3DWTA

Structure of cabbcii-10 nanobody
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
125
Chain Sequence
VQLVESGGGSVQAGGSLRLSCTASGGSSYSTFSLGWFRQAPGQEREAVAAIASMGGLTYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCAAVRGYFMRLPSSHNFRYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords cAbBCII-10
publication title General strategy to humanize a camelid single-domain antibody and identification of a universal humanized nanobody scaffold.
pubmed doi rcsb
source organism Camelus dromedarius
total genus 32
structure length 125
sequence length 127
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dwtA00
1F4XH 1OP3K 1X4YA 1KB5L 2YD4A 2Q8BL 4X4MA 4FFWD 2EE6A 2FHFA 1J1OL 2R15A 1ZT4A 1CZ8H 4YWGL 2X40A 4HBQA 2XNAA 4X4ME 5DEGB 3IVKB 5T1MA 2EDJA 3IETA 2ZCHL 2G5RA 3SE4A 2APWA 4P2QB 4PV8B 4F7TA 1MFAH 1I75A 3QDMB 3VXOA 2VL5A 4HIJB 1T2JA 4Z7OF 4ZOEA 5BW7A 2J8UA 4KKBC 5KSVA 1ZVHA 4K3EL 3O3BB 4AZ8A 4Q0XL 4Y1AD 1Q9LB 4YC2C 2J8UE 3QYCA 1G6RH 3TCLB 1FAKT 4F37F 3GRWA 1E4KA 3FB7B 5JUEL 5HI4C 4RA0C 5DDHA 3NFNB 3GMRB 2WBKA 1BM3H 1H8SA 3MV7D 4PJ7A 2GT9A 1KYOJ 1G9EA 2ZSWB 5IMMA 1DBKH 3VXSA 4P5TD 2GTWB 4PJ7E 1RAMA 3OAUH 2EIDA 2WSKA 4WUKL 3QFJB 4BYHA 3QA3A 1MCWW 1F90L 5IR1B 3VXSE 4U2ZA 1ND0A 3IFNH 4KJQD 4AG4L 3C8DA 4AMKH 3IS0X 4PLKC 4JPVH 1RU9H 2YHGA 1G7MB 2E6PA 4N8VG 1G9NC 3H7BB 3QUZB 4X9BA 5IFHH 5DRZA 4R90H 4NIKB 3RDTA 5GRVK 4FQ1H 5DQJA 1DANT 3EYSL 2EDQA 5DJ8B 5KAQF 2WWKT 4MVBC 1GGBH 5IMLA 3N1GC 4K23L 3V7MA 5CEZH 1CBVL 3HCVA 4ZFGL 4RMUA 5TDNB 4YHNB 4WHDA 3ARQA 1EUUA 1ZKAA 4K2UL 3QEGL 5TQ2H 4I18A 3CFCL 2E9WA 4ZPVB 4Y5YA 2MCG1 2EYSB 4OLUH 4LSRH 1YC8A 2E8YA 4OLVH 3IDJA 2DM3A 1FNSL 4LLWB 4OIIH 5L7XL 3H9YA 1ZS8B 4HPOL 1ZSDB 2HFTA 4J3UA 3BDYL 4U1IA 4NNPL 3LKPA 1LE5B 1SJXA 2VLJA 3FOLA 4X6DA 1N5AB 1NMCC 1TCMA 5HHOE 4P46D 5H35B 2XKUA 3RVUC 1D6VL 3PWPE 1XGPA 2VLJE 1FL6B 4X6DE 1I1AB 2NQCA 1SJEA 4PJCF 4TPRH 4EBQL 1WCBA 1W8OA 4NCC1 4HWNA 5IVXF 4DZ8A 4KRNA 3GB7B 2YPLD 4PRPD 3I02A 4X80L 1DVFA 3QIUA 3MRMB 4HD9A 4KK9D 3DSFH 1LEGB 2EDBA 1B4RA 5JW3L 4XVJH 4QF1A 5E2UH 3RVVD 2AEPH 4OB5H 3KYMB 2VQ1A 1LO5B 2HT4D 1X5KA 5FO7A 1AGBB 1MJUH 4FP8L 1Z3GH 4DKDC 3BW9A 4A6YA 1A7OL 1Q9KA 5GSVA 1BFTA 4LDEB 4YFEA 4PJ8C 1FO0L 2AEIT 1OTUC 1N64H 2Y7QB 5I71B 3CVHA 5HY9B 1EIBA 3K1KC 2XN9D 2WIMA 1I1CA 1UB6A 2RQ8A 5D7KD 3L3IB 1SYVB 4GG8A 3WFEH 1AC0A 3EJJX 3MREB 3QEUB 3O6LH 4NQUA 1JPFA 4ODBD 1Q72H 3EDFA 3JWDH 2V5YA 1KPUB 4Y4HB 4Z0XB 1OLLA 2FWOB 3BN3B 4ZAKC 1YN7B 4IOFC 4LBEA 2NZ9D 2ADGA 1YEDB 3HC4H 3A6OA 3P9LB 5IIEA 4NBYB 2EKJA 2XA8L 1QSVA 3RY6A 4RDQG 4K9EC 4JB9H 3S98A 1TPXC 3ARDC 3L5XL 3K4DA 3MJ8B 3VD9A 4M61B 1P84K 4XVUC 3ARZA 5CGTA 1ODAA 3JWOL 1EEYA 4Q9RL 1S7WA 5HDLA 1A1NB 3JVGC 2ADFH 2Z4QB 3FFCD 1GVIA 5TH2B 2VE6B 5GGUB 1P7QA 5I8KL 2KUTA 4AEEA 4PBVC 2RHEA 5EFIA 3EO0A 3QUXA 4MXQC 1KG0A 3BMWA 3QNZA 3U2SA 4F7PB 5LG1A 3MV8D 2Q7YB 3MGOB 7FABH 2A6DA 1S9WB 1YN6A 4Z7QE 1KIQA 5FK9A 2BNRD 3QO0A 3V9FA 1RK0A 2YXFA 4IRJD 5CMAA 4O2CA 1T22B 4N1CA 4LEOA 2HT3C 4U1SB 5ITBH 3S96A 5EIIB 3QAZC 3HNTL 1WF5A 4ZXBC 5DQDL 2J8UF 5E8NA 4RWHA 5EOCH 3SJVA 4GKZA 1CLYH 1YNTA 5INCB 4Y4KD 1I1RA 3AUVA 4TN9A 4P23C 4PJ5B 4L9LA 3SJVE 4YZFE 3J8F7 2NY2C 5T1LD 4NZUL 1JF6A 4XPFH 4YAQA 5DUML 3N85L 3OJ2C 3CFEA 3NABH 1F58L 5C9JA 4TNWF 1CF8L 3SDDC 2EDDA 5T1DH 1KN4L 1NCAL 5FYJH 5JNYA 4F7MB 5ADOL 5F88A 4CMHB 3MR9A 1QBMH 2DKSA 3U1SH 3BKML 3PWNA 5HYSB 3I3EA 4PLJC 3DECA 3HZVA 2HRPL 5E70A 5A3ID 1NMBH 3QPXL 2DQFB 4JANB 1I85C 5JXEC 3NCEB 4NKOA 1JK8B 4Z7NF 2O61A 1N4XL 4F80A 5C2UB 1AP2B 1XCTB 5FIEA 5CP7A 2FO4B 4XP1L 3C6LC 3VFUA 4JDZB 1FAIH 3EOAA 1Y6NR 4YXLL 2FECI 1K4CB 4K8RC 3D39B 4LOUC 5E08H 1SY6H 5C08B 1I7RA 1NAMA 4GMSL 2IFFL 4PRIA 4R3SB 3EYOB 1G6VK 3AAZB 3OB0K 2W91A 3KVQA 4L8DA 3TN0B 4PRIE 5JORA 2Y72A 3QFDA 4OJFH 3UTTB 2FX7L 1J11A 5F9OL 4JFDB 4YHOH 4KKAC 5I8EA 1D5IL 1YEHL 1KCUH 2VLKD 4X7SL 4XCNB 2EYTA 4PYHA 3QUYD 2XWJB 4NQVA 3DRQB 3S36L 5JPNB 1V7ML 5ESAA 4MCZB 4X6DF 5DD6B 4KKLC 1MLCA 3HAEH 3A6CH 5HVFB 2W0FB 5HGDB 1IRAY 4U6YB 1QEWA 5ICZB 3CSBA 5E6IB 5TE6L 4IDJH 5IMOB 1IC7H 3EBAA 2DQUL 1PKQE 2HT2D 4G43B 2OZ4A 2VSDA 1BQHB 3ARFB 1T66C 4XP5L 5F1NA 2OYPA 3GI9H 3SCMA 4IIQA 1DLHB 2DQEL 2HH0L 3X11A 5C2BL 5LQBL 5DQ9A 1AGCB 1IAIL 2F8OA 2OR7A 1SEQL 2ESVE 3RBGA 3U0PB 4F2MA 3EAKA 1OGTB 3DX8B 1OGAD 5GRJL 1NGZA 2CLVA 2PXYC 5L2KD 1BQLL 1KPVA 2NY1C 4PJFF 4NRYB 3TPKA 1WWCA 4K94C 1HOCA 4N0CD 1ZLSH 4KTDL 3UDWC 1O7SA 3F7VB 2JE8A 1NBZB 4OGAC 4KC3B 4K3HA 4ZD3L 2DRUA 1CLOH 1Y6KR 3BP6B 4LCIH 3V5HA 4NO0D 2APTA 2IC2A 2HRLA 1IM3A 4OUUB 3W0WD 4XPAL 5C7XL 3IDUA 1QYGH 4WI8A 3KJ4B 4JFED 3O2WH 4I0CC 3RGVC 1BX2B 3VFWA 4Y5XA 3L7FB 1IZKA 5JHDD 4PJCB 2EEAA 3TNNB 4JY6A 2B4CC 4M6NL 1QNZL 1LDPH 2AKRB 1ZVSB 3BSZH 1NCCL 5E1AB 5IVXB 2H9GA 1AGEA 4LQ1A 2UY7A 5CWSA 3EDJA 5KSAC 4GW4A 3MNZB 3BJ91 1B0RB 3WKML 5CKAA 1WBZA 3BIKA 5C0CD 5K9QG 2ZOKA 4UTBL 5MI0C 1T2QL 3B9VA 3MXWH 4M7ZB 4GAJL 3NTCH 3UAJD 2C3VA 1IEBB 4KTEL 3NZHH 2H2PD 5CEZE 2X9WA 1N8ZB 1W0VB 3D69B 1ADQL 4MCYA 4KJWC 2DQIH 4CVZB 4ELMF 3EJZC 3PIQB 3ZLQC 4Y2DA 5IHZA 1UGNA 4Y4FD 1RJZA 4F9PA 2H32H 4Z7QF 1YEKH 3RVWC 2GTZA 3I50H 2GFBB 