YNTA 2XXMB 1II4E 1Q72H 4O58H 3CXHK 1CICD 3FN0L 5E1AA 3UDWA 5DHYB 2EDBA 2HFGL 1R3LB 2DKSA 4JM4L 3U46B 4LLWA 1FFPB 3H3BC 2O5ZL 4MA1B 2FCBA 3NFSL 4RISL 3O0RL 2FSEB 1XGUB 2ZUYA 1HKLL 3CAFA 3V52H 3VE0B 4PTUB 4BZ1H 4IRSD 2HH0L 2X89A 2X4QB 3MLWH 1TTGA 1NFDF 4MDIA 3CFKA 3S5LA 2QQLL 4PJDA 1S7SA 2F9BT 2NXZC 5GPRA 3I6KB 4LIQH 5FYJL 2P46B 2HP4A 3SPVB 4NJAH 3BE1H 5DD5L 3SEPA 1HWHB 1A3LL 4L4VB 1HDMA 1AI1L 5ETUB 3TN0D 4P59H 3TO4B 3DMMA 3MC0A 3ILQC 1E28A 2R2BB 2RCSL 5ICZB 5L2KA 3GBNH 4ZUSA 1JYVA 1JGDB 2FJHB 2IPKA 4S10A 4GSDL 3QFJE 2DLIA 2AJSH 5HHOD 1ZXQA 3IDMB 1BIIA 5C0BD 1S3KH 1JWMB 1UM6H 4H88L 2YS4A 4JQIL 4YPGA 1UXSB 4V1DD 3HKFA 5I1DB 5DMIL 2VXSH 4G9FD 2ZP0T 3UTQA 2D7TH 4JGUA 2OXGA 5E99L 4NUJA 3GEWB 1NBYA 4G80B 4MAUH 5DVKA 1XGPA 3ZDZF 4LOUC 4M6AA 5SV4A 5IB3B 2MHAA 4KHTH 2XNAA 3QQ4A 4HF5L 4XX1G 2WANA 4P2QD 1L6ZA 3S37H 2IAMB 4ZG1A 4PJGF 1ZKAA 1AE6H 1FL5B 4YBHA 4LHQB 3EYVB 3MBXH 3N85H 5GJTH 4P57A 2JB6A 3QEHB 3RY6A 1Q1JL 5EO9A 1Z5LB 2BRQA 3L6FA 1VHPA 1B4JH 4G7YL 3JVGA 4QHKJ 2Y72A 3MCLL 1C16B 1IGML 1Q9WA 5KSUB 4PJDE 4FFVC 3QDMD 4WTZG 1UB6A 3QEUA 3HS0A 1CLYL 4JHAH 3VXTB 5IW1A 1TTUA 1NCDH 1U8JA 3HAEH 4LHUA 4HFUL 4F7CB 5DMKA 1S7VB 3I02B 4M7JH 3RU8H 4P5TB 3B9KB 2YBRA 4YEFA 1RVFH 3O9WC 5I71C 4RNRB 5C7XL 4AMKH 5L2KE 2BSRA 3BD3A 2DTMH 5BV7L 5T3XD 4HULB 4Y2DD 3HG1D 2DN7A 1QFWI 1U95A 5EOCH 3R1GH 3MV7A 3GJEA 3Q48A 3BZFA 1JHKL 2WUCH 4X5XB 1A64A 4MB5A 3TBTB 2P42B 3GMMB 3NCJH 1J0ZA 4M8QB 3AAZA 4TSAH 1KLUB 3GNMH 5IW6B 1XGTB 2Q8BL 3VXQA 1BQLL 5EUKB 1I1RA 3FT4A 5SWZB 1RZKC 4OF6A 2J12B 4F3FA 3OAUH 2I25N 3CH1B 2B0SH 4XCEB 4N0YL 5JQ6L 1DUZA 1N0XH 1X6NA 2CIIB 5I9QB 1EFXB 2I9LB 2ICWI 2Y23A 2E3VA 1T0MB 2ADIB 1ZSDB 1IFHL 3V4VH 1ZHNA 3VGGA 1B3JA 5L9DH 4L3EA 5CIPB 3AS2A 3QUXA 4W81A 5HDBF 4U0RC 4YJZL 3PABB 1DLFH 2W92A 4G6JH 1M4KA 1I3VA 3NPSC 1RIHH 3B5HA 3GGWA 4V2BA 2QQNH 4O58L 5AAWA 1FG2A 5JO5B 4JZJB 1S7UB 4N90E 4W70A 4LLAA 4YGVA 