1IGMH 4U0QB 3Q6FB 4WFHE 5ID1B 1QFUL 2NY4B 2X44D 1FIGL 2VWEC 1JWSB 4IDLA 1ONQB 5CIPB 3LRSB 1B4JH 3CPLA 1KJ2L 5JXAH 3KPMA 1U93B 1MCOH 5I17B 4YZFF 3FOMA 3HKFA 1A6AA 5E8PA 5DJ0B 1KTKE 2ZPKH 4OZ4B 2WBJD 1P7HL 3TZVC 1BOYA 4HC1H 4HXBH 1CDBA 1I3RA 4LLUA 1XF3B 3QH3B 3F5WB 4RX4A 5E9DA 3VH8G 3DMMD 1JNNL 2J8HA 2G75A 3U4EA 1YEEH 5SWZA 4DVBA 2WUCH 3BAEH 4F7EA 5E9DE 4H25A 1WAAA 2MQ3A 1C5DA 3FO0H 5BVPH 4AIXA 5SWZE 5IT2L 1KOAA 1ZT4B 4NSKA 4O2EA 1HINL 4J7RA 5DO2D 1OD7A 1WAAE 3WKNA 3MBEA 3QI9D 3OJMB 5T1MB 1T2XA 3O4LD 3IETB 4E5XA 1OWRM 1OAZL 1TJIL 4F7TB 3RWHA 3VXOB 1J0YA 1G7PB 4UV7L 5I74C 3K4AA 2J8UB 1MFBH 2P24A 5C0BA 5KSVB 4HH9A 5DLMH 3U30B 1ZGLP 5IW6A 4YR6B 2OX5A 1BBJA 3O6FA 3ZZ1A 4BZYA 1YY9C 2DQCL 1T03H 4W68A 5C0BE 3MLZH 4NWTH 3SKMA 1UACL 1NUDA 2IPUG 4NCC2 1I9RH 3TVMD 3VXUD 3D1MC 1Q9WB 5DDHB 1M71A 4ZUSA 4PJ7B 3GJEA 1IVLA 2GT9B 4FZEH 3VXSB 5IEKA 3FB8A 2O5XH 3DYMA 3L5WA 1T1ZB 4H1LG 3QA3B 5CS7A 4JRYA 4JQIL 4WDIA 1W72L 5LCVH 1ND0B 2OTWA 2ARJQ 3VFRB 2P49B 1CD1A 4JRYE 1NGPL 1P1ZA 4Z95H 4S1QH 5LXGH 3JV6A 1HYSC 4CN4A 5DRZB 1UADC 4O9HL 3RDTB 4M7KH 2AEQH 5DQJB 1BOGA 3IFOA 5HXMA 4RMWA 5IMLB 3VD7A 2IF7A 4WI3A 5AZEH 3HCVB 4LLMA 5LBSH 4EIGB 3OKOA 43C9A 5KBNC 1S7UA 4HWEL 3V0VA 4CN6A 2IQAB 2E7HA 2OK0H 3D3VA 4R96B 3LMJH 1KENH 1GIGH 3WN5C 3QWQB 5KN5A 1CWVA 4I18B 4PJDA 3D3VE 3OXSA 1J0HA 5DMJB 2ZUVA 4PJDE 3IDJB 2HTLC 3AU1A 1EX0A 2EH7L 2X4SA 3GMMA 3BESR 3HPJA 1KNOB 4NN7B 4W70A 5HHOB 3QDJA 1FCGA 3PWPB 5J12B 5J3HC 5IJVB 5FYJE 2VLJB 4X6DB 1JNHA 1LK3H 1JGVH 3WIFA 3VDCA 1XGPB 2VISA 4KH2A 1SJEB 1RHHB 3P11H 1QHPA 3ARGC 3BGAA 5CEXA 4JEGB 5CJQL 4NM8H 3BGMA 4ZO6A 2ZUQB 3NFPB 1DVFB 3QIUB 3VWJC 5E99L 4Q9QH 2AS5M 2BY3A 4DEPB 1AJ7H 1DSFL 1JVKA 5J6GA 4KTYA 4G6KH 1WBXA 2VQ1B 3OKDA 5LGJB 2BX5A 4D0CA 5FO7B 5CD5D 3BW9B 3LKRA 4A6YB 1U8IA 3LQZA 3KPPB 4LPWA 1HWHB 1Q9KB 5GSVB 5I1HL 4OCSH 3B2VL 4RAVA 2E27H 4WW2F 2E8ZA 4OZGA 5DD3H 2DTML 5BS0A 4N9GA 3CVHB 4I48A 1CFQB 2LU7A 2D7TL 5CGMA 4EOWL 1M6OB 2VR5A 1UB6B 4OZGE 5BS0E 1JZ5A 4U6XA 5CHNA 3GMLA 1JPFB 5DR5L 1QLEL 1J1XL 2BVTA 4PIRF 3HAEA 5T5NG 4LBEB 2ADGB 5GS2H 3BISA 3ULUC 2BVUA 4HIEA 4YHZL 1T89C 2P42B 1DQTA 1GC1L 1BMGA 1F00I 4PJEA 4DQOL 3LEYH 3IFLL 5KTEL 3JV0A 1NGYA 4YBLB 3ARTA 4PJEE 3CXDH 4O58H 5E2VL 1A3RH 3RX7A 1KGCD 1H5BA 3BPLB 4XNZB 3ZL4H 3ILPA 3S5LG 4Y5YC 1S7WB 5JLZA 1F97A 3ISWA 3FB5A 5MEPA 1DEEA 3I6LE 5GSRA 1EFXA 1JGDA 2F15A 3D48R 5CUSL 4FHBD 2AGJL 5EFIB 3STLA 5I1EL 3QUXB 2YUXA 1KG0B 5ALBL 3QNZB 3U2SB 4TUOA 2N7BA 3PL6B 4JREB 2A6DB 1YN6B 2EDYA 3MLWH 1KIQB 5FK9B 3X14A 2C5DC 2I9LA 3QIWA 4KRLB 1I8MA 2B1HH 5CMAB 4O2CB 2W0PA 4LEOB 3S96B 5DMIH 4OGYL 5E8NB 5MEND 3MOAH 3SJVB 4GKZB 4LVHB 1YNTB 5IB2A 3HFML 2E3VA 1OAYH 1IQWL 4FQXD 5M94B 5SWQA 2XKSA 5FGSA 4FN0A 1G7JA 3THMH 4YAQB 1PW3A 3DYPA 2EZ0C 4I5BB 3CFEB 5C9JB 3M17B 1NFIB 4PGZA 1XIWA 5I0ZA 1WK0A 5BV7C 1RZIA 4OLZL 4J4PD 5I1GH 4FQJL 2XWBA 5JNYB 3BD4A 4Y16C 3MR9B 1HZHH 2N7AA 1MSPA 3PWNB 5DEFB 4TSCL 1AC6A 1BEYH 4UUJA 3BQUD 3UJJH 1JMXA 3HZVB 3TT3L 3B2UC 4D9LH 4JJ5A 4Y5VC 3BUYA 5EOQL 2M26A 1LO0L 2WQRA 2WANA 4NNXA 2F5AH 1EAJA 4NKOB 2H32A 3ULVL 1MPAL 3RP1A 2O61B 1T6VN 3EOTL 1TZHA 3DRTA 3SGEH 2D2OA 3IRZA 3GIVA 5LJYH 5CP7B 1UWEH 1C1EH 3VFUB 5T5FH 3FT4A 3EJYD 3O2DH 1XEDA 5EU7E 1K3IA 3EOAB 5HHNB 1XZ0A 3RTQA 4LAQH 4BUGA 5A2JH 1FORL 1JTPA 5J06A 2IAMB 4QHKI 5DRNA 3AM8C 1KIRB 3QJHA 3R1GL 4PG2A 4XAKE 4HUKB 4G7VH 1I7RB 1NAMB 3O2VH 2Q20A 4PRIB 3QUML 5GISH 1VB9A 1TTUA 2F54A 5DD5H 3PJSB 4XRCB 4PJDF 4L8DB 4RFOH 4U7MA 3OR6A 1YJDC 3BH8A 3VGDA 5C1MB 1U36A 5JORB 3QFDB 2F54E 3EUUA 4P9HH 1WQVT 4GBXD 4PD4J 5HHPA 3REWA 4GOSA 1I8KA 2WP3T 1G6RL 1TQCB 3R06A 25C8H 2EYTB 3NFSL 2LV4A 1PG7W 2FCBA 5ESAB 1NBVH 1MLCB 1HK6A 1PKQB 3CDYA 1Z0MA 5HHVL 4Y8AA 1QEWB 5L9DL 5B8CC 1CXKA 5CCKH 1YPZE 2CJUL 2WM0A 3C9NA 2FGZA 3OAUL 4LVOB 1A7NH 1UCBH 3OJVC 4WI9A 3SY0A 2YD5A 4AL8H 2ESVB 5F1NB 3FMGH 3QZWA 3PWVA 3IFNL 4AMKL 1Z0NA 4IIQB 4MMXC 3SCMB 2I9TA 5T3ZH 4R2GD 4JPVL 2C7UA 3RVTD 3X11B 3MRDA 4XMPL 5DQ9B 5L2JA 3SO5A 4AIOA 3MODH 1MHEA 4F2MB 5DK2A 2HVJA 4C83B 2FX9L 4L9LC 3GM0A 1NGZB 3G04A 4R90L 5DJCA 1RURH 3V4VH 1YEIL 4FQ1L 2QL1A 4JFHE 3ZYJA 1JWMA 1D9KA 1G6RB 5D70L 1GGBL 2UUDH 2F5BL 4QRUB 3Q48A 1A47A 1HOCB 3L1OL 3WDHA 5K9JL 4J1UA 5CEZL 1VCAA 5HHME 2NY6B 3BZEA 5EBGA 4OCNC 3V5HB 2R1WA 1IM9D 4OLEA 4OZGF 3GMOA 1IM3B 3N1PC 1AE6L 1U3HC 3VGGA 1VGEH 4OBSA 4UBDC 2H3NA 2YWYA 5TQ2L 4GQPH 3VFWB 1Z9SA 4Y5XB 2R29L 2GJ6D 1FG2A 1AIFA 3L7EB 4L8SB 4JY6B 4PJ9C 2DJ4A 5GGSY 1AXTL 5BJTA 1BVLA 4OZFA 2H9GB 1AGEB 4PBXA 4H0GA 2V17H 4LCWA 4F37K 5K93A 4GW4B 1NLBH 3T0DA 1JL8A 3DVNA 4PJEF 2ZOKB 4LCWE 2PR4H 2UWEA 1NC4A 1ORQA 2IQ9H 3QP3A 5ADPL 5D7LD 1OVZA 3OQ3B 4OQTA 2UWEE 4OM1L 5E8OA 2C3VB 1N0XL 3L5JA 5JOPD 5I1AB 3KXFE 2B8OT 4KK8C 4F8TA 4PRNA 5F7EH 4OCRL 3VG9C 1TJGH 1OARH 4H1LH 4MCYB 1A1OB 1EGJH 1T5XA 4KKBD 3EZ8A 3DIFA 4X5LA 3B5HA 4WW2B 4Y2DB 1QLFA 5IHZB 2E7LA 1RJZB 2VXUH 3C87A 1WUNT 1FL3A 4XVJL 3DUSA 5E2UL 1MF2H 2AEPL 1RZKH 4OB5L 1MCSA 4WHYG 4P2RD 2OTUB 2GTZB 3OV6A 5CFHA 1MJUL 1Z3GL 1JHTB 4POUB 3DI2B 1Q8MA 2DLHA 3U48A 4F8QA 3QCTH 5D7SL 4ONGH 2DIBA 1N64L 2VO5A 3CPLB 4DN3L 2EYRA 2ZSVB 1NGQL 3SQOL 3KPMB 3SGEI 2R39A 5ISZD 1IEAB 2XXCB 3FOMB 4HFWA 3NIGE 4PLKD 4Z7WA 1A6AB 1F3RB 5E8PB 5K9QI 1PFCA 2X5PA 1Q72L 3BKJH 4HS8L 5D1XB 1I3RB 1QD0A 3CMGA 3VJ6B 4LLUB 1ETZA 5E2TH 2R2EA 2Z31A 1FYTA 4XPGH 4R97C 1INEH 4MVBD 1QFPA 4XTRC 2VXSL 5E9DB 1KJMB 1FYTE 3FQRB 4W6WB 1MREL 3U4EB 5SWZB 4DVBB 1I4FA 3FO2A 4H25B 3DVGB 3D0LA 4ZS6C 1LEIB 1KTRL 4RFNC 4NSKB 4O2EB 5SX5K 5FEBA 3ZHKA 5IKCA 1HYRC 4R9HA 1VDGA 5BCAA 2PCPA 4LFHD 3KYOA 3MFFA 3GBNL 1RZFH 4FXKA 4NC1E 35C8H 1I1FA 4RFEB 3RWHB 3WNLA 2DOCA 2C3GA 2P24B 1C12A 5C0BB 3V0WH 4HH9B 2GI7A 2Y06H 4J3WA 3TWCH 3TESA 1BBJB 4MD4A 4MA3A 1DANU 5CILL 7FABL 4IRSB 3RVUD 2O26U 3SKMB 4RGOH 5JIIA 4TULH 3GZKA 5JTWA 1QSFA 5ITBL 1M71B 4ZUSB 1J12A 4UOW1 3GJEB 1BWWA 3MFGB 3TV3H 4LRIA 5EOCL 1VADA 1CLYL 1QSFE 2ED8A 4Y0GA 5I19L 5KVEH 4U1HA 5IEKB 5ANMA 4MXVE 5DUPL 1J86A 1BF8A 2BNUA 1IL1A 4XWGL 4QRQA 2OTWB 3NABL 5H8DA 5JDSA 1INQA 1CD1B 2E9BA 1XF2A 1P1ZB 5DURB 1YPZF 4X9FA 3JV6B 4HK3N 4Y1AA 3FB6A 4RGNC 3U1SL 1N5YL 4CADA 2YEZA 3UCRA 3IFOB 3WD5H 1SBSH 5IEHA 4Y1AE 2Z8VC 4CJ1A 4KQ3L 4JQVC 2NYYC 4DKEH 3P73B 2NXZC 4LLMB 4KKCC 3MV7A 4XMKL 3OKOB 3NA9H 4Z0BH 2AJZA 3V0VB 5C0NC 1ZTXH 1H8NA 3BGFB 1HWGB 3D3VB 3MV7E 3T09A 4NRZA 4O5LH 4LGSB 4HGWA 4OLXH 5KN5B 1QFWL 2JTDA 4PJDB 3PDOA 4IOFD 4NN6C 4DW2H 1ZLVH 2OI9B 3OJDA 3BJLA 4G42B 1V3KA 5CJBA 2BOCA 3AU1B 3JV4A 2MNUA 1BQSA 3ARDD 1SY6L 3TO4C 3QHZH 1G0XA 3VRLE 4TVPL 5EU6D 1QOKA 5FA4A 2ZZUT 2YZ1A 4RRPG 1JNHB 4D0BA 5D96B 3I9GH 1EK3A 4ZO7A 5DA4A 4XVUD 3WIFB 4JKPL 3WO3B 15C8H 1WLHA 4U3HA 5GGQH 4OJFL 4MMZC 3HI1A 5HGGS 3ZKQD 2R9HC 2FBOJ 3IJYA 3P0GB 5DZLA 3CX2A 1DQMH 4XBEL 3SDYH 4ZTOH 3BGMB 2X4PA 5C0DA 4MXQD 3QHFL 1JGLH 3LS5H 4RDQF 3A6CL 1MI5E 4TNWK 3O6FC 1UA6L 3CXHK 3V6ZA 5J6GB 4AEFA 1V7NL 3U36A 5HVHB 4NDMA 2A83A 2NXYB 1LHZA 1WBXB 5GGRA 3OKDB 4D0CB 2X70A 1A6VH 2VDKL 2HT3D 3LKRB 2YA1A 1U8IB 3LQZB 4ZXBD 1MCBA 2A38A 3I3BA 4P46A 4GQ9L 4N0YH 4RAVB 4HUWA 4EN3C 3E2HC 4OZGB 3KYAA 1PBYA 5BS0B 4N9GB 4P23D 5KANG 4I48B 4OQ1A 4P48A 4M1GH 1FNLA 5L8KB 4NQSA 2YBRA 4U6XB 5CHNB 3SDDD 2YPLA 4PRPA 1D5XA 1WV7T 3GMLB 4XBPB 4OI9A 5KW9L 3HAEB 2YPLE 1CLOL 4LCIL 1NCDH 4PLJD 2WZPD 4TSBL 3KDMA 3QUZC 3MPCA 2RJMA 1WGOA 1CXIA 3T4YB 1FH5H 4PJEB 3UX9B 5JXED 4N0FA 4ODUA 3K0WA 3G9VA 1W2KT 1NGYB 4S0TD 2VDQH 5HJ3A 1CTNA 3BSZL 4OI8A 5T3ZE 5I0DA 3QT2A 3X12B 3C6LD 2XN9A 4CNIA 3ILPB 4KHXL 1GGIL 5JLZB 1BVZA 3FB5B 3IDMB 3TA3C 1DEEB 2XN9E 5GSRB 4K8RD 5BXFB 4LOUD 1Y0LA 3ZTNH 1EFXB 1JGDB 4M8QA 4S11A 2WWKO 3D2UD 5D7KE 1JPST 3STLB 1AKJD 4L5FL 3GMPA 3MXWL 3PGDA 3NTCL 4TUOB 4J2XA 3VMOA 3NZHL 4N90D 4M7JH 4NT6A 1D5MB 4LIQH 3X14B 2X7LA 1BVKA 2I9LB 2E9IA 1E4XH 4RBPK 3T2PA 3OPZH 5K59E 1D5ZB 2DQIL 1I8MB 2NNAA 1P4LA 3D6GA 2KQNA 2FHBA 1EBAA 4MXWL 4KKAD 3A67L 3VFSA 4NQCD 5F9WC 4MWFA 1Q0YH 5IB2B 1YEKL 4IOIA 3KPRD 4MYWB 2HLAB 3I50L 1F4WH 2AJSH 1OW0A 1Q94B 3EHBC 5SWQB 5CZVL 3WJLC 3FFCA 4EZMA 4FZ8H 4OV6F 5B39G 5IFAL 1YEFL 1XIWB 4ZTPL 1IJ9A 1MEXH 1PAMA 3FFCE 2XFXA 1RZIB 2XWBB 4JRWA 3MV8A 1MCHA 3ZYZA 1F6FB 1H3PH 2E9JA 1C08B 1S7XA 3B5GA 4YK4C 4EQ2A 2BNRA 1ZOXA 4UUJB 5HD8D 3MV8E 4HKBA 4J8RA 1EGJA 2CDFA 4HC1L 3EIFA 4IRJA 3ZHDA 4JJ5B 2BNRE 2DQDH 1MNUL 1D6EA 4OKVA 4NNXB 2ICES 2PXYD 1NUNB 2CK0L 4QXGH 2H32B 1E4JA 4K3DH 4Y4KA 1BAFH 1WIUA 3DRTB 1PJ9A 4KPHH 4ZSOA 4ODHL 3MC0A 2W60A 3GIVB 1YEEL 4HAFA 1BBDH 3HE7A 5T1LA 3FT4B 1A1MA 4ZSOE 3FO0L 2BVPA 1IMHC 3DI3B 2GEEA 2ICWI 3H9HA 2WUBH 1MFCL 1XZ0B 2IPTH 4DOHE 3RGVD 5DRNB 5CEYA 3H0TA 3QJHB 1P69B 2UYLB 4XNQA 4TQEH 1EPFA 5FYLH 3HI5H 4CKVX 2F54B 1H5BC 2DYPB 4AEHL 4LK4A 3LVEA 2OXHA 1KBGL 1K2DA 3CUPA 3OR6B 4XNYH 5FYKH 3BH8B 5DLML 5BQ7A 5KSAD 5HHPB 3VRLF 3REWB 4WUUD 1OAXL 1MELA 4L1HA 5I1JH 5EH1A 3MLZL 4NWTL 4FTVD 1IKFH 5IB3A 3KLDA 4M9OA 4C58B 5C6TH 3SKOB 5J13C 5JHLL 1D5BA 2AJVH 3EOBA 3WNOA 3TH4T 1I9RL 3EYQC 1R3LA 3LD8B 2I25N 1YPZB 3S6CA 2HAZA 3EYFA 5DHVH 3QIWC 3C9NB 4KJWD 4J12A 4M5YH 5D7JC 3S35L 3SOBH 3EJZD 3KS0H 3SY0B 4GXUM 3MRGA 3SDCC 3CLFH 3PWVB 4HEME 4PG9B 3LB6D 1S78D 1MUJA 3G6DH 3HNSH 3HZMA 2I9TB 1FVDA 3MRDB 4GKNA 5L2JB 3BPOC 4MLIA 4Z95L 2EEDA 1MHEB 1WC7A 4S1QL 5DK2B 1R5IA 5LXGL 2HVJB 5EO9B 2QSCH 2JELH 4XNUL 4XWOC 3G04B 5DJCB 1JPSH 1JNLH 2GY5A 4HJ0C 4M7KL 1D9KB 3UTQA 2VLKA 5HHMB 2K3TA 3JWOC 4NN5B 4QOKE 1MIML 1YEJL 3QUYA 3BXNA 3DHMA 3WS3A 1BFOA 1NGWB 2VLKE 5DRXB 3PWLA 2PW1A 3O0RH 4KI5C 5LBSL 3BZEB 3GMQA 5DVLA 2CR3A 3E3QC 4PRHD 5KZCB 2R1WB 4TSAH 3GMOB 2OK0L 4H5SA 2CDGA 3LMJL 3NIFF 1KENL 2RR3A 5IB5A 2X1OA 4QHNA 2COQA 1T21A 3V6BR 1QRKA 4KUCD 1FG2B 1AIFB 1CT8A 4P3CL 4ZFOA 1VHPA 3LAFA 4IEFB 3O9WD 5IJKA 1HH9B 2LAGB 4QRSA 5BJTB 4OZFB 1OGAA 4KDWA 5J1AA 5AZ2L 1CG9A 2EE3A 3M8OL 4L8BA 1TFHA 1ZGLM 4LCWB 4OCWL 5JW4M 1CCZA 2YD1A 5L2KA 2IG2H 1I7TA 1OGAE 1G9ML 4YDJA 4L4VD 2LTQC 2UWEB 5L2KE 2K7QA 1ORQB 2FYYA 2W0LA 3FN9A 3KXFB 4YJZL 4MB3A 4NO0A 2IANE 3CZJA 3EFDH 4K3GA 5D6DA 3WFCL 5DRWB 4XXCA 3VCLA 3JZ7A 1T5XB 1F02I 4ISVA 4Q9QL 5FUCC 2ZCKL 1RD6A 5JHDA 3SO3C 1YY9D 1J87A 5IB4B 4FFYL 3DUSB 3ET9F 4G6KL 3MACL 2ADJA 4WFFD 3VFPA 5K59F 3OBAA 4WV1A 3OZ9L 2JIXB 3DNKA 3X3GH 4RAUA 2DQTL 3H3PL 2ERJC 5C0CA 1RSFA 2L4OA 2E27L 2PYFB 4PY8I 3FQUA 5T3XD 1S7VA 1T6WA 2ICWA 3ZYIA 