1YMMD 4UT6H 2ZOLA 1DE4A 1MI5A 5JW3H 3N50A 3D39D 3LY6A 3C2AH 4BZ1L 3FHQA 3MRBB 2X4PA 3GSNB 1QYGH 1ZLSL 2JK5B 1A7NH 4XMLH 1S8DA 4Q2ZA 2CLZB 4WW2A 3UJTH 1T1YA 1ZV5A 2M8XA 3O3AB 5DO2D 5JPMA 5GGUB 5D8JH 3CDGA 4OKDA 1XIWD 5KOVC 5MHSD 1WCQA 2GT9B 2P5EA 3STZB 3AREA 1OF2A 5HVWA 4D0DA 1NCUA 1VPOL 2MQ3A 4N1EA 4Q9RL 4WTWA 1WICA 3HC3H 2GSGA 3QPQD 4KWUA 4U1KB 3MV7E 1D6VH 1FLRL 3WNLA 4XI5C 2XPGB 2WLYA 4CL7A 4OFKA 3PGCB 1PQZA 1OHQA 4XPBL 4MX7B 5I1AB 1SYVA 4KZDH 2R4RL 3GBNL 4NSKB 5HD8C 4F37F 2R39A 2V9QA 4PS4H 4LVOB 3F7YA 2R1WB 2AJSL 1QZ1A 2HWZL 4PV8A 1TVHB 5GS0L 5FAAA 2VR9A 4U6HB 1UCBH 4LK4A 3CU1A 4JKPH 3DV6A 5IK3B 4Y89A 1Q94B 3I6LE 5DQJB 4ODXB 4PRIB 5D6DC 2VXSL 3MODL 1K6QH 5DFVD 1P84J 5JZ7D 3SE9L 2VKWA 4GAGH 4O2CB 1C5CH 1FV1A 4L3EE 2ENSA 4LBEA 1UH2A 1KENH 3DUUB 4JG1H 2EDKA 3WLBB 2C9AA 4KJYB 4XH2A 1FL3A 1KOAA 3S6CA 4OCLC 3MRKB 2X1QA 1UJ3A 4N8CL 4ELMF 2CRMA 2VABA 3KG5A 3F12B 5TQ2L 1MI5E 4MXQD 3FT2B 3VGDA 3IFPB 5DGQA 2DQIH 1JNJA 1FIGH 1ZTXH 1JGUH 1JMXA 4P4KD 3MLUH 4IBLT 1YMMA 5I76A 3QDME 2IAND 1AXSB 3W5NA 1NBVL 3DARA 3BIBX 3EOBB 4WWKD 5FHBL 1VCAA 4NDMB 1ZGLA 2RAMA 1IEAB 2B2XH 4WW1B 4JJ5A 2P5EE 1C5BL 2VXUL 3EBAA 5E1HB 3S36H 2NLJA 3VFMB 5EIIA 3V6FA 5BRZA 1H15A 5CGTA 1U8NB 2EC9U 2NXZB 4R7NB 2EYTA 4M6NH 4F33A 3KPLA 3L7FB 1NCCH 1AGEA 2DTML 4LFHD 4M5YL 1NDMA 1Z9OA 5EOCL 2X1WL 5FYKL 5DJ2B 1IQWL 4Y4FC 2BJMH 3C60C 1KG0B 2QTEA 4P3DA 1LP9A 5GSRA 4OAWA 3G04A 3QZWB 5DURD 4D9LL 1GC1H 5EN2A 5TDNB 5EC2B 2BSED 1WQVT 3U30B 2DKUA 2R0WL 5IHUL 1GSMA 3LKOA 3CD4A 2CR6A 4OCSL 3BSZH 5ENWB 2E7LA 1UWGL 3CFCH 3OAUL 3O11B 4Z76A 4P5MB 5FA4B 4WU5B 2BVPB 2V9RA 4JO4H 2H45A 4KI5E 3RIFF 5L6YL 5D7LB 1CXFA 5GHWH 4X6CF 3EYFA 4QXUL 4P46D 5EZOL 5C0IB 4K55A 4Y5XB 1UKQA 5FGCB 3JZ7A 4Y4KC 3PL6C 3NVQA 3ZKNC 3GSVA 5L9DL 3BJLA 4OQ1A 4JHZA 5D1ZB 3TA3A 1SBSL 1T21A 4OI8A 3QI9A 5IF0A 4XNQB 1Z9SA 3DTXA 1UT9A 4ZOCA 3D3VD 1FBIH 4HV8B 3MNVA 1R3IL 5JHDB 2DQHL 4Z7QF 1U8HA 1YMME 5B38A 3DXAA 1NC2A 2ICWB 3MLTA 4XVUD 1XF1A 2W65A 3UZEA 4Z7WB 1Y0LB 5KW9H 3K8LA 3DRQA 3LKQB 3Q2CA 5CD3B 1A9EB 2RGSA 3QG7H 4MD4B 5JNYA 4RFEB 2XTJC 3OL2A 3D2UB 4K3GA 3W9EB 1NCNA 2QHRH 1JTTA 1QYGL 1E4XH 3HZKB 4K94L 2EYSB 5BRZE 5IJKC 5MENA 1BLNA 2CPCA 4OCRH 5MHSE 3VFNA 2XACC 5E8OA 5L8JB 5L88H 2AV1A 3ARTA 1WFNA 5HY9B 3TPKA 1IVLA 1T83C 2VYRE 4KKCC 2DMBA 2FH6A 3FQXA 1X9QA 4NHCH 3T4AA 1AO7A 4OZGB 5L0QB 3MRIB 2XWTA 4RGMC 1GJIA 1LP9E 4LCCC 5JUEH 2CLVB 3QXDA 4TVSa 5DC0A 4P2CG 3X3GH 1U8OB 4MJIB 5A2JH 2WV3A 4F7PA 4WI4A 3NFPA 3IDNB 4XP5L 1BJ1J 5IROA 2F58L 1MFDH 2FD6H 2JIXB 3PQYD 4ZUVB 1J1PL 2ZNWA 1P4LB 1UCBL 4ETQB 3LD8B 1WIPA 1LO4H 2BMKB 2CDGB 1UYWL 4GKOA 3SY0A 3P9LA 5CSZB 5MERA 2Z9TA 5JDJA 4BFIA 2FBOJ 3JV4A 2YPKB 2EE9A 4JFFA 4BZ2H 2I07B 4FZ8H 1VFAB 4ODSH 3SKMA 2F74B 1C5DA 2GTZA 3DSFH 1KENL 3EYQD 5MEPA 4JANB 5J8OA 4CDGC 1D5IL 1RK1B 4WHCA 4ZXBC 4N0CC 1FDLL 5IB1B 4FFZH 4AENA 3QUKA 1N2RA 1KJMB 3KLAB 4K8RH 3DXAE 3KWWA 4K9EH 4YH6A 3GSUB 1A9BB 4DGIH 2VOTA 1JYWA 1L9MA 3ZZ1A 1PEZA 3BUYA 1X7QA 1P9MC 4P2YA 2DQIL 1NPUA 2QHLA 1FIGL 2HT3D 1ZTXL 1CR9L 4PLKC 2F8VA 5EZJB 4I3SH 3NCCB 2E9BA 1VADB 1H5BA 4HWBH 3U7AA 2A77L 3BQUC 4AK1A 1FZMB 4GRLD 4X9GA 3FKUS 4LVHC 1C1EH 1DUYB 4OM1H 3T3ME 1P7KB 3DVNA 3O2DA 3DO7A 4QRRD 3NCFB 1AJ7H 2C1PB 2WIIA 1AO7E 1ZA3B 1SMOA 3NIGE 4NQCD 4YAQB 4M6NL 2G2RA 5CCKH 4XPAH 4XPGH 4WEMB 1XZ0A 1U8PB 1WEJL 5HHXL 4MYWB 3ILQD 4S1RH 2FEEL 1R5IA 2R9HC 5ESAB 2BJML 2FEDC 4NZRL 5T1KB 1UG9A 2IH1B 2YD6A 3Q6GH 3KPMB 1GC1L 2AEPH 1CBVH 5D7SH 1UWXK 5FUCE 2JE8A 3IKKA 3P9MA 2AJUH 1QLFB 5FDYA 1W0WB 3NFNB 4JFFE 1MFAH 3T1WA 2JCCA 1VFOA 2AK4A 4GXVH 1F45A 1YEEL 5F88B 3MJ9A 1ODAA 3HC0B 3S35X 3QA3A 3T0EC 2F53B 3GI8H 3H9SA 4I0PD 3UPRA 2BK8A 4NZUL 4LSVL 1AHWA 4ZO7A 1FYTA 2V7NB 2FATH 1A22B 4K3EH 3WIFB 4GMSL 1NFIA 1AGCB 3GMPB 3R06B 4L8DB 2X5PA 2XWBA 3D87B 3H7BB 3VFOB 3KPSB 3FFCB 3MRLA 1I1AA 4LPTA 3JWOL 6FABL 