1A6TA 4HFWB 1TQBB 2XACC 1OM3H 5CSZA 1F5WA 3W2DL 1HNFA 1U8JA 3GK8H 5DXWA 1WZ1H 1ETZB 1B0GA 2R2EB 1FYTB 3I6KA 4Y4FA 1UEYA 1NBYA 4NQED 4NKIH 4JRXD 4HPYH 1TZIA 2ID5A 2P5WD 1BGXH 4RMSA 4LQFH 1DUYA 1I4FB 5DWUH 1KELH 3FO2B 3LEYL 3MYJA 2YD8A 1BD2E 1A9EB 3CXDL 1AGDA 1A3RL 4GMTL 5ECJE 5IKCB 3BPNC 4BZ2L 2ILLA 2MSPA 3K74B 1BIHA 4Z18A 3ZL4L 2PCPB 4K7PY 3KYOB 3MFFB 4OZIA 4RISH 3NBNA 1A7RL 3RWFA 4X99B 2E6JA 2HTLD 4H88H 3KJ4C 2WBJA 4ONFL 3N0PB 4WI4A 2CSPA 1ZA3A 1NJ9B 4PB0H 1H0DA 5FM5O 4JFZL 4UB0L 5AAMA 4NGHH 1NC2D 4U7KA 1JN6A 2Z8SA 4JPWH 3DMMA 1P84J 4UT6L 3DX6B 1VGKA 3OF6D 5IV2A 3QXUA 3ARGD 1QSFB 5DMIL 4YXHH 3W9DA 4LARL 3G08A 1MJ8H 1VADB 5LVEA 4HWBA 4U1HB 3C6SA 3QI9A 3UTSE 3X3FH 1Z6JT 1U92A 3SE8L 3GBML 5GJTH 5IFJB 4X4ZA 2EXWC 3C5ZC 1INQB 1XF2B 2NW2A 1FN4A 4TOYL 1CLCA 4Y1AB 2FNBA 3FB6B 1HZHL 1LEKA 3P30H 4UT7H 1C5CL 4CADB 2YEZB 5IEHB 1BEYL 1G7QA 3BPCA 3ZT7A 4U05A 3WSQH 3UJJL 1PD6A 3TVMA 2CRZA 3IDGA 5KJRH 4LIQE 1ACZA 1BIIB 4JQXC 1QR4A 3MV7B 2F5AL 4FABL 1T0MA 2F58L 4NZRH 1CE1L 5DT1L 1DR9A 2FEDC 1UWXK 4OZHA 1S5HA 2G5BA 3Q1SH 5FUZL 4HGWB 3FAXA 1UWEL 1C1EL 4HXAL 3RPKA 2Z31C 5T5FL 1ZEAH 1JWUA 3PDOB 3FL7A 2H6PA 3FONB 3HE6C 3SKJH 3O2DL 5FB8B 3ULUD 3OJDB 1EHNA 1QQDA 1CFBA 4XP9L 4S1DC 3ME0A 2BOCB 3ARVA 4LAQL 3JV4B 4WTZG 3F7PC 3C2SA 1J7VR 2LQRA 4MD5A 4G7VL 4LASH 3N9GH 4OD3H 1MLBA 3O2VL 2NY0C 4NP4L 5DSCA 5GISL 4G80A 1AQDB 2BRRH 3ZKMC 2EO1A 1Q1JH 5DD5L 1VEOA 1B9ZA 4RFOL 5F1KC 2OM5A 4NJ9H 3EKCA 5BVJA 3VA6A 2VDNL 3IJYB 3R8QA 1CLZL 5FM8A 1MI5B 3RL1A 4CU7A 2X4PB 5C0DB 2YMXH 1NBVL 2ZJSH 1JZ3A 1QVOB 4LHUG 5BRZD 4JKMA 1OD9A 1REIA 2Z35A 3OXRA 5F1OB 3V6ZB 5JIPA 4ZFZA 1CK0L 3MNWA 4NDMB 5GGRB 3PGFH 2R0LL 2X70B 5CD3A 3OGCA 4Y88A 3ARYA 3T77A 3VXME 5SWSD 1CYGA 4GXVH 3MRJA 4P46B 1EV2E 3MODL 1J8HE 3CFDB 4HUWB 5HYJD 3MLVH 1CE6A 2QBWA 2V5SA 5FYLE 1S8DA 4LNRA 3EFFA 1RURL 3DETC 5D93B 2EZ0D 4UT9H 5FYKE 4POZD 1UZ8B 5ESVA 2YBRB 2DM2A 1E6JH 2YPLB 5DTFB 3ABZA 1D5XB 2XPGA 4M6MH 5DMKA 4M62H 3NZ8A 1VACA 1J0ZA 5DHVA 4PUBH 4BFGA 3KDMB 1RI8A 4OF7A 5KS9A 3OKKA 3BKYH 4MAUH 3O8XA 1VGEL 2FLBT 3HI6L 2UZYB 1ORSA 3CX5K 2VR4A 4WEMB 3C09C 4P5TC 3TYGH 5HJ3B 5F70A 1UB5B 3S88H 2XN9B 4CNIB 2XZCH 1MCLA 4HF5H 1G0DA 3T0ED 4PPTA 3CFJA 2BVEA 2HFFA 5EO0A 4M8QB 5CKGA 1KF9B 3ZE0F 2G9HA 4OCYL 1C16A 2YKLL 3GMPB 3PGDB 4MHHI 3RA7H 1F2QA 5TJWK 4U1NB 3WXVH 4NT6B 5KVDH 4BH7A 2AXHA 1SM3H 2X7LB 1AHWA 1TJGL 4RIRB 1OARL 1BVKB 2UVFA 2NNAB 1P4LB 5JQ6H 4Y7MA 3MCLH 3UEZA 1IARB 5L6YH 4ZNCD 5DC9B 3RJDA 1UWGL 4M43L 3UYRL 2VXUL 3G5XA 3VFSB 1R24A 1MFDH 4MWFB 5DD0L 3HC3H 1RZKL 4IOIB 1GZPA 2DM7A 4MSWA 1KGCE 3GIZH 3FFCB 5F6IC 4GG6F 2R2HA 3QJFA 4ONGL 1PVHA 2XFXB 4PJBF 4HX1A 3OTTA 12E8H 3MV8B 2CIKA 1DEDA 1EFQA 4E9LA 3JXAA 4HSQA 4XCCL 2BNRB 5GJSH 3L3OB 4H1LB 4LSQH 4ZG1A 3E0GA 5BMFH 2NY5L 4X83A 4IRJB 3K3QA 2W9DH 3INUH 4MJ6A 1FFRA 4H8WL 4F33A 5E2TL 1D6EB 4XPGL 4DGIH 4MA1B 1INEL 1KFAH 5MENA 3U79A 1IGCH 1FVCA 4ZOAA 4N5UA 4Y4KB 4I3SH 4F15B 1RUQL 5GHWH 4CMMA 4ZSOB 5D7IF 3ELAT 2W60B 4FQXA 5MENE 4KK9C 4XVSH 5DC4B 4YEEA 1HILA 3HE7B 4N8VA 4KQ4L 4CVUA 1A1MB 4DOHB 2IGFL 1PY4A 4YX2L 5D1QC 1U3HD 3H9HB 2WW8A 4TNVF 4K9EH 1OT1A 4QYOA 4YUEH 4UBDD 2B7DT 4J4PA 4XZUA 2DI8A 5CEYB 2V2XA 1RZFL 35C8L 2R4RH 4XNQB 4I77H 3AB0B 4PJ9D 3I3DA 4B53A 3BQUA 5FAAA 1K2DB 3V0WL 4PGDA 1J18A 2APXA 5BQ7B 1XH3A 4XP4H 3V5DB 1R6VA 4FQHB 2J2ZA 1FLTX 1S9KC 5TE7L 2YZ8A 4M4RA 2AXJA 1WBYB 1TZGL 5IB3B 3PP4L 1D5BB 4WFED 3WYRA 1R3LB 3WL9A 4J6RH 3CVIH 4HIXH 4KK8D 1DE4A 2B2XL 3EYFB 1P2CA 1JRHH 2A9NH 2CGRL 1YYMH 5KVEL 3SDAC 1MCNA 1BJ1J 3MRGB 1EMTH 1MUJB 3HZMB 1FVDB 4IMKA 1GC1C 4UZGA 4JM2F 4NRXB 1WC7B 2P8PA 3DUUB 3ZMRA 5B4MC 5I30L 4M93B 3ARED 4HJGA 4TYUA 2NPLX 4QOKB 4GBXA 1S3KH 1WT5C 5I1KL 4JO2H 3DV6B 1NSNL 4UDTB 3EYVA 2VLKB 4Z8FH 3IDYB 3VWKC 3T2OA 1CU4H 3QUYB 3BXNB 1K5NA 1WCQA 3RNQA 3WS3B 1A5FL 1BFOB 1N3NA 3PWLB 2Y5EA 1PG7X 3RWEA 2PW1B 4MX7A 2E6QA 3NA9L 3GMQB 1I9JH 4QRPD 4H5SB 2HVKB 3DXAE 4UILH 4O5LL 2EC8A 4QHNB 5IHBA 3MTRA 4ETYA 1T21B 3O41A 1I9IH 3QQNA 1HXYA 1T1YA 5F3BA 4U0RB 4ZFOB 3UTZA 2BSSB 1U8KA 4N5ED 4HK0A 3LDBC 1H8OA 4QRSB 4XPBH 1DQQA 1OGAB 5J1AB 1CG9B 1JHKH 1YUHA 5ENWB 1DQJB 5L2KB 4ZS6D 1I7TB 3BZFA 2XXMB 2DTSA 3RWGA 3I9GL 4K8RH 3FRUA 5IB1A 3TT1L 2VXQH 2IANB 2FYYB 5GGQL 3MA9L 4P5MA 4JHWH 4KROC 4I2XA 2PETA 4YHPA 5FCUH 1RUPH 1VFMA 1IM9A 4M1DH 4I2XE 1MRCL 1EHLL 1DL7H 5EU3A 4UU9A 1UCTA 1AFVH 1LO2H 4YDKH 5A3IC 3ARUA 4LPUA 3CSGA 4ISVB 3LS5L 1SVZA 4G8IA 4S2SA 1KEGH 4I3RH 5LGHH 1BFVH 2HJLA 2F53D 3ZTJG 5C0RL 3HMXL 5MHSD 1QFWM 2ADJB 3VFPB 4WV1B 5LWYL 2ZG3A 2XZQH 3LIZH 2DQGH 1JGUL 3ULVC 3GFUA 1NDGA 1NKOA 2R2CA 5C0AD 3NMEA 4I0KA 3EDDA 4LLAA 4AJ0A 4HIHA 5D7LA 1S7VB 4MB5A 2VN7A 2ICWB 1A6TB 4IJ3B 2D7PA 5D7LE 2BJMH 3TBYA 5CSZB 1Y18A 1IGYA 1XGYH 2WP3O 5JOPE 3WDJA 2VKXA 1ES0B 1U8JB 3ZE2F 1A3QA 1VFUA 5J9PB 4Y4FB 4EI5D 1NBYB 5JO5B 1SJHB 3U4BL 1NCDL 1CQKA 4K94H 1TZIB 5A2FA 4P2RA 5C07D 4NJAL 1BD2B 4KKCD 1DUYB 5DJ6B 3ZHLA 4GS7C 1MHCA 2PTUA 4P2RE 5C0ND 5GZOC 3RPIA 3HMWH 5FGBC 1TVBA 2VDQL 4OCLC 2HT2C 1XF1A 1P4BL 1NANI 3STZB 3CK0H 3A0OA 3BYYA 2PTTA 5C09E 2BCKA 5ISZA 2MHAA 2DLFH 3KLAA 3SGDH 3VD5A 2FH8A 2B4CH 1DBBL 