2PO6C 5D2NB 4RWYL 2O5YL 1HOCB 4Z78B 1H0DA 4PPTA 3WO4B 2NY7L 4KUCF 3C8HA 4PJCA 4ZSOB 1QBBA 4OKVB 5IB5B 5C2BL 3VI4F 4NQDA 3QDGD 3LEYL 4PRHB 2FYYB 4XRCA 1MLCB 4WI5A 2P24B 4ZO6A 4RA3A 4HBCL 4L8CB 2VLJB 1F3DH 4MCYB 5C0RL 4HUXB 4NC2B 2X41A 5DUMH 5I1JH 4J1UB 3C5ZC 4MCZA 4XB7A 4QTHA 4FP8L 4O2FB 4NO3A 4NHCL 1AR2A 1VFMA 3G6AB 2MWCA 4PREA 3PWUA 5GRJH 2D7PA 2FBJH 4ONHA 4OQTL 1QSFD 5JUEL 3W11D 1F4XL 3JV5A 5CZXD 2CIKA 3LH2H 4LQ1A 5C1MB 1IC1A 4W4NA 3VWJC 3QXAB 4OZ4B 1MAJA 2PW1A 1JL8A 1G0XA 1OSPL 5BJTA 3F7VA 1RZFH 3LHPH 2QSTA 4CVXB 1KB5A 2NY3B 3B9AA 1F2XK 3BAEL 2JCCE 2AK4E 5E2VL 1QFWM 1VB9A 1NFDE 3FO0H 4ISVB 1I7TA 4R7DA 3H9SE 3TV3H 3PWNA 5EO0B 4PB9H 4BFEA 3WNPA 2VLRB 1FVCB 1MJJA 3U9PL 1FYTE 4JKWA 3LQZA 3IDYC 1YN6A 4ZDHB 5IVXF 3FN3A 32C2B 1U3JA 3RJDA 3V8OA 5CKAA 2R2HA 4X6DF 2ENYA 5TJWK 3IB4A 4G7VH 4CUCA 4AQ1B 4QRQB 4PBXA 1W72B 4K8RL 4NOBA 5IVZB 2XKNA 3TWCH 1H8NA 3IDXH 4BZYA 4KQ3H 2MCPH 1LK2B 4H5SB 4P3CL 2P8LB 4ZTOH 3UC0H 5DC9B 3DBXB 1T1XB 5E7BA 4G3YH 1B6UA 1EA9C 3BKML 3TBYB 2HTLC 1D9KA 4NQDE 5IT2H 5I1HH 4Y5YC 4S1DC 5KN5B 3TNNA 4A2MA 2BNRD 3GMNA 5K9QI 4F8QA 5DK0A 3OGCB 3RPIA 1C1EL 5CJBA 4OM1L 3ZDZE 3DX6A 2DS4A 5ALCH 1L4IA 5AD0A 4F7EB 3HMWL 4KZEH 4Q7DA 3UPAA 2FO4B 3X13A 2P47B 4DQOL 1T4KA 5CCKL 3DYMA 1J1OL 4XI5D 1HYSC 3CVHB 1RZJH 2HVJB 3VRJA 2W38A 5I2IA 1I7RB 2D3VA 3B3IA 3OKOA 4HMDA 3WJLC 4AIXA 5IWLA 5CBEB 2DQUH 4OZFA 1NKOA 1FO0B 5HD8D 3KYKH 4RGMB 3O6LL 5JOPE 1EK3A 2XWJB 3Q6GL 1BPVA 5DD3L 5IFAH 1VKXB 1IQDA 1K5NB 2C7UA 4CGTA 1BOYA 3VGEA 1UQSA 3T04D 1IBGH 5DHVA 4UNVA 2AJUL 3REVA 1MRCL 4H25A 2YWYA 3OSKA 3X3FL 4OFDA 1Z3GH 4LDEB 5EBLA 5T3ZE 5H37G 4AZ8A 1L0XA 1GRWA 5DSCA 4GW5B 4O2EA 1CTNA 4PJ8A 4AEHH 1X4XA 1CGUA 3GI8L 4GAFB 2RR3A 3ARZA 3QUYC 5EUOF 5EOCJ 3TESA 1S7RA 1LNUA 4HZAA 8FABB 1A6VH 1UKSA 3LKSB 1IT9H 3C8KA 4NNXA 2VLLB 1A8JH 1T20A 2OTWB 4ZXBB 3W81A 3P2TA 3QZWG 5F8QC 2Y36L 1NLBH 1LD9B 1UVQA 3KPOA 3MQIA 4FQQA 4M43H 4NWUL 4OIAA 4FQXB 1KTDA 3WN5A 4UILL 3HAEB 4TQEL 5DC4B 4BYHA 4FQ1L 4J2XA 3QWRD 5DJ6A 1EH9A 2IMNA 3KR3L 2DQJH 1KNOA 5FO9B 4O5LH 1HQRB 3QDGE 3WFHB 1NUGA 1EO7A 3NMEA 4R0LA 3SDAA 1E6JL 1HZHH 5JHLH 1CK0H 1JZ8A 5ICXA 3MBEB 2W0FA 3V5DA 4LVHB 3MRPB 1CFSB 1A7PL 3DSNA 3MRFB 4GRWE 3KYOB 2WBJA 4HK0A 4LF3A 3B83A 2R29L 1UZ6F 3G6JA 1GAFH 5HDBE 5I1JL 2Q86A 4IOIB 1FE8L 3UJJH 4X6EB 1I4FB 1JUFB 3OX8B 4AG4L 1J0IA 3SDDA 3TPUA 4WFFE 4Y4FD 1U8LB 3LH2L 4M62H 3C60D 2HKHH 3M45A 1FNEA 1DFBH 1YNKH 1PEWA 2YD2A 4A6YA 4HEME 3BMWA 1B0RB 3VXRA 2UZIH 4ODWA 4N0FB 3BYYA 1IL1A 1NCWL 2Z8SA 5IR1A 3FO0L 5HHNA 3P4LA 4NKMA 1AD9A 3JTSB 3MRDB 4R96B 4K9EC 3NCYS 1DQQB 4Z95L 4Y1AB 1E4XI 3ALXA 1XF3B 5HGHA 4JDTL 4CNIB 4Y4KD 3PL6D 4M4RA 2HT2C 1INDH 3C8DA 4IEFB 4U3HA 4PRPA 1EVUA 3VFTB 4PRAA 5ESVB 3MR9B 5IGXL 3IDJB 1MCDA 4Q97A 3PWPA 1NBZB 3RWEA 4PJBF 4JG0H 4GBXA 5DRZB 4NKDA 4M61B 2CDFA 2YN3A 5FYJE 4Q9QL 2B1HH 1JNHB 5C92A 3PP3H 5EOQL 4ZTOL 3WS6A 5HJ3B 5E8EA 3UC0L 3ZE0E 4QRSA 4XC1L 2XKUA 1JYNA 3ZYOA 3O3BB 4IRJD 2LE9A 4JY4B 5EO1B 2LAGB 2XTJD 4YK4B 5GRYA 1RUMH 3VA2C 4E41D 1VEMA 4S1SH 1JPSL 2BVUA 4UT9L 5J0BA 3WNNA 3FQRA 1S9XB 2E6QA 4WV1A 4XNMA 5ALCL 1TVDA 4PJHF 3PWVA 4XCFL 4X6BA 3G6JE 3IT8D 2A0LC 5IMKA 4HX1B 1N7ML 3UYRL 5KSAC 1HHGB 1RULH 4CN1A 2PYFA 4X6CA 1JWUB 2VDPL 2D4FA 3C2SA 5GS0D 1X3DA 3RX7A 5CHNB 2IH3B 5J6HB 3RNQB 3FO2B 4GW4B 4XHJC 1CDUA 4Y16A 3P0VH 5H35B 4PJAA 2XZCH 5FUOH 1HK6A 1QR1B 3BDYH 1MCLA 1RZJL 4LCWD 3KPRB 1D5ZA 1S7QB 3A67H 2DQTH 3C5ZB 5TE6H 4P49A 1IM3B 1YA5A 5MEOA 4AEEA 2P43B 1EVTC 1L0YA 4HKBB 1IC7L 3ORJA 3HZYB 3KYKL 3VXRE 3BVNB 2YPLB 4XP9H 3LPFA 2DLFH 4YDIH 1DDHB 2Y1VA 2VDMH 5JMOC 3GUTB 2XRAH 4X4XA 5FO7B 2MFNA 4L9DA 1VGEH 1OGAA 2NTFA 2X9YA 2R2CA 4PGCA 3CLFH 4HPOL 1AIFA 5D1QA 1OP5H 1OAYL 2Y07H 4NCC2 4PRPE 5GSVB 3ZHDA 1FGVH 5CBAB 3WSQH 4UQ2A 2AGJH 3IXAA 1BP3B 2O5XH 3PWPE 1RI8A 1JV5A 4KVNH 3IF1B 2YKLH 4N0CD 2P1YA 1IZKA 2EEDA 3GMQB 