4QY8A 3RWFB 3UBXI 1X5JA 3RVXC 2WBJB 1DUZA 5KOVC 3TO4D 5F1SA 1I8LC 1ZA3B 4P9MH 3CC5A 1JRHI 5GRZA 4JFOA 1AXSB 1H0DB 1I7ZA 1U8HA 4D3CL 2HWZH 5TPWL 2EDOA 1JN6B 3I2CL 3PXJA 3DMMB 1E4XL 4O02L 5CP3A 3OPZL 1VGKB 3AS0A 2VMFA 5IV2B 2W1NA 4XP6L 1OAQH 4KVNH 3QIBB 4KXZH 3NCFB 3UTSB 4OCXL 2YPVH 3G08B 5J1SC 4XI5D 5GS0H 5IROA 1LO3L 1P5UA 5D2LA 4XNMA 3C6SB 5FHAL 3HS0B 3TJHC 1U92B 3KNBA 4BQ9A 1MHHA 4HWUA 1KTDA 3ESUF 5D2LE 4FZ8L 4EUPA 2L7JA 2EH8L 5F8QC 4YQXH 3Q5TA 1FSKC 2NW2B 1FN4B 1CICB 1N2RA 2Y4SA 4WW2C 1MJJB 2XICA 3AVEA 1WEJH 4X5XA 2R0ZH 3MUHL 1LEKB 2N56A 3PQYD 2HFGH 3BRGC 5T1KD 2OJZH 3PWJA 4DTGL 1A8JH 3BPCB 2R56L 4HUVB 4HDIB 3TVMB 5C8JA 3IDGB 2DQDL 3RWJA 3UAJC 3P0YH 2H2PC 3MRKA 5C0IA 4FQPA 1T0MB 4LPYA 1OF2B 4FQIH 5D1ZC 4KPHL 2G5BB 3O81A 4EDWH 1I3GL 1IC4H 1BBDL 4WU7B 2ARJB 1JWUB 5D72H 5TF1H 2H6PB 4U1JA 1RZJL 4H0IA 4M6OL 4MLSA 1LK2A 4LKCA 1QQDB 3QUZD 3SE3C 5D1XC 3U7WL 3SE9L 5FXCH 5J11B 3CLEH 1N6QL 3S37X 1K3ZA 1ACYH 4MD5B 4TQEL 4PJ8A 3WXWH 1TVDA 1G7HA 4LLVA 5DSCB 1KIPB 4G80B 3STBA 1R3IH 1A7PL 3O4OB 3HC0A 4P5KA 4NM4L 1TETL 4FQLH 3V2AR 4XNYL 3QXWA 4X7TA 5DJYA 5GS1B 4DK3A 4IOSD 3H42H 3TA3D 4Y19D 4AM0A 1IKFL 3WIHH 3RL1B 2VLRA 5C6TL 1YQVL 2MWCA 4Z76A 4JM2B 4ZAKA 1CGSH 2VLRE 4JO4H 5F3HB 3OXRB 2Z35B 1X44A 4G6JL 1S7QB 4M5YL 4JFQA 4KGJA 4PRBA 3SOBL 3VXMB 2CLRA 1MCCA 3ARDA 3MRNB 5EU6A 1J8HB 2CKBH 3T77B 1EH9A 4DKFH 3MRJB 3IDNA 1A4KA 3R4DA 5EU6E 4APQB 5T3XH 1CE6B 5EU4A 3JVGA 4LNRB 3EFFB 1JPSL 3DX9A 3OKLA 4LSDA 3BUTA 2FHCA 3DO7A 3VI3F 3MOBL 1NCNA 2ED7A 2VZTA 5JW4R 4LRNH 1M7DA 2YD6A 4HFUH 5J89A 4PGCA 2XPGB 2C3XA 1MWAA 5HDQL 5MEQA 2X4TA 5DMKB 5A2IH 5FM5M 1JUFA 3O0RL 3UBXA 2I5YH 1RVFL 2KPNA 1G7IA 5ILTH 3NZ8B 2R23B 4RNRA 2VR9A 4TSAL 5CIPH 5DHVB 1QBBA 2MPAL 4NO2A 4JO1H 3N1QC 3SGDI 3SPVB 3O8XB 1X3DA 3ES6A 5AYUL 4ZXBA 1ORSB 1KXQE 4R4BA 4E0RA 5GGTH 3NCJH 3QPQD 2FR4B 3CU1A 5HHQB 4P23A 2XZAH 2GCYA 3BP4A 1IGJB 4DUWA 4WI2A 5D8JH 2JF1A 2X89D 3E6HA 2IG2L 5MERA 1EEZB 3ARRA 2QQKL 2HFFB 3SDDA 1VESA 1A6UL 4KXZI 5EO0B 1DBMH 3QDHA 1JF1B 3MMEB 5H37G 1C16B 2JJUA 3FO9A 2IBZY 2Z8WC 2F8XC 3A6BL 3GO1H 3MBXL 4WTWA 4KY1L 1TJHL 4BH7B 4F9LC 1AHWB 1ZWIA 2B39A 4OFPA 5I1LA 3VFNA 1I85A 1IAKA 4B7LA 5JXEA 3DROA 1AD9A 1MJ7H 3GKWH 3KLHD 3G5XB 4GKSB 1F11A 3EYQD 3C6LA 4HKXA 4WI7A 1EUTA 3U7AA 3X3GL 1XR8A 2P1YA 3GSRB 4S1SH 4I0PC 2D7NA 4MA7L 3BT2H 5C3TA 5D7JD 2R2HB 3QJFB 4O2FB 1Q38A 2WQ8A 5EN2A 1KCVL 3IF1A 2DIAA 5HGHA 3VGAC 3NGBC 3Q6GL 3LV3A 2RB8A 1AKJA 4HX1B 1ZXQA 4JZJB 3T2NH 2CIKB 5D2LF 1MHPL 5BOZG 5C86A 2NXYC 4ZS7H 1OM3L 1WWWX 4N90E 3VDAA 3CH1A 3GK8L 3UTOA 1QZ1A 4XC3H 4XWOD 2I60H 2W07A 4MJ6B 4F33B 4IM8A 4HJ0D 5DJ2A 4NQCA 3T1FA 5MENB 4HPYL 1FVCB 3KPRA 4PR5B 4EIZC 5K9OB 2GSIA 4FQXB 4LQFL 5IUSA 4KI5D 1HILB 2HLFC 5DWUL 3KPRE 2CIIA 2Q6WA 5IW1A 4HUUA 4LSUH 3KPSE 3U82B 3WLWD 4QYOB 1RJCA 5HGAA 1OLZA 4DKAA 2V2XB 2DKMA 4PYGA 3OG4B 4LKXA 4MNHA 1P6FA 4OD1H 5I8OH 5FKAA 2UUDK 1L7IL 4HZLA 4LU5L 2VDML 3U7YL 4PB0L 3BHBA 1ERNA 5E4EC 2PXYA 4XPHH 1CFNA 2BRQA 1DN0B 4NGHL 4D0DA 4L1DA 5MEOA 4V1DD 4NZJA 4HG4K 5FF6A 1UYWH 4B7IA 3UDWA 3MJ6A 5EZIL 5IQ9A 3WS6C 1HH6A 1OP9A 3WL9B 4L3ED 3ARXA 2J6EL 4YXHL 1MJ8L 1ZK9A 2A9MH 4S1RH 5JR1H 5EOTB 1YYLH 5C08D 3X3FL 3DBXA 4KU1A 2DQJH 3RGVA 5GJTL 4G9DB 5T33L 3PP3H 1RULH 4KZDH 5KVGL 3TN0D 3U9PH 5F7NC 2Y6SD 3UTTD 4EVNB 1R3HA 4HJGB 5F7FA 1UJ3C 2QQLL 5KSAA 4GBXB 1IE5A 4WUUA 4P2YA 3P30L 4UT7L 2PUQT 3EYVB 1QRND 4FTVA 2DI7A 3TPUA 5BV7H 1FDLH 4P3DB 5FKPA 1K5NB 3BKCH 5TFSL 2HJFA 3OG6B 1N3NB 1GPOH 4A6YH 4FTVE 1GGTA 1UM5H 2F8VA 3DXAB 3RWEB 4HJJL 1I3VA 4MX7B 3QWRD 1JTOA 2G60H 1DP0A 4Z78A 1H3VA 3Q1SL 3W11D 1JGEA 3OX8A 3QNYA 1UVQB 3SKJL 1OPGH 1T1YB 5F3BB 4UI2A 1EEUA 3UMTA 3UTZB 1U8KB 4H20H 3D18B 4X8JB 1DQQB 3AXLA 3T3PE 4LSTL 2J88H 4LASL 1F3DH 3V4UH 4OD3L 3BZFB 2BRRL 3FRUB 1EO7A 2VWEE 4OTXH 4NJ9L 4I2XB 4G3YH 3TJEH 1VERA 3JTTA 1T0NA 3AS2A 3CAFA 4PRHA 4Q6IC 3GMNA 1IM9B 1C5BH 5EU3B 1RIVH 4UU9B 3TZVA 1BZQK 4LVNB 2X9YA 4PRHE 1YJDH 5EA0H 5EUKA 3DGCR 4G8IB 4S2SB 3E8UL 3MXVL 5DZOA 2HJLB 4UDUA 1FC1A 3AY4C 3O9WA 3PABA 2X4NA 4LLQA 3PGFL 1JFQH 3GSWA 4QRTA 1QPXA 3H6JA 2Y36H 2JB6A 1E28B 1NDGB 5ACZA 1NQBA 4L4VA 4IBLT 1SQ2N 2W9LA 4YFDB 3MLVL 3QULA 3ZE1E 4JG1L 3B4NA 4RAHA 2AJUH 4HIHB 5D7LB 1K4DA 2ZCLH 4YHKH 1U58A 3L5IA 3S97C 1X5YA 2EXWD 3CXHJ 1DQLL 5D2NC 4Z5RA 3MO1B 3WIHA 2UZXB 3GDBA 1E6JL 3KYKL 5E7FA 1Y18B 2OXGA 1IGYB 3ILQC 4LP4A 3O11B 3TGXA 3VFGL 4KDTC 5LGKA 5B39B 4GAGH 4YC2B 3T65A 4ZOCA 2A73A 4KK5C 4J3TA 4PUBL 2NTSP 3BEWA 1F4YL 4P2RB 4UV4H 3WFDH 3BZDA 2A6JB 3S36X 1W0WA 4PJHA 1MHCB 3HMXA 2NMSA 5B3JE 3GSNL 2CRMA 4PBWD 1IZJA 1J0IA 1PG7H 1ZA6A 3FN0H 4TRPL 5DUBA 3RPIB 1TVBB 5C09B 2FEDD 1Y6MR 4PJHE 4NZTH 1U8PA 3G5YA 1CD9B 2PTTB 5HVGB 2XZCL 2BCKB 3HE6D 3C08H 1IFHL 4JY5H 2VABA 1OSZB 2HMID 4R2GC 3RVTC 2BXZA 2DICA 5T3XE 3KLAB 3P0VL 3LQAL 2AXFB 4S1DD 4NYLA 1J05A 4OGXH 1N26A 1B2WH 2ENSA 3CC5B 5TE4L 3HAEG 4JFOB 1I7ZB 1U8HB 4NQEA 2NY0D 3B83A 4JRXA 1J10A 1LE9B 3WXVL 2R0KH 3ZKMD 1A3LH 5CJ8A 1QA9A 1SM3L 4AH2A 2P5WA 4CW1B 3QG6A 4IMLB 4NQEE 3RIFF 3BP5A 4JRXE 4NHCH 1L7TH 3U9UB 5JQ6L 3MCLL 4H26A 5CJ5A 4OSUH 5L6YL 2P5WE 1NAMH 1ZLVK 1W0YT 2VXVH 5GGTA 