3DROA 5D2LF 3QUZA 4RZCB 4B41A 4OD3H 4MSWA 4HMEA 2I60H 1JGVL 3TVMC 3NCBB 3BN3B 5J3HD 2BOBB 2Z31D 1KIRB 4F80A 5HGBA 3QB7C 4JEGB 4WTZA 3IJHB 3MYZA 4D2NA 4IRJA 2IPTH 2ZCLH 5TE4H 1JNLH 4QXTA 4DN3H 1G6VK 2BOCA 1MCFA 1BWMA 4DCQA 1FL6B 1KCUL 4XP6L 4Y5YB 1DQTA 5JHLL 3QNZA 4X6CE 3OXSB 3WJJA 4QRPA 2Q8AL 1JPGA 3FB8A 4PJAE 1EMTH 3V6ZB 1QRNB 1RIVL 3G08B 3T3PF 4M6MH 1BFOA 1QRKA 4U1JB 2PCPB 4XPTH 3NGBC 1KYOJ 5LGJA 4W6WB 1JBJA 1AR1C 4TRPH 5EOTA 5GRVL 2R9HD 3OKNB 4L4TB 3LKRB 2VZUA 3BIKA 5CEXB 4OJFL 5D7JC 4HKJA 3O41B 2FEDD 4X83A 1KACB 4OFIA 4OUUA 4Z7QE 2FR4B 4E0RB 4P48A 5C09A 5IMOB 3IETB 3O6FC 1DFBL 4QGYA 3MXVH 5MI0B 2BRRH 4KUCD 3JXAA 1N6VA 2M1KA 4K7PL 3VFUB 3BYTA 5FFLA 4QLRA 4APQD 3NCEB 1JZ5A 3LKNA 4EVNB 1T04A 1FSKC 4U7KA 5HYJA 2HJKA 4WFEE 4HUVA 2OTUB 3VWKC 5A2FA 4PGEB 3T0ED 3DX7A 3L3GA 3V5KB 3ULUL 1XGYL 3ARDB 4MA7L 1FNAA 5JOEA 1QFHA 5GS1A 2HRPL 1ZA6A 4PB0H 1CT8A 3LS4L 1A6ZB 4EDWH 1F97A 4FRWA 2NX5B 3R0NA 1FVDA 2GK0B 3V7AG 2AJ3B 3EO0A 3GM8A 1DQMH 3N1GC 5EG6C 4NYLA 4U49A 3T2OA 5LAXB 4JPIB 4XVTH 2E27H 1ZS8B 3RHWF 5DRWB 4KDWA 1HI6A 4RDQF 3IFOA 4UTAH 3IKCA 3HI1A 4QRPE 1FVEB 2R23A 1DVFD 3SBWC 1VGKB 2NY5H 4HIHB 1X5ZA 4C4KT 1C7TA 3AS0A 2KH2B 5JXEA 4IDLA 3IJSA 3RDTD 1XR9B 1MREH 4HSQA 3RAJH 4EDXB 4RRPG 1FIEA 3MLXL 2DYPD 1JNNH 2QADB 4KRLB 1AY1L 5C09E 3A67L 2J1KA 2N4IA 3QHTC 4AJ0A 3RWFA 4U1LB 3VWJD 1MAKA 5I1GL 3S37X 4OGXL 3FJTA 1I9JL 2A2QT 3L5XH 4EOWH 4HMCA 1KPRA 4Q0XH 4X8JA 3FQWB 5SV3A 2XRAL 5GRVK 1INQB 3BH8A 1F5WA 3EHBC 2AJYH 2F8XC 2X4RB 5L2JA 1CL7L 2H9GB 4J7RA 4D0BA 4OLZH 5BS0D 1HHHB 4APQA 3CLFL 2Q3AA 4QRUB 2X4UA 4IMKA 1FGVL 1LWRA 3GI9L 4LSPL 1PD6A 1ZK9A 4IRZL 4JDZA 4XMPH 2YKLL 5AZEL 4PP1D 2VXVH 1Y6NR 3BXNA 4GKSB 3K0WA 4WRLA 1Q38A 4NRXA 2EIZA 3QFDA 2EDTA 5KG9A 3NH7L 1TQCC 1NLDL 2ITDA 3CK0L 5E4EB 2VLKA 1H8OA 1NGYA 4QCIA 1DLHA 4M1CD 3RGVD 1FZOA 2XA8L 1RJZB 4WUKH 3CSYB 2A9NL 3VD4A 4JO1H 4DKEH 1BVZA 4WJ5A 4C55A 3FQNB 