2XTJE 1MAJA 1MFDL 1WICA 4U3XA 3HC3L 2C1OA 5D2LB 1PGRB 4XNMB 3KNBB 1KTDB 3SHSA 3GIZL 1ZANH 2QQQA 4EUPB 2XQBH 4WU5A 1W8NA 2EIBA 1N2RB 4PB9L 3DUHA 3ZDZE 1QO3A 2MOVA 4X5XB 3UC0H 4XAWH 5IWLC 3WMSA 3E6FA 3REVA 2WINB 1NMCB 4DWHA 2OZ4H 2XOTA 4QHUA 3PWJB 5GJSL 4F7CA 1UH4A 3OF6A 5IM7A 4KZEH 1P4IH 5C8JB 4FXLA 2W9DL 3ARGA 1G9MC 4MA8H 3DETD 3RWJB 3VXPA 3ARBC 4HS3A 2GHWB 5IF0B 3MRKB 2D03H 1U8MB 4DGIL 3OGOE 1FNAA 2WNGA 1M7IA 4I3SL 1F45A 2W65B 2XWTA 3VWJA 3S34H 1MCPH 4XVSL 3MRHA 1CVSC 2WMPA 2YD7A 1MRFL 4U1JB 2E7CA 1QBLL 5EZLA 1LK2B 2DL2A 2H26A 3MUGA 4PY7A 1YNKH 4K9EL 5H37H 2DL9A 1EXUA 2GITA 3HZKB 3VMPA 1IGTB 2DWDA 4LL9A 1U8LA 3O45A 3MJ9L 4PJ8B 4YNYB 5D71H 1G7HB 1VFBA 4G7YH 4OM0H 1A0QH 2A1WH 2ORBL 2OL3A 4X5WA 5HI5C 3HC0B 2CR6A 3T3PF 4NC2B 4FQ2H 1UENA 4XP4L 1X9QA 4P4RA 4X7TB 5DJYB 1T7XA 2BHUA 1OSPH 3EDEA 5INDA 4FFZH 4NC1C 2VDPH 4AEIH 2QLVB 3EO9H 4AM0B 1NFKA 4U1GC 2VLRB 2JK5A 4AIZA 3BWAA 2ARWA 1SHMA 4J23A 4Z76B 2BFVH 3F6IA 4ZAKB 4HLZG 3JV5A 4PJXA 3CVIL 1UG9A 3LOWA 5JW4Q 1T89A 5M7QA 3PG2A 3UZQA 3TM6A 1LMKA 3IJSA 1JRHL 5HHOD 4JFQB 4PRBB 1CGUA 2CLRB 2FDBP 3PWPD 3ARDB 3U0WH 1KEMH 1IT9H 5EU6B 3PDDA 2VUOA 4TVSa 1H15A 4X9GA 1A14H 4LEXH 5KG9A 3IDNB 5IROC 1A4KB 1IBGH 2ADIA 4KUCF 5EU4B 3BH9B 5DYOA 2GK0A 3GHBH 4WJ5A 3OKLB 3DX9B 4B41A 3SKNA 4JO2L 1QKZL 3DO7B 3CSPA 5CJOH 1DVFD 1M7DB 1K8DA 2YK1H 4JPKH 1L6XA 5MEQB 2X4TB 1JUFB 3PHSA 2AQ3A 3UBXB 4U1KA 1G7IB 4TNVK 1I9JL 1GHFH 1UC6A 1HN1A 4RNRB 4QHMB 3ZSTA 4HIIA 4YDLC 2BP3A 4OFIA 3IDXH 5EWIH 4NO2B 2NY7H 3IFPB 2QSQA 4AQOA 1HQRA 1WWAX 5AUMA 3ES6B 3NIDE 3QAZB 5E5RB 4ZXBB 5SWSA 3QZWG 4R4BB 4E0RB 4BZ1H 3CDCA 5IBUB 4UINH 3VA2C 2JB5H 5HYJA 2CXGA 4HHAA 3F58H 5F7WC 5SWSE 3LKOA 2VZOA 4P23B 2GCYB 4LP5A 2NY2B 4ALAH 1FRGH 4P2OC 3VFVA 3E6HB 3LEVH 3GSQA 4OAWA 5MERB 1UWXH 5HYQB 2DLIA 4JO3L 3LHPH 5D1QD 3SDDB 4MS8C 4PJHF 2O5ZH 2IH3A 4Y16A 4XGZA 2DBLL 2R8SL 4F58L 5FCUL 1RUPL 3FO9B 2EICA 1YY8A 6CGTA 4M1CC 1G7LA 1OTTC 4IRZH 3S37H 1E4WH 4O4YL 3WUWA 1U42A 1ZWIB 1EVUA 1HHJB 4M00A 1AFVL 3C2AH 5F96H 4G8GD 5DF0A 4YDKL 1HI6A 4Y5VA 3WJJC 5I75C 5I1LB 3VFNB 3OKNA 4YLQT 3V5KA 3MLRH 3DROB 2YSSB 1AD9B 3VXQA 1KEGL 1BFVL 4I1NB 1S7SB 4YFLI 1X6NA 3ZKXC 2G2RA 1RQ5A 4D8PA 2PKDA 3C6LB 5FECB 4HKXB 4OZFG 2DQGL 1OAUL 1ITCA 3T0EA 1JPGB 2YOCA 2VQTA 3RWIA 2YRLA 3SDAD 4JG0H 4C55A 2WIIB 5EN2B 3AM8A 3PL6D 5HGHB 1A6WL 1AKJB 4JDTH 4WIQA 1IGIL 2FGWH 3ALXA 4M03A 3RX5A 3MZTA 1T4KA 3L9RB 5B4MD 2VRAA 1XGYL 4WWKC 1OQOA 1RIHL 1KB5H 3IT8D 1KULA 3ZDZF 1PKOA 2EDHA 2XZZA 1J1OH 3SJVD 4YWGH 4PRDA 1N7MH 5DJ2B 3VWKD 1BHGA 3BRFA 3TBSA 1RJYA 1XMWA 1ZT7A 3NPZB 3KPRB 2GSIB 1N59A 1KCKA 1NCBL 3KPSB 5I73C 3WEXA 5B8CA 5L0QC 2CIIB 2Q6WB 3HMWL 5HDBE 1RFDH 4HUUB 1NKRA 4K3EH 1OOAA 2VDOL 3CK0L 5EZOH 4JY4A 5HGAB 3OKMA 5F8RC 4JZOB 4LKXB 1BZ7A 1H3XA 3LRGA 4MNHB 3T2QA 5ID0A 4OLWL 1IC1A 1KB9K 4LHQB 3FCTA 3B3IA 4HZLB 2HFEA 4ONHA 1TNMA 5ELIA 3FHAA 2PXYB 2NY1B 2J5LC 2EDFA 4BKLA 5EUOA 4D0DB 5IHUL 3GGWA 5MEOB 4PJ7F 5GGRY 1ZT1A 4R7DB 4AG4H 2FZ3A 4KROD 5EUOE 4MAYC 2EXYC 1HH6B 5GRWA 1FZMA 4KVNL 5FOBA 3G5VA 1GGCH 3H2WA 2W0KA 3V7AE 5HBBA 1A7QL 4HKZB 1EEQA 1M05A 1HSBA 2MCPH 2IAMD 1U3HA 5GS0L 3ZDYE 3DBXB 2H2SC 3RGVB 3HZYB 4YO0B 3EYSH 4Z77B 4K7PL 1RZ7H 1ROWA 1SEBA 3VRJA 2R4SL 3VMNA 4PJ9A 3BVNA 1MOEA 4WVRA 4YQXL 4N9OB 4OF8A 5HGBB 2Y9RT 4LHUB 5IP4A 2QHLA 2CPCA 5IK3A 5KSAB 3ULVD 4K2UH 1KXTB 2HFGL 1NLDL 4X6CA 3CGTA 4FTVB 3TPUB 4MNGA 5MI0B 5FKPB 2HJFB 5ITFA 4X6CE 5DC0A 4BUHA 4JKWA 4MNGE 1FNSH 3KAAA 3GUTA 5L7XH 2VDLH 5L88H 1FZOA 4FQIL 2ESVD 4Z78B 4D9RD 5BZDB 4PLOB 1JGEB 4EDWL 3OX8B 3QNYB 3ULSA 3MLSH 4U3CA 4R7NA 5FO9A 1T0PB 1D6VH 1NAKL 3PV7A 1U8OB 4O51A 1EJOL 4XC1H 4N1EA 3AREA 4GRLC 4JLRB 3AXLB 3TP4A 1HHGA 3CLEL 3TBTB 1CL7H 2VZ3A 5CSBA 5DHYA 5TDOA 5GZOD 2PW2A 3NIDF 4L3AA 5C0GA 5JA8B 3WXWL 4RQQB 1RZKC 4X80H 2EC9U 4KK6C 1R3IL 3LS4H 2YN5A 2DQHH 1FNGA 3JTTB 2YD2A 1T0NB 3H42L 4PRHB 5CSGA 1LD9A 3GMNB 4QRPA 3V52L 4HCRL 2JJTC 5HD8C 2NCMA 3RVXD 4FP8H 4XH2A 3VD4A 3TZVB 4FXGA 1A7OH 4Q9BA 4QRPE 4NO3A 2ZNXA 4AENA 4YIQA 3NA4A 2W9EH 3AB0C 2MQCA 3DARA 4UDUB 5F71A 4JKLA 2NY5C 3P3YA 4DCQA 3PABB 2B5IC 5GS3A 4LLQB 4H8WC 1T04A 5IW3A 1P5VA 1CFVH 4YHYC 2CKBL 3MROA 5FO8A 5ACZB 5AWNH 3VFMA 3VRIA 5CEZD 1Q0XL 3BO8B 1RUAL 2P43B 2F9BT 1RZ8B 3QULB 5ALCL 2MQ0A 3TJHD 1T83C 3IJHA 4QTIL 1K4DB 4X7CC 2P5ED 1EZVY 5F21B 2FEEL 1U58B 2XA8H 3B9KC 2NY3C 1ED3A 3QDGD 4MJ5A 5HI3C 4Z5RB 3O3UN 5I74B 2X4OA 4KFZC 3L5XH 2DLGA 3T65B 5ILTL 3TBWA 4ORGA 2F53A 4WFHD 2A73B 3JWOH 1NGXA 3QEQD 4Q9RH 4JO1L 4Q2ZB 1U2CA 3FTGA 3T4AA 2F53E 3MRLA 5MHSE 3VXTB 5I6XC 3T0XA 2CKBB 1W0WB 4PJHB 5C0AA 5I8KH 1OB1A 4XCYA 1N6UA 3EO1A 5DUBB 1ZA6B 3NCJL 3IGAA 5D1ZD 1PZ5A 2X4RB 5C0AE 2XZAL 1U8PB 3WLBA 2Y5TA 1LO4L 3VW3H 2HJKA 5D8JL 1S78C 3LB6C 2VABB 4I4WB 4LCCB 5HDBF 5EOCJ 4NYLB 1J05B 5D1XD 5CBEA 4NFDA 1PEZA 2CLZA 4OIBA 4HLZH 2PYEA 4NHUA 1BP3B 3HNTH 5DQDH 4U0RC 1KN2H 3CX5J 4NQEB 1AH1A 1CFSA 2PYEE 4JRXB 1TCRA 3GO1L 3QEHA 5MP6L 4RGNE 4AH2B 1LGVA 2P5WB 1JV5A 4JQVA 1OAKL 3QG6B 5C07A 3BP5B 1FE8L 5DUMH 2XTJB 4QHLA 2ITCA 4H26B 1FL5B 4ODWA 1F58H 1CF8H 3GKWL 3BI9X 1OCWH 4R4FH 3TBVB 4DN4H 3WN5B 2BOBA 1YQ2A 4C59B 3BKMH 3G5ZA 2A0LC 4U6HA 2HRPH 4WU5B 3O9WC 1MY7A 1UFUA 3GRWL 3BT2L 2ITDB 4S0SD 4LPVA 4K55A 3TO4A 4RCAA 3ZDYF 2GUOA 4N8CL 4IRSD 3UPRA 1N4XH 3REVB 4ZS7L 3C8HA 4QHUB 4F7CB 2XNAB 5DJDA 5IM7B 1FGVH 1R5WA 4X0KA 1NCWL 2I60L 4PJIA 4YXLH 5FGCE 1EVTC 3VXPB 4PJAA 3VG0H 3GEWB 4HS3B 4N0RA 1J0JA 3V6OC 2VL5B 1KLUA 3FO1A 1CL7I 3T8XA 3IVKA 4PJIE 3LN4A 3OR7A 1M7IB 3GHEL 4PJAE 3NAAL 4P4KC 4PJGA 2XWTB 1UKSA 3VWJB 4M02A 4PV8A 4X6CF 3MRHB 1MRDL 4PJGE 5DURD 4MDJA 3O6ML 2P8LA 5EZLB 2Q87A 3RY4A 2H26B 4LSUL 3MUGB 2FX7H 1HEZA 5F9OH 4MZ3A 2GITB 1D5IH 2LABA 3MJ7A 1I1YA 2YUVA 5IGXL 3DOSA 3ESVF 3PQYA 2DWDB 3WFZA 3O45B 1KIUA 5T1KA 5IMMB 1WFUA 1VFBB 4C56A 4EN3A 4OD1L 5I8OL 3WNNA 4JGMA 2OL3B 3GMRA 4X5WB 3PQYE 1F6LL 3RNKA 1KB5A 3WHE1 4G5ZL 1JHLL 1K6QH 4C56E 2ZSWA 5TE6H 2DQUH 4P4RB 4XPHL 2M8XA 3RZCC 2GTWA 2DF3A 5INDB 3SGKC 4GUPA 1U2HA 2ZUUA 5EULV 4OZFH 5C9KA 2FATL 4YFLF 4QO1A 4AIZB 3BWAB 3QXAA 2DQEH 3KPNA 5EBLA 1SEQH 3MLUH 2IBGA 2A9ML 5FYJD 5GRJH 4U1MA 3QUZA 4M5ZH 3IJSB 4FMFA 4W6YB 4YBQC 3ORJA 3IU3A 2Q3AA 2IJ0C 1BQLH 1KCRL 4OQTH 1NPUA 3R0NA 4HBCL 1LVEA 1RULL 4ZYKA 4KZDL 3MRFA 5BO1H 1H15B 4MJ2A 5KG9B 4KMTL 2ADIB 5DFTA 2Z0BA 3QIBC 5B3NA 4Y5YB 5F97E 3S8WA 4WJ5B 3GSXA 5AYQA 4XPAH 5C7XH 3TA3A 4Y19A 4I0PD 4XCFL 3BE1H 1K8DB 3HA0A 1FDLL 2EYSA 4ODVL 4Y19E 4U1IB 4A6YL 2H1PH 3LKPB 3FOLB 4ORZC 4U1KB 1H3GA 3RUGA 1NCCH 2G60L 2NXYD 3QDJE 2KZ1B 4HIIB 2DD8H 2KDGA 3CVHL 3RUGE 4K7FA 4TVPD 3GSUA 1LE5A 4JGUA 1N5AA 1HQRB 3WKMH 4TTDC 3WNPA 1WCBB 5AUMB 5I18H 1T20A 2Z92A 4L4TD 5SWSB 5I66A 1OPGL 4DZ8B 5BS0D 3Q5OA 3I02B 4HHAB 5F93C 4GAJH 3LKOB 4KTEH 2UVEA 2HLFD 4CU8A 4IHOA 3WJLA 3VFVB 1OQXA 3GSQB 4QF1B 4XT1C 4YPJA 2R1YA 1HHKA 5BV7B 3EW3B 2R0WH 5KOMC 3QRFM 1RJLA 1FGNH 5E00A 2IH3B 4Y16B 1MAML 4G3YL 3TJEL 3H9SD 4XGZB 1E27A 1YY8B 1AQKH 5I16A 3KYMA 4ELKA 5FDWA 1G7LB 2KL6A 3HUJA 4U1LA 2OMNA 3WUWB 1SMOA 3MX0A 1HI6B 4Y5VB 1ITBB 1FIGH 3HUJE 3OKNB 3HG1D 3V5KB 3VXQB 4GG8B 4QEGA 4JFFD 4MQXC 1FNEA 2MKWA 3F6LA 3ROOA 5EZJA 4RWYL 2G2RB 3UO1H 2BXYA 4D8PB 5GS1C 3T0BA 3L3IA 3FT2A 1YDPA 5IIEB 2X89A 1PSKH 3QEUA 3PWUA 1YNLH 2HKHL 3RWIB 2QADC 2EIEA 2ZOLA 1RUKL 4ETQA 2J4WL 1RZJC 1SJVA 2ZCLL 1FBIH 2Q8AL 2GSGA 3K1DA 1KSRA 3RWDA 5DJZA 1EEYB 3BWUC 2AJXH 4YXKH 2E5EA 1FO0A 5IT2H 3JUYA 4NFCA 1GOFA 1VA9A 4PRDB 4APQC 2BNQA 1P7QB 3TBSB 1T3FA 5F6HJ 1WAAF 1RJYB 4FS0A 2DDQL 1ZT7B 3EO0B 4UV4L 1R3JA 2BNQE 5JQHC 3SEPA 1TJIH 4LPTA 1N59B 5TH2A 2VE6A 5C0JA 2YRZA 5GGUA 5CINL 5B8CB 3RL2A 3FQWA 3FN0L 4E41A 1IEHA 3QO0B 3BYTA 1RK0B 1NUFA 2D7MA 4PJIF 5D7JA 2C3HA 4E42A 4NZTL 4PJAF 1RK1A 4E41E 2DQCH 2VLME 3SDCA 3RU8L 2JKXA 3F7RA 3WO4C 3C08L 3EGSA 1BZ7B 4PJGF 4NKDA 1IAII 5ID0B 1KC5L 1NEZA 4OGXL 1T22A 4U1SA 3FCTB 4L9LB 4WENB 3B3IB 2HFEB 1U3JA 1ZV5A 4ONHB 4BSWA 3TH3T 1AI1L 5INCA 1DQDL 4POZC 2XG5A 5EUOB 3GGWB 4HEPG 3RQ3A 4JQIH 3SBWC 1ZT1B 4KUZL 3ROLA 1E0OB 2FZ3B 4NHCL 5F88B 2JJVA 1IILE 4OSUL 1FZMB 1MVFA 4EJ1C 1NAML 3MLYH 1MCRA 4XAKD 1BJ8A 1U3YA 4D9QD 1V05A 4KI5E 2RFXA 1HSBB 2I26N 1U3HB 3E3QE 3SKUD 2ZKHH 4WEBL 1PLGH 4FQCH 5D5MA 5IVNA 2QEJA 5HYSA 1P53A 3O6KH 3VRJB 1HE7A 5D5ME 2BERA 2DYPD 2A77L 3RKPA 2AABH 2DLEA 3BVNB 4PJ9B 3S3PA 3V4PH 4QGYA 2GJZA 4PP1C 4HWEH 5FV1L 1F4XL 2QHRH 1CDYA 5IK3B 3T0EC 5J57B 3I6GA 4XAWL 4RMQA 1B6DA 1JNJA 3NH7H 3UP1A 1CZ8L 4X6CB 4V1DA 3TCXA 2OZ4L 4MNGB 1AR2A 4JDZA 3C60C 4WO4C 4KZEL 1P4IL 2D4FA 1RUMH 5ITFB 4UNTA 5E6ZA 4V1DE 1H3TA 4MA8L 4L3EA 4G8FA 1MFAL 2D03L 2PO6C 3GUTB 2EH7H 3VG9B 1KJVA 4L3EE 1FZOB 3ILQD 4QXTA 2CUIA 3S34L 3ULSB 5JZ7C 1MCDA 3EYOA 5I8EB 1UM4H 4R7NB 5FO9B 4KK5D 2WWMC 4O51B 5FUCE 3T04D 4MNQD 1OT2A 4NQVB 4QHKJ 3UTTA 4ONOA 4TUKH 1HHGB 1BM3L 5TDOB 2E7MA 5SV4A 3RIFK 2PW2B 1DBKL 5D71L 1QRNA 1XF4A 4HK3J 2W0FA 1DSFH 1FNGB 4U6YA 2NLJA 5ICZA 2A2QT 5EDXA 1QRNE 3QWRA 1OSPL 1RU9L 1LD9B 1BQHA 4QRPB 3QQ4A 3SQBA 4XH2B 3VXRD 2CLVB 1DLHA 4JZNA 1ZVYA 3CDGA 5IFHL 4NO3B 4AENB 4YIQB 2BFVL 5I1HH 1AGCA 3B2VH 2VNCA 4BJLA 1X5AA 1KPVB 4R97B 4OFYD 4RZCA 2DTMH 4Q6YA 2D7TH 3QUKA 4DCQB 4EOWH 1T04B 5JPMA 3U0WL 3DO3A 3HUJF 5IVZA 2OS7A 3ARWA 1HIMH 3G6JA 4X4XA 3IXAA 5DR5H 1HHHA 3MV01 1J1XH 4RFNB 3KXFD 1A14L 3F7VA 1NBZA 2IMNA 1IBGL 3PDGA 2VTFA 3BP6A 3G6JE 3IJHB 4LGRB 1L9MA 2XI9A 1C7TA 4OLUL 4LSRL 1M1SA 4OLVL 1ED3B 4ERSH 4OIIL 1R3KA 3AS1A 3GJFH 2X4OB 1BX2A 4DQOH 4JPKL 5CWSB 3IFLH 5KTEH 2OTPA 4Y2OA 2J1KA 5E2VH 3D0VA 1WBZB 3BIKB 4ORGB 2F53B 1KPRA 2KBGA 2AJ3A 1NGXB 2JIXD 5EWIL 4X4YA 4TPRL 3FTGB 1U0QA 2FECL 3MRLB 4K3JH 4JN2A 4OBRA 2IWGA 3ARBD 4XHQA 5C0AB 1OB1B 1PY9A 4XCYB 4BZ1L 5CUSH 4UINL 2AGJH 5I1EH 3WHXA 4R0LC 3L95A 4BQBA 1PZ5B 1S9YA 4OT1H 5ALBH 1IEBA 4U49A 2Y5TB 3DSFL 4GRWH 2FRGP 2CH8A 3S35X 3D69A 3LEVL 1OWWA 3C5ZA 1MFEH 2P44B 1QLRA 1JPTH 5CBEB 3AREC 2CLZB 2PYEB 4NHUB 4OF5A 2IMMA 2YN3A 3LCYA 4RGNB 3TIEA 1CFSB 4IRZL 1TCRB 1UH3A 3ZDXE 3B5TA 2GFBA 3QEHB 5HI5D 4Y8DC 1JV5B 1WISA 1HDMA 4XB8A 5F96L 1CD8A 3C2AL 5ID1A 2NXZB 4JQXA 3H9ZA 5DMYA 3U0TA 2ITCB 3S4SA 4ODWB 3MLRL 3GBLA 3LRSA 1NL0H 5GRUH 3WFEL 2LFGA 3O6LL 1NUGA 2QTEA 4Z7WE 4FQJH 3JWDL 2BOBB 5I17A 2VERN 2AW2A 4LLDA 1FV1A 4M4PA 4NN6B 3HC4L 3HE6A 2YRPA 3G5ZB 4TSCH 1ADQA 2C4XA 2YR3A 4U6HB 4N5EC 3C8KA 4NCDA 