1RMFH 1I8IB 1OTUD 3BIAX 4YDLC 5FYKE 4X7DC 4MQXC 4QYOA 2BZDA 4WUUB 2LU4A 1UM4L 1DVFA 4JY6B 2NY1C 2JKXA 5D72H 5I17B 3AS1A 4HH8A 2Y5TA 3CFDA 4LLYA 4OSUL 1E6OH 3LQAH 3RWCB 1BEYH 5GXBB 2YD4A 5GGTH 3MMEB 1AGDA 5J12C 4MNHB 1HYSD 1RK0A 3EDFA 3W2DH 5CINL 5HHMD 2DYPA 3B9DA 4G8EB 3VXMA 3MNWB 1OAUH 2UVEA 3RWDB 4FQHB 2OSLA 3W9DA 1WZ1H 4GG8A 2NW2A 1CGWA 3HAEG 3EUUA 4OZHA 2R8SL 2BNQD 1TTFA 3QWQB 3RWHB 1W72L 3MXVL 2CXGA 4KRPB 2R69L 1U8QA 2C3VA 4LP4A 4MD0A 2ZUSA 1NAMB 5E8NA 3MRNB 4JB9H 2ATKB 4JO3H 1J0JA 1YY8A 5DJAA 1TJGL 3EFFA 4YXKL 5I8OL 3H0TA 1HKFA 4NGHL 4X9IA 2AJXH 2KUTA 3AB0B 2R0ZL 4IDJH 1B88A 2A73B 5BS0A 2C4FT 4D8PA 3QUYD 2R0LH 3MOAH 2VKXA 4HT1L 3FONB 3WHXB 4YDJA 4QHMA 5JIPA 4P4RB 3O45B 4HS6B 1FJ1B 1NC4B 1QA9A 2VDQL 3CMGA 4JE4B 4BKLA 3QHFH 2VLKE 3CMOH 5TF1L 5J6GB 3QCVH 3QRGL 3MRMA 2AI0H 1YY9D 3CVHL 4WHTB 3ULUF 1Q8MA 1SMAA 1D7FA 4ONFH 3OB0H 4N5ED 1I8MB 1N3NA 1I1YA 4XXCC 3ARXA 1FO0L 2V5YA 4NM8L 3U0TA 3RGVA 5I8KH 4JM2A 5IJVB 3B4NA 4PG9B 2RBLA 3TVMB 2E27L 2V7HA 1VACA 5AYQA 5DQDL 3NN8A 1Y6KR 1IARB 4NRZB 3LEXA 2ADFL 1HH9B 1F3JA 4M93C 1U6AL 2Y7QB 3VGAC 1WZKA 3EZJB 1ZLUH 1XR8B 4K3DL 1EERB 1GGCH 3QO0B 1MJ7L 1S9WB 3VXME 1WK0A 4PJIB 3BP5B 4TULH 1JZ7A 1BREA 1U3HC 5DHYA 4KPHL 3CU7A 4OZHE 1R3LA 3BRFA 3U46A 1A02N 1FFPA 2OK0L 2FX7H 3T2QA 4RGNB 5BVPL 5KANI 2FSEA 1XGUA 4NBZB 3THMH 5LXGH 3VE0A 4PTUA 2HLFC 4PUBH 3OQ3B 3I50H 1O0VA 2X4QA 3REWB 3WL9B 3TZVC 4EOWL 4XWGL 2MPAL 3GRWH 4Q0XL 3TBSB 1OD9A 5FA3B 1T03H 2YUWA 3W0WB 3O6FB 4HUMB 3TJHD 4WENB 4AIZB 1U9KA 2WBKA 2AJYL 4FZEL 3VH8B 5CJ5A 5BS0E 4P2OC 3SPVA 2QSQA 4K8RD 3WKML 5D1XC 3VU2A 4L4VA 3BGMB 4YHLH 5ETUA 1ZT7B 3TO4A 2W07A 3EO1B 2HT2D 2R2BA 5I1KH 1G9ML 2E9JA 1MCIA 4FQLH 1LO0L 1QHOA 5ICZA 3IGAB 3GJFH 3V7MA 1K9TA 5D7KD 2VXVL 4DK6A 3MXWL 3HE6C 3S36X 4HW6A 3UTSD 1JGDA 2FJHA 2DD8H 1WT5A 5F9JB 4OI7A 4NJ9L 4C4KO 4PY8I 1T1WB 3ARWA 5C2UB 3IDMA 4G43B 1FRGH 1CLZH 2DIAA 4MB4A 1JWMA 