1XF5A 4JB9L 2G75B 4JG0L 2F74A 3TO4B 3SDXA 4F7EB 5GS2D 1MPAH 2GUOB 4RGMC 2NW3A 3UPRB 4NQDD 1C5DB 1G1YA 4ZQKA 3SDXE 4DUVA 5D5MF 1TITA 4I3GA 3MBEB 2H41A 5DJDB 5FGCB 1QSFD 2A6KA 4E5XB 3KHQA 1R5WB 4R8WH 4X0KB 3VGHA 2ADFL 4PJIB 2CQVA 4PJAB 1KJ2A 1N7ML 3OKYA 1KLUB 3CD4A 1FORH 3FO1B 3T8XB 4U33A 3LN4B 2D3VA 3OR7B 3R1GH 2AQ1A 4PJGB 5IW6B 3O6FB 3QUMH 3K2UH 1BECA 1G7PA 3OL2A 4KRPB 4BK4A 1E6OH 4MDJB 1ZE3C 2P8LB 2SEBA 1RFDL 2IALA 1PX3A 1HEZB 5EZOL 4YR6A 2VB5A 4Z7UA 5KSBA 3BEVA 4FG6C 3MJ7B 1I1YB 4LDLB 3VD3A 4WWID 3PQYB 1AO7D 4YDVA 4Z7UE 5T1KB 1NCTA 3NFSH 5KSBE 1BWMA 4C56B 4EN3B 2XT1B 2K1MA 3FB8B 1Q9WA 3E2HB 3L5WB 4LVEA 3RNKB 1KB5B 4JRYB 5HHVH 4WDIB 5L9DH 3IDIA 4XPFL 5ANME 4P2OD 5DFVC 3P4LA 2CJUH 3MRIA 4MQ7A 2X9XA 2N4IA 4GUPB 3F8UB 1T1ZA 1FFQA 5DJXA 4MS8D 5T1DL 5FYJL 2R1XA 1D7FA 3QXAB 1QBML 3T08A 3VFRA 3KPNB 4XMPH 5EBLB 4EI5C 4ODSH 1GGCL 4X6EA 5EO1A 1BOGB 5DEZA 4EQ3A 4M1CD 1OTTD 5FYJU 4UTAH 5F7YC 2FX9H 2MCPL 4U1MB 2BVOA 5JW5A 1NMBL 1WSST 1YEIH 3RI5F 1A6ZA 4Z7NE 3IU3B 3ZKND 43C9B 5D70H 3NCBB 1S7UB 1DBJH 2ATPA 1RZ7L 4ZYKB 2F5BH 5K9JH 3L1OH 3MRFB 4P5TA 1U8QA 1X6LA 4BA8A 3QCUH 4HG4J 2H45A 1MY5A 2BY0A 3HNVH 3M45A 1O5DT 5I9QC 3OXSB 1FAIL 1UQSA 2IQAA 5F7DA 3GSXB 4R96A 3V6FA 1AE6H 3TA3B 1MI5D 4Y19B 1T1XA 1JE6A 5E08L 1R5VA 3S3SA 2X4SB 1GGUA 4KGLA 1W72A 3UYPA 1ZHLA 3GMMB 3HPJB 2R29H 1ZGLA 2VL4A 3G6JF 3QDJB 1T7YA 3LQAC 2ICCA 1AXTH 3RUGB 1PYWA 4UAOC 3NPSC 2VDLL 2XA3A 4U6VH 5L88L 2AP2A 1KNOA 1INDH 2VISB 5HHOA 2YC1A 4WWKD 3PWPA 4K7FB 3GSUB 5IJVA 4P59H 3MLSL 1HCFX 4YHOL 3U4AA 5CEXB 2ED9A 1T20B 2Z92B 4P57A 4GXUN 5IBTH 1KCUL 5I66B 5F9WB 5ADPH 4XI5C 4XC1L 1RHHA 1K9TA 2FJFA 4OM1H 3VDBA 1QSZA 4GKOA 4KHTH 1CVRA 1N0XH 1UKTA 4B50A 1CL7L 2UWEF 4IHOB 4OCRH 2D0GA 4IDJL 1IC7L 2YUWA 3NFPA 1J88A 3LS4L 4CN1A 2R1YB 1HHKB 1B3JA 3KG5A 2DQHL 2OR8A 3CNKA 4LSVH 1RJLB 5E00B 3ARPA 3GI9L 4HKJA 1E27B 1H3UA 5TQ0H 4YK4B 5I16B 1JZ8A 5FDWB 4PJFA 4ELKB 5LGJA 3HUJB 4U1LB 1FFOA 1FJ1A 2BMKA 1BPVA 3TNMA 4JCLA 1CGVA 3KPPA 2CO6B 4MHHG 4PJFE 3W9EA 4BH8A 5T3ZD 4MZ2A 2W9EL 5D7SH 3MNVA 4YE4H 2MJWA 2X2YA 4DN3H 1CFQA 1ZLSL 1H9VA 1NGQH 1FNEB 1PDKA 3SQOH 3ZDXF 3ROOB 5EZJB 1M6OA 5I15H 4MAYD 3T3ME 2EXYD 1AR1C 4X7DC 4PRPE 1CFVL 3FT2B 1YDPB 5GGVH 3NIGF 4HIEB 5AWNL 3PWUB 3LKSA 1KCSH 5JW4N 5E8EA 1KLFA 5D1QA 4HS8H 1QYGL 5E7BA 5EC2A 4Z7WF 3O2WL 2H2SD 2ZOLB 3OB8A 4ETQB 4JHAH 2J12B 1WZKA 2VXSH 2GSGB 4XMLH 2ZP0T 3QO1A 2C9AA 1LDPL 1MREH 4HWBH 1H5BB 3RWDB 4G8GA 5DJZB 2V2WA 5MEPB 1IAIM 1FO0B 1WTLA 4G8GE 2BNQB 4CBPA 3SDXF 5D4QA 1T3FB 3ARSA 5J13B 5ICYA 5DMGC 3GBNH 4DFIA 1R3JB 4ELMA 1V8HA 4ZNEA 3I75A 5C0JB 3TIDA 3PP3K 3RL2B 3FQWB 4L29A 4ELME 3QIWB 4E41B 4ZNEE 5SV3A 3MUY1 5D7JB 3SDAA 1HXMA 4E42B 3PL6A 1RK1B 5CILH 3SDCB 3VW3L 2D31A 2QR0A 3K8KA 1N0LA 3EGSB 1I1AC 3BPOB 4NKDB 3UYOD 3GJFA 1NEZB 4N1HB 2C3WA 4GRLD 2JJSC 1IGML 1G7JB 43CAA 3UTPD 3IS1X 4D94A 1WT5A 4BSWB 4G9FD 2OCFD 1KN2L 1U6AH 5I19H 3VWKA 4KK6D 4Z7UF 1KACB 5KSBF 1B4JL 5DUPH 4MXVF 3JTSA 3HE7D 4XWGH 5JXAL 3ROLB 1MCOL 4I5BA 1ZHBA 2IBBA 4LPCA 3M17A 1NFIA 5IVOA 1OCWL 4R4FL 2ZPKL 1VPOH 2RFXB 4DN4L 4HXBL 3BUYB 5D5MB 1N5YH 4YHMH 5DEFA 4OF6A 5I71C 4KQ3H 4MJID 4GRWE 1JI2A 1LILA 1TZHB 3QPQC 5CZKA 5I8CA 2GJZB 4OF3A 1Z2KA 5DK0A 4XMKH 2WUCL 3BAEL 3LSOA 1JZ4A 4NPYA 3I6GB 4ZUUA 5BVPL 2V7NA 4Y4HC 4V1DB 1QFWH 3RTQB 5ACMA 2LTQB 5CGYC 4QWWC 1KUMA 1FGVL 4K71B 4X6BA 4L3EB 5HHNA 4G8FB 4PLNC 3VG0L 4QRRD 3B9KD 2B1AH 2NY3D 5HI3D 3RHWF 2IAMA 1HSAA 1KJVB 3BIBX 1KIRA 2GY7B 1MFBL 3LKNA 4W6XB 4QXTB 4TVPH 4UQ3A 1I8KB 4LFHG 3SO3B 1T03L 4BELD 2YD9A 2ICWJ 1I7UA 3PJSA 4WY7H 4XRCA 3KLHC 4JKPH 3K2MC 3K80A 2XG4A 3R06B 4HLJA 1EZVX 4EUPG 5HYEA 1XFPA 4QOKD 3NCYP 4NKMA 3IRPX 3DTXA 4I8DA 3LZFH 3RAJH 2X6MA 4XBEH 4FZEL 2ERJB 4BSVA 3DHJA 5B38A 4F3FA 4X7FC 1QRNB 1GOGA 3ULVE 3M1BA 2O5XL 3QHFH 1XF4B 3B9EA 1PKQA 1UA6H 2NLJB 2X4UA 3MRBA 3VXNA 1HKLH 3QZWB 1K6QL 3I85A 5LCVL 1CXEA 2C7UB 1V7NH 4QXUH 4J3XA 3QQ4B 2VDKH 2ESVA 4JZNB 1BZ9A 3CDGB 3QUMA 1JWMB 3MLUL 2AEQL 4GQ9H 5DGQA 4D9RE 1KT2A 3Q3GA 3R0MA 4V2BA 4RZCB 4C83A 4M5ZL 4WHTA 3QUKB 4J1UB 5AZEL 3VGBA 3SGJC 5JPMB 2X09A 4O00A 4OQTL 1G6RA 5C0FA 5IVZB 2Z91A 3FAWA 2P8MA 1FZJA 5FGBA 4JVPA 4QRUA 3G6JB 4GSDH 4X4XB 5BO1L 3IXAB 2IAND 4UIKH 1HHHB 5EORH 1GIGL 5KW9H 1GJIA 3MRQA 4LLYA 3WLWC 4CMHC 3BZ4A 3T0VA 4DVRH 3BPNB 2H3NB 3CH8A 3MQIA 4Q97A 3T3MF 3EDKA 4Q58C 3Q5YA 4TSBH 1V3LA 4G6AC 2A0LD 3DVFA 4GT7A 3BE1L 1R3KB 4ZOBA 1BVLB 4BSJA 1I8LA 3VE0A 3L7EA 3WBDA 2H1PL 4L8SA 3D0VB 5J6HA 1S9XA 2DWEA 2AK1H 4MB4A 1LK3L 1KPRB 3DVNB 1JGVL 3ZSSA 2AJ3B 1NC4B 3L3JA 5IQ7H 2DD8L 4X4YB 1AXIB 4KHXH 1FCCA 3RWCA 1GGIH 1XT5A 3P11L 4JN2B 5E8OB 4BM7A 5I18L 2V9QA 3RY5A 4PRNB 3W0WA 4NM8L 1AY1H 1XGQA 3LEXA 3WHXB 2V7HA 3L95B 4P4KD 4JFEA 3DIFB 4L5FH 1IKNC 1S9YB 3W0WE 2Q76A 5I1AA 1AJ7L 1DLFH 1QLFB 4QTHA 2DMCA 2P5EA 1IGFH 4JFEE 1FL3B 5GS0C 3BFOA 1A1OA 3C5ZB 3QDGA 3TN0C 1QLRB 2P5EE 2Y6SC 5JHDE 3FQTA 2MKLC 2R0WL 1V3MA 4WW2A 4MXWH 2GJJA 3TC9A 3QISA 2GW5A 1II4E 1FGNL 3QDGE 4MGXA 2HTKC 4FOMA 3W81A 3DWTA 1A21A 3A67H 2PNDA 4AY0A 3TIEB 1CGWA 3KPLA 1BREA 1AQKL 3QHTC 4OCSL 3UBXG 2OTUA 3QEQA 5DD3L 1TVHA 1SMAA 1BD2D 1JHTA 2EYRB 1HDMB