2BHYA 1UXSA 2DM4A 5I1DA 3WUZA 4NM4L 5JTWA 1YEHL 2CRYA 4RIRB 4P9ML 4JO1L 3ZKXC 3T65B 1HWGB 1EFXD 2I9TB 2ILLA 4AY0A 2PN5A 4G80A 4U6TA 1OT2A 5EH1A 5IB3A 3RVUC 1TETH 3O8XB 1UENA 1OCWL 1AD0B 1MFCL 4OQTA 3LB6C 1SJHB 4PIRF 4H1LB 1DR9A 4YHML 4LKCB 35C8L 2IAMA 4ZS7L 1CGYA 1E6OL 1FL5A 3EYVA 5I18H 3CFJB 2QV2A 3SGJC 2B39A 1SM3H 3QEHA 1T7VA 2D4DA 5I6XC 1Z5LA 2YZ1A 3U0WL 4G6AD 2YWZA 1KBGH 1ZLVH 4ETYA 5ISZB 3QPXL 1C16A 1KCKA 3M17B 5F44A 5KSUA 3PHOB 1MFNA 1ZLWK 3VXTA 1EGJH 3QEQB 4LRNH 4OLVL 1KXQE 3DX9B 5EORH 4L4VE 1F4WL 4F7CA 1S7VA 2AAVA 1NEZB 5E5MB 3O6ML 4KRMB 3I02A 4R97C 1XCTB 2HMIC 4FTVD 4TVPH 4P5TA 5GZOC 5C0AD 2OJZH 3B9KA 4PJ9C 4RNRA 5CJQH 3SE4A 3FO1A 4UUJB 4KJQC 5C6TH 1UZ6E 4Y4HD 4LQFH 3K8KA 1F4HA 3WKNA 4ORGB 2DOCA 4LLMB 4CN4A 4HC1H 4P9HL 1MCPL 4KJWC 4Z5RB 4LSQL 3E3QC 4ZOBA 1VDGA 5F96L 4X5XA 4QWWD 3FRUB 3TBTA 3GMMA 4M8QA 3QCVL 1SHMA 1KLUA 2NY5C 5CEZH 5IW6A 4AQOA 1XGTA 3LEVH 4J4PC 5EUKA 1B4RA 4ZAKD 5BMFL 1MIMH 4MHHI 5SWZA 2RHEA 2N7AA 5TE7L 1F58L 3CH1A 1A6WH 4XCEA 1A1MB 4R26L 4TSBL 4BSVB 4NQUA 2CIIA 4UT7L 2C3HA 4QTIL 4YQXL 1EFXA 5DGRA 2I9LA 3GIZL 1RY7B 2JJVA 4J12A 4EI6B 4WI2A 1T0MA 4EN3B 2ADIA 1ZSDA 1MFBL 3RZCD 2ZUWA 1HNFA 4NQVA 3EJZC 1KJ2H 1QUNA 5CIPA 4GG6F 5I16B 4URTB 1GGCL 1KCLA 5HYQB 3PABA 3SDCB 1XCQB 3DYOA 5BW7A 2N1KA 4YHZH 1AR1D 5JO5A 3CIQA 4PYGA 2H26B 4JZJA 1S7UA 2D0GA 2Z8VC 3GO1H 5J12B 1U0QA 5D7JD 2ZJSH 3ZYJA 1KLGB 3QXTA 5IUSA 4KC3B 4R90L 1CDYA 3HC4H 2FB4H 3MRBA 3GSNA 4DGYL 4MMXC 1T3FB 2JK5A 4NWTL 5AZ2H 5F3BB 1BM3H 4FQIL 2CLZA 4RMQA 1ZOXA 3O3AA 4WCYH 4M5ZH 5GGUA 5T5NG 1RUKH 4M9OA 1CXHA 2VR4A 4RX4D 2GT9A 4ZNCD 3STZA 4Y19B 1LO3L 3OPZH 1OARL 3VWKD 4UTBL 4BQBA 2EH7H 4YHYB 3NACL 3DYPA 3UZQA 4U1KA 3HUJB 3O4LB 2XPGA 3PGCA 4TOYH 4MX7A 5I1AA 4FQLL 4P99A 1CFNB 4WO4C 4QXGL 3EYUH 5I1CL 4NSKA 2DD8L 2EYRB 1KELH 2KZWA 2R1WA 3KYNA 5SWZE 1G9NL 1TVHA 3MUHL 3MLZL 4OCWL 1FRGL 2ZOKB 1YYMH 2R0KH 4U6HA 3K8MA 5HI5C